data_5DVX
# 
_entry.id   5DVX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DVX         
WWPDB D_1000213905 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DVX 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mahon, B.P.'    1 
'Socorro, L.'    2 
'Driscoll, J.M.' 3 
'McKenna, R.'    4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            55 
_citation.language                  ? 
_citation.page_first                4642 
_citation.page_last                 4653 
_citation.title                     'The Structure of Carbonic Anhydrase IX Is Adapted for Low-pH Catalysis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.6b00243 
_citation.pdbx_database_id_PubMed   27439028 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mahon, B.P.'          1  ? 
primary 'Bhatt, A.'            2  ? 
primary 'Socorro, L.'          3  ? 
primary 'Driscoll, J.M.'       4  ? 
primary 'Okoh, C.'             5  ? 
primary 'Lomelino, C.L.'       6  ? 
primary 'Mboge, M.Y.'          7  ? 
primary 'Kurian, J.J.'         8  ? 
primary 'Tu, C.'               9  ? 
primary 'Agbandje-McKenna, M.' 10 ? 
primary 'Frost, S.C.'          11 ? 
primary 'McKenna, R.'          12 ? 
# 
_cell.entry_id           5DVX 
_cell.length_a           57.877 
_cell.length_b           102.744 
_cell.length_c           108.964 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5DVX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Carbonic anhydrase 9'                   28521.043 2   4.2.1.1 'C161S, L180S, A210K, A258K, F259Y, M360S' 
'catalytic-domain (UNP residues 140-399)' ? 
2 non-polymer syn 'ZINC ION'                               65.409    4   ?       ?                                          ? ? 
3 non-polymer syn GLYCEROL                                 92.094    6   ?       ?                                          ? ? 
4 non-polymer syn 'CHLORIDE ION'                           35.453    3   ?       ?                                          ? ? 
5 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143   1   ?       ?                                          ? ? 
6 water       nat water                                    18.015    626 ?       ?                                          ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Carbonate dehydratase IX,Carbonic anhydrase IX,CAIX,Membrane antigen MN,P54/58N,Renal cell carcinoma-associated antigen G250,RCC-associated antigen G250,pMW1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGRE
YRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEI
AEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQ
PLNGRVIEASFPAGVDSSPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELSGFQLPPLPELRLRNNGHSVQLTLPPGLEMKLGPGRE
YRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTKYARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEI
AEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVSLSAKQLHTLSDTLWGPGDSRLQLNFRATQ
PLNGRVIEASFPAGVDSSPR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   TRP n 
1 3   ARG n 
1 4   TYR n 
1 5   GLY n 
1 6   GLY n 
1 7   ASP n 
1 8   PRO n 
1 9   PRO n 
1 10  TRP n 
1 11  PRO n 
1 12  ARG n 
1 13  VAL n 
1 14  SER n 
1 15  PRO n 
1 16  ALA n 
1 17  CYS n 
1 18  ALA n 
1 19  GLY n 
1 20  ARG n 
1 21  PHE n 
1 22  GLN n 
1 23  SER n 
1 24  PRO n 
1 25  VAL n 
1 26  ASP n 
1 27  ILE n 
1 28  ARG n 
1 29  PRO n 
1 30  GLN n 
1 31  LEU n 
1 32  ALA n 
1 33  ALA n 
1 34  PHE n 
1 35  SER n 
1 36  PRO n 
1 37  ALA n 
1 38  LEU n 
1 39  ARG n 
1 40  PRO n 
1 41  LEU n 
1 42  GLU n 
1 43  LEU n 
1 44  SER n 
1 45  GLY n 
1 46  PHE n 
1 47  GLN n 
1 48  LEU n 
1 49  PRO n 
1 50  PRO n 
1 51  LEU n 
1 52  PRO n 
1 53  GLU n 
1 54  LEU n 
1 55  ARG n 
1 56  LEU n 
1 57  ARG n 
1 58  ASN n 
1 59  ASN n 
1 60  GLY n 
1 61  HIS n 
1 62  SER n 
1 63  VAL n 
1 64  GLN n 
1 65  LEU n 
1 66  THR n 
1 67  LEU n 
1 68  PRO n 
1 69  PRO n 
1 70  GLY n 
1 71  LEU n 
1 72  GLU n 
1 73  MET n 
1 74  LYS n 
1 75  LEU n 
1 76  GLY n 
1 77  PRO n 
1 78  GLY n 
1 79  ARG n 
1 80  GLU n 
1 81  TYR n 
1 82  ARG n 
1 83  ALA n 
1 84  LEU n 
1 85  GLN n 
1 86  LEU n 
1 87  HIS n 
1 88  LEU n 
1 89  HIS n 
1 90  TRP n 
1 91  GLY n 
1 92  ALA n 
1 93  ALA n 
1 94  GLY n 
1 95  ARG n 
1 96  PRO n 
1 97  GLY n 
1 98  SER n 
1 99  GLU n 
1 100 HIS n 
1 101 THR n 
1 102 VAL n 
1 103 GLU n 
1 104 GLY n 
1 105 HIS n 
1 106 ARG n 
1 107 PHE n 
1 108 PRO n 
1 109 ALA n 
1 110 GLU n 
1 111 ILE n 
1 112 HIS n 
1 113 VAL n 
1 114 VAL n 
1 115 HIS n 
1 116 LEU n 
1 117 SER n 
1 118 THR n 
1 119 LYS n 
1 120 TYR n 
1 121 ALA n 
1 122 ARG n 
1 123 VAL n 
1 124 ASP n 
1 125 GLU n 
1 126 ALA n 
1 127 LEU n 
1 128 GLY n 
1 129 ARG n 
1 130 PRO n 
1 131 GLY n 
1 132 GLY n 
1 133 LEU n 
1 134 ALA n 
1 135 VAL n 
1 136 LEU n 
1 137 ALA n 
1 138 ALA n 
1 139 PHE n 
1 140 LEU n 
1 141 GLU n 
1 142 GLU n 
1 143 GLY n 
1 144 PRO n 
1 145 GLU n 
1 146 GLU n 
1 147 ASN n 
1 148 SER n 
1 149 ALA n 
1 150 TYR n 
1 151 GLU n 
1 152 GLN n 
1 153 LEU n 
1 154 LEU n 
1 155 SER n 
1 156 ARG n 
1 157 LEU n 
1 158 GLU n 
1 159 GLU n 
1 160 ILE n 
1 161 ALA n 
1 162 GLU n 
1 163 GLU n 
1 164 GLY n 
1 165 SER n 
1 166 GLU n 
1 167 THR n 
1 168 GLN n 
1 169 VAL n 
1 170 PRO n 
1 171 GLY n 
1 172 LEU n 
1 173 ASP n 
1 174 ILE n 
1 175 SER n 
1 176 ALA n 
1 177 LEU n 
1 178 LEU n 
1 179 PRO n 
1 180 SER n 
1 181 ASP n 
1 182 PHE n 
1 183 SER n 
1 184 ARG n 
1 185 TYR n 
1 186 PHE n 
1 187 GLN n 
1 188 TYR n 
1 189 GLU n 
1 190 GLY n 
1 191 SER n 
1 192 LEU n 
1 193 THR n 
1 194 THR n 
1 195 PRO n 
1 196 PRO n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 GLY n 
1 201 VAL n 
1 202 ILE n 
1 203 TRP n 
1 204 THR n 
1 205 VAL n 
1 206 PHE n 
1 207 ASN n 
1 208 GLN n 
1 209 THR n 
1 210 VAL n 
1 211 SER n 
1 212 LEU n 
1 213 SER n 
1 214 ALA n 
1 215 LYS n 
1 216 GLN n 
1 217 LEU n 
1 218 HIS n 
1 219 THR n 
1 220 LEU n 
1 221 SER n 
1 222 ASP n 
1 223 THR n 
1 224 LEU n 
1 225 TRP n 
1 226 GLY n 
1 227 PRO n 
1 228 GLY n 
1 229 ASP n 
1 230 SER n 
1 231 ARG n 
1 232 LEU n 
1 233 GLN n 
1 234 LEU n 
1 235 ASN n 
1 236 PHE n 
1 237 ARG n 
1 238 ALA n 
1 239 THR n 
1 240 GLN n 
1 241 PRO n 
1 242 LEU n 
1 243 ASN n 
1 244 GLY n 
1 245 ARG n 
1 246 VAL n 
1 247 ILE n 
1 248 GLU n 
1 249 ALA n 
1 250 SER n 
1 251 PHE n 
1 252 PRO n 
1 253 ALA n 
1 254 GLY n 
1 255 VAL n 
1 256 ASP n 
1 257 SER n 
1 258 SER n 
1 259 PRO n 
1 260 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   260 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CA9, G250, MN' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    CAH9_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          Q16790 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;HWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGRE
YRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEI
AEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQ
PLNGRVIEASFPAGVDSSPR
;
_struct_ref.pdbx_align_begin           140 
_struct_ref.pdbx_align_end             ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DVX A 1 ? 260 ? Q16790 140 ? 399 ? 140 399 
2 1 5DVX B 1 ? 260 ? Q16790 140 ? 399 ? 140 399 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DVX SER A 35  ? UNP Q16790 CYS 174 'engineered mutation' 174 1  
1 5DVX SER A 44  ? UNP Q16790 LEU 183 'engineered mutation' 183 2  
1 5DVX LYS A 74  ? UNP Q16790 ALA 213 'engineered mutation' 213 3  
1 5DVX LYS A 119 ? UNP Q16790 ALA 258 'engineered mutation' 258 4  
1 5DVX TYR A 120 ? UNP Q16790 PHE 259 'engineered mutation' 259 5  
1 5DVX SER A 211 ? UNP Q16790 MET 350 'engineered mutation' 350 6  
2 5DVX SER B 35  ? UNP Q16790 CYS 174 'engineered mutation' 174 7  
2 5DVX SER B 44  ? UNP Q16790 LEU 183 'engineered mutation' 183 8  
2 5DVX LYS B 74  ? UNP Q16790 ALA 213 'engineered mutation' 213 9  
2 5DVX LYS B 119 ? UNP Q16790 ALA 258 'engineered mutation' 258 10 
2 5DVX TYR B 120 ? UNP Q16790 PHE 259 'engineered mutation' 259 11 
2 5DVX SER B 211 ? UNP Q16790 MET 350 'engineered mutation' 350 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                           ?                               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                                 ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                                ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                    ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                               ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                   ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'  204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER'                   'C4 H12 N O3 1'  122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                   ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                               ?                               'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DVX 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.84 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Tris HCl, pH 8.5, 8% (w/v) PEG 8000' 
_exptl_crystal_grow.pdbx_pH_range   8.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-05-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9177 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9177 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            12.880 
_reflns.entry_id                         5DVX 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.600 
_reflns.d_resolution_low                 20.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       86682 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.200 
_reflns.pdbx_Rmerge_I_obs                0.100 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         19.738 
_reflns.pdbx_netI_over_sigmaI            5.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.945 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.108 
_reflns.pdbx_Rpim_I_all                  0.040 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         622633 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.600 1.630  ? ? ? ? ? 4246 ? 99.300  ? ? ? ? 0.565 ? ? ? ? ? ? ? ? 6.700 ? 0.728 ? ? 0.612 0.233 0 1  1 0.893 ? 
1.630 1.660  ? ? ? ? ? 4313 ? 100.000 ? ? ? ? 0.504 ? ? ? ? ? ? ? ? 7.100 ? 0.721 ? ? 0.544 0.202 0 2  1 0.918 ? 
1.660 1.690  ? ? ? ? ? 4275 ? 100.000 ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 7.100 ? 0.735 ? ? 0.496 0.184 0 3  1 0.924 ? 
1.690 1.720  ? ? ? ? ? 4281 ? 100.000 ? ? ? ? 0.388 ? ? ? ? ? ? ? ? 7.200 ? 0.746 ? ? 0.418 0.155 0 4  1 0.938 ? 
1.720 1.760  ? ? ? ? ? 4293 ? 100.000 ? ? ? ? 0.330 ? ? ? ? ? ? ? ? 7.200 ? 0.744 ? ? 0.356 0.132 0 5  1 0.955 ? 
1.760 1.800  ? ? ? ? ? 4259 ? 100.000 ? ? ? ? 0.286 ? ? ? ? ? ? ? ? 7.200 ? 0.754 ? ? 0.308 0.114 0 6  1 0.967 ? 
1.800 1.850  ? ? ? ? ? 4334 ? 100.000 ? ? ? ? 0.257 ? ? ? ? ? ? ? ? 7.200 ? 0.775 ? ? 0.277 0.102 0 7  1 0.972 ? 
1.850 1.900  ? ? ? ? ? 4280 ? 100.000 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 7.200 ? 0.770 ? ? 0.240 0.089 0 8  1 0.978 ? 
1.900 1.950  ? ? ? ? ? 4297 ? 100.000 ? ? ? ? 0.196 ? ? ? ? ? ? ? ? 7.300 ? 0.845 ? ? 0.211 0.078 0 9  1 0.980 ? 
1.950 2.020  ? ? ? ? ? 4327 ? 100.000 ? ? ? ? 0.162 ? ? ? ? ? ? ? ? 7.300 ? 0.821 ? ? 0.175 0.064 0 10 1 0.987 ? 
2.020 2.090  ? ? ? ? ? 4290 ? 100.000 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 7.300 ? 0.863 ? ? 0.147 0.054 0 11 1 0.990 ? 
2.090 2.170  ? ? ? ? ? 4320 ? 100.000 ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 7.300 ? 0.840 ? ? 0.129 0.048 0 12 1 0.992 ? 
2.170 2.270  ? ? ? ? ? 4310 ? 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 7.300 ? 0.929 ? ? 0.126 0.046 0 13 1 0.992 ? 
2.270 2.390  ? ? ? ? ? 4329 ? 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 7.300 ? 0.894 ? ? 0.112 0.041 0 14 1 0.993 ? 
2.390 2.540  ? ? ? ? ? 4359 ? 100.000 ? ? ? ? 0.089 ? ? ? ? ? ? ? ? 7.300 ? 0.908 ? ? 0.096 0.035 0 15 1 0.995 ? 
2.540 2.730  ? ? ? ? ? 4344 ? 100.000 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 7.300 ? 0.990 ? ? 0.087 0.032 0 16 1 0.995 ? 
2.730 3.010  ? ? ? ? ? 4368 ? 100.000 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 7.300 ? 1.093 ? ? 0.079 0.029 0 17 1 0.996 ? 
3.010 3.440  ? ? ? ? ? 4409 ? 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 7.200 ? 1.278 ? ? 0.073 0.027 0 18 1 0.996 ? 
3.440 4.330  ? ? ? ? ? 4430 ? 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 7.100 ? 1.686 ? ? 0.072 0.027 0 19 1 0.995 ? 
4.330 20.000 ? ? ? ? ? 4618 ? 99.400  ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 6.800 ? 1.727 ? ? 0.074 0.028 0 20 1 0.994 ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5DVX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     77844 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.835 
_refine.ls_d_res_high                            1.598 
_refine.ls_percent_reflns_obs                    93.59 
_refine.ls_R_factor_obs                          0.1683 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1678 
_refine.ls_R_factor_R_free                       0.1913 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.32 
_refine.ls_number_reflns_R_free                  3607 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3IAI 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.15 
_refine.pdbx_overall_phase_error                 18.37 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3992 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         51 
_refine_hist.number_atoms_solvent             626 
_refine_hist.number_atoms_total               4669 
_refine_hist.d_res_high                       1.598 
_refine_hist.d_res_low                        19.835 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 4324 'X-RAY DIFFRACTION' ? 
f_angle_d          1.151  ? ? 5897 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.337 ? ? 1644 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.047  ? ? 641  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 777  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.5976 1.6186  3827 0.2070 61.00  0.2348 . . 85  . . . . 
'X-RAY DIFFRACTION' . 1.6186 1.6408  4450 0.1969 71.00  0.2000 . . 98  . . . . 
'X-RAY DIFFRACTION' . 1.6408 1.6642  4536 0.1952 73.00  0.2259 . . 114 . . . . 
'X-RAY DIFFRACTION' . 1.6642 1.6891  4902 0.1964 78.00  0.2010 . . 121 . . . . 
'X-RAY DIFFRACTION' . 1.6891 1.7154  5162 0.1901 83.00  0.2170 . . 107 . . . . 
'X-RAY DIFFRACTION' . 1.7154 1.7435  5449 0.1876 87.00  0.2190 . . 134 . . . . 
'X-RAY DIFFRACTION' . 1.7435 1.7736  5691 0.1824 92.00  0.2361 . . 144 . . . . 
'X-RAY DIFFRACTION' . 1.7736 1.8058  6014 0.1820 95.00  0.1880 . . 125 . . . . 
'X-RAY DIFFRACTION' . 1.8058 1.8405  6001 0.1810 97.00  0.2144 . . 152 . . . . 
'X-RAY DIFFRACTION' . 1.8405 1.8781  6168 0.1910 99.00  0.2232 . . 156 . . . . 
'X-RAY DIFFRACTION' . 1.8781 1.9189  6213 0.1928 99.00  0.2003 . . 122 . . . . 
'X-RAY DIFFRACTION' . 1.9189 1.9635  6256 0.1889 100.00 0.1801 . . 158 . . . . 
'X-RAY DIFFRACTION' . 1.9635 2.0125  6290 0.1762 100.00 0.2109 . . 145 . . . . 
'X-RAY DIFFRACTION' . 2.0125 2.0669  6240 0.1769 100.00 0.2183 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.0669 2.1276  6216 0.1752 100.00 0.1807 . . 152 . . . . 
'X-RAY DIFFRACTION' . 2.1276 2.1962  6253 0.1829 100.00 0.2391 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.1962 2.2746  6253 0.1767 100.00 0.2484 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.2746 2.3656  6233 0.1721 100.00 0.1909 . . 144 . . . . 
'X-RAY DIFFRACTION' . 2.3656 2.4730  6266 0.1693 100.00 0.2121 . . 159 . . . . 
'X-RAY DIFFRACTION' . 2.4730 2.6031  6229 0.1645 100.00 0.2026 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.6031 2.7658  6262 0.1650 100.00 0.1741 . . 166 . . . . 
'X-RAY DIFFRACTION' . 2.7658 2.9787  6202 0.1693 100.00 0.1987 . . 147 . . . . 
'X-RAY DIFFRACTION' . 2.9787 3.2773  6260 0.1631 100.00 0.1765 . . 155 . . . . 
'X-RAY DIFFRACTION' . 3.2773 3.7487  6239 0.1506 100.00 0.1832 . . 149 . . . . 
'X-RAY DIFFRACTION' . 3.7487 4.7125  6272 0.1311 100.00 0.1444 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.7125 19.8368 6196 0.1572 99.00  0.1492 . . 145 . . . . 
# 
_struct.entry_id                     5DVX 
_struct.title                        
'Crystal structure of the catalytic-domain of human carbonic anhydrase IX at 1.6 angstrom resolution' 
_struct.pdbx_descriptor              'Carbonic anhydrase 9 (E.C.4.2.1.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DVX 
_struct_keywords.text            'carbonic anhydrase IX, catalytic domain, water network, LYASE' 
_struct_keywords.pdbx_keywords   LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 6 ? 
R N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 9   ? SER A 14  ? PRO A 148 SER A 153 1 ? 6  
HELX_P HELX_P2  AA2 PRO A 15  ? GLY A 19  ? PRO A 154 GLY A 158 5 ? 5  
HELX_P HELX_P3  AA3 ARG A 28  ? ALA A 32  ? ARG A 167 ALA A 171 5 ? 5  
HELX_P HELX_P4  AA4 ARG A 122 ? LEU A 127 ? ARG A 261 LEU A 266 1 ? 6  
HELX_P HELX_P5  AA5 ASN A 147 ? SER A 155 ? ASN A 286 SER A 294 1 ? 9  
HELX_P HELX_P6  AA6 ARG A 156 ? ALA A 161 ? ARG A 295 ALA A 300 5 ? 6  
HELX_P HELX_P7  AA7 ASP A 173 ? LEU A 178 ? ASP A 312 LEU A 317 5 ? 6  
HELX_P HELX_P8  AA8 SER A 213 ? THR A 223 ? SER A 352 THR A 362 1 ? 11 
HELX_P HELX_P9  AA9 PRO B 9   ? VAL B 13  ? PRO B 148 VAL B 152 5 ? 5  
HELX_P HELX_P10 AB1 SER B 14  ? GLY B 19  ? SER B 153 GLY B 158 5 ? 6  
HELX_P HELX_P11 AB2 ARG B 28  ? ALA B 32  ? ARG B 167 ALA B 171 5 ? 5  
HELX_P HELX_P12 AB3 ARG B 122 ? LEU B 127 ? ARG B 261 LEU B 266 1 ? 6  
HELX_P HELX_P13 AB4 ASN B 147 ? SER B 155 ? ASN B 286 SER B 294 1 ? 9  
HELX_P HELX_P14 AB5 ARG B 156 ? ALA B 161 ? ARG B 295 ALA B 300 5 ? 6  
HELX_P HELX_P15 AB6 ASP B 173 ? LEU B 178 ? ASP B 312 LEU B 317 5 ? 6  
HELX_P HELX_P16 AB7 SER B 213 ? THR B 223 ? SER B 352 THR B 362 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 17  SG  ? ? ? 1_555 A CYS 197 SG ? ? A CYS 156 A CYS 336 1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf2  disulf ?    ? B CYS 17  SG  ? ? ? 1_555 B CYS 197 SG ? ? B CYS 156 B CYS 336 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc1  metalc ?    ? A HIS 1   ND1 A ? ? 1_555 D ZN  .   ZN ? ? A HIS 140 A ZN  402 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc2  metalc ?    ? A TRP 2   N   ? ? ? 1_555 D ZN  .   ZN ? ? A TRP 141 A ZN  402 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc3  metalc ?    ? A TRP 2   O   ? ? ? 1_555 D ZN  .   ZN ? ? A TRP 141 A ZN  402 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc4  metalc ?    ? A HIS 61  NE2 ? ? ? 1_555 D ZN  .   ZN ? ? A HIS 200 A ZN  402 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc5  metalc ?    ? A HIS 87  NE2 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 226 A ZN  401 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc6  metalc ?    ? A HIS 89  NE2 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 228 A ZN  401 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc7  metalc ?    ? A HIS 105 NE2 ? ? ? 1_555 K ZN  .   ZN ? ? A HIS 244 A ZN  409 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc8  metalc ?    ? A HIS 112 ND1 ? ? ? 1_555 C ZN  .   ZN ? ? A HIS 251 A ZN  401 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc9  metalc ?    ? B TRP 2   N   ? ? ? 1_555 K ZN  .   ZN ? ? B TRP 141 A ZN  409 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc10 metalc ?    ? B TRP 2   O   ? ? ? 1_555 K ZN  .   ZN ? ? B TRP 141 A ZN  409 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc11 metalc ?    ? B HIS 61  NE2 ? ? ? 1_555 K ZN  .   ZN ? ? B HIS 200 A ZN  409 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc12 metalc ?    ? B HIS 87  NE2 ? ? ? 1_555 L ZN  .   ZN ? ? B HIS 226 B ZN  401 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc13 metalc ?    ? B HIS 89  NE2 ? ? ? 1_555 L ZN  .   ZN ? ? B HIS 228 B ZN  401 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc14 metalc ?    ? B HIS 112 ND1 ? ? ? 1_555 L ZN  .   ZN ? ? B HIS 251 B ZN  401 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc15 metalc ?    ? C ZN  .   ZN  ? ? ? 1_555 Q HOH .   O  ? ? A ZN  401 A HOH 606 1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc16 metalc ?    ? K ZN  .   ZN  ? ? ? 1_555 R HOH .   O  ? ? A ZN  409 B HOH 671 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc17 metalc ?    ? L ZN  .   ZN  ? ? ? 1_555 R HOH .   O  ? ? B ZN  401 B HOH 575 1_555 ? ? ? ? ? ? ? 1.915 ? 
covale1  covale none ? A HIS 1   O   ? ? ? 1_555 B GLU 103 CB A ? A HIS 140 B GLU 242 2_555 ? ? ? ? ? ? ? 1.406 ? 
covale2  covale none ? A HIS 1   O   ? ? ? 1_555 B GLU 103 CB B ? A HIS 140 B GLU 242 2_555 ? ? ? ? ? ? ? 1.455 ? 
metalc18 metalc ?    ? B HIS 105 NE2 ? ? ? 1_555 D ZN  .   ZN ? ? B HIS 244 A ZN  402 2_554 ? ? ? ? ? ? ? 2.087 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 7   A . ? ASP 146 A PRO 8   A ? PRO 147 A 1 -2.79 
2 SER 23  A . ? SER 162 A PRO 24  A ? PRO 163 A 1 -0.30 
3 LEU 51  A . ? LEU 190 A PRO 52  A ? PRO 191 A 1 2.79  
4 PRO 195 A . ? PRO 334 A PRO 196 A ? PRO 335 A 1 13.03 
5 ASP 7   B . ? ASP 146 B PRO 8   B ? PRO 147 B 1 -1.02 
6 SER 23  B . ? SER 162 B PRO 24  B ? PRO 163 B 1 0.45  
7 LEU 51  B . ? LEU 190 B PRO 52  B ? PRO 191 B 1 2.29  
8 PRO 195 B . ? PRO 334 B PRO 196 B ? PRO 335 B 1 13.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2  ? 
AA2 ? 10 ? 
AA3 ? 6  ? 
AA4 ? 2  ? 
AA5 ? 10 ? 
AA6 ? 6  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA2 1 2  ? parallel      
AA2 2 3  ? anti-parallel 
AA2 3 4  ? anti-parallel 
AA2 4 5  ? parallel      
AA2 5 6  ? anti-parallel 
AA2 6 7  ? anti-parallel 
AA2 7 8  ? anti-parallel 
AA2 8 9  ? anti-parallel 
AA2 9 10 ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
AA3 3 4  ? anti-parallel 
AA3 4 5  ? anti-parallel 
AA3 5 6  ? parallel      
AA4 1 2  ? parallel      
AA5 1 2  ? parallel      
AA5 2 3  ? anti-parallel 
AA5 3 4  ? anti-parallel 
AA5 4 5  ? parallel      
AA5 5 6  ? anti-parallel 
AA5 6 7  ? anti-parallel 
AA5 7 8  ? anti-parallel 
AA5 8 9  ? anti-parallel 
AA5 9 10 ? anti-parallel 
AA6 1 2  ? anti-parallel 
AA6 2 3  ? anti-parallel 
AA6 3 4  ? anti-parallel 
AA6 4 5  ? anti-parallel 
AA6 5 6  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ASP A 26  ? ILE A 27  ? ASP A 165 ILE A 166 
AA1 2  THR A 101 ? VAL A 102 ? THR A 240 VAL A 241 
AA2 1  ALA A 33  ? PHE A 34  ? ALA A 172 PHE A 173 
AA2 2  GLU A 248 ? ALA A 249 ? GLU A 387 ALA A 388 
AA2 3  TYR A 185 ? SER A 191 ? TYR A 324 SER A 330 
AA2 4  GLN A 199 ? PHE A 206 ? GLN A 338 PHE A 345 
AA2 5  LEU A 133 ? GLU A 142 ? LEU A 272 GLU A 281 
AA2 6  ALA A 109 ? SER A 117 ? ALA A 248 SER A 256 
AA2 7  ARG A 79  ? TRP A 90  ? ARG A 218 TRP A 229 
AA2 8  VAL A 63  ? THR A 66  ? VAL A 202 THR A 205 
AA2 9  LEU A 54  ? ASN A 58  ? LEU A 193 ASN A 197 
AA2 10 GLU A 166 ? VAL A 169 ? GLU A 305 VAL A 308 
AA3 1  GLU A 42  ? SER A 44  ? GLU A 181 SER A 183 
AA3 2  GLU A 72  ? GLY A 76  ? GLU A 211 GLY A 215 
AA3 3  ARG A 79  ? TRP A 90  ? ARG A 218 TRP A 229 
AA3 4  ALA A 109 ? SER A 117 ? ALA A 248 SER A 256 
AA3 5  LEU A 133 ? GLU A 142 ? LEU A 272 GLU A 281 
AA3 6  VAL A 210 ? LEU A 212 ? VAL A 349 LEU A 351 
AA4 1  ASP B 26  ? ILE B 27  ? ASP B 165 ILE B 166 
AA4 2  THR B 101 ? VAL B 102 ? THR B 240 VAL B 241 
AA5 1  ALA B 33  ? PHE B 34  ? ALA B 172 PHE B 173 
AA5 2  GLU B 248 ? ALA B 249 ? GLU B 387 ALA B 388 
AA5 3  TYR B 185 ? SER B 191 ? TYR B 324 SER B 330 
AA5 4  GLN B 199 ? PHE B 206 ? GLN B 338 PHE B 345 
AA5 5  LEU B 133 ? GLU B 142 ? LEU B 272 GLU B 281 
AA5 6  ALA B 109 ? SER B 117 ? ALA B 248 SER B 256 
AA5 7  ARG B 79  ? TRP B 90  ? ARG B 218 TRP B 229 
AA5 8  VAL B 63  ? THR B 66  ? VAL B 202 THR B 205 
AA5 9  LEU B 54  ? ASN B 58  ? LEU B 193 ASN B 197 
AA5 10 GLU B 166 ? VAL B 169 ? GLU B 305 VAL B 308 
AA6 1  GLU B 42  ? SER B 44  ? GLU B 181 SER B 183 
AA6 2  GLU B 72  ? GLY B 76  ? GLU B 211 GLY B 215 
AA6 3  ARG B 79  ? TRP B 90  ? ARG B 218 TRP B 229 
AA6 4  ALA B 109 ? SER B 117 ? ALA B 248 SER B 256 
AA6 5  LEU B 133 ? GLU B 142 ? LEU B 272 GLU B 281 
AA6 6  VAL B 210 ? LEU B 212 ? VAL B 349 LEU B 351 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  N ILE A 27  ? N ILE A 166 O THR A 101 ? O THR A 240 
AA2 1 2  N ALA A 33  ? N ALA A 172 O ALA A 249 ? O ALA A 388 
AA2 2 3  O GLU A 248 ? O GLU A 387 N GLN A 187 ? N GLN A 326 
AA2 3 4  N GLY A 190 ? N GLY A 329 O VAL A 201 ? O VAL A 340 
AA2 4 5  O THR A 204 ? O THR A 343 N ALA A 137 ? N ALA A 276 
AA2 5 6  O ALA A 134 ? O ALA A 273 N HIS A 115 ? N HIS A 254 
AA2 6 7  O VAL A 114 ? O VAL A 253 N LEU A 84  ? N LEU A 223 
AA2 7 8  O LEU A 86  ? O LEU A 225 N LEU A 65  ? N LEU A 204 
AA2 8 9  O GLN A 64  ? O GLN A 203 N ARG A 57  ? N ARG A 196 
AA2 9 10 N LEU A 56  ? N LEU A 195 O THR A 167 ? O THR A 306 
AA3 1 2  N GLU A 42  ? N GLU A 181 O LYS A 74  ? O LYS A 213 
AA3 2 3  N LEU A 75  ? N LEU A 214 O ARG A 79  ? O ARG A 218 
AA3 3 4  N LEU A 84  ? N LEU A 223 O VAL A 114 ? O VAL A 253 
AA3 4 5  N HIS A 115 ? N HIS A 254 O ALA A 134 ? O ALA A 273 
AA3 5 6  N GLU A 141 ? N GLU A 280 O VAL A 210 ? O VAL A 349 
AA4 1 2  N ILE B 27  ? N ILE B 166 O THR B 101 ? O THR B 240 
AA5 1 2  N ALA B 33  ? N ALA B 172 O ALA B 249 ? O ALA B 388 
AA5 2 3  O GLU B 248 ? O GLU B 387 N GLN B 187 ? N GLN B 326 
AA5 3 4  N GLY B 190 ? N GLY B 329 O VAL B 201 ? O VAL B 340 
AA5 4 5  O THR B 204 ? O THR B 343 N ALA B 137 ? N ALA B 276 
AA5 5 6  O ALA B 134 ? O ALA B 273 N HIS B 115 ? N HIS B 254 
AA5 6 7  O VAL B 114 ? O VAL B 253 N LEU B 84  ? N LEU B 223 
AA5 7 8  O LEU B 86  ? O LEU B 225 N LEU B 65  ? N LEU B 204 
AA5 8 9  O GLN B 64  ? O GLN B 203 N ARG B 57  ? N ARG B 196 
AA5 9 10 N LEU B 54  ? N LEU B 193 O VAL B 169 ? O VAL B 308 
AA6 1 2  N GLU B 42  ? N GLU B 181 O LYS B 74  ? O LYS B 213 
AA6 2 3  N MET B 73  ? N MET B 212 O TYR B 81  ? O TYR B 220 
AA6 3 4  N LEU B 84  ? N LEU B 223 O VAL B 114 ? O VAL B 253 
AA6 4 5  N HIS B 115 ? N HIS B 254 O ALA B 134 ? O ALA B 273 
AA6 5 6  N GLU B 141 ? N GLU B 280 O VAL B 210 ? O VAL B 349 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  401 ? 4 'binding site for residue ZN A 401'  
AC2 Software A ZN  402 ? 4 'binding site for residue ZN A 402'  
AC3 Software A GOL 403 ? 4 'binding site for residue GOL A 403' 
AC4 Software A GOL 404 ? 8 'binding site for residue GOL A 404' 
AC5 Software A GOL 405 ? 8 'binding site for residue GOL A 405' 
AC6 Software A CL  406 ? 2 'binding site for residue CL A 406'  
AC7 Software A CL  407 ? 2 'binding site for residue CL A 407'  
AC8 Software A TRS 408 ? 5 'binding site for residue TRS A 408' 
AC9 Software A ZN  409 ? 4 'binding site for residue ZN A 409'  
AD1 Software B ZN  401 ? 4 'binding site for residue ZN B 401'  
AD2 Software B GOL 402 ? 6 'binding site for residue GOL B 402' 
AD3 Software B GOL 403 ? 4 'binding site for residue GOL B 403' 
AD4 Software B GOL 404 ? 6 'binding site for residue GOL B 404' 
AD5 Software B CL  405 ? 2 'binding site for residue CL B 405'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 87  ? HIS A 226 . ? 1_555 ? 
2  AC1 4 HIS A 89  ? HIS A 228 . ? 1_555 ? 
3  AC1 4 HIS A 112 ? HIS A 251 . ? 1_555 ? 
4  AC1 4 HOH Q .   ? HOH A 606 . ? 1_555 ? 
5  AC2 4 HIS A 1   ? HIS A 140 . ? 1_555 ? 
6  AC2 4 TRP A 2   ? TRP A 141 . ? 1_555 ? 
7  AC2 4 HIS A 61  ? HIS A 200 . ? 1_555 ? 
8  AC2 4 HIS B 105 ? HIS B 244 . ? 2_555 ? 
9  AC3 4 GLN A 85  ? GLN A 224 . ? 1_555 ? 
10 AC3 4 HOH Q .   ? HOH A 506 . ? 1_555 ? 
11 AC3 4 HOH Q .   ? HOH A 638 . ? 1_555 ? 
12 AC3 4 HOH Q .   ? HOH A 755 . ? 1_555 ? 
13 AC4 8 ARG A 12  ? ARG A 151 . ? 4_445 ? 
14 AC4 8 GLN A 187 ? GLN A 326 . ? 1_555 ? 
15 AC4 8 TYR A 188 ? TYR A 327 . ? 1_555 ? 
16 AC4 8 GLU A 189 ? GLU A 328 . ? 1_555 ? 
17 AC4 8 ILE A 202 ? ILE A 341 . ? 1_555 ? 
18 AC4 8 HOH Q .   ? HOH A 512 . ? 1_555 ? 
19 AC4 8 HOH Q .   ? HOH A 538 . ? 1_555 ? 
20 AC4 8 HOH Q .   ? HOH A 595 . ? 1_555 ? 
21 AC5 8 ARG A 12  ? ARG A 151 . ? 4_445 ? 
22 AC5 8 VAL A 13  ? VAL A 152 . ? 4_445 ? 
23 AC5 8 GLU A 248 ? GLU A 387 . ? 1_555 ? 
24 AC5 8 HOH Q .   ? HOH A 521 . ? 1_555 ? 
25 AC5 8 HOH Q .   ? HOH A 646 . ? 1_555 ? 
26 AC5 8 GLY B 254 ? GLY B 393 . ? 3_544 ? 
27 AC5 8 VAL B 255 ? VAL B 394 . ? 3_544 ? 
28 AC5 8 ASP B 256 ? ASP B 395 . ? 3_544 ? 
29 AC6 2 ARG A 20  ? ARG A 159 . ? 1_555 ? 
30 AC6 2 GLN A 199 ? GLN A 338 . ? 1_555 ? 
31 AC7 2 GLU A 103 ? GLU A 242 . ? 1_555 ? 
32 AC7 2 HOH Q .   ? HOH A 579 . ? 1_555 ? 
33 AC8 5 LEU A 234 ? LEU A 373 . ? 1_555 ? 
34 AC8 5 PHE A 236 ? PHE A 375 . ? 1_555 ? 
35 AC8 5 HOH Q .   ? HOH A 575 . ? 1_555 ? 
36 AC8 5 HOH Q .   ? HOH A 611 . ? 1_555 ? 
37 AC8 5 HOH Q .   ? HOH A 675 . ? 1_555 ? 
38 AC9 4 HIS A 105 ? HIS A 244 . ? 1_555 ? 
39 AC9 4 TRP B 2   ? TRP B 141 . ? 1_555 ? 
40 AC9 4 HIS B 61  ? HIS B 200 . ? 1_555 ? 
41 AC9 4 HOH R .   ? HOH B 671 . ? 1_555 ? 
42 AD1 4 HIS B 87  ? HIS B 226 . ? 1_555 ? 
43 AD1 4 HIS B 89  ? HIS B 228 . ? 1_555 ? 
44 AD1 4 HIS B 112 ? HIS B 251 . ? 1_555 ? 
45 AD1 4 HOH R .   ? HOH B 575 . ? 1_555 ? 
46 AD2 6 GLN B 85  ? GLN B 224 . ? 1_555 ? 
47 AD2 6 VAL B 114 ? VAL B 253 . ? 1_555 ? 
48 AD2 6 HOH R .   ? HOH B 586 . ? 1_555 ? 
49 AD2 6 HOH R .   ? HOH B 602 . ? 1_555 ? 
50 AD2 6 HOH R .   ? HOH B 611 . ? 1_555 ? 
51 AD2 6 HOH R .   ? HOH B 683 . ? 1_555 ? 
52 AD3 4 PRO B 130 ? PRO B 269 . ? 1_555 ? 
53 AD3 4 GLY B 131 ? GLY B 270 . ? 1_555 ? 
54 AD3 4 GLU B 189 ? GLU B 328 . ? 1_555 ? 
55 AD3 4 HOH R .   ? HOH B 511 . ? 1_555 ? 
56 AD4 6 PRO A 69  ? PRO A 208 . ? 2_454 ? 
57 AD4 6 PHE B 21  ? PHE B 160 . ? 1_555 ? 
58 AD4 6 ARG B 245 ? ARG B 384 . ? 1_555 ? 
59 AD4 6 HOH R .   ? HOH B 514 . ? 1_555 ? 
60 AD4 6 HOH R .   ? HOH B 547 . ? 1_555 ? 
61 AD4 6 HOH R .   ? HOH B 707 . ? 1_555 ? 
62 AD5 2 ARG B 20  ? ARG B 159 . ? 1_555 ? 
63 AD5 2 GLN B 199 ? GLN B 338 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DVX 
_atom_sites.fract_transf_matrix[1][1]   0.017278 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009733 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009177 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 1   ? 15.387  -18.434 12.758  1.00 54.17 ? 140 HIS A N   1 
ATOM   2    C  CA  . HIS A 1 1   ? 14.531  -17.383 13.502  1.00 43.58 ? 140 HIS A CA  1 
ATOM   3    C  C   . HIS A 1 1   ? 15.441  -16.154 13.862  1.00 50.39 ? 140 HIS A C   1 
ATOM   4    O  O   . HIS A 1 1   ? 16.555  -16.266 14.686  1.00 65.95 ? 140 HIS A O   1 
ATOM   5    C  CB  . HIS A 1 1   ? 13.655  -17.950 14.616  1.00 47.99 ? 140 HIS A CB  1 
ATOM   6    C  CG  A HIS A 1 1   ? 12.569  -16.997 15.150  0.50 43.97 ? 140 HIS A CG  1 
ATOM   7    C  CG  B HIS A 1 1   ? 12.674  -18.947 14.162  0.50 43.97 ? 140 HIS A CG  1 
ATOM   8    N  ND1 A HIS A 1 1   ? 12.329  -15.903 14.618  0.50 16.63 ? 140 HIS A ND1 1 
ATOM   9    N  ND1 B HIS A 1 1   ? 11.691  -18.598 13.490  0.50 16.63 ? 140 HIS A ND1 1 
ATOM   10   C  CD2 A HIS A 1 1   ? 11.706  -17.091 16.319  0.50 43.91 ? 140 HIS A CD2 1 
ATOM   11   C  CD2 B HIS A 1 1   ? 12.507  -20.367 14.438  0.50 43.91 ? 140 HIS A CD2 1 
ATOM   12   C  CE1 A HIS A 1 1   ? 11.364  -15.226 15.317  0.50 33.53 ? 140 HIS A CE1 1 
ATOM   13   C  CE1 B HIS A 1 1   ? 10.855  -19.660 13.268  0.50 33.53 ? 140 HIS A CE1 1 
ATOM   14   N  NE2 A HIS A 1 1   ? 10.990  -15.986 16.380  0.50 22.50 ? 140 HIS A NE2 1 
ATOM   15   N  NE2 B HIS A 1 1   ? 11.381  -20.757 13.873  0.50 22.50 ? 140 HIS A NE2 1 
ATOM   16   N  N   . TRP A 1 2   ? 15.033  -15.015 13.303  1.00 29.60 ? 141 TRP A N   1 
ATOM   17   C  CA  . TRP A 1 2   ? 15.354  -14.385 12.080  1.00 15.17 ? 141 TRP A CA  1 
ATOM   18   C  C   . TRP A 1 2   ? 14.954  -12.920 11.982  1.00 11.79 ? 141 TRP A C   1 
ATOM   19   O  O   . TRP A 1 2   ? 14.085  -12.450 12.677  1.00 11.48 ? 141 TRP A O   1 
ATOM   20   C  CB  . TRP A 1 2   ? 14.900  -15.206 10.835  1.00 13.10 ? 141 TRP A CB  1 
ATOM   21   C  CG  . TRP A 1 2   ? 13.397  -15.269 10.694  1.00 12.05 ? 141 TRP A CG  1 
ATOM   22   C  CD1 . TRP A 1 2   ? 12.545  -16.245 11.147  1.00 11.59 ? 141 TRP A CD1 1 
ATOM   23   C  CD2 . TRP A 1 2   ? 12.520  -14.257 10.105  1.00 10.02 ? 141 TRP A CD2 1 
ATOM   24   N  NE1 . TRP A 1 2   ? 11.264  -15.911 10.928  1.00 10.76 ? 141 TRP A NE1 1 
ATOM   25   C  CE2 . TRP A 1 2   ? 11.177  -14.734 10.286  1.00 12.04 ? 141 TRP A CE2 1 
ATOM   26   C  CE3 . TRP A 1 2   ? 12.724  -13.057 9.506   1.00 11.43 ? 141 TRP A CE3 1 
ATOM   27   C  CZ2 . TRP A 1 2   ? 10.084  -14.024 9.824   1.00 10.71 ? 141 TRP A CZ2 1 
ATOM   28   C  CZ3 . TRP A 1 2   ? 11.636  -12.338 9.064   1.00 10.11 ? 141 TRP A CZ3 1 
ATOM   29   C  CH2 . TRP A 1 2   ? 10.344  -12.825 9.214   1.00 9.43  ? 141 TRP A CH2 1 
ATOM   30   N  N   . ARG A 1 3   ? 15.625  -12.202 11.074  1.00 11.59 ? 142 ARG A N   1 
ATOM   31   C  CA  . ARG A 1 3   ? 15.266  -10.801 10.849  1.00 10.02 ? 142 ARG A CA  1 
ATOM   32   C  C   . ARG A 1 3   ? 15.219  -10.506 9.355   1.00 13.41 ? 142 ARG A C   1 
ATOM   33   O  O   . ARG A 1 3   ? 15.919  -11.149 8.567   1.00 13.26 ? 142 ARG A O   1 
ATOM   34   C  CB  . ARG A 1 3   ? 16.267  -9.864  11.546  1.00 11.61 ? 142 ARG A CB  1 
ATOM   35   C  CG  . ARG A 1 3   ? 17.638  -9.787  10.871  1.00 13.62 ? 142 ARG A CG  1 
ATOM   36   C  CD  . ARG A 1 3   ? 18.646  -9.062  11.756  1.00 13.03 ? 142 ARG A CD  1 
ATOM   37   N  NE  . ARG A 1 3   ? 18.968  -9.873  12.925  1.00 14.85 ? 142 ARG A NE  1 
ATOM   38   C  CZ  . ARG A 1 3   ? 19.879  -9.547  13.843  1.00 13.92 ? 142 ARG A CZ  1 
ATOM   39   N  NH1 . ARG A 1 3   ? 20.563  -8.418  13.731  1.00 15.15 ? 142 ARG A NH1 1 
ATOM   40   N  NH2 . ARG A 1 3   ? 20.101  -10.356 14.874  1.00 17.53 ? 142 ARG A NH2 1 
ATOM   41   N  N   . TYR A 1 4   ? 14.384  -9.552  8.958   1.00 12.53 ? 143 TYR A N   1 
ATOM   42   C  CA  . TYR A 1 4   ? 14.340  -9.163  7.553   1.00 13.56 ? 143 TYR A CA  1 
ATOM   43   C  C   . TYR A 1 4   ? 15.696  -8.626  7.105   1.00 17.02 ? 143 TYR A C   1 
ATOM   44   O  O   . TYR A 1 4   ? 16.369  -7.899  7.847   1.00 18.62 ? 143 TYR A O   1 
ATOM   45   C  CB  . TYR A 1 4   ? 13.230  -8.133  7.294   1.00 12.77 ? 143 TYR A CB  1 
ATOM   46   C  CG  . TYR A 1 4   ? 11.849  -8.766  7.277   1.00 11.43 ? 143 TYR A CG  1 
ATOM   47   C  CD1 . TYR A 1 4   ? 11.328  -9.323  6.110   1.00 10.73 ? 143 TYR A CD1 1 
ATOM   48   C  CD2 . TYR A 1 4   ? 11.092  -8.849  8.444   1.00 11.40 ? 143 TYR A CD2 1 
ATOM   49   C  CE1 . TYR A 1 4   ? 10.069  -9.936  6.100   1.00 9.62  ? 143 TYR A CE1 1 
ATOM   50   C  CE2 . TYR A 1 4   ? 9.837   -9.446  8.447   1.00 8.84  ? 143 TYR A CE2 1 
ATOM   51   C  CZ  . TYR A 1 4   ? 9.334   -9.988  7.271   1.00 10.55 ? 143 TYR A CZ  1 
ATOM   52   O  OH  . TYR A 1 4   ? 8.097   -10.585 7.272   1.00 8.98  ? 143 TYR A OH  1 
ATOM   53   N  N   . GLY A 1 5   ? 16.100  -9.024  5.900   1.00 16.81 ? 144 GLY A N   1 
ATOM   54   C  CA  . GLY A 1 5   ? 17.385  -8.619  5.350   1.00 19.31 ? 144 GLY A CA  1 
ATOM   55   C  C   . GLY A 1 5   ? 18.532  -9.442  5.904   1.00 23.08 ? 144 GLY A C   1 
ATOM   56   O  O   . GLY A 1 5   ? 19.693  -9.249  5.523   1.00 23.38 ? 144 GLY A O   1 
ATOM   57   N  N   . GLY A 1 6   ? 18.214  -10.383 6.786   1.00 18.29 ? 145 GLY A N   1 
ATOM   58   C  CA  . GLY A 1 6   ? 19.239  -11.172 7.434   1.00 18.53 ? 145 GLY A CA  1 
ATOM   59   C  C   . GLY A 1 6   ? 19.696  -12.334 6.579   1.00 21.60 ? 145 GLY A C   1 
ATOM   60   O  O   . GLY A 1 6   ? 19.130  -12.616 5.527   1.00 22.35 ? 145 GLY A O   1 
ATOM   61   N  N   . ASP A 1 7   ? 20.726  -13.014 7.032   1.00 26.83 ? 146 ASP A N   1 
ATOM   62   C  CA  . ASP A 1 7   ? 21.302  -14.163 6.359   1.00 26.40 ? 146 ASP A CA  1 
ATOM   63   C  C   . ASP A 1 7   ? 21.186  -15.347 7.294   1.00 23.23 ? 146 ASP A C   1 
ATOM   64   O  O   . ASP A 1 7   ? 21.250  -15.144 8.449   1.00 24.16 ? 146 ASP A O   1 
ATOM   65   C  CB  . ASP A 1 7   ? 22.774  -13.824 6.102   1.00 39.98 ? 146 ASP A CB  1 
ATOM   66   C  CG  . ASP A 1 7   ? 23.540  -14.920 5.437   1.00 55.99 ? 146 ASP A CG  1 
ATOM   67   O  OD1 . ASP A 1 7   ? 23.535  -14.989 4.182   1.00 58.23 ? 146 ASP A OD1 1 
ATOM   68   O  OD2 . ASP A 1 7   ? 24.210  -15.690 6.145   1.00 62.74 ? 146 ASP A OD2 1 
ATOM   69   N  N   . PRO A 1 8   ? 21.047  -16.583 6.815   1.00 23.66 ? 147 PRO A N   1 
ATOM   70   C  CA  . PRO A 1 8   ? 20.931  -16.964 5.404   1.00 23.23 ? 147 PRO A CA  1 
ATOM   71   C  C   . PRO A 1 8   ? 19.537  -16.728 4.835   1.00 19.30 ? 147 PRO A C   1 
ATOM   72   O  O   . PRO A 1 8   ? 18.602  -16.459 5.604   1.00 20.18 ? 147 PRO A O   1 
ATOM   73   C  CB  . PRO A 1 8   ? 21.234  -18.462 5.433   1.00 21.78 ? 147 PRO A CB  1 
ATOM   74   C  CG  . PRO A 1 8   ? 20.740  -18.905 6.762   1.00 25.31 ? 147 PRO A CG  1 
ATOM   75   C  CD  . PRO A 1 8   ? 20.918  -17.744 7.710   1.00 23.74 ? 147 PRO A CD  1 
ATOM   76   N  N   . PRO A 1 9   ? 19.394  -16.826 3.501   1.00 17.47 ? 148 PRO A N   1 
ATOM   77   C  CA  . PRO A 1 9   ? 18.074  -16.759 2.873   1.00 15.61 ? 148 PRO A CA  1 
ATOM   78   C  C   . PRO A 1 9   ? 17.183  -17.830 3.485   1.00 16.13 ? 148 PRO A C   1 
ATOM   79   O  O   . PRO A 1 9   ? 17.675  -18.871 3.930   1.00 16.05 ? 148 PRO A O   1 
ATOM   80   C  CB  . PRO A 1 9   ? 18.365  -17.040 1.398   1.00 21.31 ? 148 PRO A CB  1 
ATOM   81   C  CG  . PRO A 1 9   ? 19.786  -16.603 1.218   1.00 24.90 ? 148 PRO A CG  1 
ATOM   82   C  CD  . PRO A 1 9   ? 20.475  -16.944 2.502   1.00 22.92 ? 148 PRO A CD  1 
ATOM   83   N  N   . TRP A 1 10  ? 15.881  -17.572 3.513   1.00 16.88 ? 149 TRP A N   1 
ATOM   84   C  CA  . TRP A 1 10  ? 14.938  -18.486 4.142   1.00 15.12 ? 149 TRP A CA  1 
ATOM   85   C  C   . TRP A 1 10  ? 14.974  -19.954 3.658   1.00 14.03 ? 149 TRP A C   1 
ATOM   86   O  O   . TRP A 1 10  ? 14.754  -20.853 4.468   1.00 17.41 ? 149 TRP A O   1 
ATOM   87   C  CB  . TRP A 1 10  ? 13.522  -17.935 3.985   1.00 15.87 ? 149 TRP A CB  1 
ATOM   88   C  CG  . TRP A 1 10  ? 13.261  -16.698 4.787   1.00 17.44 ? 149 TRP A CG  1 
ATOM   89   C  CD1 . TRP A 1 10  ? 14.086  -16.112 5.712   1.00 17.59 ? 149 TRP A CD1 1 
ATOM   90   C  CD2 . TRP A 1 10  ? 12.079  -15.904 4.740   1.00 12.54 ? 149 TRP A CD2 1 
ATOM   91   N  NE1 . TRP A 1 10  ? 13.478  -14.983 6.242   1.00 14.95 ? 149 TRP A NE1 1 
ATOM   92   C  CE2 . TRP A 1 10  ? 12.245  -14.841 5.656   1.00 13.22 ? 149 TRP A CE2 1 
ATOM   93   C  CE3 . TRP A 1 10  ? 10.888  -15.981 4.000   1.00 12.97 ? 149 TRP A CE3 1 
ATOM   94   C  CZ2 . TRP A 1 10  ? 11.267  -13.870 5.852   1.00 15.21 ? 149 TRP A CZ2 1 
ATOM   95   C  CZ3 . TRP A 1 10  ? 9.923   -15.023 4.200   1.00 15.24 ? 149 TRP A CZ3 1 
ATOM   96   C  CH2 . TRP A 1 10  ? 10.113  -13.978 5.118   1.00 14.91 ? 149 TRP A CH2 1 
ATOM   97   N  N   . PRO A 1 11  ? 15.221  -20.206 2.349   1.00 14.20 ? 150 PRO A N   1 
ATOM   98   C  CA  . PRO A 1 11  ? 15.187  -21.620 1.937   1.00 16.88 ? 150 PRO A CA  1 
ATOM   99   C  C   . PRO A 1 11  ? 16.231  -22.468 2.648   1.00 22.55 ? 150 PRO A C   1 
ATOM   100  O  O   . PRO A 1 11  ? 16.095  -23.686 2.696   1.00 21.09 ? 150 PRO A O   1 
ATOM   101  C  CB  . PRO A 1 11  ? 15.473  -21.554 0.435   1.00 16.29 ? 150 PRO A CB  1 
ATOM   102  C  CG  . PRO A 1 11  ? 14.969  -20.225 0.022   1.00 21.10 ? 150 PRO A CG  1 
ATOM   103  C  CD  . PRO A 1 11  ? 15.308  -19.311 1.185   1.00 15.11 ? 150 PRO A CD  1 
ATOM   104  N  N   . ARG A 1 12  ? 17.259  -21.823 3.192   1.00 21.25 ? 151 ARG A N   1 
ATOM   105  C  CA  . ARG A 1 12  ? 18.282  -22.527 3.958   1.00 26.93 ? 151 ARG A CA  1 
ATOM   106  C  C   . ARG A 1 12  ? 17.712  -23.075 5.266   1.00 34.28 ? 151 ARG A C   1 
ATOM   107  O  O   . ARG A 1 12  ? 18.054  -24.181 5.682   1.00 44.39 ? 151 ARG A O   1 
ATOM   108  C  CB  . ARG A 1 12  ? 19.478  -21.617 4.242   1.00 29.30 ? 151 ARG A CB  1 
ATOM   109  C  CG  . ARG A 1 12  ? 20.314  -21.307 3.017   1.00 45.07 ? 151 ARG A CG  1 
ATOM   110  C  CD  . ARG A 1 12  ? 21.070  -22.545 2.553   1.00 48.80 ? 151 ARG A CD  1 
ATOM   111  N  NE  . ARG A 1 12  ? 22.105  -22.947 3.507   1.00 55.35 ? 151 ARG A NE  1 
ATOM   112  C  CZ  . ARG A 1 12  ? 22.455  -24.208 3.747   1.00 56.81 ? 151 ARG A CZ  1 
ATOM   113  N  NH1 . ARG A 1 12  ? 23.411  -24.477 4.626   1.00 53.99 ? 151 ARG A NH1 1 
ATOM   114  N  NH2 . ARG A 1 12  ? 21.847  -25.202 3.110   1.00 54.75 ? 151 ARG A NH2 1 
ATOM   115  N  N   . VAL A 1 13  ? 16.834  -22.313 5.910   1.00 32.63 ? 152 VAL A N   1 
ATOM   116  C  CA  . VAL A 1 13  ? 16.285  -22.757 7.187   1.00 40.08 ? 152 VAL A CA  1 
ATOM   117  C  C   . VAL A 1 13  ? 14.948  -23.487 7.005   1.00 35.22 ? 152 VAL A C   1 
ATOM   118  O  O   . VAL A 1 13  ? 14.621  -24.384 7.778   1.00 33.96 ? 152 VAL A O   1 
ATOM   119  C  CB  . VAL A 1 13  ? 16.107  -21.551 8.160   1.00 47.92 ? 152 VAL A CB  1 
ATOM   120  C  CG1 . VAL A 1 13  ? 16.793  -20.308 7.600   1.00 53.39 ? 152 VAL A CG1 1 
ATOM   121  C  CG2 . VAL A 1 13  ? 14.636  -21.250 8.437   1.00 46.94 ? 152 VAL A CG2 1 
ATOM   122  N  N   . SER A 1 14  ? 14.199  -23.119 5.968   1.00 20.82 ? 153 SER A N   1 
ATOM   123  C  CA  . SER A 1 14  ? 12.928  -23.758 5.645   1.00 16.22 ? 153 SER A CA  1 
ATOM   124  C  C   . SER A 1 14  ? 12.819  -23.979 4.128   1.00 11.30 ? 153 SER A C   1 
ATOM   125  O  O   . SER A 1 14  ? 12.450  -23.050 3.410   1.00 12.98 ? 153 SER A O   1 
ATOM   126  C  CB  . SER A 1 14  ? 11.749  -22.913 6.142   1.00 23.96 ? 153 SER A CB  1 
ATOM   127  O  OG  . SER A 1 14  ? 11.773  -22.792 7.559   1.00 26.42 ? 153 SER A OG  1 
ATOM   128  N  N   . PRO A 1 15  ? 13.180  -25.175 3.629   1.00 14.19 ? 154 PRO A N   1 
ATOM   129  C  CA  . PRO A 1 15  ? 13.212  -25.360 2.170   1.00 15.47 ? 154 PRO A CA  1 
ATOM   130  C  C   . PRO A 1 15  ? 11.860  -25.107 1.511   1.00 10.28 ? 154 PRO A C   1 
ATOM   131  O  O   . PRO A 1 15  ? 11.828  -24.749 0.333   1.00 13.25 ? 154 PRO A O   1 
ATOM   132  C  CB  . PRO A 1 15  ? 13.634  -26.830 1.995   1.00 18.08 ? 154 PRO A CB  1 
ATOM   133  C  CG  . PRO A 1 15  ? 13.394  -27.479 3.333   1.00 21.31 ? 154 PRO A CG  1 
ATOM   134  C  CD  . PRO A 1 15  ? 13.612  -26.382 4.355   1.00 23.12 ? 154 PRO A CD  1 
ATOM   135  N  N   . ALA A 1 16  ? 10.770  -25.264 2.256   1.00 12.12 ? 155 ALA A N   1 
ATOM   136  C  CA  . ALA A 1 16  ? 9.443   -25.007 1.696   1.00 13.12 ? 155 ALA A CA  1 
ATOM   137  C  C   . ALA A 1 16  ? 9.300   -23.561 1.213   1.00 13.53 ? 155 ALA A C   1 
ATOM   138  O  O   . ALA A 1 16  ? 8.430   -23.269 0.391   1.00 12.75 ? 155 ALA A O   1 
ATOM   139  C  CB  . ALA A 1 16  ? 8.357   -25.328 2.727   1.00 16.59 ? 155 ALA A CB  1 
ATOM   140  N  N   . CYS A 1 17  ? 10.157  -22.662 1.698   1.00 12.52 ? 156 CYS A N   1 
ATOM   141  C  CA  . CYS A 1 17  ? 10.095  -21.270 1.261   1.00 10.27 ? 156 CYS A CA  1 
ATOM   142  C  C   . CYS A 1 17  ? 10.489  -21.108 -0.210  1.00 11.59 ? 156 CYS A C   1 
ATOM   143  O  O   . CYS A 1 17  ? 10.247  -20.059 -0.813  1.00 13.18 ? 156 CYS A O   1 
ATOM   144  C  CB  . CYS A 1 17  ? 10.983  -20.390 2.159   1.00 10.37 ? 156 CYS A CB  1 
ATOM   145  S  SG  . CYS A 1 17  ? 10.391  -20.270 3.870   1.00 12.37 ? 156 CYS A SG  1 
ATOM   146  N  N   . ALA A 1 18  ? 11.090  -22.148 -0.790  1.00 10.81 ? 157 ALA A N   1 
ATOM   147  C  CA  . ALA A 1 18  ? 11.426  -22.153 -2.211  1.00 12.06 ? 157 ALA A CA  1 
ATOM   148  C  C   . ALA A 1 18  ? 10.395  -22.923 -3.052  1.00 13.14 ? 157 ALA A C   1 
ATOM   149  O  O   . ALA A 1 18  ? 10.674  -23.274 -4.206  1.00 14.04 ? 157 ALA A O   1 
ATOM   150  C  CB  . ALA A 1 18  ? 12.832  -22.737 -2.426  1.00 12.17 ? 157 ALA A CB  1 
ATOM   151  N  N   . GLY A 1 19  ? 9.242   -23.223 -2.460  1.00 13.08 ? 158 GLY A N   1 
ATOM   152  C  CA  . GLY A 1 19  ? 8.147   -23.888 -3.155  1.00 13.42 ? 158 GLY A CA  1 
ATOM   153  C  C   . GLY A 1 19  ? 7.655   -23.081 -4.348  1.00 15.12 ? 158 GLY A C   1 
ATOM   154  O  O   . GLY A 1 19  ? 8.025   -21.912 -4.517  1.00 13.80 ? 158 GLY A O   1 
ATOM   155  N  N   . ARG A 1 20  ? 6.833   -23.709 -5.189  1.00 13.06 ? 159 ARG A N   1 
ATOM   156  C  CA  . ARG A 1 20  ? 6.387   -23.073 -6.427  1.00 14.94 ? 159 ARG A CA  1 
ATOM   157  C  C   . ARG A 1 20  ? 5.183   -22.159 -6.265  1.00 12.35 ? 159 ARG A C   1 
ATOM   158  O  O   . ARG A 1 20  ? 4.874   -21.397 -7.183  1.00 14.13 ? 159 ARG A O   1 
ATOM   159  C  CB  A ARG A 1 20  ? 6.041   -24.145 -7.467  0.56 19.08 ? 159 ARG A CB  1 
ATOM   160  C  CB  B ARG A 1 20  ? 6.065   -24.137 -7.482  0.44 19.80 ? 159 ARG A CB  1 
ATOM   161  C  CG  A ARG A 1 20  ? 7.170   -25.121 -7.757  0.56 24.58 ? 159 ARG A CG  1 
ATOM   162  C  CG  B ARG A 1 20  ? 7.255   -25.010 -7.859  0.44 25.11 ? 159 ARG A CG  1 
ATOM   163  C  CD  A ARG A 1 20  ? 6.794   -26.095 -8.866  0.56 29.57 ? 159 ARG A CD  1 
ATOM   164  C  CD  B ARG A 1 20  ? 7.308   -25.267 -9.360  0.44 30.86 ? 159 ARG A CD  1 
ATOM   165  N  NE  A ARG A 1 20  ? 6.127   -25.424 -9.981  0.56 34.61 ? 159 ARG A NE  1 
ATOM   166  N  NE  B ARG A 1 20  ? 6.053   -25.820 -9.860  0.44 35.48 ? 159 ARG A NE  1 
ATOM   167  C  CZ  A ARG A 1 20  ? 6.750   -24.690 -10.897 0.56 33.18 ? 159 ARG A CZ  1 
ATOM   168  C  CZ  B ARG A 1 20  ? 5.388   -25.345 -10.908 0.44 33.17 ? 159 ARG A CZ  1 
ATOM   169  N  NH1 A ARG A 1 20  ? 8.064   -24.519 -10.831 0.56 31.83 ? 159 ARG A NH1 1 
ATOM   170  N  NH1 B ARG A 1 20  ? 5.859   -24.305 -11.585 0.44 33.52 ? 159 ARG A NH1 1 
ATOM   171  N  NH2 A ARG A 1 20  ? 6.059   -24.122 -11.878 0.56 32.92 ? 159 ARG A NH2 1 
ATOM   172  N  NH2 B ARG A 1 20  ? 4.254   -25.916 -11.284 0.44 33.85 ? 159 ARG A NH2 1 
ATOM   173  N  N   . PHE A 1 21  ? 4.494   -22.236 -5.126  1.00 10.16 ? 160 PHE A N   1 
ATOM   174  C  CA  . PHE A 1 21  ? 3.226   -21.525 -5.004  1.00 10.31 ? 160 PHE A CA  1 
ATOM   175  C  C   . PHE A 1 21  ? 3.233   -20.666 -3.742  1.00 10.81 ? 160 PHE A C   1 
ATOM   176  O  O   . PHE A 1 21  ? 2.429   -20.846 -2.821  1.00 11.20 ? 160 PHE A O   1 
ATOM   177  C  CB  . PHE A 1 21  ? 2.058   -22.521 -5.024  1.00 10.12 ? 160 PHE A CB  1 
ATOM   178  C  CG  . PHE A 1 21  ? 2.045   -23.395 -6.251  1.00 12.18 ? 160 PHE A CG  1 
ATOM   179  C  CD1 . PHE A 1 21  ? 2.059   -24.777 -6.138  1.00 18.13 ? 160 PHE A CD1 1 
ATOM   180  C  CD2 . PHE A 1 21  ? 2.022   -22.831 -7.513  1.00 13.09 ? 160 PHE A CD2 1 
ATOM   181  C  CE1 . PHE A 1 21  ? 2.052   -25.587 -7.279  1.00 17.00 ? 160 PHE A CE1 1 
ATOM   182  C  CE2 . PHE A 1 21  ? 2.018   -23.632 -8.663  1.00 12.72 ? 160 PHE A CE2 1 
ATOM   183  C  CZ  . PHE A 1 21  ? 2.031   -25.010 -8.536  1.00 18.06 ? 160 PHE A CZ  1 
ATOM   184  N  N   . GLN A 1 22  ? 4.152   -19.707 -3.739  1.00 8.79  ? 161 GLN A N   1 
ATOM   185  C  CA  . GLN A 1 22  ? 4.412   -18.865 -2.578  1.00 7.89  ? 161 GLN A CA  1 
ATOM   186  C  C   . GLN A 1 22  ? 3.668   -17.540 -2.653  1.00 9.99  ? 161 GLN A C   1 
ATOM   187  O  O   . GLN A 1 22  ? 3.156   -17.141 -3.703  1.00 10.30 ? 161 GLN A O   1 
ATOM   188  C  CB  . GLN A 1 22  ? 5.914   -18.603 -2.441  1.00 11.79 ? 161 GLN A CB  1 
ATOM   189  C  CG  . GLN A 1 22  ? 6.723   -19.873 -2.190  1.00 9.28  ? 161 GLN A CG  1 
ATOM   190  C  CD  . GLN A 1 22  ? 6.632   -20.324 -0.745  1.00 8.99  ? 161 GLN A CD  1 
ATOM   191  O  OE1 . GLN A 1 22  ? 7.138   -19.653 0.158   1.00 10.03 ? 161 GLN A OE1 1 
ATOM   192  N  NE2 . GLN A 1 22  ? 5.966   -21.460 -0.513  1.00 10.03 ? 161 GLN A NE2 1 
ATOM   193  N  N   . SER A 1 23  ? 3.625   -16.869 -1.509  1.00 7.80  ? 162 SER A N   1 
ATOM   194  C  CA  . SER A 1 23  ? 3.072   -15.513 -1.380  1.00 8.80  ? 162 SER A CA  1 
ATOM   195  C  C   . SER A 1 23  ? 4.131   -14.592 -0.797  1.00 8.32  ? 162 SER A C   1 
ATOM   196  O  O   . SER A 1 23  ? 5.047   -15.063 -0.128  1.00 9.45  ? 162 SER A O   1 
ATOM   197  C  CB  . SER A 1 23  ? 1.827   -15.534 -0.475  1.00 8.65  ? 162 SER A CB  1 
ATOM   198  O  OG  . SER A 1 23  ? 0.815   -16.342 -1.056  1.00 7.85  ? 162 SER A OG  1 
ATOM   199  N  N   . PRO A 1 24  ? 4.019   -13.275 -1.023  1.00 8.09  ? 163 PRO A N   1 
ATOM   200  C  CA  . PRO A 1 24  ? 2.988   -12.568 -1.784  1.00 8.16  ? 163 PRO A CA  1 
ATOM   201  C  C   . PRO A 1 24  ? 3.260   -12.622 -3.275  1.00 8.45  ? 163 PRO A C   1 
ATOM   202  O  O   . PRO A 1 24  ? 4.333   -13.063 -3.706  1.00 9.99  ? 163 PRO A O   1 
ATOM   203  C  CB  . PRO A 1 24  ? 3.105   -11.135 -1.267  1.00 9.38  ? 163 PRO A CB  1 
ATOM   204  C  CG  . PRO A 1 24  ? 4.611   -11.003 -1.048  1.00 9.28  ? 163 PRO A CG  1 
ATOM   205  C  CD  . PRO A 1 24  ? 5.027   -12.341 -0.473  1.00 7.90  ? 163 PRO A CD  1 
ATOM   206  N  N   . VAL A 1 25  ? 2.280   -12.158 -4.049  1.00 8.33  ? 164 VAL A N   1 
ATOM   207  C  CA  . VAL A 1 25  ? 2.378   -12.104 -5.505  1.00 7.66  ? 164 VAL A CA  1 
ATOM   208  C  C   . VAL A 1 25  ? 1.951   -10.727 -5.994  1.00 9.66  ? 164 VAL A C   1 
ATOM   209  O  O   . VAL A 1 25  ? 1.326   -9.956  -5.260  1.00 9.91  ? 164 VAL A O   1 
ATOM   210  C  CB  . VAL A 1 25  ? 1.474   -13.158 -6.176  1.00 9.31  ? 164 VAL A CB  1 
ATOM   211  C  CG1 . VAL A 1 25  ? 1.855   -14.557 -5.731  1.00 11.73 ? 164 VAL A CG1 1 
ATOM   212  C  CG2 . VAL A 1 25  ? -0.000  -12.880 -5.849  1.00 10.96 ? 164 VAL A CG2 1 
ATOM   213  N  N   . ASP A 1 26  ? 2.273   -10.445 -7.255  1.00 9.93  ? 165 ASP A N   1 
ATOM   214  C  CA  . ASP A 1 26  ? 1.789   -9.252  -7.927  1.00 10.17 ? 165 ASP A CA  1 
ATOM   215  C  C   . ASP A 1 26  ? 0.389   -9.510  -8.469  1.00 10.90 ? 165 ASP A C   1 
ATOM   216  O  O   . ASP A 1 26  ? 0.150   -10.530 -9.113  1.00 11.46 ? 165 ASP A O   1 
ATOM   217  C  CB  . ASP A 1 26  ? 2.750   -8.861  -9.053  1.00 9.87  ? 165 ASP A CB  1 
ATOM   218  C  CG  . ASP A 1 26  ? 2.318   -7.601  -9.772  1.00 12.95 ? 165 ASP A CG  1 
ATOM   219  O  OD1 . ASP A 1 26  ? 2.300   -7.618  -11.032 1.00 15.91 ? 165 ASP A OD1 1 
ATOM   220  O  OD2 . ASP A 1 26  ? 2.009   -6.600  -9.086  1.00 11.57 ? 165 ASP A OD2 1 
ATOM   221  N  N   . ILE A 1 27  ? -0.538  -8.611  -8.170  1.00 8.77  ? 166 ILE A N   1 
ATOM   222  C  CA  . ILE A 1 27  ? -1.906  -8.725  -8.667  1.00 7.85  ? 166 ILE A CA  1 
ATOM   223  C  C   . ILE A 1 27  ? -2.069  -7.856  -9.901  1.00 11.43 ? 166 ILE A C   1 
ATOM   224  O  O   . ILE A 1 27  ? -1.871  -6.641  -9.830  1.00 11.35 ? 166 ILE A O   1 
ATOM   225  C  CB  . ILE A 1 27  ? -2.913  -8.295  -7.600  1.00 10.60 ? 166 ILE A CB  1 
ATOM   226  C  CG1 . ILE A 1 27  ? -2.738  -9.152  -6.346  1.00 11.92 ? 166 ILE A CG1 1 
ATOM   227  C  CG2 . ILE A 1 27  ? -4.350  -8.375  -8.133  1.00 11.45 ? 166 ILE A CG2 1 
ATOM   228  C  CD1 . ILE A 1 27  ? -3.480  -8.613  -5.129  1.00 11.43 ? 166 ILE A CD1 1 
ATOM   229  N  N   . ARG A 1 28  ? -2.438  -8.489  -11.014 1.00 11.91 ? 167 ARG A N   1 
ATOM   230  C  CA  . ARG A 1 28  ? -2.717  -7.785  -12.262 1.00 13.86 ? 167 ARG A CA  1 
ATOM   231  C  C   . ARG A 1 28  ? -4.202  -7.938  -12.511 1.00 12.82 ? 167 ARG A C   1 
ATOM   232  O  O   . ARG A 1 28  ? -4.649  -8.968  -13.008 1.00 11.87 ? 167 ARG A O   1 
ATOM   233  C  CB  . ARG A 1 28  ? -1.885  -8.356  -13.412 1.00 13.46 ? 167 ARG A CB  1 
ATOM   234  C  CG  . ARG A 1 28  ? -0.375  -8.226  -13.217 1.00 16.18 ? 167 ARG A CG  1 
ATOM   235  C  CD  . ARG A 1 28  ? 0.388   -8.971  -14.302 1.00 17.49 ? 167 ARG A CD  1 
ATOM   236  N  NE  . ARG A 1 28  ? 0.187   -8.431  -15.641 1.00 21.37 ? 167 ARG A NE  1 
ATOM   237  C  CZ  . ARG A 1 28  ? 0.675   -9.000  -16.738 1.00 27.37 ? 167 ARG A CZ  1 
ATOM   238  N  NH1 . ARG A 1 28  ? 1.354   -10.135 -16.642 1.00 29.17 ? 167 ARG A NH1 1 
ATOM   239  N  NH2 . ARG A 1 28  ? 0.458   -8.461  -17.931 1.00 27.47 ? 167 ARG A NH2 1 
ATOM   240  N  N   . PRO A 1 29  ? -4.984  -6.932  -12.103 1.00 12.51 ? 168 PRO A N   1 
ATOM   241  C  CA  . PRO A 1 29  ? -6.438  -7.083  -12.132 1.00 12.53 ? 168 PRO A CA  1 
ATOM   242  C  C   . PRO A 1 29  ? -6.990  -7.371  -13.529 1.00 12.61 ? 168 PRO A C   1 
ATOM   243  O  O   . PRO A 1 29  ? -8.035  -8.022  -13.644 1.00 14.56 ? 168 PRO A O   1 
ATOM   244  C  CB  . PRO A 1 29  ? -6.931  -5.735  -11.596 1.00 15.37 ? 168 PRO A CB  1 
ATOM   245  C  CG  . PRO A 1 29  ? -5.831  -5.291  -10.668 1.00 14.55 ? 168 PRO A CG  1 
ATOM   246  C  CD  . PRO A 1 29  ? -4.577  -5.696  -11.405 1.00 15.61 ? 168 PRO A CD  1 
ATOM   247  N  N   . GLN A 1 30  ? -6.284  -6.935  -14.568 1.00 13.69 ? 169 GLN A N   1 
ATOM   248  C  CA  . GLN A 1 30  ? -6.746  -7.162  -15.941 1.00 14.89 ? 169 GLN A CA  1 
ATOM   249  C  C   . GLN A 1 30  ? -6.645  -8.630  -16.349 1.00 15.31 ? 169 GLN A C   1 
ATOM   250  O  O   . GLN A 1 30  ? -7.272  -9.068  -17.320 1.00 18.80 ? 169 GLN A O   1 
ATOM   251  C  CB  . GLN A 1 30  ? -5.975  -6.250  -16.897 1.00 20.15 ? 169 GLN A CB  1 
ATOM   252  C  CG  . GLN A 1 30  ? -6.271  -4.784  -16.558 1.00 21.48 ? 169 GLN A CG  1 
ATOM   253  C  CD  . GLN A 1 30  ? -5.550  -3.788  -17.436 1.00 28.68 ? 169 GLN A CD  1 
ATOM   254  O  OE1 . GLN A 1 30  ? -5.910  -3.609  -18.595 1.00 30.39 ? 169 GLN A OE1 1 
ATOM   255  N  NE2 . GLN A 1 30  ? -4.552  -3.100  -16.875 1.00 23.41 ? 169 GLN A NE2 1 
ATOM   256  N  N   . LEU A 1 31  ? -5.848  -9.391  -15.613 1.00 12.63 ? 170 LEU A N   1 
ATOM   257  C  CA  . LEU A 1 31  ? -5.693  -10.808 -15.879 1.00 14.37 ? 170 LEU A CA  1 
ATOM   258  C  C   . LEU A 1 31  ? -6.441  -11.662 -14.862 1.00 13.12 ? 170 LEU A C   1 
ATOM   259  O  O   . LEU A 1 31  ? -6.456  -12.895 -14.962 1.00 16.72 ? 170 LEU A O   1 
ATOM   260  C  CB  A LEU A 1 31  ? -4.219  -11.196 -15.883 0.46 15.01 ? 170 LEU A CB  1 
ATOM   261  C  CB  B LEU A 1 31  ? -4.213  -11.186 -15.886 0.54 15.10 ? 170 LEU A CB  1 
ATOM   262  C  CG  A LEU A 1 31  ? -3.453  -10.841 -17.155 0.46 16.56 ? 170 LEU A CG  1 
ATOM   263  C  CG  B LEU A 1 31  ? -3.369  -10.833 -17.119 0.54 16.59 ? 170 LEU A CG  1 
ATOM   264  C  CD1 A LEU A 1 31  ? -1.989  -11.200 -16.989 0.46 17.64 ? 170 LEU A CD1 1 
ATOM   265  C  CD1 B LEU A 1 31  ? -3.406  -9.348  -17.496 0.54 14.91 ? 170 LEU A CD1 1 
ATOM   266  C  CD2 A LEU A 1 31  ? -4.056  -11.570 -18.349 0.46 18.47 ? 170 LEU A CD2 1 
ATOM   267  C  CD2 B LEU A 1 31  ? -1.936  -11.293 -16.894 0.54 17.51 ? 170 LEU A CD2 1 
ATOM   268  N  N   . ALA A 1 32  ? -7.043  -11.021 -13.871 1.00 11.29 ? 171 ALA A N   1 
ATOM   269  C  CA  . ALA A 1 32  ? -7.764  -11.775 -12.854 1.00 10.49 ? 171 ALA A CA  1 
ATOM   270  C  C   . ALA A 1 32  ? -9.034  -12.348 -13.456 1.00 14.15 ? 171 ALA A C   1 
ATOM   271  O  O   . ALA A 1 32  ? -9.654  -11.743 -14.336 1.00 16.76 ? 171 ALA A O   1 
ATOM   272  C  CB  . ALA A 1 32  ? -8.088  -10.905 -11.653 1.00 12.17 ? 171 ALA A CB  1 
ATOM   273  N  N   . ALA A 1 33  ? -9.396  -13.539 -13.011 1.00 11.30 ? 172 ALA A N   1 
ATOM   274  C  CA  . ALA A 1 33  ? -10.591 -14.194 -13.524 1.00 12.94 ? 172 ALA A CA  1 
ATOM   275  C  C   . ALA A 1 33  ? -11.825 -13.863 -12.696 1.00 10.58 ? 172 ALA A C   1 
ATOM   276  O  O   . ALA A 1 33  ? -11.910 -14.224 -11.530 1.00 12.70 ? 172 ALA A O   1 
ATOM   277  C  CB  . ALA A 1 33  ? -10.371 -15.698 -13.564 1.00 12.68 ? 172 ALA A CB  1 
ATOM   278  N  N   . PHE A 1 34  ? -12.802 -13.204 -13.306 1.00 14.22 ? 173 PHE A N   1 
ATOM   279  C  CA  . PHE A 1 34  ? -14.048 -12.911 -12.608 1.00 13.90 ? 173 PHE A CA  1 
ATOM   280  C  C   . PHE A 1 34  ? -14.841 -14.179 -12.334 1.00 12.10 ? 173 PHE A C   1 
ATOM   281  O  O   . PHE A 1 34  ? -15.128 -14.945 -13.264 1.00 17.00 ? 173 PHE A O   1 
ATOM   282  C  CB  . PHE A 1 34  ? -14.909 -11.940 -13.420 1.00 14.71 ? 173 PHE A CB  1 
ATOM   283  C  CG  . PHE A 1 34  ? -16.303 -11.774 -12.888 1.00 18.02 ? 173 PHE A CG  1 
ATOM   284  C  CD1 . PHE A 1 34  ? -17.397 -11.909 -13.729 1.00 21.05 ? 173 PHE A CD1 1 
ATOM   285  C  CD2 . PHE A 1 34  ? -16.526 -11.499 -11.548 1.00 16.71 ? 173 PHE A CD2 1 
ATOM   286  C  CE1 . PHE A 1 34  ? -18.689 -11.770 -13.246 1.00 20.70 ? 173 PHE A CE1 1 
ATOM   287  C  CE2 . PHE A 1 34  ? -17.808 -11.357 -11.059 1.00 18.89 ? 173 PHE A CE2 1 
ATOM   288  C  CZ  . PHE A 1 34  ? -18.898 -11.493 -11.909 1.00 20.95 ? 173 PHE A CZ  1 
ATOM   289  N  N   . SER A 1 35  ? -15.141 -14.424 -11.057 1.00 13.98 ? 174 SER A N   1 
ATOM   290  C  CA  . SER A 1 35  ? -15.953 -15.570 -10.640 1.00 13.18 ? 174 SER A CA  1 
ATOM   291  C  C   . SER A 1 35  ? -17.211 -15.115 -9.904  1.00 16.51 ? 174 SER A C   1 
ATOM   292  O  O   . SER A 1 35  ? -17.142 -14.694 -8.747  1.00 16.68 ? 174 SER A O   1 
ATOM   293  C  CB  . SER A 1 35  ? -15.159 -16.520 -9.740  1.00 15.17 ? 174 SER A CB  1 
ATOM   294  O  OG  . SER A 1 35  ? -16.000 -17.580 -9.307  1.00 19.65 ? 174 SER A OG  1 
ATOM   295  N  N   . PRO A 1 36  ? -18.377 -15.191 -10.567 1.00 20.74 ? 175 PRO A N   1 
ATOM   296  C  CA  . PRO A 1 36  ? -19.603 -14.739 -9.889  1.00 26.23 ? 175 PRO A CA  1 
ATOM   297  C  C   . PRO A 1 36  ? -19.967 -15.590 -8.664  1.00 25.34 ? 175 PRO A C   1 
ATOM   298  O  O   . PRO A 1 36  ? -20.823 -15.185 -7.879  1.00 26.35 ? 175 PRO A O   1 
ATOM   299  C  CB  . PRO A 1 36  ? -20.675 -14.849 -10.985 1.00 29.03 ? 175 PRO A CB  1 
ATOM   300  C  CG  . PRO A 1 36  ? -20.115 -15.772 -12.004 1.00 23.81 ? 175 PRO A CG  1 
ATOM   301  C  CD  . PRO A 1 36  ? -18.622 -15.598 -11.959 1.00 26.53 ? 175 PRO A CD  1 
ATOM   302  N  N   . ALA A 1 37  ? -19.298 -16.729 -8.491  1.00 24.93 ? 176 ALA A N   1 
ATOM   303  C  CA  . ALA A 1 37  ? -19.478 -17.576 -7.314  1.00 20.29 ? 176 ALA A CA  1 
ATOM   304  C  C   . ALA A 1 37  ? -18.948 -16.932 -6.031  1.00 21.36 ? 176 ALA A C   1 
ATOM   305  O  O   . ALA A 1 37  ? -19.311 -17.340 -4.933  1.00 23.59 ? 176 ALA A O   1 
ATOM   306  C  CB  . ALA A 1 37  ? -18.799 -18.921 -7.531  1.00 26.88 ? 176 ALA A CB  1 
ATOM   307  N  N   . LEU A 1 38  ? -18.068 -15.945 -6.171  1.00 16.57 ? 177 LEU A N   1 
ATOM   308  C  CA  . LEU A 1 38  ? -17.450 -15.297 -5.015  1.00 15.90 ? 177 LEU A CA  1 
ATOM   309  C  C   . LEU A 1 38  ? -18.364 -14.221 -4.421  1.00 18.91 ? 177 LEU A C   1 
ATOM   310  O  O   . LEU A 1 38  ? -18.496 -13.123 -4.974  1.00 20.71 ? 177 LEU A O   1 
ATOM   311  C  CB  . LEU A 1 38  ? -16.103 -14.696 -5.414  1.00 14.52 ? 177 LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 38  ? -15.039 -15.725 -5.829  1.00 13.60 ? 177 LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 38  ? -13.778 -15.031 -6.254  1.00 12.88 ? 177 LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 38  ? -14.733 -16.690 -4.685  1.00 16.21 ? 177 LEU A CD2 1 
ATOM   315  N  N   . ARG A 1 39  ? -18.972 -14.554 -3.286  1.00 17.12 ? 178 ARG A N   1 
ATOM   316  C  CA  . ARG A 1 39  ? -19.954 -13.710 -2.618  1.00 19.59 ? 178 ARG A CA  1 
ATOM   317  C  C   . ARG A 1 39  ? -19.283 -12.765 -1.629  1.00 15.01 ? 178 ARG A C   1 
ATOM   318  O  O   . ARG A 1 39  ? -18.104 -12.942 -1.311  1.00 15.60 ? 178 ARG A O   1 
ATOM   319  C  CB  . ARG A 1 39  ? -20.978 -14.583 -1.882  1.00 23.34 ? 178 ARG A CB  1 
ATOM   320  C  CG  . ARG A 1 39  ? -21.547 -15.746 -2.691  1.00 36.01 ? 178 ARG A CG  1 
ATOM   321  C  CD  . ARG A 1 39  ? -22.608 -15.307 -3.706  1.00 48.53 ? 178 ARG A CD  1 
ATOM   322  N  NE  . ARG A 1 39  ? -22.085 -14.569 -4.853  1.00 54.20 ? 178 ARG A NE  1 
ATOM   323  C  CZ  . ARG A 1 39  ? -22.513 -13.364 -5.220  1.00 58.07 ? 178 ARG A CZ  1 
ATOM   324  N  NH1 . ARG A 1 39  ? -23.469 -12.760 -4.527  1.00 55.93 ? 178 ARG A NH1 1 
ATOM   325  N  NH2 . ARG A 1 39  ? -21.988 -12.762 -6.278  1.00 61.18 ? 178 ARG A NH2 1 
ATOM   326  N  N   . PRO A 1 40  ? -20.021 -11.745 -1.149  1.00 14.90 ? 179 PRO A N   1 
ATOM   327  C  CA  . PRO A 1 40  ? -19.408 -10.866 -0.144  1.00 13.30 ? 179 PRO A CA  1 
ATOM   328  C  C   . PRO A 1 40  ? -18.929 -11.642 1.081   1.00 13.61 ? 179 PRO A C   1 
ATOM   329  O  O   . PRO A 1 40  ? -19.582 -12.612 1.503   1.00 14.39 ? 179 PRO A O   1 
ATOM   330  C  CB  . PRO A 1 40  ? -20.544 -9.904  0.217   1.00 18.19 ? 179 PRO A CB  1 
ATOM   331  C  CG  . PRO A 1 40  ? -21.367 -9.841  -1.031  1.00 21.73 ? 179 PRO A CG  1 
ATOM   332  C  CD  . PRO A 1 40  ? -21.342 -11.241 -1.584  1.00 17.28 ? 179 PRO A CD  1 
ATOM   333  N  N   . LEU A 1 41  ? -17.794 -11.230 1.646   1.00 15.30 ? 180 LEU A N   1 
ATOM   334  C  CA  . LEU A 1 41  ? -17.280 -11.864 2.843   1.00 12.96 ? 180 LEU A CA  1 
ATOM   335  C  C   . LEU A 1 41  ? -18.259 -11.687 4.000   1.00 15.42 ? 180 LEU A C   1 
ATOM   336  O  O   . LEU A 1 41  ? -18.899 -10.646 4.117   1.00 18.63 ? 180 LEU A O   1 
ATOM   337  C  CB  . LEU A 1 41  ? -15.916 -11.277 3.213   1.00 15.21 ? 180 LEU A CB  1 
ATOM   338  C  CG  . LEU A 1 41  ? -14.881 -11.240 2.091   1.00 17.28 ? 180 LEU A CG  1 
ATOM   339  C  CD1 . LEU A 1 41  ? -13.587 -10.613 2.613   1.00 20.16 ? 180 LEU A CD1 1 
ATOM   340  C  CD2 . LEU A 1 41  ? -14.625 -12.628 1.516   1.00 19.87 ? 180 LEU A CD2 1 
ATOM   341  N  N   . GLU A 1 42  ? -18.357 -12.699 4.853   1.00 13.65 ? 181 GLU A N   1 
ATOM   342  C  CA  . GLU A 1 42  ? -19.247 -12.647 6.011   1.00 14.28 ? 181 GLU A CA  1 
ATOM   343  C  C   . GLU A 1 42  ? -18.448 -12.812 7.293   1.00 19.89 ? 181 GLU A C   1 
ATOM   344  O  O   . GLU A 1 42  ? -17.805 -13.837 7.521   1.00 18.84 ? 181 GLU A O   1 
ATOM   345  C  CB  . GLU A 1 42  ? -20.332 -13.718 5.918   1.00 15.09 ? 181 GLU A CB  1 
ATOM   346  C  CG  . GLU A 1 42  ? -21.223 -13.542 4.706   1.00 17.61 ? 181 GLU A CG  1 
ATOM   347  C  CD  . GLU A 1 42  ? -22.258 -14.644 4.549   1.00 22.83 ? 181 GLU A CD  1 
ATOM   348  O  OE1 . GLU A 1 42  ? -22.972 -14.626 3.525   1.00 26.18 ? 181 GLU A OE1 1 
ATOM   349  O  OE2 . GLU A 1 42  ? -22.357 -15.526 5.432   1.00 24.34 ? 181 GLU A OE2 1 
ATOM   350  N  N   . LEU A 1 43  ? -18.493 -11.776 8.121   1.00 15.95 ? 182 LEU A N   1 
ATOM   351  C  CA  . LEU A 1 43  ? -17.774 -11.747 9.374   1.00 15.81 ? 182 LEU A CA  1 
ATOM   352  C  C   . LEU A 1 43  ? -18.750 -11.666 10.533  1.00 19.45 ? 182 LEU A C   1 
ATOM   353  O  O   . LEU A 1 43  ? -19.786 -11.009 10.424  1.00 21.28 ? 182 LEU A O   1 
ATOM   354  C  CB  . LEU A 1 43  ? -16.822 -10.546 9.404   1.00 15.07 ? 182 LEU A CB  1 
ATOM   355  C  CG  . LEU A 1 43  ? -15.445 -10.627 8.736   1.00 23.42 ? 182 LEU A CG  1 
ATOM   356  C  CD1 . LEU A 1 43  ? -15.513 -11.097 7.298   1.00 26.76 ? 182 LEU A CD1 1 
ATOM   357  C  CD2 . LEU A 1 43  ? -14.799 -9.256  8.805   1.00 23.90 ? 182 LEU A CD2 1 
ATOM   358  N  N   . SER A 1 44  ? -18.458 -12.377 11.615  1.00 16.39 ? 183 SER A N   1 
ATOM   359  C  CA  . SER A 1 44  ? -19.225 -12.191 12.845  1.00 15.62 ? 183 SER A CA  1 
ATOM   360  C  C   . SER A 1 44  ? -18.292 -12.232 14.042  1.00 16.68 ? 183 SER A C   1 
ATOM   361  O  O   . SER A 1 44  ? -17.241 -12.881 14.009  1.00 15.98 ? 183 SER A O   1 
ATOM   362  C  CB  . SER A 1 44  ? -20.347 -13.230 12.996  1.00 22.33 ? 183 SER A CB  1 
ATOM   363  O  OG  . SER A 1 44  ? -19.851 -14.524 13.255  1.00 25.75 ? 183 SER A OG  1 
ATOM   364  N  N   . GLY A 1 45  ? -18.654 -11.493 15.086  1.00 15.39 ? 184 GLY A N   1 
ATOM   365  C  CA  . GLY A 1 45  ? -17.871 -11.501 16.305  1.00 14.30 ? 184 GLY A CA  1 
ATOM   366  C  C   . GLY A 1 45  ? -16.663 -10.572 16.307  1.00 11.36 ? 184 GLY A C   1 
ATOM   367  O  O   . GLY A 1 45  ? -15.861 -10.631 17.226  1.00 13.49 ? 184 GLY A O   1 
ATOM   368  N  N   . PHE A 1 46  ? -16.530 -9.722  15.294  1.00 13.18 ? 185 PHE A N   1 
ATOM   369  C  CA  . PHE A 1 46  ? -15.345 -8.861  15.173  1.00 12.84 ? 185 PHE A CA  1 
ATOM   370  C  C   . PHE A 1 46  ? -15.442 -7.568  15.997  1.00 17.02 ? 185 PHE A C   1 
ATOM   371  O  O   . PHE A 1 46  ? -14.444 -6.865  16.166  1.00 15.72 ? 185 PHE A O   1 
ATOM   372  C  CB  . PHE A 1 46  ? -15.089 -8.494  13.704  1.00 13.54 ? 185 PHE A CB  1 
ATOM   373  C  CG  . PHE A 1 46  ? -14.314 -9.536  12.925  1.00 14.69 ? 185 PHE A CG  1 
ATOM   374  C  CD1 . PHE A 1 46  ? -14.791 -10.835 12.797  1.00 16.96 ? 185 PHE A CD1 1 
ATOM   375  C  CD2 . PHE A 1 46  ? -13.122 -9.191  12.292  1.00 14.32 ? 185 PHE A CD2 1 
ATOM   376  C  CE1 . PHE A 1 46  ? -14.078 -11.795 12.078  1.00 15.65 ? 185 PHE A CE1 1 
ATOM   377  C  CE2 . PHE A 1 46  ? -12.407 -10.134 11.557  1.00 13.31 ? 185 PHE A CE2 1 
ATOM   378  C  CZ  . PHE A 1 46  ? -12.888 -11.439 11.445  1.00 14.03 ? 185 PHE A CZ  1 
ATOM   379  N  N   . GLN A 1 47  ? -16.639 -7.233  16.481  1.00 16.47 ? 186 GLN A N   1 
ATOM   380  C  CA  . GLN A 1 47  ? -16.818 -6.035  17.299  1.00 17.61 ? 186 GLN A CA  1 
ATOM   381  C  C   . GLN A 1 47  ? -16.576 -6.365  18.764  1.00 18.59 ? 186 GLN A C   1 
ATOM   382  O  O   . GLN A 1 47  ? -17.498 -6.719  19.505  1.00 18.74 ? 186 GLN A O   1 
ATOM   383  C  CB  . GLN A 1 47  ? -18.216 -5.439  17.103  1.00 18.32 ? 186 GLN A CB  1 
ATOM   384  C  CG  . GLN A 1 47  ? -18.402 -4.741  15.764  1.00 19.52 ? 186 GLN A CG  1 
ATOM   385  C  CD  . GLN A 1 47  ? -18.525 -5.711  14.617  1.00 28.00 ? 186 GLN A CD  1 
ATOM   386  O  OE1 . GLN A 1 47  ? -19.353 -6.624  14.650  1.00 27.35 ? 186 GLN A OE1 1 
ATOM   387  N  NE2 . GLN A 1 47  ? -17.676 -5.544  13.603  1.00 25.82 ? 186 GLN A NE2 1 
ATOM   388  N  N   . LEU A 1 48  ? -15.319 -6.252  19.180  1.00 15.17 ? 187 LEU A N   1 
ATOM   389  C  CA  . LEU A 1 48  ? -14.926 -6.629  20.525  1.00 12.78 ? 187 LEU A CA  1 
ATOM   390  C  C   . LEU A 1 48  ? -15.235 -5.511  21.518  1.00 15.82 ? 187 LEU A C   1 
ATOM   391  O  O   . LEU A 1 48  ? -15.128 -4.329  21.185  1.00 16.02 ? 187 LEU A O   1 
ATOM   392  C  CB  . LEU A 1 48  ? -13.428 -6.955  20.576  1.00 13.54 ? 187 LEU A CB  1 
ATOM   393  C  CG  . LEU A 1 48  ? -12.927 -7.969  19.544  1.00 14.87 ? 187 LEU A CG  1 
ATOM   394  C  CD1 . LEU A 1 48  ? -11.419 -8.169  19.711  1.00 15.29 ? 187 LEU A CD1 1 
ATOM   395  C  CD2 . LEU A 1 48  ? -13.653 -9.297  19.626  1.00 16.77 ? 187 LEU A CD2 1 
ATOM   396  N  N   . PRO A 1 49  ? -15.632 -5.886  22.738  1.00 16.58 ? 188 PRO A N   1 
ATOM   397  C  CA  . PRO A 1 49  ? -15.844 -4.903  23.806  1.00 19.59 ? 188 PRO A CA  1 
ATOM   398  C  C   . PRO A 1 49  ? -14.513 -4.390  24.344  1.00 20.42 ? 188 PRO A C   1 
ATOM   399  O  O   . PRO A 1 49  ? -13.489 -5.017  24.087  1.00 17.48 ? 188 PRO A O   1 
ATOM   400  C  CB  . PRO A 1 49  ? -16.601 -5.702  24.865  1.00 17.30 ? 188 PRO A CB  1 
ATOM   401  C  CG  . PRO A 1 49  ? -16.129 -7.099  24.682  1.00 17.98 ? 188 PRO A CG  1 
ATOM   402  C  CD  . PRO A 1 49  ? -15.899 -7.263  23.192  1.00 17.00 ? 188 PRO A CD  1 
ATOM   403  N  N   . PRO A 1 50  ? -14.523 -3.265  25.077  1.00 20.40 ? 189 PRO A N   1 
ATOM   404  C  CA  . PRO A 1 50  ? -13.275 -2.700  25.615  1.00 26.50 ? 189 PRO A CA  1 
ATOM   405  C  C   . PRO A 1 50  ? -12.509 -3.659  26.522  1.00 22.15 ? 189 PRO A C   1 
ATOM   406  O  O   . PRO A 1 50  ? -11.272 -3.622  26.543  1.00 22.04 ? 189 PRO A O   1 
ATOM   407  C  CB  . PRO A 1 50  ? -13.758 -1.486  26.410  1.00 25.21 ? 189 PRO A CB  1 
ATOM   408  C  CG  . PRO A 1 50  ? -15.027 -1.091  25.758  1.00 24.82 ? 189 PRO A CG  1 
ATOM   409  C  CD  . PRO A 1 50  ? -15.673 -2.370  25.292  1.00 21.98 ? 189 PRO A CD  1 
ATOM   410  N  N   . LEU A 1 51  ? -13.234 -4.491  27.266  1.00 17.88 ? 190 LEU A N   1 
ATOM   411  C  CA  . LEU A 1 51  ? -12.656 -5.529  28.109  1.00 15.09 ? 190 LEU A CA  1 
ATOM   412  C  C   . LEU A 1 51  ? -13.267 -6.879  27.758  1.00 18.89 ? 190 LEU A C   1 
ATOM   413  O  O   . LEU A 1 51  ? -14.456 -6.947  27.440  1.00 23.18 ? 190 LEU A O   1 
ATOM   414  C  CB  . LEU A 1 51  ? -12.887 -5.216  29.594  1.00 20.46 ? 190 LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 51  ? -12.225 -3.948  30.127  1.00 22.42 ? 190 LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 51  ? -12.671 -3.707  31.563  1.00 22.06 ? 190 LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 51  ? -10.704 -4.066  30.047  1.00 25.66 ? 190 LEU A CD2 1 
ATOM   418  N  N   . PRO A 1 52  ? -12.485 -7.969  27.835  1.00 17.95 ? 191 PRO A N   1 
ATOM   419  C  CA  . PRO A 1 52  ? -11.086 -8.048  28.279  1.00 19.69 ? 191 PRO A CA  1 
ATOM   420  C  C   . PRO A 1 52  ? -10.108 -7.470  27.267  1.00 19.22 ? 191 PRO A C   1 
ATOM   421  O  O   . PRO A 1 52  ? -10.447 -7.259  26.098  1.00 18.55 ? 191 PRO A O   1 
ATOM   422  C  CB  . PRO A 1 52  ? -10.848 -9.552  28.436  1.00 17.60 ? 191 PRO A CB  1 
ATOM   423  C  CG  . PRO A 1 52  ? -11.793 -10.174 27.432  1.00 20.83 ? 191 PRO A CG  1 
ATOM   424  C  CD  . PRO A 1 52  ? -13.010 -9.289  27.440  1.00 21.16 ? 191 PRO A CD  1 
ATOM   425  N  N   . GLU A 1 53  ? -8.882  -7.249  27.730  1.00 15.47 ? 192 GLU A N   1 
ATOM   426  C  CA  . GLU A 1 53  ? -7.845  -6.694  26.877  1.00 15.66 ? 192 GLU A CA  1 
ATOM   427  C  C   . GLU A 1 53  ? -7.208  -7.767  25.997  1.00 14.64 ? 192 GLU A C   1 
ATOM   428  O  O   . GLU A 1 53  ? -7.403  -8.973  26.205  1.00 15.60 ? 192 GLU A O   1 
ATOM   429  C  CB  . GLU A 1 53  ? -6.792  -5.993  27.741  1.00 16.49 ? 192 GLU A CB  1 
ATOM   430  C  CG  . GLU A 1 53  ? -7.337  -4.703  28.370  1.00 15.32 ? 192 GLU A CG  1 
ATOM   431  C  CD  . GLU A 1 53  ? -6.261  -3.871  29.032  1.00 27.51 ? 192 GLU A CD  1 
ATOM   432  O  OE1 . GLU A 1 53  ? -5.467  -4.442  29.811  1.00 27.95 ? 192 GLU A OE1 1 
ATOM   433  O  OE2 . GLU A 1 53  ? -6.215  -2.652  28.768  1.00 33.58 ? 192 GLU A OE2 1 
ATOM   434  N  N   . LEU A 1 54  ? -6.436  -7.302  25.015  1.00 14.15 ? 193 LEU A N   1 
ATOM   435  C  CA  . LEU A 1 54  ? -5.776  -8.160  24.034  1.00 11.68 ? 193 LEU A CA  1 
ATOM   436  C  C   . LEU A 1 54  ? -4.263  -7.977  24.109  1.00 9.29  ? 193 LEU A C   1 
ATOM   437  O  O   . LEU A 1 54  ? -3.794  -6.869  24.314  1.00 13.49 ? 193 LEU A O   1 
ATOM   438  C  CB  . LEU A 1 54  ? -6.258  -7.825  22.622  1.00 12.89 ? 193 LEU A CB  1 
ATOM   439  C  CG  . LEU A 1 54  ? -7.662  -8.229  22.158  1.00 17.85 ? 193 LEU A CG  1 
ATOM   440  C  CD1 . LEU A 1 54  ? -8.727  -7.505  22.924  1.00 21.11 ? 193 LEU A CD1 1 
ATOM   441  C  CD2 . LEU A 1 54  ? -7.802  -7.936  20.681  1.00 15.42 ? 193 LEU A CD2 1 
ATOM   442  N  N   . ARG A 1 55  ? -3.520  -9.062  23.927  1.00 11.35 ? 194 ARG A N   1 
ATOM   443  C  CA  . ARG A 1 55  ? -2.055  -9.008  23.860  1.00 9.86  ? 194 ARG A CA  1 
ATOM   444  C  C   . ARG A 1 55  ? -1.578  -8.369  22.553  1.00 13.25 ? 194 ARG A C   1 
ATOM   445  O  O   . ARG A 1 55  ? -2.016  -8.755  21.463  1.00 12.27 ? 194 ARG A O   1 
ATOM   446  C  CB  . ARG A 1 55  ? -1.477  -10.411 23.975  1.00 10.29 ? 194 ARG A CB  1 
ATOM   447  C  CG  . ARG A 1 55  ? 0.049   -10.533 24.085  1.00 13.53 ? 194 ARG A CG  1 
ATOM   448  C  CD  . ARG A 1 55  ? 0.369   -12.021 24.159  1.00 24.93 ? 194 ARG A CD  1 
ATOM   449  N  NE  . ARG A 1 55  ? 1.762   -12.371 24.433  1.00 37.75 ? 194 ARG A NE  1 
ATOM   450  C  CZ  . ARG A 1 55  ? 2.377   -13.434 23.911  1.00 39.40 ? 194 ARG A CZ  1 
ATOM   451  N  NH1 . ARG A 1 55  ? 1.738   -14.220 23.053  1.00 36.67 ? 194 ARG A NH1 1 
ATOM   452  N  NH2 . ARG A 1 55  ? 3.642   -13.702 24.230  1.00 30.38 ? 194 ARG A NH2 1 
ATOM   453  N  N   . LEU A 1 56  ? -0.695  -7.384  22.670  1.00 11.88 ? 195 LEU A N   1 
ATOM   454  C  CA  . LEU A 1 56  ? -0.061  -6.752  21.523  1.00 9.19  ? 195 LEU A CA  1 
ATOM   455  C  C   . LEU A 1 56  ? 1.452   -6.932  21.685  1.00 11.52 ? 195 LEU A C   1 
ATOM   456  O  O   . LEU A 1 56  ? 2.011   -6.484  22.682  1.00 11.68 ? 195 LEU A O   1 
ATOM   457  C  CB  . LEU A 1 56  ? -0.426  -5.270  21.442  1.00 9.16  ? 195 LEU A CB  1 
ATOM   458  C  CG  . LEU A 1 56  ? 0.064   -4.532  20.190  1.00 9.76  ? 195 LEU A CG  1 
ATOM   459  C  CD1 . LEU A 1 56  ? -0.710  -4.982  18.949  1.00 10.27 ? 195 LEU A CD1 1 
ATOM   460  C  CD2 . LEU A 1 56  ? -0.024  -3.028  20.313  1.00 10.38 ? 195 LEU A CD2 1 
ATOM   461  N  N   . ARG A 1 57  ? 2.107   -7.592  20.722  1.00 8.78  ? 196 ARG A N   1 
ATOM   462  C  CA  . ARG A 1 57  ? 3.502   -8.011  20.920  1.00 9.69  ? 196 ARG A CA  1 
ATOM   463  C  C   . ARG A 1 57  ? 4.396   -7.616  19.757  1.00 11.35 ? 196 ARG A C   1 
ATOM   464  O  O   . ARG A 1 57  ? 4.036   -7.802  18.595  1.00 10.26 ? 196 ARG A O   1 
ATOM   465  C  CB  A ARG A 1 57  ? 3.592   -9.527  21.140  0.44 12.05 ? 196 ARG A CB  1 
ATOM   466  C  CB  B ARG A 1 57  ? 3.561   -9.532  21.135  0.56 11.94 ? 196 ARG A CB  1 
ATOM   467  C  CG  A ARG A 1 57  ? 5.029   -10.033 21.283  0.44 13.43 ? 196 ARG A CG  1 
ATOM   468  C  CG  B ARG A 1 57  ? 4.958   -10.140 21.067  0.56 15.64 ? 196 ARG A CG  1 
ATOM   469  C  CD  A ARG A 1 57  ? 5.085   -11.455 21.837  0.44 14.73 ? 196 ARG A CD  1 
ATOM   470  C  CD  B ARG A 1 57  ? 4.923   -11.652 21.350  0.56 16.98 ? 196 ARG A CD  1 
ATOM   471  N  NE  A ARG A 1 57  ? 6.356   -11.689 22.520  0.44 18.76 ? 196 ARG A NE  1 
ATOM   472  N  NE  B ARG A 1 57  ? 6.266   -12.227 21.308  0.56 14.53 ? 196 ARG A NE  1 
ATOM   473  C  CZ  A ARG A 1 57  ? 7.409   -12.270 21.957  0.44 17.88 ? 196 ARG A CZ  1 
ATOM   474  C  CZ  B ARG A 1 57  ? 7.134   -12.145 22.311  0.56 17.05 ? 196 ARG A CZ  1 
ATOM   475  N  NH1 A ARG A 1 57  ? 7.334   -12.696 20.704  0.44 17.88 ? 196 ARG A NH1 1 
ATOM   476  N  NH1 B ARG A 1 57  ? 6.797   -11.517 23.430  0.56 16.51 ? 196 ARG A NH1 1 
ATOM   477  N  NH2 A ARG A 1 57  ? 8.532   -12.428 22.647  0.44 16.71 ? 196 ARG A NH2 1 
ATOM   478  N  NH2 B ARG A 1 57  ? 8.344   -12.675 22.193  0.56 19.87 ? 196 ARG A NH2 1 
ATOM   479  N  N   . ASN A 1 58  ? 5.561   -7.065  20.083  1.00 9.30  ? 197 ASN A N   1 
ATOM   480  C  CA  . ASN A 1 58  ? 6.631   -6.879  19.112  1.00 8.03  ? 197 ASN A CA  1 
ATOM   481  C  C   . ASN A 1 58  ? 7.419   -8.178  19.067  1.00 10.20 ? 197 ASN A C   1 
ATOM   482  O  O   . ASN A 1 58  ? 8.185   -8.466  19.989  1.00 10.05 ? 197 ASN A O   1 
ATOM   483  C  CB  . ASN A 1 58  ? 7.525   -5.688  19.515  1.00 7.82  ? 197 ASN A CB  1 
ATOM   484  C  CG  . ASN A 1 58  ? 8.758   -5.525  18.608  1.00 8.34  ? 197 ASN A CG  1 
ATOM   485  O  OD1 . ASN A 1 58  ? 9.045   -6.374  17.761  1.00 10.84 ? 197 ASN A OD1 1 
ATOM   486  N  ND2 . ASN A 1 58  ? 9.486   -4.424  18.790  1.00 8.46  ? 197 ASN A ND2 1 
ATOM   487  N  N   . ASN A 1 59  ? 7.234   -8.979  18.015  1.00 9.42  ? 198 ASN A N   1 
ATOM   488  C  CA  . ASN A 1 59  ? 7.925   -10.269 17.962  1.00 10.33 ? 198 ASN A CA  1 
ATOM   489  C  C   . ASN A 1 59  ? 9.207   -10.209 17.119  1.00 9.29  ? 198 ASN A C   1 
ATOM   490  O  O   . ASN A 1 59  ? 9.841   -11.245 16.869  1.00 10.31 ? 198 ASN A O   1 
ATOM   491  C  CB  . ASN A 1 59  ? 6.980   -11.366 17.433  1.00 8.52  ? 198 ASN A CB  1 
ATOM   492  C  CG  . ASN A 1 59  ? 6.445   -11.066 16.032  1.00 9.98  ? 198 ASN A CG  1 
ATOM   493  O  OD1 . ASN A 1 59  ? 7.147   -10.510 15.197  1.00 8.96  ? 198 ASN A OD1 1 
ATOM   494  N  ND2 . ASN A 1 59  ? 5.189   -11.454 15.772  1.00 9.98  ? 198 ASN A ND2 1 
ATOM   495  N  N   . GLY A 1 60  ? 9.587   -9.002  16.696  1.00 7.97  ? 199 GLY A N   1 
ATOM   496  C  CA  . GLY A 1 60  ? 10.812  -8.814  15.925  1.00 8.32  ? 199 GLY A CA  1 
ATOM   497  C  C   . GLY A 1 60  ? 10.590  -8.990  14.430  1.00 8.97  ? 199 GLY A C   1 
ATOM   498  O  O   . GLY A 1 60  ? 11.458  -8.639  13.638  1.00 9.40  ? 199 GLY A O   1 
ATOM   499  N  N   . HIS A 1 61  ? 9.449   -9.553  14.046  1.00 7.31  ? 200 HIS A N   1 
ATOM   500  C  CA  . HIS A 1 61  ? 9.102   -9.667  12.623  1.00 8.87  ? 200 HIS A CA  1 
ATOM   501  C  C   . HIS A 1 61  ? 7.986   -8.692  12.247  1.00 9.89  ? 200 HIS A C   1 
ATOM   502  O  O   . HIS A 1 61  ? 7.885   -8.240  11.096  1.00 8.20  ? 200 HIS A O   1 
ATOM   503  C  CB  . HIS A 1 61  ? 8.659   -11.083 12.271  1.00 9.24  ? 200 HIS A CB  1 
ATOM   504  C  CG  . HIS A 1 61  ? 9.606   -12.148 12.725  1.00 9.00  ? 200 HIS A CG  1 
ATOM   505  N  ND1 . HIS A 1 61  ? 9.159   -13.373 13.162  1.00 11.38 ? 200 HIS A ND1 1 
ATOM   506  C  CD2 . HIS A 1 61  ? 10.955  -12.176 12.817  1.00 10.44 ? 200 HIS A CD2 1 
ATOM   507  C  CE1 . HIS A 1 61  ? 10.197  -14.118 13.487  1.00 10.04 ? 200 HIS A CE1 1 
ATOM   508  N  NE2 . HIS A 1 61  ? 11.298  -13.414 13.302  1.00 9.19  ? 200 HIS A NE2 1 
ATOM   509  N  N   . SER A 1 62  ? 7.145   -8.380  13.236  1.00 9.93  ? 201 SER A N   1 
ATOM   510  C  CA  . SER A 1 62  ? 6.008   -7.483  13.077  1.00 8.03  ? 201 SER A CA  1 
ATOM   511  C  C   . SER A 1 62  ? 5.494   -7.124  14.458  1.00 9.09  ? 201 SER A C   1 
ATOM   512  O  O   . SER A 1 62  ? 6.066   -7.574  15.470  1.00 9.76  ? 201 SER A O   1 
ATOM   513  C  CB  . SER A 1 62  ? 4.880   -8.143  12.265  1.00 8.98  ? 201 SER A CB  1 
ATOM   514  O  OG  . SER A 1 62  ? 3.804   -7.226  12.045  1.00 8.28  ? 201 SER A OG  1 
ATOM   515  N  N   . VAL A 1 63  ? 4.419   -6.332  14.498  1.00 6.94  ? 202 VAL A N   1 
ATOM   516  C  CA  . VAL A 1 63  ? 3.637   -6.177  15.730  1.00 7.47  ? 202 VAL A CA  1 
ATOM   517  C  C   . VAL A 1 63  ? 2.383   -7.041  15.541  1.00 5.75  ? 202 VAL A C   1 
ATOM   518  O  O   . VAL A 1 63  ? 1.718   -6.949  14.511  1.00 7.96  ? 202 VAL A O   1 
ATOM   519  C  CB  . VAL A 1 63  ? 3.286   -4.701  16.032  1.00 8.77  ? 202 VAL A CB  1 
ATOM   520  C  CG1 . VAL A 1 63  ? 2.639   -3.993  14.817  1.00 10.00 ? 202 VAL A CG1 1 
ATOM   521  C  CG2 . VAL A 1 63  ? 2.384   -4.624  17.248  1.00 11.12 ? 202 VAL A CG2 1 
ATOM   522  N  N   . GLN A 1 64  ? 2.116   -7.930  16.501  1.00 7.96  ? 203 GLN A N   1 
ATOM   523  C  CA  . GLN A 1 64  ? 1.036   -8.899  16.356  1.00 8.51  ? 203 GLN A CA  1 
ATOM   524  C  C   . GLN A 1 64  ? 0.023   -8.765  17.489  1.00 11.32 ? 203 GLN A C   1 
ATOM   525  O  O   . GLN A 1 64  ? 0.395   -8.698  18.661  1.00 9.62  ? 203 GLN A O   1 
ATOM   526  C  CB  . GLN A 1 64  ? 1.592   -10.327 16.303  1.00 7.83  ? 203 GLN A CB  1 
ATOM   527  C  CG  . GLN A 1 64  ? 0.525   -11.416 16.100  1.00 8.57  ? 203 GLN A CG  1 
ATOM   528  C  CD  . GLN A 1 64  ? 1.137   -12.745 15.639  1.00 10.39 ? 203 GLN A CD  1 
ATOM   529  O  OE1 . GLN A 1 64  ? 2.021   -12.773 14.779  1.00 12.19 ? 203 GLN A OE1 1 
ATOM   530  N  NE2 . GLN A 1 64  ? 0.674   -13.854 16.227  1.00 10.34 ? 203 GLN A NE2 1 
ATOM   531  N  N   . LEU A 1 65  ? -1.251  -8.694  17.113  1.00 8.07  ? 204 LEU A N   1 
ATOM   532  C  CA  . LEU A 1 65  ? -2.379  -8.596  18.038  1.00 8.53  ? 204 LEU A CA  1 
ATOM   533  C  C   . LEU A 1 65  ? -3.063  -9.957  18.153  1.00 9.51  ? 204 LEU A C   1 
ATOM   534  O  O   . LEU A 1 65  ? -3.521  -10.515 17.155  1.00 10.17 ? 204 LEU A O   1 
ATOM   535  C  CB  . LEU A 1 65  ? -3.391  -7.557  17.552  1.00 8.85  ? 204 LEU A CB  1 
ATOM   536  C  CG  . LEU A 1 65  ? -4.629  -7.308  18.425  1.00 10.05 ? 204 LEU A CG  1 
ATOM   537  C  CD1 . LEU A 1 65  ? -4.253  -6.578  19.724  1.00 12.22 ? 204 LEU A CD1 1 
ATOM   538  C  CD2 . LEU A 1 65  ? -5.689  -6.528  17.634  1.00 10.42 ? 204 LEU A CD2 1 
ATOM   539  N  N   . THR A 1 66  ? -3.133  -10.504 19.367  1.00 9.09  ? 205 THR A N   1 
ATOM   540  C  CA  . THR A 1 66  ? -3.800  -11.789 19.577  1.00 10.45 ? 205 THR A CA  1 
ATOM   541  C  C   . THR A 1 66  ? -5.312  -11.617 19.672  1.00 11.89 ? 205 THR A C   1 
ATOM   542  O  O   . THR A 1 66  ? -5.800  -10.786 20.439  1.00 11.95 ? 205 THR A O   1 
ATOM   543  C  CB  . THR A 1 66  ? -3.285  -12.479 20.844  1.00 12.34 ? 205 THR A CB  1 
ATOM   544  O  OG1 . THR A 1 66  ? -1.886  -12.752 20.700  1.00 13.30 ? 205 THR A OG1 1 
ATOM   545  C  CG2 . THR A 1 66  ? -4.000  -13.774 21.044  1.00 11.27 ? 205 THR A CG2 1 
ATOM   546  N  N   . LEU A 1 67  ? -6.056  -12.388 18.883  1.00 10.67 ? 206 LEU A N   1 
ATOM   547  C  CA  . LEU A 1 67  ? -7.503  -12.232 18.848  1.00 9.41  ? 206 LEU A CA  1 
ATOM   548  C  C   . LEU A 1 67  ? -8.174  -13.300 19.703  1.00 11.14 ? 206 LEU A C   1 
ATOM   549  O  O   . LEU A 1 67  ? -7.693  -14.434 19.780  1.00 14.14 ? 206 LEU A O   1 
ATOM   550  C  CB  . LEU A 1 67  ? -7.998  -12.292 17.395  1.00 9.77  ? 206 LEU A CB  1 
ATOM   551  C  CG  . LEU A 1 67  ? -7.382  -11.200 16.515  1.00 9.74  ? 206 LEU A CG  1 
ATOM   552  C  CD1 . LEU A 1 67  ? -7.693  -11.446 15.031  1.00 10.67 ? 206 LEU A CD1 1 
ATOM   553  C  CD2 . LEU A 1 67  ? -7.837  -9.791  16.927  1.00 13.06 ? 206 LEU A CD2 1 
ATOM   554  N  N   . PRO A 1 68  ? -9.278  -12.934 20.367  1.00 11.87 ? 207 PRO A N   1 
ATOM   555  C  CA  . PRO A 1 68  ? -10.012 -13.863 21.233  1.00 12.94 ? 207 PRO A CA  1 
ATOM   556  C  C   . PRO A 1 68  ? -10.832 -14.856 20.412  1.00 15.86 ? 207 PRO A C   1 
ATOM   557  O  O   . PRO A 1 68  ? -10.925 -14.716 19.190  1.00 14.32 ? 207 PRO A O   1 
ATOM   558  C  CB  . PRO A 1 68  ? -10.923 -12.932 22.037  1.00 14.33 ? 207 PRO A CB  1 
ATOM   559  C  CG  . PRO A 1 68  ? -11.211 -11.818 21.106  1.00 14.49 ? 207 PRO A CG  1 
ATOM   560  C  CD  . PRO A 1 68  ? -9.909  -11.601 20.334  1.00 12.13 ? 207 PRO A CD  1 
ATOM   561  N  N   . PRO A 1 69  ? -11.411 -15.869 21.068  1.00 13.82 ? 208 PRO A N   1 
ATOM   562  C  CA  . PRO A 1 69  ? -12.337 -16.754 20.357  1.00 14.54 ? 208 PRO A CA  1 
ATOM   563  C  C   . PRO A 1 69  ? -13.535 -16.021 19.768  1.00 14.50 ? 208 PRO A C   1 
ATOM   564  O  O   . PRO A 1 69  ? -13.857 -14.896 20.163  1.00 14.76 ? 208 PRO A O   1 
ATOM   565  C  CB  . PRO A 1 69  ? -12.804 -17.725 21.449  1.00 18.00 ? 208 PRO A CB  1 
ATOM   566  C  CG  . PRO A 1 69  ? -11.696 -17.726 22.444  1.00 21.30 ? 208 PRO A CG  1 
ATOM   567  C  CD  . PRO A 1 69  ? -11.140 -16.329 22.442  1.00 16.87 ? 208 PRO A CD  1 
ATOM   568  N  N   . GLY A 1 70  ? -14.183 -16.658 18.798  1.00 14.54 ? 209 GLY A N   1 
ATOM   569  C  CA  . GLY A 1 70  ? -15.459 -16.165 18.320  1.00 15.37 ? 209 GLY A CA  1 
ATOM   570  C  C   . GLY A 1 70  ? -15.457 -15.239 17.131  1.00 15.48 ? 209 GLY A C   1 
ATOM   571  O  O   . GLY A 1 70  ? -16.506 -14.715 16.771  1.00 16.34 ? 209 GLY A O   1 
ATOM   572  N  N   . LEU A 1 71  ? -14.295 -15.018 16.518  1.00 11.48 ? 210 LEU A N   1 
ATOM   573  C  CA  . LEU A 1 71  ? -14.265 -14.210 15.307  1.00 13.62 ? 210 LEU A CA  1 
ATOM   574  C  C   . LEU A 1 71  ? -14.419 -15.149 14.130  1.00 15.22 ? 210 LEU A C   1 
ATOM   575  O  O   . LEU A 1 71  ? -13.479 -15.848 13.766  1.00 15.49 ? 210 LEU A O   1 
ATOM   576  C  CB  . LEU A 1 71  ? -12.961 -13.407 15.172  1.00 10.71 ? 210 LEU A CB  1 
ATOM   577  C  CG  . LEU A 1 71  ? -12.862 -12.163 16.069  1.00 12.67 ? 210 LEU A CG  1 
ATOM   578  C  CD1 . LEU A 1 71  ? -12.454 -12.567 17.486  1.00 10.67 ? 210 LEU A CD1 1 
ATOM   579  C  CD2 . LEU A 1 71  ? -11.926 -11.077 15.504  1.00 10.80 ? 210 LEU A CD2 1 
ATOM   580  N  N   . GLU A 1 72  ? -15.606 -15.159 13.538  1.00 15.50 ? 211 GLU A N   1 
ATOM   581  C  CA  . GLU A 1 72  ? -15.910 -16.105 12.464  1.00 14.48 ? 211 GLU A CA  1 
ATOM   582  C  C   . GLU A 1 72  ? -15.843 -15.412 11.118  1.00 15.86 ? 211 GLU A C   1 
ATOM   583  O  O   . GLU A 1 72  ? -16.310 -14.291 10.961  1.00 16.36 ? 211 GLU A O   1 
ATOM   584  C  CB  A GLU A 1 72  ? -17.287 -16.732 12.677  0.46 19.92 ? 211 GLU A CB  1 
ATOM   585  C  CB  B GLU A 1 72  ? -17.294 -16.723 12.668  0.54 19.01 ? 211 GLU A CB  1 
ATOM   586  C  CG  A GLU A 1 72  ? -17.418 -17.488 13.989  0.46 28.28 ? 211 GLU A CG  1 
ATOM   587  C  CG  B GLU A 1 72  ? -17.533 -17.267 14.065  0.54 28.66 ? 211 GLU A CG  1 
ATOM   588  C  CD  A GLU A 1 72  ? -18.829 -17.978 14.236  0.46 35.04 ? 211 GLU A CD  1 
ATOM   589  C  CD  B GLU A 1 72  ? -17.886 -18.739 14.057  0.54 37.66 ? 211 GLU A CD  1 
ATOM   590  O  OE1 A GLU A 1 72  ? -19.061 -18.637 15.273  0.46 39.11 ? 211 GLU A OE1 1 
ATOM   591  O  OE1 B GLU A 1 72  ? -18.808 -19.138 14.803  0.54 40.40 ? 211 GLU A OE1 1 
ATOM   592  O  OE2 A GLU A 1 72  ? -19.706 -17.708 13.391  0.46 35.18 ? 211 GLU A OE2 1 
ATOM   593  O  OE2 B GLU A 1 72  ? -17.234 -19.499 13.310  0.54 40.79 ? 211 GLU A OE2 1 
ATOM   594  N  N   . MET A 1 73  ? -15.236 -16.080 10.145  1.00 13.29 ? 212 MET A N   1 
ATOM   595  C  CA  . MET A 1 73  ? -15.108 -15.526 8.814   1.00 11.84 ? 212 MET A CA  1 
ATOM   596  C  C   . MET A 1 73  ? -15.508 -16.565 7.772   1.00 12.25 ? 212 MET A C   1 
ATOM   597  O  O   . MET A 1 73  ? -14.987 -17.685 7.800   1.00 14.98 ? 212 MET A O   1 
ATOM   598  C  CB  A MET A 1 73  ? -13.663 -15.048 8.631   0.62 16.11 ? 212 MET A CB  1 
ATOM   599  C  CB  B MET A 1 73  ? -13.687 -15.041 8.500   0.38 15.55 ? 212 MET A CB  1 
ATOM   600  C  CG  A MET A 1 73  ? -13.431 -14.161 7.457   0.62 14.44 ? 212 MET A CG  1 
ATOM   601  C  CG  B MET A 1 73  ? -13.584 -14.564 7.043   0.38 15.63 ? 212 MET A CG  1 
ATOM   602  S  SD  A MET A 1 73  ? -13.202 -15.162 5.992   0.62 11.75 ? 212 MET A SD  1 
ATOM   603  S  SD  B MET A 1 73  ? -11.949 -14.334 6.312   0.38 24.11 ? 212 MET A SD  1 
ATOM   604  C  CE  A MET A 1 73  ? -11.464 -15.611 6.149   0.62 16.93 ? 212 MET A CE  1 
ATOM   605  C  CE  B MET A 1 73  ? -11.269 -15.987 6.370   0.38 17.35 ? 212 MET A CE  1 
ATOM   606  N  N   . LYS A 1 74  ? -16.429 -16.205 6.877   1.00 11.55 ? 213 LYS A N   1 
ATOM   607  C  CA  . LYS A 1 74  ? -16.860 -17.134 5.836   1.00 10.42 ? 213 LYS A CA  1 
ATOM   608  C  C   . LYS A 1 74  ? -16.520 -16.637 4.440   1.00 11.81 ? 213 LYS A C   1 
ATOM   609  O  O   . LYS A 1 74  ? -16.948 -15.549 4.042   1.00 12.92 ? 213 LYS A O   1 
ATOM   610  C  CB  . LYS A 1 74  ? -18.369 -17.401 5.945   1.00 10.51 ? 213 LYS A CB  1 
ATOM   611  C  CG  . LYS A 1 74  ? -18.875 -18.428 4.930   1.00 14.42 ? 213 LYS A CG  1 
ATOM   612  C  CD  . LYS A 1 74  ? -20.359 -18.744 5.151   1.00 19.41 ? 213 LYS A CD  1 
ATOM   613  C  CE  . LYS A 1 74  ? -20.836 -19.872 4.242   1.00 18.80 ? 213 LYS A CE  1 
ATOM   614  N  NZ  . LYS A 1 74  ? -22.299 -20.126 4.450   1.00 22.60 ? 213 LYS A NZ  1 
ATOM   615  N  N   . LEU A 1 75  ? -15.759 -17.441 3.693   1.00 11.85 ? 214 LEU A N   1 
ATOM   616  C  CA  . LEU A 1 75  ? -15.404 -17.120 2.316   1.00 11.72 ? 214 LEU A CA  1 
ATOM   617  C  C   . LEU A 1 75  ? -16.453 -17.612 1.332   1.00 10.91 ? 214 LEU A C   1 
ATOM   618  O  O   . LEU A 1 75  ? -16.509 -17.162 0.183   1.00 14.14 ? 214 LEU A O   1 
ATOM   619  C  CB  . LEU A 1 75  ? -14.042 -17.720 1.960   1.00 10.04 ? 214 LEU A CB  1 
ATOM   620  C  CG  . LEU A 1 75  ? -12.820 -17.169 2.686   1.00 11.73 ? 214 LEU A CG  1 
ATOM   621  C  CD1 . LEU A 1 75  ? -11.552 -17.838 2.168   1.00 12.75 ? 214 LEU A CD1 1 
ATOM   622  C  CD2 . LEU A 1 75  ? -12.746 -15.649 2.516   1.00 13.96 ? 214 LEU A CD2 1 
ATOM   623  N  N   . GLY A 1 76  ? -17.296 -18.536 1.781   1.00 13.58 ? 215 GLY A N   1 
ATOM   624  C  CA  . GLY A 1 76  ? -18.341 -19.080 0.934   1.00 15.66 ? 215 GLY A CA  1 
ATOM   625  C  C   . GLY A 1 76  ? -18.728 -20.449 1.442   1.00 11.92 ? 215 GLY A C   1 
ATOM   626  O  O   . GLY A 1 76  ? -18.196 -20.902 2.453   1.00 14.17 ? 215 GLY A O   1 
ATOM   627  N  N   . PRO A 1 77  ? -19.641 -21.115 0.725   1.00 14.26 ? 216 PRO A N   1 
ATOM   628  C  CA  . PRO A 1 77  ? -20.056 -22.470 1.078   1.00 17.57 ? 216 PRO A CA  1 
ATOM   629  C  C   . PRO A 1 77  ? -18.843 -23.366 1.274   1.00 13.97 ? 216 PRO A C   1 
ATOM   630  O  O   . PRO A 1 77  ? -17.973 -23.386 0.404   1.00 13.10 ? 216 PRO A O   1 
ATOM   631  C  CB  . PRO A 1 77  ? -20.873 -22.910 -0.138  1.00 18.87 ? 216 PRO A CB  1 
ATOM   632  C  CG  . PRO A 1 77  ? -21.413 -21.632 -0.700  1.00 23.07 ? 216 PRO A CG  1 
ATOM   633  C  CD  . PRO A 1 77  ? -20.315 -20.622 -0.484  1.00 14.95 ? 216 PRO A CD  1 
ATOM   634  N  N   . GLY A 1 78  ? -18.772 -24.060 2.402   1.00 12.56 ? 217 GLY A N   1 
ATOM   635  C  CA  . GLY A 1 78  ? -17.678 -24.974 2.664   1.00 11.49 ? 217 GLY A CA  1 
ATOM   636  C  C   . GLY A 1 78  ? -16.355 -24.345 3.055   1.00 13.33 ? 217 GLY A C   1 
ATOM   637  O  O   . GLY A 1 78  ? -15.368 -25.047 3.193   1.00 14.30 ? 217 GLY A O   1 
ATOM   638  N  N   . ARG A 1 79  ? -16.331 -23.026 3.230   1.00 12.06 ? 218 ARG A N   1 
ATOM   639  C  CA  . ARG A 1 79  ? -15.079 -22.346 3.532   1.00 9.83  ? 218 ARG A CA  1 
ATOM   640  C  C   . ARG A 1 79  ? -15.252 -21.390 4.708   1.00 13.59 ? 218 ARG A C   1 
ATOM   641  O  O   . ARG A 1 79  ? -15.440 -20.185 4.519   1.00 15.48 ? 218 ARG A O   1 
ATOM   642  C  CB  . ARG A 1 79  ? -14.558 -21.617 2.283   1.00 12.07 ? 218 ARG A CB  1 
ATOM   643  C  CG  . ARG A 1 79  ? -14.192 -22.579 1.133   1.00 13.63 ? 218 ARG A CG  1 
ATOM   644  C  CD  . ARG A 1 79  ? -13.341 -21.901 0.046   1.00 13.47 ? 218 ARG A CD  1 
ATOM   645  N  NE  . ARG A 1 79  ? -14.086 -20.826 -0.597  1.00 12.25 ? 218 ARG A NE  1 
ATOM   646  C  CZ  . ARG A 1 79  ? -13.531 -19.809 -1.255  1.00 13.63 ? 218 ARG A CZ  1 
ATOM   647  N  NH1 . ARG A 1 79  ? -14.300 -18.871 -1.794  1.00 13.13 ? 218 ARG A NH1 1 
ATOM   648  N  NH2 . ARG A 1 79  ? -12.213 -19.734 -1.394  1.00 14.60 ? 218 ARG A NH2 1 
ATOM   649  N  N   . GLU A 1 80  ? -15.192 -21.942 5.920   1.00 13.21 ? 219 GLU A N   1 
ATOM   650  C  CA  . GLU A 1 80  ? -15.430 -21.149 7.125   1.00 12.79 ? 219 GLU A CA  1 
ATOM   651  C  C   . GLU A 1 80  ? -14.211 -21.210 8.031   1.00 12.88 ? 219 GLU A C   1 
ATOM   652  O  O   . GLU A 1 80  ? -13.517 -22.229 8.094   1.00 14.28 ? 219 GLU A O   1 
ATOM   653  C  CB  . GLU A 1 80  ? -16.688 -21.639 7.854   1.00 15.04 ? 219 GLU A CB  1 
ATOM   654  C  CG  . GLU A 1 80  ? -17.896 -21.613 6.943   1.00 16.81 ? 219 GLU A CG  1 
ATOM   655  C  CD  . GLU A 1 80  ? -19.199 -21.869 7.668   1.00 31.60 ? 219 GLU A CD  1 
ATOM   656  O  OE1 . GLU A 1 80  ? -19.525 -21.105 8.594   1.00 37.72 ? 219 GLU A OE1 1 
ATOM   657  O  OE2 . GLU A 1 80  ? -19.906 -22.823 7.296   1.00 36.89 ? 219 GLU A OE2 1 
ATOM   658  N  N   . TYR A 1 81  ? -13.958 -20.099 8.716   1.00 10.66 ? 220 TYR A N   1 
ATOM   659  C  CA  . TYR A 1 81  ? -12.705 -19.873 9.440   1.00 11.10 ? 220 TYR A CA  1 
ATOM   660  C  C   . TYR A 1 81  ? -12.924 -19.152 10.753  1.00 12.10 ? 220 TYR A C   1 
ATOM   661  O  O   . TYR A 1 81  ? -13.976 -18.552 10.958  1.00 14.76 ? 220 TYR A O   1 
ATOM   662  C  CB  . TYR A 1 81  ? -11.750 -19.042 8.577   1.00 10.60 ? 220 TYR A CB  1 
ATOM   663  C  CG  . TYR A 1 81  ? -11.349 -19.753 7.327   1.00 11.59 ? 220 TYR A CG  1 
ATOM   664  C  CD1 . TYR A 1 81  ? -12.101 -19.664 6.158   1.00 11.56 ? 220 TYR A CD1 1 
ATOM   665  C  CD2 . TYR A 1 81  ? -10.215 -20.550 7.337   1.00 14.96 ? 220 TYR A CD2 1 
ATOM   666  C  CE1 . TYR A 1 81  ? -11.701 -20.370 5.015   1.00 13.48 ? 220 TYR A CE1 1 
ATOM   667  C  CE2 . TYR A 1 81  ? -9.827  -21.236 6.245   1.00 16.10 ? 220 TYR A CE2 1 
ATOM   668  C  CZ  . TYR A 1 81  ? -10.553 -21.153 5.096   1.00 12.02 ? 220 TYR A CZ  1 
ATOM   669  O  OH  . TYR A 1 81  ? -10.074 -21.875 4.024   1.00 22.15 ? 220 TYR A OH  1 
ATOM   670  N  N   . ARG A 1 82  ? -11.907 -19.202 11.609  1.00 11.51 ? 221 ARG A N   1 
ATOM   671  C  CA  . ARG A 1 82  ? -11.877 -18.463 12.830  1.00 12.61 ? 221 ARG A CA  1 
ATOM   672  C  C   . ARG A 1 82  ? -10.586 -17.611 12.882  1.00 10.75 ? 221 ARG A C   1 
ATOM   673  O  O   . ARG A 1 82  ? -9.591  -18.103 12.611  1.00 11.37 ? 221 ARG A O   1 
ATOM   674  C  CB  . ARG A 1 82  ? -11.852 -19.422 14.003  1.00 19.24 ? 221 ARG A CB  1 
ATOM   675  C  CG  . ARG A 1 82  ? -12.534 -18.820 15.160  1.00 24.79 ? 221 ARG A CG  1 
ATOM   676  C  CD  . ARG A 1 82  ? -12.371 -19.573 16.474  1.00 32.67 ? 221 ARG A CD  1 
ATOM   677  N  NE  . ARG A 1 82  ? -11.345 -19.028 17.357  1.00 31.13 ? 221 ARG A NE  1 
ATOM   678  C  CZ  . ARG A 1 82  ? -10.165 -19.588 17.510  1.00 26.91 ? 221 ARG A CZ  1 
ATOM   679  N  NH1 . ARG A 1 82  ? -9.866  -20.706 16.828  1.00 22.76 ? 221 ARG A NH1 1 
ATOM   680  N  NH2 . ARG A 1 82  ? -9.295  -19.040 18.351  1.00 26.30 ? 221 ARG A NH2 1 
ATOM   681  N  N   . ALA A 1 83  ? -10.691 -16.348 13.267  1.00 10.16 ? 222 ALA A N   1 
ATOM   682  C  CA  . ALA A 1 83  ? -9.503  -15.493 13.279  1.00 9.51  ? 222 ALA A CA  1 
ATOM   683  C  C   . ALA A 1 83  ? -8.613  -15.790 14.481  1.00 11.98 ? 222 ALA A C   1 
ATOM   684  O  O   . ALA A 1 83  ? -9.108  -15.993 15.592  1.00 13.63 ? 222 ALA A O   1 
ATOM   685  C  CB  . ALA A 1 83  ? -9.906  -14.034 13.273  1.00 11.53 ? 222 ALA A CB  1 
ATOM   686  N  N   . LEU A 1 84  ? -7.304  -15.806 14.248  1.00 8.30  ? 223 LEU A N   1 
ATOM   687  C  CA  . LEU A 1 84  ? -6.315  -16.088 15.291  1.00 10.04 ? 223 LEU A CA  1 
ATOM   688  C  C   . LEU A 1 84  ? -5.568  -14.840 15.755  1.00 11.05 ? 223 LEU A C   1 
ATOM   689  O  O   . LEU A 1 84  ? -5.359  -14.635 16.954  1.00 11.22 ? 223 LEU A O   1 
ATOM   690  C  CB  . LEU A 1 84  ? -5.276  -17.089 14.780  1.00 12.14 ? 223 LEU A CB  1 
ATOM   691  C  CG  . LEU A 1 84  ? -5.781  -18.427 14.261  1.00 14.10 ? 223 LEU A CG  1 
ATOM   692  C  CD1 . LEU A 1 84  ? -4.637  -19.184 13.612  1.00 17.82 ? 223 LEU A CD1 1 
ATOM   693  C  CD2 . LEU A 1 84  ? -6.388  -19.220 15.401  1.00 18.94 ? 223 LEU A CD2 1 
ATOM   694  N  N   . GLN A 1 85  ? -5.128  -14.028 14.802  1.00 9.20  ? 224 GLN A N   1 
ATOM   695  C  CA  . GLN A 1 85  ? -4.231  -12.909 15.101  1.00 8.78  ? 224 GLN A CA  1 
ATOM   696  C  C   . GLN A 1 85  ? -4.184  -11.992 13.894  1.00 9.29  ? 224 GLN A C   1 
ATOM   697  O  O   . GLN A 1 85  ? -4.546  -12.409 12.789  1.00 10.35 ? 224 GLN A O   1 
ATOM   698  C  CB  . GLN A 1 85  ? -2.799  -13.393 15.420  1.00 9.18  ? 224 GLN A CB  1 
ATOM   699  C  CG  . GLN A 1 85  ? -2.224  -14.382 14.361  1.00 9.03  ? 224 GLN A CG  1 
ATOM   700  C  CD  . GLN A 1 85  ? -1.217  -13.762 13.394  1.00 9.37  ? 224 GLN A CD  1 
ATOM   701  O  OE1 . GLN A 1 85  ? -1.190  -12.550 13.195  1.00 9.91  ? 224 GLN A OE1 1 
ATOM   702  N  NE2 . GLN A 1 85  ? -0.373  -14.616 12.789  1.00 11.62 ? 224 GLN A NE2 1 
ATOM   703  N  N   . LEU A 1 86  ? -3.743  -10.753 14.099  1.00 8.94  ? 225 LEU A N   1 
ATOM   704  C  CA  . LEU A 1 86  ? -3.457  -9.884  12.963  1.00 7.42  ? 225 LEU A CA  1 
ATOM   705  C  C   . LEU A 1 86  ? -2.106  -9.232  13.179  1.00 9.22  ? 225 LEU A C   1 
ATOM   706  O  O   . LEU A 1 86  ? -1.617  -9.136  14.308  1.00 8.62  ? 225 LEU A O   1 
ATOM   707  C  CB  . LEU A 1 86  ? -4.572  -8.836  12.749  1.00 8.00  ? 225 LEU A CB  1 
ATOM   708  C  CG  . LEU A 1 86  ? -4.892  -7.804  13.842  1.00 8.21  ? 225 LEU A CG  1 
ATOM   709  C  CD1 . LEU A 1 86  ? -3.947  -6.623  13.793  1.00 9.66  ? 225 LEU A CD1 1 
ATOM   710  C  CD2 . LEU A 1 86  ? -6.343  -7.317  13.676  1.00 8.97  ? 225 LEU A CD2 1 
ATOM   711  N  N   . HIS A 1 87  ? -1.485  -8.817  12.088  1.00 7.06  ? 226 HIS A N   1 
ATOM   712  C  CA  . HIS A 1 87  ? -0.192  -8.140  12.167  1.00 6.82  ? 226 HIS A CA  1 
ATOM   713  C  C   . HIS A 1 87  ? -0.031  -7.298  10.916  1.00 7.66  ? 226 HIS A C   1 
ATOM   714  O  O   . HIS A 1 87  ? -0.902  -7.310  10.027  1.00 8.86  ? 226 HIS A O   1 
ATOM   715  C  CB  . HIS A 1 87  ? 0.960   -9.152  12.291  1.00 7.01  ? 226 HIS A CB  1 
ATOM   716  C  CG  . HIS A 1 87  ? 1.035   -10.082 11.120  1.00 7.14  ? 226 HIS A CG  1 
ATOM   717  N  ND1 . HIS A 1 87  ? 0.433   -11.320 11.116  1.00 8.05  ? 226 HIS A ND1 1 
ATOM   718  C  CD2 . HIS A 1 87  ? 1.571   -9.920  9.888   1.00 6.71  ? 226 HIS A CD2 1 
ATOM   719  C  CE1 . HIS A 1 87  ? 0.598   -11.885 9.930   1.00 8.58  ? 226 HIS A CE1 1 
ATOM   720  N  NE2 . HIS A 1 87  ? 1.295   -11.059 9.170   1.00 5.94  ? 226 HIS A NE2 1 
ATOM   721  N  N   . LEU A 1 88  ? 1.075   -6.566  10.834  1.00 7.86  ? 227 LEU A N   1 
ATOM   722  C  CA  . LEU A 1 88  ? 1.261   -5.589  9.765   1.00 8.70  ? 227 LEU A CA  1 
ATOM   723  C  C   . LEU A 1 88  ? 2.612   -5.721  9.056   1.00 8.24  ? 227 LEU A C   1 
ATOM   724  O  O   . LEU A 1 88  ? 3.574   -6.265  9.598   1.00 9.27  ? 227 LEU A O   1 
ATOM   725  C  CB  . LEU A 1 88  ? 1.112   -4.165  10.336  1.00 10.32 ? 227 LEU A CB  1 
ATOM   726  C  CG  . LEU A 1 88  ? -0.204  -3.884  11.081  1.00 11.40 ? 227 LEU A CG  1 
ATOM   727  C  CD1 . LEU A 1 88  ? -0.066  -2.701  12.058  1.00 16.33 ? 227 LEU A CD1 1 
ATOM   728  C  CD2 . LEU A 1 88  ? -1.278  -3.581  10.087  1.00 17.92 ? 227 LEU A CD2 1 
ATOM   729  N  N   . HIS A 1 89  ? 2.680   -5.194  7.839   1.00 7.34  ? 228 HIS A N   1 
ATOM   730  C  CA  . HIS A 1 89  ? 3.927   -5.122  7.083   1.00 8.10  ? 228 HIS A CA  1 
ATOM   731  C  C   . HIS A 1 89  ? 4.106   -3.704  6.582   1.00 9.19  ? 228 HIS A C   1 
ATOM   732  O  O   . HIS A 1 89  ? 3.148   -3.103  6.106   1.00 9.49  ? 228 HIS A O   1 
ATOM   733  C  CB  . HIS A 1 89  ? 3.914   -6.102  5.911   1.00 8.45  ? 228 HIS A CB  1 
ATOM   734  C  CG  . HIS A 1 89  ? 3.751   -7.529  6.331   1.00 7.71  ? 228 HIS A CG  1 
ATOM   735  N  ND1 . HIS A 1 89  ? 4.825   -8.339  6.645   1.00 9.13  ? 228 HIS A ND1 1 
ATOM   736  C  CD2 . HIS A 1 89  ? 2.644   -8.291  6.489   1.00 7.76  ? 228 HIS A CD2 1 
ATOM   737  C  CE1 . HIS A 1 89  ? 4.378   -9.537  6.990   1.00 7.98  ? 228 HIS A CE1 1 
ATOM   738  N  NE2 . HIS A 1 89  ? 3.060   -9.536  6.897   1.00 7.64  ? 228 HIS A NE2 1 
ATOM   739  N  N   . TRP A 1 90  ? 5.322   -3.168  6.690   1.00 8.40  ? 229 TRP A N   1 
ATOM   740  C  CA  . TRP A 1 90  ? 5.524   -1.756  6.388   1.00 9.99  ? 229 TRP A CA  1 
ATOM   741  C  C   . TRP A 1 90  ? 6.934   -1.491  5.880   1.00 10.02 ? 229 TRP A C   1 
ATOM   742  O  O   . TRP A 1 90  ? 7.776   -2.396  5.818   1.00 9.18  ? 229 TRP A O   1 
ATOM   743  C  CB  . TRP A 1 90  ? 5.231   -0.910  7.632   1.00 11.48 ? 229 TRP A CB  1 
ATOM   744  C  CG  . TRP A 1 90  ? 6.111   -1.253  8.819   1.00 9.87  ? 229 TRP A CG  1 
ATOM   745  C  CD1 . TRP A 1 90  ? 7.390   -0.811  9.050   1.00 12.19 ? 229 TRP A CD1 1 
ATOM   746  C  CD2 . TRP A 1 90  ? 5.775   -2.100  9.924   1.00 9.11  ? 229 TRP A CD2 1 
ATOM   747  N  NE1 . TRP A 1 90  ? 7.867   -1.335  10.232  1.00 9.83  ? 229 TRP A NE1 1 
ATOM   748  C  CE2 . TRP A 1 90  ? 6.893   -2.129  10.786  1.00 8.59  ? 229 TRP A CE2 1 
ATOM   749  C  CE3 . TRP A 1 90  ? 4.632   -2.839  10.272  1.00 10.27 ? 229 TRP A CE3 1 
ATOM   750  C  CZ2 . TRP A 1 90  ? 6.902   -2.866  11.965  1.00 9.28  ? 229 TRP A CZ2 1 
ATOM   751  C  CZ3 . TRP A 1 90  ? 4.647   -3.578  11.452  1.00 9.41  ? 229 TRP A CZ3 1 
ATOM   752  C  CH2 . TRP A 1 90  ? 5.778   -3.586  12.281  1.00 9.26  ? 229 TRP A CH2 1 
ATOM   753  N  N   . GLY A 1 91  ? 7.183   -0.235  5.518   1.00 11.95 ? 230 GLY A N   1 
ATOM   754  C  CA  . GLY A 1 91  ? 8.444   0.144   4.924   1.00 10.82 ? 230 GLY A CA  1 
ATOM   755  C  C   . GLY A 1 91  ? 9.331   0.933   5.863   1.00 13.26 ? 230 GLY A C   1 
ATOM   756  O  O   . GLY A 1 91  ? 9.753   0.446   6.901   1.00 11.79 ? 230 GLY A O   1 
ATOM   757  N  N   . ALA A 1 92  ? 9.619   2.168   5.471   1.00 13.35 ? 231 ALA A N   1 
ATOM   758  C  CA  . ALA A 1 92  ? 10.468  3.051   6.250   1.00 11.41 ? 231 ALA A CA  1 
ATOM   759  C  C   . ALA A 1 92  ? 10.125  4.473   5.836   1.00 18.96 ? 231 ALA A C   1 
ATOM   760  O  O   . ALA A 1 92  ? 9.171   4.687   5.090   1.00 17.89 ? 231 ALA A O   1 
ATOM   761  C  CB  . ALA A 1 92  ? 11.931  2.750   6.011   1.00 13.66 ? 231 ALA A CB  1 
ATOM   762  N  N   . ALA A 1 93  ? 10.831  5.453   6.380   1.00 19.31 ? 232 ALA A N   1 
ATOM   763  C  CA  . ALA A 1 93  ? 10.495  6.839   6.081   1.00 20.22 ? 232 ALA A CA  1 
ATOM   764  C  C   . ALA A 1 93  ? 10.561  7.053   4.569   1.00 20.18 ? 232 ALA A C   1 
ATOM   765  O  O   . ALA A 1 93  ? 11.610  6.860   3.961   1.00 25.06 ? 232 ALA A O   1 
ATOM   766  C  CB  . ALA A 1 93  ? 11.436  7.785   6.811   1.00 21.23 ? 232 ALA A CB  1 
ATOM   767  N  N   . GLY A 1 94  ? 9.417   7.371   3.967   1.00 21.84 ? 233 GLY A N   1 
ATOM   768  C  CA  . GLY A 1 94  ? 9.344   7.642   2.541   1.00 22.67 ? 233 GLY A CA  1 
ATOM   769  C  C   . GLY A 1 94  ? 9.294   6.426   1.634   1.00 23.55 ? 233 GLY A C   1 
ATOM   770  O  O   . GLY A 1 94  ? 9.136   6.561   0.426   1.00 24.04 ? 233 GLY A O   1 
ATOM   771  N  N   . ARG A 1 95  ? 9.470   5.238   2.201   1.00 16.27 ? 234 ARG A N   1 
ATOM   772  C  CA  . ARG A 1 95  ? 9.575   4.023   1.404   1.00 14.17 ? 234 ARG A CA  1 
ATOM   773  C  C   . ARG A 1 95  ? 8.421   3.055   1.694   1.00 11.37 ? 234 ARG A C   1 
ATOM   774  O  O   . ARG A 1 95  ? 8.104   2.798   2.856   1.00 13.37 ? 234 ARG A O   1 
ATOM   775  C  CB  A ARG A 1 95  ? 10.926  3.356   1.668   0.53 20.09 ? 234 ARG A CB  1 
ATOM   776  C  CB  B ARG A 1 95  ? 10.922  3.343   1.667   0.47 19.95 ? 234 ARG A CB  1 
ATOM   777  C  CG  A ARG A 1 95  ? 12.096  4.308   1.440   0.53 20.74 ? 234 ARG A CG  1 
ATOM   778  C  CG  B ARG A 1 95  ? 11.308  2.355   0.597   0.47 21.48 ? 234 ARG A CG  1 
ATOM   779  C  CD  A ARG A 1 95  ? 13.352  3.837   2.135   0.53 20.50 ? 234 ARG A CD  1 
ATOM   780  C  CD  B ARG A 1 95  ? 12.707  1.797   0.780   0.47 21.62 ? 234 ARG A CD  1 
ATOM   781  N  NE  A ARG A 1 95  ? 13.880  2.617   1.536   0.53 21.86 ? 234 ARG A NE  1 
ATOM   782  N  NE  B ARG A 1 95  ? 12.848  0.509   0.104   0.47 21.73 ? 234 ARG A NE  1 
ATOM   783  C  CZ  A ARG A 1 95  ? 14.866  1.901   2.061   0.53 19.55 ? 234 ARG A CZ  1 
ATOM   784  C  CZ  B ARG A 1 95  ? 13.932  -0.255  0.172   0.47 19.58 ? 234 ARG A CZ  1 
ATOM   785  N  NH1 A ARG A 1 95  ? 15.428  2.283   3.200   0.53 19.19 ? 234 ARG A NH1 1 
ATOM   786  N  NH1 B ARG A 1 95  ? 14.977  0.141   0.882   0.47 20.84 ? 234 ARG A NH1 1 
ATOM   787  N  NH2 A ARG A 1 95  ? 15.285  0.803   1.453   0.53 20.37 ? 234 ARG A NH2 1 
ATOM   788  N  NH2 B ARG A 1 95  ? 13.969  -1.413  -0.469  0.47 24.98 ? 234 ARG A NH2 1 
ATOM   789  N  N   . PRO A 1 96  ? 7.782   2.512   0.641   1.00 13.32 ? 235 PRO A N   1 
ATOM   790  C  CA  . PRO A 1 96  ? 6.615   1.654   0.867   1.00 13.88 ? 235 PRO A CA  1 
ATOM   791  C  C   . PRO A 1 96  ? 7.007   0.241   1.298   1.00 11.59 ? 235 PRO A C   1 
ATOM   792  O  O   . PRO A 1 96  ? 8.123   -0.202  1.033   1.00 15.33 ? 235 PRO A O   1 
ATOM   793  C  CB  . PRO A 1 96  ? 5.929   1.643   -0.501  1.00 14.14 ? 235 PRO A CB  1 
ATOM   794  C  CG  . PRO A 1 96  ? 7.062   1.760   -1.461  1.00 15.64 ? 235 PRO A CG  1 
ATOM   795  C  CD  . PRO A 1 96  ? 8.034   2.726   -0.795  1.00 16.38 ? 235 PRO A CD  1 
ATOM   796  N  N   . GLY A 1 97  ? 6.083   -0.469  1.944   1.00 10.20 ? 236 GLY A N   1 
ATOM   797  C  CA  . GLY A 1 97  ? 6.389   -1.807  2.437   1.00 9.05  ? 236 GLY A CA  1 
ATOM   798  C  C   . GLY A 1 97  ? 5.253   -2.817  2.429   1.00 10.05 ? 236 GLY A C   1 
ATOM   799  O  O   . GLY A 1 97  ? 5.285   -3.771  3.209   1.00 9.77  ? 236 GLY A O   1 
ATOM   800  N  N   . SER A 1 98  ? 4.259   -2.645  1.561   1.00 10.76 ? 237 SER A N   1 
ATOM   801  C  CA  . SER A 1 98  ? 3.246   -3.688  1.435   1.00 8.34  ? 237 SER A CA  1 
ATOM   802  C  C   . SER A 1 98  ? 3.902   -4.953  0.869   1.00 10.37 ? 237 SER A C   1 
ATOM   803  O  O   . SER A 1 98  ? 4.996   -4.907  0.296   1.00 10.18 ? 237 SER A O   1 
ATOM   804  C  CB  . SER A 1 98  ? 2.058   -3.235  0.553   1.00 9.80  ? 237 SER A CB  1 
ATOM   805  O  OG  . SER A 1 98  ? 2.426   -3.160  -0.824  1.00 10.35 ? 237 SER A OG  1 
ATOM   806  N  N   . GLU A 1 99  ? 3.253   -6.093  1.074   1.00 8.40  ? 238 GLU A N   1 
ATOM   807  C  CA  . GLU A 1 99  ? 3.750   -7.357  0.542   1.00 7.27  ? 238 GLU A CA  1 
ATOM   808  C  C   . GLU A 1 99  ? 3.220   -7.628  -0.857  1.00 8.72  ? 238 GLU A C   1 
ATOM   809  O  O   . GLU A 1 99  ? 3.986   -7.864  -1.797  1.00 10.37 ? 238 GLU A O   1 
ATOM   810  C  CB  . GLU A 1 99  ? 3.367   -8.501  1.481   1.00 9.10  ? 238 GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 99  ? 3.986   -8.346  2.879   1.00 8.60  ? 238 GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 99  ? 4.432   -9.673  3.466   1.00 11.05 ? 238 GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 99  ? 5.646   -9.882  3.612   1.00 10.74 ? 238 GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 99  ? 3.573   -10.515 3.784   1.00 9.19  ? 238 GLU A OE2 1 
ATOM   815  N  N   . HIS A 1 100 ? 1.901   -7.597  -1.004  1.00 8.99  ? 239 HIS A N   1 
ATOM   816  C  CA  . HIS A 1 100 ? 1.335   -7.707  -2.343  1.00 8.65  ? 239 HIS A CA  1 
ATOM   817  C  C   . HIS A 1 100 ? 1.570   -6.407  -3.103  1.00 10.46 ? 239 HIS A C   1 
ATOM   818  O  O   . HIS A 1 100 ? 1.759   -5.355  -2.490  1.00 10.30 ? 239 HIS A O   1 
ATOM   819  C  CB  . HIS A 1 100 ? -0.153  -8.054  -2.257  1.00 8.28  ? 239 HIS A CB  1 
ATOM   820  C  CG  . HIS A 1 100 ? -0.394  -9.453  -1.785  1.00 6.69  ? 239 HIS A CG  1 
ATOM   821  N  ND1 . HIS A 1 100 ? -0.434  -9.792  -0.447  1.00 9.00  ? 239 HIS A ND1 1 
ATOM   822  C  CD2 . HIS A 1 100 ? -0.559  -10.607 -2.473  1.00 7.49  ? 239 HIS A CD2 1 
ATOM   823  C  CE1 . HIS A 1 100 ? -0.629  -11.095 -0.336  1.00 8.66  ? 239 HIS A CE1 1 
ATOM   824  N  NE2 . HIS A 1 100 ? -0.705  -11.614 -1.550  1.00 9.66  ? 239 HIS A NE2 1 
ATOM   825  N  N   . THR A 1 101 ? 1.604   -6.495  -4.433  1.00 9.37  ? 240 THR A N   1 
ATOM   826  C  CA  . THR A 1 101 ? 1.699   -5.310  -5.281  1.00 10.04 ? 240 THR A CA  1 
ATOM   827  C  C   . THR A 1 101 ? 0.523   -5.344  -6.240  1.00 11.99 ? 240 THR A C   1 
ATOM   828  O  O   . THR A 1 101 ? -0.078  -6.395  -6.429  1.00 10.24 ? 240 THR A O   1 
ATOM   829  C  CB  . THR A 1 101 ? 3.045   -5.251  -6.055  1.00 7.38  ? 240 THR A CB  1 
ATOM   830  O  OG1 . THR A 1 101 ? 3.264   -6.474  -6.789  1.00 10.36 ? 240 THR A OG1 1 
ATOM   831  C  CG2 . THR A 1 101 ? 4.209   -5.049  -5.082  1.00 9.47  ? 240 THR A CG2 1 
ATOM   832  N  N   . VAL A 1 102 ? 0.184   -4.200  -6.829  1.00 8.85  ? 241 VAL A N   1 
ATOM   833  C  CA  . VAL A 1 102 ? -0.862  -4.179  -7.857  1.00 8.62  ? 241 VAL A CA  1 
ATOM   834  C  C   . VAL A 1 102 ? -0.260  -3.567  -9.109  1.00 9.20  ? 241 VAL A C   1 
ATOM   835  O  O   . VAL A 1 102 ? 0.178   -2.412  -9.080  1.00 12.04 ? 241 VAL A O   1 
ATOM   836  C  CB  . VAL A 1 102 ? -2.093  -3.386  -7.402  1.00 11.50 ? 241 VAL A CB  1 
ATOM   837  C  CG1 . VAL A 1 102 ? -3.107  -3.273  -8.555  1.00 12.28 ? 241 VAL A CG1 1 
ATOM   838  C  CG2 . VAL A 1 102 ? -2.724  -4.036  -6.166  1.00 12.66 ? 241 VAL A CG2 1 
ATOM   839  N  N   . GLU A 1 103 ? -0.248  -4.339  -10.203 1.00 11.03 ? 242 GLU A N   1 
ATOM   840  C  CA  . GLU A 1 103 ? 0.434   -3.964  -11.456 1.00 9.46  ? 242 GLU A CA  1 
ATOM   841  C  C   . GLU A 1 103 ? 1.860   -3.490  -11.182 1.00 12.37 ? 242 GLU A C   1 
ATOM   842  O  O   . GLU A 1 103 ? 2.356   -2.538  -11.800 1.00 13.31 ? 242 GLU A O   1 
ATOM   843  C  CB  . GLU A 1 103 ? -0.386  -2.909  -12.211 1.00 13.94 ? 242 GLU A CB  1 
ATOM   844  C  CG  . GLU A 1 103 ? -1.767  -3.463  -12.597 1.00 14.33 ? 242 GLU A CG  1 
ATOM   845  C  CD  . GLU A 1 103 ? -2.568  -2.557  -13.516 1.00 24.36 ? 242 GLU A CD  1 
ATOM   846  O  OE1 . GLU A 1 103 ? -3.529  -3.064  -14.127 1.00 16.95 ? 242 GLU A OE1 1 
ATOM   847  O  OE2 . GLU A 1 103 ? -2.252  -1.351  -13.630 1.00 22.24 ? 242 GLU A OE2 1 
ATOM   848  N  N   . GLY A 1 104 ? 2.518   -4.170  -10.244 1.00 9.45  ? 243 GLY A N   1 
ATOM   849  C  CA  . GLY A 1 104 ? 3.923   -3.914  -9.982  1.00 9.27  ? 243 GLY A CA  1 
ATOM   850  C  C   . GLY A 1 104 ? 4.195   -2.779  -9.008  1.00 9.67  ? 243 GLY A C   1 
ATOM   851  O  O   . GLY A 1 104 ? 5.355   -2.522  -8.674  1.00 10.01 ? 243 GLY A O   1 
ATOM   852  N  N   . HIS A 1 105 ? 3.139   -2.119  -8.537  1.00 10.97 ? 244 HIS A N   1 
ATOM   853  C  CA  . HIS A 1 105 ? 3.273   -0.980  -7.626  1.00 9.17  ? 244 HIS A CA  1 
ATOM   854  C  C   . HIS A 1 105 ? 3.097   -1.387  -6.168  1.00 10.84 ? 244 HIS A C   1 
ATOM   855  O  O   . HIS A 1 105 ? 2.197   -2.164  -5.826  1.00 10.23 ? 244 HIS A O   1 
ATOM   856  C  CB  . HIS A 1 105 ? 2.235   0.116   -7.950  1.00 9.54  ? 244 HIS A CB  1 
ATOM   857  C  CG  . HIS A 1 105 ? 2.402   0.747   -9.300  1.00 11.47 ? 244 HIS A CG  1 
ATOM   858  N  ND1 . HIS A 1 105 ? 3.333   1.736   -9.547  1.00 10.08 ? 244 HIS A ND1 1 
ATOM   859  C  CD2 . HIS A 1 105 ? 1.751   0.535   -10.471 1.00 13.35 ? 244 HIS A CD2 1 
ATOM   860  C  CE1 . HIS A 1 105 ? 3.239   2.115   -10.813 1.00 9.23  ? 244 HIS A CE1 1 
ATOM   861  N  NE2 . HIS A 1 105 ? 2.295   1.394   -11.398 1.00 10.34 ? 244 HIS A NE2 1 
ATOM   862  N  N   . ARG A 1 106 ? 3.927   -0.819  -5.299  1.00 11.30 ? 245 ARG A N   1 
ATOM   863  C  CA  . ARG A 1 106 ? 3.906   -1.167  -3.879  1.00 10.60 ? 245 ARG A CA  1 
ATOM   864  C  C   . ARG A 1 106 ? 3.207   -0.081  -3.072  1.00 12.57 ? 245 ARG A C   1 
ATOM   865  O  O   . ARG A 1 106 ? 3.355   1.108   -3.357  1.00 13.87 ? 245 ARG A O   1 
ATOM   866  C  CB  . ARG A 1 106 ? 5.339   -1.390  -3.367  1.00 9.73  ? 245 ARG A CB  1 
ATOM   867  C  CG  . ARG A 1 106 ? 5.387   -2.056  -1.991  1.00 10.29 ? 245 ARG A CG  1 
ATOM   868  C  CD  . ARG A 1 106 ? 6.809   -2.297  -1.516  1.00 14.45 ? 245 ARG A CD  1 
ATOM   869  N  NE  . ARG A 1 106 ? 7.613   -3.047  -2.482  1.00 14.68 ? 245 ARG A NE  1 
ATOM   870  C  CZ  . ARG A 1 106 ? 7.554   -4.364  -2.658  1.00 15.34 ? 245 ARG A CZ  1 
ATOM   871  N  NH1 . ARG A 1 106 ? 6.713   -5.107  -1.953  1.00 12.88 ? 245 ARG A NH1 1 
ATOM   872  N  NH2 . ARG A 1 106 ? 8.337   -4.948  -3.556  1.00 19.04 ? 245 ARG A NH2 1 
ATOM   873  N  N   . PHE A 1 107 ? 2.426   -0.498  -2.073  1.00 9.98  ? 246 PHE A N   1 
ATOM   874  C  CA  . PHE A 1 107 ? 1.654   0.405   -1.228  1.00 8.89  ? 246 PHE A CA  1 
ATOM   875  C  C   . PHE A 1 107 ? 2.402   0.668   0.084   1.00 10.47 ? 246 PHE A C   1 
ATOM   876  O  O   . PHE A 1 107 ? 3.309   -0.090  0.427   1.00 10.27 ? 246 PHE A O   1 
ATOM   877  C  CB  . PHE A 1 107 ? 0.266   -0.187  -0.932  1.00 10.37 ? 246 PHE A CB  1 
ATOM   878  C  CG  . PHE A 1 107 ? -0.627  -0.275  -2.131  1.00 11.51 ? 246 PHE A CG  1 
ATOM   879  C  CD1 . PHE A 1 107 ? -0.445  -1.279  -3.069  1.00 14.70 ? 246 PHE A CD1 1 
ATOM   880  C  CD2 . PHE A 1 107 ? -1.639  0.651   -2.320  1.00 18.40 ? 246 PHE A CD2 1 
ATOM   881  C  CE1 . PHE A 1 107 ? -1.272  -1.362  -4.186  1.00 19.15 ? 246 PHE A CE1 1 
ATOM   882  C  CE2 . PHE A 1 107 ? -2.471  0.575   -3.431  1.00 18.69 ? 246 PHE A CE2 1 
ATOM   883  C  CZ  . PHE A 1 107 ? -2.281  -0.429  -4.362  1.00 18.81 ? 246 PHE A CZ  1 
ATOM   884  N  N   . PRO A 1 108 ? 2.042   1.739   0.819   1.00 11.00 ? 247 PRO A N   1 
ATOM   885  C  CA  . PRO A 1 108 ? 2.791   2.029   2.054   1.00 9.82  ? 247 PRO A CA  1 
ATOM   886  C  C   . PRO A 1 108 ? 2.871   0.875   3.070   1.00 10.70 ? 247 PRO A C   1 
ATOM   887  O  O   . PRO A 1 108 ? 3.959   0.605   3.602   1.00 11.10 ? 247 PRO A O   1 
ATOM   888  C  CB  . PRO A 1 108 ? 2.022   3.211   2.646   1.00 12.37 ? 247 PRO A CB  1 
ATOM   889  C  CG  . PRO A 1 108 ? 1.540   3.946   1.404   1.00 12.55 ? 247 PRO A CG  1 
ATOM   890  C  CD  . PRO A 1 108 ? 1.128   2.844   0.462   1.00 11.81 ? 247 PRO A CD  1 
ATOM   891  N  N   . ALA A 1 109 ? 1.754   0.198   3.323   1.00 10.12 ? 248 ALA A N   1 
ATOM   892  C  CA  . ALA A 1 109 ? 1.757   -0.900  4.285   1.00 10.45 ? 248 ALA A CA  1 
ATOM   893  C  C   . ALA A 1 109 ? 0.624   -1.872  3.990   1.00 11.34 ? 248 ALA A C   1 
ATOM   894  O  O   . ALA A 1 109 ? -0.131  -1.680  3.035   1.00 10.23 ? 248 ALA A O   1 
ATOM   895  C  CB  . ALA A 1 109 ? 1.654   -0.356  5.721   1.00 11.04 ? 248 ALA A CB  1 
ATOM   896  N  N   . GLU A 1 110 ? 0.516   -2.916  4.802   1.00 9.24  ? 249 GLU A N   1 
ATOM   897  C  CA  . GLU A 1 110 ? -0.456  -3.976  4.550   1.00 8.29  ? 249 GLU A CA  1 
ATOM   898  C  C   . GLU A 1 110 ? -0.812  -4.647  5.870   1.00 9.98  ? 249 GLU A C   1 
ATOM   899  O  O   . GLU A 1 110 ? 0.048   -4.893  6.710   1.00 9.52  ? 249 GLU A O   1 
ATOM   900  C  CB  . GLU A 1 110 ? 0.121   -4.995  3.547   1.00 9.36  ? 249 GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 110 ? -0.824  -6.119  3.125   1.00 9.03  ? 249 GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 110 ? -0.290  -6.933  1.955   1.00 8.68  ? 249 GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 110 ? 0.452   -6.372  1.123   1.00 9.22  ? 249 GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 110 ? -0.632  -8.133  1.838   1.00 8.79  ? 249 GLU A OE2 1 
ATOM   905  N  N   . ILE A 1 111 ? -2.098  -4.908  6.064   1.00 8.30  ? 250 ILE A N   1 
ATOM   906  C  CA  . ILE A 1 111 ? -2.557  -5.652  7.231   1.00 6.08  ? 250 ILE A CA  1 
ATOM   907  C  C   . ILE A 1 111 ? -2.958  -7.070  6.850   1.00 8.12  ? 250 ILE A C   1 
ATOM   908  O  O   . ILE A 1 111 ? -3.590  -7.300  5.808   1.00 8.08  ? 250 ILE A O   1 
ATOM   909  C  CB  . ILE A 1 111 ? -3.766  -4.944  7.936   1.00 9.75  ? 250 ILE A CB  1 
ATOM   910  C  CG1 . ILE A 1 111 ? -4.196  -5.736  9.178   1.00 9.49  ? 250 ILE A CG1 1 
ATOM   911  C  CG2 . ILE A 1 111 ? -4.953  -4.720  6.955   1.00 10.49 ? 250 ILE A CG2 1 
ATOM   912  C  CD1 . ILE A 1 111 ? -5.138  -4.996  10.111  1.00 12.55 ? 250 ILE A CD1 1 
ATOM   913  N  N   . HIS A 1 112 ? -2.591  -8.021  7.713   1.00 7.60  ? 251 HIS A N   1 
ATOM   914  C  CA  . HIS A 1 112 ? -2.968  -9.430  7.565   1.00 6.13  ? 251 HIS A CA  1 
ATOM   915  C  C   . HIS A 1 112 ? -3.754  -9.915  8.763   1.00 8.11  ? 251 HIS A C   1 
ATOM   916  O  O   . HIS A 1 112 ? -3.282  -9.778  9.889   1.00 9.42  ? 251 HIS A O   1 
ATOM   917  C  CB  . HIS A 1 112 ? -1.724  -10.309 7.431   1.00 9.27  ? 251 HIS A CB  1 
ATOM   918  C  CG  . HIS A 1 112 ? -0.987  -10.105 6.152   1.00 6.41  ? 251 HIS A CG  1 
ATOM   919  N  ND1 . HIS A 1 112 ? 0.299   -10.562 5.947   1.00 7.05  ? 251 HIS A ND1 1 
ATOM   920  C  CD2 . HIS A 1 112 ? -1.362  -9.492  5.006   1.00 6.07  ? 251 HIS A CD2 1 
ATOM   921  C  CE1 . HIS A 1 112 ? 0.682   -10.242 4.724   1.00 7.70  ? 251 HIS A CE1 1 
ATOM   922  N  NE2 . HIS A 1 112 ? -0.304  -9.589  4.131   1.00 8.03  ? 251 HIS A NE2 1 
ATOM   923  N  N   . VAL A 1 113 ? -4.928  -10.496 8.529   1.00 8.15  ? 252 VAL A N   1 
ATOM   924  C  CA  . VAL A 1 113 ? -5.683  -11.155 9.594   1.00 8.78  ? 252 VAL A CA  1 
ATOM   925  C  C   . VAL A 1 113 ? -5.667  -12.643 9.275   1.00 9.44  ? 252 VAL A C   1 
ATOM   926  O  O   . VAL A 1 113 ? -6.222  -13.067 8.250   1.00 8.21  ? 252 VAL A O   1 
ATOM   927  C  CB  . VAL A 1 113 ? -7.142  -10.639 9.700   1.00 9.06  ? 252 VAL A CB  1 
ATOM   928  C  CG1 . VAL A 1 113 ? -7.835  -11.228 10.939  1.00 8.64  ? 252 VAL A CG1 1 
ATOM   929  C  CG2 . VAL A 1 113 ? -7.180  -9.097  9.717   1.00 11.11 ? 252 VAL A CG2 1 
ATOM   930  N  N   . VAL A 1 114 ? -5.004  -13.427 10.129  1.00 9.00  ? 253 VAL A N   1 
ATOM   931  C  CA  . VAL A 1 114 ? -4.758  -14.854 9.876   1.00 8.55  ? 253 VAL A CA  1 
ATOM   932  C  C   . VAL A 1 114 ? -5.835  -15.702 10.529  1.00 9.07  ? 253 VAL A C   1 
ATOM   933  O  O   . VAL A 1 114 ? -6.144  -15.500 11.708  1.00 9.37  ? 253 VAL A O   1 
ATOM   934  C  CB  . VAL A 1 114 ? -3.360  -15.268 10.403  1.00 7.91  ? 253 VAL A CB  1 
ATOM   935  C  CG1 . VAL A 1 114 ? -3.047  -16.726 10.095  1.00 11.38 ? 253 VAL A CG1 1 
ATOM   936  C  CG2 . VAL A 1 114 ? -2.304  -14.360 9.782   1.00 7.92  ? 253 VAL A CG2 1 
ATOM   937  N  N   . HIS A 1 115 ? -6.382  -16.648 9.762   1.00 8.59  ? 254 HIS A N   1 
ATOM   938  C  CA  . HIS A 1 115 ? -7.508  -17.480 10.203  1.00 8.06  ? 254 HIS A CA  1 
ATOM   939  C  C   . HIS A 1 115 ? -7.203  -18.975 10.099  1.00 13.07 ? 254 HIS A C   1 
ATOM   940  O  O   . HIS A 1 115 ? -6.453  -19.413 9.225   1.00 11.23 ? 254 HIS A O   1 
ATOM   941  C  CB  . HIS A 1 115 ? -8.770  -17.221 9.368   1.00 7.80  ? 254 HIS A CB  1 
ATOM   942  C  CG  . HIS A 1 115 ? -9.301  -15.819 9.420   1.00 9.10  ? 254 HIS A CG  1 
ATOM   943  N  ND1 . HIS A 1 115 ? -8.662  -14.746 8.837   1.00 10.73 ? 254 HIS A ND1 1 
ATOM   944  C  CD2 . HIS A 1 115 ? -10.460 -15.336 9.929   1.00 9.89  ? 254 HIS A CD2 1 
ATOM   945  C  CE1 . HIS A 1 115 ? -9.397  -13.657 9.006   1.00 11.30 ? 254 HIS A CE1 1 
ATOM   946  N  NE2 . HIS A 1 115 ? -10.492 -13.990 9.667   1.00 10.94 ? 254 HIS A NE2 1 
ATOM   947  N  N   . LEU A 1 116 ? -7.863  -19.749 10.955  1.00 10.74 ? 255 LEU A N   1 
ATOM   948  C  CA  . LEU A 1 116 ? -7.793  -21.217 10.956  1.00 11.00 ? 255 LEU A CA  1 
ATOM   949  C  C   . LEU A 1 116 ? -9.110  -21.824 10.495  1.00 12.18 ? 255 LEU A C   1 
ATOM   950  O  O   . LEU A 1 116 ? -10.166 -21.450 10.985  1.00 13.85 ? 255 LEU A O   1 
ATOM   951  C  CB  . LEU A 1 116 ? -7.461  -21.722 12.365  1.00 11.95 ? 255 LEU A CB  1 
ATOM   952  C  CG  . LEU A 1 116 ? -7.492  -23.232 12.583  1.00 13.11 ? 255 LEU A CG  1 
ATOM   953  C  CD1 . LEU A 1 116 ? -6.438  -23.916 11.738  1.00 15.06 ? 255 LEU A CD1 1 
ATOM   954  C  CD2 . LEU A 1 116 ? -7.271  -23.537 14.059  1.00 16.48 ? 255 LEU A CD2 1 
ATOM   955  N  N   . SER A 1 117 ? -9.050  -22.760 9.549   1.00 10.31 ? 256 SER A N   1 
ATOM   956  C  CA  . SER A 1 117 ? -10.254 -23.443 9.091   1.00 10.51 ? 256 SER A CA  1 
ATOM   957  C  C   . SER A 1 117 ? -10.984 -24.137 10.239  1.00 13.02 ? 256 SER A C   1 
ATOM   958  O  O   . SER A 1 117 ? -10.339 -24.732 11.101  1.00 14.43 ? 256 SER A O   1 
ATOM   959  C  CB  . SER A 1 117 ? -9.900  -24.471 8.027   1.00 13.86 ? 256 SER A CB  1 
ATOM   960  O  OG  . SER A 1 117 ? -11.037 -25.244 7.712   1.00 16.62 ? 256 SER A OG  1 
ATOM   961  N  N   . THR A 1 118 ? -12.314 -24.070 10.234  1.00 15.23 ? 257 THR A N   1 
ATOM   962  C  CA  . THR A 1 118 ? -13.112 -24.750 11.254  1.00 19.77 ? 257 THR A CA  1 
ATOM   963  C  C   . THR A 1 118 ? -12.967 -26.264 11.145  1.00 23.45 ? 257 THR A C   1 
ATOM   964  O  O   . THR A 1 118 ? -13.394 -26.988 12.035  1.00 23.19 ? 257 THR A O   1 
ATOM   965  C  CB  . THR A 1 118 ? -14.620 -24.385 11.163  1.00 21.11 ? 257 THR A CB  1 
ATOM   966  O  OG1 . THR A 1 118 ? -15.132 -24.743 9.878   1.00 23.13 ? 257 THR A OG1 1 
ATOM   967  C  CG2 . THR A 1 118 ? -14.834 -22.899 11.386  1.00 28.70 ? 257 THR A CG2 1 
ATOM   968  N  N   . LYS A 1 119 ? -12.339 -26.739 10.076  1.00 21.05 ? 258 LYS A N   1 
ATOM   969  C  CA  . LYS A 1 119 ? -12.119 -28.173 9.903   1.00 21.88 ? 258 LYS A CA  1 
ATOM   970  C  C   . LYS A 1 119 ? -10.945 -28.677 10.735  1.00 29.69 ? 258 LYS A C   1 
ATOM   971  O  O   . LYS A 1 119 ? -10.749 -29.886 10.849  1.00 28.59 ? 258 LYS A O   1 
ATOM   972  C  CB  . LYS A 1 119 ? -11.864 -28.509 8.430   1.00 25.31 ? 258 LYS A CB  1 
ATOM   973  C  CG  . LYS A 1 119 ? -13.012 -28.170 7.479   1.00 34.72 ? 258 LYS A CG  1 
ATOM   974  C  CD  . LYS A 1 119 ? -12.575 -28.362 6.022   1.00 48.64 ? 258 LYS A CD  1 
ATOM   975  C  CE  . LYS A 1 119 ? -13.549 -27.750 5.014   1.00 52.09 ? 258 LYS A CE  1 
ATOM   976  N  NZ  . LYS A 1 119 ? -14.089 -26.419 5.421   1.00 52.63 ? 258 LYS A NZ  1 
ATOM   977  N  N   . TYR A 1 120 ? -10.162 -27.761 11.306  1.00 22.14 ? 259 TYR A N   1 
ATOM   978  C  CA  . TYR A 1 120 ? -8.973  -28.150 12.063  1.00 23.24 ? 259 TYR A CA  1 
ATOM   979  C  C   . TYR A 1 120 ? -8.979  -27.519 13.448  1.00 27.25 ? 259 TYR A C   1 
ATOM   980  O  O   . TYR A 1 120 ? -9.328  -26.354 13.609  1.00 27.31 ? 259 TYR A O   1 
ATOM   981  C  CB  . TYR A 1 120 ? -7.691  -27.756 11.315  1.00 20.63 ? 259 TYR A CB  1 
ATOM   982  C  CG  . TYR A 1 120 ? -7.531  -28.457 9.983   1.00 24.01 ? 259 TYR A CG  1 
ATOM   983  C  CD1 . TYR A 1 120 ? -7.021  -29.748 9.906   1.00 26.93 ? 259 TYR A CD1 1 
ATOM   984  C  CD2 . TYR A 1 120 ? -7.862  -27.816 8.798   1.00 19.02 ? 259 TYR A CD2 1 
ATOM   985  C  CE1 . TYR A 1 120 ? -6.872  -30.387 8.690   1.00 27.04 ? 259 TYR A CE1 1 
ATOM   986  C  CE2 . TYR A 1 120 ? -7.715  -28.446 7.577   1.00 26.26 ? 259 TYR A CE2 1 
ATOM   987  C  CZ  . TYR A 1 120 ? -7.223  -29.732 7.527   1.00 30.17 ? 259 TYR A CZ  1 
ATOM   988  O  OH  . TYR A 1 120 ? -7.079  -30.354 6.309   1.00 34.22 ? 259 TYR A OH  1 
ATOM   989  N  N   . ALA A 1 121 ? -8.573  -28.293 14.449  1.00 35.39 ? 260 ALA A N   1 
ATOM   990  C  CA  . ALA A 1 121 ? -8.602  -27.827 15.827  1.00 33.79 ? 260 ALA A CA  1 
ATOM   991  C  C   . ALA A 1 121 ? -7.413  -26.925 16.138  1.00 27.75 ? 260 ALA A C   1 
ATOM   992  O  O   . ALA A 1 121 ? -7.521  -26.001 16.935  1.00 30.09 ? 260 ALA A O   1 
ATOM   993  C  CB  . ALA A 1 121 ? -8.629  -29.012 16.780  1.00 34.42 ? 260 ALA A CB  1 
ATOM   994  N  N   . ARG A 1 122 ? -6.274  -27.208 15.510  1.00 25.97 ? 261 ARG A N   1 
ATOM   995  C  CA  . ARG A 1 122 ? -5.040  -26.473 15.778  1.00 25.93 ? 261 ARG A CA  1 
ATOM   996  C  C   . ARG A 1 122 ? -4.286  -26.120 14.496  1.00 23.13 ? 261 ARG A C   1 
ATOM   997  O  O   . ARG A 1 122 ? -4.410  -26.815 13.490  1.00 21.11 ? 261 ARG A O   1 
ATOM   998  C  CB  . ARG A 1 122 ? -4.145  -27.293 16.710  1.00 35.06 ? 261 ARG A CB  1 
ATOM   999  C  CG  . ARG A 1 122 ? -4.828  -27.671 18.020  1.00 45.98 ? 261 ARG A CG  1 
ATOM   1000 C  CD  . ARG A 1 122 ? -4.311  -28.986 18.566  1.00 53.87 ? 261 ARG A CD  1 
ATOM   1001 N  NE  . ARG A 1 122 ? -2.937  -28.875 19.032  1.00 56.17 ? 261 ARG A NE  1 
ATOM   1002 C  CZ  . ARG A 1 122 ? -1.937  -29.593 18.539  1.00 54.92 ? 261 ARG A CZ  1 
ATOM   1003 N  NH1 . ARG A 1 122 ? -2.172  -30.467 17.568  1.00 53.40 ? 261 ARG A NH1 1 
ATOM   1004 N  NH2 . ARG A 1 122 ? -0.709  -29.437 19.015  1.00 55.09 ? 261 ARG A NH2 1 
ATOM   1005 N  N   . VAL A 1 123 ? -3.502  -25.044 14.549  1.00 20.18 ? 262 VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 123 ? -2.706  -24.596 13.402  1.00 21.52 ? 262 VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 123 ? -1.781  -25.687 12.872  1.00 20.08 ? 262 VAL A C   1 
ATOM   1008 O  O   . VAL A 1 123 ? -1.660  -25.866 11.667  1.00 20.14 ? 262 VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 123 ? -1.859  -23.352 13.761  1.00 21.68 ? 262 VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 123 ? -0.839  -23.039 12.679  1.00 22.76 ? 262 VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 123 ? -2.760  -22.159 13.990  1.00 23.07 ? 262 VAL A CG2 1 
ATOM   1012 N  N   . ASP A 1 124 ? -1.132  -26.435 13.760  1.00 22.45 ? 263 ASP A N   1 
ATOM   1013 C  CA  . ASP A 1 124 ? -0.148  -27.396 13.275  1.00 23.85 ? 263 ASP A CA  1 
ATOM   1014 C  C   . ASP A 1 124 ? -0.804  -28.552 12.507  1.00 27.92 ? 263 ASP A C   1 
ATOM   1015 O  O   . ASP A 1 124 ? -0.150  -29.201 11.689  1.00 30.76 ? 263 ASP A O   1 
ATOM   1016 C  CB  . ASP A 1 124 ? 0.732   -27.915 14.426  1.00 33.64 ? 263 ASP A CB  1 
ATOM   1017 C  CG  . ASP A 1 124 ? -0.059  -28.509 15.568  1.00 45.46 ? 263 ASP A CG  1 
ATOM   1018 O  OD1 . ASP A 1 124 ? -1.274  -28.754 15.418  1.00 50.31 ? 263 ASP A OD1 1 
ATOM   1019 O  OD2 . ASP A 1 124 ? 0.555   -28.734 16.635  1.00 50.26 ? 263 ASP A OD2 1 
ATOM   1020 N  N   . GLU A 1 125 ? -2.101  -28.766 12.721  1.00 25.03 ? 264 GLU A N   1 
ATOM   1021 C  CA  . GLU A 1 125 ? -2.854  -29.746 11.942  1.00 24.92 ? 264 GLU A CA  1 
ATOM   1022 C  C   . GLU A 1 125 ? -3.184  -29.186 10.562  1.00 25.36 ? 264 GLU A C   1 
ATOM   1023 O  O   . GLU A 1 125 ? -3.302  -29.927 9.584   1.00 27.65 ? 264 GLU A O   1 
ATOM   1024 C  CB  . GLU A 1 125 ? -4.151  -30.139 12.654  1.00 29.18 ? 264 GLU A CB  1 
ATOM   1025 C  CG  . GLU A 1 125 ? -3.967  -30.882 13.963  1.00 41.46 ? 264 GLU A CG  1 
ATOM   1026 C  CD  . GLU A 1 125 ? -5.280  -31.089 14.698  1.00 54.82 ? 264 GLU A CD  1 
ATOM   1027 O  OE1 . GLU A 1 125 ? -6.220  -30.291 14.482  1.00 54.55 ? 264 GLU A OE1 1 
ATOM   1028 O  OE2 . GLU A 1 125 ? -5.373  -32.055 15.487  1.00 60.23 ? 264 GLU A OE2 1 
ATOM   1029 N  N   . ALA A 1 126 ? -3.337  -27.868 10.496  1.00 20.34 ? 265 ALA A N   1 
ATOM   1030 C  CA  . ALA A 1 126 ? -3.766  -27.197 9.267   1.00 20.20 ? 265 ALA A CA  1 
ATOM   1031 C  C   . ALA A 1 126 ? -2.616  -26.838 8.329   1.00 20.15 ? 265 ALA A C   1 
ATOM   1032 O  O   . ALA A 1 126 ? -2.825  -26.653 7.126   1.00 17.87 ? 265 ALA A O   1 
ATOM   1033 C  CB  . ALA A 1 126 ? -4.547  -25.942 9.618   1.00 20.95 ? 265 ALA A CB  1 
ATOM   1034 N  N   . LEU A 1 127 ? -1.408  -26.730 8.877   1.00 18.94 ? 266 LEU A N   1 
ATOM   1035 C  CA  . LEU A 1 127 ? -0.249  -26.302 8.094   1.00 18.23 ? 266 LEU A CA  1 
ATOM   1036 C  C   . LEU A 1 127 ? -0.027  -27.146 6.854   1.00 20.96 ? 266 LEU A C   1 
ATOM   1037 O  O   . LEU A 1 127 ? 0.058   -28.375 6.933   1.00 24.74 ? 266 LEU A O   1 
ATOM   1038 C  CB  . LEU A 1 127 ? 1.025   -26.334 8.942   1.00 20.48 ? 266 LEU A CB  1 
ATOM   1039 C  CG  . LEU A 1 127 ? 1.272   -25.131 9.834   1.00 24.74 ? 266 LEU A CG  1 
ATOM   1040 C  CD1 . LEU A 1 127 ? 2.477   -25.397 10.731  1.00 30.84 ? 266 LEU A CD1 1 
ATOM   1041 C  CD2 . LEU A 1 127 ? 1.493   -23.879 8.995   1.00 18.36 ? 266 LEU A CD2 1 
ATOM   1042 N  N   . GLY A 1 128 ? 0.052   -26.480 5.708   1.00 19.91 ? 267 GLY A N   1 
ATOM   1043 C  CA  . GLY A 1 128 ? 0.335   -27.147 4.456   1.00 20.53 ? 267 GLY A CA  1 
ATOM   1044 C  C   . GLY A 1 128 ? -0.858  -27.832 3.816   1.00 20.25 ? 267 GLY A C   1 
ATOM   1045 O  O   . GLY A 1 128 ? -0.766  -28.299 2.680   1.00 22.69 ? 267 GLY A O   1 
ATOM   1046 N  N   . ARG A 1 129 ? -1.975  -27.890 4.537   1.00 19.37 ? 268 ARG A N   1 
ATOM   1047 C  CA  . ARG A 1 129 ? -3.186  -28.510 3.999   1.00 18.34 ? 268 ARG A CA  1 
ATOM   1048 C  C   . ARG A 1 129 ? -3.945  -27.489 3.174   1.00 18.49 ? 268 ARG A C   1 
ATOM   1049 O  O   . ARG A 1 129 ? -4.150  -26.371 3.626   1.00 17.96 ? 268 ARG A O   1 
ATOM   1050 C  CB  A ARG A 1 129 ? -4.082  -29.040 5.122   0.44 26.82 ? 268 ARG A CB  1 
ATOM   1051 C  CB  B ARG A 1 129 ? -4.082  -29.054 5.117   0.56 26.34 ? 268 ARG A CB  1 
ATOM   1052 C  CG  A ARG A 1 129 ? -3.391  -29.940 6.134   0.44 33.82 ? 268 ARG A CG  1 
ATOM   1053 C  CG  B ARG A 1 129 ? -3.401  -30.024 6.072   0.56 33.77 ? 268 ARG A CG  1 
ATOM   1054 C  CD  A ARG A 1 129 ? -2.883  -31.217 5.493   0.44 39.58 ? 268 ARG A CD  1 
ATOM   1055 C  CD  B ARG A 1 129 ? -2.553  -31.038 5.326   0.56 39.74 ? 268 ARG A CD  1 
ATOM   1056 N  NE  A ARG A 1 129 ? -2.764  -32.302 6.464   0.44 44.74 ? 268 ARG A NE  1 
ATOM   1057 N  NE  B ARG A 1 129 ? -3.305  -31.748 4.294   0.56 42.96 ? 268 ARG A NE  1 
ATOM   1058 C  CZ  A ARG A 1 129 ? -2.337  -33.525 6.168   0.44 48.46 ? 268 ARG A CZ  1 
ATOM   1059 C  CZ  B ARG A 1 129 ? -2.772  -32.189 3.159   0.56 42.16 ? 268 ARG A CZ  1 
ATOM   1060 N  NH1 A ARG A 1 129 ? -1.977  -33.821 4.926   0.44 50.98 ? 268 ARG A NH1 1 
ATOM   1061 N  NH1 B ARG A 1 129 ? -1.484  -31.988 2.909   0.56 40.55 ? 268 ARG A NH1 1 
ATOM   1062 N  NH2 A ARG A 1 129 ? -2.265  -34.450 7.114   0.44 49.81 ? 268 ARG A NH2 1 
ATOM   1063 N  NH2 B ARG A 1 129 ? -3.526  -32.823 2.273   0.56 43.88 ? 268 ARG A NH2 1 
ATOM   1064 N  N   . PRO A 1 130 ? -4.367  -27.867 1.959   1.00 18.43 ? 269 PRO A N   1 
ATOM   1065 C  CA  . PRO A 1 130 ? -5.110  -26.904 1.140   1.00 17.12 ? 269 PRO A CA  1 
ATOM   1066 C  C   . PRO A 1 130 ? -6.345  -26.375 1.868   1.00 16.29 ? 269 PRO A C   1 
ATOM   1067 O  O   . PRO A 1 130 ? -7.193  -27.147 2.328   1.00 19.39 ? 269 PRO A O   1 
ATOM   1068 C  CB  . PRO A 1 130 ? -5.486  -27.716 -0.105  1.00 22.10 ? 269 PRO A CB  1 
ATOM   1069 C  CG  . PRO A 1 130 ? -4.419  -28.779 -0.186  1.00 27.72 ? 269 PRO A CG  1 
ATOM   1070 C  CD  . PRO A 1 130 ? -4.107  -29.130 1.245   1.00 26.16 ? 269 PRO A CD  1 
ATOM   1071 N  N   . GLY A 1 131 ? -6.409  -25.054 2.013   1.00 13.66 ? 270 GLY A N   1 
ATOM   1072 C  CA  . GLY A 1 131 ? -7.523  -24.399 2.675   1.00 14.79 ? 270 GLY A CA  1 
ATOM   1073 C  C   . GLY A 1 131 ? -7.492  -24.395 4.195   1.00 18.16 ? 270 GLY A C   1 
ATOM   1074 O  O   . GLY A 1 131 ? -8.394  -23.843 4.835   1.00 18.13 ? 270 GLY A O   1 
ATOM   1075 N  N   . GLY A 1 132 ? -6.448  -24.972 4.786   1.00 13.05 ? 271 GLY A N   1 
ATOM   1076 C  CA  . GLY A 1 132 ? -6.364  -25.066 6.237   1.00 11.33 ? 271 GLY A CA  1 
ATOM   1077 C  C   . GLY A 1 132 ? -6.236  -23.724 6.934   1.00 12.67 ? 271 GLY A C   1 
ATOM   1078 O  O   . GLY A 1 132 ? -6.760  -23.523 8.036   1.00 12.82 ? 271 GLY A O   1 
ATOM   1079 N  N   . LEU A 1 133 ? -5.527  -22.806 6.281   1.00 12.34 ? 272 LEU A N   1 
ATOM   1080 C  CA  . LEU A 1 133 ? -5.349  -21.451 6.791   1.00 10.98 ? 272 LEU A CA  1 
ATOM   1081 C  C   . LEU A 1 133 ? -5.814  -20.470 5.726   1.00 9.89  ? 272 LEU A C   1 
ATOM   1082 O  O   . LEU A 1 133 ? -5.731  -20.748 4.516   1.00 11.20 ? 272 LEU A O   1 
ATOM   1083 C  CB  . LEU A 1 133 ? -3.881  -21.186 7.151   1.00 10.98 ? 272 LEU A CB  1 
ATOM   1084 C  CG  . LEU A 1 133 ? -3.234  -22.114 8.179   1.00 10.96 ? 272 LEU A CG  1 
ATOM   1085 C  CD1 . LEU A 1 133 ? -1.736  -21.809 8.247   1.00 12.98 ? 272 LEU A CD1 1 
ATOM   1086 C  CD2 . LEU A 1 133 ? -3.886  -21.892 9.539   1.00 16.50 ? 272 LEU A CD2 1 
ATOM   1087 N  N   . ALA A 1 134 ? -6.309  -19.321 6.180   1.00 9.14  ? 273 ALA A N   1 
ATOM   1088 C  CA  . ALA A 1 134 ? -6.760  -18.270 5.280   1.00 9.17  ? 273 ALA A CA  1 
ATOM   1089 C  C   . ALA A 1 134 ? -6.320  -16.927 5.821   1.00 9.78  ? 273 ALA A C   1 
ATOM   1090 O  O   . ALA A 1 134 ? -6.353  -16.698 7.032   1.00 11.75 ? 273 ALA A O   1 
ATOM   1091 C  CB  . ALA A 1 134 ? -8.278  -18.309 5.117   1.00 12.11 ? 273 ALA A CB  1 
ATOM   1092 N  N   . VAL A 1 135 ? -5.884  -16.036 4.934   1.00 8.31  ? 274 VAL A N   1 
ATOM   1093 C  CA  . VAL A 1 135 ? -5.492  -14.704 5.370   1.00 8.17  ? 274 VAL A CA  1 
ATOM   1094 C  C   . VAL A 1 135 ? -6.321  -13.650 4.658   1.00 8.65  ? 274 VAL A C   1 
ATOM   1095 O  O   . VAL A 1 135 ? -6.518  -13.725 3.442   1.00 10.17 ? 274 VAL A O   1 
ATOM   1096 C  CB  . VAL A 1 135 ? -3.985  -14.438 5.115   1.00 8.60  ? 274 VAL A CB  1 
ATOM   1097 C  CG1 . VAL A 1 135 ? -3.567  -13.097 5.720   1.00 9.86  ? 274 VAL A CG1 1 
ATOM   1098 C  CG2 . VAL A 1 135 ? -3.143  -15.539 5.737   1.00 9.74  ? 274 VAL A CG2 1 
ATOM   1099 N  N   . LEU A 1 136 ? -6.813  -12.678 5.423   1.00 9.80  ? 275 LEU A N   1 
ATOM   1100 C  CA  . LEU A 1 136 ? -7.444  -11.490 4.851   1.00 8.61  ? 275 LEU A CA  1 
ATOM   1101 C  C   . LEU A 1 136 ? -6.412  -10.394 4.820   1.00 10.09 ? 275 LEU A C   1 
ATOM   1102 O  O   . LEU A 1 136 ? -5.785  -10.116 5.848   1.00 10.57 ? 275 LEU A O   1 
ATOM   1103 C  CB  . LEU A 1 136 ? -8.639  -11.019 5.671   1.00 11.74 ? 275 LEU A CB  1 
ATOM   1104 C  CG  . LEU A 1 136 ? -9.908  -11.838 5.688   1.00 15.59 ? 275 LEU A CG  1 
ATOM   1105 C  CD1 . LEU A 1 136 ? -10.971 -10.991 6.371   1.00 15.21 ? 275 LEU A CD1 1 
ATOM   1106 C  CD2 . LEU A 1 136 ? -10.355 -12.262 4.271   1.00 14.96 ? 275 LEU A CD2 1 
ATOM   1107 N  N   . ALA A 1 137 ? -6.241  -9.772  3.654   1.00 7.36  ? 276 ALA A N   1 
ATOM   1108 C  CA  . ALA A 1 137 ? -5.201  -8.758  3.472   1.00 6.31  ? 276 ALA A CA  1 
ATOM   1109 C  C   . ALA A 1 137 ? -5.791  -7.464  2.920   1.00 11.05 ? 276 ALA A C   1 
ATOM   1110 O  O   . ALA A 1 137 ? -6.620  -7.492  2.005   1.00 11.27 ? 276 ALA A O   1 
ATOM   1111 C  CB  . ALA A 1 137 ? -4.122  -9.276  2.534   1.00 9.45  ? 276 ALA A CB  1 
ATOM   1112 N  N   . ALA A 1 138 ? -5.349  -6.332  3.470   1.00 8.12  ? 277 ALA A N   1 
ATOM   1113 C  CA  . ALA A 1 138 ? -5.732  -5.025  2.912   1.00 8.37  ? 277 ALA A CA  1 
ATOM   1114 C  C   . ALA A 1 138 ? -4.526  -4.098  2.845   1.00 8.82  ? 277 ALA A C   1 
ATOM   1115 O  O   . ALA A 1 138 ? -3.645  -4.145  3.712   1.00 9.76  ? 277 ALA A O   1 
ATOM   1116 C  CB  . ALA A 1 138 ? -6.826  -4.383  3.739   1.00 11.66 ? 277 ALA A CB  1 
ATOM   1117 N  N   . PHE A 1 139 ? -4.487  -3.263  1.815   1.00 8.89  ? 278 PHE A N   1 
ATOM   1118 C  CA  . PHE A 1 139 ? -3.448  -2.236  1.697   1.00 9.58  ? 278 PHE A CA  1 
ATOM   1119 C  C   . PHE A 1 139 ? -3.758  -1.027  2.563   1.00 9.75  ? 278 PHE A C   1 
ATOM   1120 O  O   . PHE A 1 139 ? -4.907  -0.609  2.660   1.00 10.86 ? 278 PHE A O   1 
ATOM   1121 C  CB  . PHE A 1 139 ? -3.307  -1.796  0.242   1.00 10.63 ? 278 PHE A CB  1 
ATOM   1122 C  CG  . PHE A 1 139 ? -2.894  -2.898  -0.678  1.00 10.20 ? 278 PHE A CG  1 
ATOM   1123 C  CD1 . PHE A 1 139 ? -3.733  -3.306  -1.698  1.00 10.01 ? 278 PHE A CD1 1 
ATOM   1124 C  CD2 . PHE A 1 139 ? -1.686  -3.548  -0.506  1.00 11.22 ? 278 PHE A CD2 1 
ATOM   1125 C  CE1 . PHE A 1 139 ? -3.356  -4.325  -2.553  1.00 9.32  ? 278 PHE A CE1 1 
ATOM   1126 C  CE2 . PHE A 1 139 ? -1.303  -4.578  -1.357  1.00 11.27 ? 278 PHE A CE2 1 
ATOM   1127 C  CZ  . PHE A 1 139 ? -2.142  -4.966  -2.384  1.00 9.91  ? 278 PHE A CZ  1 
ATOM   1128 N  N   . LEU A 1 140 ? -2.720  -0.452  3.168   1.00 9.77  ? 279 LEU A N   1 
ATOM   1129 C  CA  . LEU A 1 140 ? -2.841  0.812   3.884   1.00 10.83 ? 279 LEU A CA  1 
ATOM   1130 C  C   . LEU A 1 140 ? -2.184  1.897   3.044   1.00 9.82  ? 279 LEU A C   1 
ATOM   1131 O  O   . LEU A 1 140 ? -1.030  1.756   2.633   1.00 12.17 ? 279 LEU A O   1 
ATOM   1132 C  CB  . LEU A 1 140 ? -2.172  0.772   5.266   1.00 10.80 ? 279 LEU A CB  1 
ATOM   1133 C  CG  . LEU A 1 140 ? -2.184  -0.446  6.204   1.00 23.32 ? 279 LEU A CG  1 
ATOM   1134 C  CD1 . LEU A 1 140 ? -1.898  -0.020  7.651   1.00 17.10 ? 279 LEU A CD1 1 
ATOM   1135 C  CD2 . LEU A 1 140 ? -3.406  -1.339  6.128   1.00 18.78 ? 279 LEU A CD2 1 
ATOM   1136 N  N   . GLU A 1 141 ? -2.926  2.975   2.811   1.00 13.21 ? 280 GLU A N   1 
ATOM   1137 C  CA  . GLU A 1 141 ? -2.455  4.103   2.019   1.00 18.65 ? 280 GLU A CA  1 
ATOM   1138 C  C   . GLU A 1 141 ? -2.458  5.365   2.841   1.00 15.07 ? 280 GLU A C   1 
ATOM   1139 O  O   . GLU A 1 141 ? -3.112  5.428   3.876   1.00 15.39 ? 280 GLU A O   1 
ATOM   1140 C  CB  . GLU A 1 141 ? -3.354  4.338   0.794   1.00 22.61 ? 280 GLU A CB  1 
ATOM   1141 C  CG  . GLU A 1 141 ? -3.293  3.287   -0.285  1.00 29.73 ? 280 GLU A CG  1 
ATOM   1142 C  CD  . GLU A 1 141 ? -4.069  3.711   -1.524  1.00 24.68 ? 280 GLU A CD  1 
ATOM   1143 O  OE1 . GLU A 1 141 ? -5.306  3.873   -1.440  1.00 24.83 ? 280 GLU A OE1 1 
ATOM   1144 O  OE2 . GLU A 1 141 ? -3.431  3.900   -2.571  1.00 30.43 ? 280 GLU A OE2 1 
ATOM   1145 N  N   . GLU A 1 142 ? -1.755  6.388   2.356   1.00 16.19 ? 281 GLU A N   1 
ATOM   1146 C  CA  . GLU A 1 142 ? -1.808  7.693   2.997   1.00 15.86 ? 281 GLU A CA  1 
ATOM   1147 C  C   . GLU A 1 142 ? -3.085  8.424   2.619   1.00 22.14 ? 281 GLU A C   1 
ATOM   1148 O  O   . GLU A 1 142 ? -3.477  8.438   1.448   1.00 20.87 ? 281 GLU A O   1 
ATOM   1149 C  CB  A GLU A 1 142 ? -0.600  8.553   2.621   0.56 17.90 ? 281 GLU A CB  1 
ATOM   1150 C  CB  B GLU A 1 142 ? -0.589  8.533   2.608   0.44 18.38 ? 281 GLU A CB  1 
ATOM   1151 C  CG  A GLU A 1 142 ? -0.560  9.865   3.402   0.56 23.49 ? 281 GLU A CG  1 
ATOM   1152 C  CG  B GLU A 1 142 ? -0.522  9.887   3.304   0.44 23.68 ? 281 GLU A CG  1 
ATOM   1153 C  CD  A GLU A 1 142 ? 0.505   10.832  2.914   0.56 28.51 ? 281 GLU A CD  1 
ATOM   1154 C  CD  B GLU A 1 142 ? 0.714   10.683  2.918   0.44 28.55 ? 281 GLU A CD  1 
ATOM   1155 O  OE1 A GLU A 1 142 ? 0.395   12.031  3.242   0.56 30.55 ? 281 GLU A OE1 1 
ATOM   1156 O  OE1 B GLU A 1 142 ? 0.640   11.465  1.948   0.44 31.63 ? 281 GLU A OE1 1 
ATOM   1157 O  OE2 A GLU A 1 142 ? 1.443   10.400  2.208   0.56 30.78 ? 281 GLU A OE2 1 
ATOM   1158 O  OE2 B GLU A 1 142 ? 1.761   10.521  3.580   0.44 28.72 ? 281 GLU A OE2 1 
ATOM   1159 N  N   . GLY A 1 143 ? -3.722  9.020   3.621   1.00 18.23 ? 282 GLY A N   1 
ATOM   1160 C  CA  . GLY A 1 143 ? -4.856  9.904   3.421   1.00 25.81 ? 282 GLY A CA  1 
ATOM   1161 C  C   . GLY A 1 143 ? -4.713  11.138  4.300   1.00 23.78 ? 282 GLY A C   1 
ATOM   1162 O  O   . GLY A 1 143 ? -3.814  11.211  5.140   1.00 22.36 ? 282 GLY A O   1 
ATOM   1163 N  N   . PRO A 1 144 ? -5.606  12.118  4.117   1.00 23.82 ? 283 PRO A N   1 
ATOM   1164 C  CA  . PRO A 1 144 ? -5.560  13.385  4.862   1.00 27.89 ? 283 PRO A CA  1 
ATOM   1165 C  C   . PRO A 1 144 ? -5.995  13.282  6.326   1.00 29.41 ? 283 PRO A C   1 
ATOM   1166 O  O   . PRO A 1 144 ? -5.589  14.123  7.137   1.00 28.86 ? 283 PRO A O   1 
ATOM   1167 C  CB  . PRO A 1 144 ? -6.527  14.280  4.075   1.00 29.15 ? 283 PRO A CB  1 
ATOM   1168 C  CG  . PRO A 1 144 ? -7.495  13.324  3.461   1.00 29.80 ? 283 PRO A CG  1 
ATOM   1169 C  CD  . PRO A 1 144 ? -6.676  12.103  3.106   1.00 21.82 ? 283 PRO A CD  1 
ATOM   1170 N  N   . GLU A 1 145 ? -6.804  12.280  6.666   1.00 23.56 ? 284 GLU A N   1 
ATOM   1171 C  CA  . GLU A 1 145 ? -7.370  12.191  8.007   1.00 22.57 ? 284 GLU A CA  1 
ATOM   1172 C  C   . GLU A 1 145 ? -6.705  11.131  8.885   1.00 27.20 ? 284 GLU A C   1 
ATOM   1173 O  O   . GLU A 1 145 ? -6.255  10.091  8.401   1.00 23.09 ? 284 GLU A O   1 
ATOM   1174 C  CB  . GLU A 1 145 ? -8.872  11.906  7.925   1.00 31.28 ? 284 GLU A CB  1 
ATOM   1175 C  CG  . GLU A 1 145 ? -9.634  12.804  6.952   1.00 41.67 ? 284 GLU A CG  1 
ATOM   1176 C  CD  . GLU A 1 145 ? -9.656  14.268  7.370   1.00 54.82 ? 284 GLU A CD  1 
ATOM   1177 O  OE1 . GLU A 1 145 ? -9.395  14.568  8.556   1.00 57.74 ? 284 GLU A OE1 1 
ATOM   1178 O  OE2 . GLU A 1 145 ? -9.937  15.124  6.504   1.00 62.30 ? 284 GLU A OE2 1 
ATOM   1179 N  N   . GLU A 1 146 ? -6.672  11.389  10.185  1.00 21.99 ? 285 GLU A N   1 
ATOM   1180 C  CA  . GLU A 1 146 ? -6.200  10.394  11.130  1.00 21.65 ? 285 GLU A CA  1 
ATOM   1181 C  C   . GLU A 1 146 ? -7.202  9.249   11.221  1.00 23.95 ? 285 GLU A C   1 
ATOM   1182 O  O   . GLU A 1 146 ? -8.398  9.480   11.364  1.00 22.00 ? 285 GLU A O   1 
ATOM   1183 C  CB  . GLU A 1 146 ? -5.978  11.025  12.505  1.00 26.53 ? 285 GLU A CB  1 
ATOM   1184 C  CG  . GLU A 1 146 ? -5.631  10.022  13.587  1.00 34.89 ? 285 GLU A CG  1 
ATOM   1185 C  CD  . GLU A 1 146 ? -5.010  10.677  14.808  1.00 44.03 ? 285 GLU A CD  1 
ATOM   1186 O  OE1 . GLU A 1 146 ? -5.608  10.597  15.901  1.00 40.66 ? 285 GLU A OE1 1 
ATOM   1187 O  OE2 . GLU A 1 146 ? -3.915  11.264  14.673  1.00 45.95 ? 285 GLU A OE2 1 
ATOM   1188 N  N   . ASN A 1 147 ? -6.715  8.013   11.122  1.00 16.90 ? 286 ASN A N   1 
ATOM   1189 C  CA  . ASN A 1 147 ? -7.583  6.846   11.248  1.00 16.11 ? 286 ASN A CA  1 
ATOM   1190 C  C   . ASN A 1 147 ? -7.750  6.471   12.716  1.00 16.39 ? 286 ASN A C   1 
ATOM   1191 O  O   . ASN A 1 147 ? -6.808  6.012   13.369  1.00 16.27 ? 286 ASN A O   1 
ATOM   1192 C  CB  . ASN A 1 147 ? -7.013  5.674   10.430  1.00 14.85 ? 286 ASN A CB  1 
ATOM   1193 C  CG  . ASN A 1 147 ? -7.957  4.486   10.366  1.00 13.33 ? 286 ASN A CG  1 
ATOM   1194 O  OD1 . ASN A 1 147 ? -8.416  3.987   11.391  1.00 16.49 ? 286 ASN A OD1 1 
ATOM   1195 N  ND2 . ASN A 1 147 ? -8.231  4.009   9.150   1.00 17.03 ? 286 ASN A ND2 1 
ATOM   1196 N  N   . SER A 1 148 ? -8.951  6.679   13.252  1.00 18.57 ? 287 SER A N   1 
ATOM   1197 C  CA  . SER A 1 148 ? -9.163  6.509   14.688  1.00 17.76 ? 287 SER A CA  1 
ATOM   1198 C  C   . SER A 1 148 ? -9.009  5.054   15.149  1.00 19.24 ? 287 SER A C   1 
ATOM   1199 O  O   . SER A 1 148 ? -8.532  4.802   16.258  1.00 20.00 ? 287 SER A O   1 
ATOM   1200 C  CB  A SER A 1 148 ? -10.544 7.042   15.086  0.55 22.91 ? 287 SER A CB  1 
ATOM   1201 C  CB  B SER A 1 148 ? -10.547 7.026   15.082  0.45 22.99 ? 287 SER A CB  1 
ATOM   1202 O  OG  A SER A 1 148 ? -11.574 6.360   14.399  0.55 26.74 ? 287 SER A OG  1 
ATOM   1203 O  OG  B SER A 1 148 ? -10.787 6.805   16.460  0.45 24.61 ? 287 SER A OG  1 
ATOM   1204 N  N   . ALA A 1 149 ? -9.407  4.100   14.308  1.00 18.98 ? 288 ALA A N   1 
ATOM   1205 C  CA  . ALA A 1 149 ? -9.272  2.689   14.661  1.00 15.75 ? 288 ALA A CA  1 
ATOM   1206 C  C   . ALA A 1 149 ? -7.801  2.302   14.776  1.00 13.72 ? 288 ALA A C   1 
ATOM   1207 O  O   . ALA A 1 149 ? -7.388  1.682   15.751  1.00 16.84 ? 288 ALA A O   1 
ATOM   1208 C  CB  . ALA A 1 149 ? -9.977  1.799   13.632  1.00 17.06 ? 288 ALA A CB  1 
ATOM   1209 N  N   . TYR A 1 150 ? -7.004  2.704   13.795  1.00 14.68 ? 289 TYR A N   1 
ATOM   1210 C  CA  . TYR A 1 150 ? -5.590  2.354   13.822  1.00 12.54 ? 289 TYR A CA  1 
ATOM   1211 C  C   . TYR A 1 150 ? -4.860  3.076   14.946  1.00 16.98 ? 289 TYR A C   1 
ATOM   1212 O  O   . TYR A 1 150 ? -3.899  2.539   15.501  1.00 15.87 ? 289 TYR A O   1 
ATOM   1213 C  CB  . TYR A 1 150 ? -4.926  2.644   12.474  1.00 12.90 ? 289 TYR A CB  1 
ATOM   1214 C  CG  . TYR A 1 150 ? -5.063  1.475   11.528  1.00 11.80 ? 289 TYR A CG  1 
ATOM   1215 C  CD1 . TYR A 1 150 ? -6.199  1.324   10.730  1.00 14.69 ? 289 TYR A CD1 1 
ATOM   1216 C  CD2 . TYR A 1 150 ? -4.080  0.494   11.461  1.00 14.08 ? 289 TYR A CD2 1 
ATOM   1217 C  CE1 . TYR A 1 150 ? -6.340  0.246   9.882   1.00 13.00 ? 289 TYR A CE1 1 
ATOM   1218 C  CE2 . TYR A 1 150 ? -4.210  -0.586  10.612  1.00 13.92 ? 289 TYR A CE2 1 
ATOM   1219 C  CZ  . TYR A 1 150 ? -5.343  -0.709  9.831   1.00 13.52 ? 289 TYR A CZ  1 
ATOM   1220 O  OH  . TYR A 1 150 ? -5.467  -1.793  8.990   1.00 13.88 ? 289 TYR A OH  1 
ATOM   1221 N  N   . GLU A 1 151 ? -5.326  4.273   15.300  1.00 18.69 ? 290 GLU A N   1 
ATOM   1222 C  CA  . GLU A 1 151 ? -4.686  5.037   16.376  1.00 15.38 ? 290 GLU A CA  1 
ATOM   1223 C  C   . GLU A 1 151 ? -4.701  4.260   17.690  1.00 17.36 ? 290 GLU A C   1 
ATOM   1224 O  O   . GLU A 1 151 ? -3.786  4.391   18.497  1.00 18.19 ? 290 GLU A O   1 
ATOM   1225 C  CB  . GLU A 1 151 ? -5.367  6.391   16.560  1.00 16.25 ? 290 GLU A CB  1 
ATOM   1226 C  CG  . GLU A 1 151 ? -4.652  7.311   17.549  1.00 17.75 ? 290 GLU A CG  1 
ATOM   1227 C  CD  . GLU A 1 151 ? -3.271  7.723   17.074  1.00 20.64 ? 290 GLU A CD  1 
ATOM   1228 O  OE1 . GLU A 1 151 ? -2.978  7.609   15.859  1.00 22.13 ? 290 GLU A OE1 1 
ATOM   1229 O  OE2 . GLU A 1 151 ? -2.470  8.179   17.922  1.00 24.57 ? 290 GLU A OE2 1 
ATOM   1230 N  N   . GLN A 1 152 ? -5.721  3.431   17.892  1.00 14.83 ? 291 GLN A N   1 
ATOM   1231 C  CA  . GLN A 1 152 ? -5.789  2.596   19.093  1.00 19.82 ? 291 GLN A CA  1 
ATOM   1232 C  C   . GLN A 1 152 ? -4.563  1.700   19.236  1.00 16.21 ? 291 GLN A C   1 
ATOM   1233 O  O   . GLN A 1 152 ? -4.101  1.451   20.348  1.00 18.41 ? 291 GLN A O   1 
ATOM   1234 C  CB  A GLN A 1 152 ? -7.034  1.708   19.115  0.35 22.34 ? 291 GLN A CB  1 
ATOM   1235 C  CB  B GLN A 1 152 ? -7.061  1.745   19.063  0.65 21.84 ? 291 GLN A CB  1 
ATOM   1236 C  CG  A GLN A 1 152 ? -8.311  2.306   18.601  0.35 29.03 ? 291 GLN A CG  1 
ATOM   1237 C  CG  B GLN A 1 152 ? -8.350  2.553   19.281  0.65 23.97 ? 291 GLN A CG  1 
ATOM   1238 C  CD  A GLN A 1 152 ? -9.503  1.939   19.456  0.35 32.69 ? 291 GLN A CD  1 
ATOM   1239 C  CD  B GLN A 1 152 ? -9.592  1.884   18.704  0.65 34.18 ? 291 GLN A CD  1 
ATOM   1240 O  OE1 A GLN A 1 152 ? -9.582  0.822   19.959  0.35 33.77 ? 291 GLN A OE1 1 
ATOM   1241 O  OE1 B GLN A 1 152 ? -9.552  1.317   17.613  0.65 32.16 ? 291 GLN A OE1 1 
ATOM   1242 N  NE2 A GLN A 1 152 ? -10.481 2.832   19.538  0.35 37.60 ? 291 GLN A NE2 1 
ATOM   1243 N  NE2 B GLN A 1 152 ? -10.699 1.953   19.431  0.65 30.47 ? 291 GLN A NE2 1 
ATOM   1244 N  N   . LEU A 1 153 ? -4.047  1.204   18.113  1.00 14.57 ? 292 LEU A N   1 
ATOM   1245 C  CA  . LEU A 1 153 ? -2.865  0.342   18.147  1.00 12.61 ? 292 LEU A CA  1 
ATOM   1246 C  C   . LEU A 1 153 ? -1.572  1.143   18.018  1.00 13.18 ? 292 LEU A C   1 
ATOM   1247 O  O   . LEU A 1 153 ? -0.602  0.876   18.733  1.00 14.31 ? 292 LEU A O   1 
ATOM   1248 C  CB  . LEU A 1 153 ? -2.936  -0.706  17.027  1.00 13.17 ? 292 LEU A CB  1 
ATOM   1249 C  CG  . LEU A 1 153 ? -4.161  -1.625  17.075  1.00 18.09 ? 292 LEU A CG  1 
ATOM   1250 C  CD1 . LEU A 1 153 ? -4.080  -2.681  15.962  1.00 16.79 ? 292 LEU A CD1 1 
ATOM   1251 C  CD2 . LEU A 1 153 ? -4.309  -2.262  18.445  1.00 18.15 ? 292 LEU A CD2 1 
ATOM   1252 N  N   . LEU A 1 154 ? -1.563  2.120   17.115  1.00 13.39 ? 293 LEU A N   1 
ATOM   1253 C  CA  . LEU A 1 154 ? -0.353  2.878   16.823  1.00 12.50 ? 293 LEU A CA  1 
ATOM   1254 C  C   . LEU A 1 154 ? 0.119   3.636   18.067  1.00 16.33 ? 293 LEU A C   1 
ATOM   1255 O  O   . LEU A 1 154 ? 1.322   3.761   18.315  1.00 15.78 ? 293 LEU A O   1 
ATOM   1256 C  CB  . LEU A 1 154 ? -0.589  3.838   15.653  1.00 14.36 ? 293 LEU A CB  1 
ATOM   1257 C  CG  . LEU A 1 154 ? -0.857  3.153   14.301  1.00 15.19 ? 293 LEU A CG  1 
ATOM   1258 C  CD1 . LEU A 1 154 ? -1.125  4.178   13.232  1.00 16.28 ? 293 LEU A CD1 1 
ATOM   1259 C  CD2 . LEU A 1 154 ? 0.302   2.244   13.879  1.00 17.42 ? 293 LEU A CD2 1 
ATOM   1260 N  N   . SER A 1 155 ? -0.833  4.115   18.860  1.00 16.69 ? 294 SER A N   1 
ATOM   1261 C  CA  . SER A 1 155 ? -0.504  4.883   20.059  1.00 16.69 ? 294 SER A CA  1 
ATOM   1262 C  C   . SER A 1 155 ? 0.160   4.031   21.137  1.00 13.93 ? 294 SER A C   1 
ATOM   1263 O  O   . SER A 1 155 ? 0.676   4.568   22.117  1.00 16.73 ? 294 SER A O   1 
ATOM   1264 C  CB  . SER A 1 155 ? -1.761  5.548   20.628  1.00 16.04 ? 294 SER A CB  1 
ATOM   1265 O  OG  . SER A 1 155 ? -2.694  4.579   21.069  1.00 18.85 ? 294 SER A OG  1 
ATOM   1266 N  N   . ARG A 1 156 ? 0.132   2.706   20.969  1.00 14.43 ? 295 ARG A N   1 
ATOM   1267 C  CA  . ARG A 1 156 ? 0.692   1.798   21.962  1.00 16.42 ? 295 ARG A CA  1 
ATOM   1268 C  C   . ARG A 1 156 ? 2.021   1.180   21.507  1.00 14.42 ? 295 ARG A C   1 
ATOM   1269 O  O   . ARG A 1 156 ? 2.604   0.363   22.223  1.00 17.38 ? 295 ARG A O   1 
ATOM   1270 C  CB  A ARG A 1 156 ? -0.300  0.679   22.279  0.14 18.10 ? 295 ARG A CB  1 
ATOM   1271 C  CB  B ARG A 1 156 ? -0.311  0.691   22.296  0.86 17.21 ? 295 ARG A CB  1 
ATOM   1272 C  CG  A ARG A 1 156 ? -1.672  1.154   22.707  0.14 19.52 ? 295 ARG A CG  1 
ATOM   1273 C  CG  B ARG A 1 156 ? -1.692  1.191   22.712  0.86 20.78 ? 295 ARG A CG  1 
ATOM   1274 C  CD  A ARG A 1 156 ? -1.618  1.882   24.035  0.14 20.16 ? 295 ARG A CD  1 
ATOM   1275 C  CD  B ARG A 1 156 ? -1.625  2.052   23.968  0.86 20.18 ? 295 ARG A CD  1 
ATOM   1276 N  NE  A ARG A 1 156 ? -2.729  1.484   24.891  0.14 20.24 ? 295 ARG A NE  1 
ATOM   1277 N  NE  B ARG A 1 156 ? -1.147  1.279   25.109  0.86 18.40 ? 295 ARG A NE  1 
ATOM   1278 C  CZ  A ARG A 1 156 ? -2.623  0.619   25.893  0.14 21.17 ? 295 ARG A CZ  1 
ATOM   1279 C  CZ  B ARG A 1 156 ? -1.936  0.609   25.942  0.86 20.51 ? 295 ARG A CZ  1 
ATOM   1280 N  NH1 A ARG A 1 156 ? -1.452  0.066   26.177  0.14 20.97 ? 295 ARG A NH1 1 
ATOM   1281 N  NH1 B ARG A 1 156 ? -3.252  0.614   25.766  0.86 22.10 ? 295 ARG A NH1 1 
ATOM   1282 N  NH2 A ARG A 1 156 ? -3.689  0.312   26.614  0.14 21.67 ? 295 ARG A NH2 1 
ATOM   1283 N  NH2 B ARG A 1 156 ? -1.407  -0.076  26.947  0.86 22.68 ? 295 ARG A NH2 1 
ATOM   1284 N  N   . LEU A 1 157 ? 2.510   1.565   20.332  1.00 12.05 ? 296 LEU A N   1 
ATOM   1285 C  CA  . LEU A 1 157 ? 3.758   0.977   19.828  1.00 11.67 ? 296 LEU A CA  1 
ATOM   1286 C  C   . LEU A 1 157 ? 5.000   1.399   20.629  1.00 15.17 ? 296 LEU A C   1 
ATOM   1287 O  O   . LEU A 1 157 ? 5.914   0.597   20.813  1.00 13.07 ? 296 LEU A O   1 
ATOM   1288 C  CB  . LEU A 1 157 ? 3.959   1.316   18.351  1.00 11.49 ? 296 LEU A CB  1 
ATOM   1289 C  CG  . LEU A 1 157 ? 2.910   0.719   17.391  1.00 11.03 ? 296 LEU A CG  1 
ATOM   1290 C  CD1 . LEU A 1 157 ? 3.292   1.032   15.966  1.00 13.12 ? 296 LEU A CD1 1 
ATOM   1291 C  CD2 . LEU A 1 157 ? 2.744   -0.785  17.584  1.00 10.57 ? 296 LEU A CD2 1 
ATOM   1292 N  N   . GLU A 1 158 ? 5.040   2.640   21.113  1.00 13.23 ? 297 GLU A N   1 
ATOM   1293 C  CA  . GLU A 1 158 ? 6.213   3.119   21.852  1.00 14.29 ? 297 GLU A CA  1 
ATOM   1294 C  C   . GLU A 1 158 ? 6.532   2.239   23.063  1.00 15.29 ? 297 GLU A C   1 
ATOM   1295 O  O   . GLU A 1 158 ? 7.701   1.987   23.358  1.00 16.02 ? 297 GLU A O   1 
ATOM   1296 C  CB  . GLU A 1 158 ? 6.018   4.578   22.290  1.00 17.76 ? 297 GLU A CB  1 
ATOM   1297 C  CG  . GLU A 1 158 ? 7.187   5.149   23.097  1.00 27.40 ? 297 GLU A CG  1 
ATOM   1298 C  CD  . GLU A 1 158 ? 8.542   4.933   22.424  1.00 38.22 ? 297 GLU A CD  1 
ATOM   1299 O  OE1 . GLU A 1 158 ? 9.502   4.535   23.125  1.00 42.89 ? 297 GLU A OE1 1 
ATOM   1300 O  OE2 . GLU A 1 158 ? 8.653   5.172   21.201  1.00 43.33 ? 297 GLU A OE2 1 
ATOM   1301 N  N   . GLU A 1 159 ? 5.504   1.739   23.748  1.00 12.84 ? 298 GLU A N   1 
ATOM   1302 C  CA  . GLU A 1 159 ? 5.742   0.947   24.944  1.00 15.67 ? 298 GLU A CA  1 
ATOM   1303 C  C   . GLU A 1 159 ? 6.193   -0.478  24.629  1.00 15.67 ? 298 GLU A C   1 
ATOM   1304 O  O   . GLU A 1 159 ? 6.615   -1.212  25.525  1.00 15.87 ? 298 GLU A O   1 
ATOM   1305 C  CB  . GLU A 1 159 ? 4.495   0.926   25.828  1.00 22.16 ? 298 GLU A CB  1 
ATOM   1306 C  CG  . GLU A 1 159 ? 3.306   0.216   25.246  1.00 24.41 ? 298 GLU A CG  1 
ATOM   1307 C  CD  . GLU A 1 159 ? 2.006   0.680   25.882  1.00 28.51 ? 298 GLU A CD  1 
ATOM   1308 O  OE1 . GLU A 1 159 ? 1.619   1.841   25.646  1.00 22.84 ? 298 GLU A OE1 1 
ATOM   1309 O  OE2 . GLU A 1 159 ? 1.388   -0.108  26.623  1.00 28.06 ? 298 GLU A OE2 1 
ATOM   1310 N  N   . ILE A 1 160 ? 6.126   -0.870  23.359  1.00 11.39 ? 299 ILE A N   1 
ATOM   1311 C  CA  . ILE A 1 160 ? 6.688   -2.158  22.967  1.00 10.88 ? 299 ILE A CA  1 
ATOM   1312 C  C   . ILE A 1 160 ? 7.780   -2.000  21.909  1.00 12.07 ? 299 ILE A C   1 
ATOM   1313 O  O   . ILE A 1 160 ? 7.983   -2.883  21.072  1.00 11.25 ? 299 ILE A O   1 
ATOM   1314 C  CB  . ILE A 1 160 ? 5.593   -3.149  22.456  1.00 11.16 ? 299 ILE A CB  1 
ATOM   1315 C  CG1 . ILE A 1 160 ? 4.805   -2.561  21.284  1.00 11.20 ? 299 ILE A CG1 1 
ATOM   1316 C  CG2 . ILE A 1 160 ? 4.657   -3.542  23.600  1.00 13.31 ? 299 ILE A CG2 1 
ATOM   1317 C  CD1 . ILE A 1 160 ? 3.852   -3.564  20.634  1.00 10.44 ? 299 ILE A CD1 1 
ATOM   1318 N  N   . ALA A 1 161 ? 8.505   -0.890  21.961  1.00 10.26 ? 300 ALA A N   1 
ATOM   1319 C  CA  . ALA A 1 161 ? 9.530   -0.610  20.951  1.00 11.40 ? 300 ALA A CA  1 
ATOM   1320 C  C   . ALA A 1 161 ? 10.624  -1.677  20.864  1.00 9.59  ? 300 ALA A C   1 
ATOM   1321 O  O   . ALA A 1 161 ? 11.078  -2.013  19.761  1.00 10.28 ? 300 ALA A O   1 
ATOM   1322 C  CB  . ALA A 1 161 ? 10.175  0.759   21.221  1.00 14.40 ? 300 ALA A CB  1 
ATOM   1323 N  N   . GLU A 1 162 ? 11.057  -2.191  22.008  1.00 13.87 ? 301 GLU A N   1 
ATOM   1324 C  CA  . GLU A 1 162 ? 12.125  -3.187  22.019  1.00 14.41 ? 301 GLU A CA  1 
ATOM   1325 C  C   . GLU A 1 162 ? 11.613  -4.569  21.616  1.00 10.85 ? 301 GLU A C   1 
ATOM   1326 O  O   . GLU A 1 162 ? 10.499  -4.970  21.979  1.00 11.44 ? 301 GLU A O   1 
ATOM   1327 C  CB  . GLU A 1 162 ? 12.793  -3.237  23.389  1.00 15.21 ? 301 GLU A CB  1 
ATOM   1328 C  CG  . GLU A 1 162 ? 13.384  -1.897  23.806  1.00 18.27 ? 301 GLU A CG  1 
ATOM   1329 C  CD  . GLU A 1 162 ? 14.491  -1.424  22.860  1.00 36.52 ? 301 GLU A CD  1 
ATOM   1330 O  OE1 . GLU A 1 162 ? 15.196  -2.278  22.272  1.00 37.57 ? 301 GLU A OE1 1 
ATOM   1331 O  OE2 . GLU A 1 162 ? 14.660  -0.195  22.700  1.00 40.21 ? 301 GLU A OE2 1 
ATOM   1332 N  N   . GLU A 1 163 ? 12.433  -5.298  20.862  1.00 10.48 ? 302 GLU A N   1 
ATOM   1333 C  CA  . GLU A 1 163 ? 12.040  -6.628  20.425  1.00 10.69 ? 302 GLU A CA  1 
ATOM   1334 C  C   . GLU A 1 163 ? 11.644  -7.503  21.607  1.00 12.78 ? 302 GLU A C   1 
ATOM   1335 O  O   . GLU A 1 163 ? 12.289  -7.475  22.679  1.00 11.69 ? 302 GLU A O   1 
ATOM   1336 C  CB  . GLU A 1 163 ? 13.176  -7.297  19.637  1.00 10.81 ? 302 GLU A CB  1 
ATOM   1337 C  CG  . GLU A 1 163 ? 12.790  -8.626  18.976  1.00 10.90 ? 302 GLU A CG  1 
ATOM   1338 C  CD  . GLU A 1 163 ? 12.781  -9.822  19.916  1.00 11.48 ? 302 GLU A CD  1 
ATOM   1339 O  OE1 . GLU A 1 163 ? 11.981  -10.749 19.684  1.00 12.09 ? 302 GLU A OE1 1 
ATOM   1340 O  OE2 . GLU A 1 163 ? 13.560  -9.847  20.895  1.00 12.81 ? 302 GLU A OE2 1 
ATOM   1341 N  N   . GLY A 1 164 ? 10.572  -8.268  21.419  1.00 8.53  ? 303 GLY A N   1 
ATOM   1342 C  CA  . GLY A 1 164 ? 10.118  -9.201  22.426  1.00 8.00  ? 303 GLY A CA  1 
ATOM   1343 C  C   . GLY A 1 164 ? 9.200   -8.591  23.465  1.00 10.99 ? 303 GLY A C   1 
ATOM   1344 O  O   . GLY A 1 164 ? 8.710   -9.309  24.335  1.00 14.62 ? 303 GLY A O   1 
ATOM   1345 N  N   . SER A 1 165 ? 8.948   -7.288  23.365  1.00 9.64  ? 304 SER A N   1 
ATOM   1346 C  CA  . SER A 1 165 ? 8.091   -6.614  24.339  1.00 10.76 ? 304 SER A CA  1 
ATOM   1347 C  C   . SER A 1 165 ? 6.625   -6.829  24.021  1.00 14.56 ? 304 SER A C   1 
ATOM   1348 O  O   . SER A 1 165 ? 6.249   -7.026  22.861  1.00 11.68 ? 304 SER A O   1 
ATOM   1349 C  CB  A SER A 1 165 ? 8.352   -5.099  24.359  0.79 10.44 ? 304 SER A CB  1 
ATOM   1350 C  CB  B SER A 1 165 ? 8.403   -5.124  24.407  0.21 10.83 ? 304 SER A CB  1 
ATOM   1351 O  OG  A SER A 1 165 ? 9.705   -4.782  24.631  0.79 11.14 ? 304 SER A OG  1 
ATOM   1352 O  OG  B SER A 1 165 ? 8.517   -4.588  23.111  0.21 10.45 ? 304 SER A OG  1 
ATOM   1353 N  N   . GLU A 1 166 ? 5.795   -6.775  25.059  1.00 10.75 ? 305 GLU A N   1 
ATOM   1354 C  CA  . GLU A 1 166 ? 4.357   -6.909  24.875  1.00 11.53 ? 305 GLU A CA  1 
ATOM   1355 C  C   . GLU A 1 166 ? 3.614   -5.990  25.806  1.00 15.37 ? 305 GLU A C   1 
ATOM   1356 O  O   . GLU A 1 166 ? 4.142   -5.539  26.818  1.00 15.12 ? 305 GLU A O   1 
ATOM   1357 C  CB  A GLU A 1 166 ? 3.884   -8.330  25.168  0.29 13.72 ? 305 GLU A CB  1 
ATOM   1358 C  CB  B GLU A 1 166 ? 3.905   -8.356  25.051  0.71 13.83 ? 305 GLU A CB  1 
ATOM   1359 C  CG  A GLU A 1 166 ? 4.789   -9.435  24.717  0.29 15.82 ? 305 GLU A CG  1 
ATOM   1360 C  CG  B GLU A 1 166 ? 4.090   -8.958  26.419  0.71 14.05 ? 305 GLU A CG  1 
ATOM   1361 C  CD  A GLU A 1 166 ? 4.483   -10.733 25.425  0.29 24.18 ? 305 GLU A CD  1 
ATOM   1362 C  CD  B GLU A 1 166 ? 3.551   -10.387 26.468  0.71 24.13 ? 305 GLU A CD  1 
ATOM   1363 O  OE1 A GLU A 1 166 ? 4.212   -10.708 26.643  0.29 24.51 ? 305 GLU A OE1 1 
ATOM   1364 O  OE1 B GLU A 1 166 ? 2.389   -10.581 26.876  0.71 22.04 ? 305 GLU A OE1 1 
ATOM   1365 O  OE2 A GLU A 1 166 ? 4.503   -11.781 24.761  0.29 18.69 ? 305 GLU A OE2 1 
ATOM   1366 O  OE2 B GLU A 1 166 ? 4.291   -11.319 26.098  0.71 29.04 ? 305 GLU A OE2 1 
ATOM   1367 N  N   . THR A 1 167 ? 2.361   -5.747  25.469  1.00 11.19 ? 306 THR A N   1 
ATOM   1368 C  CA  . THR A 1 167 ? 1.501   -4.933  26.305  1.00 11.88 ? 306 THR A CA  1 
ATOM   1369 C  C   . THR A 1 167 ? 0.059   -5.389  26.098  1.00 16.31 ? 306 THR A C   1 
ATOM   1370 O  O   . THR A 1 167 ? -0.223  -6.132  25.174  1.00 14.58 ? 306 THR A O   1 
ATOM   1371 C  CB  . THR A 1 167 ? 1.666   -3.436  25.981  1.00 14.49 ? 306 THR A CB  1 
ATOM   1372 O  OG1 . THR A 1 167 ? 1.038   -2.646  26.998  1.00 16.49 ? 306 THR A OG1 1 
ATOM   1373 C  CG2 . THR A 1 167 ? 1.076   -3.085  24.624  1.00 14.68 ? 306 THR A CG2 1 
ATOM   1374 N  N   . GLN A 1 168 ? -0.836  -4.977  26.981  1.00 14.90 ? 307 GLN A N   1 
ATOM   1375 C  CA  . GLN A 1 168 ? -2.255  -5.309  26.852  1.00 14.78 ? 307 GLN A CA  1 
ATOM   1376 C  C   . GLN A 1 168 ? -3.042  -4.083  26.412  1.00 16.30 ? 307 GLN A C   1 
ATOM   1377 O  O   . GLN A 1 168 ? -2.836  -2.980  26.935  1.00 17.22 ? 307 GLN A O   1 
ATOM   1378 C  CB  . GLN A 1 168 ? -2.793  -5.853  28.181  1.00 17.61 ? 307 GLN A CB  1 
ATOM   1379 C  CG  . GLN A 1 168 ? -2.110  -7.134  28.643  1.00 18.49 ? 307 GLN A CG  1 
ATOM   1380 C  CD  . GLN A 1 168 ? -2.617  -8.359  27.919  1.00 27.03 ? 307 GLN A CD  1 
ATOM   1381 O  OE1 . GLN A 1 168 ? -3.828  -8.571  27.799  1.00 32.41 ? 307 GLN A OE1 1 
ATOM   1382 N  NE2 . GLN A 1 168 ? -1.697  -9.165  27.415  1.00 23.10 ? 307 GLN A NE2 1 
ATOM   1383 N  N   . VAL A 1 169 ? -3.934  -4.249  25.437  1.00 12.93 ? 308 VAL A N   1 
ATOM   1384 C  CA  . VAL A 1 169 ? -4.694  -3.114  24.924  1.00 13.49 ? 308 VAL A CA  1 
ATOM   1385 C  C   . VAL A 1 169 ? -6.200  -3.393  24.969  1.00 14.06 ? 308 VAL A C   1 
ATOM   1386 O  O   . VAL A 1 169 ? -6.610  -4.538  24.940  1.00 14.57 ? 308 VAL A O   1 
ATOM   1387 C  CB  . VAL A 1 169 ? -4.289  -2.744  23.452  1.00 14.09 ? 308 VAL A CB  1 
ATOM   1388 C  CG1 . VAL A 1 169 ? -2.798  -2.462  23.378  1.00 14.21 ? 308 VAL A CG1 1 
ATOM   1389 C  CG2 . VAL A 1 169 ? -4.674  -3.853  22.464  1.00 15.39 ? 308 VAL A CG2 1 
ATOM   1390 N  N   . PRO A 1 170 ? -7.018  -2.334  25.049  1.00 15.07 ? 309 PRO A N   1 
ATOM   1391 C  CA  . PRO A 1 170 ? -8.475  -2.534  25.014  1.00 14.74 ? 309 PRO A CA  1 
ATOM   1392 C  C   . PRO A 1 170 ? -8.962  -3.238  23.748  1.00 15.23 ? 309 PRO A C   1 
ATOM   1393 O  O   . PRO A 1 170 ? -8.398  -3.073  22.670  1.00 15.97 ? 309 PRO A O   1 
ATOM   1394 C  CB  . PRO A 1 170 ? -9.029  -1.103  25.060  1.00 18.00 ? 309 PRO A CB  1 
ATOM   1395 C  CG  . PRO A 1 170 ? -7.931  -0.291  25.704  1.00 20.37 ? 309 PRO A CG  1 
ATOM   1396 C  CD  . PRO A 1 170 ? -6.651  -0.918  25.239  1.00 17.61 ? 309 PRO A CD  1 
ATOM   1397 N  N   . GLY A 1 171 ? -10.008 -4.040  23.897  1.00 16.70 ? 310 GLY A N   1 
ATOM   1398 C  CA  . GLY A 1 171 ? -10.701 -4.586  22.747  1.00 14.41 ? 310 GLY A CA  1 
ATOM   1399 C  C   . GLY A 1 171 ? -11.198 -3.457  21.878  1.00 15.26 ? 310 GLY A C   1 
ATOM   1400 O  O   . GLY A 1 171 ? -11.464 -2.345  22.357  1.00 17.46 ? 310 GLY A O   1 
ATOM   1401 N  N   . LEU A 1 172 ? -11.322 -3.738  20.588  1.00 12.68 ? 311 LEU A N   1 
ATOM   1402 C  CA  . LEU A 1 172 ? -11.766 -2.752  19.626  1.00 12.07 ? 311 LEU A CA  1 
ATOM   1403 C  C   . LEU A 1 172 ? -12.497 -3.473  18.505  1.00 15.13 ? 311 LEU A C   1 
ATOM   1404 O  O   . LEU A 1 172 ? -12.488 -4.700  18.447  1.00 17.97 ? 311 LEU A O   1 
ATOM   1405 C  CB  . LEU A 1 172 ? -10.594 -1.942  19.061  1.00 16.80 ? 311 LEU A CB  1 
ATOM   1406 C  CG  . LEU A 1 172 ? -9.581  -2.652  18.149  1.00 19.06 ? 311 LEU A CG  1 
ATOM   1407 C  CD1 . LEU A 1 172 ? -8.777  -1.640  17.368  1.00 29.24 ? 311 LEU A CD1 1 
ATOM   1408 C  CD2 . LEU A 1 172 ? -8.643  -3.552  18.924  1.00 17.12 ? 311 LEU A CD2 1 
ATOM   1409 N  N   . ASP A 1 173 ? -13.128 -2.697  17.635  1.00 14.04 ? 312 ASP A N   1 
ATOM   1410 C  CA  . ASP A 1 173 ? -13.776 -3.243  16.455  1.00 15.75 ? 312 ASP A CA  1 
ATOM   1411 C  C   . ASP A 1 173 ? -12.725 -3.615  15.414  1.00 11.76 ? 312 ASP A C   1 
ATOM   1412 O  O   . ASP A 1 173 ? -12.217 -2.747  14.706  1.00 15.52 ? 312 ASP A O   1 
ATOM   1413 C  CB  . ASP A 1 173 ? -14.771 -2.225  15.890  1.00 17.11 ? 312 ASP A CB  1 
ATOM   1414 C  CG  . ASP A 1 173 ? -15.501 -2.729  14.658  1.00 20.53 ? 312 ASP A CG  1 
ATOM   1415 O  OD1 . ASP A 1 173 ? -15.285 -3.892  14.243  1.00 18.28 ? 312 ASP A OD1 1 
ATOM   1416 O  OD2 . ASP A 1 173 ? -16.323 -1.953  14.125  1.00 22.71 ? 312 ASP A OD2 1 
ATOM   1417 N  N   . ILE A 1 174 ? -12.421 -4.907  15.334  1.00 10.87 ? 313 ILE A N   1 
ATOM   1418 C  CA  . ILE A 1 174 ? -11.388 -5.402  14.425  1.00 11.56 ? 313 ILE A CA  1 
ATOM   1419 C  C   . ILE A 1 174 ? -11.760 -5.109  12.966  1.00 12.42 ? 313 ILE A C   1 
ATOM   1420 O  O   . ILE A 1 174 ? -10.886 -4.823  12.138  1.00 12.61 ? 313 ILE A O   1 
ATOM   1421 C  CB  . ILE A 1 174 ? -11.159 -6.921  14.637  1.00 11.65 ? 313 ILE A CB  1 
ATOM   1422 C  CG1 . ILE A 1 174 ? -10.758 -7.218  16.085  1.00 14.44 ? 313 ILE A CG1 1 
ATOM   1423 C  CG2 . ILE A 1 174 ? -10.078 -7.463  13.694  1.00 11.96 ? 313 ILE A CG2 1 
ATOM   1424 C  CD1 . ILE A 1 174 ? -9.471  -6.467  16.553  1.00 14.06 ? 313 ILE A CD1 1 
ATOM   1425 N  N   . SER A 1 175 ? -13.052 -5.138  12.636  1.00 15.36 ? 314 SER A N   1 
ATOM   1426 C  CA  . SER A 1 175 ? -13.448 -4.839  11.253  1.00 17.01 ? 314 SER A CA  1 
ATOM   1427 C  C   . SER A 1 175 ? -13.205 -3.374  10.871  1.00 13.92 ? 314 SER A C   1 
ATOM   1428 O  O   . SER A 1 175 ? -13.118 -3.051  9.686   1.00 16.39 ? 314 SER A O   1 
ATOM   1429 C  CB  A SER A 1 175 ? -14.925 -5.169  11.032  0.38 20.64 ? 314 SER A CB  1 
ATOM   1430 C  CB  B SER A 1 175 ? -14.914 -5.227  11.008  0.62 20.93 ? 314 SER A CB  1 
ATOM   1431 O  OG  A SER A 1 175 ? -15.155 -6.554  11.142  0.38 20.65 ? 314 SER A OG  1 
ATOM   1432 O  OG  B SER A 1 175 ? -15.806 -4.346  11.654  0.62 18.25 ? 314 SER A OG  1 
ATOM   1433 N  N   . ALA A 1 176 ? -13.082 -2.487  11.860  1.00 13.22 ? 315 ALA A N   1 
ATOM   1434 C  CA  . ALA A 1 176 ? -12.796 -1.083  11.569  1.00 12.25 ? 315 ALA A CA  1 
ATOM   1435 C  C   . ALA A 1 176 ? -11.342 -0.881  11.111  1.00 14.22 ? 315 ALA A C   1 
ATOM   1436 O  O   . ALA A 1 176 ? -10.974 0.213   10.683  1.00 18.08 ? 315 ALA A O   1 
ATOM   1437 C  CB  . ALA A 1 176 ? -13.098 -0.212  12.778  1.00 14.78 ? 315 ALA A CB  1 
ATOM   1438 N  N   . LEU A 1 177 ? -10.531 -1.938  11.203  1.00 12.58 ? 316 LEU A N   1 
ATOM   1439 C  CA  . LEU A 1 177 ? -9.162  -1.934  10.660  1.00 12.06 ? 316 LEU A CA  1 
ATOM   1440 C  C   . LEU A 1 177 ? -9.149  -2.380  9.197   1.00 14.30 ? 316 LEU A C   1 
ATOM   1441 O  O   . LEU A 1 177 ? -8.107  -2.353  8.540   1.00 14.07 ? 316 LEU A O   1 
ATOM   1442 C  CB  . LEU A 1 177 ? -8.253  -2.864  11.466  1.00 10.53 ? 316 LEU A CB  1 
ATOM   1443 C  CG  . LEU A 1 177 ? -8.100  -2.557  12.955  1.00 12.24 ? 316 LEU A CG  1 
ATOM   1444 C  CD1 . LEU A 1 177 ? -7.366  -3.688  13.648  1.00 14.14 ? 316 LEU A CD1 1 
ATOM   1445 C  CD2 . LEU A 1 177 ? -7.377  -1.207  13.165  1.00 12.57 ? 316 LEU A CD2 1 
ATOM   1446 N  N   . LEU A 1 178 ? -10.311 -2.803  8.703   1.00 12.28 ? 317 LEU A N   1 
ATOM   1447 C  CA  . LEU A 1 178 ? -10.437 -3.333  7.354   1.00 13.69 ? 317 LEU A CA  1 
ATOM   1448 C  C   . LEU A 1 178 ? -11.317 -2.418  6.507   1.00 14.18 ? 317 LEU A C   1 
ATOM   1449 O  O   . LEU A 1 178 ? -12.069 -1.603  7.041   1.00 14.09 ? 317 LEU A O   1 
ATOM   1450 C  CB  . LEU A 1 178 ? -11.022 -4.761  7.383   1.00 13.91 ? 317 LEU A CB  1 
ATOM   1451 C  CG  . LEU A 1 178 ? -10.244 -5.814  8.170   1.00 15.52 ? 317 LEU A CG  1 
ATOM   1452 C  CD1 . LEU A 1 178 ? -10.983 -7.137  8.167   1.00 16.35 ? 317 LEU A CD1 1 
ATOM   1453 C  CD2 . LEU A 1 178 ? -8.869  -6.000  7.550   1.00 16.02 ? 317 LEU A CD2 1 
ATOM   1454 N  N   . PRO A 1 179 ? -11.225 -2.540  5.177   1.00 13.53 ? 318 PRO A N   1 
ATOM   1455 C  CA  . PRO A 1 179 ? -12.106 -1.769  4.290   1.00 14.91 ? 318 PRO A CA  1 
ATOM   1456 C  C   . PRO A 1 179 ? -13.580 -2.090  4.533   1.00 14.56 ? 318 PRO A C   1 
ATOM   1457 O  O   . PRO A 1 179 ? -13.908 -3.158  5.038   1.00 16.32 ? 318 PRO A O   1 
ATOM   1458 C  CB  . PRO A 1 179 ? -11.674 -2.219  2.888   1.00 13.74 ? 318 PRO A CB  1 
ATOM   1459 C  CG  . PRO A 1 179 ? -10.273 -2.736  3.069   1.00 13.73 ? 318 PRO A CG  1 
ATOM   1460 C  CD  . PRO A 1 179 ? -10.262 -3.362  4.421   1.00 12.73 ? 318 PRO A CD  1 
ATOM   1461 N  N   . SER A 1 180 ? -14.469 -1.176  4.160   1.00 19.85 ? 319 SER A N   1 
ATOM   1462 C  CA  . SER A 1 180 ? -15.889 -1.411  4.409   1.00 19.79 ? 319 SER A CA  1 
ATOM   1463 C  C   . SER A 1 180 ? -16.508 -2.268  3.312   1.00 16.65 ? 319 SER A C   1 
ATOM   1464 O  O   . SER A 1 180 ? -17.520 -2.929  3.533   1.00 21.49 ? 319 SER A O   1 
ATOM   1465 C  CB  . SER A 1 180 ? -16.646 -0.083  4.531   1.00 23.45 ? 319 SER A CB  1 
ATOM   1466 O  OG  . SER A 1 180 ? -16.380 0.749   3.423   1.00 31.45 ? 319 SER A OG  1 
ATOM   1467 N  N   . ASP A 1 181 ? -15.891 -2.257  2.135   1.00 17.37 ? 320 ASP A N   1 
ATOM   1468 C  CA  . ASP A 1 181 ? -16.401 -3.007  0.995   1.00 19.57 ? 320 ASP A CA  1 
ATOM   1469 C  C   . ASP A 1 181 ? -15.966 -4.469  1.068   1.00 15.49 ? 320 ASP A C   1 
ATOM   1470 O  O   . ASP A 1 181 ? -14.821 -4.793  0.754   1.00 20.16 ? 320 ASP A O   1 
ATOM   1471 C  CB  . ASP A 1 181 ? -15.929 -2.354  -0.304  1.00 21.75 ? 320 ASP A CB  1 
ATOM   1472 C  CG  . ASP A 1 181 ? -16.496 -3.025  -1.544  1.00 29.37 ? 320 ASP A CG  1 
ATOM   1473 O  OD1 . ASP A 1 181 ? -16.165 -2.565  -2.656  1.00 29.07 ? 320 ASP A OD1 1 
ATOM   1474 O  OD2 . ASP A 1 181 ? -17.272 -3.995  -1.412  1.00 35.51 ? 320 ASP A OD2 1 
ATOM   1475 N  N   . PHE A 1 182 ? -16.885 -5.332  1.494   1.00 18.79 ? 321 PHE A N   1 
ATOM   1476 C  CA  . PHE A 1 182 ? -16.637 -6.770  1.592   1.00 18.26 ? 321 PHE A CA  1 
ATOM   1477 C  C   . PHE A 1 182 ? -16.994 -7.521  0.317   1.00 15.02 ? 321 PHE A C   1 
ATOM   1478 O  O   . PHE A 1 182 ? -16.892 -8.751  0.277   1.00 16.05 ? 321 PHE A O   1 
ATOM   1479 C  CB  . PHE A 1 182 ? -17.438 -7.389  2.745   1.00 18.23 ? 321 PHE A CB  1 
ATOM   1480 C  CG  . PHE A 1 182 ? -16.900 -7.077  4.116   1.00 27.81 ? 321 PHE A CG  1 
ATOM   1481 C  CD1 . PHE A 1 182 ? -17.538 -7.568  5.244   1.00 37.67 ? 321 PHE A CD1 1 
ATOM   1482 C  CD2 . PHE A 1 182 ? -15.778 -6.288  4.280   1.00 33.78 ? 321 PHE A CD2 1 
ATOM   1483 C  CE1 . PHE A 1 182 ? -17.058 -7.280  6.510   1.00 37.27 ? 321 PHE A CE1 1 
ATOM   1484 C  CE2 . PHE A 1 182 ? -15.290 -5.999  5.546   1.00 36.22 ? 321 PHE A CE2 1 
ATOM   1485 C  CZ  . PHE A 1 182 ? -15.930 -6.495  6.657   1.00 37.11 ? 321 PHE A CZ  1 
ATOM   1486 N  N   . SER A 1 183 ? -17.419 -6.801  -0.716  1.00 13.86 ? 322 SER A N   1 
ATOM   1487 C  CA  . SER A 1 183 ? -17.917 -7.478  -1.911  1.00 16.32 ? 322 SER A CA  1 
ATOM   1488 C  C   . SER A 1 183 ? -16.878 -7.554  -3.029  1.00 15.51 ? 322 SER A C   1 
ATOM   1489 O  O   . SER A 1 183 ? -16.999 -8.398  -3.924  1.00 18.15 ? 322 SER A O   1 
ATOM   1490 C  CB  A SER A 1 183 ? -19.181 -6.789  -2.443  0.64 16.62 ? 322 SER A CB  1 
ATOM   1491 C  CB  B SER A 1 183 ? -19.173 -6.770  -2.425  0.36 16.93 ? 322 SER A CB  1 
ATOM   1492 O  OG  A SER A 1 183 ? -18.868 -5.606  -3.148  0.64 18.14 ? 322 SER A OG  1 
ATOM   1493 O  OG  B SER A 1 183 ? -20.114 -6.610  -1.377  0.36 16.30 ? 322 SER A OG  1 
ATOM   1494 N  N   . ARG A 1 184 ? -15.876 -6.671  -2.995  1.00 13.45 ? 323 ARG A N   1 
ATOM   1495 C  CA  . ARG A 1 184 ? -14.899 -6.581  -4.084  1.00 13.88 ? 323 ARG A CA  1 
ATOM   1496 C  C   . ARG A 1 184 ? -13.498 -6.963  -3.622  1.00 12.12 ? 323 ARG A C   1 
ATOM   1497 O  O   . ARG A 1 184 ? -12.852 -6.222  -2.881  1.00 13.34 ? 323 ARG A O   1 
ATOM   1498 C  CB  A ARG A 1 184 ? -14.907 -5.172  -4.683  0.45 17.00 ? 323 ARG A CB  1 
ATOM   1499 C  CB  B ARG A 1 184 ? -14.885 -5.166  -4.681  0.55 16.62 ? 323 ARG A CB  1 
ATOM   1500 C  CG  A ARG A 1 184 ? -16.212 -4.860  -5.419  0.45 18.65 ? 323 ARG A CG  1 
ATOM   1501 C  CG  B ARG A 1 184 ? -16.209 -4.759  -5.341  0.55 18.87 ? 323 ARG A CG  1 
ATOM   1502 C  CD  A ARG A 1 184 ? -16.353 -3.386  -5.744  0.45 20.61 ? 323 ARG A CD  1 
ATOM   1503 C  CD  B ARG A 1 184 ? -16.136 -3.357  -5.940  0.55 18.27 ? 323 ARG A CD  1 
ATOM   1504 N  NE  A ARG A 1 184 ? -15.361 -2.928  -6.708  0.45 19.18 ? 323 ARG A NE  1 
ATOM   1505 N  NE  B ARG A 1 184 ? -17.401 -2.946  -6.549  0.55 19.69 ? 323 ARG A NE  1 
ATOM   1506 C  CZ  A ARG A 1 184 ? -15.509 -2.990  -8.027  0.45 20.13 ? 323 ARG A CZ  1 
ATOM   1507 C  CZ  B ARG A 1 184 ? -18.446 -2.485  -5.867  0.55 25.05 ? 323 ARG A CZ  1 
ATOM   1508 N  NH1 A ARG A 1 184 ? -16.613 -3.506  -8.554  0.45 25.78 ? 323 ARG A NH1 1 
ATOM   1509 N  NH1 B ARG A 1 184 ? -19.553 -2.127  -6.506  0.55 29.40 ? 323 ARG A NH1 1 
ATOM   1510 N  NH2 A ARG A 1 184 ? -14.547 -2.538  -8.820  0.45 18.46 ? 323 ARG A NH2 1 
ATOM   1511 N  NH2 B ARG A 1 184 ? -18.391 -2.387  -4.546  0.55 24.33 ? 323 ARG A NH2 1 
ATOM   1512 N  N   . TYR A 1 185 ? -13.031 -8.129  -4.054  1.00 10.03 ? 324 TYR A N   1 
ATOM   1513 C  CA  . TYR A 1 185 ? -11.739 -8.630  -3.596  1.00 9.76  ? 324 TYR A CA  1 
ATOM   1514 C  C   . TYR A 1 185 ? -11.120 -9.574  -4.610  1.00 9.48  ? 324 TYR A C   1 
ATOM   1515 O  O   . TYR A 1 185 ? -11.799 -10.037 -5.533  1.00 10.10 ? 324 TYR A O   1 
ATOM   1516 C  CB  . TYR A 1 185 ? -11.899 -9.336  -2.247  1.00 9.89  ? 324 TYR A CB  1 
ATOM   1517 C  CG  . TYR A 1 185 ? -12.940 -10.445 -2.258  1.00 10.04 ? 324 TYR A CG  1 
ATOM   1518 C  CD1 . TYR A 1 185 ? -12.616 -11.725 -2.713  1.00 9.59  ? 324 TYR A CD1 1 
ATOM   1519 C  CD2 . TYR A 1 185 ? -14.235 -10.221 -1.791  1.00 9.62  ? 324 TYR A CD2 1 
ATOM   1520 C  CE1 . TYR A 1 185 ? -13.546 -12.746 -2.713  1.00 10.74 ? 324 TYR A CE1 1 
ATOM   1521 C  CE2 . TYR A 1 185 ? -15.177 -11.240 -1.799  1.00 12.21 ? 324 TYR A CE2 1 
ATOM   1522 C  CZ  . TYR A 1 185 ? -14.828 -12.498 -2.255  1.00 11.97 ? 324 TYR A CZ  1 
ATOM   1523 O  OH  . TYR A 1 185 ? -15.760 -13.511 -2.255  1.00 12.49 ? 324 TYR A OH  1 
ATOM   1524 N  N   . PHE A 1 186 ? -9.827  -9.846  -4.422  1.00 9.10  ? 325 PHE A N   1 
ATOM   1525 C  CA  . PHE A 1 186 ? -9.091  -10.830 -5.213  1.00 9.33  ? 325 PHE A CA  1 
ATOM   1526 C  C   . PHE A 1 186 ? -8.838  -12.054 -4.350  1.00 9.78  ? 325 PHE A C   1 
ATOM   1527 O  O   . PHE A 1 186 ? -8.786  -11.945 -3.125  1.00 10.15 ? 325 PHE A O   1 
ATOM   1528 C  CB  . PHE A 1 186 ? -7.765  -10.244 -5.713  1.00 9.28  ? 325 PHE A CB  1 
ATOM   1529 C  CG  . PHE A 1 186 ? -7.936  -9.003  -6.539  1.00 9.42  ? 325 PHE A CG  1 
ATOM   1530 C  CD1 . PHE A 1 186 ? -7.757  -7.742  -5.984  1.00 12.53 ? 325 PHE A CD1 1 
ATOM   1531 C  CD2 . PHE A 1 186 ? -8.308  -9.102  -7.869  1.00 11.43 ? 325 PHE A CD2 1 
ATOM   1532 C  CE1 . PHE A 1 186 ? -7.935  -6.596  -6.761  1.00 13.37 ? 325 PHE A CE1 1 
ATOM   1533 C  CE2 . PHE A 1 186 ? -8.498  -7.964  -8.646  1.00 13.81 ? 325 PHE A CE2 1 
ATOM   1534 C  CZ  . PHE A 1 186 ? -8.311  -6.720  -8.098  1.00 13.65 ? 325 PHE A CZ  1 
ATOM   1535 N  N   . GLN A 1 187 ? -8.699  -13.225 -4.968  1.00 7.74  ? 326 GLN A N   1 
ATOM   1536 C  CA  . GLN A 1 187 ? -8.483  -14.425 -4.169  1.00 8.25  ? 326 GLN A CA  1 
ATOM   1537 C  C   . GLN A 1 187 ? -7.594  -15.411 -4.910  1.00 8.87  ? 326 GLN A C   1 
ATOM   1538 O  O   . GLN A 1 187 ? -7.773  -15.634 -6.108  1.00 9.90  ? 326 GLN A O   1 
ATOM   1539 C  CB  . GLN A 1 187 ? -9.828  -15.055 -3.822  1.00 9.82  ? 326 GLN A CB  1 
ATOM   1540 C  CG  . GLN A 1 187 ? -9.784  -16.117 -2.744  1.00 8.54  ? 326 GLN A CG  1 
ATOM   1541 C  CD  . GLN A 1 187 ? -11.191 -16.466 -2.284  1.00 9.56  ? 326 GLN A CD  1 
ATOM   1542 O  OE1 . GLN A 1 187 ? -11.867 -17.318 -2.878  1.00 10.88 ? 326 GLN A OE1 1 
ATOM   1543 N  NE2 . GLN A 1 187 ? -11.650 -15.788 -1.240  1.00 9.27  ? 326 GLN A NE2 1 
ATOM   1544 N  N   . TYR A 1 188 ? -6.617  -15.982 -4.208  1.00 8.35  ? 327 TYR A N   1 
ATOM   1545 C  CA  . TYR A 1 188 ? -5.738  -16.963 -4.833  1.00 7.61  ? 327 TYR A CA  1 
ATOM   1546 C  C   . TYR A 1 188 ? -5.164  -17.895 -3.783  1.00 8.02  ? 327 TYR A C   1 
ATOM   1547 O  O   . TYR A 1 188 ? -5.296  -17.628 -2.576  1.00 8.83  ? 327 TYR A O   1 
ATOM   1548 C  CB  . TYR A 1 188 ? -4.616  -16.267 -5.615  1.00 8.89  ? 327 TYR A CB  1 
ATOM   1549 C  CG  . TYR A 1 188 ? -3.526  -15.686 -4.750  1.00 7.59  ? 327 TYR A CG  1 
ATOM   1550 C  CD1 . TYR A 1 188 ? -2.328  -16.384 -4.555  1.00 5.90  ? 327 TYR A CD1 1 
ATOM   1551 C  CD2 . TYR A 1 188 ? -3.675  -14.446 -4.132  1.00 8.61  ? 327 TYR A CD2 1 
ATOM   1552 C  CE1 . TYR A 1 188 ? -1.313  -15.861 -3.767  1.00 8.55  ? 327 TYR A CE1 1 
ATOM   1553 C  CE2 . TYR A 1 188 ? -2.663  -13.912 -3.334  1.00 8.62  ? 327 TYR A CE2 1 
ATOM   1554 C  CZ  . TYR A 1 188 ? -1.483  -14.630 -3.158  1.00 7.49  ? 327 TYR A CZ  1 
ATOM   1555 O  OH  . TYR A 1 188 ? -0.473  -14.140 -2.366  1.00 10.11 ? 327 TYR A OH  1 
ATOM   1556 N  N   . GLU A 1 189 ? -4.512  -18.969 -4.227  1.00 8.56  ? 328 GLU A N   1 
ATOM   1557 C  CA  . GLU A 1 189 ? -3.911  -19.911 -3.287  1.00 8.99  ? 328 GLU A CA  1 
ATOM   1558 C  C   . GLU A 1 189 ? -2.395  -19.723 -3.243  1.00 10.95 ? 328 GLU A C   1 
ATOM   1559 O  O   . GLU A 1 189 ? -1.741  -19.696 -4.288  1.00 10.58 ? 328 GLU A O   1 
ATOM   1560 C  CB  . GLU A 1 189 ? -4.269  -21.358 -3.663  1.00 10.47 ? 328 GLU A CB  1 
ATOM   1561 C  CG  . GLU A 1 189 ? -3.922  -22.345 -2.550  1.00 16.18 ? 328 GLU A CG  1 
ATOM   1562 C  CD  . GLU A 1 189 ? -4.496  -23.724 -2.778  1.00 30.76 ? 328 GLU A CD  1 
ATOM   1563 O  OE1 . GLU A 1 189 ? -3.886  -24.697 -2.302  1.00 28.12 ? 328 GLU A OE1 1 
ATOM   1564 O  OE2 . GLU A 1 189 ? -5.573  -23.835 -3.401  1.00 40.40 ? 328 GLU A OE2 1 
ATOM   1565 N  N   . GLY A 1 190 ? -1.847  -19.586 -2.037  1.00 8.54  ? 329 GLY A N   1 
ATOM   1566 C  CA  . GLY A 1 190 ? -0.421  -19.332 -1.886  1.00 8.24  ? 329 GLY A CA  1 
ATOM   1567 C  C   . GLY A 1 190 ? 0.125   -19.894 -0.585  1.00 9.44  ? 329 GLY A C   1 
ATOM   1568 O  O   . GLY A 1 190 ? -0.222  -21.013 -0.186  1.00 10.00 ? 329 GLY A O   1 
ATOM   1569 N  N   . SER A 1 191 ? 0.960   -19.107 0.088   1.00 8.17  ? 330 SER A N   1 
ATOM   1570 C  CA  . SER A 1 191 ? 1.715   -19.606 1.247   1.00 8.68  ? 330 SER A CA  1 
ATOM   1571 C  C   . SER A 1 191 ? 1.685   -18.602 2.381   1.00 9.32  ? 330 SER A C   1 
ATOM   1572 O  O   . SER A 1 191 ? 1.303   -17.441 2.192   1.00 9.03  ? 330 SER A O   1 
ATOM   1573 C  CB  . SER A 1 191 ? 3.186   -19.885 0.864   1.00 9.25  ? 330 SER A CB  1 
ATOM   1574 O  OG  . SER A 1 191 ? 3.934   -18.669 0.728   1.00 8.54  ? 330 SER A OG  1 
ATOM   1575 N  N   . LEU A 1 192 ? 2.135   -19.030 3.554   1.00 8.39  ? 331 LEU A N   1 
ATOM   1576 C  CA  . LEU A 1 192 ? 2.514   -18.072 4.593   1.00 8.75  ? 331 LEU A CA  1 
ATOM   1577 C  C   . LEU A 1 192 ? 3.657   -17.239 4.043   1.00 9.43  ? 331 LEU A C   1 
ATOM   1578 O  O   . LEU A 1 192 ? 4.467   -17.766 3.277   1.00 10.81 ? 331 LEU A O   1 
ATOM   1579 C  CB  . LEU A 1 192 ? 2.945   -18.802 5.865   1.00 10.70 ? 331 LEU A CB  1 
ATOM   1580 C  CG  . LEU A 1 192 ? 1.853   -19.717 6.417   1.00 12.50 ? 331 LEU A CG  1 
ATOM   1581 C  CD1 . LEU A 1 192 ? 2.385   -20.501 7.622   1.00 17.08 ? 331 LEU A CD1 1 
ATOM   1582 C  CD2 . LEU A 1 192 ? 0.653   -18.894 6.820   1.00 15.03 ? 331 LEU A CD2 1 
ATOM   1583 N  N   . THR A 1 193 ? 3.748   -15.955 4.407   1.00 7.18  ? 332 THR A N   1 
ATOM   1584 C  CA  . THR A 1 193 ? 4.824   -15.136 3.842   1.00 6.78  ? 332 THR A CA  1 
ATOM   1585 C  C   . THR A 1 193 ? 6.027   -15.042 4.766   1.00 6.95  ? 332 THR A C   1 
ATOM   1586 O  O   . THR A 1 193 ? 6.933   -14.246 4.515   1.00 10.25 ? 332 THR A O   1 
ATOM   1587 C  CB  . THR A 1 193 ? 4.383   -13.695 3.481   1.00 9.32  ? 332 THR A CB  1 
ATOM   1588 O  OG1 . THR A 1 193 ? 4.143   -12.931 4.676   1.00 9.31  ? 332 THR A OG1 1 
ATOM   1589 C  CG2 . THR A 1 193 ? 3.121   -13.694 2.579   1.00 7.10  ? 332 THR A CG2 1 
ATOM   1590 N  N   . THR A 1 194 ? 6.017   -15.833 5.831   1.00 8.87  ? 333 THR A N   1 
ATOM   1591 C  CA  . THR A 1 194 ? 7.183   -16.000 6.704   1.00 9.03  ? 333 THR A CA  1 
ATOM   1592 C  C   . THR A 1 194 ? 7.448   -17.477 6.916   1.00 9.65  ? 333 THR A C   1 
ATOM   1593 O  O   . THR A 1 194 ? 6.552   -18.297 6.721   1.00 11.79 ? 333 THR A O   1 
ATOM   1594 C  CB  . THR A 1 194 ? 6.978   -15.314 8.067   1.00 9.50  ? 333 THR A CB  1 
ATOM   1595 O  OG1 . THR A 1 194 ? 5.741   -15.751 8.657   1.00 10.67 ? 333 THR A OG1 1 
ATOM   1596 C  CG2 . THR A 1 194 ? 6.964   -13.814 7.895   1.00 9.30  ? 333 THR A CG2 1 
ATOM   1597 N  N   . PRO A 1 195 ? 8.681   -17.833 7.323   1.00 9.84  ? 334 PRO A N   1 
ATOM   1598 C  CA  . PRO A 1 195 ? 8.933   -19.253 7.603   1.00 13.25 ? 334 PRO A CA  1 
ATOM   1599 C  C   . PRO A 1 195 ? 7.893   -19.791 8.586   1.00 13.16 ? 334 PRO A C   1 
ATOM   1600 O  O   . PRO A 1 195 ? 7.523   -19.105 9.546   1.00 13.15 ? 334 PRO A O   1 
ATOM   1601 C  CB  . PRO A 1 195 ? 10.347  -19.248 8.193   1.00 11.33 ? 334 PRO A CB  1 
ATOM   1602 C  CG  . PRO A 1 195 ? 11.009  -18.061 7.522   1.00 12.87 ? 334 PRO A CG  1 
ATOM   1603 C  CD  . PRO A 1 195 ? 9.903   -17.015 7.431   1.00 11.54 ? 334 PRO A CD  1 
ATOM   1604 N  N   . PRO A 1 196 ? 7.394   -21.009 8.359   1.00 13.60 ? 335 PRO A N   1 
ATOM   1605 C  CA  . PRO A 1 196 ? 7.874   -22.042 7.438   1.00 13.79 ? 335 PRO A CA  1 
ATOM   1606 C  C   . PRO A 1 196 ? 7.350   -21.963 6.000   1.00 14.33 ? 335 PRO A C   1 
ATOM   1607 O  O   . PRO A 1 196 ? 7.576   -22.914 5.248   1.00 12.31 ? 335 PRO A O   1 
ATOM   1608 C  CB  . PRO A 1 196 ? 7.377   -23.331 8.108   1.00 16.00 ? 335 PRO A CB  1 
ATOM   1609 C  CG  . PRO A 1 196 ? 6.099   -22.936 8.731   1.00 19.54 ? 335 PRO A CG  1 
ATOM   1610 C  CD  . PRO A 1 196 ? 6.317   -21.518 9.231   1.00 14.13 ? 335 PRO A CD  1 
ATOM   1611 N  N   . CYS A 1 197 ? 6.650   -20.890 5.635   1.00 9.89  ? 336 CYS A N   1 
ATOM   1612 C  CA  . CYS A 1 197 ? 6.200   -20.710 4.245   1.00 10.62 ? 336 CYS A CA  1 
ATOM   1613 C  C   . CYS A 1 197 ? 5.306   -21.817 3.719   1.00 10.64 ? 336 CYS A C   1 
ATOM   1614 O  O   . CYS A 1 197 ? 5.354   -22.134 2.519   1.00 11.94 ? 336 CYS A O   1 
ATOM   1615 C  CB  . CYS A 1 197 ? 7.391   -20.581 3.289   1.00 13.71 ? 336 CYS A CB  1 
ATOM   1616 S  SG  . CYS A 1 197 ? 8.597   -19.282 3.719   1.00 12.14 ? 336 CYS A SG  1 
ATOM   1617 N  N   . ALA A 1 198 ? 4.494   -22.400 4.599   1.00 12.00 ? 337 ALA A N   1 
ATOM   1618 C  CA  . ALA A 1 198 ? 3.625   -23.512 4.218   1.00 10.03 ? 337 ALA A CA  1 
ATOM   1619 C  C   . ALA A 1 198 ? 2.627   -23.092 3.140   1.00 11.11 ? 337 ALA A C   1 
ATOM   1620 O  O   . ALA A 1 198 ? 2.069   -21.997 3.204   1.00 11.00 ? 337 ALA A O   1 
ATOM   1621 C  CB  . ALA A 1 198 ? 2.882   -24.046 5.435   1.00 14.17 ? 337 ALA A CB  1 
ATOM   1622 N  N   . GLN A 1 199 ? 2.411   -23.963 2.156   1.00 11.26 ? 338 GLN A N   1 
ATOM   1623 C  CA  . GLN A 1 199 ? 1.485   -23.664 1.058   1.00 11.29 ? 338 GLN A CA  1 
ATOM   1624 C  C   . GLN A 1 199 ? 0.053   -24.110 1.390   1.00 10.92 ? 338 GLN A C   1 
ATOM   1625 O  O   . GLN A 1 199 ? -0.224  -24.555 2.501   1.00 13.64 ? 338 GLN A O   1 
ATOM   1626 C  CB  . GLN A 1 199 ? 1.999   -24.298 -0.248  1.00 12.01 ? 338 GLN A CB  1 
ATOM   1627 C  CG  . GLN A 1 199 ? 3.220   -23.518 -0.723  1.00 10.83 ? 338 GLN A CG  1 
ATOM   1628 C  CD  . GLN A 1 199 ? 3.905   -24.017 -1.989  1.00 11.35 ? 338 GLN A CD  1 
ATOM   1629 O  OE1 . GLN A 1 199 ? 4.810   -23.346 -2.492  1.00 12.24 ? 338 GLN A OE1 1 
ATOM   1630 N  NE2 . GLN A 1 199 ? 3.510   -25.187 -2.489  1.00 12.79 ? 338 GLN A NE2 1 
ATOM   1631 N  N   . GLY A 1 200 ? -0.865  -23.924 0.444   1.00 11.15 ? 339 GLY A N   1 
ATOM   1632 C  CA  . GLY A 1 200 ? -2.265  -24.246 0.692   1.00 12.12 ? 339 GLY A CA  1 
ATOM   1633 C  C   . GLY A 1 200 ? -3.057  -23.148 1.394   1.00 14.30 ? 339 GLY A C   1 
ATOM   1634 O  O   . GLY A 1 200 ? -4.185  -23.385 1.840   1.00 13.90 ? 339 GLY A O   1 
ATOM   1635 N  N   . VAL A 1 201 ? -2.461  -21.967 1.534   1.00 9.17  ? 340 VAL A N   1 
ATOM   1636 C  CA  . VAL A 1 201 ? -3.123  -20.839 2.204   1.00 7.06  ? 340 VAL A CA  1 
ATOM   1637 C  C   . VAL A 1 201 ? -4.044  -20.088 1.245   1.00 10.37 ? 340 VAL A C   1 
ATOM   1638 O  O   . VAL A 1 201 ? -3.637  -19.756 0.140   1.00 10.84 ? 340 VAL A O   1 
ATOM   1639 C  CB  . VAL A 1 201 ? -2.080  -19.862 2.801   1.00 7.12  ? 340 VAL A CB  1 
ATOM   1640 C  CG1 . VAL A 1 201 ? -2.761  -18.682 3.508   1.00 10.42 ? 340 VAL A CG1 1 
ATOM   1641 C  CG2 . VAL A 1 201 ? -1.180  -20.597 3.785   1.00 10.72 ? 340 VAL A CG2 1 
ATOM   1642 N  N   . ILE A 1 202 ? -5.285  -19.834 1.658   1.00 9.10  ? 341 ILE A N   1 
ATOM   1643 C  CA  . ILE A 1 202 ? -6.193  -19.052 0.821   1.00 9.23  ? 341 ILE A CA  1 
ATOM   1644 C  C   . ILE A 1 202 ? -6.045  -17.575 1.141   1.00 11.01 ? 341 ILE A C   1 
ATOM   1645 O  O   . ILE A 1 202 ? -6.356  -17.147 2.255   1.00 9.66  ? 341 ILE A O   1 
ATOM   1646 C  CB  A ILE A 1 202 ? -7.654  -19.469 1.009   0.32 10.84 ? 341 ILE A CB  1 
ATOM   1647 C  CB  B ILE A 1 202 ? -7.663  -19.459 1.018   0.68 10.15 ? 341 ILE A CB  1 
ATOM   1648 C  CG1 A ILE A 1 202 ? -7.816  -20.951 0.682   0.32 13.63 ? 341 ILE A CG1 1 
ATOM   1649 C  CG1 B ILE A 1 202 ? -7.799  -20.981 0.980   0.68 14.29 ? 341 ILE A CG1 1 
ATOM   1650 C  CG2 A ILE A 1 202 ? -8.561  -18.624 0.121   0.32 10.55 ? 341 ILE A CG2 1 
ATOM   1651 C  CG2 B ILE A 1 202 ? -8.549  -18.790 -0.040  0.68 10.36 ? 341 ILE A CG2 1 
ATOM   1652 C  CD1 A ILE A 1 202 ? -9.203  -21.470 0.927   0.32 12.66 ? 341 ILE A CD1 1 
ATOM   1653 C  CD1 B ILE A 1 202 ? -7.203  -21.615 -0.253  0.68 16.02 ? 341 ILE A CD1 1 
ATOM   1654 N  N   . TRP A 1 203 ? -5.592  -16.803 0.155   1.00 8.84  ? 342 TRP A N   1 
ATOM   1655 C  CA  . TRP A 1 203 ? -5.404  -15.362 0.309   1.00 6.87  ? 342 TRP A CA  1 
ATOM   1656 C  C   . TRP A 1 203 ? -6.560  -14.597 -0.304  1.00 8.44  ? 342 TRP A C   1 
ATOM   1657 O  O   . TRP A 1 203 ? -6.936  -14.858 -1.437  1.00 10.33 ? 342 TRP A O   1 
ATOM   1658 C  CB  . TRP A 1 203 ? -4.098  -14.913 -0.362  1.00 8.90  ? 342 TRP A CB  1 
ATOM   1659 C  CG  . TRP A 1 203 ? -2.906  -15.248 0.457   1.00 8.27  ? 342 TRP A CG  1 
ATOM   1660 C  CD1 . TRP A 1 203 ? -2.184  -16.413 0.435   1.00 9.89  ? 342 TRP A CD1 1 
ATOM   1661 C  CD2 . TRP A 1 203 ? -2.309  -14.418 1.439   1.00 7.61  ? 342 TRP A CD2 1 
ATOM   1662 N  NE1 . TRP A 1 203 ? -1.170  -16.355 1.367   1.00 8.52  ? 342 TRP A NE1 1 
ATOM   1663 C  CE2 . TRP A 1 203 ? -1.232  -15.137 1.997   1.00 7.59  ? 342 TRP A CE2 1 
ATOM   1664 C  CE3 . TRP A 1 203 ? -2.591  -13.131 1.921   1.00 9.57  ? 342 TRP A CE3 1 
ATOM   1665 C  CZ2 . TRP A 1 203 ? -0.421  -14.604 3.006   1.00 9.10  ? 342 TRP A CZ2 1 
ATOM   1666 C  CZ3 . TRP A 1 203 ? -1.780  -12.596 2.903   1.00 9.24  ? 342 TRP A CZ3 1 
ATOM   1667 C  CH2 . TRP A 1 203 ? -0.713  -13.336 3.447   1.00 9.55  ? 342 TRP A CH2 1 
ATOM   1668 N  N   . THR A 1 204 ? -7.095  -13.642 0.451   1.00 7.87  ? 343 THR A N   1 
ATOM   1669 C  CA  . THR A 1 204 ? -8.147  -12.750 -0.026  1.00 6.72  ? 343 THR A CA  1 
ATOM   1670 C  C   . THR A 1 204 ? -7.632  -11.342 0.169   1.00 8.32  ? 343 THR A C   1 
ATOM   1671 O  O   . THR A 1 204 ? -7.326  -10.962 1.299   1.00 9.78  ? 343 THR A O   1 
ATOM   1672 C  CB  . THR A 1 204 ? -9.458  -12.962 0.753   1.00 9.73  ? 343 THR A CB  1 
ATOM   1673 O  OG1 . THR A 1 204 ? -9.887  -14.318 0.575   1.00 9.63  ? 343 THR A OG1 1 
ATOM   1674 C  CG2 . THR A 1 204 ? -10.568 -12.003 0.287   1.00 9.94  ? 343 THR A CG2 1 
ATOM   1675 N  N   . VAL A 1 205 ? -7.502  -10.596 -0.932  1.00 7.70  ? 344 VAL A N   1 
ATOM   1676 C  CA  . VAL A 1 205 ? -6.973  -9.237  -0.886  1.00 8.15  ? 344 VAL A CA  1 
ATOM   1677 C  C   . VAL A 1 205 ? -8.080  -8.251  -1.270  1.00 10.56 ? 344 VAL A C   1 
ATOM   1678 O  O   . VAL A 1 205 ? -8.622  -8.318  -2.374  1.00 11.18 ? 344 VAL A O   1 
ATOM   1679 C  CB  . VAL A 1 205 ? -5.760  -9.077  -1.835  1.00 9.03  ? 344 VAL A CB  1 
ATOM   1680 C  CG1 . VAL A 1 205 ? -5.186  -7.669  -1.750  1.00 11.66 ? 344 VAL A CG1 1 
ATOM   1681 C  CG2 . VAL A 1 205 ? -4.673  -10.109 -1.509  1.00 10.61 ? 344 VAL A CG2 1 
ATOM   1682 N  N   . PHE A 1 206 ? -8.423  -7.351  -0.350  1.00 10.16 ? 345 PHE A N   1 
ATOM   1683 C  CA  . PHE A 1 206 ? -9.465  -6.352  -0.619  1.00 12.21 ? 345 PHE A CA  1 
ATOM   1684 C  C   . PHE A 1 206 ? -9.086  -5.462  -1.800  1.00 10.96 ? 345 PHE A C   1 
ATOM   1685 O  O   . PHE A 1 206 ? -7.926  -5.081  -1.956  1.00 11.23 ? 345 PHE A O   1 
ATOM   1686 C  CB  . PHE A 1 206 ? -9.705  -5.463  0.600   1.00 11.40 ? 345 PHE A CB  1 
ATOM   1687 C  CG  . PHE A 1 206 ? -10.454 -6.122  1.718   1.00 13.45 ? 345 PHE A CG  1 
ATOM   1688 C  CD1 . PHE A 1 206 ? -9.786  -6.824  2.704   1.00 11.64 ? 345 PHE A CD1 1 
ATOM   1689 C  CD2 . PHE A 1 206 ? -11.821 -5.976  1.821   1.00 18.15 ? 345 PHE A CD2 1 
ATOM   1690 C  CE1 . PHE A 1 206 ? -10.478 -7.409  3.759   1.00 16.94 ? 345 PHE A CE1 1 
ATOM   1691 C  CE2 . PHE A 1 206 ? -12.518 -6.549  2.879   1.00 20.16 ? 345 PHE A CE2 1 
ATOM   1692 C  CZ  . PHE A 1 206 ? -11.839 -7.267  3.848   1.00 17.48 ? 345 PHE A CZ  1 
ATOM   1693 N  N   . ASN A 1 207 ? -10.070 -5.123  -2.630  1.00 11.09 ? 346 ASN A N   1 
ATOM   1694 C  CA  . ASN A 1 207 ? -9.852  -4.144  -3.689  1.00 12.34 ? 346 ASN A CA  1 
ATOM   1695 C  C   . ASN A 1 207 ? -9.761  -2.721  -3.117  1.00 12.36 ? 346 ASN A C   1 
ATOM   1696 O  O   . ASN A 1 207 ? -8.925  -1.927  -3.531  1.00 15.54 ? 346 ASN A O   1 
ATOM   1697 C  CB  . ASN A 1 207 ? -10.981 -4.235  -4.722  1.00 14.96 ? 346 ASN A CB  1 
ATOM   1698 C  CG  . ASN A 1 207 ? -10.796 -3.271  -5.876  1.00 19.60 ? 346 ASN A CG  1 
ATOM   1699 O  OD1 . ASN A 1 207 ? -11.618 -2.373  -6.080  1.00 28.36 ? 346 ASN A OD1 1 
ATOM   1700 N  ND2 . ASN A 1 207 ? -9.722  -3.443  -6.630  1.00 14.85 ? 346 ASN A ND2 1 
ATOM   1701 N  N   . GLN A 1 208 ? -10.624 -2.435  -2.150  1.00 12.43 ? 347 GLN A N   1 
ATOM   1702 C  CA  . GLN A 1 208 ? -10.631 -1.150  -1.453  1.00 16.36 ? 347 GLN A CA  1 
ATOM   1703 C  C   . GLN A 1 208 ? -9.492  -1.107  -0.435  1.00 16.15 ? 347 GLN A C   1 
ATOM   1704 O  O   . GLN A 1 208 ? -9.175  -2.123  0.184   1.00 13.50 ? 347 GLN A O   1 
ATOM   1705 C  CB  . GLN A 1 208 ? -11.972 -0.921  -0.756  1.00 18.13 ? 347 GLN A CB  1 
ATOM   1706 C  CG  . GLN A 1 208 ? -12.129 0.469   -0.132  1.00 17.18 ? 347 GLN A CG  1 
ATOM   1707 C  CD  . GLN A 1 208 ? -13.483 0.668   0.540   1.00 21.75 ? 347 GLN A CD  1 
ATOM   1708 O  OE1 . GLN A 1 208 ? -13.925 -0.159  1.333   1.00 25.54 ? 347 GLN A OE1 1 
ATOM   1709 N  NE2 . GLN A 1 208 ? -14.157 1.760   0.200   1.00 33.62 ? 347 GLN A NE2 1 
ATOM   1710 N  N   . THR A 1 209 ? -8.877  0.062   -0.276  1.00 13.39 ? 348 THR A N   1 
ATOM   1711 C  CA  . THR A 1 209 ? -7.805  0.223   0.703   1.00 13.15 ? 348 THR A CA  1 
ATOM   1712 C  C   . THR A 1 209 ? -8.299  0.867   1.997   1.00 15.00 ? 348 THR A C   1 
ATOM   1713 O  O   . THR A 1 209 ? -9.460  1.275   2.112   1.00 16.74 ? 348 THR A O   1 
ATOM   1714 C  CB  . THR A 1 209 ? -6.661  1.089   0.149   1.00 16.28 ? 348 THR A CB  1 
ATOM   1715 O  OG1 . THR A 1 209 ? -7.136  2.430   -0.040  1.00 17.70 ? 348 THR A OG1 1 
ATOM   1716 C  CG2 . THR A 1 209 ? -6.133  0.535   -1.173  1.00 14.77 ? 348 THR A CG2 1 
ATOM   1717 N  N   . VAL A 1 210 ? -7.412  0.949   2.985   1.00 11.56 ? 349 VAL A N   1 
ATOM   1718 C  CA  . VAL A 1 210 ? -7.685  1.754   4.171   1.00 15.44 ? 349 VAL A CA  1 
ATOM   1719 C  C   . VAL A 1 210 ? -6.675  2.911   4.227   1.00 13.64 ? 349 VAL A C   1 
ATOM   1720 O  O   . VAL A 1 210 ? -5.540  2.758   3.788   1.00 14.95 ? 349 VAL A O   1 
ATOM   1721 C  CB  A VAL A 1 210 ? -7.628  0.940   5.480   0.59 19.15 ? 349 VAL A CB  1 
ATOM   1722 C  CB  B VAL A 1 210 ? -7.589  0.886   5.456   0.41 18.95 ? 349 VAL A CB  1 
ATOM   1723 C  CG1 A VAL A 1 210 ? -8.602  -0.242  5.436   0.59 20.52 ? 349 VAL A CG1 1 
ATOM   1724 C  CG1 B VAL A 1 210 ? -7.504  1.742   6.698   0.41 16.31 ? 349 VAL A CG1 1 
ATOM   1725 C  CG2 A VAL A 1 210 ? -6.238  0.468   5.731   0.59 15.66 ? 349 VAL A CG2 1 
ATOM   1726 C  CG2 B VAL A 1 210 ? -8.764  -0.093  5.543   0.41 20.28 ? 349 VAL A CG2 1 
ATOM   1727 N  N   . SER A 1 211 ? -7.099  4.074   4.727   1.00 15.31 ? 350 SER A N   1 
ATOM   1728 C  CA  . SER A 1 211 ? -6.225  5.244   4.769   1.00 16.01 ? 350 SER A CA  1 
ATOM   1729 C  C   . SER A 1 211 ? -5.775  5.609   6.183   1.00 15.19 ? 350 SER A C   1 
ATOM   1730 O  O   . SER A 1 211 ? -6.584  5.683   7.119   1.00 15.53 ? 350 SER A O   1 
ATOM   1731 C  CB  . SER A 1 211 ? -6.921  6.460   4.140   1.00 21.39 ? 350 SER A CB  1 
ATOM   1732 O  OG  . SER A 1 211 ? -7.086  6.296   2.744   1.00 23.33 ? 350 SER A OG  1 
ATOM   1733 N  N   . LEU A 1 212 ? -4.470  5.837   6.310   1.00 12.76 ? 351 LEU A N   1 
ATOM   1734 C  CA  . LEU A 1 212 ? -3.860  6.352   7.542   1.00 11.70 ? 351 LEU A CA  1 
ATOM   1735 C  C   . LEU A 1 212 ? -3.232  7.706   7.246   1.00 14.11 ? 351 LEU A C   1 
ATOM   1736 O  O   . LEU A 1 212 ? -2.867  7.975   6.104   1.00 16.58 ? 351 LEU A O   1 
ATOM   1737 C  CB  . LEU A 1 212 ? -2.780  5.396   8.064   1.00 13.92 ? 351 LEU A CB  1 
ATOM   1738 C  CG  . LEU A 1 212 ? -3.195  4.213   8.934   1.00 13.52 ? 351 LEU A CG  1 
ATOM   1739 C  CD1 . LEU A 1 212 ? -4.176  3.302   8.210   1.00 15.83 ? 351 LEU A CD1 1 
ATOM   1740 C  CD2 . LEU A 1 212 ? -1.974  3.429   9.375   1.00 15.01 ? 351 LEU A CD2 1 
ATOM   1741 N  N   . SER A 1 213 ? -3.088  8.557   8.262   1.00 17.49 ? 352 SER A N   1 
ATOM   1742 C  CA  . SER A 1 213 ? -2.378  9.822   8.056   1.00 18.86 ? 352 SER A CA  1 
ATOM   1743 C  C   . SER A 1 213 ? -0.878  9.595   7.850   1.00 24.41 ? 352 SER A C   1 
ATOM   1744 O  O   . SER A 1 213 ? -0.347  8.538   8.200   1.00 18.67 ? 352 SER A O   1 
ATOM   1745 C  CB  . SER A 1 213 ? -2.600  10.766  9.235   1.00 17.32 ? 352 SER A CB  1 
ATOM   1746 O  OG  . SER A 1 213 ? -1.879  10.338  10.385  1.00 19.95 ? 352 SER A OG  1 
ATOM   1747 N  N   . ALA A 1 214 ? -0.198  10.591  7.290   1.00 23.53 ? 353 ALA A N   1 
ATOM   1748 C  CA  . ALA A 1 214 ? 1.249   10.528  7.115   1.00 20.56 ? 353 ALA A CA  1 
ATOM   1749 C  C   . ALA A 1 214 ? 1.946   10.274  8.447   1.00 20.29 ? 353 ALA A C   1 
ATOM   1750 O  O   . ALA A 1 214 ? 2.867   9.458   8.536   1.00 19.37 ? 353 ALA A O   1 
ATOM   1751 C  CB  . ALA A 1 214 ? 1.769   11.821  6.481   1.00 22.94 ? 353 ALA A CB  1 
ATOM   1752 N  N   . LYS A 1 215 ? 1.496   10.980  9.476   1.00 19.93 ? 354 LYS A N   1 
ATOM   1753 C  CA  . LYS A 1 215 ? 2.031   10.814  10.818  1.00 22.34 ? 354 LYS A CA  1 
ATOM   1754 C  C   . LYS A 1 215 ? 1.844   9.383   11.320  1.00 21.12 ? 354 LYS A C   1 
ATOM   1755 O  O   . LYS A 1 215 ? 2.745   8.816   11.935  1.00 19.66 ? 354 LYS A O   1 
ATOM   1756 C  CB  . LYS A 1 215 ? 1.371   11.798  11.790  1.00 26.48 ? 354 LYS A CB  1 
ATOM   1757 C  CG  . LYS A 1 215 ? 1.641   11.486  13.255  1.00 38.82 ? 354 LYS A CG  1 
ATOM   1758 C  CD  . LYS A 1 215 ? 0.810   12.357  14.178  1.00 50.80 ? 354 LYS A CD  1 
ATOM   1759 C  CE  . LYS A 1 215 ? 1.262   12.215  15.624  1.00 62.01 ? 354 LYS A CE  1 
ATOM   1760 N  NZ  . LYS A 1 215 ? 2.732   12.400  15.775  1.00 69.27 ? 354 LYS A NZ  1 
ATOM   1761 N  N   . GLN A 1 216 ? 0.676   8.805   11.057  1.00 16.88 ? 355 GLN A N   1 
ATOM   1762 C  CA  . GLN A 1 216 ? 0.397   7.446   11.492  1.00 19.09 ? 355 GLN A CA  1 
ATOM   1763 C  C   . GLN A 1 216 ? 1.295   6.428   10.788  1.00 17.32 ? 355 GLN A C   1 
ATOM   1764 O  O   . GLN A 1 216 ? 1.800   5.505   11.423  1.00 15.66 ? 355 GLN A O   1 
ATOM   1765 C  CB  . GLN A 1 216 ? -1.076  7.102   11.259  1.00 16.10 ? 355 GLN A CB  1 
ATOM   1766 C  CG  . GLN A 1 216 ? -1.992  7.662   12.329  1.00 18.80 ? 355 GLN A CG  1 
ATOM   1767 C  CD  . GLN A 1 216 ? -3.442  7.339   12.070  1.00 18.10 ? 355 GLN A CD  1 
ATOM   1768 O  OE1 . GLN A 1 216 ? -3.912  7.428   10.932  1.00 18.17 ? 355 GLN A OE1 1 
ATOM   1769 N  NE2 . GLN A 1 216 ? -4.164  6.966   13.124  1.00 16.14 ? 355 GLN A NE2 1 
ATOM   1770 N  N   . LEU A 1 217 ? 1.491   6.595   9.484   1.00 15.58 ? 356 LEU A N   1 
ATOM   1771 C  CA  . LEU A 1 217 ? 2.354   5.685   8.736   1.00 12.63 ? 356 LEU A CA  1 
ATOM   1772 C  C   . LEU A 1 217 ? 3.796   5.800   9.237   1.00 19.11 ? 356 LEU A C   1 
ATOM   1773 O  O   . LEU A 1 217 ? 4.507   4.805   9.332   1.00 15.93 ? 356 LEU A O   1 
ATOM   1774 C  CB  . LEU A 1 217 ? 2.269   5.959   7.234   1.00 14.11 ? 356 LEU A CB  1 
ATOM   1775 C  CG  . LEU A 1 217 ? 0.964   5.491   6.574   1.00 15.52 ? 356 LEU A CG  1 
ATOM   1776 C  CD1 . LEU A 1 217 ? 0.830   6.081   5.177   1.00 15.36 ? 356 LEU A CD1 1 
ATOM   1777 C  CD2 . LEU A 1 217 ? 0.920   3.962   6.511   1.00 15.03 ? 356 LEU A CD2 1 
ATOM   1778 N  N   . HIS A 1 218 ? 4.210   7.015   9.589   1.00 18.87 ? 357 HIS A N   1 
ATOM   1779 C  CA  . HIS A 1 218 ? 5.534   7.220   10.163  1.00 18.57 ? 357 HIS A CA  1 
ATOM   1780 C  C   . HIS A 1 218 ? 5.665   6.519   11.526  1.00 19.67 ? 357 HIS A C   1 
ATOM   1781 O  O   . HIS A 1 218 ? 6.656   5.838   11.797  1.00 18.41 ? 357 HIS A O   1 
ATOM   1782 C  CB  . HIS A 1 218 ? 5.828   8.721   10.288  1.00 21.00 ? 357 HIS A CB  1 
ATOM   1783 C  CG  . HIS A 1 218 ? 7.165   9.022   10.887  1.00 29.71 ? 357 HIS A CG  1 
ATOM   1784 N  ND1 . HIS A 1 218 ? 7.334   9.330   12.221  1.00 34.86 ? 357 HIS A ND1 1 
ATOM   1785 C  CD2 . HIS A 1 218 ? 8.402   9.039   10.336  1.00 31.44 ? 357 HIS A CD2 1 
ATOM   1786 C  CE1 . HIS A 1 218 ? 8.617   9.534   12.463  1.00 31.09 ? 357 HIS A CE1 1 
ATOM   1787 N  NE2 . HIS A 1 218 ? 9.286   9.360   11.337  1.00 29.95 ? 357 HIS A NE2 1 
ATOM   1788 N  N   . THR A 1 219 ? 4.657   6.664   12.377  1.00 15.97 ? 358 THR A N   1 
ATOM   1789 C  CA  . THR A 1 219 ? 4.658   5.987   13.673  1.00 13.89 ? 358 THR A CA  1 
ATOM   1790 C  C   . THR A 1 219 ? 4.810   4.471   13.508  1.00 14.67 ? 358 THR A C   1 
ATOM   1791 O  O   . THR A 1 219 ? 5.575   3.826   14.235  1.00 14.84 ? 358 THR A O   1 
ATOM   1792 C  CB  . THR A 1 219 ? 3.378   6.309   14.461  1.00 14.78 ? 358 THR A CB  1 
ATOM   1793 O  OG1 . THR A 1 219 ? 3.366   7.711   14.776  1.00 19.69 ? 358 THR A OG1 1 
ATOM   1794 C  CG2 . THR A 1 219 ? 3.303   5.509   15.752  1.00 16.63 ? 358 THR A CG2 1 
ATOM   1795 N  N   . LEU A 1 220 ? 4.087   3.907   12.549  1.00 14.11 ? 359 LEU A N   1 
ATOM   1796 C  CA  . LEU A 1 220 ? 4.160   2.473   12.298  1.00 11.86 ? 359 LEU A CA  1 
ATOM   1797 C  C   . LEU A 1 220 ? 5.568   2.028   11.904  1.00 12.23 ? 359 LEU A C   1 
ATOM   1798 O  O   . LEU A 1 220 ? 6.048   1.008   12.392  1.00 13.04 ? 359 LEU A O   1 
ATOM   1799 C  CB  . LEU A 1 220 ? 3.160   2.081   11.212  1.00 11.71 ? 359 LEU A CB  1 
ATOM   1800 C  CG  . LEU A 1 220 ? 3.091   0.606   10.844  1.00 11.81 ? 359 LEU A CG  1 
ATOM   1801 C  CD1 . LEU A 1 220 ? 2.807   -0.226  12.091  1.00 15.77 ? 359 LEU A CD1 1 
ATOM   1802 C  CD2 . LEU A 1 220 ? 2.038   0.366   9.766   1.00 10.79 ? 359 LEU A CD2 1 
ATOM   1803 N  N   . SER A 1 221 ? 6.235   2.785   11.036  1.00 14.77 ? 360 SER A N   1 
ATOM   1804 C  CA  . SER A 1 221 ? 7.518   2.331   10.501  1.00 14.67 ? 360 SER A CA  1 
ATOM   1805 C  C   . SER A 1 221 ? 8.732   2.820   11.283  1.00 15.01 ? 360 SER A C   1 
ATOM   1806 O  O   . SER A 1 221 ? 9.826   2.301   11.098  1.00 16.38 ? 360 SER A O   1 
ATOM   1807 C  CB  . SER A 1 221 ? 7.657   2.753   9.034   1.00 17.35 ? 360 SER A CB  1 
ATOM   1808 O  OG  . SER A 1 221 ? 7.648   4.167   8.911   1.00 17.14 ? 360 SER A OG  1 
ATOM   1809 N  N   . ASP A 1 222 ? 8.542   3.786   12.174  1.00 12.81 ? 361 ASP A N   1 
ATOM   1810 C  CA  . ASP A 1 222 ? 9.673   4.446   12.845  1.00 14.79 ? 361 ASP A CA  1 
ATOM   1811 C  C   . ASP A 1 222 ? 9.834   4.064   14.321  1.00 16.72 ? 361 ASP A C   1 
ATOM   1812 O  O   . ASP A 1 222 ? 10.840  4.397   14.943  1.00 18.34 ? 361 ASP A O   1 
ATOM   1813 C  CB  . ASP A 1 222 ? 9.515   5.976   12.712  1.00 19.17 ? 361 ASP A CB  1 
ATOM   1814 C  CG  . ASP A 1 222 ? 10.638  6.767   13.386  1.00 29.26 ? 361 ASP A CG  1 
ATOM   1815 O  OD1 . ASP A 1 222 ? 11.755  6.786   12.836  1.00 31.15 ? 361 ASP A OD1 1 
ATOM   1816 O  OD2 . ASP A 1 222 ? 10.401  7.397   14.445  1.00 31.25 ? 361 ASP A OD2 1 
ATOM   1817 N  N   . THR A 1 223 ? 8.865   3.352   14.886  1.00 14.24 ? 362 THR A N   1 
ATOM   1818 C  CA  . THR A 1 223 ? 8.835   3.150   16.334  1.00 11.34 ? 362 THR A CA  1 
ATOM   1819 C  C   . THR A 1 223 ? 9.499   1.856   16.842  1.00 12.06 ? 362 THR A C   1 
ATOM   1820 O  O   . THR A 1 223 ? 10.086  1.843   17.930  1.00 12.98 ? 362 THR A O   1 
ATOM   1821 C  CB  . THR A 1 223 ? 7.375   3.183   16.845  1.00 12.90 ? 362 THR A CB  1 
ATOM   1822 O  OG1 . THR A 1 223 ? 6.776   4.422   16.452  1.00 15.18 ? 362 THR A OG1 1 
ATOM   1823 C  CG2 . THR A 1 223 ? 7.313   3.066   18.355  1.00 12.37 ? 362 THR A CG2 1 
ATOM   1824 N  N   . LEU A 1 224 ? 9.372   0.767   16.086  1.00 10.67 ? 363 LEU A N   1 
ATOM   1825 C  CA  . LEU A 1 224 ? 9.760   -0.538  16.596  1.00 8.57  ? 363 LEU A CA  1 
ATOM   1826 C  C   . LEU A 1 224 ? 11.171  -0.958  16.213  1.00 9.52  ? 363 LEU A C   1 
ATOM   1827 O  O   . LEU A 1 224 ? 11.651  -0.680  15.107  1.00 10.85 ? 363 LEU A O   1 
ATOM   1828 C  CB  . LEU A 1 224 ? 8.787   -1.611  16.103  1.00 9.64  ? 363 LEU A CB  1 
ATOM   1829 C  CG  . LEU A 1 224 ? 7.318   -1.344  16.448  1.00 10.59 ? 363 LEU A CG  1 
ATOM   1830 C  CD1 . LEU A 1 224 ? 6.435   -2.403  15.812  1.00 13.28 ? 363 LEU A CD1 1 
ATOM   1831 C  CD2 . LEU A 1 224 ? 7.101   -1.305  17.972  1.00 9.36  ? 363 LEU A CD2 1 
ATOM   1832 N  N   . TRP A 1 225 ? 11.825  -1.622  17.154  1.00 10.70 ? 364 TRP A N   1 
ATOM   1833 C  CA  . TRP A 1 225 ? 13.120  -2.251  16.934  1.00 11.09 ? 364 TRP A CA  1 
ATOM   1834 C  C   . TRP A 1 225 ? 12.994  -3.763  16.763  1.00 10.87 ? 364 TRP A C   1 
ATOM   1835 O  O   . TRP A 1 225 ? 12.062  -4.384  17.277  1.00 11.76 ? 364 TRP A O   1 
ATOM   1836 C  CB  . TRP A 1 225 ? 14.049  -1.863  18.090  1.00 14.02 ? 364 TRP A CB  1 
ATOM   1837 C  CG  . TRP A 1 225 ? 14.334  -0.396  17.965  1.00 25.37 ? 364 TRP A CG  1 
ATOM   1838 C  CD1 . TRP A 1 225 ? 13.589  0.627   18.474  1.00 44.49 ? 364 TRP A CD1 1 
ATOM   1839 C  CD2 . TRP A 1 225 ? 15.451  0.217   17.301  1.00 29.00 ? 364 TRP A CD2 1 
ATOM   1840 N  NE1 . TRP A 1 225 ? 14.149  1.838   18.139  1.00 48.90 ? 364 TRP A NE1 1 
ATOM   1841 C  CE2 . TRP A 1 225 ? 15.298  1.613   17.427  1.00 41.01 ? 364 TRP A CE2 1 
ATOM   1842 C  CE3 . TRP A 1 225 ? 16.557  -0.278  16.609  1.00 23.75 ? 364 TRP A CE3 1 
ATOM   1843 C  CZ2 . TRP A 1 225 ? 16.214  2.518   16.890  1.00 40.46 ? 364 TRP A CZ2 1 
ATOM   1844 C  CZ3 . TRP A 1 225 ? 17.472  0.626   16.079  1.00 26.34 ? 364 TRP A CZ3 1 
ATOM   1845 C  CH2 . TRP A 1 225 ? 17.290  2.004   16.219  1.00 32.25 ? 364 TRP A CH2 1 
ATOM   1846 N  N   . GLY A 1 226 ? 13.920  -4.341  16.007  1.00 11.33 ? 365 GLY A N   1 
ATOM   1847 C  CA  . GLY A 1 226 ? 13.892  -5.771  15.712  1.00 10.81 ? 365 GLY A CA  1 
ATOM   1848 C  C   . GLY A 1 226 ? 14.959  -6.589  16.418  1.00 12.87 ? 365 GLY A C   1 
ATOM   1849 O  O   . GLY A 1 226 ? 15.567  -6.123  17.381  1.00 12.64 ? 365 GLY A O   1 
ATOM   1850 N  N   . PRO A 1 227 ? 15.189  -7.830  15.940  1.00 10.34 ? 366 PRO A N   1 
ATOM   1851 C  CA  . PRO A 1 227 ? 16.179  -8.717  16.560  1.00 12.88 ? 366 PRO A CA  1 
ATOM   1852 C  C   . PRO A 1 227 ? 17.567  -8.094  16.539  1.00 10.59 ? 366 PRO A C   1 
ATOM   1853 O  O   . PRO A 1 227 ? 17.907  -7.334  15.630  1.00 15.22 ? 366 PRO A O   1 
ATOM   1854 C  CB  . PRO A 1 227 ? 16.117  -9.981  15.681  1.00 13.32 ? 366 PRO A CB  1 
ATOM   1855 C  CG  . PRO A 1 227 ? 14.732  -9.931  15.048  1.00 11.75 ? 366 PRO A CG  1 
ATOM   1856 C  CD  . PRO A 1 227 ? 14.546  -8.462  14.770  1.00 9.03  ? 366 PRO A CD  1 
ATOM   1857 N  N   . GLY A 1 228 ? 18.366  -8.412  17.551  1.00 16.09 ? 367 GLY A N   1 
ATOM   1858 C  CA  . GLY A 1 228 ? 19.708  -7.863  17.635  1.00 18.29 ? 367 GLY A CA  1 
ATOM   1859 C  C   . GLY A 1 228 ? 19.645  -6.349  17.725  1.00 19.05 ? 367 GLY A C   1 
ATOM   1860 O  O   . GLY A 1 228 ? 18.819  -5.799  18.463  1.00 19.52 ? 367 GLY A O   1 
ATOM   1861 N  N   . ASP A 1 229 ? 20.506  -5.670  16.978  1.00 17.74 ? 368 ASP A N   1 
ATOM   1862 C  CA  . ASP A 1 229 ? 20.538  -4.213  16.996  1.00 18.48 ? 368 ASP A CA  1 
ATOM   1863 C  C   . ASP A 1 229 ? 19.645  -3.581  15.929  1.00 21.82 ? 368 ASP A C   1 
ATOM   1864 O  O   . ASP A 1 229 ? 19.709  -2.374  15.702  1.00 21.71 ? 368 ASP A O   1 
ATOM   1865 C  CB  . ASP A 1 229 ? 21.985  -3.696  16.873  1.00 22.85 ? 368 ASP A CB  1 
ATOM   1866 C  CG  . ASP A 1 229 ? 22.673  -4.139  15.594  1.00 39.36 ? 368 ASP A CG  1 
ATOM   1867 O  OD1 . ASP A 1 229 ? 22.080  -4.897  14.796  1.00 39.46 ? 368 ASP A OD1 1 
ATOM   1868 O  OD2 . ASP A 1 229 ? 23.836  -3.723  15.391  1.00 53.23 ? 368 ASP A OD2 1 
ATOM   1869 N  N   . SER A 1 230 ? 18.856  -4.402  15.240  1.00 17.93 ? 369 SER A N   1 
ATOM   1870 C  CA  . SER A 1 230 ? 18.205  -3.965  14.008  1.00 17.74 ? 369 SER A CA  1 
ATOM   1871 C  C   . SER A 1 230 ? 16.959  -3.102  14.256  1.00 14.69 ? 369 SER A C   1 
ATOM   1872 O  O   . SER A 1 230 ? 16.334  -3.168  15.318  1.00 17.01 ? 369 SER A O   1 
ATOM   1873 C  CB  . SER A 1 230 ? 17.821  -5.180  13.157  1.00 16.06 ? 369 SER A CB  1 
ATOM   1874 O  OG  . SER A 1 230 ? 16.724  -5.891  13.736  1.00 16.04 ? 369 SER A OG  1 
ATOM   1875 N  N   . ARG A 1 231 ? 16.610  -2.426  13.221  1.00 14.98 ? 370 ARG A N   1 
ATOM   1876 C  CA  . ARG A 1 231 ? 15.421  -1.534  13.152  1.00 15.15 ? 370 ARG A CA  1 
ATOM   1877 C  C   . ARG A 1 231 ? 14.255  -2.461  12.572  1.00 14.79 ? 370 ARG A C   1 
ATOM   1878 O  O   . ARG A 1 231 ? 14.506  -3.109  11.652  1.00 14.14 ? 370 ARG A O   1 
ATOM   1879 C  CB  A ARG A 1 231 ? 15.669  -0.034  12.555  0.54 20.23 ? 370 ARG A CB  1 
ATOM   1880 C  CB  B ARG A 1 231 ? 15.469  -0.264  12.426  0.46 20.27 ? 370 ARG A CB  1 
ATOM   1881 C  CG  A ARG A 1 231 ? 14.552  0.777   12.688  0.54 24.79 ? 370 ARG A CG  1 
ATOM   1882 C  CG  B ARG A 1 231 ? 16.206  0.872   13.088  0.46 26.20 ? 370 ARG A CG  1 
ATOM   1883 C  CD  A ARG A 1 231 ? 15.184  2.103   12.611  0.54 27.35 ? 370 ARG A CD  1 
ATOM   1884 C  CD  B ARG A 1 231 ? 15.256  2.007   13.425  0.46 30.59 ? 370 ARG A CD  1 
ATOM   1885 N  NE  A ARG A 1 231 ? 14.184  2.955   13.145  0.54 32.09 ? 370 ARG A NE  1 
ATOM   1886 N  NE  B ARG A 1 231 ? 15.293  3.064   12.420  0.46 32.70 ? 370 ARG A NE  1 
ATOM   1887 C  CZ  A ARG A 1 231 ? 14.149  4.237   12.916  0.54 35.43 ? 370 ARG A CZ  1 
ATOM   1888 C  CZ  B ARG A 1 231 ? 14.543  4.161   12.462  0.46 35.19 ? 370 ARG A CZ  1 
ATOM   1889 N  NH1 A ARG A 1 231 ? 15.014  4.768   12.105  0.54 35.43 ? 370 ARG A NH1 1 
ATOM   1890 N  NH1 B ARG A 1 231 ? 13.686  4.350   13.459  0.46 34.90 ? 370 ARG A NH1 1 
ATOM   1891 N  NH2 A ARG A 1 231 ? 13.214  4.949   13.444  0.54 34.14 ? 370 ARG A NH2 1 
ATOM   1892 N  NH2 B ARG A 1 231 ? 14.642  5.068   11.501  0.46 35.57 ? 370 ARG A NH2 1 
ATOM   1893 N  N   . LEU A 1 232 ? 13.032  -2.380  13.113  1.00 30.00 ? 371 LEU A N   1 
ATOM   1894 C  CA  . LEU A 1 232 ? 11.938  -3.137  12.513  1.00 30.00 ? 371 LEU A CA  1 
ATOM   1895 C  C   . LEU A 1 232 ? 11.303  -2.278  11.406  1.00 30.00 ? 371 LEU A C   1 
ATOM   1896 O  O   . LEU A 1 232 ? 10.370  -1.605  11.619  1.00 30.00 ? 371 LEU A O   1 
ATOM   1897 C  CB  . LEU A 1 232 ? 10.910  -3.605  13.533  1.00 20.00 ? 371 LEU A CB  1 
ATOM   1898 C  CG  . LEU A 1 232 ? 10.407  -5.040  13.389  1.00 20.00 ? 371 LEU A CG  1 
ATOM   1899 C  CD1 . LEU A 1 232 ? 9.234   -5.354  14.291  1.00 20.00 ? 371 LEU A CD1 1 
ATOM   1900 C  CD2 . LEU A 1 232 ? 10.096  -5.389  11.987  1.00 20.00 ? 371 LEU A CD2 1 
ATOM   1901 N  N   . GLN A 1 233 ? 11.919  -2.380  10.238  1.00 10.66 ? 372 GLN A N   1 
ATOM   1902 C  CA  . GLN A 1 233 ? 11.525  -1.657  9.042   1.00 9.98  ? 372 GLN A CA  1 
ATOM   1903 C  C   . GLN A 1 233 ? 11.609  -2.600  7.840   1.00 9.67  ? 372 GLN A C   1 
ATOM   1904 O  O   . GLN A 1 233 ? 12.320  -3.542  7.894   1.00 11.27 ? 372 GLN A O   1 
ATOM   1905 C  CB  . GLN A 1 233 ? 12.448  -0.440  8.764   1.00 11.96 ? 372 GLN A CB  1 
ATOM   1906 C  CG  . GLN A 1 233 ? 12.358  0.594   9.834   1.00 16.46 ? 372 GLN A CG  1 
ATOM   1907 C  CD  . GLN A 1 233 ? 13.020  1.896   9.513   1.00 14.11 ? 372 GLN A CD  1 
ATOM   1908 O  OE1 . GLN A 1 233 ? 14.072  1.907   9.000   1.00 16.30 ? 372 GLN A OE1 1 
ATOM   1909 N  NE2 . GLN A 1 233 ? 12.356  2.964   9.782   1.00 15.00 ? 372 GLN A NE2 1 
ATOM   1910 N  N   . LEU A 1 234 ? 10.926  -2.233  6.768   1.00 9.69  ? 373 LEU A N   1 
ATOM   1911 C  CA  . LEU A 1 234 ? 10.988  -2.996  5.525   1.00 9.95  ? 373 LEU A CA  1 
ATOM   1912 C  C   . LEU A 1 234 ? 10.698  -4.460  5.790   1.00 10.68 ? 373 LEU A C   1 
ATOM   1913 O  O   . LEU A 1 234 ? 11.380  -5.349  5.271   1.00 10.35 ? 373 LEU A O   1 
ATOM   1914 C  CB  . LEU A 1 234 ? 12.361  -2.837  4.846   1.00 13.87 ? 373 LEU A CB  1 
ATOM   1915 C  CG  . LEU A 1 234 ? 12.797  -1.383  4.650   1.00 15.03 ? 373 LEU A CG  1 
ATOM   1916 C  CD1 . LEU A 1 234 ? 14.278  -1.306  4.281   1.00 18.60 ? 373 LEU A CD1 1 
ATOM   1917 C  CD2 . LEU A 1 234 ? 11.948  -0.722  3.582   1.00 13.82 ? 373 LEU A CD2 1 
ATOM   1918 N  N   . ASN A 1 235 ? 9.692   -4.713  6.625   1.00 9.74  ? 374 ASN A N   1 
ATOM   1919 C  CA  . ASN A 1 235 ? 9.422   -6.080  7.039   1.00 8.34  ? 374 ASN A CA  1 
ATOM   1920 C  C   . ASN A 1 235 ? 8.412   -6.730  6.103   1.00 8.34  ? 374 ASN A C   1 
ATOM   1921 O  O   . ASN A 1 235 ? 7.316   -7.139  6.504   1.00 10.69 ? 374 ASN A O   1 
ATOM   1922 C  CB  . ASN A 1 235 ? 8.947   -6.131  8.502   1.00 7.92  ? 374 ASN A CB  1 
ATOM   1923 C  CG  . ASN A 1 235 ? 7.690   -5.320  8.755   1.00 10.07 ? 374 ASN A CG  1 
ATOM   1924 O  OD1 . ASN A 1 235 ? 7.446   -4.312  8.108   1.00 10.46 ? 374 ASN A OD1 1 
ATOM   1925 N  ND2 . ASN A 1 235 ? 6.880   -5.771  9.708   1.00 8.39  ? 374 ASN A ND2 1 
ATOM   1926 N  N   . PHE A 1 236 ? 8.804   -6.817  4.836   1.00 8.31  ? 375 PHE A N   1 
ATOM   1927 C  CA  . PHE A 1 236 ? 8.005   -7.471  3.815   1.00 7.96  ? 375 PHE A CA  1 
ATOM   1928 C  C   . PHE A 1 236 ? 8.872   -8.424  2.990   1.00 8.18  ? 375 PHE A C   1 
ATOM   1929 O  O   . PHE A 1 236 ? 10.077  -8.233  2.847   1.00 10.91 ? 375 PHE A O   1 
ATOM   1930 C  CB  . PHE A 1 236 ? 7.330   -6.443  2.896   1.00 10.24 ? 375 PHE A CB  1 
ATOM   1931 C  CG  . PHE A 1 236 ? 8.289   -5.563  2.139   1.00 8.95  ? 375 PHE A CG  1 
ATOM   1932 C  CD1 . PHE A 1 236 ? 8.703   -5.901  0.860   1.00 10.16 ? 375 PHE A CD1 1 
ATOM   1933 C  CD2 . PHE A 1 236 ? 8.729   -4.370  2.689   1.00 9.76  ? 375 PHE A CD2 1 
ATOM   1934 C  CE1 . PHE A 1 236 ? 9.568   -5.083  0.147   1.00 12.27 ? 375 PHE A CE1 1 
ATOM   1935 C  CE2 . PHE A 1 236 ? 9.604   -3.539  1.976   1.00 14.61 ? 375 PHE A CE2 1 
ATOM   1936 C  CZ  . PHE A 1 236 ? 10.014  -3.901  0.703   1.00 13.36 ? 375 PHE A CZ  1 
ATOM   1937 N  N   . ARG A 1 237 ? 8.228   -9.459  2.469   1.00 8.01  ? 376 ARG A N   1 
ATOM   1938 C  CA  . ARG A 1 237 ? 8.874   -10.434 1.605   1.00 8.51  ? 376 ARG A CA  1 
ATOM   1939 C  C   . ARG A 1 237 ? 8.817   -9.980  0.153   1.00 9.70  ? 376 ARG A C   1 
ATOM   1940 O  O   . ARG A 1 237 ? 7.836   -9.363  -0.275  1.00 11.35 ? 376 ARG A O   1 
ATOM   1941 C  CB  . ARG A 1 237 ? 8.191   -11.792 1.761   1.00 7.37  ? 376 ARG A CB  1 
ATOM   1942 C  CG  . ARG A 1 237 ? 8.933   -12.945 1.113   1.00 9.73  ? 376 ARG A CG  1 
ATOM   1943 C  CD  . ARG A 1 237 ? 8.093   -14.220 1.115   1.00 10.00 ? 376 ARG A CD  1 
ATOM   1944 N  NE  . ARG A 1 237 ? 8.928   -15.363 0.733   1.00 11.57 ? 376 ARG A NE  1 
ATOM   1945 C  CZ  . ARG A 1 237 ? 8.473   -16.600 0.560   1.00 9.99  ? 376 ARG A CZ  1 
ATOM   1946 N  NH1 . ARG A 1 237 ? 7.173   -16.865 0.718   1.00 10.53 ? 376 ARG A NH1 1 
ATOM   1947 N  NH2 . ARG A 1 237 ? 9.321   -17.576 0.237   1.00 9.80  ? 376 ARG A NH2 1 
ATOM   1948 N  N   . ALA A 1 238 ? 9.876   -10.288 -0.594  1.00 11.64 ? 377 ALA A N   1 
ATOM   1949 C  CA  . ALA A 1 238 ? 9.891   -10.043 -2.030  1.00 16.48 ? 377 ALA A CA  1 
ATOM   1950 C  C   . ALA A 1 238 ? 8.732   -10.756 -2.724  1.00 15.58 ? 377 ALA A C   1 
ATOM   1951 O  O   . ALA A 1 238 ? 8.295   -11.820 -2.294  1.00 13.11 ? 377 ALA A O   1 
ATOM   1952 C  CB  . ALA A 1 238 ? 11.216  -10.499 -2.623  1.00 17.31 ? 377 ALA A CB  1 
ATOM   1953 N  N   . THR A 1 239 ? 8.260   -10.168 -3.816  1.00 12.28 ? 378 THR A N   1 
ATOM   1954 C  CA  . THR A 1 239 ? 7.216   -10.762 -4.628  1.00 11.67 ? 378 THR A CA  1 
ATOM   1955 C  C   . THR A 1 239 ? 7.639   -12.122 -5.170  1.00 12.50 ? 378 THR A C   1 
ATOM   1956 O  O   . THR A 1 239 ? 8.780   -12.289 -5.618  1.00 15.70 ? 378 THR A O   1 
ATOM   1957 C  CB  . THR A 1 239 ? 6.919   -9.857  -5.853  1.00 17.80 ? 378 THR A CB  1 
ATOM   1958 O  OG1 . THR A 1 239 ? 6.822   -8.494  -5.425  1.00 26.75 ? 378 THR A OG1 1 
ATOM   1959 C  CG2 . THR A 1 239 ? 5.653   -10.298 -6.559  1.00 24.98 ? 378 THR A CG2 1 
ATOM   1960 N  N   . GLN A 1 240 ? 6.695   -13.064 -5.200  1.00 11.44 ? 379 GLN A N   1 
ATOM   1961 C  CA  . GLN A 1 240 ? 6.955   -14.447 -5.610  1.00 11.32 ? 379 GLN A CA  1 
ATOM   1962 C  C   . GLN A 1 240 ? 6.302   -14.752 -6.950  1.00 10.24 ? 379 GLN A C   1 
ATOM   1963 O  O   . GLN A 1 240 ? 5.259   -14.189 -7.261  1.00 11.99 ? 379 GLN A O   1 
ATOM   1964 C  CB  . GLN A 1 240 ? 6.438   -15.412 -4.547  1.00 11.23 ? 379 GLN A CB  1 
ATOM   1965 C  CG  . GLN A 1 240 ? 7.026   -15.133 -3.189  1.00 11.24 ? 379 GLN A CG  1 
ATOM   1966 C  CD  . GLN A 1 240 ? 8.500   -15.448 -3.132  1.00 15.15 ? 379 GLN A CD  1 
ATOM   1967 O  OE1 . GLN A 1 240 ? 8.928   -16.560 -3.478  1.00 16.61 ? 379 GLN A OE1 1 
ATOM   1968 N  NE2 . GLN A 1 240 ? 9.300   -14.463 -2.716  1.00 14.26 ? 379 GLN A NE2 1 
ATOM   1969 N  N   . PRO A 1 241 ? 6.911   -15.645 -7.754  1.00 12.11 ? 380 PRO A N   1 
ATOM   1970 C  CA  . PRO A 1 241 ? 6.348   -15.932 -9.084  1.00 11.54 ? 380 PRO A CA  1 
ATOM   1971 C  C   . PRO A 1 241 ? 4.992   -16.634 -9.040  1.00 10.43 ? 380 PRO A C   1 
ATOM   1972 O  O   . PRO A 1 241 ? 4.794   -17.519 -8.205  1.00 13.70 ? 380 PRO A O   1 
ATOM   1973 C  CB  . PRO A 1 241 ? 7.410   -16.836 -9.721  1.00 13.00 ? 380 PRO A CB  1 
ATOM   1974 C  CG  . PRO A 1 241 ? 8.112   -17.473 -8.580  1.00 15.41 ? 380 PRO A CG  1 
ATOM   1975 C  CD  . PRO A 1 241 ? 8.145   -16.415 -7.506  1.00 13.82 ? 380 PRO A CD  1 
ATOM   1976 N  N   . LEU A 1 242 ? 4.066   -16.245 -9.917  1.00 11.95 ? 381 LEU A N   1 
ATOM   1977 C  CA  . LEU A 1 242 ? 2.740   -16.887 -9.924  1.00 13.01 ? 381 LEU A CA  1 
ATOM   1978 C  C   . LEU A 1 242 ? 2.780   -18.331 -10.362 1.00 11.31 ? 381 LEU A C   1 
ATOM   1979 O  O   . LEU A 1 242 ? 1.979   -19.136 -9.898  1.00 12.62 ? 381 LEU A O   1 
ATOM   1980 C  CB  . LEU A 1 242 ? 1.737   -16.160 -10.824 1.00 19.96 ? 381 LEU A CB  1 
ATOM   1981 C  CG  . LEU A 1 242 ? 0.717   -15.199 -10.241 1.00 25.94 ? 381 LEU A CG  1 
ATOM   1982 C  CD1 . LEU A 1 242 ? -0.260  -14.789 -11.354 1.00 19.77 ? 381 LEU A CD1 1 
ATOM   1983 C  CD2 . LEU A 1 242 ? -0.035  -15.820 -9.061  1.00 15.26 ? 381 LEU A CD2 1 
ATOM   1984 N  N   . ASN A 1 243 ? 3.693   -18.657 -11.276 1.00 13.11 ? 382 ASN A N   1 
ATOM   1985 C  CA  . ASN A 1 243 ? 3.879   -20.026 -11.730 1.00 10.70 ? 382 ASN A CA  1 
ATOM   1986 C  C   . ASN A 1 243 ? 2.572   -20.707 -12.179 1.00 11.06 ? 382 ASN A C   1 
ATOM   1987 O  O   . ASN A 1 243 ? 2.303   -21.855 -11.833 1.00 13.34 ? 382 ASN A O   1 
ATOM   1988 C  CB  . ASN A 1 243 ? 4.560   -20.852 -10.639 1.00 13.74 ? 382 ASN A CB  1 
ATOM   1989 C  CG  . ASN A 1 243 ? 6.044   -20.540 -10.513 1.00 16.74 ? 382 ASN A CG  1 
ATOM   1990 O  OD1 . ASN A 1 243 ? 6.699   -20.176 -11.496 1.00 18.31 ? 382 ASN A OD1 1 
ATOM   1991 N  ND2 . ASN A 1 243 ? 6.591   -20.719 -9.310  1.00 13.46 ? 382 ASN A ND2 1 
ATOM   1992 N  N   . GLY A 1 244 ? 1.770   -19.984 -12.956 1.00 12.03 ? 383 GLY A N   1 
ATOM   1993 C  CA  . GLY A 1 244 ? 0.611   -20.605 -13.584 1.00 10.34 ? 383 GLY A CA  1 
ATOM   1994 C  C   . GLY A 1 244 ? -0.675  -20.517 -12.787 1.00 12.43 ? 383 GLY A C   1 
ATOM   1995 O  O   . GLY A 1 244 ? -1.728  -20.957 -13.237 1.00 13.40 ? 383 GLY A O   1 
ATOM   1996 N  N   . ARG A 1 245 ? -0.586  -19.982 -11.579 1.00 11.15 ? 384 ARG A N   1 
ATOM   1997 C  CA  . ARG A 1 245 ? -1.775  -19.786 -10.754 1.00 10.53 ? 384 ARG A CA  1 
ATOM   1998 C  C   . ARG A 1 245 ? -2.721  -18.739 -11.321 1.00 10.38 ? 384 ARG A C   1 
ATOM   1999 O  O   . ARG A 1 245 ? -2.292  -17.798 -11.993 1.00 11.56 ? 384 ARG A O   1 
ATOM   2000 C  CB  . ARG A 1 245 ? -1.375  -19.389 -9.331  1.00 10.77 ? 384 ARG A CB  1 
ATOM   2001 C  CG  . ARG A 1 245 ? -0.816  -20.537 -8.508  1.00 10.24 ? 384 ARG A CG  1 
ATOM   2002 C  CD  . ARG A 1 245 ? -0.356  -20.038 -7.143  1.00 9.54  ? 384 ARG A CD  1 
ATOM   2003 N  NE  . ARG A 1 245 ? 0.900   -19.293 -7.247  1.00 10.38 ? 384 ARG A NE  1 
ATOM   2004 C  CZ  . ARG A 1 245 ? 1.488   -18.694 -6.217  1.00 8.97  ? 384 ARG A CZ  1 
ATOM   2005 N  NH1 . ARG A 1 245 ? 0.906   -18.729 -5.013  1.00 8.36  ? 384 ARG A NH1 1 
ATOM   2006 N  NH2 . ARG A 1 245 ? 2.651   -18.057 -6.392  1.00 9.54  ? 384 ARG A NH2 1 
ATOM   2007 N  N   . VAL A 1 246 ? -4.010  -18.927 -11.041 1.00 9.64  ? 385 VAL A N   1 
ATOM   2008 C  CA  . VAL A 1 246 ? -5.027  -17.943 -11.387 1.00 10.70 ? 385 VAL A CA  1 
ATOM   2009 C  C   . VAL A 1 246 ? -5.376  -17.104 -10.165 1.00 10.60 ? 385 VAL A C   1 
ATOM   2010 O  O   . VAL A 1 246 ? -5.561  -17.649 -9.075  1.00 14.34 ? 385 VAL A O   1 
ATOM   2011 C  CB  . VAL A 1 246 ? -6.294  -18.628 -11.901 1.00 12.25 ? 385 VAL A CB  1 
ATOM   2012 C  CG1 . VAL A 1 246 ? -7.446  -17.629 -12.021 1.00 12.53 ? 385 VAL A CG1 1 
ATOM   2013 C  CG2 . VAL A 1 246 ? -5.997  -19.310 -13.241 1.00 15.02 ? 385 VAL A CG2 1 
ATOM   2014 N  N   . ILE A 1 247 ? -5.413  -15.783 -10.323 1.00 8.34  ? 386 ILE A N   1 
ATOM   2015 C  CA  . ILE A 1 247 ? -5.991  -14.943 -9.286  1.00 8.99  ? 386 ILE A CA  1 
ATOM   2016 C  C   . ILE A 1 247 ? -7.430  -14.679 -9.695  1.00 10.58 ? 386 ILE A C   1 
ATOM   2017 O  O   . ILE A 1 247 ? -7.689  -14.229 -10.812 1.00 12.96 ? 386 ILE A O   1 
ATOM   2018 C  CB  . ILE A 1 247 ? -5.230  -13.620 -9.097  1.00 10.18 ? 386 ILE A CB  1 
ATOM   2019 C  CG1 . ILE A 1 247 ? -3.763  -13.897 -8.756  1.00 11.13 ? 386 ILE A CG1 1 
ATOM   2020 C  CG2 . ILE A 1 247 ? -5.899  -12.767 -7.998  1.00 8.29  ? 386 ILE A CG2 1 
ATOM   2021 C  CD1 . ILE A 1 247 ? -2.949  -12.642 -8.515  1.00 12.87 ? 386 ILE A CD1 1 
ATOM   2022 N  N   . GLU A 1 248 ? -8.372  -14.990 -8.814  1.00 10.04 ? 387 GLU A N   1 
ATOM   2023 C  CA  . GLU A 1 248 ? -9.786  -14.737 -9.098  1.00 8.43  ? 387 GLU A CA  1 
ATOM   2024 C  C   . GLU A 1 248 ? -10.169 -13.357 -8.590  1.00 12.26 ? 387 GLU A C   1 
ATOM   2025 O  O   . GLU A 1 248 ? -9.529  -12.836 -7.689  1.00 11.76 ? 387 GLU A O   1 
ATOM   2026 C  CB  . GLU A 1 248 ? -10.689 -15.804 -8.468  1.00 11.09 ? 387 GLU A CB  1 
ATOM   2027 C  CG  . GLU A 1 248 ? -10.468 -17.205 -9.048  1.00 12.35 ? 387 GLU A CG  1 
ATOM   2028 C  CD  . GLU A 1 248 ? -11.466 -18.246 -8.537  1.00 18.18 ? 387 GLU A CD  1 
ATOM   2029 O  OE1 . GLU A 1 248 ? -11.422 -19.400 -9.028  1.00 19.61 ? 387 GLU A OE1 1 
ATOM   2030 O  OE2 . GLU A 1 248 ? -12.284 -17.920 -7.651  1.00 17.84 ? 387 GLU A OE2 1 
ATOM   2031 N  N   . ALA A 1 249 ? -11.199 -12.767 -9.200  1.00 10.53 ? 388 ALA A N   1 
ATOM   2032 C  CA  . ALA A 1 249 ? -11.799 -11.520 -8.723  1.00 11.91 ? 388 ALA A CA  1 
ATOM   2033 C  C   . ALA A 1 249 ? -13.289 -11.718 -8.481  1.00 12.88 ? 388 ALA A C   1 
ATOM   2034 O  O   . ALA A 1 249 ? -13.956 -12.426 -9.243  1.00 12.90 ? 388 ALA A O   1 
ATOM   2035 C  CB  . ALA A 1 249 ? -11.585 -10.379 -9.727  1.00 12.01 ? 388 ALA A CB  1 
ATOM   2036 N  N   . SER A 1 250 ? -13.807 -11.081 -7.431  1.00 10.24 ? 389 SER A N   1 
ATOM   2037 C  CA  . SER A 1 250 ? -15.222 -11.195 -7.052  1.00 12.63 ? 389 SER A CA  1 
ATOM   2038 C  C   . SER A 1 250 ? -16.102 -10.192 -7.784  1.00 11.98 ? 389 SER A C   1 
ATOM   2039 O  O   . SER A 1 250 ? -17.282 -10.048 -7.470  1.00 14.71 ? 389 SER A O   1 
ATOM   2040 C  CB  . SER A 1 250 ? -15.394 -10.998 -5.544  1.00 12.55 ? 389 SER A CB  1 
ATOM   2041 O  OG  . SER A 1 250 ? -15.167 -9.640  -5.209  1.00 13.71 ? 389 SER A OG  1 
ATOM   2042 N  N   . PHE A 1 251 ? -15.517 -9.485  -8.736  1.00 14.55 ? 390 PHE A N   1 
ATOM   2043 C  CA  . PHE A 1 251 ? -16.214 -8.415  -9.447  1.00 19.44 ? 390 PHE A CA  1 
ATOM   2044 C  C   . PHE A 1 251 ? -15.678 -8.334  -10.866 1.00 21.40 ? 390 PHE A C   1 
ATOM   2045 O  O   . PHE A 1 251 ? -14.518 -8.656  -11.093 1.00 18.54 ? 390 PHE A O   1 
ATOM   2046 C  CB  . PHE A 1 251 ? -16.043 -7.075  -8.706  1.00 15.88 ? 390 PHE A CB  1 
ATOM   2047 C  CG  . PHE A 1 251 ? -14.608 -6.637  -8.560  1.00 14.61 ? 390 PHE A CG  1 
ATOM   2048 C  CD1 . PHE A 1 251 ? -13.783 -7.216  -7.596  1.00 10.61 ? 390 PHE A CD1 1 
ATOM   2049 C  CD2 . PHE A 1 251 ? -14.069 -5.670  -9.390  1.00 24.05 ? 390 PHE A CD2 1 
ATOM   2050 C  CE1 . PHE A 1 251 ? -12.462 -6.830  -7.460  1.00 13.57 ? 390 PHE A CE1 1 
ATOM   2051 C  CE2 . PHE A 1 251 ? -12.736 -5.278  -9.253  1.00 24.19 ? 390 PHE A CE2 1 
ATOM   2052 C  CZ  . PHE A 1 251 ? -11.936 -5.860  -8.284  1.00 18.30 ? 390 PHE A CZ  1 
ATOM   2053 N  N   . PRO A 1 252 ? -16.525 -7.896  -11.827 1.00 22.26 ? 391 PRO A N   1 
ATOM   2054 C  CA  . PRO A 1 252 ? -16.172 -7.848  -13.253 1.00 26.11 ? 391 PRO A CA  1 
ATOM   2055 C  C   . PRO A 1 252 ? -15.241 -6.703  -13.653 1.00 34.49 ? 391 PRO A C   1 
ATOM   2056 O  O   . PRO A 1 252 ? -14.721 -5.993  -12.798 1.00 34.99 ? 391 PRO A O   1 
ATOM   2057 C  CB  . PRO A 1 252 ? -17.533 -7.699  -13.944 1.00 25.41 ? 391 PRO A CB  1 
ATOM   2058 C  CG  . PRO A 1 252 ? -18.396 -7.052  -12.942 1.00 26.11 ? 391 PRO A CG  1 
ATOM   2059 C  CD  . PRO A 1 252 ? -17.948 -7.582  -11.607 1.00 24.52 ? 391 PRO A CD  1 
ATOM   2060 N  N   . ALA A 1 253 ? -15.098 -6.489  -14.957 1.00 54.68 ? 392 ALA A N   1 
ATOM   2061 C  CA  . ALA A 1 253 ? -13.999 -5.687  -15.491 1.00 67.92 ? 392 ALA A CA  1 
ATOM   2062 C  C   . ALA A 1 253 ? -14.112 -4.217  -15.108 1.00 72.04 ? 392 ALA A C   1 
ATOM   2063 O  O   . ALA A 1 253 ? -13.523 -3.788  -14.115 1.00 77.85 ? 392 ALA A O   1 
ATOM   2064 C  CB  . ALA A 1 253 ? -13.940 -5.830  -17.006 1.00 71.06 ? 392 ALA A CB  1 
ATOM   2065 N  N   . GLY A 1 254 ? -14.850 -3.443  -15.894 1.00 69.60 ? 393 GLY A N   1 
ATOM   2066 C  CA  . GLY A 1 254 ? -15.020 -2.030  -15.611 1.00 66.05 ? 393 GLY A CA  1 
ATOM   2067 C  C   . GLY A 1 254 ? -13.801 -1.171  -15.897 1.00 62.77 ? 393 GLY A C   1 
ATOM   2068 O  O   . GLY A 1 254 ? -12.663 -1.554  -15.618 1.00 59.46 ? 393 GLY A O   1 
ATOM   2069 N  N   . VAL A 1 255 ? -14.052 0.004   -16.462 1.00 61.24 ? 394 VAL A N   1 
ATOM   2070 C  CA  . VAL A 1 255 ? -12.997 0.931   -16.853 1.00 56.75 ? 394 VAL A CA  1 
ATOM   2071 C  C   . VAL A 1 255 ? -12.701 1.913   -15.715 1.00 59.69 ? 394 VAL A C   1 
ATOM   2072 O  O   . VAL A 1 255 ? -13.591 2.254   -14.936 1.00 59.45 ? 394 VAL A O   1 
ATOM   2073 C  CB  . VAL A 1 255 ? -13.382 1.697   -18.135 1.00 42.93 ? 394 VAL A CB  1 
ATOM   2074 C  CG1 . VAL A 1 255 ? -13.509 0.730   -19.306 1.00 37.10 ? 394 VAL A CG1 1 
ATOM   2075 C  CG2 . VAL A 1 255 ? -14.686 2.450   -17.936 1.00 41.84 ? 394 VAL A CG2 1 
ATOM   2076 N  N   . ASP A 1 256 ? -11.445 2.338   -15.595 1.00 62.40 ? 395 ASP A N   1 
ATOM   2077 C  CA  . ASP A 1 256 ? -11.068 3.306   -14.564 1.00 69.60 ? 395 ASP A CA  1 
ATOM   2078 C  C   . ASP A 1 256 ? -11.495 4.729   -14.920 1.00 67.22 ? 395 ASP A C   1 
ATOM   2079 O  O   . ASP A 1 256 ? -11.492 5.618   -14.065 1.00 62.07 ? 395 ASP A O   1 
ATOM   2080 C  CB  . ASP A 1 256 ? -9.555  3.282   -14.310 1.00 75.83 ? 395 ASP A CB  1 
ATOM   2081 C  CG  . ASP A 1 256 ? -9.105  2.054   -13.534 1.00 83.43 ? 395 ASP A CG  1 
ATOM   2082 O  OD1 . ASP A 1 256 ? -9.916  1.502   -12.760 1.00 85.27 ? 395 ASP A OD1 1 
ATOM   2083 O  OD2 . ASP A 1 256 ? -7.925  1.664   -13.671 1.00 86.31 ? 395 ASP A OD2 1 
ATOM   2084 N  N   . SER A 1 257 ? -11.860 4.941   -16.180 1.00 66.32 ? 396 SER A N   1 
ATOM   2085 C  CA  . SER A 1 257 ? -12.182 6.280   -16.664 1.00 65.63 ? 396 SER A CA  1 
ATOM   2086 C  C   . SER A 1 257 ? -13.027 6.227   -17.932 1.00 65.72 ? 396 SER A C   1 
ATOM   2087 O  O   . SER A 1 257 ? -13.224 5.160   -18.505 1.00 67.80 ? 396 SER A O   1 
ATOM   2088 C  CB  . SER A 1 257 ? -10.898 7.068   -16.924 1.00 60.57 ? 396 SER A CB  1 
ATOM   2089 O  OG  . SER A 1 257 ? -9.971  6.284   -17.656 1.00 55.26 ? 396 SER A OG  1 
ATOM   2090 N  N   . SER A 1 258 ? -13.521 7.383   -18.368 1.00 61.22 ? 397 SER A N   1 
ATOM   2091 C  CA  . SER A 1 258 ? -14.346 7.454   -19.571 1.00 57.63 ? 397 SER A CA  1 
ATOM   2092 C  C   . SER A 1 258 ? -14.370 8.860   -20.159 1.00 53.43 ? 397 SER A C   1 
ATOM   2093 O  O   . SER A 1 258 ? -14.568 9.835   -19.429 1.00 52.78 ? 397 SER A O   1 
ATOM   2094 C  CB  . SER A 1 258 ? -15.776 6.993   -19.272 1.00 58.58 ? 397 SER A CB  1 
ATOM   2095 O  OG  . SER A 1 258 ? -15.866 5.577   -19.246 1.00 57.12 ? 397 SER A OG  1 
ATOM   2096 N  N   . PRO A 1 259 ? -14.166 8.966   -21.485 1.00 42.87 ? 398 PRO A N   1 
ATOM   2097 C  CA  . PRO A 1 259 ? -14.243 10.253  -22.188 1.00 37.19 ? 398 PRO A CA  1 
ATOM   2098 C  C   . PRO A 1 259 ? -15.643 10.862  -22.121 1.00 44.48 ? 398 PRO A C   1 
ATOM   2099 O  O   . PRO A 1 259 ? -16.634 10.126  -22.110 1.00 48.16 ? 398 PRO A O   1 
ATOM   2100 C  CB  . PRO A 1 259 ? -13.863 9.893   -23.632 1.00 24.04 ? 398 PRO A CB  1 
ATOM   2101 C  CG  . PRO A 1 259 ? -14.096 8.429   -23.747 1.00 30.77 ? 398 PRO A CG  1 
ATOM   2102 C  CD  . PRO A 1 259 ? -13.798 7.864   -22.393 1.00 37.51 ? 398 PRO A CD  1 
ATOM   2103 N  N   . ARG A 1 260 ? -15.713 12.191  -22.066 1.00 46.02 ? 399 ARG A N   1 
ATOM   2104 C  CA  . ARG A 1 260 ? -16.986 12.899  -21.957 1.00 49.12 ? 399 ARG A CA  1 
ATOM   2105 C  C   . ARG A 1 260 ? -17.876 12.627  -23.169 1.00 51.46 ? 399 ARG A C   1 
ATOM   2106 O  O   . ARG A 1 260 ? -19.067 12.347  -23.026 1.00 52.19 ? 399 ARG A O   1 
ATOM   2107 C  CB  . ARG A 1 260 ? -16.751 14.406  -21.807 1.00 50.64 ? 399 ARG A CB  1 
ATOM   2108 C  CG  . ARG A 1 260 ? -15.704 14.791  -20.768 1.00 48.71 ? 399 ARG A CG  1 
ATOM   2109 C  CD  . ARG A 1 260 ? -16.212 14.610  -19.342 1.00 51.25 ? 399 ARG A CD  1 
ATOM   2110 N  NE  . ARG A 1 260 ? -15.296 15.196  -18.364 1.00 51.46 ? 399 ARG A NE  1 
ATOM   2111 C  CZ  . ARG A 1 260 ? -15.539 15.278  -17.057 1.00 50.55 ? 399 ARG A CZ  1 
ATOM   2112 N  NH1 . ARG A 1 260 ? -16.678 14.812  -16.556 1.00 51.69 ? 399 ARG A NH1 1 
ATOM   2113 N  NH2 . ARG A 1 260 ? -14.641 15.830  -16.249 1.00 38.41 ? 399 ARG A NH2 1 
ATOM   2114 N  N   . TRP B 1 2   ? 0.532   0.105   -13.918 1.00 13.56 ? 141 TRP B N   1 
ATOM   2115 C  CA  . TRP B 1 2   ? 1.013   -0.321  -15.232 1.00 14.22 ? 141 TRP B CA  1 
ATOM   2116 C  C   . TRP B 1 2   ? 2.484   0.061   -15.391 1.00 13.02 ? 141 TRP B C   1 
ATOM   2117 O  O   . TRP B 1 2   ? 3.001   0.899   -14.640 1.00 13.65 ? 141 TRP B O   1 
ATOM   2118 C  CB  . TRP B 1 2   ? 0.196   0.338   -16.352 1.00 15.19 ? 141 TRP B CB  1 
ATOM   2119 C  CG  . TRP B 1 2   ? 0.144   1.856   -16.274 1.00 11.72 ? 141 TRP B CG  1 
ATOM   2120 C  CD1 . TRP B 1 2   ? -0.782  2.622   -15.640 1.00 12.35 ? 141 TRP B CD1 1 
ATOM   2121 C  CD2 . TRP B 1 2   ? 1.097   2.771   -16.846 1.00 9.73  ? 141 TRP B CD2 1 
ATOM   2122 N  NE1 . TRP B 1 2   ? -0.476  3.965   -15.783 1.00 12.91 ? 141 TRP B NE1 1 
ATOM   2123 C  CE2 . TRP B 1 2   ? 0.677   4.077   -16.517 1.00 9.79  ? 141 TRP B CE2 1 
ATOM   2124 C  CE3 . TRP B 1 2   ? 2.265   2.608   -17.599 1.00 13.30 ? 141 TRP B CE3 1 
ATOM   2125 C  CZ2 . TRP B 1 2   ? 1.380   5.223   -16.928 1.00 11.68 ? 141 TRP B CZ2 1 
ATOM   2126 C  CZ3 . TRP B 1 2   ? 2.967   3.743   -18.001 1.00 13.03 ? 141 TRP B CZ3 1 
ATOM   2127 C  CH2 . TRP B 1 2   ? 2.523   5.030   -17.663 1.00 10.55 ? 141 TRP B CH2 1 
ATOM   2128 N  N   . ARG B 1 3   ? 3.133   -0.478  -16.420 1.00 13.47 ? 142 ARG B N   1 
ATOM   2129 C  CA  . ARG B 1 3   ? 4.515   -0.107  -16.709 1.00 11.99 ? 142 ARG B CA  1 
ATOM   2130 C  C   . ARG B 1 3   ? 4.693   0.108   -18.203 1.00 15.39 ? 142 ARG B C   1 
ATOM   2131 O  O   . ARG B 1 3   ? 3.946   -0.453  -18.999 1.00 15.04 ? 142 ARG B O   1 
ATOM   2132 C  CB  . ARG B 1 3   ? 5.503   -1.173  -16.200 1.00 12.68 ? 142 ARG B CB  1 
ATOM   2133 C  CG  . ARG B 1 3   ? 5.536   -2.456  -17.023 1.00 12.95 ? 142 ARG B CG  1 
ATOM   2134 C  CD  . ARG B 1 3   ? 6.416   -3.514  -16.362 1.00 14.61 ? 142 ARG B CD  1 
ATOM   2135 N  NE  . ARG B 1 3   ? 5.828   -4.036  -15.131 1.00 13.85 ? 142 ARG B NE  1 
ATOM   2136 C  CZ  . ARG B 1 3   ? 6.379   -5.011  -14.407 1.00 14.46 ? 142 ARG B CZ  1 
ATOM   2137 N  NH1 . ARG B 1 3   ? 7.535   -5.546  -14.787 1.00 15.47 ? 142 ARG B NH1 1 
ATOM   2138 N  NH2 . ARG B 1 3   ? 5.774   -5.446  -13.307 1.00 14.62 ? 142 ARG B NH2 1 
ATOM   2139 N  N   . TYR B 1 4   ? 5.663   0.931   -18.582 1.00 12.92 ? 143 TYR B N   1 
ATOM   2140 C  CA  . TYR B 1 4   ? 5.945   1.086   -19.999 1.00 12.99 ? 143 TYR B CA  1 
ATOM   2141 C  C   . TYR B 1 4   ? 6.348   -0.277  -20.571 1.00 15.78 ? 143 TYR B C   1 
ATOM   2142 O  O   . TYR B 1 4   ? 7.084   -1.035  -19.932 1.00 17.35 ? 143 TYR B O   1 
ATOM   2143 C  CB  . TYR B 1 4   ? 7.020   2.147   -20.216 1.00 12.80 ? 143 TYR B CB  1 
ATOM   2144 C  CG  . TYR B 1 4   ? 6.456   3.539   -20.046 1.00 11.76 ? 143 TYR B CG  1 
ATOM   2145 C  CD1 . TYR B 1 4   ? 6.484   4.185   -18.810 1.00 13.98 ? 143 TYR B CD1 1 
ATOM   2146 C  CD2 . TYR B 1 4   ? 5.836   4.191   -21.112 1.00 11.63 ? 143 TYR B CD2 1 
ATOM   2147 C  CE1 . TYR B 1 4   ? 5.929   5.471   -18.652 1.00 10.28 ? 143 TYR B CE1 1 
ATOM   2148 C  CE2 . TYR B 1 4   ? 5.286   5.471   -20.963 1.00 11.67 ? 143 TYR B CE2 1 
ATOM   2149 C  CZ  . TYR B 1 4   ? 5.340   6.096   -19.734 1.00 10.99 ? 143 TYR B CZ  1 
ATOM   2150 O  OH  . TYR B 1 4   ? 4.806   7.350   -19.583 1.00 9.98  ? 143 TYR B OH  1 
ATOM   2151 N  N   . GLY B 1 5   ? 5.819   -0.597  -21.750 1.00 18.20 ? 144 GLY B N   1 
ATOM   2152 C  CA  . GLY B 1 5   ? 6.070   -1.889  -22.370 1.00 22.16 ? 144 GLY B CA  1 
ATOM   2153 C  C   . GLY B 1 5   ? 5.197   -3.018  -21.835 1.00 25.23 ? 144 GLY B C   1 
ATOM   2154 O  O   . GLY B 1 5   ? 5.319   -4.167  -22.269 1.00 28.48 ? 144 GLY B O   1 
ATOM   2155 N  N   . GLY B 1 6   ? 4.310   -2.695  -20.898 1.00 20.61 ? 145 GLY B N   1 
ATOM   2156 C  CA  . GLY B 1 6   ? 3.461   -3.690  -20.264 1.00 19.86 ? 145 GLY B CA  1 
ATOM   2157 C  C   . GLY B 1 6   ? 2.218   -4.050  -21.065 1.00 26.36 ? 145 GLY B C   1 
ATOM   2158 O  O   . GLY B 1 6   ? 1.964   -3.481  -22.130 1.00 24.91 ? 145 GLY B O   1 
ATOM   2159 N  N   . ASP B 1 7   ? 1.470   -5.030  -20.558 1.00 21.95 ? 146 ASP B N   1 
ATOM   2160 C  CA  . ASP B 1 7   ? 0.210   -5.480  -21.153 1.00 26.58 ? 146 ASP B CA  1 
ATOM   2161 C  C   . ASP B 1 7   ? -0.886  -5.546  -20.097 1.00 24.38 ? 146 ASP B C   1 
ATOM   2162 O  O   . ASP B 1 7   ? -0.585  -5.724  -18.917 1.00 21.50 ? 146 ASP B O   1 
ATOM   2163 C  CB  A ASP B 1 7   ? 0.389   -6.847  -21.822 0.55 33.85 ? 146 ASP B CB  1 
ATOM   2164 C  CB  B ASP B 1 7   ? 0.383   -6.856  -21.805 0.45 34.18 ? 146 ASP B CB  1 
ATOM   2165 C  CG  A ASP B 1 7   ? 1.073   -6.747  -23.169 0.55 41.37 ? 146 ASP B CG  1 
ATOM   2166 C  CG  B ASP B 1 7   ? 1.548   -6.904  -22.768 0.45 41.46 ? 146 ASP B CG  1 
ATOM   2167 O  OD1 A ASP B 1 7   ? 0.444   -6.226  -24.115 0.55 44.51 ? 146 ASP B OD1 1 
ATOM   2168 O  OD1 B ASP B 1 7   ? 1.435   -6.337  -23.876 0.45 44.09 ? 146 ASP B OD1 1 
ATOM   2169 O  OD2 A ASP B 1 7   ? 2.234   -7.194  -23.285 0.55 44.65 ? 146 ASP B OD2 1 
ATOM   2170 O  OD2 B ASP B 1 7   ? 2.577   -7.519  -22.416 0.45 43.12 ? 146 ASP B OD2 1 
ATOM   2171 N  N   . PRO B 1 8   ? -2.162  -5.414  -20.504 1.00 21.00 ? 147 PRO B N   1 
ATOM   2172 C  CA  . PRO B 1 8   ? -2.684  -5.188  -21.858 1.00 20.89 ? 147 PRO B CA  1 
ATOM   2173 C  C   . PRO B 1 8   ? -2.581  -3.716  -22.271 1.00 25.60 ? 147 PRO B C   1 
ATOM   2174 O  O   . PRO B 1 8   ? -2.215  -2.882  -21.439 1.00 22.92 ? 147 PRO B O   1 
ATOM   2175 C  CB  . PRO B 1 8   ? -4.137  -5.658  -21.754 1.00 25.35 ? 147 PRO B CB  1 
ATOM   2176 C  CG  . PRO B 1 8   ? -4.498  -5.442  -20.376 1.00 31.82 ? 147 PRO B CG  1 
ATOM   2177 C  CD  . PRO B 1 8   ? -3.254  -5.590  -19.531 1.00 24.66 ? 147 PRO B CD  1 
ATOM   2178 N  N   . PRO B 1 9   ? -2.861  -3.403  -23.548 1.00 24.83 ? 148 PRO B N   1 
ATOM   2179 C  CA  . PRO B 1 9   ? -2.843  -2.001  -23.990 1.00 19.43 ? 148 PRO B CA  1 
ATOM   2180 C  C   . PRO B 1 9   ? -3.751  -1.093  -23.169 1.00 21.14 ? 148 PRO B C   1 
ATOM   2181 O  O   . PRO B 1 9   ? -4.773  -1.542  -22.655 1.00 19.02 ? 148 PRO B O   1 
ATOM   2182 C  CB  . PRO B 1 9   ? -3.334  -2.087  -25.438 1.00 21.35 ? 148 PRO B CB  1 
ATOM   2183 C  CG  . PRO B 1 9   ? -2.937  -3.459  -25.880 1.00 26.87 ? 148 PRO B CG  1 
ATOM   2184 C  CD  . PRO B 1 9   ? -3.099  -4.332  -24.671 1.00 27.01 ? 148 PRO B CD  1 
ATOM   2185 N  N   . TRP B 1 10  ? -3.373  0.181   -23.062 1.00 17.51 ? 149 TRP B N   1 
ATOM   2186 C  CA  . TRP B 1 10  ? -4.114  1.144   -22.245 1.00 16.22 ? 149 TRP B CA  1 
ATOM   2187 C  C   . TRP B 1 10  ? -5.623  1.288   -22.524 1.00 15.82 ? 149 TRP B C   1 
ATOM   2188 O  O   . TRP B 1 10  ? -6.395  1.439   -21.577 1.00 18.75 ? 149 TRP B O   1 
ATOM   2189 C  CB  . TRP B 1 10  ? -3.464  2.528   -22.380 1.00 21.03 ? 149 TRP B CB  1 
ATOM   2190 C  CG  . TRP B 1 10  ? -2.120  2.651   -21.719 1.00 21.04 ? 149 TRP B CG  1 
ATOM   2191 C  CD1 . TRP B 1 10  ? -1.517  1.746   -20.881 1.00 17.27 ? 149 TRP B CD1 1 
ATOM   2192 C  CD2 . TRP B 1 10  ? -1.197  3.735   -21.871 1.00 15.25 ? 149 TRP B CD2 1 
ATOM   2193 N  NE1 . TRP B 1 10  ? -0.282  2.222   -20.484 1.00 17.19 ? 149 TRP B NE1 1 
ATOM   2194 C  CE2 . TRP B 1 10  ? -0.061  3.436   -21.082 1.00 14.43 ? 149 TRP B CE2 1 
ATOM   2195 C  CE3 . TRP B 1 10  ? -1.221  4.930   -22.593 1.00 14.98 ? 149 TRP B CE3 1 
ATOM   2196 C  CZ2 . TRP B 1 10  ? 1.036   4.298   -20.992 1.00 17.31 ? 149 TRP B CZ2 1 
ATOM   2197 C  CZ3 . TRP B 1 10  ? -0.131  5.780   -22.505 1.00 12.53 ? 149 TRP B CZ3 1 
ATOM   2198 C  CH2 . TRP B 1 10  ? 0.983   5.460   -21.713 1.00 14.97 ? 149 TRP B CH2 1 
ATOM   2199 N  N   . PRO B 1 11  ? -6.053  1.237   -23.803 1.00 18.55 ? 150 PRO B N   1 
ATOM   2200 C  CA  . PRO B 1 11  ? -7.486  1.498   -24.033 1.00 22.32 ? 150 PRO B CA  1 
ATOM   2201 C  C   . PRO B 1 11  ? -8.471  0.530   -23.370 1.00 24.63 ? 150 PRO B C   1 
ATOM   2202 O  O   . PRO B 1 11  ? -9.633  0.904   -23.201 1.00 23.94 ? 150 PRO B O   1 
ATOM   2203 C  CB  . PRO B 1 11  ? -7.615  1.392   -25.558 1.00 19.22 ? 150 PRO B CB  1 
ATOM   2204 C  CG  . PRO B 1 11  ? -6.278  1.765   -26.067 1.00 19.36 ? 150 PRO B CG  1 
ATOM   2205 C  CD  . PRO B 1 11  ? -5.311  1.169   -25.078 1.00 17.18 ? 150 PRO B CD  1 
ATOM   2206 N  N   . ARG B 1 12  ? -8.034  -0.658  -22.966 1.00 24.18 ? 151 ARG B N   1 
ATOM   2207 C  CA  . ARG B 1 12  ? -8.988  -1.592  -22.377 1.00 29.86 ? 151 ARG B CA  1 
ATOM   2208 C  C   . ARG B 1 12  ? -9.566  -1.070  -21.054 1.00 29.87 ? 151 ARG B C   1 
ATOM   2209 O  O   . ARG B 1 12  ? -10.771 -1.171  -20.819 1.00 36.10 ? 151 ARG B O   1 
ATOM   2210 C  CB  . ARG B 1 12  ? -8.330  -2.959  -22.179 1.00 36.35 ? 151 ARG B CB  1 
ATOM   2211 C  CG  . ARG B 1 12  ? -8.037  -3.681  -23.495 1.00 45.94 ? 151 ARG B CG  1 
ATOM   2212 C  CD  . ARG B 1 12  ? -8.530  -5.122  -23.472 1.00 52.28 ? 151 ARG B CD  1 
ATOM   2213 N  NE  . ARG B 1 12  ? -7.810  -5.931  -22.492 1.00 59.71 ? 151 ARG B NE  1 
ATOM   2214 C  CZ  . ARG B 1 12  ? -8.327  -6.982  -21.861 1.00 60.53 ? 151 ARG B CZ  1 
ATOM   2215 N  NH1 . ARG B 1 12  ? -9.577  -7.355  -22.101 1.00 63.38 ? 151 ARG B NH1 1 
ATOM   2216 N  NH2 . ARG B 1 12  ? -7.594  -7.656  -20.984 1.00 55.72 ? 151 ARG B NH2 1 
ATOM   2217 N  N   . VAL B 1 13  ? -8.716  -0.498  -20.207 1.00 20.74 ? 152 VAL B N   1 
ATOM   2218 C  CA  . VAL B 1 13  ? -9.144  0.062   -18.916 1.00 27.69 ? 152 VAL B CA  1 
ATOM   2219 C  C   . VAL B 1 13  ? -9.292  1.596   -18.962 1.00 24.09 ? 152 VAL B C   1 
ATOM   2220 O  O   . VAL B 1 13  ? -10.015 2.206   -18.160 1.00 22.40 ? 152 VAL B O   1 
ATOM   2221 C  CB  . VAL B 1 13  ? -8.172  -0.366  -17.791 1.00 33.82 ? 152 VAL B CB  1 
ATOM   2222 C  CG1 . VAL B 1 13  ? -8.420  0.408   -16.510 1.00 33.69 ? 152 VAL B CG1 1 
ATOM   2223 C  CG2 . VAL B 1 13  ? -8.338  -1.850  -17.531 1.00 37.77 ? 152 VAL B CG2 1 
ATOM   2224 N  N   . SER B 1 14  ? -8.618  2.223   -19.920 1.00 22.28 ? 153 SER B N   1 
ATOM   2225 C  CA  . SER B 1 14  ? -8.691  3.671   -20.047 1.00 18.38 ? 153 SER B CA  1 
ATOM   2226 C  C   . SER B 1 14  ? -9.099  4.002   -21.471 1.00 17.11 ? 153 SER B C   1 
ATOM   2227 O  O   . SER B 1 14  ? -8.264  4.204   -22.354 1.00 17.09 ? 153 SER B O   1 
ATOM   2228 C  CB  A SER B 1 14  ? -7.345  4.317   -19.702 0.71 18.83 ? 153 SER B CB  1 
ATOM   2229 C  CB  B SER B 1 14  ? -7.346  4.309   -19.697 0.29 18.70 ? 153 SER B CB  1 
ATOM   2230 O  OG  A SER B 1 14  ? -6.827  3.799   -18.487 0.71 19.19 ? 153 SER B OG  1 
ATOM   2231 O  OG  B SER B 1 14  ? -7.378  5.707   -19.892 0.29 19.02 ? 153 SER B OG  1 
ATOM   2232 N  N   . PRO B 1 15  ? -10.415 4.052   -21.697 1.00 16.53 ? 154 PRO B N   1 
ATOM   2233 C  CA  . PRO B 1 15  ? -10.977 4.182   -23.045 1.00 14.34 ? 154 PRO B CA  1 
ATOM   2234 C  C   . PRO B 1 15  ? -10.591 5.462   -23.771 1.00 14.18 ? 154 PRO B C   1 
ATOM   2235 O  O   . PRO B 1 15  ? -10.571 5.455   -25.000 1.00 16.44 ? 154 PRO B O   1 
ATOM   2236 C  CB  . PRO B 1 15  ? -12.493 4.161   -22.798 1.00 21.10 ? 154 PRO B CB  1 
ATOM   2237 C  CG  . PRO B 1 15  ? -12.670 3.496   -21.495 1.00 24.22 ? 154 PRO B CG  1 
ATOM   2238 C  CD  . PRO B 1 15  ? -11.453 3.798   -20.680 1.00 23.28 ? 154 PRO B CD  1 
ATOM   2239 N  N   . ALA B 1 16  ? -10.326 6.539   -23.038 1.00 14.06 ? 155 ALA B N   1 
ATOM   2240 C  CA  . ALA B 1 16  ? -9.922  7.783   -23.683 1.00 15.23 ? 155 ALA B CA  1 
ATOM   2241 C  C   . ALA B 1 16  ? -8.585  7.636   -24.429 1.00 16.40 ? 155 ALA B C   1 
ATOM   2242 O  O   . ALA B 1 16  ? -8.300  8.407   -25.338 1.00 13.92 ? 155 ALA B O   1 
ATOM   2243 C  CB  . ALA B 1 16  ? -9.851  8.910   -22.665 1.00 17.02 ? 155 ALA B CB  1 
ATOM   2244 N  N   . CYS B 1 17  ? -7.785  6.631   -24.081 1.00 12.00 ? 156 CYS B N   1 
ATOM   2245 C  CA  . CYS B 1 17  ? -6.488  6.432   -24.745 1.00 13.98 ? 156 CYS B CA  1 
ATOM   2246 C  C   . CYS B 1 17  ? -6.632  5.996   -26.208 1.00 13.11 ? 156 CYS B C   1 
ATOM   2247 O  O   . CYS B 1 17  ? -5.666  6.035   -26.976 1.00 13.89 ? 156 CYS B O   1 
ATOM   2248 C  CB  . CYS B 1 17  ? -5.633  5.405   -23.979 1.00 13.10 ? 156 CYS B CB  1 
ATOM   2249 S  SG  . CYS B 1 17  ? -5.191  5.889   -22.284 1.00 14.83 ? 156 CYS B SG  1 
ATOM   2250 N  N   . ALA B 1 18  ? -7.846  5.614   -26.606 1.00 12.64 ? 157 ALA B N   1 
ATOM   2251 C  CA  . ALA B 1 18  ? -8.094  5.258   -27.997 1.00 17.69 ? 157 ALA B CA  1 
ATOM   2252 C  C   . ALA B 1 18  ? -8.634  6.438   -28.794 1.00 14.47 ? 157 ALA B C   1 
ATOM   2253 O  O   . ALA B 1 18  ? -9.036  6.270   -29.950 1.00 15.00 ? 157 ALA B O   1 
ATOM   2254 C  CB  . ALA B 1 18  ? -9.087  4.096   -28.075 1.00 16.85 ? 157 ALA B CB  1 
ATOM   2255 N  N   . GLY B 1 19  ? -8.628  7.626   -28.193 1.00 12.64 ? 158 GLY B N   1 
ATOM   2256 C  CA  . GLY B 1 19  ? -9.109  8.824   -28.879 1.00 12.94 ? 158 GLY B CA  1 
ATOM   2257 C  C   . GLY B 1 19  ? -8.346  9.207   -30.145 1.00 9.37  ? 158 GLY B C   1 
ATOM   2258 O  O   . GLY B 1 19  ? -7.230  8.742   -30.385 1.00 11.89 ? 158 GLY B O   1 
ATOM   2259 N  N   . ARG B 1 20  ? -8.959  10.072  -30.956 1.00 9.50  ? 159 ARG B N   1 
ATOM   2260 C  CA  . ARG B 1 20  ? -8.386  10.488  -32.231 1.00 9.81  ? 159 ARG B CA  1 
ATOM   2261 C  C   . ARG B 1 20  ? -7.402  11.641  -32.083 1.00 10.94 ? 159 ARG B C   1 
ATOM   2262 O  O   . ARG B 1 20  ? -6.689  11.974  -33.033 1.00 13.50 ? 159 ARG B O   1 
ATOM   2263 C  CB  . ARG B 1 20  ? -9.502  10.899  -33.201 1.00 13.88 ? 159 ARG B CB  1 
ATOM   2264 C  CG  . ARG B 1 20  ? -10.373 9.749   -33.679 1.00 15.88 ? 159 ARG B CG  1 
ATOM   2265 C  CD  . ARG B 1 20  ? -11.633 10.284  -34.350 1.00 14.51 ? 159 ARG B CD  1 
ATOM   2266 N  NE  . ARG B 1 20  ? -12.418 11.051  -33.393 1.00 13.14 ? 159 ARG B NE  1 
ATOM   2267 C  CZ  . ARG B 1 20  ? -13.252 12.038  -33.708 1.00 10.82 ? 159 ARG B CZ  1 
ATOM   2268 N  NH1 . ARG B 1 20  ? -13.914 12.675  -32.756 1.00 13.10 ? 159 ARG B NH1 1 
ATOM   2269 N  NH2 . ARG B 1 20  ? -13.428 12.387  -34.986 1.00 13.83 ? 159 ARG B NH2 1 
ATOM   2270 N  N   . PHE B 1 21  ? -7.381  12.275  -30.915 1.00 11.80 ? 160 PHE B N   1 
ATOM   2271 C  CA  . PHE B 1 21  ? -6.641  13.525  -30.771 1.00 9.85  ? 160 PHE B CA  1 
ATOM   2272 C  C   . PHE B 1 21  ? -5.720  13.448  -29.566 1.00 10.21 ? 160 PHE B C   1 
ATOM   2273 O  O   . PHE B 1 21  ? -5.859  14.196  -28.591 1.00 12.74 ? 160 PHE B O   1 
ATOM   2274 C  CB  . PHE B 1 21  ? -7.620  14.696  -30.697 1.00 12.67 ? 160 PHE B CB  1 
ATOM   2275 C  CG  . PHE B 1 21  ? -8.543  14.758  -31.880 1.00 12.23 ? 160 PHE B CG  1 
ATOM   2276 C  CD1 . PHE B 1 21  ? -9.919  14.632  -31.722 1.00 14.16 ? 160 PHE B CD1 1 
ATOM   2277 C  CD2 . PHE B 1 21  ? -8.027  14.871  -33.163 1.00 13.06 ? 160 PHE B CD2 1 
ATOM   2278 C  CE1 . PHE B 1 21  ? -10.760 14.662  -32.835 1.00 15.78 ? 160 PHE B CE1 1 
ATOM   2279 C  CE2 . PHE B 1 21  ? -8.855  14.900  -34.274 1.00 15.87 ? 160 PHE B CE2 1 
ATOM   2280 C  CZ  . PHE B 1 21  ? -10.224 14.789  -34.108 1.00 14.08 ? 160 PHE B CZ  1 
ATOM   2281 N  N   . GLN B 1 22  ? -4.765  12.534  -29.684 1.00 10.32 ? 161 GLN B N   1 
ATOM   2282 C  CA  . GLN B 1 22  ? -3.860  12.169  -28.596 1.00 8.06  ? 161 GLN B CA  1 
ATOM   2283 C  C   . GLN B 1 22  ? -2.505  12.872  -28.682 1.00 10.17 ? 161 GLN B C   1 
ATOM   2284 O  O   . GLN B 1 22  ? -2.148  13.454  -29.713 1.00 10.31 ? 161 GLN B O   1 
ATOM   2285 C  CB  . GLN B 1 22  ? -3.662  10.653  -28.594 1.00 10.64 ? 161 GLN B CB  1 
ATOM   2286 C  CG  . GLN B 1 22  ? -4.965  9.868   -28.309 1.00 10.81 ? 161 GLN B CG  1 
ATOM   2287 C  CD  . GLN B 1 22  ? -5.310  9.849   -26.823 1.00 11.24 ? 161 GLN B CD  1 
ATOM   2288 O  OE1 . GLN B 1 22  ? -4.604  9.239   -26.023 1.00 11.03 ? 161 GLN B OE1 1 
ATOM   2289 N  NE2 . GLN B 1 22  ? -6.406  10.514  -26.450 1.00 10.18 ? 161 GLN B NE2 1 
ATOM   2290 N  N   . SER B 1 23  ? -1.766  12.799  -27.576 1.00 9.00  ? 162 SER B N   1 
ATOM   2291 C  CA  . SER B 1 23  ? -0.380  13.272  -27.467 1.00 10.31 ? 162 SER B CA  1 
ATOM   2292 C  C   . SER B 1 23  ? 0.493   12.106  -27.027 1.00 9.54  ? 162 SER B C   1 
ATOM   2293 O  O   . SER B 1 23  ? 0.003   11.149  -26.425 1.00 11.49 ? 162 SER B O   1 
ATOM   2294 C  CB  . SER B 1 23  ? -0.267  14.432  -26.457 1.00 7.80  ? 162 SER B CB  1 
ATOM   2295 O  OG  . SER B 1 23  ? -1.038  15.534  -26.900 1.00 9.49  ? 162 SER B OG  1 
ATOM   2296 N  N   . PRO B 1 24  ? 1.798   12.164  -27.305 1.00 7.97  ? 163 PRO B N   1 
ATOM   2297 C  CA  . PRO B 1 24  ? 2.546   13.225  -27.988 1.00 8.18  ? 163 PRO B CA  1 
ATOM   2298 C  C   . PRO B 1 24  ? 2.407   13.133  -29.511 1.00 9.56  ? 163 PRO B C   1 
ATOM   2299 O  O   . PRO B 1 24  ? 1.817   12.173  -30.012 1.00 10.46 ? 163 PRO B O   1 
ATOM   2300 C  CB  . PRO B 1 24  ? 3.987   12.957  -27.541 1.00 9.58  ? 163 PRO B CB  1 
ATOM   2301 C  CG  . PRO B 1 24  ? 4.035   11.436  -27.492 1.00 11.06 ? 163 PRO B CG  1 
ATOM   2302 C  CD  . PRO B 1 24  ? 2.675   11.041  -26.914 1.00 9.64  ? 163 PRO B CD  1 
ATOM   2303 N  N   . VAL B 1 25  ? 2.913   14.143  -30.215 1.00 8.32  ? 164 VAL B N   1 
ATOM   2304 C  CA  . VAL B 1 25  ? 2.875   14.175  -31.675 1.00 8.29  ? 164 VAL B CA  1 
ATOM   2305 C  C   . VAL B 1 25  ? 4.251   14.551  -32.217 1.00 7.11  ? 164 VAL B C   1 
ATOM   2306 O  O   . VAL B 1 25  ? 5.124   15.024  -31.479 1.00 9.84  ? 164 VAL B O   1 
ATOM   2307 C  CB  . VAL B 1 25  ? 1.827   15.182  -32.222 1.00 10.84 ? 164 VAL B CB  1 
ATOM   2308 C  CG1 . VAL B 1 25  ? 0.440   14.825  -31.703 1.00 11.27 ? 164 VAL B CG1 1 
ATOM   2309 C  CG2 . VAL B 1 25  ? 2.185   16.603  -31.818 1.00 9.56  ? 164 VAL B CG2 1 
ATOM   2310 N  N   . ASP B 1 26  ? 4.416   14.315  -33.515 1.00 10.66 ? 165 ASP B N   1 
ATOM   2311 C  CA  . ASP B 1 26  ? 5.592   14.763  -34.245 1.00 11.53 ? 165 ASP B CA  1 
ATOM   2312 C  C   . ASP B 1 26  ? 5.367   16.216  -34.661 1.00 11.59 ? 165 ASP B C   1 
ATOM   2313 O  O   . ASP B 1 26  ? 4.324   16.548  -35.242 1.00 14.26 ? 165 ASP B O   1 
ATOM   2314 C  CB  . ASP B 1 26  ? 5.837   13.870  -35.457 1.00 9.31  ? 165 ASP B CB  1 
ATOM   2315 C  CG  . ASP B 1 26  ? 7.088   14.254  -36.220 1.00 12.70 ? 165 ASP B CG  1 
ATOM   2316 O  OD1 . ASP B 1 26  ? 7.016   14.395  -37.460 1.00 15.52 ? 165 ASP B OD1 1 
ATOM   2317 O  OD2 . ASP B 1 26  ? 8.130   14.406  -35.578 1.00 11.42 ? 165 ASP B OD2 1 
ATOM   2318 N  N   . ILE B 1 27  ? 6.334   17.065  -34.340 1.00 10.63 ? 166 ILE B N   1 
ATOM   2319 C  CA  . ILE B 1 27  ? 6.298   18.482  -34.695 1.00 10.84 ? 166 ILE B CA  1 
ATOM   2320 C  C   . ILE B 1 27  ? 7.090   18.738  -35.957 1.00 11.59 ? 166 ILE B C   1 
ATOM   2321 O  O   . ILE B 1 27  ? 8.267   18.381  -36.034 1.00 14.46 ? 166 ILE B O   1 
ATOM   2322 C  CB  . ILE B 1 27  ? 6.878   19.359  -33.584 1.00 12.69 ? 166 ILE B CB  1 
ATOM   2323 C  CG1 . ILE B 1 27  ? 6.113   19.141  -32.277 1.00 12.72 ? 166 ILE B CG1 1 
ATOM   2324 C  CG2 . ILE B 1 27  ? 6.854   20.823  -34.002 1.00 15.73 ? 166 ILE B CG2 1 
ATOM   2325 C  CD1 . ILE B 1 27  ? 6.805   19.739  -31.066 1.00 12.79 ? 166 ILE B CD1 1 
ATOM   2326 N  N   . ARG B 1 28  ? 6.442   19.344  -36.947 1.00 12.60 ? 167 ARG B N   1 
ATOM   2327 C  CA  . ARG B 1 28  ? 7.131   19.694  -38.184 1.00 14.53 ? 167 ARG B CA  1 
ATOM   2328 C  C   . ARG B 1 28  ? 7.153   21.209  -38.364 1.00 14.25 ? 167 ARG B C   1 
ATOM   2329 O  O   . ARG B 1 28  ? 6.168   21.779  -38.829 1.00 16.87 ? 167 ARG B O   1 
ATOM   2330 C  CB  . ARG B 1 28  ? 6.466   18.997  -39.373 1.00 16.61 ? 167 ARG B CB  1 
ATOM   2331 C  CG  . ARG B 1 28  ? 6.444   17.474  -39.182 1.00 19.55 ? 167 ARG B CG  1 
ATOM   2332 C  CD  . ARG B 1 28  ? 5.871   16.732  -40.366 1.00 22.90 ? 167 ARG B CD  1 
ATOM   2333 N  NE  . ARG B 1 28  ? 6.763   16.911  -41.507 1.00 22.32 ? 167 ARG B NE  1 
ATOM   2334 C  CZ  . ARG B 1 28  ? 6.537   16.432  -42.723 1.00 22.96 ? 167 ARG B CZ  1 
ATOM   2335 N  NH1 . ARG B 1 28  ? 5.447   15.720  -42.968 1.00 24.44 ? 167 ARG B NH1 1 
ATOM   2336 N  NH2 . ARG B 1 28  ? 7.417   16.660  -43.691 1.00 22.86 ? 167 ARG B NH2 1 
ATOM   2337 N  N   . PRO B 1 29  ? 8.265   21.857  -37.976 1.00 17.81 ? 168 PRO B N   1 
ATOM   2338 C  CA  . PRO B 1 29  ? 8.286   23.324  -37.905 1.00 16.27 ? 168 PRO B CA  1 
ATOM   2339 C  C   . PRO B 1 29  ? 7.939   24.020  -39.220 1.00 22.00 ? 168 PRO B C   1 
ATOM   2340 O  O   . PRO B 1 29  ? 7.365   25.107  -39.175 1.00 21.71 ? 168 PRO B O   1 
ATOM   2341 C  CB  . PRO B 1 29  ? 9.721   23.624  -37.484 1.00 20.74 ? 168 PRO B CB  1 
ATOM   2342 C  CG  . PRO B 1 29  ? 10.104  22.417  -36.660 1.00 22.22 ? 168 PRO B CG  1 
ATOM   2343 C  CD  . PRO B 1 29  ? 9.490   21.265  -37.402 1.00 17.46 ? 168 PRO B CD  1 
ATOM   2344 N  N   . GLN B 1 30  ? 8.227   23.388  -40.354 1.00 24.21 ? 169 GLN B N   1 
ATOM   2345 C  CA  . GLN B 1 30  ? 7.915   23.966  -41.666 1.00 30.42 ? 169 GLN B CA  1 
ATOM   2346 C  C   . GLN B 1 30  ? 6.422   23.957  -41.975 1.00 24.68 ? 169 GLN B C   1 
ATOM   2347 O  O   . GLN B 1 30  ? 5.940   24.750  -42.788 1.00 26.77 ? 169 GLN B O   1 
ATOM   2348 C  CB  A GLN B 1 30  ? 8.670   23.218  -42.769 0.62 33.63 ? 169 GLN B CB  1 
ATOM   2349 C  CB  B GLN B 1 30  ? 8.659   23.194  -42.770 0.38 33.44 ? 169 GLN B CB  1 
ATOM   2350 C  CG  A GLN B 1 30  ? 10.161  23.489  -42.793 0.62 35.52 ? 169 GLN B CG  1 
ATOM   2351 C  CG  B GLN B 1 30  ? 7.993   21.857  -43.143 0.38 31.74 ? 169 GLN B CG  1 
ATOM   2352 C  CD  A GLN B 1 30  ? 10.524  24.627  -43.720 0.62 40.81 ? 169 GLN B CD  1 
ATOM   2353 C  CD  B GLN B 1 30  ? 8.919   20.890  -43.869 0.38 29.72 ? 169 GLN B CD  1 
ATOM   2354 O  OE1 A GLN B 1 30  ? 9.850   25.654  -43.751 0.62 44.78 ? 169 GLN B OE1 1 
ATOM   2355 O  OE1 B GLN B 1 30  ? 8.974   19.695  -43.545 0.38 18.64 ? 169 GLN B OE1 1 
ATOM   2356 N  NE2 A GLN B 1 30  ? 11.589  24.444  -44.492 0.62 41.41 ? 169 GLN B NE2 1 
ATOM   2357 N  NE2 B GLN B 1 30  ? 9.642   21.396  -44.861 0.38 29.12 ? 169 GLN B NE2 1 
ATOM   2358 N  N   . LEU B 1 31  ? 5.685   23.074  -41.311 1.00 20.65 ? 170 LEU B N   1 
ATOM   2359 C  CA  . LEU B 1 31  ? 4.261   22.922  -41.551 1.00 20.70 ? 170 LEU B CA  1 
ATOM   2360 C  C   . LEU B 1 31  ? 3.413   23.582  -40.478 1.00 16.27 ? 170 LEU B C   1 
ATOM   2361 O  O   . LEU B 1 31  ? 2.185   23.570  -40.551 1.00 23.84 ? 170 LEU B O   1 
ATOM   2362 C  CB  . LEU B 1 31  ? 3.888   21.439  -41.633 1.00 25.89 ? 170 LEU B CB  1 
ATOM   2363 C  CG  . LEU B 1 31  ? 4.329   20.643  -42.862 1.00 31.51 ? 170 LEU B CG  1 
ATOM   2364 C  CD1 . LEU B 1 31  ? 3.805   19.219  -42.775 1.00 27.05 ? 170 LEU B CD1 1 
ATOM   2365 C  CD2 . LEU B 1 31  ? 3.814   21.322  -44.116 1.00 33.71 ? 170 LEU B CD2 1 
ATOM   2366 N  N   . ALA B 1 32  ? 4.062   24.133  -39.465 1.00 13.79 ? 171 ALA B N   1 
ATOM   2367 C  CA  . ALA B 1 32  ? 3.328   24.769  -38.385 1.00 10.64 ? 171 ALA B CA  1 
ATOM   2368 C  C   . ALA B 1 32  ? 2.734   26.084  -38.882 1.00 14.92 ? 171 ALA B C   1 
ATOM   2369 O  O   . ALA B 1 32  ? 3.355   26.783  -39.674 1.00 16.09 ? 171 ALA B O   1 
ATOM   2370 C  CB  . ALA B 1 32  ? 4.235   25.014  -37.189 1.00 12.25 ? 171 ALA B CB  1 
ATOM   2371 N  N   . ALA B 1 33  ? 1.553   26.427  -38.383 1.00 13.03 ? 172 ALA B N   1 
ATOM   2372 C  CA  . ALA B 1 33  ? 0.899   27.672  -38.771 1.00 11.33 ? 172 ALA B CA  1 
ATOM   2373 C  C   . ALA B 1 33  ? 1.426   28.792  -37.893 1.00 12.93 ? 172 ALA B C   1 
ATOM   2374 O  O   . ALA B 1 33  ? 1.247   28.755  -36.680 1.00 15.70 ? 172 ALA B O   1 
ATOM   2375 C  CB  . ALA B 1 33  ? -0.596  27.552  -38.623 1.00 12.20 ? 172 ALA B CB  1 
ATOM   2376 N  N   . PHE B 1 34  ? 2.094   29.776  -38.494 1.00 12.39 ? 173 PHE B N   1 
ATOM   2377 C  CA  . PHE B 1 34  ? 2.569   30.927  -37.731 1.00 12.12 ? 173 PHE B CA  1 
ATOM   2378 C  C   . PHE B 1 34  ? 1.378   31.782  -37.328 1.00 11.48 ? 173 PHE B C   1 
ATOM   2379 O  O   . PHE B 1 34  ? 0.690   32.358  -38.176 1.00 14.12 ? 173 PHE B O   1 
ATOM   2380 C  CB  . PHE B 1 34  ? 3.588   31.736  -38.546 1.00 12.62 ? 173 PHE B CB  1 
ATOM   2381 C  CG  . PHE B 1 34  ? 3.966   33.052  -37.917 1.00 14.37 ? 173 PHE B CG  1 
ATOM   2382 C  CD1 . PHE B 1 34  ? 3.962   34.219  -38.665 1.00 14.72 ? 173 PHE B CD1 1 
ATOM   2383 C  CD2 . PHE B 1 34  ? 4.339   33.122  -36.586 1.00 16.78 ? 173 PHE B CD2 1 
ATOM   2384 C  CE1 . PHE B 1 34  ? 4.318   35.433  -38.089 1.00 16.44 ? 173 PHE B CE1 1 
ATOM   2385 C  CE2 . PHE B 1 34  ? 4.689   34.323  -36.010 1.00 17.92 ? 173 PHE B CE2 1 
ATOM   2386 C  CZ  . PHE B 1 34  ? 4.679   35.484  -36.757 1.00 17.06 ? 173 PHE B CZ  1 
ATOM   2387 N  N   . SER B 1 35  ? 1.170   31.878  -36.018 1.00 12.88 ? 174 SER B N   1 
ATOM   2388 C  CA  . SER B 1 35  ? 0.038   32.604  -35.463 1.00 14.65 ? 174 SER B CA  1 
ATOM   2389 C  C   . SER B 1 35  ? 0.518   33.741  -34.591 1.00 17.03 ? 174 SER B C   1 
ATOM   2390 O  O   . SER B 1 35  ? 0.851   33.535  -33.423 1.00 18.23 ? 174 SER B O   1 
ATOM   2391 C  CB  A SER B 1 35  ? -0.845  31.650  -34.644 0.73 15.17 ? 174 SER B CB  1 
ATOM   2392 C  CB  B SER B 1 35  ? -0.863  31.668  -34.656 0.27 16.53 ? 174 SER B CB  1 
ATOM   2393 O  OG  A SER B 1 35  ? -1.165  30.476  -35.377 0.73 17.58 ? 174 SER B OG  1 
ATOM   2394 O  OG  B SER B 1 35  ? -1.994  32.365  -34.165 0.27 18.11 ? 174 SER B OG  1 
ATOM   2395 N  N   . PRO B 1 36  ? 0.523   34.961  -35.137 1.00 18.43 ? 175 PRO B N   1 
ATOM   2396 C  CA  . PRO B 1 36  ? 1.018   36.118  -34.375 1.00 22.14 ? 175 PRO B CA  1 
ATOM   2397 C  C   . PRO B 1 36  ? 0.154   36.461  -33.160 1.00 25.27 ? 175 PRO B C   1 
ATOM   2398 O  O   . PRO B 1 36  ? 0.580   37.262  -32.326 1.00 25.99 ? 175 PRO B O   1 
ATOM   2399 C  CB  . PRO B 1 36  ? 1.014   37.252  -35.409 1.00 21.48 ? 175 PRO B CB  1 
ATOM   2400 C  CG  . PRO B 1 36  ? 0.106   36.807  -36.491 1.00 23.76 ? 175 PRO B CG  1 
ATOM   2401 C  CD  . PRO B 1 36  ? 0.195   35.304  -36.528 1.00 16.22 ? 175 PRO B CD  1 
ATOM   2402 N  N   . ALA B 1 37  ? -1.021  35.848  -33.045 1.00 22.70 ? 176 ALA B N   1 
ATOM   2403 C  CA  . ALA B 1 37  ? -1.857  36.025  -31.852 1.00 23.80 ? 176 ALA B CA  1 
ATOM   2404 C  C   . ALA B 1 37  ? -1.214  35.407  -30.617 1.00 22.87 ? 176 ALA B C   1 
ATOM   2405 O  O   . ALA B 1 37  ? -1.572  35.745  -29.486 1.00 27.05 ? 176 ALA B O   1 
ATOM   2406 C  CB  . ALA B 1 37  ? -3.238  35.419  -32.074 1.00 26.08 ? 176 ALA B CB  1 
ATOM   2407 N  N   . LEU B 1 38  ? -0.273  34.495  -30.830 1.00 19.41 ? 177 LEU B N   1 
ATOM   2408 C  CA  . LEU B 1 38  ? 0.378   33.790  -29.729 1.00 17.80 ? 177 LEU B CA  1 
ATOM   2409 C  C   . LEU B 1 38  ? 1.489   34.628  -29.114 1.00 24.13 ? 177 LEU B C   1 
ATOM   2410 O  O   . LEU B 1 38  ? 2.570   34.747  -29.684 1.00 25.41 ? 177 LEU B O   1 
ATOM   2411 C  CB  . LEU B 1 38  ? 0.941   32.456  -30.213 1.00 17.62 ? 177 LEU B CB  1 
ATOM   2412 C  CG  . LEU B 1 38  ? -0.104  31.441  -30.648 1.00 18.24 ? 177 LEU B CG  1 
ATOM   2413 C  CD1 . LEU B 1 38  ? 0.583   30.174  -31.125 1.00 17.31 ? 177 LEU B CD1 1 
ATOM   2414 C  CD2 . LEU B 1 38  ? -1.043  31.157  -29.478 1.00 18.70 ? 177 LEU B CD2 1 
ATOM   2415 N  N   . ARG B 1 39  ? 1.218   35.192  -27.940 1.00 20.97 ? 178 ARG B N   1 
ATOM   2416 C  CA  . ARG B 1 39  ? 2.153   36.108  -27.302 1.00 23.40 ? 178 ARG B CA  1 
ATOM   2417 C  C   . ARG B 1 39  ? 3.090   35.347  -26.350 1.00 22.59 ? 178 ARG B C   1 
ATOM   2418 O  O   . ARG B 1 39  ? 2.831   34.180  -26.026 1.00 22.24 ? 178 ARG B O   1 
ATOM   2419 C  CB  . ARG B 1 39  ? 1.374   37.207  -26.564 1.00 29.78 ? 178 ARG B CB  1 
ATOM   2420 C  CG  . ARG B 1 39  ? 0.173   37.751  -27.346 1.00 34.98 ? 178 ARG B CG  1 
ATOM   2421 C  CD  . ARG B 1 39  ? 0.541   38.625  -28.547 1.00 47.39 ? 178 ARG B CD  1 
ATOM   2422 N  NE  . ARG B 1 39  ? 1.804   39.343  -28.407 1.00 52.80 ? 178 ARG B NE  1 
ATOM   2423 C  CZ  . ARG B 1 39  ? 2.787   39.295  -29.303 1.00 54.58 ? 178 ARG B CZ  1 
ATOM   2424 N  NH1 . ARG B 1 39  ? 3.906   39.981  -29.106 1.00 58.09 ? 178 ARG B NH1 1 
ATOM   2425 N  NH2 . ARG B 1 39  ? 2.649   38.565  -30.401 1.00 50.32 ? 178 ARG B NH2 1 
ATOM   2426 N  N   . PRO B 1 40  ? 4.182   35.994  -25.896 1.00 21.00 ? 179 PRO B N   1 
ATOM   2427 C  CA  . PRO B 1 40  ? 5.082   35.290  -24.971 1.00 18.81 ? 179 PRO B CA  1 
ATOM   2428 C  C   . PRO B 1 40  ? 4.388   34.749  -23.727 1.00 22.06 ? 179 PRO B C   1 
ATOM   2429 O  O   . PRO B 1 40  ? 3.485   35.382  -23.175 1.00 21.81 ? 179 PRO B O   1 
ATOM   2430 C  CB  . PRO B 1 40  ? 6.098   36.369  -24.589 1.00 22.39 ? 179 PRO B CB  1 
ATOM   2431 C  CG  . PRO B 1 40  ? 6.143   37.262  -25.798 1.00 22.03 ? 179 PRO B CG  1 
ATOM   2432 C  CD  . PRO B 1 40  ? 4.723   37.312  -26.289 1.00 21.82 ? 179 PRO B CD  1 
ATOM   2433 N  N   . LEU B 1 41  ? 4.816   33.567  -23.298 1.00 22.53 ? 180 LEU B N   1 
ATOM   2434 C  CA  . LEU B 1 41  ? 4.273   32.957  -22.095 1.00 23.11 ? 180 LEU B CA  1 
ATOM   2435 C  C   . LEU B 1 41  ? 4.568   33.826  -20.886 1.00 21.66 ? 180 LEU B C   1 
ATOM   2436 O  O   . LEU B 1 41  ? 5.620   34.458  -20.812 1.00 21.84 ? 180 LEU B O   1 
ATOM   2437 C  CB  . LEU B 1 41  ? 4.864   31.565  -21.892 1.00 20.46 ? 180 LEU B CB  1 
ATOM   2438 C  CG  . LEU B 1 41  ? 4.774   30.628  -23.091 1.00 19.64 ? 180 LEU B CG  1 
ATOM   2439 C  CD1 . LEU B 1 41  ? 5.456   29.323  -22.719 1.00 22.86 ? 180 LEU B CD1 1 
ATOM   2440 C  CD2 . LEU B 1 41  ? 3.330   30.398  -23.497 1.00 23.84 ? 180 LEU B CD2 1 
ATOM   2441 N  N   . GLU B 1 42  ? 3.633   33.858  -19.945 1.00 22.09 ? 181 GLU B N   1 
ATOM   2442 C  CA  . GLU B 1 42  ? 3.819   34.611  -18.708 1.00 22.28 ? 181 GLU B CA  1 
ATOM   2443 C  C   . GLU B 1 42  ? 3.713   33.676  -17.515 1.00 25.62 ? 181 GLU B C   1 
ATOM   2444 O  O   . GLU B 1 42  ? 2.661   33.079  -17.272 1.00 24.30 ? 181 GLU B O   1 
ATOM   2445 C  CB  . GLU B 1 42  ? 2.793   35.738  -18.600 1.00 24.89 ? 181 GLU B CB  1 
ATOM   2446 C  CG  . GLU B 1 42  ? 2.913   36.762  -19.720 1.00 28.52 ? 181 GLU B CG  1 
ATOM   2447 C  CD  . GLU B 1 42  ? 1.828   37.817  -19.686 1.00 37.97 ? 181 GLU B CD  1 
ATOM   2448 O  OE1 . GLU B 1 42  ? 1.783   38.642  -20.621 1.00 42.72 ? 181 GLU B OE1 1 
ATOM   2449 O  OE2 . GLU B 1 42  ? 1.015   37.816  -18.739 1.00 39.70 ? 181 GLU B OE2 1 
ATOM   2450 N  N   . LEU B 1 43  ? 4.809   33.552  -16.777 1.00 24.45 ? 182 LEU B N   1 
ATOM   2451 C  CA  . LEU B 1 43  ? 4.843   32.696  -15.598 1.00 29.24 ? 182 LEU B CA  1 
ATOM   2452 C  C   . LEU B 1 43  ? 5.037   33.571  -14.367 1.00 30.19 ? 182 LEU B C   1 
ATOM   2453 O  O   . LEU B 1 43  ? 5.827   34.513  -14.388 1.00 33.25 ? 182 LEU B O   1 
ATOM   2454 C  CB  . LEU B 1 43  ? 5.965   31.654  -15.696 1.00 28.35 ? 182 LEU B CB  1 
ATOM   2455 C  CG  . LEU B 1 43  ? 5.741   30.342  -16.452 1.00 31.81 ? 182 LEU B CG  1 
ATOM   2456 C  CD1 . LEU B 1 43  ? 5.210   30.567  -17.854 1.00 38.60 ? 182 LEU B CD1 1 
ATOM   2457 C  CD2 . LEU B 1 43  ? 7.039   29.573  -16.508 1.00 31.61 ? 182 LEU B CD2 1 
ATOM   2458 N  N   . SER B 1 44  ? 4.318   33.259  -13.298 1.00 25.73 ? 183 SER B N   1 
ATOM   2459 C  CA  . SER B 1 44  ? 4.516   33.961  -12.038 1.00 33.07 ? 183 SER B CA  1 
ATOM   2460 C  C   . SER B 1 44  ? 4.470   32.997  -10.860 1.00 33.46 ? 183 SER B C   1 
ATOM   2461 O  O   . SER B 1 44  ? 3.716   32.020  -10.870 1.00 26.43 ? 183 SER B O   1 
ATOM   2462 C  CB  A SER B 1 44  ? 3.461   35.054  -11.868 0.53 37.09 ? 183 SER B CB  1 
ATOM   2463 C  CB  B SER B 1 44  ? 3.465   35.058  -11.861 0.47 37.21 ? 183 SER B CB  1 
ATOM   2464 O  OG  A SER B 1 44  ? 2.157   34.516  -11.998 0.53 39.99 ? 183 SER B OG  1 
ATOM   2465 O  OG  B SER B 1 44  ? 3.555   36.021  -12.896 0.47 38.65 ? 183 SER B OG  1 
ATOM   2466 N  N   . GLY B 1 45  ? 5.289   33.281  -9.851  1.00 30.07 ? 184 GLY B N   1 
ATOM   2467 C  CA  . GLY B 1 45  ? 5.327   32.481  -8.642  1.00 26.38 ? 184 GLY B CA  1 
ATOM   2468 C  C   . GLY B 1 45  ? 6.224   31.258  -8.716  1.00 28.57 ? 184 GLY B C   1 
ATOM   2469 O  O   . GLY B 1 45  ? 6.252   30.458  -7.781  1.00 28.14 ? 184 GLY B O   1 
ATOM   2470 N  N   . PHE B 1 46  ? 6.991   31.132  -9.795  1.00 25.90 ? 185 PHE B N   1 
ATOM   2471 C  CA  . PHE B 1 46  ? 7.804   29.936  -10.008 1.00 29.82 ? 185 PHE B CA  1 
ATOM   2472 C  C   . PHE B 1 46  ? 9.121   29.992  -9.228  1.00 30.47 ? 185 PHE B C   1 
ATOM   2473 O  O   . PHE B 1 46  ? 9.812   28.982  -9.095  1.00 24.88 ? 185 PHE B O   1 
ATOM   2474 C  CB  . PHE B 1 46  ? 8.093   29.734  -11.506 1.00 27.70 ? 185 PHE B CB  1 
ATOM   2475 C  CG  . PHE B 1 46  ? 6.986   29.036  -12.263 1.00 24.66 ? 185 PHE B CG  1 
ATOM   2476 C  CD1 . PHE B 1 46  ? 5.704   29.569  -12.305 1.00 26.48 ? 185 PHE B CD1 1 
ATOM   2477 C  CD2 . PHE B 1 46  ? 7.237   27.855  -12.946 1.00 25.64 ? 185 PHE B CD2 1 
ATOM   2478 C  CE1 . PHE B 1 46  ? 4.684   28.933  -13.009 1.00 26.51 ? 185 PHE B CE1 1 
ATOM   2479 C  CE2 . PHE B 1 46  ? 6.226   27.209  -13.656 1.00 22.56 ? 185 PHE B CE2 1 
ATOM   2480 C  CZ  . PHE B 1 46  ? 4.949   27.745  -13.685 1.00 21.97 ? 185 PHE B CZ  1 
ATOM   2481 N  N   . GLN B 1 47  ? 9.471   31.168  -8.712  1.00 25.00 ? 186 GLN B N   1 
ATOM   2482 C  CA  . GLN B 1 47  ? 10.691  31.300  -7.919  1.00 32.15 ? 186 GLN B CA  1 
ATOM   2483 C  C   . GLN B 1 47  ? 10.406  31.007  -6.448  1.00 31.67 ? 186 GLN B C   1 
ATOM   2484 O  O   . GLN B 1 47  ? 10.126  31.914  -5.663  1.00 30.15 ? 186 GLN B O   1 
ATOM   2485 C  CB  . GLN B 1 47  ? 11.297  32.700  -8.070  1.00 30.05 ? 186 GLN B CB  1 
ATOM   2486 C  CG  . GLN B 1 47  ? 11.968  32.959  -9.409  1.00 34.56 ? 186 GLN B CG  1 
ATOM   2487 C  CD  . GLN B 1 47  ? 10.973  33.155  -10.531 1.00 50.79 ? 186 GLN B CD  1 
ATOM   2488 O  OE1 . GLN B 1 47  ? 10.050  33.965  -10.423 1.00 54.01 ? 186 GLN B OE1 1 
ATOM   2489 N  NE2 . GLN B 1 47  ? 11.154  32.416  -11.619 1.00 56.42 ? 186 GLN B NE2 1 
ATOM   2490 N  N   . LEU B 1 48  ? 10.491  29.734  -6.079  1.00 28.06 ? 187 LEU B N   1 
ATOM   2491 C  CA  . LEU B 1 48  ? 10.152  29.299  -4.730  1.00 27.78 ? 187 LEU B CA  1 
ATOM   2492 C  C   . LEU B 1 48  ? 11.289  29.514  -3.735  1.00 27.63 ? 187 LEU B C   1 
ATOM   2493 O  O   . LEU B 1 48  ? 12.464  29.389  -4.083  1.00 29.38 ? 187 LEU B O   1 
ATOM   2494 C  CB  . LEU B 1 48  ? 9.750   27.823  -4.741  1.00 22.16 ? 187 LEU B CB  1 
ATOM   2495 C  CG  . LEU B 1 48  ? 8.599   27.469  -5.675  1.00 27.18 ? 187 LEU B CG  1 
ATOM   2496 C  CD1 . LEU B 1 48  ? 8.361   25.963  -5.706  1.00 28.62 ? 187 LEU B CD1 1 
ATOM   2497 C  CD2 . LEU B 1 48  ? 7.339   28.188  -5.213  1.00 27.07 ? 187 LEU B CD2 1 
ATOM   2498 N  N   . PRO B 1 49  ? 10.932  29.856  -2.489  1.00 30.03 ? 188 PRO B N   1 
ATOM   2499 C  CA  . PRO B 1 49  ? 11.886  29.955  -1.384  1.00 31.70 ? 188 PRO B CA  1 
ATOM   2500 C  C   . PRO B 1 49  ? 12.276  28.548  -0.930  1.00 42.56 ? 188 PRO B C   1 
ATOM   2501 O  O   . PRO B 1 49  ? 11.595  27.592  -1.315  1.00 37.03 ? 188 PRO B O   1 
ATOM   2502 C  CB  . PRO B 1 49  ? 11.091  30.698  -0.311  1.00 29.14 ? 188 PRO B CB  1 
ATOM   2503 C  CG  . PRO B 1 49  ? 9.691   30.292  -0.558  1.00 29.84 ? 188 PRO B CG  1 
ATOM   2504 C  CD  . PRO B 1 49  ? 9.554   30.138  -2.046  1.00 23.55 ? 188 PRO B CD  1 
ATOM   2505 N  N   . PRO B 1 50  ? 13.356  28.413  -0.142  1.00 45.34 ? 189 PRO B N   1 
ATOM   2506 C  CA  . PRO B 1 50  ? 13.804  27.093  0.323   1.00 44.42 ? 189 PRO B CA  1 
ATOM   2507 C  C   . PRO B 1 50  ? 12.749  26.325  1.126   1.00 36.73 ? 189 PRO B C   1 
ATOM   2508 O  O   . PRO B 1 50  ? 12.712  25.093  1.065   1.00 33.96 ? 189 PRO B O   1 
ATOM   2509 C  CB  . PRO B 1 50  ? 15.022  27.424  1.195   1.00 52.17 ? 189 PRO B CB  1 
ATOM   2510 C  CG  . PRO B 1 50  ? 14.923  28.886  1.483   1.00 51.40 ? 189 PRO B CG  1 
ATOM   2511 C  CD  . PRO B 1 50  ? 14.269  29.482  0.290   1.00 48.84 ? 189 PRO B CD  1 
ATOM   2512 N  N   . LEU B 1 51  ? 11.904  27.035  1.866   1.00 29.24 ? 190 LEU B N   1 
ATOM   2513 C  CA  . LEU B 1 51  ? 10.827  26.391  2.613   1.00 29.27 ? 190 LEU B CA  1 
ATOM   2514 C  C   . LEU B 1 51  ? 9.471   27.003  2.277   1.00 28.15 ? 190 LEU B C   1 
ATOM   2515 O  O   . LEU B 1 51  ? 9.380   28.197  2.024   1.00 32.86 ? 190 LEU B O   1 
ATOM   2516 C  CB  . LEU B 1 51  ? 11.093  26.478  4.123   1.00 34.96 ? 190 LEU B CB  1 
ATOM   2517 C  CG  . LEU B 1 51  ? 12.326  25.723  4.626   1.00 39.15 ? 190 LEU B CG  1 
ATOM   2518 C  CD1 . LEU B 1 51  ? 12.581  26.004  6.105   1.00 37.96 ? 190 LEU B CD1 1 
ATOM   2519 C  CD2 . LEU B 1 51  ? 12.154  24.231  4.386   1.00 37.74 ? 190 LEU B CD2 1 
ATOM   2520 N  N   . PRO B 1 52  ? 8.407   26.184  2.268   1.00 30.91 ? 191 PRO B N   1 
ATOM   2521 C  CA  . PRO B 1 52  ? 8.367   24.752  2.590   1.00 32.10 ? 191 PRO B CA  1 
ATOM   2522 C  C   . PRO B 1 52  ? 9.006   23.861  1.528   1.00 39.08 ? 191 PRO B C   1 
ATOM   2523 O  O   . PRO B 1 52  ? 9.269   24.303  0.408   1.00 27.88 ? 191 PRO B O   1 
ATOM   2524 C  CB  . PRO B 1 52  ? 6.867   24.462  2.691   1.00 29.32 ? 191 PRO B CB  1 
ATOM   2525 C  CG  . PRO B 1 52  ? 6.241   25.465  1.793   1.00 32.01 ? 191 PRO B CG  1 
ATOM   2526 C  CD  . PRO B 1 52  ? 7.073   26.702  1.917   1.00 29.68 ? 191 PRO B CD  1 
ATOM   2527 N  N   . GLU B 1 53  ? 9.248   22.609  1.892   1.00 32.68 ? 192 GLU B N   1 
ATOM   2528 C  CA  . GLU B 1 53  ? 9.859   21.659  0.977   1.00 33.46 ? 192 GLU B CA  1 
ATOM   2529 C  C   . GLU B 1 53  ? 8.821   21.087  0.024   1.00 27.22 ? 192 GLU B C   1 
ATOM   2530 O  O   . GLU B 1 53  ? 7.613   21.275  0.217   1.00 21.89 ? 192 GLU B O   1 
ATOM   2531 C  CB  . GLU B 1 53  ? 10.555  20.538  1.758   1.00 36.94 ? 192 GLU B CB  1 
ATOM   2532 C  CG  . GLU B 1 53  ? 11.832  20.987  2.460   1.00 34.62 ? 192 GLU B CG  1 
ATOM   2533 C  CD  . GLU B 1 53  ? 12.625  19.828  3.035   1.00 38.45 ? 192 GLU B CD  1 
ATOM   2534 O  OE1 . GLU B 1 53  ? 12.031  18.986  3.740   1.00 35.95 ? 192 GLU B OE1 1 
ATOM   2535 O  OE2 . GLU B 1 53  ? 13.841  19.747  2.765   1.00 46.24 ? 192 GLU B OE2 1 
ATOM   2536 N  N   . LEU B 1 54  ? 9.296   20.393  -1.009  1.00 25.15 ? 193 LEU B N   1 
ATOM   2537 C  CA  . LEU B 1 54  ? 8.419   19.815  -2.029  1.00 22.66 ? 193 LEU B CA  1 
ATOM   2538 C  C   . LEU B 1 54  ? 8.555   18.294  -2.065  1.00 17.35 ? 193 LEU B C   1 
ATOM   2539 O  O   . LEU B 1 54  ? 9.661   17.763  -1.935  1.00 22.71 ? 193 LEU B O   1 
ATOM   2540 C  CB  . LEU B 1 54  ? 8.739   20.387  -3.422  1.00 22.04 ? 193 LEU B CB  1 
ATOM   2541 C  CG  . LEU B 1 54  ? 8.350   21.831  -3.771  1.00 24.50 ? 193 LEU B CG  1 
ATOM   2542 C  CD1 . LEU B 1 54  ? 9.136   22.829  -2.943  1.00 26.33 ? 193 LEU B CD1 1 
ATOM   2543 C  CD2 . LEU B 1 54  ? 8.533   22.123  -5.258  1.00 21.62 ? 193 LEU B CD2 1 
ATOM   2544 N  N   . ARG B 1 55  ? 7.432   17.610  -2.269  1.00 18.26 ? 194 ARG B N   1 
ATOM   2545 C  CA  . ARG B 1 55  ? 7.419   16.155  -2.442  1.00 17.84 ? 194 ARG B CA  1 
ATOM   2546 C  C   . ARG B 1 55  ? 7.986   15.738  -3.796  1.00 20.03 ? 194 ARG B C   1 
ATOM   2547 O  O   . ARG B 1 55  ? 7.539   16.219  -4.841  1.00 21.03 ? 194 ARG B O   1 
ATOM   2548 C  CB  . ARG B 1 55  ? 6.000   15.628  -2.295  1.00 18.83 ? 194 ARG B CB  1 
ATOM   2549 C  CG  . ARG B 1 55  ? 5.870   14.122  -2.341  1.00 25.50 ? 194 ARG B CG  1 
ATOM   2550 C  CD  . ARG B 1 55  ? 4.417   13.724  -2.134  1.00 34.59 ? 194 ARG B CD  1 
ATOM   2551 N  NE  . ARG B 1 55  ? 4.259   12.282  -1.991  1.00 48.00 ? 194 ARG B NE  1 
ATOM   2552 C  CZ  . ARG B 1 55  ? 3.097   11.645  -2.081  1.00 59.68 ? 194 ARG B CZ  1 
ATOM   2553 N  NH1 . ARG B 1 55  ? 1.984   12.328  -2.310  1.00 61.11 ? 194 ARG B NH1 1 
ATOM   2554 N  NH2 . ARG B 1 55  ? 3.047   10.326  -1.937  1.00 62.12 ? 194 ARG B NH2 1 
ATOM   2555 N  N   . LEU B 1 56  ? 8.964   14.836  -3.764  1.00 18.90 ? 195 LEU B N   1 
ATOM   2556 C  CA  . LEU B 1 56  ? 9.543   14.257  -4.976  1.00 17.75 ? 195 LEU B CA  1 
ATOM   2557 C  C   . LEU B 1 56  ? 9.340   12.748  -4.896  1.00 17.50 ? 195 LEU B C   1 
ATOM   2558 O  O   . LEU B 1 56  ? 9.825   12.107  -3.966  1.00 18.96 ? 195 LEU B O   1 
ATOM   2559 C  CB  . LEU B 1 56  ? 11.024  14.603  -5.106  1.00 15.18 ? 195 LEU B CB  1 
ATOM   2560 C  CG  . LEU B 1 56  ? 11.709  14.190  -6.410  1.00 17.43 ? 195 LEU B CG  1 
ATOM   2561 C  CD1 . LEU B 1 56  ? 11.221  15.074  -7.559  1.00 15.91 ? 195 LEU B CD1 1 
ATOM   2562 C  CD2 . LEU B 1 56  ? 13.229  14.250  -6.296  1.00 18.83 ? 195 LEU B CD2 1 
ATOM   2563 N  N   . ARG B 1 57  ? 8.624   12.183  -5.863  1.00 15.24 ? 196 ARG B N   1 
ATOM   2564 C  CA  . ARG B 1 57  ? 8.165   10.796  -5.748  1.00 12.26 ? 196 ARG B CA  1 
ATOM   2565 C  C   . ARG B 1 57  ? 8.478   9.962   -6.987  1.00 13.14 ? 196 ARG B C   1 
ATOM   2566 O  O   . ARG B 1 57  ? 8.278   10.399  -8.122  1.00 15.56 ? 196 ARG B O   1 
ATOM   2567 C  CB  A ARG B 1 57  ? 6.661   10.766  -5.466  0.42 14.53 ? 196 ARG B CB  1 
ATOM   2568 C  CB  B ARG B 1 57  ? 6.658   10.769  -5.469  0.58 14.05 ? 196 ARG B CB  1 
ATOM   2569 C  CG  A ARG B 1 57  ? 6.087   9.374   -5.286  0.42 18.35 ? 196 ARG B CG  1 
ATOM   2570 C  CG  B ARG B 1 57  ? 6.049   9.383   -5.496  0.58 17.99 ? 196 ARG B CG  1 
ATOM   2571 C  CD  A ARG B 1 57  ? 4.694   9.428   -4.672  0.42 21.82 ? 196 ARG B CD  1 
ATOM   2572 C  CD  B ARG B 1 57  ? 4.588   9.382   -5.053  0.58 21.97 ? 196 ARG B CD  1 
ATOM   2573 N  NE  A ARG B 1 57  ? 4.095   8.098   -4.588  0.42 25.19 ? 196 ARG B NE  1 
ATOM   2574 N  NE  B ARG B 1 57  ? 4.020   8.043   -5.197  0.58 26.99 ? 196 ARG B NE  1 
ATOM   2575 C  CZ  A ARG B 1 57  ? 3.266   7.598   -5.499  0.42 24.30 ? 196 ARG B CZ  1 
ATOM   2576 C  CZ  B ARG B 1 57  ? 4.102   7.089   -4.274  0.58 24.37 ? 196 ARG B CZ  1 
ATOM   2577 N  NH1 A ARG B 1 57  ? 2.924   8.325   -6.552  0.42 26.87 ? 196 ARG B NH1 1 
ATOM   2578 N  NH1 B ARG B 1 57  ? 4.717   7.321   -3.119  0.58 28.34 ? 196 ARG B NH1 1 
ATOM   2579 N  NH2 A ARG B 1 57  ? 2.772   6.377   -5.351  0.42 26.82 ? 196 ARG B NH2 1 
ATOM   2580 N  NH2 B ARG B 1 57  ? 3.570   5.897   -4.509  0.58 20.44 ? 196 ARG B NH2 1 
ATOM   2581 N  N   . ASN B 1 58  ? 8.990   8.761   -6.756  1.00 11.30 ? 197 ASN B N   1 
ATOM   2582 C  CA  . ASN B 1 58  ? 9.113   7.765   -7.817  1.00 10.53 ? 197 ASN B CA  1 
ATOM   2583 C  C   . ASN B 1 58  ? 7.803   6.991   -7.904  1.00 13.15 ? 197 ASN B C   1 
ATOM   2584 O  O   . ASN B 1 58  ? 7.523   6.155   -7.043  1.00 11.16 ? 197 ASN B O   1 
ATOM   2585 C  CB  . ASN B 1 58  ? 10.291  6.825   -7.531  1.00 13.40 ? 197 ASN B CB  1 
ATOM   2586 C  CG  . ASN B 1 58  ? 10.400  5.692   -8.541  1.00 11.05 ? 197 ASN B CG  1 
ATOM   2587 O  OD1 . ASN B 1 58  ? 9.534   5.527   -9.404  1.00 12.35 ? 197 ASN B OD1 1 
ATOM   2588 N  ND2 . ASN B 1 58  ? 11.462  4.888   -8.422  1.00 10.68 ? 197 ASN B ND2 1 
ATOM   2589 N  N   . ASN B 1 59  ? 6.980   7.267   -8.915  1.00 11.43 ? 198 ASN B N   1 
ATOM   2590 C  CA  . ASN B 1 59  ? 5.679   6.596   -8.994  1.00 10.99 ? 198 ASN B CA  1 
ATOM   2591 C  C   . ASN B 1 59  ? 5.675   5.397   -9.946  1.00 10.83 ? 198 ASN B C   1 
ATOM   2592 O  O   . ASN B 1 59  ? 4.620   4.836   -10.238 1.00 11.30 ? 198 ASN B O   1 
ATOM   2593 C  CB  . ASN B 1 59  ? 4.575   7.597   -9.385  1.00 11.24 ? 198 ASN B CB  1 
ATOM   2594 C  CG  . ASN B 1 59  ? 4.820   8.248   -10.738 1.00 11.64 ? 198 ASN B CG  1 
ATOM   2595 O  OD1 . ASN B 1 59  ? 5.311   7.606   -11.656 1.00 10.83 ? 198 ASN B OD1 1 
ATOM   2596 N  ND2 . ASN B 1 59  ? 4.496   9.531   -10.852 1.00 14.00 ? 198 ASN B ND2 1 
ATOM   2597 N  N   . GLY B 1 60  ? 6.857   5.024   -10.430 1.00 10.21 ? 199 GLY B N   1 
ATOM   2598 C  CA  . GLY B 1 60  ? 6.989   3.877   -11.306 1.00 11.13 ? 199 GLY B CA  1 
ATOM   2599 C  C   . GLY B 1 60  ? 6.761   4.220   -12.762 1.00 10.35 ? 199 GLY B C   1 
ATOM   2600 O  O   . GLY B 1 60  ? 7.084   3.422   -13.622 1.00 10.77 ? 199 GLY B O   1 
ATOM   2601 N  N   . HIS B 1 61  ? 6.197   5.400   -13.027 1.00 9.15  ? 200 HIS B N   1 
ATOM   2602 C  CA  . HIS B 1 61  ? 5.997   5.879   -14.397 1.00 9.48  ? 200 HIS B CA  1 
ATOM   2603 C  C   . HIS B 1 61  ? 6.977   7.009   -14.717 1.00 10.97 ? 200 HIS B C   1 
ATOM   2604 O  O   . HIS B 1 61  ? 7.371   7.202   -15.872 1.00 8.40  ? 200 HIS B O   1 
ATOM   2605 C  CB  . HIS B 1 61  ? 4.562   6.377   -14.593 1.00 10.24 ? 200 HIS B CB  1 
ATOM   2606 C  CG  . HIS B 1 61  ? 3.504   5.409   -14.151 1.00 8.89  ? 200 HIS B CG  1 
ATOM   2607 N  ND1 . HIS B 1 61  ? 2.327   5.819   -13.558 1.00 14.17 ? 200 HIS B ND1 1 
ATOM   2608 C  CD2 . HIS B 1 61  ? 3.431   4.060   -14.245 1.00 11.24 ? 200 HIS B CD2 1 
ATOM   2609 C  CE1 . HIS B 1 61  ? 1.582   4.758   -13.289 1.00 11.64 ? 200 HIS B CE1 1 
ATOM   2610 N  NE2 . HIS B 1 61  ? 2.224   3.681   -13.707 1.00 10.35 ? 200 HIS B NE2 1 
ATOM   2611 N  N   . SER B 1 62  ? 7.357   7.751   -13.678 1.00 10.27 ? 201 SER B N   1 
ATOM   2612 C  CA  . SER B 1 62  ? 8.281   8.878   -13.793 1.00 8.86  ? 201 SER B CA  1 
ATOM   2613 C  C   . SER B 1 62  ? 8.714   9.294   -12.391 1.00 11.20 ? 201 SER B C   1 
ATOM   2614 O  O   . SER B 1 62  ? 8.317   8.665   -11.394 1.00 11.25 ? 201 SER B O   1 
ATOM   2615 C  CB  . SER B 1 62  ? 7.620   10.061  -14.513 1.00 10.88 ? 201 SER B CB  1 
ATOM   2616 O  OG  . SER B 1 62  ? 8.545   11.128  -14.696 1.00 11.08 ? 201 SER B OG  1 
ATOM   2617 N  N   . VAL B 1 63  ? 9.525   10.341  -12.306 1.00 9.37  ? 202 VAL B N   1 
ATOM   2618 C  CA  . VAL B 1 63  ? 9.738   11.008  -11.029 1.00 11.30 ? 202 VAL B CA  1 
ATOM   2619 C  C   . VAL B 1 63  ? 8.926   12.291  -11.089 1.00 12.08 ? 202 VAL B C   1 
ATOM   2620 O  O   . VAL B 1 63  ? 9.017   13.056  -12.054 1.00 11.40 ? 202 VAL B O   1 
ATOM   2621 C  CB  . VAL B 1 63  ? 11.229  11.275  -10.730 1.00 12.50 ? 202 VAL B CB  1 
ATOM   2622 C  CG1 . VAL B 1 63  ? 11.929  11.951  -11.917 1.00 14.74 ? 202 VAL B CG1 1 
ATOM   2623 C  CG2 . VAL B 1 63  ? 11.374  12.108  -9.470  1.00 13.22 ? 202 VAL B CG2 1 
ATOM   2624 N  N   . GLN B 1 64  ? 8.082   12.494  -10.082 1.00 12.51 ? 203 GLN B N   1 
ATOM   2625 C  CA  . GLN B 1 64  ? 7.140   13.601  -10.101 1.00 11.76 ? 203 GLN B CA  1 
ATOM   2626 C  C   . GLN B 1 64  ? 7.354   14.525  -8.903  1.00 15.53 ? 203 GLN B C   1 
ATOM   2627 O  O   . GLN B 1 64  ? 7.452   14.070  -7.762  1.00 14.49 ? 203 GLN B O   1 
ATOM   2628 C  CB  . GLN B 1 64  ? 5.699   13.081  -10.124 1.00 13.05 ? 203 GLN B CB  1 
ATOM   2629 C  CG  . GLN B 1 64  ? 4.631   14.176  -10.188 1.00 15.30 ? 203 GLN B CG  1 
ATOM   2630 C  CD  . GLN B 1 64  ? 3.283   13.649  -10.645 1.00 15.73 ? 203 GLN B CD  1 
ATOM   2631 O  OE1 . GLN B 1 64  ? 3.205   12.842  -11.571 1.00 15.30 ? 203 GLN B OE1 1 
ATOM   2632 N  NE2 . GLN B 1 64  ? 2.216   14.102  -10.002 1.00 16.64 ? 203 GLN B NE2 1 
ATOM   2633 N  N   . LEU B 1 65  ? 7.440   15.820  -9.198  1.00 14.73 ? 204 LEU B N   1 
ATOM   2634 C  CA  . LEU B 1 65  ? 7.602   16.877  -8.202  1.00 14.13 ? 204 LEU B CA  1 
ATOM   2635 C  C   . LEU B 1 65  ? 6.261   17.572  -7.988  1.00 16.04 ? 204 LEU B C   1 
ATOM   2636 O  O   . LEU B 1 65  ? 5.668   18.098  -8.928  1.00 17.31 ? 204 LEU B O   1 
ATOM   2637 C  CB  . LEU B 1 65  ? 8.667   17.881  -8.662  1.00 13.79 ? 204 LEU B CB  1 
ATOM   2638 C  CG  . LEU B 1 65  ? 8.988   19.059  -7.745  1.00 16.08 ? 204 LEU B CG  1 
ATOM   2639 C  CD1 . LEU B 1 65  ? 9.700   18.556  -6.488  1.00 19.07 ? 204 LEU B CD1 1 
ATOM   2640 C  CD2 . LEU B 1 65  ? 9.862   20.063  -8.479  1.00 16.51 ? 204 LEU B CD2 1 
ATOM   2641 N  N   . THR B 1 66  ? 5.772   17.565  -6.750  1.00 14.98 ? 205 THR B N   1 
ATOM   2642 C  CA  . THR B 1 66  ? 4.511   18.225  -6.436  1.00 14.46 ? 205 THR B CA  1 
ATOM   2643 C  C   . THR B 1 66  ? 4.765   19.710  -6.247  1.00 16.29 ? 205 THR B C   1 
ATOM   2644 O  O   . THR B 1 66  ? 5.633   20.102  -5.468  1.00 19.45 ? 205 THR B O   1 
ATOM   2645 C  CB  . THR B 1 66  ? 3.856   17.644  -5.153  1.00 16.63 ? 205 THR B CB  1 
ATOM   2646 O  OG1 . THR B 1 66  ? 3.608   16.247  -5.338  1.00 17.62 ? 205 THR B OG1 1 
ATOM   2647 C  CG2 . THR B 1 66  ? 2.546   18.346  -4.862  1.00 18.80 ? 205 THR B CG2 1 
ATOM   2648 N  N   . LEU B 1 67  ? 4.014   20.534  -6.968  1.00 16.10 ? 206 LEU B N   1 
ATOM   2649 C  CA  . LEU B 1 67  ? 4.202   21.974  -6.895  1.00 19.01 ? 206 LEU B CA  1 
ATOM   2650 C  C   . LEU B 1 67  ? 3.162   22.597  -5.973  1.00 21.15 ? 206 LEU B C   1 
ATOM   2651 O  O   . LEU B 1 67  ? 2.020   22.141  -5.927  1.00 21.14 ? 206 LEU B O   1 
ATOM   2652 C  CB  . LEU B 1 67  ? 4.126   22.590  -8.295  1.00 20.63 ? 206 LEU B CB  1 
ATOM   2653 C  CG  . LEU B 1 67  ? 5.199   22.097  -9.257  1.00 16.52 ? 206 LEU B CG  1 
ATOM   2654 C  CD1 . LEU B 1 67  ? 4.852   22.561  -10.666 1.00 13.96 ? 206 LEU B CD1 1 
ATOM   2655 C  CD2 . LEU B 1 67  ? 6.588   22.593  -8.852  1.00 16.73 ? 206 LEU B CD2 1 
ATOM   2656 N  N   . PRO B 1 68  ? 3.561   23.649  -5.235  1.00 21.90 ? 207 PRO B N   1 
ATOM   2657 C  CA  . PRO B 1 68  ? 2.657   24.307  -4.288  1.00 30.58 ? 207 PRO B CA  1 
ATOM   2658 C  C   . PRO B 1 68  ? 1.638   25.186  -4.997  1.00 32.16 ? 207 PRO B C   1 
ATOM   2659 O  O   . PRO B 1 68  ? 1.810   25.469  -6.182  1.00 24.77 ? 207 PRO B O   1 
ATOM   2660 C  CB  . PRO B 1 68  ? 3.609   25.157  -3.448  1.00 27.07 ? 207 PRO B CB  1 
ATOM   2661 C  CG  . PRO B 1 68  ? 4.699   25.522  -4.396  1.00 26.01 ? 207 PRO B CG  1 
ATOM   2662 C  CD  . PRO B 1 68  ? 4.887   24.294  -5.267  1.00 18.53 ? 207 PRO B CD  1 
ATOM   2663 N  N   . PRO B 1 69  ? 0.599   25.636  -4.278  1.00 31.25 ? 208 PRO B N   1 
ATOM   2664 C  CA  . PRO B 1 69  ? -0.315  26.624  -4.862  1.00 29.50 ? 208 PRO B CA  1 
ATOM   2665 C  C   . PRO B 1 69  ? 0.426   27.913  -5.221  1.00 25.43 ? 208 PRO B C   1 
ATOM   2666 O  O   . PRO B 1 69  ? 1.501   28.173  -4.676  1.00 30.90 ? 208 PRO B O   1 
ATOM   2667 C  CB  . PRO B 1 69  ? -1.337  26.862  -3.745  1.00 33.21 ? 208 PRO B CB  1 
ATOM   2668 C  CG  . PRO B 1 69  ? -1.305  25.604  -2.933  1.00 36.35 ? 208 PRO B CG  1 
ATOM   2669 C  CD  . PRO B 1 69  ? 0.121   25.135  -2.976  1.00 33.56 ? 208 PRO B CD  1 
ATOM   2670 N  N   . GLY B 1 70  ? -0.144  28.710  -6.118  1.00 30.85 ? 209 GLY B N   1 
ATOM   2671 C  CA  . GLY B 1 70  ? 0.391   30.027  -6.425  1.00 30.05 ? 209 GLY B CA  1 
ATOM   2672 C  C   . GLY B 1 70  ? 1.309   30.146  -7.634  1.00 32.34 ? 209 GLY B C   1 
ATOM   2673 O  O   . GLY B 1 70  ? 1.870   31.208  -7.883  1.00 26.49 ? 209 GLY B O   1 
ATOM   2674 N  N   . LEU B 1 71  ? 1.473   29.059  -8.382  1.00 27.84 ? 210 LEU B N   1 
ATOM   2675 C  CA  . LEU B 1 71  ? 2.239   29.091  -9.629  1.00 24.32 ? 210 LEU B CA  1 
ATOM   2676 C  C   . LEU B 1 71  ? 1.310   29.302  -10.813 1.00 25.66 ? 210 LEU B C   1 
ATOM   2677 O  O   . LEU B 1 71  ? 0.524   28.429  -11.137 1.00 24.59 ? 210 LEU B O   1 
ATOM   2678 C  CB  . LEU B 1 71  ? 3.058   27.812  -9.796  1.00 22.55 ? 210 LEU B CB  1 
ATOM   2679 C  CG  . LEU B 1 71  ? 4.376   27.767  -9.022  1.00 26.92 ? 210 LEU B CG  1 
ATOM   2680 C  CD1 . LEU B 1 71  ? 4.146   27.527  -7.532  1.00 31.37 ? 210 LEU B CD1 1 
ATOM   2681 C  CD2 . LEU B 1 71  ? 5.293   26.690  -9.601  1.00 24.64 ? 210 LEU B CD2 1 
ATOM   2682 N  N   . GLU B 1 72  ? 1.359   30.488  -11.413 1.00 26.37 ? 211 GLU B N   1 
ATOM   2683 C  CA  . GLU B 1 72  ? 0.437   30.834  -12.488 1.00 34.50 ? 211 GLU B CA  1 
ATOM   2684 C  C   . GLU B 1 72  ? 1.105   30.813  -13.866 1.00 29.37 ? 211 GLU B C   1 
ATOM   2685 O  O   . GLU B 1 72  ? 2.232   31.285  -14.033 1.00 25.27 ? 211 GLU B O   1 
ATOM   2686 C  CB  . GLU B 1 72  ? -0.180  32.213  -12.231 1.00 45.67 ? 211 GLU B CB  1 
ATOM   2687 C  CG  . GLU B 1 72  ? -1.119  32.273  -11.029 1.00 59.19 ? 211 GLU B CG  1 
ATOM   2688 C  CD  . GLU B 1 72  ? -2.570  31.986  -11.393 1.00 69.06 ? 211 GLU B CD  1 
ATOM   2689 O  OE1 . GLU B 1 72  ? -2.951  32.199  -12.563 1.00 71.90 ? 211 GLU B OE1 1 
ATOM   2690 O  OE2 . GLU B 1 72  ? -3.330  31.543  -10.506 1.00 73.01 ? 211 GLU B OE2 1 
ATOM   2691 N  N   . MET B 1 73  ? 0.401   30.274  -14.857 1.00 29.14 ? 212 MET B N   1 
ATOM   2692 C  CA  . MET B 1 73  ? 0.902   30.255  -16.225 1.00 26.20 ? 212 MET B CA  1 
ATOM   2693 C  C   . MET B 1 73  ? -0.181  30.842  -17.113 1.00 21.35 ? 212 MET B C   1 
ATOM   2694 O  O   . MET B 1 73  ? -1.315  30.367  -17.105 1.00 20.34 ? 212 MET B O   1 
ATOM   2695 C  CB  A MET B 1 73  ? 1.272   28.821  -16.589 0.48 24.86 ? 212 MET B CB  1 
ATOM   2696 C  CB  B MET B 1 73  ? 1.268   28.842  -16.759 0.52 23.63 ? 212 MET B CB  1 
ATOM   2697 C  CG  A MET B 1 73  ? 2.188   28.695  -17.746 0.48 23.17 ? 212 MET B CG  1 
ATOM   2698 C  CG  B MET B 1 73  ? 1.526   28.807  -18.329 0.52 18.21 ? 212 MET B CG  1 
ATOM   2699 S  SD  A MET B 1 73  ? 1.129   28.723  -19.164 0.48 17.74 ? 212 MET B SD  1 
ATOM   2700 S  SD  B MET B 1 73  ? 2.045   27.283  -19.234 0.52 17.62 ? 212 MET B SD  1 
ATOM   2701 C  CE  A MET B 1 73  ? 0.346   27.115  -19.047 0.48 19.57 ? 212 MET B CE  1 
ATOM   2702 C  CE  B MET B 1 73  ? 0.544   26.310  -19.163 0.52 15.49 ? 212 MET B CE  1 
ATOM   2703 N  N   . LYS B 1 74  ? 0.167   31.874  -17.881 1.00 22.50 ? 213 LYS B N   1 
ATOM   2704 C  CA  . LYS B 1 74  ? -0.802  32.502  -18.776 1.00 19.05 ? 213 LYS B CA  1 
ATOM   2705 C  C   . LYS B 1 74  ? -0.424  32.289  -20.234 1.00 18.63 ? 213 LYS B C   1 
ATOM   2706 O  O   . LYS B 1 74  ? 0.649   32.700  -20.664 1.00 20.18 ? 213 LYS B O   1 
ATOM   2707 C  CB  . LYS B 1 74  ? -0.914  34.000  -18.489 1.00 22.00 ? 213 LYS B CB  1 
ATOM   2708 C  CG  . LYS B 1 74  ? -1.944  34.707  -19.338 1.00 28.97 ? 213 LYS B CG  1 
ATOM   2709 C  CD  . LYS B 1 74  ? -2.058  36.174  -18.936 1.00 35.64 ? 213 LYS B CD  1 
ATOM   2710 C  CE  . LYS B 1 74  ? -3.184  36.872  -19.677 1.00 38.66 ? 213 LYS B CE  1 
ATOM   2711 N  NZ  . LYS B 1 74  ? -3.246  38.313  -19.305 1.00 40.03 ? 213 LYS B NZ  1 
ATOM   2712 N  N   . LEU B 1 75  ? -1.323  31.647  -20.980 1.00 18.68 ? 214 LEU B N   1 
ATOM   2713 C  CA  . LEU B 1 75  ? -1.123  31.383  -22.404 1.00 16.57 ? 214 LEU B CA  1 
ATOM   2714 C  C   . LEU B 1 75  ? -1.639  32.537  -23.251 1.00 20.96 ? 214 LEU B C   1 
ATOM   2715 O  O   . LEU B 1 75  ? -1.278  32.682  -24.417 1.00 20.88 ? 214 LEU B O   1 
ATOM   2716 C  CB  . LEU B 1 75  ? -1.824  30.092  -22.817 1.00 14.70 ? 214 LEU B CB  1 
ATOM   2717 C  CG  . LEU B 1 75  ? -1.261  28.809  -22.200 1.00 15.25 ? 214 LEU B CG  1 
ATOM   2718 C  CD1 . LEU B 1 75  ? -1.994  27.591  -22.743 1.00 17.90 ? 214 LEU B CD1 1 
ATOM   2719 C  CD2 . LEU B 1 75  ? 0.235   28.695  -22.435 1.00 16.39 ? 214 LEU B CD2 1 
ATOM   2720 N  N   . GLY B 1 76  ? -2.495  33.354  -22.656 1.00 23.54 ? 215 GLY B N   1 
ATOM   2721 C  CA  . GLY B 1 76  ? -3.066  34.489  -23.352 1.00 26.69 ? 215 GLY B CA  1 
ATOM   2722 C  C   . GLY B 1 76  ? -4.361  34.899  -22.689 1.00 29.94 ? 215 GLY B C   1 
ATOM   2723 O  O   . GLY B 1 76  ? -4.743  34.340  -21.656 1.00 25.44 ? 215 GLY B O   1 
ATOM   2724 N  N   . PRO B 1 77  ? -5.033  35.898  -23.263 1.00 31.32 ? 216 PRO B N   1 
ATOM   2725 C  CA  . PRO B 1 77  ? -6.316  36.370  -22.735 1.00 32.52 ? 216 PRO B CA  1 
ATOM   2726 C  C   . PRO B 1 77  ? -7.319  35.231  -22.558 1.00 27.26 ? 216 PRO B C   1 
ATOM   2727 O  O   . PRO B 1 77  ? -7.562  34.465  -23.492 1.00 27.73 ? 216 PRO B O   1 
ATOM   2728 C  CB  . PRO B 1 77  ? -6.782  37.367  -23.799 1.00 37.41 ? 216 PRO B CB  1 
ATOM   2729 C  CG  . PRO B 1 77  ? -5.503  37.866  -24.413 1.00 38.52 ? 216 PRO B CG  1 
ATOM   2730 C  CD  . PRO B 1 77  ? -4.589  36.673  -24.434 1.00 30.90 ? 216 PRO B CD  1 
ATOM   2731 N  N   . GLY B 1 78  ? -7.878  35.109  -21.358 1.00 32.35 ? 217 GLY B N   1 
ATOM   2732 C  CA  . GLY B 1 78  ? -8.873  34.087  -21.091 1.00 29.34 ? 217 GLY B CA  1 
ATOM   2733 C  C   . GLY B 1 78  ? -8.283  32.696  -20.952 1.00 29.61 ? 217 GLY B C   1 
ATOM   2734 O  O   . GLY B 1 78  ? -9.019  31.715  -20.845 1.00 31.39 ? 217 GLY B O   1 
ATOM   2735 N  N   . ARG B 1 79  ? -6.956  32.600  -20.959 1.00 24.16 ? 218 ARG B N   1 
ATOM   2736 C  CA  . ARG B 1 79  ? -6.302  31.294  -20.908 1.00 24.19 ? 218 ARG B CA  1 
ATOM   2737 C  C   . ARG B 1 79  ? -5.245  31.270  -19.811 1.00 26.21 ? 218 ARG B C   1 
ATOM   2738 O  O   . ARG B 1 79  ? -4.054  31.459  -20.060 1.00 23.87 ? 218 ARG B O   1 
ATOM   2739 C  CB  . ARG B 1 79  ? -5.690  30.936  -22.275 1.00 22.08 ? 218 ARG B CB  1 
ATOM   2740 C  CG  . ARG B 1 79  ? -6.730  30.777  -23.387 1.00 20.16 ? 218 ARG B CG  1 
ATOM   2741 C  CD  . ARG B 1 79  ? -6.163  29.987  -24.571 1.00 23.19 ? 218 ARG B CD  1 
ATOM   2742 N  NE  . ARG B 1 79  ? -5.049  30.686  -25.186 1.00 24.50 ? 218 ARG B NE  1 
ATOM   2743 C  CZ  . ARG B 1 79  ? -4.103  30.091  -25.905 1.00 21.10 ? 218 ARG B CZ  1 
ATOM   2744 N  NH1 . ARG B 1 79  ? -4.125  28.779  -26.080 1.00 20.84 ? 218 ARG B NH1 1 
ATOM   2745 N  NH2 . ARG B 1 79  ? -3.125  30.812  -26.423 1.00 20.84 ? 218 ARG B NH2 1 
ATOM   2746 N  N   . GLU B 1 80  ? -5.705  31.057  -18.580 1.00 21.90 ? 219 GLU B N   1 
ATOM   2747 C  CA  . GLU B 1 80  ? -4.835  31.097  -17.416 1.00 22.34 ? 219 GLU B CA  1 
ATOM   2748 C  C   . GLU B 1 80  ? -4.922  29.805  -16.613 1.00 19.90 ? 219 GLU B C   1 
ATOM   2749 O  O   . GLU B 1 80  ? -5.984  29.189  -16.526 1.00 21.63 ? 219 GLU B O   1 
ATOM   2750 C  CB  A GLU B 1 80  ? -5.189  32.302  -16.543 0.68 32.93 ? 219 GLU B CB  1 
ATOM   2751 C  CB  B GLU B 1 80  ? -5.179  32.304  -16.541 0.32 33.84 ? 219 GLU B CB  1 
ATOM   2752 C  CG  A GLU B 1 80  ? -5.064  33.618  -17.294 0.68 38.64 ? 219 GLU B CG  1 
ATOM   2753 C  CG  B GLU B 1 80  ? -4.913  33.633  -17.233 0.32 38.93 ? 219 GLU B CG  1 
ATOM   2754 C  CD  A GLU B 1 80  ? -5.433  34.821  -16.458 0.68 42.54 ? 219 GLU B CD  1 
ATOM   2755 C  CD  B GLU B 1 80  ? -5.219  34.831  -16.359 0.32 42.51 ? 219 GLU B CD  1 
ATOM   2756 O  OE1 A GLU B 1 80  ? -4.536  35.376  -15.789 0.68 42.97 ? 219 GLU B OE1 1 
ATOM   2757 O  OE1 B GLU B 1 80  ? -6.375  35.303  -16.383 0.32 43.69 ? 219 GLU B OE1 1 
ATOM   2758 O  OE2 A GLU B 1 80  ? -6.618  35.215  -16.483 0.68 43.34 ? 219 GLU B OE2 1 
ATOM   2759 O  OE2 B GLU B 1 80  ? -4.302  35.301  -15.653 0.32 43.06 ? 219 GLU B OE2 1 
ATOM   2760 N  N   . TYR B 1 81  ? -3.790  29.405  -16.040 1.00 20.01 ? 220 TYR B N   1 
ATOM   2761 C  CA  . TYR B 1 81  ? -3.631  28.078  -15.455 1.00 20.48 ? 220 TYR B CA  1 
ATOM   2762 C  C   . TYR B 1 81  ? -2.813  28.140  -14.173 1.00 24.84 ? 220 TYR B C   1 
ATOM   2763 O  O   . TYR B 1 81  ? -2.049  29.082  -13.970 1.00 29.05 ? 220 TYR B O   1 
ATOM   2764 C  CB  . TYR B 1 81  ? -2.950  27.146  -16.464 1.00 20.22 ? 220 TYR B CB  1 
ATOM   2765 C  CG  . TYR B 1 81  ? -3.761  26.928  -17.721 1.00 19.22 ? 220 TYR B CG  1 
ATOM   2766 C  CD1 . TYR B 1 81  ? -3.665  27.800  -18.802 1.00 18.70 ? 220 TYR B CD1 1 
ATOM   2767 C  CD2 . TYR B 1 81  ? -4.625  25.851  -17.822 1.00 18.43 ? 220 TYR B CD2 1 
ATOM   2768 C  CE1 . TYR B 1 81  ? -4.425  27.603  -19.944 1.00 16.56 ? 220 TYR B CE1 1 
ATOM   2769 C  CE2 . TYR B 1 81  ? -5.375  25.642  -18.949 1.00 18.77 ? 220 TYR B CE2 1 
ATOM   2770 C  CZ  . TYR B 1 81  ? -5.278  26.518  -20.006 1.00 20.05 ? 220 TYR B CZ  1 
ATOM   2771 O  OH  . TYR B 1 81  ? -6.040  26.293  -21.123 1.00 33.50 ? 220 TYR B OH  1 
ATOM   2772 N  N   . ARG B 1 82  ? -2.944  27.116  -13.332 1.00 22.47 ? 221 ARG B N   1 
ATOM   2773 C  CA  . ARG B 1 82  ? -2.116  26.998  -12.139 1.00 26.00 ? 221 ARG B CA  1 
ATOM   2774 C  C   . ARG B 1 82  ? -1.374  25.672  -12.185 1.00 17.67 ? 221 ARG B C   1 
ATOM   2775 O  O   . ARG B 1 82  ? -1.966  24.642  -12.510 1.00 17.94 ? 221 ARG B O   1 
ATOM   2776 C  CB  . ARG B 1 82  ? -2.956  27.072  -10.861 1.00 33.37 ? 221 ARG B CB  1 
ATOM   2777 C  CG  . ARG B 1 82  ? -4.090  28.087  -10.878 1.00 48.97 ? 221 ARG B CG  1 
ATOM   2778 C  CD  . ARG B 1 82  ? -4.931  27.952  -9.608  1.00 63.41 ? 221 ARG B CD  1 
ATOM   2779 N  NE  . ARG B 1 82  ? -6.370  27.894  -9.866  1.00 73.88 ? 221 ARG B NE  1 
ATOM   2780 C  CZ  . ARG B 1 82  ? -7.008  26.827  -10.344 1.00 75.40 ? 221 ARG B CZ  1 
ATOM   2781 N  NH1 . ARG B 1 82  ? -6.333  25.724  -10.637 1.00 75.93 ? 221 ARG B NH1 1 
ATOM   2782 N  NH2 . ARG B 1 82  ? -8.321  26.863  -10.538 1.00 70.95 ? 221 ARG B NH2 1 
ATOM   2783 N  N   . ALA B 1 83  ? -0.091  25.699  -11.844 1.00 17.78 ? 222 ALA B N   1 
ATOM   2784 C  CA  . ALA B 1 83  ? 0.739   24.505  -11.944 1.00 16.78 ? 222 ALA B CA  1 
ATOM   2785 C  C   . ALA B 1 83  ? 0.416   23.506  -10.841 1.00 18.13 ? 222 ALA B C   1 
ATOM   2786 O  O   . ALA B 1 83  ? 0.191   23.888  -9.694  1.00 20.87 ? 222 ALA B O   1 
ATOM   2787 C  CB  . ALA B 1 83  ? 2.208   24.885  -11.911 1.00 18.60 ? 222 ALA B CB  1 
ATOM   2788 N  N   . LEU B 1 84  ? 0.387   22.224  -11.206 1.00 16.11 ? 223 LEU B N   1 
ATOM   2789 C  CA  . LEU B 1 84  ? 0.088   21.136  -10.274 1.00 16.34 ? 223 LEU B CA  1 
ATOM   2790 C  C   . LEU B 1 84  ? 1.324   20.329  -9.914  1.00 20.92 ? 223 LEU B C   1 
ATOM   2791 O  O   . LEU B 1 84  ? 1.536   19.969  -8.754  1.00 17.81 ? 223 LEU B O   1 
ATOM   2792 C  CB  . LEU B 1 84  ? -0.952  20.189  -10.871 1.00 17.05 ? 223 LEU B CB  1 
ATOM   2793 C  CG  . LEU B 1 84  ? -2.296  20.758  -11.308 1.00 18.22 ? 223 LEU B CG  1 
ATOM   2794 C  CD1 . LEU B 1 84  ? -3.101  19.700  -12.067 1.00 25.94 ? 223 LEU B CD1 1 
ATOM   2795 C  CD2 . LEU B 1 84  ? -3.048  21.265  -10.091 1.00 25.29 ? 223 LEU B CD2 1 
ATOM   2796 N  N   . GLN B 1 85  ? 2.113   19.996  -10.933 1.00 15.46 ? 224 GLN B N   1 
ATOM   2797 C  CA  . GLN B 1 85  ? 3.221   19.072  -10.771 1.00 16.33 ? 224 GLN B CA  1 
ATOM   2798 C  C   . GLN B 1 85  ? 4.089   19.113  -12.005 1.00 15.17 ? 224 GLN B C   1 
ATOM   2799 O  O   . GLN B 1 85  ? 3.652   19.582  -13.051 1.00 16.89 ? 224 GLN B O   1 
ATOM   2800 C  CB  . GLN B 1 85  ? 2.711   17.644  -10.540 1.00 14.21 ? 224 GLN B CB  1 
ATOM   2801 C  CG  . GLN B 1 85  ? 1.661   17.183  -11.568 1.00 13.68 ? 224 GLN B CG  1 
ATOM   2802 C  CD  . GLN B 1 85  ? 2.201   16.225  -12.644 1.00 12.66 ? 224 GLN B CD  1 
ATOM   2803 O  OE1 . GLN B 1 85  ? 3.401   16.155  -12.901 1.00 13.32 ? 224 GLN B OE1 1 
ATOM   2804 N  NE2 . GLN B 1 85  ? 1.295   15.493  -13.271 1.00 14.04 ? 224 GLN B NE2 1 
ATOM   2805 N  N   . LEU B 1 86  ? 5.314   18.627  -11.878 1.00 13.32 ? 225 LEU B N   1 
ATOM   2806 C  CA  . LEU B 1 86  ? 6.139   18.394  -13.053 1.00 10.71 ? 225 LEU B CA  1 
ATOM   2807 C  C   . LEU B 1 86  ? 6.751   17.005  -12.989 1.00 14.07 ? 225 LEU B C   1 
ATOM   2808 O  O   . LEU B 1 86  ? 6.913   16.423  -11.911 1.00 13.59 ? 225 LEU B O   1 
ATOM   2809 C  CB  . LEU B 1 86  ? 7.226   19.467  -13.190 1.00 11.91 ? 225 LEU B CB  1 
ATOM   2810 C  CG  . LEU B 1 86  ? 8.289   19.649  -12.095 1.00 11.68 ? 225 LEU B CG  1 
ATOM   2811 C  CD1 . LEU B 1 86  ? 9.425   18.648  -12.227 1.00 13.87 ? 225 LEU B CD1 1 
ATOM   2812 C  CD2 . LEU B 1 86  ? 8.828   21.080  -12.181 1.00 17.34 ? 225 LEU B CD2 1 
ATOM   2813 N  N   . HIS B 1 87  ? 7.109   16.470  -14.152 1.00 10.40 ? 226 HIS B N   1 
ATOM   2814 C  CA  . HIS B 1 87  ? 7.744   15.157  -14.203 1.00 11.40 ? 226 HIS B CA  1 
ATOM   2815 C  C   . HIS B 1 87  ? 8.528   15.071  -15.496 1.00 11.94 ? 226 HIS B C   1 
ATOM   2816 O  O   . HIS B 1 87  ? 8.491   16.007  -16.297 1.00 12.33 ? 226 HIS B O   1 
ATOM   2817 C  CB  . HIS B 1 87  ? 6.703   14.040  -14.120 1.00 8.61  ? 226 HIS B CB  1 
ATOM   2818 C  CG  . HIS B 1 87  ? 5.715   14.086  -15.235 1.00 9.34  ? 226 HIS B CG  1 
ATOM   2819 N  ND1 . HIS B 1 87  ? 4.508   14.740  -15.134 1.00 11.20 ? 226 HIS B ND1 1 
ATOM   2820 C  CD2 . HIS B 1 87  ? 5.783   13.605  -16.499 1.00 8.33  ? 226 HIS B CD2 1 
ATOM   2821 C  CE1 . HIS B 1 87  ? 3.866   14.652  -16.287 1.00 12.66 ? 226 HIS B CE1 1 
ATOM   2822 N  NE2 . HIS B 1 87  ? 4.618   13.966  -17.130 1.00 7.54  ? 226 HIS B NE2 1 
ATOM   2823 N  N   . LEU B 1 88  ? 9.215   13.946  -15.700 1.00 10.17 ? 227 LEU B N   1 
ATOM   2824 C  CA  . LEU B 1 88  ? 10.154  13.790  -16.819 1.00 11.17 ? 227 LEU B CA  1 
ATOM   2825 C  C   . LEU B 1 88  ? 9.929   12.508  -17.627 1.00 13.50 ? 227 LEU B C   1 
ATOM   2826 O  O   . LEU B 1 88  ? 9.388   11.526  -17.133 1.00 12.20 ? 227 LEU B O   1 
ATOM   2827 C  CB  A LEU B 1 88  ? 11.596  13.823  -16.306 0.67 11.91 ? 227 LEU B CB  1 
ATOM   2828 C  CB  B LEU B 1 88  ? 11.604  13.779  -16.315 0.33 12.96 ? 227 LEU B CB  1 
ATOM   2829 C  CG  A LEU B 1 88  ? 12.018  15.057  -15.500 0.67 16.47 ? 227 LEU B CG  1 
ATOM   2830 C  CG  B LEU B 1 88  ? 12.323  14.976  -15.679 0.33 17.44 ? 227 LEU B CG  1 
ATOM   2831 C  CD1 A LEU B 1 88  ? 13.292  14.774  -14.709 0.67 14.56 ? 227 LEU B CD1 1 
ATOM   2832 C  CD1 B LEU B 1 88  ? 12.393  16.153  -16.627 0.33 18.95 ? 227 LEU B CD1 1 
ATOM   2833 C  CD2 A LEU B 1 88  ? 12.238  16.214  -16.426 0.67 19.29 ? 227 LEU B CD2 1 
ATOM   2834 C  CD2 B LEU B 1 88  ? 11.721  15.376  -14.340 0.33 12.68 ? 227 LEU B CD2 1 
ATOM   2835 N  N   . HIS B 1 89  ? 10.401  12.523  -18.870 1.00 9.43  ? 228 HIS B N   1 
ATOM   2836 C  CA  . HIS B 1 89  ? 10.401  11.336  -19.719 1.00 8.49  ? 228 HIS B CA  1 
ATOM   2837 C  C   . HIS B 1 89  ? 11.797  11.170  -20.304 1.00 10.08 ? 228 HIS B C   1 
ATOM   2838 O  O   . HIS B 1 89  ? 12.390  12.150  -20.760 1.00 11.58 ? 228 HIS B O   1 
ATOM   2839 C  CB  . HIS B 1 89  ? 9.360   11.472  -20.829 1.00 9.15  ? 228 HIS B CB  1 
ATOM   2840 C  CG  . HIS B 1 89  ? 7.964   11.648  -20.321 1.00 8.92  ? 228 HIS B CG  1 
ATOM   2841 N  ND1 . HIS B 1 89  ? 7.133   10.580  -20.063 1.00 8.93  ? 228 HIS B ND1 1 
ATOM   2842 C  CD2 . HIS B 1 89  ? 7.251   12.762  -20.027 1.00 9.19  ? 228 HIS B CD2 1 
ATOM   2843 C  CE1 . HIS B 1 89  ? 5.963   11.028  -19.636 1.00 8.84  ? 228 HIS B CE1 1 
ATOM   2844 N  NE2 . HIS B 1 89  ? 6.008   12.348  -19.603 1.00 9.16  ? 228 HIS B NE2 1 
ATOM   2845 N  N   . TRP B 1 90  ? 12.312  9.942   -20.300 1.00 9.31  ? 229 TRP B N   1 
ATOM   2846 C  CA  . TRP B 1 90  ? 13.717  9.712   -20.688 1.00 8.39  ? 229 TRP B CA  1 
ATOM   2847 C  C   . TRP B 1 90  ? 13.944  8.343   -21.316 1.00 10.20 ? 229 TRP B C   1 
ATOM   2848 O  O   . TRP B 1 90  ? 13.033  7.518   -21.366 1.00 11.05 ? 229 TRP B O   1 
ATOM   2849 C  CB  . TRP B 1 90  ? 14.632  9.890   -19.468 1.00 10.12 ? 229 TRP B CB  1 
ATOM   2850 C  CG  . TRP B 1 90  ? 14.323  8.935   -18.327 1.00 9.99  ? 229 TRP B CG  1 
ATOM   2851 C  CD1 . TRP B 1 90  ? 14.728  7.643   -18.224 1.00 11.56 ? 229 TRP B CD1 1 
ATOM   2852 C  CD2 . TRP B 1 90  ? 13.526  9.203   -17.157 1.00 12.26 ? 229 TRP B CD2 1 
ATOM   2853 N  NE1 . TRP B 1 90  ? 14.251  7.084   -17.054 1.00 12.52 ? 229 TRP B NE1 1 
ATOM   2854 C  CE2 . TRP B 1 90  ? 13.511  8.022   -16.384 1.00 11.68 ? 229 TRP B CE2 1 
ATOM   2855 C  CE3 . TRP B 1 90  ? 12.820  10.324  -16.692 1.00 10.52 ? 229 TRP B CE3 1 
ATOM   2856 C  CZ2 . TRP B 1 90  ? 12.828  7.930   -15.163 1.00 9.16  ? 229 TRP B CZ2 1 
ATOM   2857 C  CZ3 . TRP B 1 90  ? 12.140  10.230  -15.477 1.00 10.02 ? 229 TRP B CZ3 1 
ATOM   2858 C  CH2 . TRP B 1 90  ? 12.155  9.042   -14.728 1.00 11.27 ? 229 TRP B CH2 1 
ATOM   2859 N  N   . GLY B 1 91  ? 15.174  8.084   -21.773 1.00 12.91 ? 230 GLY B N   1 
ATOM   2860 C  CA  . GLY B 1 91  ? 15.430  6.832   -22.460 1.00 13.81 ? 230 GLY B CA  1 
ATOM   2861 C  C   . GLY B 1 91  ? 16.227  5.826   -21.644 1.00 15.19 ? 230 GLY B C   1 
ATOM   2862 O  O   . GLY B 1 91  ? 15.799  5.404   -20.571 1.00 14.03 ? 230 GLY B O   1 
ATOM   2863 N  N   A ALA B 1 92  ? 17.372  5.388   -22.175 0.51 14.67 ? 231 ALA B N   1 
ATOM   2864 N  N   B ALA B 1 92  ? 17.400  5.488   -22.144 0.49 14.46 ? 231 ALA B N   1 
ATOM   2865 C  CA  A ALA B 1 92  ? 18.225  4.376   -21.514 0.51 13.03 ? 231 ALA B CA  1 
ATOM   2866 C  CA  B ALA B 1 92  ? 18.319  4.675   -21.382 0.49 12.03 ? 231 ALA B CA  1 
ATOM   2867 C  C   A ALA B 1 92  ? 19.632  4.384   -22.119 0.51 15.74 ? 231 ALA B C   1 
ATOM   2868 C  C   B ALA B 1 92  ? 19.716  5.161   -21.680 0.49 17.58 ? 231 ALA B C   1 
ATOM   2869 O  O   A ALA B 1 92  ? 19.727  4.302   -23.334 0.51 16.14 ? 231 ALA B O   1 
ATOM   2870 O  O   B ALA B 1 92  ? 19.915  6.233   -22.244 0.49 17.27 ? 231 ALA B O   1 
ATOM   2871 C  CB  A ALA B 1 92  ? 17.593  2.993   -21.652 0.51 14.58 ? 231 ALA B CB  1 
ATOM   2872 C  CB  B ALA B 1 92  ? 18.160  3.205   -21.737 0.49 17.46 ? 231 ALA B CB  1 
ATOM   2873 N  N   . ALA B 1 93  ? 20.686  4.365   -21.283 1.00 20.27 ? 232 ALA B N   1 
ATOM   2874 C  CA  . ALA B 1 93  ? 22.082  4.616   -21.689 1.00 25.91 ? 232 ALA B CA  1 
ATOM   2875 C  C   . ALA B 1 93  ? 22.285  4.703   -23.202 1.00 28.09 ? 232 ALA B C   1 
ATOM   2876 O  O   . ALA B 1 93  ? 22.242  3.696   -23.909 1.00 38.78 ? 232 ALA B O   1 
ATOM   2877 C  CB  . ALA B 1 93  ? 22.982  3.536   -21.114 1.00 36.05 ? 232 ALA B CB  1 
ATOM   2878 N  N   . GLY B 1 94  ? 22.540  5.916   -23.678 1.00 19.59 ? 233 GLY B N   1 
ATOM   2879 C  CA  . GLY B 1 94  ? 22.760  6.180   -25.089 1.00 18.02 ? 233 GLY B CA  1 
ATOM   2880 C  C   . GLY B 1 94  ? 21.505  6.291   -25.944 1.00 23.50 ? 233 GLY B C   1 
ATOM   2881 O  O   . GLY B 1 94  ? 21.557  6.774   -27.067 1.00 19.83 ? 233 GLY B O   1 
ATOM   2882 N  N   . ARG B 1 95  ? 20.352  5.930   -25.403 1.00 15.87 ? 234 ARG B N   1 
ATOM   2883 C  CA  . ARG B 1 95  ? 19.155  5.897   -26.221 1.00 13.75 ? 234 ARG B CA  1 
ATOM   2884 C  C   . ARG B 1 95  ? 18.182  6.989   -25.752 1.00 15.44 ? 234 ARG B C   1 
ATOM   2885 O  O   . ARG B 1 95  ? 17.994  7.180   -24.556 1.00 16.57 ? 234 ARG B O   1 
ATOM   2886 C  CB  . ARG B 1 95  ? 18.513  4.505   -26.155 1.00 20.82 ? 234 ARG B CB  1 
ATOM   2887 C  CG  . ARG B 1 95  ? 17.348  4.287   -27.091 1.00 33.21 ? 234 ARG B CG  1 
ATOM   2888 C  CD  . ARG B 1 95  ? 16.748  2.902   -26.911 1.00 32.24 ? 234 ARG B CD  1 
ATOM   2889 N  NE  . ARG B 1 95  ? 15.356  2.864   -27.343 1.00 32.55 ? 234 ARG B NE  1 
ATOM   2890 C  CZ  . ARG B 1 95  ? 14.590  1.781   -27.287 1.00 34.68 ? 234 ARG B CZ  1 
ATOM   2891 N  NH1 . ARG B 1 95  ? 15.086  0.643   -26.811 1.00 29.89 ? 234 ARG B NH1 1 
ATOM   2892 N  NH2 . ARG B 1 95  ? 13.330  1.841   -27.703 1.00 36.92 ? 234 ARG B NH2 1 
ATOM   2893 N  N   . PRO B 1 96  ? 17.605  7.749   -26.696 1.00 14.36 ? 235 PRO B N   1 
ATOM   2894 C  CA  . PRO B 1 96  ? 16.773  8.896   -26.310 1.00 13.02 ? 235 PRO B CA  1 
ATOM   2895 C  C   . PRO B 1 96  ? 15.365  8.497   -25.887 1.00 10.94 ? 235 PRO B C   1 
ATOM   2896 O  O   . PRO B 1 96  ? 14.890  7.430   -26.267 1.00 12.66 ? 235 PRO B O   1 
ATOM   2897 C  CB  . PRO B 1 96  ? 16.721  9.729   -27.593 1.00 12.96 ? 235 PRO B CB  1 
ATOM   2898 C  CG  . PRO B 1 96  ? 16.762  8.684   -28.682 1.00 13.82 ? 235 PRO B CG  1 
ATOM   2899 C  CD  . PRO B 1 96  ? 17.743  7.640   -28.164 1.00 15.16 ? 235 PRO B CD  1 
ATOM   2900 N  N   . GLY B 1 97  ? 14.704  9.372   -25.132 1.00 10.21 ? 236 GLY B N   1 
ATOM   2901 C  CA  . GLY B 1 97  ? 13.370  9.080   -24.635 1.00 9.82  ? 236 GLY B CA  1 
ATOM   2902 C  C   . GLY B 1 97  ? 12.406  10.253  -24.550 1.00 13.33 ? 236 GLY B C   1 
ATOM   2903 O  O   . GLY B 1 97  ? 11.457  10.200  -23.761 1.00 10.25 ? 236 GLY B O   1 
ATOM   2904 N  N   . SER B 1 98  ? 12.586  11.296  -25.361 1.00 9.74  ? 237 SER B N   1 
ATOM   2905 C  CA  . SER B 1 98  ? 11.564  12.350  -25.379 1.00 7.42  ? 237 SER B CA  1 
ATOM   2906 C  C   . SER B 1 98  ? 10.260  11.780  -25.930 1.00 9.07  ? 237 SER B C   1 
ATOM   2907 O  O   . SER B 1 98  ? 10.250  10.761  -26.628 1.00 11.38 ? 237 SER B O   1 
ATOM   2908 C  CB  . SER B 1 98  ? 12.012  13.583  -26.200 1.00 11.09 ? 237 SER B CB  1 
ATOM   2909 O  OG  . SER B 1 98  ? 12.046  13.339  -27.606 1.00 10.56 ? 237 SER B OG  1 
ATOM   2910 N  N   . GLU B 1 99  ? 9.153   12.443  -25.600 1.00 9.68  ? 238 GLU B N   1 
ATOM   2911 C  CA  . GLU B 1 99  ? 7.848   12.028  -26.094 1.00 7.50  ? 238 GLU B CA  1 
ATOM   2912 C  C   . GLU B 1 99  ? 7.523   12.672  -27.449 1.00 8.41  ? 238 GLU B C   1 
ATOM   2913 O  O   . GLU B 1 99  ? 7.187   11.986  -28.435 1.00 11.05 ? 238 GLU B O   1 
ATOM   2914 C  CB  . GLU B 1 99  ? 6.776   12.380  -25.063 1.00 8.48  ? 238 GLU B CB  1 
ATOM   2915 C  CG  . GLU B 1 99  ? 6.970   11.646  -23.733 1.00 8.01  ? 238 GLU B CG  1 
ATOM   2916 C  CD  . GLU B 1 99  ? 5.638   11.214  -23.142 1.00 9.18  ? 238 GLU B CD  1 
ATOM   2917 O  OE1 . GLU B 1 99  ? 5.357   10.002  -23.130 1.00 9.99  ? 238 GLU B OE1 1 
ATOM   2918 O  OE2 . GLU B 1 99  ? 4.859   12.091  -22.723 1.00 10.77 ? 238 GLU B OE2 1 
ATOM   2919 N  N   . HIS B 1 100 ? 7.616   13.995  -27.499 1.00 9.69  ? 239 HIS B N   1 
ATOM   2920 C  CA  . HIS B 1 100 ? 7.468   14.683  -28.773 1.00 9.49  ? 239 HIS B CA  1 
ATOM   2921 C  C   . HIS B 1 100 ? 8.711   14.429  -29.611 1.00 9.07  ? 239 HIS B C   1 
ATOM   2922 O  O   . HIS B 1 100 ? 9.796   14.162  -29.078 1.00 10.84 ? 239 HIS B O   1 
ATOM   2923 C  CB  . HIS B 1 100 ? 7.223   16.179  -28.555 1.00 9.00  ? 239 HIS B CB  1 
ATOM   2924 C  CG  . HIS B 1 100 ? 5.863   16.473  -28.001 1.00 9.05  ? 239 HIS B CG  1 
ATOM   2925 N  ND1 . HIS B 1 100 ? 5.590   16.427  -26.649 1.00 10.00 ? 239 HIS B ND1 1 
ATOM   2926 C  CD2 . HIS B 1 100 ? 4.683   16.735  -28.618 1.00 9.83  ? 239 HIS B CD2 1 
ATOM   2927 C  CE1 . HIS B 1 100 ? 4.308   16.687  -26.453 1.00 9.49  ? 239 HIS B CE1 1 
ATOM   2928 N  NE2 . HIS B 1 100 ? 3.734   16.876  -27.631 1.00 9.91  ? 239 HIS B NE2 1 
ATOM   2929 N  N   . THR B 1 101 ? 8.534   14.484  -30.923 1.00 9.66  ? 240 THR B N   1 
ATOM   2930 C  CA  . THR B 1 101 ? 9.657   14.378  -31.855 1.00 11.08 ? 240 THR B CA  1 
ATOM   2931 C  C   . THR B 1 101 ? 9.631   15.603  -32.749 1.00 12.46 ? 240 THR B C   1 
ATOM   2932 O  O   . THR B 1 101 ? 8.637   16.312  -32.794 1.00 9.87  ? 240 THR B O   1 
ATOM   2933 C  CB  . THR B 1 101 ? 9.599   13.083  -32.706 1.00 7.15  ? 240 THR B CB  1 
ATOM   2934 O  OG1 . THR B 1 101 ? 8.334   12.989  -33.382 1.00 9.42  ? 240 THR B OG1 1 
ATOM   2935 C  CG2 . THR B 1 101 ? 9.785   11.848  -31.812 1.00 11.01 ? 240 THR B CG2 1 
ATOM   2936 N  N   . VAL B 1 102 ? 10.743  15.883  -33.424 1.00 10.92 ? 241 VAL B N   1 
ATOM   2937 C  CA  . VAL B 1 102 ? 10.752  16.960  -34.408 1.00 11.90 ? 241 VAL B CA  1 
ATOM   2938 C  C   . VAL B 1 102 ? 11.202  16.384  -35.733 1.00 10.49 ? 241 VAL B C   1 
ATOM   2939 O  O   . VAL B 1 102 ? 12.323  15.864  -35.848 1.00 10.44 ? 241 VAL B O   1 
ATOM   2940 C  CB  . VAL B 1 102 ? 11.668  18.123  -33.985 1.00 11.30 ? 241 VAL B CB  1 
ATOM   2941 C  CG1 . VAL B 1 102 ? 11.779  19.156  -35.113 1.00 12.97 ? 241 VAL B CG1 1 
ATOM   2942 C  CG2 . VAL B 1 102 ? 11.139  18.767  -32.679 1.00 14.70 ? 241 VAL B CG2 1 
ATOM   2943 N  N   . GLU B 1 103 ? 10.306  16.473  -36.711 1.00 11.48 ? 242 GLU B N   1 
ATOM   2944 C  CA  . GLU B 1 103 ? 10.486  15.893  -38.026 1.00 13.78 ? 242 GLU B CA  1 
ATOM   2945 C  C   . GLU B 1 103 ? 10.968  14.431  -37.913 1.00 11.62 ? 242 GLU B C   1 
ATOM   2946 O  O   . GLU B 1 103 ? 11.839  13.942  -38.654 1.00 12.75 ? 242 GLU B O   1 
ATOM   2947 C  CB  A GLU B 1 103 ? 11.479  16.726  -38.823 0.74 17.55 ? 242 GLU B CB  1 
ATOM   2948 C  CB  B GLU B 1 103 ? 11.419  16.784  -38.837 0.26 19.15 ? 242 GLU B CB  1 
ATOM   2949 C  CG  A GLU B 1 103 ? 10.991  18.066  -39.281 0.74 17.25 ? 242 GLU B CG  1 
ATOM   2950 C  CG  B GLU B 1 103 ? 10.839  18.168  -39.118 0.26 22.25 ? 242 GLU B CG  1 
ATOM   2951 C  CD  A GLU B 1 103 ? 10.034  17.945  -40.442 0.74 23.18 ? 242 GLU B CD  1 
ATOM   2952 C  CD  B GLU B 1 103 ? 11.878  19.273  -39.119 0.26 30.70 ? 242 GLU B CD  1 
ATOM   2953 O  OE1 A GLU B 1 103 ? 9.336   18.933  -40.735 0.74 37.18 ? 242 GLU B OE1 1 
ATOM   2954 O  OE1 B GLU B 1 103 ? 12.730  19.293  -38.208 0.26 40.98 ? 242 GLU B OE1 1 
ATOM   2955 O  OE2 A GLU B 1 103 ? 9.989   16.865  -41.070 0.74 31.52 ? 242 GLU B OE2 1 
ATOM   2956 O  OE2 B GLU B 1 103 ? 11.851  20.117  -40.039 0.26 36.96 ? 242 GLU B OE2 1 
ATOM   2957 N  N   . GLY B 1 104 ? 10.366  13.744  -36.949 1.00 10.89 ? 243 GLY B N   1 
ATOM   2958 C  CA  . GLY B 1 104 ? 10.584  12.328  -36.733 1.00 11.35 ? 243 GLY B CA  1 
ATOM   2959 C  C   . GLY B 1 104 ? 11.759  11.950  -35.842 1.00 12.62 ? 243 GLY B C   1 
ATOM   2960 O  O   . GLY B 1 104 ? 11.939  10.774  -35.549 1.00 12.79 ? 243 GLY B O   1 
ATOM   2961 N  N   . HIS B 1 105 ? 12.524  12.941  -35.392 1.00 10.56 ? 244 HIS B N   1 
ATOM   2962 C  CA  . HIS B 1 105 ? 13.743  12.736  -34.590 1.00 9.53  ? 244 HIS B CA  1 
ATOM   2963 C  C   . HIS B 1 105 ? 13.472  12.914  -33.107 1.00 12.36 ? 244 HIS B C   1 
ATOM   2964 O  O   . HIS B 1 105 ? 12.720  13.812  -32.716 1.00 11.47 ? 244 HIS B O   1 
ATOM   2965 C  CB  . HIS B 1 105 ? 14.833  13.710  -35.046 1.00 10.32 ? 244 HIS B CB  1 
ATOM   2966 C  CG  . HIS B 1 105 ? 15.279  13.479  -36.455 1.00 10.66 ? 244 HIS B CG  1 
ATOM   2967 N  ND1 . HIS B 1 105 ? 16.208  12.517  -36.799 1.00 12.60 ? 244 HIS B ND1 1 
ATOM   2968 C  CD2 . HIS B 1 105 ? 14.903  14.068  -37.611 1.00 12.10 ? 244 HIS B CD2 1 
ATOM   2969 C  CE1 . HIS B 1 105 ? 16.395  12.538  -38.108 1.00 9.43  ? 244 HIS B CE1 1 
ATOM   2970 N  NE2 . HIS B 1 105 ? 15.614  13.470  -38.626 1.00 10.70 ? 244 HIS B NE2 1 
ATOM   2971 N  N   . ARG B 1 106 ? 14.097  12.070  -32.285 1.00 10.23 ? 245 ARG B N   1 
ATOM   2972 C  CA  . ARG B 1 106 ? 13.849  12.069  -30.850 1.00 10.63 ? 245 ARG B CA  1 
ATOM   2973 C  C   . ARG B 1 106 ? 14.991  12.720  -30.059 1.00 13.16 ? 245 ARG B C   1 
ATOM   2974 O  O   . ARG B 1 106 ? 16.162  12.597  -30.436 1.00 14.43 ? 245 ARG B O   1 
ATOM   2975 C  CB  . ARG B 1 106 ? 13.629  10.631  -30.374 1.00 11.64 ? 245 ARG B CB  1 
ATOM   2976 C  CG  . ARG B 1 106 ? 13.022  10.532  -28.970 1.00 11.46 ? 245 ARG B CG  1 
ATOM   2977 C  CD  . ARG B 1 106 ? 12.857  9.072   -28.527 1.00 12.81 ? 245 ARG B CD  1 
ATOM   2978 N  NE  . ARG B 1 106 ? 12.137  8.263   -29.508 1.00 17.01 ? 245 ARG B NE  1 
ATOM   2979 C  CZ  . ARG B 1 106 ? 10.820  8.276   -29.668 1.00 15.38 ? 245 ARG B CZ  1 
ATOM   2980 N  NH1 . ARG B 1 106 ? 10.060  9.059   -28.904 1.00 13.16 ? 245 ARG B NH1 1 
ATOM   2981 N  NH2 . ARG B 1 106 ? 10.259  7.509   -30.591 1.00 21.93 ? 245 ARG B NH2 1 
ATOM   2982 N  N   . PHE B 1 107 ? 14.634  13.416  -28.979 1.00 10.43 ? 246 PHE B N   1 
ATOM   2983 C  CA  . PHE B 1 107 ? 15.578  14.100  -28.090 1.00 11.75 ? 246 PHE B CA  1 
ATOM   2984 C  C   . PHE B 1 107 ? 15.866  13.232  -26.865 1.00 10.96 ? 246 PHE B C   1 
ATOM   2985 O  O   . PHE B 1 107 ? 15.082  12.332  -26.551 1.00 11.40 ? 246 PHE B O   1 
ATOM   2986 C  CB  . PHE B 1 107 ? 15.024  15.462  -27.663 1.00 12.09 ? 246 PHE B CB  1 
ATOM   2987 C  CG  . PHE B 1 107 ? 14.940  16.451  -28.790 1.00 12.55 ? 246 PHE B CG  1 
ATOM   2988 C  CD1 . PHE B 1 107 ? 13.922  16.362  -29.727 1.00 14.55 ? 246 PHE B CD1 1 
ATOM   2989 C  CD2 . PHE B 1 107 ? 15.875  17.469  -28.907 1.00 17.79 ? 246 PHE B CD2 1 
ATOM   2990 C  CE1 . PHE B 1 107 ? 13.839  17.258  -30.776 1.00 18.72 ? 246 PHE B CE1 1 
ATOM   2991 C  CE2 . PHE B 1 107 ? 15.796  18.386  -29.963 1.00 19.82 ? 246 PHE B CE2 1 
ATOM   2992 C  CZ  . PHE B 1 107 ? 14.774  18.277  -30.888 1.00 20.21 ? 246 PHE B CZ  1 
ATOM   2993 N  N   . PRO B 1 108 ? 16.995  13.475  -26.176 1.00 11.84 ? 247 PRO B N   1 
ATOM   2994 C  CA  . PRO B 1 108 ? 17.320  12.599  -25.040 1.00 13.17 ? 247 PRO B CA  1 
ATOM   2995 C  C   . PRO B 1 108 ? 16.226  12.515  -23.970 1.00 13.87 ? 247 PRO B C   1 
ATOM   2996 O  O   . PRO B 1 108 ? 15.940  11.418  -23.491 1.00 12.32 ? 247 PRO B O   1 
ATOM   2997 C  CB  . PRO B 1 108 ? 18.598  13.226  -24.477 1.00 13.69 ? 247 PRO B CB  1 
ATOM   2998 C  CG  . PRO B 1 108 ? 19.281  13.772  -25.716 1.00 14.38 ? 247 PRO B CG  1 
ATOM   2999 C  CD  . PRO B 1 108 ? 18.132  14.345  -26.542 1.00 13.16 ? 247 PRO B CD  1 
ATOM   3000 N  N   . ALA B 1 109 ? 15.629  13.636  -23.596 1.00 10.47 ? 248 ALA B N   1 
ATOM   3001 C  CA  . ALA B 1 109 ? 14.582  13.592  -22.575 1.00 11.40 ? 248 ALA B CA  1 
ATOM   3002 C  C   . ALA B 1 109 ? 13.630  14.772  -22.723 1.00 12.70 ? 248 ALA B C   1 
ATOM   3003 O  O   . ALA B 1 109 ? 13.773  15.580  -23.645 1.00 12.11 ? 248 ALA B O   1 
ATOM   3004 C  CB  . ALA B 1 109 ? 15.208  13.548  -21.166 1.00 13.37 ? 248 ALA B CB  1 
ATOM   3005 N  N   . GLU B 1 110 ? 12.640  14.858  -21.837 1.00 10.37 ? 249 GLU B N   1 
ATOM   3006 C  CA  . GLU B 1 110 ? 11.592  15.868  -21.960 1.00 10.29 ? 249 GLU B CA  1 
ATOM   3007 C  C   . GLU B 1 110 ? 11.009  16.160  -20.578 1.00 13.08 ? 249 GLU B C   1 
ATOM   3008 O  O   . GLU B 1 110 ? 10.774  15.229  -19.805 1.00 11.94 ? 249 GLU B O   1 
ATOM   3009 C  CB  . GLU B 1 110 ? 10.502  15.378  -22.933 1.00 10.45 ? 249 GLU B CB  1 
ATOM   3010 C  CG  . GLU B 1 110 ? 9.401   16.386  -23.238 1.00 9.83  ? 249 GLU B CG  1 
ATOM   3011 C  CD  . GLU B 1 110 ? 8.524   15.954  -24.419 1.00 9.78  ? 249 GLU B CD  1 
ATOM   3012 O  OE1 . GLU B 1 110 ? 9.026   15.231  -25.322 1.00 9.94  ? 249 GLU B OE1 1 
ATOM   3013 O  OE2 . GLU B 1 110 ? 7.332   16.338  -24.442 1.00 10.06 ? 249 GLU B OE2 1 
ATOM   3014 N  N   . ILE B 1 111 ? 10.784  17.439  -20.271 1.00 13.34 ? 250 ILE B N   1 
ATOM   3015 C  CA  . ILE B 1 111 ? 10.131  17.830  -19.017 1.00 11.22 ? 250 ILE B CA  1 
ATOM   3016 C  C   . ILE B 1 111 ? 8.695   18.293  -19.287 1.00 10.19 ? 250 ILE B C   1 
ATOM   3017 O  O   . ILE B 1 111 ? 8.440   18.974  -20.278 1.00 10.87 ? 250 ILE B O   1 
ATOM   3018 C  CB  . ILE B 1 111 ? 10.926  18.955  -18.268 1.00 11.26 ? 250 ILE B CB  1 
ATOM   3019 C  CG1 . ILE B 1 111 ? 10.242  19.290  -16.936 1.00 12.22 ? 250 ILE B CG1 1 
ATOM   3020 C  CG2 . ILE B 1 111 ? 11.140  20.204  -19.152 1.00 13.03 ? 250 ILE B CG2 1 
ATOM   3021 C  CD1 . ILE B 1 111 ? 11.099  20.131  -15.991 1.00 13.82 ? 250 ILE B CD1 1 
ATOM   3022 N  N   . HIS B 1 112 ? 7.767   17.894  -18.419 1.00 10.28 ? 251 HIS B N   1 
ATOM   3023 C  CA  . HIS B 1 112 ? 6.357   18.304  -18.496 1.00 8.53  ? 251 HIS B CA  1 
ATOM   3024 C  C   . HIS B 1 112 ? 5.932   19.000  -17.222 1.00 12.60 ? 251 HIS B C   1 
ATOM   3025 O  O   . HIS B 1 112 ? 6.115   18.438  -16.144 1.00 13.73 ? 251 HIS B O   1 
ATOM   3026 C  CB  . HIS B 1 112 ? 5.430   17.093  -18.693 1.00 10.23 ? 251 HIS B CB  1 
ATOM   3027 C  CG  . HIS B 1 112 ? 5.554   16.449  -20.033 1.00 8.19  ? 251 HIS B CG  1 
ATOM   3028 N  ND1 . HIS B 1 112 ? 5.030   15.204  -20.315 1.00 9.05  ? 251 HIS B ND1 1 
ATOM   3029 C  CD2 . HIS B 1 112 ? 6.137   16.882  -21.174 1.00 11.88 ? 251 HIS B CD2 1 
ATOM   3030 C  CE1 . HIS B 1 112 ? 5.291   14.899  -21.574 1.00 9.11  ? 251 HIS B CE1 1 
ATOM   3031 N  NE2 . HIS B 1 112 ? 5.952   15.907  -22.118 1.00 9.75  ? 251 HIS B NE2 1 
ATOM   3032 N  N   . VAL B 1 113 ? 5.349   20.193  -17.342 1.00 12.46 ? 252 VAL B N   1 
ATOM   3033 C  CA  . VAL B 1 113 ? 4.748   20.873  -16.192 1.00 10.40 ? 252 VAL B CA  1 
ATOM   3034 C  C   . VAL B 1 113 ? 3.251   20.926  -16.420 1.00 13.66 ? 252 VAL B C   1 
ATOM   3035 O  O   . VAL B 1 113 ? 2.786   21.596  -17.346 1.00 14.67 ? 252 VAL B O   1 
ATOM   3036 C  CB  . VAL B 1 113 ? 5.294   22.309  -15.998 1.00 12.19 ? 252 VAL B CB  1 
ATOM   3037 C  CG1 . VAL B 1 113 ? 4.782   22.903  -14.689 1.00 13.17 ? 252 VAL B CG1 1 
ATOM   3038 C  CG2 . VAL B 1 113 ? 6.822   22.320  -16.038 1.00 14.21 ? 252 VAL B CG2 1 
ATOM   3039 N  N   . VAL B 1 114 ? 2.500   20.211  -15.590 1.00 12.61 ? 253 VAL B N   1 
ATOM   3040 C  CA  . VAL B 1 114 ? 1.069   20.030  -15.809 1.00 11.10 ? 253 VAL B CA  1 
ATOM   3041 C  C   . VAL B 1 114 ? 0.274   21.063  -15.020 1.00 16.16 ? 253 VAL B C   1 
ATOM   3042 O  O   . VAL B 1 114 ? 0.577   21.295  -13.850 1.00 16.15 ? 253 VAL B O   1 
ATOM   3043 C  CB  . VAL B 1 114 ? 0.643   18.621  -15.422 1.00 12.11 ? 253 VAL B CB  1 
ATOM   3044 C  CG1 . VAL B 1 114 ? -0.822  18.388  -15.757 1.00 14.49 ? 253 VAL B CG1 1 
ATOM   3045 C  CG2 . VAL B 1 114 ? 1.532   17.611  -16.149 1.00 13.64 ? 253 VAL B CG2 1 
ATOM   3046 N  N   . HIS B 1 115 ? -0.708  21.694  -15.677 1.00 15.29 ? 254 HIS B N   1 
ATOM   3047 C  CA  . HIS B 1 115 ? -1.499  22.794  -15.099 1.00 14.49 ? 254 HIS B CA  1 
ATOM   3048 C  C   . HIS B 1 115 ? -3.004  22.550  -15.182 1.00 15.04 ? 254 HIS B C   1 
ATOM   3049 O  O   . HIS B 1 115 ? -3.501  21.866  -16.082 1.00 15.55 ? 254 HIS B O   1 
ATOM   3050 C  CB  . HIS B 1 115 ? -1.236  24.135  -15.813 1.00 15.05 ? 254 HIS B CB  1 
ATOM   3051 C  CG  . HIS B 1 115 ? 0.193   24.576  -15.829 1.00 17.42 ? 254 HIS B CG  1 
ATOM   3052 N  ND1 . HIS B 1 115 ? 1.157   23.942  -16.584 1.00 17.25 ? 254 HIS B ND1 1 
ATOM   3053 C  CD2 . HIS B 1 115 ? 0.808   25.632  -15.242 1.00 13.65 ? 254 HIS B CD2 1 
ATOM   3054 C  CE1 . HIS B 1 115 ? 2.311   24.569  -16.435 1.00 15.61 ? 254 HIS B CE1 1 
ATOM   3055 N  NE2 . HIS B 1 115 ? 2.127   25.596  -15.622 1.00 18.30 ? 254 HIS B NE2 1 
ATOM   3056 N  N   . LEU B 1 116 ? -3.723  23.183  -14.254 1.00 16.36 ? 255 LEU B N   1 
ATOM   3057 C  CA  . LEU B 1 116 ? -5.179  23.195  -14.206 1.00 15.03 ? 255 LEU B CA  1 
ATOM   3058 C  C   . LEU B 1 116 ? -5.720  24.582  -14.558 1.00 16.25 ? 255 LEU B C   1 
ATOM   3059 O  O   . LEU B 1 116 ? -5.254  25.587  -14.012 1.00 19.58 ? 255 LEU B O   1 
ATOM   3060 C  CB  . LEU B 1 116 ? -5.657  22.792  -12.803 1.00 17.90 ? 255 LEU B CB  1 
ATOM   3061 C  CG  . LEU B 1 116 ? -7.153  22.905  -12.510 1.00 16.93 ? 255 LEU B CG  1 
ATOM   3062 C  CD1 . LEU B 1 116 ? -7.957  21.962  -13.375 1.00 18.81 ? 255 LEU B CD1 1 
ATOM   3063 C  CD2 . LEU B 1 116 ? -7.439  22.637  -11.018 1.00 20.52 ? 255 LEU B CD2 1 
ATOM   3064 N  N   . SER B 1 117 ? -6.687  24.634  -15.471 1.00 16.67 ? 256 SER B N   1 
ATOM   3065 C  CA  . SER B 1 117 ? -7.332  25.895  -15.840 1.00 22.06 ? 256 SER B CA  1 
ATOM   3066 C  C   . SER B 1 117 ? -7.971  26.551  -14.628 1.00 23.22 ? 256 SER B C   1 
ATOM   3067 O  O   . SER B 1 117 ? -8.575  25.870  -13.813 1.00 24.31 ? 256 SER B O   1 
ATOM   3068 C  CB  . SER B 1 117 ? -8.397  25.671  -16.915 1.00 20.61 ? 256 SER B CB  1 
ATOM   3069 O  OG  . SER B 1 117 ? -9.148  26.861  -17.138 1.00 21.42 ? 256 SER B OG  1 
ATOM   3070 N  N   . THR B 1 118 ? -7.846  27.869  -14.515 1.00 19.42 ? 257 THR B N   1 
ATOM   3071 C  CA  . THR B 1 118 ? -8.521  28.586  -13.429 1.00 24.27 ? 257 THR B CA  1 
ATOM   3072 C  C   . THR B 1 118 ? -10.046 28.550  -13.566 1.00 31.91 ? 257 THR B C   1 
ATOM   3073 O  O   . THR B 1 118 ? -10.763 28.973  -12.661 1.00 34.89 ? 257 THR B O   1 
ATOM   3074 C  CB  . THR B 1 118 ? -8.063  30.046  -13.351 1.00 25.23 ? 257 THR B CB  1 
ATOM   3075 O  OG1 . THR B 1 118 ? -8.347  30.696  -14.593 1.00 26.83 ? 257 THR B OG1 1 
ATOM   3076 C  CG2 . THR B 1 118 ? -6.574  30.115  -13.069 1.00 22.66 ? 257 THR B CG2 1 
ATOM   3077 N  N   . LYS B 1 119 ? -10.542 28.055  -14.695 1.00 27.01 ? 258 LYS B N   1 
ATOM   3078 C  CA  . LYS B 1 119 ? -11.983 27.939  -14.908 1.00 32.00 ? 258 LYS B CA  1 
ATOM   3079 C  C   . LYS B 1 119 ? -12.568 26.716  -14.206 1.00 35.22 ? 258 LYS B C   1 
ATOM   3080 O  O   . LYS B 1 119 ? -13.787 26.557  -14.146 1.00 35.13 ? 258 LYS B O   1 
ATOM   3081 C  CB  . LYS B 1 119 ? -12.311 27.875  -16.401 1.00 39.20 ? 258 LYS B CB  1 
ATOM   3082 C  CG  . LYS B 1 119 ? -11.882 29.097  -17.203 1.00 48.71 ? 258 LYS B CG  1 
ATOM   3083 C  CD  . LYS B 1 119 ? -12.059 28.848  -18.696 1.00 57.80 ? 258 LYS B CD  1 
ATOM   3084 C  CE  . LYS B 1 119 ? -11.321 29.881  -19.537 1.00 65.72 ? 258 LYS B CE  1 
ATOM   3085 N  NZ  . LYS B 1 119 ? -12.010 31.200  -19.571 1.00 71.92 ? 258 LYS B NZ  1 
ATOM   3086 N  N   . TYR B 1 120 ? -11.697 25.849  -13.693 1.00 28.03 ? 259 TYR B N   1 
ATOM   3087 C  CA  . TYR B 1 120 ? -12.124 24.621  -13.031 1.00 28.18 ? 259 TYR B CA  1 
ATOM   3088 C  C   . TYR B 1 120 ? -11.514 24.521  -11.641 1.00 29.46 ? 259 TYR B C   1 
ATOM   3089 O  O   . TYR B 1 120 ? -10.346 24.854  -11.439 1.00 28.85 ? 259 TYR B O   1 
ATOM   3090 C  CB  . TYR B 1 120 ? -11.743 23.388  -13.865 1.00 22.71 ? 259 TYR B CB  1 
ATOM   3091 C  CG  . TYR B 1 120 ? -12.495 23.267  -15.168 1.00 26.73 ? 259 TYR B CG  1 
ATOM   3092 C  CD1 . TYR B 1 120 ? -13.744 22.659  -15.211 1.00 24.64 ? 259 TYR B CD1 1 
ATOM   3093 C  CD2 . TYR B 1 120 ? -11.970 23.772  -16.354 1.00 25.32 ? 259 TYR B CD2 1 
ATOM   3094 C  CE1 . TYR B 1 120 ? -14.446 22.548  -16.395 1.00 31.60 ? 259 TYR B CE1 1 
ATOM   3095 C  CE2 . TYR B 1 120 ? -12.668 23.669  -17.540 1.00 25.80 ? 259 TYR B CE2 1 
ATOM   3096 C  CZ  . TYR B 1 120 ? -13.901 23.051  -17.558 1.00 27.20 ? 259 TYR B CZ  1 
ATOM   3097 O  OH  . TYR B 1 120 ? -14.595 22.946  -18.739 1.00 33.64 ? 259 TYR B OH  1 
ATOM   3098 N  N   . ALA B 1 121 ? -12.308 24.061  -10.679 1.00 34.28 ? 260 ALA B N   1 
ATOM   3099 C  CA  . ALA B 1 121 ? -11.849 23.982  -9.297  1.00 29.59 ? 260 ALA B CA  1 
ATOM   3100 C  C   . ALA B 1 121 ? -10.984 22.750  -9.048  1.00 24.80 ? 260 ALA B C   1 
ATOM   3101 O  O   . ALA B 1 121 ? -10.042 22.788  -8.257  1.00 26.74 ? 260 ALA B O   1 
ATOM   3102 C  CB  . ALA B 1 121 ? -13.045 23.992  -8.345  1.00 28.18 ? 260 ALA B CB  1 
ATOM   3103 N  N   . ARG B 1 122 ? -11.300 21.656  -9.733  1.00 26.09 ? 261 ARG B N   1 
ATOM   3104 C  CA  . ARG B 1 122 ? -10.592 20.402  -9.513  1.00 26.68 ? 261 ARG B CA  1 
ATOM   3105 C  C   . ARG B 1 122 ? -10.234 19.724  -10.824 1.00 23.43 ? 261 ARG B C   1 
ATOM   3106 O  O   . ARG B 1 122 ? -10.912 19.910  -11.831 1.00 22.71 ? 261 ARG B O   1 
ATOM   3107 C  CB  . ARG B 1 122 ? -11.434 19.446  -8.670  1.00 31.73 ? 261 ARG B CB  1 
ATOM   3108 C  CG  . ARG B 1 122 ? -11.900 20.044  -7.358  1.00 34.33 ? 261 ARG B CG  1 
ATOM   3109 C  CD  . ARG B 1 122 ? -13.167 19.392  -6.877  1.00 38.71 ? 261 ARG B CD  1 
ATOM   3110 N  NE  . ARG B 1 122 ? -12.892 18.033  -6.427  1.00 51.87 ? 261 ARG B NE  1 
ATOM   3111 C  CZ  . ARG B 1 122 ? -13.469 16.952  -6.932  1.00 61.24 ? 261 ARG B CZ  1 
ATOM   3112 N  NH1 . ARG B 1 122 ? -14.371 17.075  -7.896  1.00 66.94 ? 261 ARG B NH1 1 
ATOM   3113 N  NH2 . ARG B 1 122 ? -13.154 15.750  -6.465  1.00 61.46 ? 261 ARG B NH2 1 
ATOM   3114 N  N   . VAL B 1 123 ? -9.175  18.926  -10.789 1.00 21.15 ? 262 VAL B N   1 
ATOM   3115 C  CA  . VAL B 1 123 ? -8.745  18.188  -11.969 1.00 19.93 ? 262 VAL B CA  1 
ATOM   3116 C  C   . VAL B 1 123 ? -9.856  17.300  -12.530 1.00 24.64 ? 262 VAL B C   1 
ATOM   3117 O  O   . VAL B 1 123 ? -10.041 17.243  -13.745 1.00 22.53 ? 262 VAL B O   1 
ATOM   3118 C  CB  . VAL B 1 123 ? -7.506  17.326  -11.658 1.00 22.37 ? 262 VAL B CB  1 
ATOM   3119 C  CG1 . VAL B 1 123 ? -7.207  16.369  -12.791 1.00 24.24 ? 262 VAL B CG1 1 
ATOM   3120 C  CG2 . VAL B 1 123 ? -6.306  18.222  -11.389 1.00 21.35 ? 262 VAL B CG2 1 
ATOM   3121 N  N   . ASP B 1 124 ? -10.613 16.614  -11.670 1.00 21.33 ? 263 ASP B N   1 
ATOM   3122 C  CA  . ASP B 1 124 ? -11.580 15.650  -12.204 1.00 23.09 ? 263 ASP B CA  1 
ATOM   3123 C  C   . ASP B 1 124 ? -12.733 16.348  -12.933 1.00 23.74 ? 263 ASP B C   1 
ATOM   3124 O  O   . ASP B 1 124 ? -13.428 15.740  -13.751 1.00 27.65 ? 263 ASP B O   1 
ATOM   3125 C  CB  . ASP B 1 124 ? -12.113 14.712  -11.109 1.00 29.41 ? 263 ASP B CB  1 
ATOM   3126 C  CG  . ASP B 1 124 ? -12.758 15.442  -9.947  1.00 41.49 ? 263 ASP B CG  1 
ATOM   3127 O  OD1 . ASP B 1 124 ? -13.040 16.653  -10.048 1.00 43.76 ? 263 ASP B OD1 1 
ATOM   3128 O  OD2 . ASP B 1 124 ? -12.986 14.780  -8.915  1.00 44.92 ? 263 ASP B OD2 1 
ATOM   3129 N  N   . GLU B 1 125 ? -12.926 17.629  -12.644 1.00 20.43 ? 264 GLU B N   1 
ATOM   3130 C  CA  . GLU B 1 125 ? -13.899 18.436  -13.366 1.00 22.07 ? 264 GLU B CA  1 
ATOM   3131 C  C   . GLU B 1 125 ? -13.359 18.894  -14.722 1.00 24.44 ? 264 GLU B C   1 
ATOM   3132 O  O   . GLU B 1 125 ? -14.115 19.087  -15.668 1.00 26.84 ? 264 GLU B O   1 
ATOM   3133 C  CB  . GLU B 1 125 ? -14.296 19.657  -12.535 1.00 29.70 ? 264 GLU B CB  1 
ATOM   3134 C  CG  . GLU B 1 125 ? -15.013 19.325  -11.245 1.00 37.28 ? 264 GLU B CG  1 
ATOM   3135 C  CD  . GLU B 1 125 ? -15.240 20.550  -10.380 1.00 44.63 ? 264 GLU B CD  1 
ATOM   3136 O  OE1 . GLU B 1 125 ? -14.475 21.530  -10.517 1.00 42.12 ? 264 GLU B OE1 1 
ATOM   3137 O  OE2 . GLU B 1 125 ? -16.185 20.528  -9.565  1.00 48.06 ? 264 GLU B OE2 1 
ATOM   3138 N  N   . ALA B 1 126 ? -12.047 19.084  -14.799 1.00 21.80 ? 265 ALA B N   1 
ATOM   3139 C  CA  . ALA B 1 126 ? -11.413 19.612  -16.010 1.00 20.51 ? 265 ALA B CA  1 
ATOM   3140 C  C   . ALA B 1 126 ? -11.074 18.497  -17.000 1.00 20.35 ? 265 ALA B C   1 
ATOM   3141 O  O   . ALA B 1 126 ? -10.922 18.735  -18.203 1.00 19.78 ? 265 ALA B O   1 
ATOM   3142 C  CB  . ALA B 1 126 ? -10.161 20.385  -15.645 1.00 17.44 ? 265 ALA B CB  1 
ATOM   3143 N  N   . LEU B 1 127 ? -10.952 17.282  -16.485 1.00 19.44 ? 266 LEU B N   1 
ATOM   3144 C  CA  . LEU B 1 127 ? -10.557 16.136  -17.302 1.00 18.16 ? 266 LEU B CA  1 
ATOM   3145 C  C   . LEU B 1 127 ? -11.463 15.959  -18.513 1.00 19.29 ? 266 LEU B C   1 
ATOM   3146 O  O   . LEU B 1 127 ? -12.689 15.868  -18.378 1.00 21.94 ? 266 LEU B O   1 
ATOM   3147 C  CB  . LEU B 1 127 ? -10.577 14.869  -16.453 1.00 18.51 ? 266 LEU B CB  1 
ATOM   3148 C  CG  . LEU B 1 127 ? -9.581  13.747  -16.713 1.00 30.15 ? 266 LEU B CG  1 
ATOM   3149 C  CD1 . LEU B 1 127 ? -8.135  14.237  -16.593 1.00 21.74 ? 266 LEU B CD1 1 
ATOM   3150 C  CD2 . LEU B 1 127 ? -9.856  12.633  -15.718 1.00 34.31 ? 266 LEU B CD2 1 
ATOM   3151 N  N   . GLY B 1 128 ? -10.860 15.920  -19.701 1.00 17.09 ? 267 GLY B N   1 
ATOM   3152 C  CA  . GLY B 1 128 ? -11.610 15.687  -20.923 1.00 17.09 ? 267 GLY B CA  1 
ATOM   3153 C  C   . GLY B 1 128 ? -12.313 16.899  -21.513 1.00 18.45 ? 267 GLY B C   1 
ATOM   3154 O  O   . GLY B 1 128 ? -12.891 16.809  -22.595 1.00 24.16 ? 267 GLY B O   1 
ATOM   3155 N  N   . ARG B 1 129 ? -12.299 18.017  -20.796 1.00 19.24 ? 268 ARG B N   1 
ATOM   3156 C  CA  . ARG B 1 129 ? -12.906 19.259  -21.274 1.00 21.25 ? 268 ARG B CA  1 
ATOM   3157 C  C   . ARG B 1 129 ? -11.923 20.082  -22.097 1.00 23.18 ? 268 ARG B C   1 
ATOM   3158 O  O   . ARG B 1 129 ? -10.750 20.163  -21.754 1.00 19.46 ? 268 ARG B O   1 
ATOM   3159 C  CB  . ARG B 1 129 ? -13.404 20.100  -20.096 1.00 27.13 ? 268 ARG B CB  1 
ATOM   3160 C  CG  . ARG B 1 129 ? -14.320 19.363  -19.136 1.00 35.23 ? 268 ARG B CG  1 
ATOM   3161 C  CD  . ARG B 1 129 ? -15.636 19.031  -19.797 1.00 45.85 ? 268 ARG B CD  1 
ATOM   3162 N  NE  . ARG B 1 129 ? -16.597 18.491  -18.843 1.00 57.02 ? 268 ARG B NE  1 
ATOM   3163 C  CZ  . ARG B 1 129 ? -17.745 17.921  -19.190 1.00 64.01 ? 268 ARG B CZ  1 
ATOM   3164 N  NH1 . ARG B 1 129 ? -18.070 17.810  -20.473 1.00 63.77 ? 268 ARG B NH1 1 
ATOM   3165 N  NH2 . ARG B 1 129 ? -18.565 17.454  -18.256 1.00 67.99 ? 268 ARG B NH2 1 
ATOM   3166 N  N   . PRO B 1 130 ? -12.396 20.713  -23.184 1.00 25.35 ? 269 PRO B N   1 
ATOM   3167 C  CA  . PRO B 1 130 ? -11.473 21.531  -23.980 1.00 22.34 ? 269 PRO B CA  1 
ATOM   3168 C  C   . PRO B 1 130 ? -10.813 22.643  -23.157 1.00 23.28 ? 269 PRO B C   1 
ATOM   3169 O  O   . PRO B 1 130 ? -11.506 23.455  -22.530 1.00 22.31 ? 269 PRO B O   1 
ATOM   3170 C  CB  . PRO B 1 130 ? -12.380 22.115  -25.069 1.00 29.03 ? 269 PRO B CB  1 
ATOM   3171 C  CG  . PRO B 1 130 ? -13.512 21.150  -25.176 1.00 36.59 ? 269 PRO B CG  1 
ATOM   3172 C  CD  . PRO B 1 130 ? -13.742 20.652  -23.778 1.00 32.88 ? 269 PRO B CD  1 
ATOM   3173 N  N   . GLY B 1 131 ? -9.485  22.646  -23.107 1.00 20.06 ? 270 GLY B N   1 
ATOM   3174 C  CA  . GLY B 1 131 ? -8.756  23.683  -22.404 1.00 15.62 ? 270 GLY B CA  1 
ATOM   3175 C  C   . GLY B 1 131 ? -8.701  23.543  -20.892 1.00 17.98 ? 270 GLY B C   1 
ATOM   3176 O  O   . GLY B 1 131 ? -8.163  24.418  -20.207 1.00 18.96 ? 270 GLY B O   1 
ATOM   3177 N  N   . GLY B 1 132 ? -9.260  22.455  -20.368 1.00 18.52 ? 271 GLY B N   1 
ATOM   3178 C  CA  . GLY B 1 132 ? -9.311  22.250  -18.923 1.00 17.59 ? 271 GLY B CA  1 
ATOM   3179 C  C   . GLY B 1 132 ? -7.956  22.071  -18.258 1.00 20.16 ? 271 GLY B C   1 
ATOM   3180 O  O   . GLY B 1 132 ? -7.749  22.483  -17.120 1.00 17.68 ? 271 GLY B O   1 
ATOM   3181 N  N   . LEU B 1 133 ? -7.036  21.430  -18.974 1.00 13.97 ? 272 LEU B N   1 
ATOM   3182 C  CA  . LEU B 1 133 ? -5.671  21.217  -18.513 1.00 13.04 ? 272 LEU B CA  1 
ATOM   3183 C  C   . LEU B 1 133 ? -4.685  21.725  -19.565 1.00 12.88 ? 272 LEU B C   1 
ATOM   3184 O  O   . LEU B 1 133 ? -5.019  21.794  -20.756 1.00 14.64 ? 272 LEU B O   1 
ATOM   3185 C  CB  . LEU B 1 133 ? -5.411  19.735  -18.244 1.00 15.22 ? 272 LEU B CB  1 
ATOM   3186 C  CG  . LEU B 1 133 ? -6.314  19.031  -17.229 1.00 13.79 ? 272 LEU B CG  1 
ATOM   3187 C  CD1 . LEU B 1 133 ? -6.028  17.542  -17.237 1.00 17.26 ? 272 LEU B CD1 1 
ATOM   3188 C  CD2 . LEU B 1 133 ? -6.108  19.624  -15.845 1.00 17.08 ? 272 LEU B CD2 1 
ATOM   3189 N  N   . ALA B 1 134 ? -3.495  22.105  -19.121 1.00 15.08 ? 273 ALA B N   1 
ATOM   3190 C  CA  . ALA B 1 134 ? -2.450  22.544  -20.033 1.00 12.45 ? 273 ALA B CA  1 
ATOM   3191 C  C   . ALA B 1 134 ? -1.106  21.990  -19.597 1.00 14.72 ? 273 ALA B C   1 
ATOM   3192 O  O   . ALA B 1 134 ? -0.786  21.968  -18.412 1.00 16.12 ? 273 ALA B O   1 
ATOM   3193 C  CB  . ALA B 1 134 ? -2.392  24.057  -20.102 1.00 15.30 ? 273 ALA B CB  1 
ATOM   3194 N  N   . VAL B 1 135 ? -0.304  21.560  -20.563 1.00 13.13 ? 274 VAL B N   1 
ATOM   3195 C  CA  . VAL B 1 135 ? 1.037   21.097  -20.243 1.00 13.76 ? 274 VAL B CA  1 
ATOM   3196 C  C   . VAL B 1 135 ? 2.064   21.963  -20.963 1.00 12.31 ? 274 VAL B C   1 
ATOM   3197 O  O   . VAL B 1 135 ? 1.909   22.294  -22.152 1.00 12.19 ? 274 VAL B O   1 
ATOM   3198 C  CB  . VAL B 1 135 ? 1.251   19.613  -20.624 1.00 12.45 ? 274 VAL B CB  1 
ATOM   3199 C  CG1 . VAL B 1 135 ? 2.625   19.134  -20.150 1.00 14.99 ? 274 VAL B CG1 1 
ATOM   3200 C  CG2 . VAL B 1 135 ? 0.152   18.734  -20.012 1.00 11.17 ? 274 VAL B CG2 1 
ATOM   3201 N  N   . LEU B 1 136 ? 3.082   22.367  -20.212 1.00 12.63 ? 275 LEU B N   1 
ATOM   3202 C  CA  . LEU B 1 136 ? 4.257   23.040  -20.752 1.00 13.12 ? 275 LEU B CA  1 
ATOM   3203 C  C   . LEU B 1 136 ? 5.358   22.008  -20.911 1.00 14.64 ? 275 LEU B C   1 
ATOM   3204 O  O   . LEU B 1 136 ? 5.669   21.317  -19.956 1.00 13.78 ? 275 LEU B O   1 
ATOM   3205 C  CB  . LEU B 1 136 ? 4.680   24.173  -19.816 1.00 16.66 ? 275 LEU B CB  1 
ATOM   3206 C  CG  . LEU B 1 136 ? 5.670   25.234  -20.247 1.00 22.68 ? 275 LEU B CG  1 
ATOM   3207 C  CD1 . LEU B 1 136 ? 5.240   25.856  -21.578 1.00 23.69 ? 275 LEU B CD1 1 
ATOM   3208 C  CD2 . LEU B 1 136 ? 5.736   26.288  -19.140 1.00 19.99 ? 275 LEU B CD2 1 
ATOM   3209 N  N   . ALA B 1 137 ? 5.940   21.897  -22.107 1.00 10.17 ? 276 ALA B N   1 
ATOM   3210 C  CA  . ALA B 1 137 ? 6.930   20.856  -22.404 1.00 10.56 ? 276 ALA B CA  1 
ATOM   3211 C  C   . ALA B 1 137 ? 8.195   21.445  -23.002 1.00 11.21 ? 276 ALA B C   1 
ATOM   3212 O  O   . ALA B 1 137 ? 8.138   22.357  -23.838 1.00 13.37 ? 276 ALA B O   1 
ATOM   3213 C  CB  . ALA B 1 137 ? 6.338   19.815  -23.370 1.00 11.25 ? 276 ALA B CB  1 
ATOM   3214 N  N   . ALA B 1 138 ? 9.335   20.928  -22.566 1.00 12.13 ? 277 ALA B N   1 
ATOM   3215 C  CA  . ALA B 1 138 ? 10.612  21.287  -23.158 1.00 11.18 ? 277 ALA B CA  1 
ATOM   3216 C  C   . ALA B 1 138 ? 11.484  20.060  -23.342 1.00 12.54 ? 277 ALA B C   1 
ATOM   3217 O  O   . ALA B 1 138 ? 11.461  19.139  -22.521 1.00 13.25 ? 277 ALA B O   1 
ATOM   3218 C  CB  . ALA B 1 138 ? 11.335  22.323  -22.300 1.00 14.04 ? 277 ALA B CB  1 
ATOM   3219 N  N   . PHE B 1 139 ? 12.267  20.059  -24.417 1.00 12.13 ? 278 PHE B N   1 
ATOM   3220 C  CA  . PHE B 1 139 ? 13.241  19.002  -24.654 1.00 11.63 ? 278 PHE B CA  1 
ATOM   3221 C  C   . PHE B 1 139 ? 14.493  19.217  -23.826 1.00 12.74 ? 278 PHE B C   1 
ATOM   3222 O  O   . PHE B 1 139 ? 14.922  20.356  -23.630 1.00 14.72 ? 278 PHE B O   1 
ATOM   3223 C  CB  . PHE B 1 139 ? 13.641  18.930  -26.129 1.00 12.35 ? 278 PHE B CB  1 
ATOM   3224 C  CG  . PHE B 1 139 ? 12.510  18.589  -27.057 1.00 11.79 ? 278 PHE B CG  1 
ATOM   3225 C  CD1 . PHE B 1 139 ? 12.114  19.477  -28.043 1.00 12.09 ? 278 PHE B CD1 1 
ATOM   3226 C  CD2 . PHE B 1 139 ? 11.843  17.380  -26.938 1.00 12.63 ? 278 PHE B CD2 1 
ATOM   3227 C  CE1 . PHE B 1 139 ? 11.060  19.164  -28.903 1.00 12.35 ? 278 PHE B CE1 1 
ATOM   3228 C  CE2 . PHE B 1 139 ? 10.795  17.053  -27.797 1.00 10.67 ? 278 PHE B CE2 1 
ATOM   3229 C  CZ  . PHE B 1 139 ? 10.403  17.951  -28.786 1.00 11.32 ? 278 PHE B CZ  1 
ATOM   3230 N  N   . LEU B 1 140 ? 15.069  18.117  -23.350 1.00 11.58 ? 279 LEU B N   1 
ATOM   3231 C  CA  . LEU B 1 140 ? 16.379  18.134  -22.694 1.00 11.34 ? 279 LEU B CA  1 
ATOM   3232 C  C   . LEU B 1 140 ? 17.403  17.505  -23.637 1.00 16.73 ? 279 LEU B C   1 
ATOM   3233 O  O   . LEU B 1 140 ? 17.160  16.427  -24.188 1.00 15.60 ? 279 LEU B O   1 
ATOM   3234 C  CB  . LEU B 1 140 ? 16.351  17.370  -21.359 1.00 14.61 ? 279 LEU B CB  1 
ATOM   3235 C  CG  . LEU B 1 140 ? 15.169  17.370  -20.382 1.00 27.97 ? 279 LEU B CG  1 
ATOM   3236 C  CD1 . LEU B 1 140 ? 15.627  16.929  -18.990 1.00 16.80 ? 279 LEU B CD1 1 
ATOM   3237 C  CD2 . LEU B 1 140 ? 14.408  18.675  -20.306 1.00 23.80 ? 279 LEU B CD2 1 
ATOM   3238 N  N   . GLU B 1 141 ? 18.521  18.198  -23.858 1.00 17.83 ? 280 GLU B N   1 
ATOM   3239 C  CA  . GLU B 1 141 ? 19.608  17.716  -24.714 1.00 18.50 ? 280 GLU B CA  1 
ATOM   3240 C  C   . GLU B 1 141 ? 20.921  17.652  -23.932 1.00 17.76 ? 280 GLU B C   1 
ATOM   3241 O  O   . GLU B 1 141 ? 21.015  18.243  -22.868 1.00 18.17 ? 280 GLU B O   1 
ATOM   3242 C  CB  . GLU B 1 141 ? 19.806  18.639  -25.916 1.00 20.61 ? 280 GLU B CB  1 
ATOM   3243 C  CG  . GLU B 1 141 ? 18.702  18.651  -26.932 1.00 26.22 ? 280 GLU B CG  1 
ATOM   3244 C  CD  . GLU B 1 141 ? 19.094  19.468  -28.147 1.00 25.93 ? 280 GLU B CD  1 
ATOM   3245 O  OE1 . GLU B 1 141 ? 19.321  20.687  -27.991 1.00 24.28 ? 280 GLU B OE1 1 
ATOM   3246 O  OE2 . GLU B 1 141 ? 19.192  18.883  -29.243 1.00 35.01 ? 280 GLU B OE2 1 
ATOM   3247 N  N   . GLU B 1 142 ? 21.930  16.971  -24.472 1.00 17.84 ? 281 GLU B N   1 
ATOM   3248 C  CA  . GLU B 1 142 ? 23.264  16.984  -23.867 1.00 19.39 ? 281 GLU B CA  1 
ATOM   3249 C  C   . GLU B 1 142 ? 23.999  18.283  -24.177 1.00 19.26 ? 281 GLU B C   1 
ATOM   3250 O  O   . GLU B 1 142 ? 23.965  18.766  -25.313 1.00 20.66 ? 281 GLU B O   1 
ATOM   3251 C  CB  . GLU B 1 142 ? 24.117  15.808  -24.350 1.00 17.83 ? 281 GLU B CB  1 
ATOM   3252 C  CG  . GLU B 1 142 ? 25.479  15.752  -23.631 1.00 21.62 ? 281 GLU B CG  1 
ATOM   3253 C  CD  . GLU B 1 142 ? 26.463  14.786  -24.259 1.00 29.70 ? 281 GLU B CD  1 
ATOM   3254 O  OE1 . GLU B 1 142 ? 27.676  14.911  -23.978 1.00 31.29 ? 281 GLU B OE1 1 
ATOM   3255 O  OE2 . GLU B 1 142 ? 26.040  13.901  -25.027 1.00 34.73 ? 281 GLU B OE2 1 
ATOM   3256 N  N   . GLY B 1 143 ? 24.651  18.837  -23.160 1.00 17.90 ? 282 GLY B N   1 
ATOM   3257 C  CA  . GLY B 1 143 ? 25.548  19.971  -23.326 1.00 22.28 ? 282 GLY B CA  1 
ATOM   3258 C  C   . GLY B 1 143 ? 26.816  19.700  -22.537 1.00 21.98 ? 282 GLY B C   1 
ATOM   3259 O  O   . GLY B 1 143 ? 26.878  18.739  -21.774 1.00 21.86 ? 282 GLY B O   1 
ATOM   3260 N  N   . PRO B 1 144 ? 27.831  20.557  -22.698 1.00 22.88 ? 283 PRO B N   1 
ATOM   3261 C  CA  . PRO B 1 144 ? 29.129  20.370  -22.037 1.00 26.78 ? 283 PRO B CA  1 
ATOM   3262 C  C   . PRO B 1 144 ? 29.137  20.650  -20.532 1.00 29.35 ? 283 PRO B C   1 
ATOM   3263 O  O   . PRO B 1 144 ? 29.987  20.113  -19.826 1.00 33.85 ? 283 PRO B O   1 
ATOM   3264 C  CB  . PRO B 1 144 ? 30.024  21.380  -22.755 1.00 28.46 ? 283 PRO B CB  1 
ATOM   3265 C  CG  . PRO B 1 144 ? 29.081  22.460  -23.188 1.00 27.94 ? 283 PRO B CG  1 
ATOM   3266 C  CD  . PRO B 1 144 ? 27.813  21.746  -23.568 1.00 24.79 ? 283 PRO B CD  1 
ATOM   3267 N  N   . GLU B 1 145 ? 28.215  21.475  -20.051 1.00 25.18 ? 284 GLU B N   1 
ATOM   3268 C  CA  . GLU B 1 145 ? 28.231  21.908  -18.660 1.00 25.65 ? 284 GLU B CA  1 
ATOM   3269 C  C   . GLU B 1 145 ? 27.184  21.202  -17.810 1.00 30.05 ? 284 GLU B C   1 
ATOM   3270 O  O   . GLU B 1 145 ? 26.131  20.803  -18.308 1.00 29.21 ? 284 GLU B O   1 
ATOM   3271 C  CB  A GLU B 1 145 ? 28.020  23.421  -18.574 0.30 33.86 ? 284 GLU B CB  1 
ATOM   3272 C  CB  B GLU B 1 145 ? 28.023  23.421  -18.575 0.70 32.66 ? 284 GLU B CB  1 
ATOM   3273 C  CG  A GLU B 1 145 ? 29.234  24.243  -18.972 0.30 40.55 ? 284 GLU B CG  1 
ATOM   3274 C  CG  B GLU B 1 145 ? 28.988  24.235  -19.434 0.70 37.69 ? 284 GLU B CG  1 
ATOM   3275 C  CD  A GLU B 1 145 ? 30.375  24.108  -17.982 0.30 46.89 ? 284 GLU B CD  1 
ATOM   3276 C  CD  B GLU B 1 145 ? 30.437  24.068  -19.019 0.70 44.96 ? 284 GLU B CD  1 
ATOM   3277 O  OE1 A GLU B 1 145 ? 31.360  23.407  -18.300 0.30 46.94 ? 284 GLU B OE1 1 
ATOM   3278 O  OE1 B GLU B 1 145 ? 30.740  24.277  -17.826 0.70 47.94 ? 284 GLU B OE1 1 
ATOM   3279 O  OE2 A GLU B 1 145 ? 30.283  24.701  -16.885 0.30 48.39 ? 284 GLU B OE2 1 
ATOM   3280 O  OE2 B GLU B 1 145 ? 31.276  23.735  -19.885 0.70 45.54 ? 284 GLU B OE2 1 
ATOM   3281 N  N   . GLU B 1 146 ? 27.485  21.044  -16.526 1.00 29.54 ? 285 GLU B N   1 
ATOM   3282 C  CA  . GLU B 1 146 ? 26.504  20.542  -15.573 1.00 28.29 ? 285 GLU B CA  1 
ATOM   3283 C  C   . GLU B 1 146 ? 25.422  21.595  -15.345 1.00 28.30 ? 285 GLU B C   1 
ATOM   3284 O  O   . GLU B 1 146 ? 25.728  22.768  -15.134 1.00 26.81 ? 285 GLU B O   1 
ATOM   3285 C  CB  . GLU B 1 146 ? 27.175  20.164  -14.249 1.00 33.98 ? 285 GLU B CB  1 
ATOM   3286 C  CG  . GLU B 1 146 ? 26.197  19.767  -13.155 1.00 45.99 ? 285 GLU B CG  1 
ATOM   3287 C  CD  . GLU B 1 146 ? 26.868  19.024  -12.012 1.00 51.40 ? 285 GLU B CD  1 
ATOM   3288 O  OE1 . GLU B 1 146 ? 26.847  19.536  -10.872 1.00 40.73 ? 285 GLU B OE1 1 
ATOM   3289 O  OE2 . GLU B 1 146 ? 27.406  17.922  -12.254 1.00 56.70 ? 285 GLU B OE2 1 
ATOM   3290 N  N   . ASN B 1 147 ? 24.159  21.176  -15.413 1.00 22.86 ? 286 ASN B N   1 
ATOM   3291 C  CA  . ASN B 1 147 ? 23.018  22.071  -15.178 1.00 20.32 ? 286 ASN B CA  1 
ATOM   3292 C  C   . ASN B 1 147 ? 22.703  22.172  -13.692 1.00 22.55 ? 286 ASN B C   1 
ATOM   3293 O  O   . ASN B 1 147 ? 22.220  21.217  -13.085 1.00 20.84 ? 286 ASN B O   1 
ATOM   3294 C  CB  . ASN B 1 147 ? 21.785  21.581  -15.962 1.00 18.04 ? 286 ASN B CB  1 
ATOM   3295 C  CG  . ASN B 1 147 ? 20.612  22.555  -15.896 1.00 20.10 ? 286 ASN B CG  1 
ATOM   3296 O  OD1 . ASN B 1 147 ? 20.167  22.948  -14.817 1.00 21.87 ? 286 ASN B OD1 1 
ATOM   3297 N  ND2 . ASN B 1 147 ? 20.100  22.942  -17.059 1.00 19.31 ? 286 ASN B ND2 1 
ATOM   3298 N  N   . SER B 1 148 ? 22.971  23.337  -13.106 1.00 24.48 ? 287 SER B N   1 
ATOM   3299 C  CA  . SER B 1 148 ? 22.892  23.484  -11.655 1.00 34.87 ? 287 SER B CA  1 
ATOM   3300 C  C   . SER B 1 148 ? 21.468  23.336  -11.118 1.00 30.25 ? 287 SER B C   1 
ATOM   3301 O  O   . SER B 1 148 ? 21.266  22.768  -10.041 1.00 24.95 ? 287 SER B O   1 
ATOM   3302 C  CB  . SER B 1 148 ? 23.483  24.834  -11.221 1.00 40.61 ? 287 SER B CB  1 
ATOM   3303 O  OG  . SER B 1 148 ? 22.672  25.921  -11.631 1.00 45.11 ? 287 SER B OG  1 
ATOM   3304 N  N   . ALA B 1 149 ? 20.487  23.831  -11.869 1.00 29.13 ? 288 ALA B N   1 
ATOM   3305 C  CA  . ALA B 1 149 ? 19.090  23.727  -11.462 1.00 25.54 ? 288 ALA B CA  1 
ATOM   3306 C  C   . ALA B 1 149 ? 18.632  22.272  -11.422 1.00 23.71 ? 288 ALA B C   1 
ATOM   3307 O  O   . ALA B 1 149 ? 17.994  21.841  -10.462 1.00 26.14 ? 288 ALA B O   1 
ATOM   3308 C  CB  . ALA B 1 149 ? 18.199  24.532  -12.401 1.00 23.49 ? 288 ALA B CB  1 
ATOM   3309 N  N   . TYR B 1 150 ? 18.955  21.514  -12.465 1.00 18.33 ? 289 TYR B N   1 
ATOM   3310 C  CA  . TYR B 1 150 ? 18.530  20.115  -12.514 1.00 15.90 ? 289 TYR B CA  1 
ATOM   3311 C  C   . TYR B 1 150 ? 19.267  19.277  -11.479 1.00 20.27 ? 289 TYR B C   1 
ATOM   3312 O  O   . TYR B 1 150 ? 18.724  18.293  -10.970 1.00 21.00 ? 289 TYR B O   1 
ATOM   3313 C  CB  . TYR B 1 150 ? 18.728  19.538  -13.913 1.00 17.58 ? 289 TYR B CB  1 
ATOM   3314 C  CG  . TYR B 1 150 ? 17.531  19.777  -14.801 1.00 15.83 ? 289 TYR B CG  1 
ATOM   3315 C  CD1 . TYR B 1 150 ? 17.385  20.971  -15.506 1.00 17.09 ? 289 TYR B CD1 1 
ATOM   3316 C  CD2 . TYR B 1 150 ? 16.529  18.820  -14.918 1.00 17.70 ? 289 TYR B CD2 1 
ATOM   3317 C  CE1 . TYR B 1 150 ? 16.281  21.199  -16.303 1.00 16.96 ? 289 TYR B CE1 1 
ATOM   3318 C  CE2 . TYR B 1 150 ? 15.433  19.034  -15.714 1.00 19.32 ? 289 TYR B CE2 1 
ATOM   3319 C  CZ  . TYR B 1 150 ? 15.311  20.224  -16.408 1.00 17.35 ? 289 TYR B CZ  1 
ATOM   3320 O  OH  . TYR B 1 150 ? 14.210  20.432  -17.194 1.00 17.05 ? 289 TYR B OH  1 
ATOM   3321 N  N   . GLU B 1 151 ? 20.497  19.671  -11.157 1.00 20.62 ? 290 GLU B N   1 
ATOM   3322 C  CA  . GLU B 1 151 ? 21.290  18.927  -10.177 1.00 21.61 ? 290 GLU B CA  1 
ATOM   3323 C  C   . GLU B 1 151 ? 20.590  18.845  -8.821  1.00 22.87 ? 290 GLU B C   1 
ATOM   3324 O  O   . GLU B 1 151 ? 20.763  17.868  -8.085  1.00 22.36 ? 290 GLU B O   1 
ATOM   3325 C  CB  . GLU B 1 151 ? 22.678  19.559  -10.025 1.00 26.57 ? 290 GLU B CB  1 
ATOM   3326 C  CG  . GLU B 1 151 ? 23.634  18.748  -9.156  1.00 32.15 ? 290 GLU B CG  1 
ATOM   3327 C  CD  . GLU B 1 151 ? 23.903  17.356  -9.707  1.00 32.47 ? 290 GLU B CD  1 
ATOM   3328 O  OE1 . GLU B 1 151 ? 23.704  17.130  -10.924 1.00 29.64 ? 290 GLU B OE1 1 
ATOM   3329 O  OE2 . GLU B 1 151 ? 24.315  16.480  -8.914  1.00 32.41 ? 290 GLU B OE2 1 
ATOM   3330 N  N   . GLN B 1 152 ? 19.798  19.861  -8.490  1.00 20.42 ? 291 GLN B N   1 
ATOM   3331 C  CA  . GLN B 1 152 ? 19.017  19.847  -7.262  1.00 23.65 ? 291 GLN B CA  1 
ATOM   3332 C  C   . GLN B 1 152 ? 18.069  18.658  -7.182  1.00 21.27 ? 291 GLN B C   1 
ATOM   3333 O  O   . GLN B 1 152 ? 17.821  18.150  -6.100  1.00 25.24 ? 291 GLN B O   1 
ATOM   3334 C  CB  . GLN B 1 152 ? 18.204  21.131  -7.117  1.00 27.69 ? 291 GLN B CB  1 
ATOM   3335 C  CG  . GLN B 1 152 ? 19.035  22.393  -7.094  1.00 38.79 ? 291 GLN B CG  1 
ATOM   3336 C  CD  . GLN B 1 152 ? 18.194  23.615  -6.810  1.00 51.92 ? 291 GLN B CD  1 
ATOM   3337 O  OE1 . GLN B 1 152 ? 17.873  24.380  -7.714  1.00 57.55 ? 291 GLN B OE1 1 
ATOM   3338 N  NE2 . GLN B 1 152 ? 17.829  23.805  -5.549  1.00 58.85 ? 291 GLN B NE2 1 
ATOM   3339 N  N   . LEU B 1 153 ? 17.504  18.245  -8.315  1.00 19.15 ? 292 LEU B N   1 
ATOM   3340 C  CA  . LEU B 1 153 ? 16.593  17.102  -8.334  1.00 16.59 ? 292 LEU B CA  1 
ATOM   3341 C  C   . LEU B 1 153 ? 17.339  15.804  -8.614  1.00 16.73 ? 292 LEU B C   1 
ATOM   3342 O  O   . LEU B 1 153 ? 17.060  14.781  -7.991  1.00 18.47 ? 292 LEU B O   1 
ATOM   3343 C  CB  . LEU B 1 153 ? 15.481  17.297  -9.369  1.00 18.52 ? 292 LEU B CB  1 
ATOM   3344 C  CG  . LEU B 1 153 ? 14.593  18.527  -9.184  1.00 22.77 ? 292 LEU B CG  1 
ATOM   3345 C  CD1 . LEU B 1 153 ? 13.488  18.569  -10.233 1.00 26.05 ? 292 LEU B CD1 1 
ATOM   3346 C  CD2 . LEU B 1 153 ? 14.001  18.567  -7.781  1.00 27.86 ? 292 LEU B CD2 1 
ATOM   3347 N  N   . LEU B 1 154 ? 18.281  15.842  -9.553  1.00 17.31 ? 293 LEU B N   1 
ATOM   3348 C  CA  . LEU B 1 154 ? 18.986  14.637  -9.946  1.00 14.01 ? 293 LEU B CA  1 
ATOM   3349 C  C   . LEU B 1 154 ? 19.765  14.044  -8.775  1.00 19.83 ? 293 LEU B C   1 
ATOM   3350 O  O   . LEU B 1 154 ? 19.850  12.822  -8.634  1.00 20.50 ? 293 LEU B O   1 
ATOM   3351 C  CB  . LEU B 1 154 ? 19.919  14.920  -11.124 1.00 17.88 ? 293 LEU B CB  1 
ATOM   3352 C  CG  . LEU B 1 154 ? 19.188  15.280  -12.422 1.00 16.11 ? 293 LEU B CG  1 
ATOM   3353 C  CD1 . LEU B 1 154 ? 20.191  15.590  -13.518 1.00 19.21 ? 293 LEU B CD1 1 
ATOM   3354 C  CD2 . LEU B 1 154 ? 18.224  14.174  -12.868 1.00 21.57 ? 293 LEU B CD2 1 
ATOM   3355 N  N   . SER B 1 155 ? 20.303  14.912  -7.922  1.00 19.08 ? 294 SER B N   1 
ATOM   3356 C  CA  . SER B 1 155 ? 21.085  14.469  -6.768  1.00 21.36 ? 294 SER B CA  1 
ATOM   3357 C  C   . SER B 1 155 ? 20.244  13.744  -5.723  1.00 24.81 ? 294 SER B C   1 
ATOM   3358 O  O   . SER B 1 155 ? 20.798  13.112  -4.826  1.00 24.92 ? 294 SER B O   1 
ATOM   3359 C  CB  . SER B 1 155 ? 21.795  15.661  -6.118  1.00 20.40 ? 294 SER B CB  1 
ATOM   3360 O  OG  . SER B 1 155 ? 20.870  16.610  -5.614  1.00 23.02 ? 294 SER B OG  1 
ATOM   3361 N  N   . ARG B 1 156 ? 18.920  13.823  -5.838  1.00 21.30 ? 295 ARG B N   1 
ATOM   3362 C  CA  . ARG B 1 156 ? 18.034  13.181  -4.866  1.00 21.83 ? 295 ARG B CA  1 
ATOM   3363 C  C   . ARG B 1 156 ? 17.369  11.925  -5.420  1.00 21.09 ? 295 ARG B C   1 
ATOM   3364 O  O   . ARG B 1 156 ? 16.577  11.289  -4.727  1.00 22.31 ? 295 ARG B O   1 
ATOM   3365 C  CB  A ARG B 1 156 ? 16.960  14.160  -4.396  0.62 21.76 ? 295 ARG B CB  1 
ATOM   3366 C  CB  B ARG B 1 156 ? 16.956  14.158  -4.396  0.38 22.62 ? 295 ARG B CB  1 
ATOM   3367 C  CG  A ARG B 1 156 ? 17.504  15.409  -3.741  0.62 27.84 ? 295 ARG B CG  1 
ATOM   3368 C  CG  B ARG B 1 156 ? 17.402  15.604  -4.361  0.38 27.89 ? 295 ARG B CG  1 
ATOM   3369 C  CD  A ARG B 1 156 ? 17.964  15.129  -2.326  0.62 34.92 ? 295 ARG B CD  1 
ATOM   3370 C  CD  B ARG B 1 156 ? 18.402  15.866  -3.257  0.38 31.85 ? 295 ARG B CD  1 
ATOM   3371 N  NE  A ARG B 1 156 ? 17.610  16.235  -1.448  0.62 40.76 ? 295 ARG B NE  1 
ATOM   3372 N  NE  B ARG B 1 156 ? 17.768  16.491  -2.102  0.38 38.24 ? 295 ARG B NE  1 
ATOM   3373 C  CZ  A ARG B 1 156 ? 16.849  16.118  -0.369  0.62 41.04 ? 295 ARG B CZ  1 
ATOM   3374 C  CZ  B ARG B 1 156 ? 17.361  15.827  -1.028  0.38 39.02 ? 295 ARG B CZ  1 
ATOM   3375 N  NH1 A ARG B 1 156 ? 16.369  14.935  -0.013  0.62 36.39 ? 295 ARG B NH1 1 
ATOM   3376 N  NH1 B ARG B 1 156 ? 17.534  14.520  -0.960  0.38 36.38 ? 295 ARG B NH1 1 
ATOM   3377 N  NH2 A ARG B 1 156 ? 16.576  17.188  0.360   0.62 50.23 ? 295 ARG B NH2 1 
ATOM   3378 N  NH2 B ARG B 1 156 ? 16.791  16.471  -0.022  0.38 43.57 ? 295 ARG B NH2 1 
ATOM   3379 N  N   . LEU B 1 157 ? 17.679  11.553  -6.657  1.00 17.65 ? 296 LEU B N   1 
ATOM   3380 C  CA  . LEU B 1 157 ? 17.031  10.370  -7.228  1.00 16.73 ? 296 LEU B CA  1 
ATOM   3381 C  C   . LEU B 1 157 ? 17.451  9.076   -6.525  1.00 17.58 ? 296 LEU B C   1 
ATOM   3382 O  O   . LEU B 1 157 ? 16.648  8.153   -6.383  1.00 17.48 ? 296 LEU B O   1 
ATOM   3383 C  CB  . LEU B 1 157 ? 17.319  10.252  -8.727  1.00 13.96 ? 296 LEU B CB  1 
ATOM   3384 C  CG  . LEU B 1 157 ? 16.747  11.359  -9.615  1.00 18.07 ? 296 LEU B CG  1 
ATOM   3385 C  CD1 . LEU B 1 157 ? 16.998  11.034  -11.079 1.00 16.39 ? 296 LEU B CD1 1 
ATOM   3386 C  CD2 . LEU B 1 157 ? 15.252  11.562  -9.361  1.00 16.86 ? 296 LEU B CD2 1 
ATOM   3387 N  N   . GLU B 1 158 ? 18.706  9.001   -6.091  1.00 18.07 ? 297 GLU B N   1 
ATOM   3388 C  CA  . GLU B 1 158 ? 19.206  7.787   -5.453  1.00 21.16 ? 297 GLU B CA  1 
ATOM   3389 C  C   . GLU B 1 158 ? 18.364  7.379   -4.249  1.00 20.74 ? 297 GLU B C   1 
ATOM   3390 O  O   . GLU B 1 158 ? 18.095  6.190   -4.039  1.00 20.92 ? 297 GLU B O   1 
ATOM   3391 C  CB  . GLU B 1 158 ? 20.667  7.973   -5.027  1.00 23.54 ? 297 GLU B CB  1 
ATOM   3392 C  CG  . GLU B 1 158 ? 21.262  6.773   -4.296  1.00 39.54 ? 297 GLU B CG  1 
ATOM   3393 C  CD  . GLU B 1 158 ? 21.066  5.466   -5.040  1.00 52.01 ? 297 GLU B CD  1 
ATOM   3394 O  OE1 . GLU B 1 158 ? 20.663  4.470   -4.400  1.00 58.28 ? 297 GLU B OE1 1 
ATOM   3395 O  OE2 . GLU B 1 158 ? 21.318  5.429   -6.264  1.00 55.34 ? 297 GLU B OE2 1 
ATOM   3396 N  N   . GLU B 1 159 ? 17.916  8.358   -3.475  1.00 18.68 ? 298 GLU B N   1 
ATOM   3397 C  CA  . GLU B 1 159 ? 17.182  8.024   -2.262  1.00 22.42 ? 298 GLU B CA  1 
ATOM   3398 C  C   . GLU B 1 159 ? 15.735  7.642   -2.546  1.00 19.68 ? 298 GLU B C   1 
ATOM   3399 O  O   . GLU B 1 159 ? 15.040  7.146   -1.659  1.00 21.15 ? 298 GLU B O   1 
ATOM   3400 C  CB  . GLU B 1 159 ? 17.244  9.172   -1.257  1.00 25.23 ? 298 GLU B CB  1 
ATOM   3401 C  CG  . GLU B 1 159 ? 16.547  10.430  -1.663  1.00 28.80 ? 298 GLU B CG  1 
ATOM   3402 C  CD  . GLU B 1 159 ? 17.102  11.643  -0.928  1.00 34.76 ? 298 GLU B CD  1 
ATOM   3403 O  OE1 . GLU B 1 159 ? 16.370  12.234  -0.105  1.00 33.09 ? 298 GLU B OE1 1 
ATOM   3404 O  OE2 . GLU B 1 159 ? 18.267  12.020  -1.190  1.00 33.06 ? 298 GLU B OE2 1 
ATOM   3405 N  N   . ILE B 1 160 ? 15.290  7.840   -3.785  1.00 13.99 ? 299 ILE B N   1 
ATOM   3406 C  CA  . ILE B 1 160 ? 13.966  7.351   -4.181  1.00 14.35 ? 299 ILE B CA  1 
ATOM   3407 C  C   . ILE B 1 160 ? 14.055  6.333   -5.321  1.00 14.13 ? 299 ILE B C   1 
ATOM   3408 O  O   . ILE B 1 160 ? 13.118  6.190   -6.122  1.00 12.82 ? 299 ILE B O   1 
ATOM   3409 C  CB  . ILE B 1 160 ? 13.003  8.498   -4.592  1.00 16.67 ? 299 ILE B CB  1 
ATOM   3410 C  CG1 . ILE B 1 160 ? 13.575  9.344   -5.735  1.00 15.38 ? 299 ILE B CG1 1 
ATOM   3411 C  CG2 . ILE B 1 160 ? 12.657  9.375   -3.382  1.00 17.44 ? 299 ILE B CG2 1 
ATOM   3412 C  CD1 . ILE B 1 160 ? 12.584  10.363  -6.271  1.00 17.35 ? 299 ILE B CD1 1 
ATOM   3413 N  N   . ALA B 1 161 ? 15.156  5.587   -5.363  1.00 12.77 ? 300 ALA B N   1 
ATOM   3414 C  CA  . ALA B 1 161 ? 15.364  4.601   -6.415  1.00 12.74 ? 300 ALA B CA  1 
ATOM   3415 C  C   . ALA B 1 161 ? 14.259  3.539   -6.435  1.00 13.65 ? 300 ALA B C   1 
ATOM   3416 O  O   . ALA B 1 161 ? 13.849  3.103   -7.505  1.00 13.81 ? 300 ALA B O   1 
ATOM   3417 C  CB  . ALA B 1 161 ? 16.724  3.948   -6.269  1.00 15.43 ? 300 ALA B CB  1 
ATOM   3418 N  N   . GLU B 1 162 ? 13.775  3.127   -5.264  1.00 13.31 ? 301 GLU B N   1 
ATOM   3419 C  CA  . GLU B 1 162 ? 12.767  2.076   -5.208  1.00 13.69 ? 301 GLU B CA  1 
ATOM   3420 C  C   . GLU B 1 162 ? 11.411  2.604   -5.658  1.00 11.59 ? 301 GLU B C   1 
ATOM   3421 O  O   . GLU B 1 162 ? 11.032  3.737   -5.320  1.00 13.66 ? 301 GLU B O   1 
ATOM   3422 C  CB  . GLU B 1 162 ? 12.651  1.515   -3.780  1.00 19.06 ? 301 GLU B CB  1 
ATOM   3423 C  CG  . GLU B 1 162 ? 13.952  0.967   -3.214  1.00 30.09 ? 301 GLU B CG  1 
ATOM   3424 C  CD  . GLU B 1 162 ? 14.513  -0.198  -4.015  1.00 49.76 ? 301 GLU B CD  1 
ATOM   3425 O  OE1 . GLU B 1 162 ? 13.727  -0.964  -4.614  1.00 51.56 ? 301 GLU B OE1 1 
ATOM   3426 O  OE2 . GLU B 1 162 ? 15.754  -0.342  -4.048  1.00 62.43 ? 301 GLU B OE2 1 
ATOM   3427 N  N   . GLU B 1 163 ? 10.674  1.797   -6.421  1.00 10.79 ? 302 GLU B N   1 
ATOM   3428 C  CA  . GLU B 1 163 ? 9.343   2.218   -6.866  1.00 11.49 ? 302 GLU B CA  1 
ATOM   3429 C  C   . GLU B 1 163 ? 8.449   2.581   -5.684  1.00 12.26 ? 302 GLU B C   1 
ATOM   3430 O  O   . GLU B 1 163 ? 8.441   1.898   -4.649  1.00 13.13 ? 302 GLU B O   1 
ATOM   3431 C  CB  . GLU B 1 163 ? 8.680   1.126   -7.715  1.00 11.68 ? 302 GLU B CB  1 
ATOM   3432 C  CG  . GLU B 1 163 ? 7.335   1.518   -8.353  1.00 10.49 ? 302 GLU B CG  1 
ATOM   3433 C  CD  . GLU B 1 163 ? 6.147   1.413   -7.406  1.00 10.93 ? 302 GLU B CD  1 
ATOM   3434 O  OE1 . GLU B 1 163 ? 6.181   0.553   -6.490  1.00 12.48 ? 302 GLU B OE1 1 
ATOM   3435 O  OE2 . GLU B 1 163 ? 5.187   2.198   -7.571  1.00 11.66 ? 302 GLU B OE2 1 
ATOM   3436 N  N   . GLY B 1 164 ? 7.723   3.681   -5.824  1.00 10.44 ? 303 GLY B N   1 
ATOM   3437 C  CA  . GLY B 1 164 ? 6.785   4.102   -4.801  1.00 12.51 ? 303 GLY B CA  1 
ATOM   3438 C  C   . GLY B 1 164 ? 7.397   4.909   -3.673  1.00 16.12 ? 303 GLY B C   1 
ATOM   3439 O  O   . GLY B 1 164 ? 6.671   5.319   -2.766  1.00 20.67 ? 303 GLY B O   1 
ATOM   3440 N  N   . SER B 1 165 ? 8.714   5.116   -3.695  1.00 13.44 ? 304 SER B N   1 
ATOM   3441 C  CA  . SER B 1 165 ? 9.360   5.888   -2.632  1.00 14.30 ? 304 SER B CA  1 
ATOM   3442 C  C   . SER B 1 165 ? 9.294   7.380   -2.913  1.00 16.92 ? 304 SER B C   1 
ATOM   3443 O  O   . SER B 1 165 ? 9.163   7.807   -4.064  1.00 16.56 ? 304 SER B O   1 
ATOM   3444 C  CB  A SER B 1 165 ? 10.799  5.444   -2.422  0.67 14.14 ? 304 SER B CB  1 
ATOM   3445 C  CB  B SER B 1 165 ? 10.828  5.487   -2.474  0.33 14.32 ? 304 SER B CB  1 
ATOM   3446 O  OG  A SER B 1 165 ? 11.579  5.698   -3.560  0.67 18.17 ? 304 SER B OG  1 
ATOM   3447 O  OG  B SER B 1 165 ? 10.992  4.089   -2.341  0.33 12.05 ? 304 SER B OG  1 
ATOM   3448 N  N   . GLU B 1 166 ? 9.412   8.173   -1.856  1.00 15.27 ? 305 GLU B N   1 
ATOM   3449 C  CA  . GLU B 1 166 ? 9.380   9.623   -1.993  1.00 15.89 ? 305 GLU B CA  1 
ATOM   3450 C  C   . GLU B 1 166 ? 10.328  10.280  -1.010  1.00 17.43 ? 305 GLU B C   1 
ATOM   3451 O  O   . GLU B 1 166 ? 10.767  9.656   -0.035  1.00 16.66 ? 305 GLU B O   1 
ATOM   3452 C  CB  . GLU B 1 166 ? 7.966   10.146  -1.781  1.00 18.69 ? 305 GLU B CB  1 
ATOM   3453 C  CG  . GLU B 1 166 ? 7.415   9.877   -0.403  1.00 21.82 ? 305 GLU B CG  1 
ATOM   3454 C  CD  . GLU B 1 166 ? 5.966   10.296  -0.293  1.00 29.36 ? 305 GLU B CD  1 
ATOM   3455 O  OE1 . GLU B 1 166 ? 5.100   9.587   -0.840  1.00 33.90 ? 305 GLU B OE1 1 
ATOM   3456 O  OE2 . GLU B 1 166 ? 5.698   11.353  0.313   1.00 36.30 ? 305 GLU B OE2 1 
ATOM   3457 N  N   . THR B 1 167 ? 10.645  11.544  -1.270  1.00 15.10 ? 306 THR B N   1 
ATOM   3458 C  CA  . THR B 1 167 ? 11.482  12.316  -0.357  1.00 17.52 ? 306 THR B CA  1 
ATOM   3459 C  C   . THR B 1 167 ? 11.072  13.782  -0.464  1.00 23.60 ? 306 THR B C   1 
ATOM   3460 O  O   . THR B 1 167 ? 10.360  14.152  -1.388  1.00 24.11 ? 306 THR B O   1 
ATOM   3461 C  CB  . THR B 1 167 ? 12.992  12.150  -0.669  1.00 18.50 ? 306 THR B CB  1 
ATOM   3462 O  OG1 . THR B 1 167 ? 13.772  12.677  0.414   1.00 24.67 ? 306 THR B OG1 1 
ATOM   3463 C  CG2 . THR B 1 167 ? 13.369  12.874  -1.962  1.00 21.49 ? 306 THR B CG2 1 
ATOM   3464 N  N   . GLN B 1 168 ? 11.490  14.607  0.490   1.00 21.49 ? 307 GLN B N   1 
ATOM   3465 C  CA  . GLN B 1 168 ? 11.174  16.040  0.475   1.00 22.07 ? 307 GLN B CA  1 
ATOM   3466 C  C   . GLN B 1 168 ? 12.411  16.825  0.075   1.00 24.61 ? 307 GLN B C   1 
ATOM   3467 O  O   . GLN B 1 168 ? 13.502  16.562  0.578   1.00 24.70 ? 307 GLN B O   1 
ATOM   3468 C  CB  . GLN B 1 168 ? 10.674  16.502  1.851   1.00 21.67 ? 307 GLN B CB  1 
ATOM   3469 C  CG  . GLN B 1 168 ? 9.396   15.830  2.324   1.00 22.61 ? 307 GLN B CG  1 
ATOM   3470 C  CD  . GLN B 1 168 ? 8.136   16.426  1.705   1.00 34.69 ? 307 GLN B CD  1 
ATOM   3471 O  OE1 . GLN B 1 168 ? 7.963   17.643  1.681   1.00 41.73 ? 307 GLN B OE1 1 
ATOM   3472 N  NE2 . GLN B 1 168 ? 7.248   15.566  1.213   1.00 29.21 ? 307 GLN B NE2 1 
ATOM   3473 N  N   . VAL B 1 169 ? 12.254  17.790  -0.829  1.00 23.32 ? 308 VAL B N   1 
ATOM   3474 C  CA  . VAL B 1 169 ? 13.402  18.550  -1.305  1.00 21.75 ? 308 VAL B CA  1 
ATOM   3475 C  C   . VAL B 1 169 ? 13.152  20.046  -1.095  1.00 22.80 ? 308 VAL B C   1 
ATOM   3476 O  O   . VAL B 1 169 ? 11.999  20.483  -1.067  1.00 22.64 ? 308 VAL B O   1 
ATOM   3477 C  CB  . VAL B 1 169 ? 13.697  18.268  -2.800  1.00 24.28 ? 308 VAL B CB  1 
ATOM   3478 C  CG1 . VAL B 1 169 ? 13.929  16.774  -3.022  1.00 21.27 ? 308 VAL B CG1 1 
ATOM   3479 C  CG2 . VAL B 1 169 ? 12.561  18.793  -3.689  1.00 21.99 ? 308 VAL B CG2 1 
ATOM   3480 N  N   . PRO B 1 170 ? 14.233  20.828  -0.929  1.00 25.80 ? 309 PRO B N   1 
ATOM   3481 C  CA  . PRO B 1 170 ? 14.096  22.281  -0.762  1.00 30.57 ? 309 PRO B CA  1 
ATOM   3482 C  C   . PRO B 1 170 ? 13.410  22.933  -1.956  1.00 35.30 ? 309 PRO B C   1 
ATOM   3483 O  O   . PRO B 1 170 ? 13.596  22.475  -3.087  1.00 29.12 ? 309 PRO B O   1 
ATOM   3484 C  CB  . PRO B 1 170 ? 15.546  22.765  -0.645  1.00 31.28 ? 309 PRO B CB  1 
ATOM   3485 C  CG  . PRO B 1 170 ? 16.314  21.575  -0.191  1.00 33.66 ? 309 PRO B CG  1 
ATOM   3486 C  CD  . PRO B 1 170 ? 15.638  20.392  -0.829  1.00 25.09 ? 309 PRO B CD  1 
ATOM   3487 N  N   . GLY B 1 171 ? 12.638  23.987  -1.702  1.00 32.33 ? 310 GLY B N   1 
ATOM   3488 C  CA  . GLY B 1 171 ? 12.071  24.792  -2.769  1.00 33.80 ? 310 GLY B CA  1 
ATOM   3489 C  C   . GLY B 1 171 ? 13.168  25.295  -3.682  1.00 31.62 ? 310 GLY B C   1 
ATOM   3490 O  O   . GLY B 1 171 ? 14.310  25.457  -3.265  1.00 28.20 ? 310 GLY B O   1 
ATOM   3491 N  N   . LEU B 1 172 ? 12.825  25.523  -4.944  1.00 27.82 ? 311 LEU B N   1 
ATOM   3492 C  CA  . LEU B 1 172 ? 13.805  25.960  -5.924  1.00 25.05 ? 311 LEU B CA  1 
ATOM   3493 C  C   . LEU B 1 172 ? 13.118  26.794  -6.989  1.00 20.55 ? 311 LEU B C   1 
ATOM   3494 O  O   . LEU B 1 172 ? 11.892  26.892  -7.012  1.00 24.85 ? 311 LEU B O   1 
ATOM   3495 C  CB  . LEU B 1 172 ? 14.518  24.762  -6.558  1.00 30.51 ? 311 LEU B CB  1 
ATOM   3496 C  CG  . LEU B 1 172 ? 13.707  23.862  -7.502  1.00 26.74 ? 311 LEU B CG  1 
ATOM   3497 C  CD1 . LEU B 1 172 ? 14.646  22.992  -8.325  1.00 36.59 ? 311 LEU B CD1 1 
ATOM   3498 C  CD2 . LEU B 1 172 ? 12.698  23.002  -6.761  1.00 21.92 ? 311 LEU B CD2 1 
ATOM   3499 N  N   . ASP B 1 173 ? 13.914  27.410  -7.851  1.00 22.72 ? 312 ASP B N   1 
ATOM   3500 C  CA  . ASP B 1 173 ? 13.372  28.161  -8.972  1.00 23.35 ? 312 ASP B CA  1 
ATOM   3501 C  C   . ASP B 1 173 ? 12.927  27.186  -10.058 1.00 22.63 ? 312 ASP B C   1 
ATOM   3502 O  O   . ASP B 1 173 ? 13.747  26.679  -10.823 1.00 23.27 ? 312 ASP B O   1 
ATOM   3503 C  CB  . ASP B 1 173 ? 14.404  29.153  -9.502  1.00 26.74 ? 312 ASP B CB  1 
ATOM   3504 C  CG  . ASP B 1 173 ? 13.869  29.993  -10.643 1.00 31.74 ? 312 ASP B CG  1 
ATOM   3505 O  OD1 . ASP B 1 173 ? 12.669  29.854  -10.975 1.00 24.92 ? 312 ASP B OD1 1 
ATOM   3506 O  OD2 . ASP B 1 173 ? 14.650  30.800  -11.196 1.00 28.54 ? 312 ASP B OD2 1 
ATOM   3507 N  N   . ILE B 1 174 ? 11.625  26.934  -10.109 1.00 19.96 ? 313 ILE B N   1 
ATOM   3508 C  CA  . ILE B 1 174 ? 11.068  25.968  -11.051 1.00 18.32 ? 313 ILE B CA  1 
ATOM   3509 C  C   . ILE B 1 174 ? 11.302  26.416  -12.499 1.00 23.97 ? 313 ILE B C   1 
ATOM   3510 O  O   . ILE B 1 174 ? 11.520  25.593  -13.385 1.00 20.54 ? 313 ILE B O   1 
ATOM   3511 C  CB  . ILE B 1 174 ? 9.566   25.756  -10.798 1.00 19.15 ? 313 ILE B CB  1 
ATOM   3512 C  CG1 . ILE B 1 174 ? 9.327   25.304  -9.355  1.00 24.38 ? 313 ILE B CG1 1 
ATOM   3513 C  CG2 . ILE B 1 174 ? 8.983   24.737  -11.782 1.00 18.66 ? 313 ILE B CG2 1 
ATOM   3514 C  CD1 . ILE B 1 174 ? 10.067  24.028  -8.986  1.00 22.64 ? 313 ILE B CD1 1 
ATOM   3515 N  N   . SER B 1 175 ? 11.286  27.724  -12.738 1.00 24.93 ? 314 SER B N   1 
ATOM   3516 C  CA  . SER B 1 175 ? 11.502  28.235  -14.091 1.00 23.33 ? 314 SER B CA  1 
ATOM   3517 C  C   . SER B 1 175 ? 12.935  27.997  -14.583 1.00 25.00 ? 314 SER B C   1 
ATOM   3518 O  O   . SER B 1 175 ? 13.197  28.034  -15.789 1.00 24.55 ? 314 SER B O   1 
ATOM   3519 C  CB  . SER B 1 175 ? 11.160  29.727  -14.164 1.00 23.28 ? 314 SER B CB  1 
ATOM   3520 O  OG  . SER B 1 175 ? 12.074  30.504  -13.410 1.00 35.89 ? 314 SER B OG  1 
ATOM   3521 N  N   . ALA B 1 176 ? 13.864  27.752  -13.661 1.00 20.50 ? 315 ALA B N   1 
ATOM   3522 C  CA  . ALA B 1 176 ? 15.241  27.461  -14.043 1.00 21.59 ? 315 ALA B CA  1 
ATOM   3523 C  C   . ALA B 1 176 ? 15.373  26.056  -14.646 1.00 20.75 ? 315 ALA B C   1 
ATOM   3524 O  O   . ALA B 1 176 ? 16.427  25.700  -15.179 1.00 23.11 ? 315 ALA B O   1 
ATOM   3525 C  CB  . ALA B 1 176 ? 16.174  27.621  -12.845 1.00 24.77 ? 315 ALA B CB  1 
ATOM   3526 N  N   . LEU B 1 177 ? 14.297  25.274  -14.566 1.00 19.02 ? 316 LEU B N   1 
ATOM   3527 C  CA  . LEU B 1 177 ? 14.240  23.949  -15.187 1.00 18.17 ? 316 LEU B CA  1 
ATOM   3528 C  C   . LEU B 1 177 ? 13.736  24.042  -16.617 1.00 23.74 ? 316 LEU B C   1 
ATOM   3529 O  O   . LEU B 1 177 ? 13.710  23.046  -17.337 1.00 20.23 ? 316 LEU B O   1 
ATOM   3530 C  CB  . LEU B 1 177 ? 13.333  23.005  -14.387 1.00 17.60 ? 316 LEU B CB  1 
ATOM   3531 C  CG  . LEU B 1 177 ? 13.695  22.723  -12.923 1.00 17.56 ? 316 LEU B CG  1 
ATOM   3532 C  CD1 . LEU B 1 177 ? 12.577  21.955  -12.209 1.00 18.69 ? 316 LEU B CD1 1 
ATOM   3533 C  CD2 . LEU B 1 177 ? 15.009  21.969  -12.837 1.00 19.28 ? 316 LEU B CD2 1 
ATOM   3534 N  N   . LEU B 1 178 ? 13.332  25.248  -17.008 1.00 19.94 ? 317 LEU B N   1 
ATOM   3535 C  CA  . LEU B 1 178 ? 12.744  25.499  -18.324 1.00 17.19 ? 317 LEU B CA  1 
ATOM   3536 C  C   . LEU B 1 178 ? 13.626  26.437  -19.143 1.00 20.38 ? 317 LEU B C   1 
ATOM   3537 O  O   . LEU B 1 178 ? 14.446  27.170  -18.579 1.00 19.70 ? 317 LEU B O   1 
ATOM   3538 C  CB  . LEU B 1 178 ? 11.345  26.102  -18.164 1.00 17.13 ? 317 LEU B CB  1 
ATOM   3539 C  CG  . LEU B 1 178 ? 10.307  25.306  -17.372 1.00 17.07 ? 317 LEU B CG  1 
ATOM   3540 C  CD1 . LEU B 1 178 ? 9.019   26.094  -17.268 1.00 21.61 ? 317 LEU B CD1 1 
ATOM   3541 C  CD2 . LEU B 1 178 ? 10.049  23.946  -18.026 1.00 19.98 ? 317 LEU B CD2 1 
ATOM   3542 N  N   . PRO B 1 179 ? 13.454  26.436  -20.475 1.00 16.62 ? 318 PRO B N   1 
ATOM   3543 C  CA  . PRO B 1 179 ? 14.198  27.383  -21.309 1.00 14.95 ? 318 PRO B CA  1 
ATOM   3544 C  C   . PRO B 1 179 ? 13.845  28.824  -20.946 1.00 17.67 ? 318 PRO B C   1 
ATOM   3545 O  O   . PRO B 1 179 ? 12.784  29.055  -20.362 1.00 22.35 ? 318 PRO B O   1 
ATOM   3546 C  CB  . PRO B 1 179 ? 13.727  27.048  -22.728 1.00 17.42 ? 318 PRO B CB  1 
ATOM   3547 C  CG  . PRO B 1 179 ? 13.182  25.645  -22.627 1.00 17.85 ? 318 PRO B CG  1 
ATOM   3548 C  CD  . PRO B 1 179 ? 12.578  25.562  -21.279 1.00 15.83 ? 318 PRO B CD  1 
ATOM   3549 N  N   . SER B 1 180 ? 14.723  29.768  -21.273 1.00 19.71 ? 319 SER B N   1 
ATOM   3550 C  CA  . SER B 1 180 ? 14.487  31.172  -20.955 1.00 23.00 ? 319 SER B CA  1 
ATOM   3551 C  C   . SER B 1 180 ? 13.658  31.911  -22.016 1.00 26.84 ? 319 SER B C   1 
ATOM   3552 O  O   . SER B 1 180 ? 13.023  32.925  -21.713 1.00 27.52 ? 319 SER B O   1 
ATOM   3553 C  CB  . SER B 1 180 ? 15.821  31.889  -20.748 1.00 28.65 ? 319 SER B CB  1 
ATOM   3554 O  OG  . SER B 1 180 ? 16.691  31.651  -21.840 1.00 36.36 ? 319 SER B OG  1 
ATOM   3555 N  N   . ASP B 1 181 ? 13.661  31.404  -23.249 1.00 22.00 ? 320 ASP B N   1 
ATOM   3556 C  CA  . ASP B 1 181 ? 12.920  32.036  -24.344 1.00 22.16 ? 320 ASP B CA  1 
ATOM   3557 C  C   . ASP B 1 181 ? 11.445  31.657  -24.260 1.00 21.50 ? 320 ASP B C   1 
ATOM   3558 O  O   . ASP B 1 181 ? 11.056  30.560  -24.658 1.00 23.32 ? 320 ASP B O   1 
ATOM   3559 C  CB  . ASP B 1 181 ? 13.522  31.628  -25.694 1.00 22.05 ? 320 ASP B CB  1 
ATOM   3560 C  CG  . ASP B 1 181 ? 12.808  32.266  -26.895 1.00 28.26 ? 320 ASP B CG  1 
ATOM   3561 O  OD1 . ASP B 1 181 ? 11.844  33.038  -26.703 1.00 30.50 ? 320 ASP B OD1 1 
ATOM   3562 O  OD2 . ASP B 1 181 ? 13.236  31.996  -28.038 1.00 24.47 ? 320 ASP B OD2 1 
ATOM   3563 N  N   . PHE B 1 182 ? 10.637  32.572  -23.734 1.00 22.46 ? 321 PHE B N   1 
ATOM   3564 C  CA  . PHE B 1 182 ? 9.199   32.356  -23.585 1.00 21.12 ? 321 PHE B CA  1 
ATOM   3565 C  C   . PHE B 1 182 ? 8.409   32.806  -24.816 1.00 20.68 ? 321 PHE B C   1 
ATOM   3566 O  O   . PHE B 1 182 ? 7.176   32.752  -24.813 1.00 22.66 ? 321 PHE B O   1 
ATOM   3567 C  CB  . PHE B 1 182 ? 8.658   33.116  -22.365 1.00 21.01 ? 321 PHE B CB  1 
ATOM   3568 C  CG  . PHE B 1 182 ? 9.032   32.512  -21.033 1.00 26.13 ? 321 PHE B CG  1 
ATOM   3569 C  CD1 . PHE B 1 182 ? 8.577   33.087  -19.858 1.00 37.86 ? 321 PHE B CD1 1 
ATOM   3570 C  CD2 . PHE B 1 182 ? 9.823   31.381  -20.953 1.00 30.43 ? 321 PHE B CD2 1 
ATOM   3571 C  CE1 . PHE B 1 182 ? 8.913   32.548  -18.627 1.00 34.94 ? 321 PHE B CE1 1 
ATOM   3572 C  CE2 . PHE B 1 182 ? 10.163  30.835  -19.724 1.00 34.03 ? 321 PHE B CE2 1 
ATOM   3573 C  CZ  . PHE B 1 182 ? 9.707   31.420  -18.562 1.00 34.30 ? 321 PHE B CZ  1 
ATOM   3574 N  N   . SER B 1 183 ? 9.106   33.270  -25.850 1.00 19.83 ? 322 SER B N   1 
ATOM   3575 C  CA  . SER B 1 183 ? 8.429   33.876  -26.996 1.00 18.64 ? 322 SER B CA  1 
ATOM   3576 C  C   . SER B 1 183 ? 8.269   32.906  -28.160 1.00 18.82 ? 322 SER B C   1 
ATOM   3577 O  O   . SER B 1 183 ? 7.397   33.100  -29.010 1.00 21.28 ? 322 SER B O   1 
ATOM   3578 C  CB  . SER B 1 183 ? 9.179   35.128  -27.467 1.00 22.21 ? 322 SER B CB  1 
ATOM   3579 O  OG  . SER B 1 183 ? 10.395  34.789  -28.114 1.00 25.36 ? 322 SER B OG  1 
ATOM   3580 N  N   . ARG B 1 184 ? 9.097   31.865  -28.197 1.00 21.17 ? 323 ARG B N   1 
ATOM   3581 C  CA  . ARG B 1 184 ? 9.095   30.930  -29.322 1.00 16.64 ? 323 ARG B CA  1 
ATOM   3582 C  C   . ARG B 1 184 ? 8.662   29.534  -28.907 1.00 16.52 ? 323 ARG B C   1 
ATOM   3583 O  O   . ARG B 1 184 ? 9.409   28.828  -28.234 1.00 16.27 ? 323 ARG B O   1 
ATOM   3584 C  CB  . ARG B 1 184 ? 10.480  30.852  -29.969 1.00 14.77 ? 323 ARG B CB  1 
ATOM   3585 C  CG  . ARG B 1 184 ? 10.989  32.178  -30.511 1.00 18.41 ? 323 ARG B CG  1 
ATOM   3586 C  CD  . ARG B 1 184 ? 12.311  32.001  -31.238 1.00 19.82 ? 323 ARG B CD  1 
ATOM   3587 N  NE  . ARG B 1 184 ? 12.744  33.254  -31.858 1.00 27.29 ? 323 ARG B NE  1 
ATOM   3588 C  CZ  . ARG B 1 184 ? 13.344  34.248  -31.207 1.00 34.05 ? 323 ARG B CZ  1 
ATOM   3589 N  NH1 . ARG B 1 184 ? 13.601  34.145  -29.907 1.00 30.85 ? 323 ARG B NH1 1 
ATOM   3590 N  NH2 . ARG B 1 184 ? 13.697  35.349  -31.859 1.00 33.65 ? 323 ARG B NH2 1 
ATOM   3591 N  N   . TYR B 1 185 ? 7.462   29.139  -29.318 1.00 13.62 ? 324 TYR B N   1 
ATOM   3592 C  CA  . TYR B 1 185 ? 6.925   27.837  -28.929 1.00 12.10 ? 324 TYR B CA  1 
ATOM   3593 C  C   . TYR B 1 185 ? 5.925   27.328  -29.962 1.00 13.82 ? 324 TYR B C   1 
ATOM   3594 O  O   . TYR B 1 185 ? 5.452   28.082  -30.814 1.00 13.81 ? 324 TYR B O   1 
ATOM   3595 C  CB  . TYR B 1 185 ? 6.262   27.916  -27.541 1.00 12.55 ? 324 TYR B CB  1 
ATOM   3596 C  CG  . TYR B 1 185 ? 5.180   28.979  -27.422 1.00 12.81 ? 324 TYR B CG  1 
ATOM   3597 C  CD1 . TYR B 1 185 ? 3.877   28.725  -27.833 1.00 13.86 ? 324 TYR B CD1 1 
ATOM   3598 C  CD2 . TYR B 1 185 ? 5.468   30.240  -26.899 1.00 13.05 ? 324 TYR B CD2 1 
ATOM   3599 C  CE1 . TYR B 1 185 ? 2.888   29.693  -27.742 1.00 12.78 ? 324 TYR B CE1 1 
ATOM   3600 C  CE2 . TYR B 1 185 ? 4.488   31.217  -26.800 1.00 16.27 ? 324 TYR B CE2 1 
ATOM   3601 C  CZ  . TYR B 1 185 ? 3.198   30.939  -27.223 1.00 15.32 ? 324 TYR B CZ  1 
ATOM   3602 O  OH  . TYR B 1 185 ? 2.209   31.892  -27.117 1.00 17.17 ? 324 TYR B OH  1 
ATOM   3603 N  N   . PHE B 1 186 ? 5.603   26.045  -29.856 1.00 12.18 ? 325 PHE B N   1 
ATOM   3604 C  CA  . PHE B 1 186 ? 4.562   25.401  -30.645 1.00 10.24 ? 325 PHE B CA  1 
ATOM   3605 C  C   . PHE B 1 186 ? 3.365   25.135  -29.746 1.00 11.14 ? 325 PHE B C   1 
ATOM   3606 O  O   . PHE B 1 186 ? 3.532   24.958  -28.538 1.00 12.98 ? 325 PHE B O   1 
ATOM   3607 C  CB  . PHE B 1 186 ? 5.097   24.098  -31.247 1.00 11.81 ? 325 PHE B CB  1 
ATOM   3608 C  CG  . PHE B 1 186 ? 6.271   24.304  -32.159 1.00 10.94 ? 325 PHE B CG  1 
ATOM   3609 C  CD1 . PHE B 1 186 ? 7.566   24.200  -31.681 1.00 14.80 ? 325 PHE B CD1 1 
ATOM   3610 C  CD2 . PHE B 1 186 ? 6.072   24.672  -33.485 1.00 13.03 ? 325 PHE B CD2 1 
ATOM   3611 C  CE1 . PHE B 1 186 ? 8.647   24.425  -32.525 1.00 15.47 ? 325 PHE B CE1 1 
ATOM   3612 C  CE2 . PHE B 1 186 ? 7.140   24.888  -34.322 1.00 14.54 ? 325 PHE B CE2 1 
ATOM   3613 C  CZ  . PHE B 1 186 ? 8.427   24.760  -33.845 1.00 14.75 ? 325 PHE B CZ  1 
ATOM   3614 N  N   . GLN B 1 187 ? 2.164   25.104  -30.311 1.00 11.20 ? 326 GLN B N   1 
ATOM   3615 C  CA  . GLN B 1 187 ? 0.979   24.889  -29.488 1.00 10.26 ? 326 GLN B CA  1 
ATOM   3616 C  C   . GLN B 1 187 ? -0.072  24.109  -30.262 1.00 11.69 ? 326 GLN B C   1 
ATOM   3617 O  O   . GLN B 1 187 ? -0.325  24.392  -31.443 1.00 12.50 ? 326 GLN B O   1 
ATOM   3618 C  CB  . GLN B 1 187 ? 0.406   26.229  -29.013 1.00 12.22 ? 326 GLN B CB  1 
ATOM   3619 C  CG  . GLN B 1 187 ? -0.624  26.101  -27.895 1.00 11.87 ? 326 GLN B CG  1 
ATOM   3620 C  CD  . GLN B 1 187 ? -0.936  27.450  -27.281 1.00 12.16 ? 326 GLN B CD  1 
ATOM   3621 O  OE1 . GLN B 1 187 ? -1.822  28.164  -27.756 1.00 16.41 ? 326 GLN B OE1 1 
ATOM   3622 N  NE2 . GLN B 1 187 ? -0.179  27.824  -26.242 1.00 14.75 ? 326 GLN B NE2 1 
ATOM   3623 N  N   . TYR B 1 188 ? -0.670  23.116  -29.605 1.00 10.54 ? 327 TYR B N   1 
ATOM   3624 C  CA  . TYR B 1 188 ? -1.725  22.325  -30.230 1.00 10.93 ? 327 TYR B CA  1 
ATOM   3625 C  C   . TYR B 1 188 ? -2.621  21.717  -29.147 1.00 10.77 ? 327 TYR B C   1 
ATOM   3626 O  O   . TYR B 1 188 ? -2.299  21.802  -27.960 1.00 11.79 ? 327 TYR B O   1 
ATOM   3627 C  CB  . TYR B 1 188 ? -1.124  21.238  -31.142 1.00 9.80  ? 327 TYR B CB  1 
ATOM   3628 C  CG  . TYR B 1 188 ? -0.525  20.068  -30.387 1.00 9.69  ? 327 TYR B CG  1 
ATOM   3629 C  CD1 . TYR B 1 188 ? -1.249  18.895  -30.197 1.00 9.74  ? 327 TYR B CD1 1 
ATOM   3630 C  CD2 . TYR B 1 188 ? 0.762   20.144  -29.843 1.00 8.29  ? 327 TYR B CD2 1 
ATOM   3631 C  CE1 . TYR B 1 188 ? -0.708  17.822  -29.476 1.00 9.57  ? 327 TYR B CE1 1 
ATOM   3632 C  CE2 . TYR B 1 188 ? 1.311   19.080  -29.132 1.00 10.13 ? 327 TYR B CE2 1 
ATOM   3633 C  CZ  . TYR B 1 188 ? 0.564   17.924  -28.945 1.00 9.87  ? 327 TYR B CZ  1 
ATOM   3634 O  OH  . TYR B 1 188 ? 1.088   16.872  -28.237 1.00 9.51  ? 327 TYR B OH  1 
ATOM   3635 N  N   . GLU B 1 189 ? -3.738  21.124  -29.565 1.00 11.07 ? 328 GLU B N   1 
ATOM   3636 C  CA  . GLU B 1 189 ? -4.644  20.473  -28.625 1.00 11.08 ? 328 GLU B CA  1 
ATOM   3637 C  C   . GLU B 1 189 ? -4.493  18.957  -28.706 1.00 11.30 ? 328 GLU B C   1 
ATOM   3638 O  O   . GLU B 1 189 ? -4.536  18.381  -29.792 1.00 12.46 ? 328 GLU B O   1 
ATOM   3639 C  CB  . GLU B 1 189 ? -6.088  20.879  -28.911 1.00 16.49 ? 328 GLU B CB  1 
ATOM   3640 C  CG  . GLU B 1 189 ? -7.050  20.459  -27.814 1.00 20.87 ? 328 GLU B CG  1 
ATOM   3641 C  CD  . GLU B 1 189 ? -8.419  21.088  -27.981 1.00 35.89 ? 328 GLU B CD  1 
ATOM   3642 O  OE1 . GLU B 1 189 ? -9.421  20.444  -27.609 1.00 37.85 ? 328 GLU B OE1 1 
ATOM   3643 O  OE2 . GLU B 1 189 ? -8.492  22.226  -28.495 1.00 40.17 ? 328 GLU B OE2 1 
ATOM   3644 N  N   . GLY B 1 190 ? -4.307  18.316  -27.554 1.00 9.70  ? 329 GLY B N   1 
ATOM   3645 C  CA  . GLY B 1 190 ? -4.088  16.878  -27.528 1.00 10.89 ? 329 GLY B CA  1 
ATOM   3646 C  C   . GLY B 1 190 ? -4.597  16.267  -26.238 1.00 12.06 ? 329 GLY B C   1 
ATOM   3647 O  O   . GLY B 1 190 ? -5.681  16.617  -25.767 1.00 12.27 ? 329 GLY B O   1 
ATOM   3648 N  N   . SER B 1 191 ? -3.818  15.352  -25.675 1.00 11.45 ? 330 SER B N   1 
ATOM   3649 C  CA  . SER B 1 191 ? -4.258  14.561  -24.529 1.00 9.23  ? 330 SER B CA  1 
ATOM   3650 C  C   . SER B 1 191 ? -3.172  14.434  -23.471 1.00 10.83 ? 330 SER B C   1 
ATOM   3651 O  O   . SER B 1 191 ? -2.010  14.773  -23.703 1.00 10.78 ? 330 SER B O   1 
ATOM   3652 C  CB  . SER B 1 191 ? -4.676  13.162  -24.977 1.00 9.85  ? 330 SER B CB  1 
ATOM   3653 O  OG  . SER B 1 191 ? -3.537  12.379  -25.296 1.00 10.27 ? 330 SER B OG  1 
ATOM   3654 N  N   . LEU B 1 192 ? -3.543  13.930  -22.297 1.00 11.52 ? 331 LEU B N   1 
ATOM   3655 C  CA  . LEU B 1 192 ? -2.536  13.433  -21.359 1.00 11.78 ? 331 LEU B CA  1 
ATOM   3656 C  C   . LEU B 1 192 ? -1.822  12.268  -22.032 1.00 11.20 ? 331 LEU B C   1 
ATOM   3657 O  O   . LEU B 1 192 ? -2.459  11.532  -22.798 1.00 9.56  ? 331 LEU B O   1 
ATOM   3658 C  CB  . LEU B 1 192 ? -3.186  12.987  -20.053 1.00 11.43 ? 331 LEU B CB  1 
ATOM   3659 C  CG  . LEU B 1 192 ? -4.001  14.095  -19.377 1.00 14.62 ? 331 LEU B CG  1 
ATOM   3660 C  CD1 . LEU B 1 192 ? -4.725  13.560  -18.149 1.00 11.87 ? 331 LEU B CD1 1 
ATOM   3661 C  CD2 . LEU B 1 192 ? -3.119  15.274  -18.991 1.00 15.13 ? 331 LEU B CD2 1 
ATOM   3662 N  N   . THR B 1 193 ? -0.522  12.088  -21.770 1.00 10.53 ? 332 THR B N   1 
ATOM   3663 C  CA  . THR B 1 193 ? 0.201   11.015  -22.461 1.00 9.11  ? 332 THR B CA  1 
ATOM   3664 C  C   . THR B 1 193 ? 0.311   9.740   -21.623 1.00 9.23  ? 332 THR B C   1 
ATOM   3665 O  O   . THR B 1 193 ? 1.008   8.795   -22.008 1.00 10.20 ? 332 THR B O   1 
ATOM   3666 C  CB  . THR B 1 193 ? 1.632   11.432  -22.890 1.00 7.52  ? 332 THR B CB  1 
ATOM   3667 O  OG1 . THR B 1 193 ? 2.493   11.533  -21.747 1.00 10.10 ? 332 THR B OG1 1 
ATOM   3668 C  CG2 . THR B 1 193 ? 1.616   12.756  -23.657 1.00 10.36 ? 332 THR B CG2 1 
ATOM   3669 N  N   . THR B 1 194 ? -0.373  9.729   -20.479 1.00 9.40  ? 333 THR B N   1 
ATOM   3670 C  CA  . THR B 1 194 ? -0.534  8.521   -19.674 1.00 9.21  ? 333 THR B CA  1 
ATOM   3671 C  C   . THR B 1 194 ? -2.008  8.362   -19.329 1.00 11.47 ? 333 THR B C   1 
ATOM   3672 O  O   . THR B 1 194 ? -2.760  9.335   -19.399 1.00 12.85 ? 333 THR B O   1 
ATOM   3673 C  CB  . THR B 1 194 ? 0.291   8.582   -18.380 1.00 10.97 ? 333 THR B CB  1 
ATOM   3674 O  OG1 . THR B 1 194 ? -0.058  9.757   -17.638 1.00 11.80 ? 333 THR B OG1 1 
ATOM   3675 C  CG2 . THR B 1 194 ? 1.806   8.566   -18.692 1.00 10.29 ? 333 THR B CG2 1 
ATOM   3676 N  N   . PRO B 1 195 ? -2.427  7.140   -18.956 1.00 10.91 ? 334 PRO B N   1 
ATOM   3677 C  CA  . PRO B 1 195 ? -3.830  7.000   -18.536 1.00 11.81 ? 334 PRO B CA  1 
ATOM   3678 C  C   . PRO B 1 195 ? -4.177  8.033   -17.471 1.00 14.45 ? 334 PRO B C   1 
ATOM   3679 O  O   . PRO B 1 195 ? -3.404  8.238   -16.533 1.00 16.12 ? 334 PRO B O   1 
ATOM   3680 C  CB  . PRO B 1 195 ? -3.888  5.570   -17.989 1.00 12.58 ? 334 PRO B CB  1 
ATOM   3681 C  CG  . PRO B 1 195 ? -2.859  4.826   -18.813 1.00 13.96 ? 334 PRO B CG  1 
ATOM   3682 C  CD  . PRO B 1 195 ? -1.721  5.846   -18.983 1.00 11.89 ? 334 PRO B CD  1 
ATOM   3683 N  N   . PRO B 1 196 ? -5.353  8.668   -17.584 1.00 12.35 ? 335 PRO B N   1 
ATOM   3684 C  CA  . PRO B 1 196 ? -6.453  8.280   -18.475 1.00 14.44 ? 335 PRO B CA  1 
ATOM   3685 C  C   . PRO B 1 196 ? -6.436  8.811   -19.920 1.00 17.98 ? 335 PRO B C   1 
ATOM   3686 O  O   . PRO B 1 196 ? -7.413  8.571   -20.618 1.00 17.35 ? 335 PRO B O   1 
ATOM   3687 C  CB  . PRO B 1 196 ? -7.679  8.835   -17.739 1.00 14.81 ? 335 PRO B CB  1 
ATOM   3688 C  CG  . PRO B 1 196 ? -7.175  10.073  -17.075 1.00 17.28 ? 335 PRO B CG  1 
ATOM   3689 C  CD  . PRO B 1 196 ? -5.749  9.738   -16.651 1.00 13.02 ? 335 PRO B CD  1 
ATOM   3690 N  N   . CYS B 1 197 ? -5.367  9.477   -20.352 1.00 13.18 ? 336 CYS B N   1 
ATOM   3691 C  CA  . CYS B 1 197 ? -5.236  9.978   -21.731 1.00 9.80  ? 336 CYS B CA  1 
ATOM   3692 C  C   . CYS B 1 197 ? -6.363  10.917  -22.136 1.00 14.06 ? 336 CYS B C   1 
ATOM   3693 O  O   . CYS B 1 197 ? -6.773  10.927  -23.299 1.00 11.22 ? 336 CYS B O   1 
ATOM   3694 C  CB  . CYS B 1 197 ? -5.189  8.847   -22.757 1.00 13.47 ? 336 CYS B CB  1 
ATOM   3695 S  SG  . CYS B 1 197 ? -3.990  7.535   -22.488 1.00 13.72 ? 336 CYS B SG  1 
ATOM   3696 N  N   . ALA B 1 198 ? -6.879  11.684  -21.186 1.00 12.36 ? 337 ALA B N   1 
ATOM   3697 C  CA  . ALA B 1 198 ? -7.997  12.580  -21.468 1.00 13.26 ? 337 ALA B CA  1 
ATOM   3698 C  C   . ALA B 1 198 ? -7.623  13.644  -22.486 1.00 12.81 ? 337 ALA B C   1 
ATOM   3699 O  O   . ALA B 1 198 ? -6.521  14.202  -22.435 1.00 14.49 ? 337 ALA B O   1 
ATOM   3700 C  CB  . ALA B 1 198 ? -8.490  13.237  -20.180 1.00 14.73 ? 337 ALA B CB  1 
ATOM   3701 N  N   . GLN B 1 199 ? -8.557  13.930  -23.388 1.00 11.86 ? 338 GLN B N   1 
ATOM   3702 C  CA  . GLN B 1 199 ? -8.337  14.924  -24.432 1.00 11.63 ? 338 GLN B CA  1 
ATOM   3703 C  C   . GLN B 1 199 ? -8.738  16.344  -23.999 1.00 14.05 ? 338 GLN B C   1 
ATOM   3704 O  O   . GLN B 1 199 ? -9.154  16.571  -22.856 1.00 17.76 ? 338 GLN B O   1 
ATOM   3705 C  CB  . GLN B 1 199 ? -9.070  14.489  -25.705 1.00 11.15 ? 338 GLN B CB  1 
ATOM   3706 C  CG  . GLN B 1 199 ? -8.353  13.300  -26.346 1.00 9.91  ? 338 GLN B CG  1 
ATOM   3707 C  CD  . GLN B 1 199 ? -8.976  12.750  -27.620 1.00 11.78 ? 338 GLN B CD  1 
ATOM   3708 O  OE1 . GLN B 1 199 ? -8.371  11.892  -28.272 1.00 12.04 ? 338 GLN B OE1 1 
ATOM   3709 N  NE2 . GLN B 1 199 ? -10.180 13.217  -27.975 1.00 14.88 ? 338 GLN B NE2 1 
ATOM   3710 N  N   . GLY B 1 200 ? -8.573  17.304  -24.906 1.00 14.80 ? 339 GLY B N   1 
ATOM   3711 C  CA  . GLY B 1 200 ? -8.812  18.703  -24.588 1.00 16.51 ? 339 GLY B CA  1 
ATOM   3712 C  C   . GLY B 1 200 ? -7.639  19.407  -23.922 1.00 15.56 ? 339 GLY B C   1 
ATOM   3713 O  O   . GLY B 1 200 ? -7.761  20.553  -23.491 1.00 18.26 ? 339 GLY B O   1 
ATOM   3714 N  N   . VAL B 1 201 ? -6.489  18.737  -23.849 1.00 13.62 ? 340 VAL B N   1 
ATOM   3715 C  CA  . VAL B 1 201 ? -5.311  19.312  -23.200 1.00 11.84 ? 340 VAL B CA  1 
ATOM   3716 C  C   . VAL B 1 201 ? -4.573  20.274  -24.129 1.00 12.85 ? 340 VAL B C   1 
ATOM   3717 O  O   . VAL B 1 201 ? -4.285  19.938  -25.278 1.00 13.33 ? 340 VAL B O   1 
ATOM   3718 C  CB  . VAL B 1 201 ? -4.337  18.203  -22.754 1.00 12.47 ? 340 VAL B CB  1 
ATOM   3719 C  CG1 . VAL B 1 201 ? -3.076  18.801  -22.081 1.00 12.24 ? 340 VAL B CG1 1 
ATOM   3720 C  CG2 . VAL B 1 201 ? -5.061  17.236  -21.828 1.00 12.86 ? 340 VAL B CG2 1 
ATOM   3721 N  N   . ILE B 1 202 ? -4.273  21.468  -23.637 1.00 13.22 ? 341 ILE B N   1 
ATOM   3722 C  CA  . ILE B 1 202 ? -3.519  22.414  -24.457 1.00 13.99 ? 341 ILE B CA  1 
ATOM   3723 C  C   . ILE B 1 202 ? -2.028  22.182  -24.243 1.00 14.15 ? 341 ILE B C   1 
ATOM   3724 O  O   . ILE B 1 202 ? -1.527  22.353  -23.134 1.00 14.02 ? 341 ILE B O   1 
ATOM   3725 C  CB  . ILE B 1 202 ? -3.861  23.884  -24.129 1.00 15.23 ? 341 ILE B CB  1 
ATOM   3726 C  CG1 . ILE B 1 202 ? -5.375  24.122  -24.154 1.00 16.86 ? 341 ILE B CG1 1 
ATOM   3727 C  CG2 . ILE B 1 202 ? -3.104  24.841  -25.061 1.00 14.80 ? 341 ILE B CG2 1 
ATOM   3728 C  CD1 . ILE B 1 202 ? -6.047  23.755  -25.448 1.00 22.80 ? 341 ILE B CD1 1 
ATOM   3729 N  N   . TRP B 1 203 ? -1.326  21.795  -25.308 1.00 11.02 ? 342 TRP B N   1 
ATOM   3730 C  CA  . TRP B 1 203 ? 0.113   21.546  -25.244 1.00 10.77 ? 342 TRP B CA  1 
ATOM   3731 C  C   . TRP B 1 203 ? 0.914   22.705  -25.784 1.00 10.66 ? 342 TRP B C   1 
ATOM   3732 O  O   . TRP B 1 203 ? 0.625   23.224  -26.857 1.00 11.78 ? 342 TRP B O   1 
ATOM   3733 C  CB  . TRP B 1 203 ? 0.474   20.276  -26.027 1.00 12.10 ? 342 TRP B CB  1 
ATOM   3734 C  CG  . TRP B 1 203 ? 0.159   19.039  -25.267 1.00 9.08  ? 342 TRP B CG  1 
ATOM   3735 C  CD1 . TRP B 1 203 ? -1.035  18.375  -25.239 1.00 10.58 ? 342 TRP B CD1 1 
ATOM   3736 C  CD2 . TRP B 1 203 ? 1.038   18.327  -24.392 1.00 9.52  ? 342 TRP B CD2 1 
ATOM   3737 N  NE1 . TRP B 1 203 ? -0.949  17.289  -24.397 1.00 9.59  ? 342 TRP B NE1 1 
ATOM   3738 C  CE2 . TRP B 1 203 ? 0.315   17.231  -23.873 1.00 9.68  ? 342 TRP B CE2 1 
ATOM   3739 C  CE3 . TRP B 1 203 ? 2.373   18.498  -24.011 1.00 9.54  ? 342 TRP B CE3 1 
ATOM   3740 C  CZ2 . TRP B 1 203 ? 0.878   16.317  -22.980 1.00 8.64  ? 342 TRP B CZ2 1 
ATOM   3741 C  CZ3 . TRP B 1 203 ? 2.938   17.577  -23.130 1.00 10.42 ? 342 TRP B CZ3 1 
ATOM   3742 C  CH2 . TRP B 1 203 ? 2.184   16.510  -22.617 1.00 9.22  ? 342 TRP B CH2 1 
ATOM   3743 N  N   . THR B 1 204 ? 1.930   23.103  -25.031 1.00 11.97 ? 343 THR B N   1 
ATOM   3744 C  CA  . THR B 1 204 ? 2.845   24.151  -25.454 1.00 10.09 ? 343 THR B CA  1 
ATOM   3745 C  C   . THR B 1 204 ? 4.257   23.600  -25.368 1.00 11.30 ? 343 THR B C   1 
ATOM   3746 O  O   . THR B 1 204 ? 4.704   23.216  -24.281 1.00 12.28 ? 343 THR B O   1 
ATOM   3747 C  CB  . THR B 1 204 ? 2.705   25.399  -24.571 1.00 12.73 ? 343 THR B CB  1 
ATOM   3748 O  OG1 . THR B 1 204 ? 1.359   25.900  -24.653 1.00 13.45 ? 343 THR B OG1 1 
ATOM   3749 C  CG2 . THR B 1 204 ? 3.671   26.480  -25.005 1.00 12.67 ? 343 THR B CG2 1 
ATOM   3750 N  N   . VAL B 1 205 ? 4.953   23.545  -26.503 1.00 10.64 ? 344 VAL B N   1 
ATOM   3751 C  CA  . VAL B 1 205 ? 6.299   22.983  -26.551 1.00 10.37 ? 344 VAL B CA  1 
ATOM   3752 C  C   . VAL B 1 205 ? 7.303   24.078  -26.908 1.00 9.83  ? 344 VAL B C   1 
ATOM   3753 O  O   . VAL B 1 205 ? 7.196   24.709  -27.958 1.00 11.90 ? 344 VAL B O   1 
ATOM   3754 C  CB  . VAL B 1 205 ? 6.390   21.840  -27.581 1.00 11.34 ? 344 VAL B CB  1 
ATOM   3755 C  CG1 . VAL B 1 205 ? 7.795   21.237  -27.606 1.00 12.51 ? 344 VAL B CG1 1 
ATOM   3756 C  CG2 . VAL B 1 205 ? 5.342   20.765  -27.283 1.00 13.78 ? 344 VAL B CG2 1 
ATOM   3757 N  N   . PHE B 1 206 ? 8.268   24.312  -26.014 1.00 12.55 ? 345 PHE B N   1 
ATOM   3758 C  CA  . PHE B 1 206 ? 9.314   25.309  -26.253 1.00 13.51 ? 345 PHE B CA  1 
ATOM   3759 C  C   . PHE B 1 206 ? 10.134  24.989  -27.484 1.00 13.18 ? 345 PHE B C   1 
ATOM   3760 O  O   . PHE B 1 206 ? 10.461  23.831  -27.729 1.00 13.14 ? 345 PHE B O   1 
ATOM   3761 C  CB  . PHE B 1 206 ? 10.276  25.394  -25.062 1.00 12.68 ? 345 PHE B CB  1 
ATOM   3762 C  CG  . PHE B 1 206 ? 9.730   26.106  -23.858 1.00 15.13 ? 345 PHE B CG  1 
ATOM   3763 C  CD1 . PHE B 1 206 ? 9.130   25.394  -22.830 1.00 19.86 ? 345 PHE B CD1 1 
ATOM   3764 C  CD2 . PHE B 1 206 ? 9.881   27.474  -23.717 1.00 21.82 ? 345 PHE B CD2 1 
ATOM   3765 C  CE1 . PHE B 1 206 ? 8.656   26.042  -21.701 1.00 21.85 ? 345 PHE B CE1 1 
ATOM   3766 C  CE2 . PHE B 1 206 ? 9.402   28.130  -22.591 1.00 27.53 ? 345 PHE B CE2 1 
ATOM   3767 C  CZ  . PHE B 1 206 ? 8.790   27.412  -21.581 1.00 25.01 ? 345 PHE B CZ  1 
ATOM   3768 N  N   . ASN B 1 207 ? 10.496  26.020  -28.251 1.00 14.26 ? 346 ASN B N   1 
ATOM   3769 C  CA  . ASN B 1 207 ? 11.449  25.843  -29.335 1.00 15.27 ? 346 ASN B CA  1 
ATOM   3770 C  C   . ASN B 1 207 ? 12.888  25.666  -28.816 1.00 17.45 ? 346 ASN B C   1 
ATOM   3771 O  O   . ASN B 1 207 ? 13.646  24.830  -29.314 1.00 18.54 ? 346 ASN B O   1 
ATOM   3772 C  CB  . ASN B 1 207 ? 11.384  27.034  -30.289 1.00 17.84 ? 346 ASN B CB  1 
ATOM   3773 C  CG  . ASN B 1 207 ? 12.288  26.857  -31.474 1.00 21.86 ? 346 ASN B CG  1 
ATOM   3774 O  OD1 . ASN B 1 207 ? 12.140  25.900  -32.232 1.00 20.47 ? 346 ASN B OD1 1 
ATOM   3775 N  ND2 . ASN B 1 207 ? 13.230  27.774  -31.645 1.00 24.45 ? 346 ASN B ND2 1 
ATOM   3776 N  N   . GLN B 1 208 ? 13.248  26.457  -27.810 1.00 15.83 ? 347 GLN B N   1 
ATOM   3777 C  CA  . GLN B 1 208 ? 14.558  26.367  -27.172 1.00 15.60 ? 347 GLN B CA  1 
ATOM   3778 C  C   . GLN B 1 208 ? 14.596  25.144  -26.260 1.00 19.41 ? 347 GLN B C   1 
ATOM   3779 O  O   . GLN B 1 208 ? 13.609  24.845  -25.600 1.00 18.78 ? 347 GLN B O   1 
ATOM   3780 C  CB  . GLN B 1 208 ? 14.840  27.635  -26.367 1.00 18.43 ? 347 GLN B CB  1 
ATOM   3781 C  CG  . GLN B 1 208 ? 16.230  27.693  -25.748 1.00 21.72 ? 347 GLN B CG  1 
ATOM   3782 C  CD  . GLN B 1 208 ? 16.463  28.982  -24.974 1.00 26.19 ? 347 GLN B CD  1 
ATOM   3783 O  OE1 . GLN B 1 208 ? 15.631  29.397  -24.165 1.00 25.16 ? 347 GLN B OE1 1 
ATOM   3784 N  NE2 . GLN B 1 208 ? 17.601  29.619  -25.219 1.00 33.08 ? 347 GLN B NE2 1 
ATOM   3785 N  N   . THR B 1 209 ? 15.728  24.447  -26.225 1.00 17.48 ? 348 THR B N   1 
ATOM   3786 C  CA  . THR B 1 209 ? 15.878  23.273  -25.361 1.00 16.81 ? 348 THR B CA  1 
ATOM   3787 C  C   . THR B 1 209 ? 16.622  23.618  -24.071 1.00 20.27 ? 348 THR B C   1 
ATOM   3788 O  O   . THR B 1 209 ? 17.130  24.728  -23.919 1.00 20.61 ? 348 THR B O   1 
ATOM   3789 C  CB  . THR B 1 209 ? 16.638  22.150  -26.066 1.00 16.64 ? 348 THR B CB  1 
ATOM   3790 O  OG1 . THR B 1 209 ? 17.985  22.587  -26.329 1.00 22.27 ? 348 THR B OG1 1 
ATOM   3791 C  CG2 . THR B 1 209 ? 15.954  21.772  -27.380 1.00 16.81 ? 348 THR B CG2 1 
ATOM   3792 N  N   . VAL B 1 210 ? 16.700  22.664  -23.145 1.00 15.39 ? 349 VAL B N   1 
ATOM   3793 C  CA  . VAL B 1 210 ? 17.603  22.832  -22.004 1.00 16.96 ? 349 VAL B CA  1 
ATOM   3794 C  C   . VAL B 1 210 ? 18.712  21.776  -22.091 1.00 18.76 ? 349 VAL B C   1 
ATOM   3795 O  O   . VAL B 1 210 ? 18.513  20.673  -22.631 1.00 18.34 ? 349 VAL B O   1 
ATOM   3796 C  CB  . VAL B 1 210 ? 16.879  22.745  -20.643 1.00 31.60 ? 349 VAL B CB  1 
ATOM   3797 C  CG1 . VAL B 1 210 ? 15.696  23.691  -20.591 1.00 29.70 ? 349 VAL B CG1 1 
ATOM   3798 C  CG2 . VAL B 1 210 ? 16.441  21.347  -20.365 1.00 34.04 ? 349 VAL B CG2 1 
ATOM   3799 N  N   . SER B 1 211 ? 19.894  22.133  -21.595 1.00 17.07 ? 350 SER B N   1 
ATOM   3800 C  CA  . SER B 1 211 ? 21.049  21.244  -21.681 1.00 14.15 ? 350 SER B CA  1 
ATOM   3801 C  C   . SER B 1 211 ? 21.420  20.658  -20.324 1.00 17.14 ? 350 SER B C   1 
ATOM   3802 O  O   . SER B 1 211 ? 21.516  21.382  -19.321 1.00 20.43 ? 350 SER B O   1 
ATOM   3803 C  CB  . SER B 1 211 ? 22.265  21.984  -22.253 1.00 16.84 ? 350 SER B CB  1 
ATOM   3804 O  OG  . SER B 1 211 ? 22.078  22.329  -23.612 1.00 23.08 ? 350 SER B OG  1 
ATOM   3805 N  N   . LEU B 1 212 ? 21.629  19.344  -20.314 1.00 18.78 ? 351 LEU B N   1 
ATOM   3806 C  CA  . LEU B 1 212 ? 22.163  18.616  -19.159 1.00 17.88 ? 351 LEU B CA  1 
ATOM   3807 C  C   . LEU B 1 212 ? 23.494  17.986  -19.553 1.00 16.71 ? 351 LEU B C   1 
ATOM   3808 O  O   . LEU B 1 212 ? 23.722  17.705  -20.730 1.00 17.61 ? 351 LEU B O   1 
ATOM   3809 C  CB  . LEU B 1 212 ? 21.180  17.529  -18.682 1.00 16.31 ? 351 LEU B CB  1 
ATOM   3810 C  CG  . LEU B 1 212 ? 20.053  17.906  -17.715 1.00 17.21 ? 351 LEU B CG  1 
ATOM   3811 C  CD1 . LEU B 1 212 ? 19.156  18.992  -18.295 1.00 18.08 ? 351 LEU B CD1 1 
ATOM   3812 C  CD2 . LEU B 1 212 ? 19.219  16.670  -17.362 1.00 19.72 ? 351 LEU B CD2 1 
ATOM   3813 N  N   . SER B 1 213 ? 24.375  17.753  -18.581 1.00 19.80 ? 352 SER B N   1 
ATOM   3814 C  CA  . SER B 1 213 ? 25.623  17.055  -18.881 1.00 24.10 ? 352 SER B CA  1 
ATOM   3815 C  C   . SER B 1 213 ? 25.338  15.598  -19.206 1.00 26.43 ? 352 SER B C   1 
ATOM   3816 O  O   . SER B 1 213 ? 24.263  15.080  -18.891 1.00 22.04 ? 352 SER B O   1 
ATOM   3817 C  CB  . SER B 1 213 ? 26.604  17.131  -17.714 1.00 21.33 ? 352 SER B CB  1 
ATOM   3818 O  OG  . SER B 1 213 ? 26.191  16.261  -16.679 1.00 21.48 ? 352 SER B OG  1 
ATOM   3819 N  N   . ALA B 1 214 ? 26.297  14.941  -19.844 1.00 23.87 ? 353 ALA B N   1 
ATOM   3820 C  CA  . ALA B 1 214 ? 26.172  13.519  -20.121 1.00 24.36 ? 353 ALA B CA  1 
ATOM   3821 C  C   . ALA B 1 214 ? 25.932  12.740  -18.826 1.00 21.20 ? 353 ALA B C   1 
ATOM   3822 O  O   . ALA B 1 214 ? 25.066  11.861  -18.772 1.00 21.03 ? 353 ALA B O   1 
ATOM   3823 C  CB  . ALA B 1 214 ? 27.416  13.009  -20.827 1.00 24.47 ? 353 ALA B CB  1 
ATOM   3824 N  N   . LYS B 1 215 ? 26.683  13.087  -17.784 1.00 21.47 ? 354 LYS B N   1 
ATOM   3825 C  CA  . LYS B 1 215 ? 26.545  12.436  -16.478 1.00 21.21 ? 354 LYS B CA  1 
ATOM   3826 C  C   . LYS B 1 215 ? 25.131  12.616  -15.919 1.00 22.97 ? 354 LYS B C   1 
ATOM   3827 O  O   . LYS B 1 215 ? 24.536  11.670  -15.405 1.00 21.88 ? 354 LYS B O   1 
ATOM   3828 C  CB  . LYS B 1 215 ? 27.586  12.988  -15.494 1.00 25.54 ? 354 LYS B CB  1 
ATOM   3829 C  CG  . LYS B 1 215 ? 27.378  12.596  -14.040 1.00 32.39 ? 354 LYS B CG  1 
ATOM   3830 C  CD  . LYS B 1 215 ? 28.347  13.362  -13.153 1.00 44.82 ? 354 LYS B CD  1 
ATOM   3831 C  CE  . LYS B 1 215 ? 28.385  12.806  -11.743 1.00 56.49 ? 354 LYS B CE  1 
ATOM   3832 N  NZ  . LYS B 1 215 ? 29.636  13.207  -11.030 1.00 65.62 ? 354 LYS B NZ  1 
ATOM   3833 N  N   . GLN B 1 216 ? 24.580  13.820  -16.062 1.00 19.02 ? 355 GLN B N   1 
ATOM   3834 C  CA  . GLN B 1 216 ? 23.241  14.105  -15.565 1.00 20.09 ? 355 GLN B CA  1 
ATOM   3835 C  C   . GLN B 1 216 ? 22.180  13.288  -16.300 1.00 19.54 ? 355 GLN B C   1 
ATOM   3836 O  O   . GLN B 1 216 ? 21.259  12.748  -15.681 1.00 18.62 ? 355 GLN B O   1 
ATOM   3837 C  CB  . GLN B 1 216 ? 22.946  15.596  -15.687 1.00 16.77 ? 355 GLN B CB  1 
ATOM   3838 C  CG  . GLN B 1 216 ? 23.590  16.399  -14.568 1.00 18.94 ? 355 GLN B CG  1 
ATOM   3839 C  CD  . GLN B 1 216 ? 23.349  17.882  -14.695 1.00 19.24 ? 355 GLN B CD  1 
ATOM   3840 O  OE1 . GLN B 1 216 ? 23.438  18.448  -15.791 1.00 22.71 ? 355 GLN B OE1 1 
ATOM   3841 N  NE2 . GLN B 1 216 ? 23.032  18.526  -13.576 1.00 18.80 ? 355 GLN B NE2 1 
ATOM   3842 N  N   . LEU B 1 217 ? 22.313  13.193  -17.616 1.00 17.70 ? 356 LEU B N   1 
ATOM   3843 C  CA  . LEU B 1 217 ? 21.358  12.407  -18.388 1.00 16.42 ? 356 LEU B CA  1 
ATOM   3844 C  C   . LEU B 1 217 ? 21.442  10.924  -18.007 1.00 20.90 ? 356 LEU B C   1 
ATOM   3845 O  O   . LEU B 1 217 ? 20.418  10.239  -17.933 1.00 19.24 ? 356 LEU B O   1 
ATOM   3846 C  CB  . LEU B 1 217 ? 21.592  12.621  -19.884 1.00 16.47 ? 356 LEU B CB  1 
ATOM   3847 C  CG  . LEU B 1 217 ? 21.106  13.987  -20.373 1.00 17.45 ? 356 LEU B CG  1 
ATOM   3848 C  CD1 . LEU B 1 217 ? 21.634  14.300  -21.770 1.00 17.86 ? 356 LEU B CD1 1 
ATOM   3849 C  CD2 . LEU B 1 217 ? 19.573  14.054  -20.362 1.00 18.11 ? 356 LEU B CD2 1 
ATOM   3850 N  N   . HIS B 1 218 ? 22.651  10.435  -17.733 1.00 19.47 ? 357 HIS B N   1 
ATOM   3851 C  CA  . HIS B 1 218 ? 22.825  9.059   -17.259 1.00 19.85 ? 357 HIS B CA  1 
ATOM   3852 C  C   . HIS B 1 218 ? 22.167  8.846   -15.891 1.00 20.32 ? 357 HIS B C   1 
ATOM   3853 O  O   . HIS B 1 218 ? 21.486  7.849   -15.660 1.00 23.47 ? 357 HIS B O   1 
ATOM   3854 C  CB  . HIS B 1 218 ? 24.319  8.707   -17.188 1.00 25.83 ? 357 HIS B CB  1 
ATOM   3855 C  CG  . HIS B 1 218 ? 24.591  7.326   -16.679 1.00 28.77 ? 357 HIS B CG  1 
ATOM   3856 N  ND1 . HIS B 1 218 ? 24.907  7.067   -15.362 1.00 34.73 ? 357 HIS B ND1 1 
ATOM   3857 C  CD2 . HIS B 1 218 ? 24.582  6.126   -17.307 1.00 34.12 ? 357 HIS B CD2 1 
ATOM   3858 C  CE1 . HIS B 1 218 ? 25.090  5.768   -15.203 1.00 35.28 ? 357 HIS B CE1 1 
ATOM   3859 N  NE2 . HIS B 1 218 ? 24.897  5.174   -16.367 1.00 33.42 ? 357 HIS B NE2 1 
ATOM   3860 N  N   . THR B 1 219 ? 22.388  9.784   -14.979 1.00 19.95 ? 358 THR B N   1 
ATOM   3861 C  CA  . THR B 1 219 ? 21.775  9.743   -13.657 1.00 17.10 ? 358 THR B CA  1 
ATOM   3862 C  C   . THR B 1 219 ? 20.248  9.673   -13.750 1.00 14.94 ? 358 THR B C   1 
ATOM   3863 O  O   . THR B 1 219 ? 19.607  8.882   -13.053 1.00 18.17 ? 358 THR B O   1 
ATOM   3864 C  CB  . THR B 1 219 ? 22.195  10.965  -12.831 1.00 21.41 ? 358 THR B CB  1 
ATOM   3865 O  OG1 . THR B 1 219 ? 23.604  10.883  -12.568 1.00 19.91 ? 358 THR B OG1 1 
ATOM   3866 C  CG2 . THR B 1 219 ? 21.448  11.019  -11.512 1.00 21.36 ? 358 THR B CG2 1 
ATOM   3867 N  N   . LEU B 1 220 ? 19.677  10.481  -14.637 1.00 14.40 ? 359 LEU B N   1 
ATOM   3868 C  CA  . LEU B 1 220 ? 18.231  10.484  -14.830 1.00 13.86 ? 359 LEU B CA  1 
ATOM   3869 C  C   . LEU B 1 220 ? 17.709  9.122   -15.271 1.00 15.56 ? 359 LEU B C   1 
ATOM   3870 O  O   . LEU B 1 220 ? 16.692  8.641   -14.762 1.00 16.38 ? 359 LEU B O   1 
ATOM   3871 C  CB  . LEU B 1 220 ? 17.841  11.554  -15.855 1.00 15.26 ? 359 LEU B CB  1 
ATOM   3872 C  CG  . LEU B 1 220 ? 16.342  11.667  -16.131 1.00 15.25 ? 359 LEU B CG  1 
ATOM   3873 C  CD1 . LEU B 1 220 ? 15.561  11.913  -14.838 1.00 15.52 ? 359 LEU B CD1 1 
ATOM   3874 C  CD2 . LEU B 1 220 ? 16.081  12.774  -17.167 1.00 14.66 ? 359 LEU B CD2 1 
ATOM   3875 N  N   . SER B 1 221 ? 18.409  8.484   -16.199 1.00 17.13 ? 360 SER B N   1 
ATOM   3876 C  CA  . SER B 1 221 ? 17.886  7.258   -16.799 1.00 15.02 ? 360 SER B CA  1 
ATOM   3877 C  C   . SER B 1 221 ? 18.355  5.957   -16.137 1.00 16.36 ? 360 SER B C   1 
ATOM   3878 O  O   . SER B 1 221 ? 17.797  4.893   -16.401 1.00 19.66 ? 360 SER B O   1 
ATOM   3879 C  CB  . SER B 1 221 ? 18.239  7.224   -18.291 1.00 21.82 ? 360 SER B CB  1 
ATOM   3880 O  OG  . SER B 1 221 ? 19.647  7.185   -18.484 1.00 20.19 ? 360 SER B OG  1 
ATOM   3881 N  N   . ASP B 1 222 ? 19.365  6.036   -15.280 1.00 16.15 ? 361 ASP B N   1 
ATOM   3882 C  CA  . ASP B 1 222 ? 20.004  4.832   -14.736 1.00 21.12 ? 361 ASP B CA  1 
ATOM   3883 C  C   . ASP B 1 222 ? 19.678  4.580   -13.263 1.00 21.69 ? 361 ASP B C   1 
ATOM   3884 O  O   . ASP B 1 222 ? 19.995  3.519   -12.729 1.00 23.42 ? 361 ASP B O   1 
ATOM   3885 C  CB  . ASP B 1 222 ? 21.531  4.940   -14.914 1.00 23.81 ? 361 ASP B CB  1 
ATOM   3886 C  CG  . ASP B 1 222 ? 22.286  3.739   -14.375 1.00 29.49 ? 361 ASP B CG  1 
ATOM   3887 O  OD1 . ASP B 1 222 ? 22.249  2.683   -15.033 1.00 31.20 ? 361 ASP B OD1 1 
ATOM   3888 O  OD2 . ASP B 1 222 ? 22.923  3.852   -13.299 1.00 34.02 ? 361 ASP B OD2 1 
ATOM   3889 N  N   . THR B 1 223 ? 19.042  5.540   -12.603 1.00 14.15 ? 362 THR B N   1 
ATOM   3890 C  CA  . THR B 1 223 ? 18.921  5.492   -11.148 1.00 15.75 ? 362 THR B CA  1 
ATOM   3891 C  C   . THR B 1 223 ? 17.635  4.847   -10.624 1.00 17.44 ? 362 THR B C   1 
ATOM   3892 O  O   . THR B 1 223 ? 17.668  4.160   -9.603  1.00 16.94 ? 362 THR B O   1 
ATOM   3893 C  CB  . THR B 1 223 ? 19.022  6.904   -10.549 1.00 16.79 ? 362 THR B CB  1 
ATOM   3894 O  OG1 . THR B 1 223 ? 20.258  7.498   -10.952 1.00 19.75 ? 362 THR B OG1 1 
ATOM   3895 C  CG2 . THR B 1 223 ? 18.985  6.857   -9.024  1.00 16.79 ? 362 THR B CG2 1 
ATOM   3896 N  N   . LEU B 1 224 ? 16.510  5.061   -11.305 1.00 13.58 ? 363 LEU B N   1 
ATOM   3897 C  CA  . LEU B 1 224 ? 15.210  4.655   -10.750 1.00 11.90 ? 363 LEU B CA  1 
ATOM   3898 C  C   . LEU B 1 224 ? 14.728  3.275   -11.184 1.00 13.00 ? 363 LEU B C   1 
ATOM   3899 O  O   . LEU B 1 224 ? 14.889  2.876   -12.343 1.00 14.06 ? 363 LEU B O   1 
ATOM   3900 C  CB  . LEU B 1 224 ? 14.121  5.669   -11.123 1.00 10.90 ? 363 LEU B CB  1 
ATOM   3901 C  CG  . LEU B 1 224 ? 14.369  7.126   -10.716 1.00 11.66 ? 363 LEU B CG  1 
ATOM   3902 C  CD1 . LEU B 1 224 ? 13.236  8.014   -11.229 1.00 13.00 ? 363 LEU B CD1 1 
ATOM   3903 C  CD2 . LEU B 1 224 ? 14.542  7.294   -9.203  1.00 13.52 ? 363 LEU B CD2 1 
ATOM   3904 N  N   . TRP B 1 225 ? 14.079  2.577   -10.256 1.00 12.04 ? 364 TRP B N   1 
ATOM   3905 C  CA  . TRP B 1 225 ? 13.430  1.316   -10.574 1.00 13.41 ? 364 TRP B CA  1 
ATOM   3906 C  C   . TRP B 1 225 ? 11.972  1.585   -10.855 1.00 12.95 ? 364 TRP B C   1 
ATOM   3907 O  O   . TRP B 1 225 ? 11.383  2.517   -10.297 1.00 12.59 ? 364 TRP B O   1 
ATOM   3908 C  CB  . TRP B 1 225 ? 13.497  0.300   -9.425  1.00 16.78 ? 364 TRP B CB  1 
ATOM   3909 C  CG  . TRP B 1 225 ? 14.844  -0.192  -9.050  1.00 26.54 ? 364 TRP B CG  1 
ATOM   3910 C  CD1 . TRP B 1 225 ? 15.616  0.241   -8.011  1.00 31.85 ? 364 TRP B CD1 1 
ATOM   3911 C  CD2 . TRP B 1 225 ? 15.620  -1.170  -9.749  1.00 32.06 ? 364 TRP B CD2 1 
ATOM   3912 N  NE1 . TRP B 1 225 ? 16.806  -0.445  -7.989  1.00 31.63 ? 364 TRP B NE1 1 
ATOM   3913 C  CE2 . TRP B 1 225 ? 16.838  -1.310  -9.052  1.00 37.38 ? 364 TRP B CE2 1 
ATOM   3914 C  CE3 . TRP B 1 225 ? 15.397  -1.955  -10.885 1.00 28.55 ? 364 TRP B CE3 1 
ATOM   3915 C  CZ2 . TRP B 1 225 ? 17.832  -2.200  -9.458  1.00 40.38 ? 364 TRP B CZ2 1 
ATOM   3916 C  CZ3 . TRP B 1 225 ? 16.383  -2.839  -11.287 1.00 35.38 ? 364 TRP B CZ3 1 
ATOM   3917 C  CH2 . TRP B 1 225 ? 17.587  -2.953  -10.575 1.00 42.64 ? 364 TRP B CH2 1 
ATOM   3918 N  N   . GLY B 1 226 ? 11.384  0.742   -11.702 1.00 12.25 ? 365 GLY B N   1 
ATOM   3919 C  CA  . GLY B 1 226 ? 9.988   0.869   -12.063 1.00 12.41 ? 365 GLY B CA  1 
ATOM   3920 C  C   . GLY B 1 226 ? 9.183   -0.223  -11.384 1.00 10.52 ? 365 GLY B C   1 
ATOM   3921 O  O   . GLY B 1 226 ? 9.662   -0.849  -10.434 1.00 11.64 ? 365 GLY B O   1 
ATOM   3922 N  N   . PRO B 1 227 ? 7.948   -0.446  -11.845 1.00 10.04 ? 366 PRO B N   1 
ATOM   3923 C  CA  . PRO B 1 227 ? 7.083   -1.460  -11.226 1.00 10.17 ? 366 PRO B CA  1 
ATOM   3924 C  C   . PRO B 1 227 ? 7.681   -2.855  -11.337 1.00 11.56 ? 366 PRO B C   1 
ATOM   3925 O  O   . PRO B 1 227 ? 8.403   -3.144  -12.300 1.00 13.17 ? 366 PRO B O   1 
ATOM   3926 C  CB  . PRO B 1 227 ? 5.774   -1.351  -12.030 1.00 11.68 ? 366 PRO B CB  1 
ATOM   3927 C  CG  . PRO B 1 227 ? 5.811   0.063   -12.611 1.00 12.34 ? 366 PRO B CG  1 
ATOM   3928 C  CD  . PRO B 1 227 ? 7.269   0.260   -12.948 1.00 9.94  ? 366 PRO B CD  1 
ATOM   3929 N  N   . GLY B 1 228 ? 7.408   -3.707  -10.355 1.00 11.45 ? 367 GLY B N   1 
ATOM   3930 C  CA  . GLY B 1 228 ? 7.934   -5.061  -10.388 1.00 12.05 ? 367 GLY B CA  1 
ATOM   3931 C  C   . GLY B 1 228 ? 9.446   -5.084  -10.386 1.00 13.18 ? 367 GLY B C   1 
ATOM   3932 O  O   . GLY B 1 228 ? 10.096  -4.358  -9.637  1.00 16.77 ? 367 GLY B O   1 
ATOM   3933 N  N   . ASP B 1 229 ? 10.010  -5.899  -11.261 1.00 18.12 ? 368 ASP B N   1 
ATOM   3934 C  CA  . ASP B 1 229 ? 11.455  -6.053  -11.331 1.00 30.14 ? 368 ASP B CA  1 
ATOM   3935 C  C   . ASP B 1 229 ? 12.122  -5.008  -12.218 1.00 29.14 ? 368 ASP B C   1 
ATOM   3936 O  O   . ASP B 1 229 ? 13.341  -4.990  -12.344 1.00 25.76 ? 368 ASP B O   1 
ATOM   3937 C  CB  A ASP B 1 229 ? 11.761  -7.430  -11.907 0.54 35.12 ? 368 ASP B CB  1 
ATOM   3938 C  CB  B ASP B 1 229 ? 11.812  -7.462  -11.821 0.46 34.95 ? 368 ASP B CB  1 
ATOM   3939 C  CG  A ASP B 1 229 ? 11.093  -7.635  -13.263 0.54 36.28 ? 368 ASP B CG  1 
ATOM   3940 C  CG  B ASP B 1 229 ? 11.714  -8.502  -10.719 0.46 34.85 ? 368 ASP B CG  1 
ATOM   3941 O  OD1 A ASP B 1 229 ? 11.798  -7.602  -14.295 0.54 42.34 ? 368 ASP B OD1 1 
ATOM   3942 O  OD1 B ASP B 1 229 ? 12.113  -8.191  -9.577  0.46 35.25 ? 368 ASP B OD1 1 
ATOM   3943 O  OD2 A ASP B 1 229 ? 9.850   -7.779  -13.297 0.54 37.91 ? 368 ASP B OD2 1 
ATOM   3944 O  OD2 B ASP B 1 229 ? 11.233  -9.623  -10.989 0.46 36.14 ? 368 ASP B OD2 1 
ATOM   3945 N  N   . SER B 1 230 ? 11.324  -4.118  -12.798 1.00 22.04 ? 369 SER B N   1 
ATOM   3946 C  CA  . SER B 1 230 ? 11.783  -3.343  -13.957 1.00 17.80 ? 369 SER B CA  1 
ATOM   3947 C  C   . SER B 1 230 ? 12.640  -2.107  -13.664 1.00 13.73 ? 369 SER B C   1 
ATOM   3948 O  O   . SER B 1 230 ? 12.610  -1.542  -12.582 1.00 14.36 ? 369 SER B O   1 
ATOM   3949 C  CB  . SER B 1 230 ? 10.571  -2.934  -14.794 1.00 14.49 ? 369 SER B CB  1 
ATOM   3950 O  OG  . SER B 1 230 ? 9.810   -1.926  -14.153 1.00 16.13 ? 369 SER B OG  1 
ATOM   3951 N  N   . ARG B 1 231 ? 13.421  -1.699  -14.660 1.00 14.92 ? 370 ARG B N   1 
ATOM   3952 C  CA  . ARG B 1 231 ? 14.131  -0.431  -14.595 1.00 12.10 ? 370 ARG B CA  1 
ATOM   3953 C  C   . ARG B 1 231 ? 13.217  0.665   -15.103 1.00 12.30 ? 370 ARG B C   1 
ATOM   3954 O  O   . ARG B 1 231 ? 12.485  0.447   -16.069 1.00 13.18 ? 370 ARG B O   1 
ATOM   3955 C  CB  . ARG B 1 231 ? 15.415  -0.488  -15.429 1.00 17.52 ? 370 ARG B CB  1 
ATOM   3956 C  CG  . ARG B 1 231 ? 16.347  -1.603  -14.992 1.00 23.48 ? 370 ARG B CG  1 
ATOM   3957 C  CD  . ARG B 1 231 ? 17.607  -1.037  -14.395 1.00 38.67 ? 370 ARG B CD  1 
ATOM   3958 N  NE  . ARG B 1 231 ? 18.551  -0.644  -15.432 1.00 33.96 ? 370 ARG B NE  1 
ATOM   3959 C  CZ  . ARG B 1 231 ? 19.555  0.209   -15.252 1.00 42.31 ? 370 ARG B CZ  1 
ATOM   3960 N  NH1 . ARG B 1 231 ? 19.750  0.779   -14.068 1.00 36.92 ? 370 ARG B NH1 1 
ATOM   3961 N  NH2 . ARG B 1 231 ? 20.361  0.496   -16.265 1.00 45.08 ? 370 ARG B NH2 1 
ATOM   3962 N  N   . LEU B 1 232 ? 13.242  1.835   -14.464 1.00 11.48 ? 371 LEU B N   1 
ATOM   3963 C  CA  . LEU B 1 232 ? 12.410  2.935   -14.954 1.00 11.36 ? 371 LEU B CA  1 
ATOM   3964 C  C   . LEU B 1 232 ? 13.185  3.631   -16.063 1.00 11.27 ? 371 LEU B C   1 
ATOM   3965 O  O   . LEU B 1 232 ? 13.935  4.591   -15.824 1.00 10.68 ? 371 LEU B O   1 
ATOM   3966 C  CB  . LEU B 1 232 ? 12.022  3.904   -13.838 1.00 12.59 ? 371 LEU B CB  1 
ATOM   3967 C  CG  . LEU B 1 232 ? 10.583  4.436   -13.938 1.00 13.69 ? 371 LEU B CG  1 
ATOM   3968 C  CD1 . LEU B 1 232 ? 10.308  5.477   -12.856 1.00 12.50 ? 371 LEU B CD1 1 
ATOM   3969 C  CD2 . LEU B 1 232 ? 10.255  5.001   -15.324 1.00 16.44 ? 371 LEU B CD2 1 
ATOM   3970 N  N   . GLN B 1 233 ? 13.009  3.092   -17.268 1.00 11.99 ? 372 GLN B N   1 
ATOM   3971 C  CA  . GLN B 1 233 ? 13.675  3.575   -18.483 1.00 13.01 ? 372 GLN B CA  1 
ATOM   3972 C  C   . GLN B 1 233 ? 12.706  3.601   -19.647 1.00 11.26 ? 372 GLN B C   1 
ATOM   3973 O  O   . GLN B 1 233 ? 11.718  2.864   -19.646 1.00 10.40 ? 372 GLN B O   1 
ATOM   3974 C  CB  . GLN B 1 233 ? 14.851  2.669   -18.835 1.00 14.81 ? 372 GLN B CB  1 
ATOM   3975 C  CG  . GLN B 1 233 ? 15.959  2.689   -17.825 1.00 14.65 ? 372 GLN B CG  1 
ATOM   3976 C  CD  . GLN B 1 233 ? 17.160  1.882   -18.283 1.00 13.14 ? 372 GLN B CD  1 
ATOM   3977 O  OE1 . GLN B 1 233 ? 17.011  0.792   -18.863 1.00 17.43 ? 372 GLN B OE1 1 
ATOM   3978 N  NE2 . GLN B 1 233 ? 18.348  2.406   -18.032 1.00 19.80 ? 372 GLN B NE2 1 
ATOM   3979 N  N   . LEU B 1 234 ? 13.029  4.401   -20.666 1.00 10.01 ? 373 LEU B N   1 
ATOM   3980 C  CA  . LEU B 1 234 ? 12.247  4.442   -21.903 1.00 11.68 ? 373 LEU B CA  1 
ATOM   3981 C  C   . LEU B 1 234 ? 10.792  4.727   -21.575 1.00 10.16 ? 373 LEU B C   1 
ATOM   3982 O  O   . LEU B 1 234 ? 9.879   4.099   -22.109 1.00 12.06 ? 373 LEU B O   1 
ATOM   3983 C  CB  . LEU B 1 234 ? 12.374  3.121   -22.677 1.00 15.03 ? 373 LEU B CB  1 
ATOM   3984 C  CG  . LEU B 1 234 ? 13.806  2.628   -22.923 1.00 17.39 ? 373 LEU B CG  1 
ATOM   3985 C  CD1 . LEU B 1 234 ? 13.783  1.186   -23.428 1.00 23.39 ? 373 LEU B CD1 1 
ATOM   3986 C  CD2 . LEU B 1 234 ? 14.527  3.538   -23.900 1.00 17.02 ? 373 LEU B CD2 1 
ATOM   3987 N  N   . ASN B 1 235 ? 10.586  5.673   -20.670 1.00 10.04 ? 374 ASN B N   1 
ATOM   3988 C  CA  . ASN B 1 235 ? 9.243   5.927   -20.178 1.00 9.56  ? 374 ASN B CA  1 
ATOM   3989 C  C   . ASN B 1 235 ? 8.554   6.999   -21.011 1.00 9.83  ? 374 ASN B C   1 
ATOM   3990 O  O   . ASN B 1 235 ? 8.238   8.090   -20.525 1.00 11.13 ? 374 ASN B O   1 
ATOM   3991 C  CB  . ASN B 1 235 ? 9.278   6.279   -18.684 1.00 8.87  ? 374 ASN B CB  1 
ATOM   3992 C  CG  . ASN B 1 235 ? 10.137  7.479   -18.365 1.00 9.17  ? 374 ASN B CG  1 
ATOM   3993 O  OD1 . ASN B 1 235 ? 11.122  7.763   -19.050 1.00 11.67 ? 374 ASN B OD1 1 
ATOM   3994 N  ND2 . ASN B 1 235 ? 9.767   8.202   -17.292 1.00 8.47  ? 374 ASN B ND2 1 
ATOM   3995 N  N   . PHE B 1 236 ? 8.368   6.671   -22.289 1.00 9.39  ? 375 PHE B N   1 
ATOM   3996 C  CA  . PHE B 1 236 ? 7.684   7.550   -23.224 1.00 8.74  ? 375 PHE B CA  1 
ATOM   3997 C  C   . PHE B 1 236 ? 6.646   6.792   -24.042 1.00 9.32  ? 375 PHE B C   1 
ATOM   3998 O  O   . PHE B 1 236 ? 6.772   5.584   -24.273 1.00 10.89 ? 375 PHE B O   1 
ATOM   3999 C  CB  . PHE B 1 236 ? 8.694   8.244   -24.158 1.00 9.92  ? 375 PHE B CB  1 
ATOM   4000 C  CG  . PHE B 1 236 ? 9.512   7.300   -25.013 1.00 10.97 ? 375 PHE B CG  1 
ATOM   4001 C  CD1 . PHE B 1 236 ? 9.078   6.929   -26.276 1.00 11.64 ? 375 PHE B CD1 1 
ATOM   4002 C  CD2 . PHE B 1 236 ? 10.735  6.814   -24.560 1.00 11.91 ? 375 PHE B CD2 1 
ATOM   4003 C  CE1 . PHE B 1 236 ? 9.846   6.069   -27.068 1.00 14.69 ? 375 PHE B CE1 1 
ATOM   4004 C  CE2 . PHE B 1 236 ? 11.506  5.965   -25.341 1.00 11.14 ? 375 PHE B CE2 1 
ATOM   4005 C  CZ  . PHE B 1 236 ? 11.063  5.586   -26.588 1.00 11.87 ? 375 PHE B CZ  1 
ATOM   4006 N  N   . ARG B 1 237 ? 5.611   7.521   -24.452 1.00 8.88  ? 376 ARG B N   1 
ATOM   4007 C  CA  . ARG B 1 237 ? 4.563   7.000   -25.326 1.00 8.79  ? 376 ARG B CA  1 
ATOM   4008 C  C   . ARG B 1 237 ? 4.942   7.237   -26.778 1.00 11.17 ? 376 ARG B C   1 
ATOM   4009 O  O   . ARG B 1 237 ? 5.533   8.265   -27.095 1.00 11.87 ? 376 ARG B O   1 
ATOM   4010 C  CB  . ARG B 1 237 ? 3.225   7.689   -25.042 1.00 10.14 ? 376 ARG B CB  1 
ATOM   4011 C  CG  . ARG B 1 237 ? 2.017   7.023   -25.709 1.00 11.54 ? 376 ARG B CG  1 
ATOM   4012 C  CD  . ARG B 1 237 ? 0.767   7.888   -25.567 1.00 11.33 ? 376 ARG B CD  1 
ATOM   4013 N  NE  . ARG B 1 237 ? -0.443  7.145   -25.917 1.00 11.70 ? 376 ARG B NE  1 
ATOM   4014 C  CZ  . ARG B 1 237 ? -1.654  7.686   -25.947 1.00 9.20  ? 376 ARG B CZ  1 
ATOM   4015 N  NH1 . ARG B 1 237 ? -1.814  8.992   -25.694 1.00 9.73  ? 376 ARG B NH1 1 
ATOM   4016 N  NH2 . ARG B 1 237 ? -2.706  6.924   -26.249 1.00 10.88 ? 376 ARG B NH2 1 
ATOM   4017 N  N   . ALA B 1 238 ? 4.569   6.305   -27.656 1.00 12.90 ? 377 ALA B N   1 
ATOM   4018 C  CA  . ALA B 1 238 ? 4.738   6.502   -29.099 1.00 17.95 ? 377 ALA B CA  1 
ATOM   4019 C  C   . ALA B 1 238 ? 3.992   7.747   -29.586 1.00 11.97 ? 377 ALA B C   1 
ATOM   4020 O  O   . ALA B 1 238 ? 2.957   8.109   -29.024 1.00 11.82 ? 377 ALA B O   1 
ATOM   4021 C  CB  . ALA B 1 238 ? 4.251   5.275   -29.856 1.00 21.82 ? 377 ALA B CB  1 
ATOM   4022 N  N   . THR B 1 239 ? 4.516   8.406   -30.619 1.00 14.30 ? 378 THR B N   1 
ATOM   4023 C  CA  . THR B 1 239 ? 3.843   9.560   -31.203 1.00 11.20 ? 378 THR B CA  1 
ATOM   4024 C  C   . THR B 1 239 ? 2.522   9.117   -31.872 1.00 13.34 ? 378 THR B C   1 
ATOM   4025 O  O   . THR B 1 239 ? 2.376   7.992   -32.376 1.00 14.19 ? 378 THR B O   1 
ATOM   4026 C  CB  A THR B 1 239 ? 4.799   10.248  -32.202 0.14 17.55 ? 378 THR B CB  1 
ATOM   4027 C  CB  B THR B 1 239 ? 4.697   10.388  -32.206 0.86 18.24 ? 378 THR B CB  1 
ATOM   4028 O  OG1 A THR B 1 239 ? 5.834   10.935  -31.480 0.14 20.10 ? 378 THR B OG1 1 
ATOM   4029 O  OG1 B THR B 1 239 ? 5.192   9.548   -33.245 0.86 16.91 ? 378 THR B OG1 1 
ATOM   4030 C  CG2 A THR B 1 239 ? 4.085   11.224  -33.056 0.14 15.60 ? 378 THR B CG2 1 
ATOM   4031 C  CG2 B THR B 1 239 ? 5.871   11.126  -31.485 0.86 17.71 ? 378 THR B CG2 1 
ATOM   4032 N  N   . GLN B 1 240 ? 1.555   10.017  -31.796 1.00 10.63 ? 379 GLN B N   1 
ATOM   4033 C  CA  . GLN B 1 240 ? 0.176   9.791   -32.194 1.00 12.18 ? 379 GLN B CA  1 
ATOM   4034 C  C   . GLN B 1 240 ? -0.198  10.582  -33.437 1.00 12.31 ? 379 GLN B C   1 
ATOM   4035 O  O   . GLN B 1 240 ? 0.299   11.690  -33.637 1.00 12.76 ? 379 GLN B O   1 
ATOM   4036 C  CB  . GLN B 1 240 ? -0.718  10.197  -31.028 1.00 9.73  ? 379 GLN B CB  1 
ATOM   4037 C  CG  . GLN B 1 240 ? -0.356  9.488   -29.727 1.00 12.53 ? 379 GLN B CG  1 
ATOM   4038 C  CD  . GLN B 1 240 ? -0.690  8.019   -29.791 1.00 17.23 ? 379 GLN B CD  1 
ATOM   4039 O  OE1 . GLN B 1 240 ? -1.806  7.660   -30.160 1.00 21.81 ? 379 GLN B OE1 1 
ATOM   4040 N  NE2 . GLN B 1 240 ? 0.262   7.160   -29.444 1.00 16.11 ? 379 GLN B NE2 1 
ATOM   4041 N  N   . PRO B 1 241 ? -1.110  10.043  -34.256 1.00 13.28 ? 380 PRO B N   1 
ATOM   4042 C  CA  . PRO B 1 241 ? -1.470  10.725  -35.503 1.00 14.89 ? 380 PRO B CA  1 
ATOM   4043 C  C   . PRO B 1 241 ? -2.188  12.059  -35.264 1.00 12.57 ? 380 PRO B C   1 
ATOM   4044 O  O   . PRO B 1 241 ? -3.007  12.175  -34.353 1.00 14.05 ? 380 PRO B O   1 
ATOM   4045 C  CB  . PRO B 1 241 ? -2.388  9.712   -36.202 1.00 18.08 ? 380 PRO B CB  1 
ATOM   4046 C  CG  . PRO B 1 241 ? -2.960  8.894   -35.087 1.00 21.94 ? 380 PRO B CG  1 
ATOM   4047 C  CD  . PRO B 1 241 ? -1.848  8.782   -34.078 1.00 15.38 ? 380 PRO B CD  1 
ATOM   4048 N  N   . LEU B 1 242 ? -1.867  13.058  -36.083 1.00 13.95 ? 381 LEU B N   1 
ATOM   4049 C  CA  . LEU B 1 242 ? -2.440  14.384  -35.941 1.00 13.06 ? 381 LEU B CA  1 
ATOM   4050 C  C   . LEU B 1 242 ? -3.942  14.388  -36.275 1.00 13.99 ? 381 LEU B C   1 
ATOM   4051 O  O   . LEU B 1 242 ? -4.706  15.133  -35.673 1.00 13.42 ? 381 LEU B O   1 
ATOM   4052 C  CB  . LEU B 1 242 ? -1.678  15.360  -36.852 1.00 14.93 ? 381 LEU B CB  1 
ATOM   4053 C  CG  . LEU B 1 242 ? -0.454  16.064  -36.250 1.00 19.73 ? 381 LEU B CG  1 
ATOM   4054 C  CD1 . LEU B 1 242 ? 0.126   17.064  -37.250 1.00 23.31 ? 381 LEU B CD1 1 
ATOM   4055 C  CD2 . LEU B 1 242 ? -0.745  16.740  -34.923 1.00 15.16 ? 381 LEU B CD2 1 
ATOM   4056 N  N   . ASN B 1 243 ? -4.347  13.545  -37.229 1.00 14.44 ? 382 ASN B N   1 
ATOM   4057 C  CA  . ASN B 1 243 ? -5.753  13.394  -37.643 1.00 12.80 ? 382 ASN B CA  1 
ATOM   4058 C  C   . ASN B 1 243 ? -6.403  14.739  -37.961 1.00 15.31 ? 382 ASN B C   1 
ATOM   4059 O  O   . ASN B 1 243 ? -7.539  15.021  -37.558 1.00 17.99 ? 382 ASN B O   1 
ATOM   4060 C  CB  . ASN B 1 243 ? -6.553  12.641  -36.570 1.00 13.15 ? 382 ASN B CB  1 
ATOM   4061 C  CG  . ASN B 1 243 ? -6.254  11.135  -36.559 1.00 16.51 ? 382 ASN B CG  1 
ATOM   4062 O  OD1 . ASN B 1 243 ? -5.980  10.532  -37.607 1.00 19.70 ? 382 ASN B OD1 1 
ATOM   4063 N  ND2 . ASN B 1 243 ? -6.268  10.534  -35.367 1.00 16.05 ? 382 ASN B ND2 1 
ATOM   4064 N  N   . GLY B 1 244 ? -5.665  15.558  -38.703 1.00 18.64 ? 383 GLY B N   1 
ATOM   4065 C  CA  . GLY B 1 244 ? -6.176  16.816  -39.202 1.00 20.43 ? 383 GLY B CA  1 
ATOM   4066 C  C   . GLY B 1 244 ? -5.892  18.004  -38.309 1.00 19.32 ? 383 GLY B C   1 
ATOM   4067 O  O   . GLY B 1 244 ? -6.158  19.137  -38.694 1.00 18.80 ? 383 GLY B O   1 
ATOM   4068 N  N   . ARG B 1 245 ? -5.338  17.760  -37.123 1.00 15.95 ? 384 ARG B N   1 
ATOM   4069 C  CA  . ARG B 1 245 ? -4.995  18.862  -36.244 1.00 14.36 ? 384 ARG B CA  1 
ATOM   4070 C  C   . ARG B 1 245 ? -3.895  19.724  -36.829 1.00 16.22 ? 384 ARG B C   1 
ATOM   4071 O  O   . ARG B 1 245 ? -2.964  19.226  -37.470 1.00 16.49 ? 384 ARG B O   1 
ATOM   4072 C  CB  . ARG B 1 245 ? -4.541  18.347  -34.875 1.00 11.24 ? 384 ARG B CB  1 
ATOM   4073 C  CG  . ARG B 1 245 ? -5.679  17.828  -34.016 1.00 13.56 ? 384 ARG B CG  1 
ATOM   4074 C  CD  . ARG B 1 245 ? -5.117  17.266  -32.734 1.00 14.31 ? 384 ARG B CD  1 
ATOM   4075 N  NE  . ARG B 1 245 ? -4.455  15.986  -32.978 1.00 10.84 ? 384 ARG B NE  1 
ATOM   4076 C  CZ  . ARG B 1 245 ? -3.794  15.313  -32.038 1.00 9.80  ? 384 ARG B CZ  1 
ATOM   4077 N  NH1 . ARG B 1 245 ? -3.696  15.818  -30.809 1.00 10.95 ? 384 ARG B NH1 1 
ATOM   4078 N  NH2 . ARG B 1 245 ? -3.235  14.146  -32.323 1.00 8.56  ? 384 ARG B NH2 1 
ATOM   4079 N  N   . VAL B 1 246 ? -3.999  21.017  -36.556 1.00 15.10 ? 385 VAL B N   1 
ATOM   4080 C  CA  . VAL B 1 246 ? -2.975  21.979  -36.911 1.00 18.91 ? 385 VAL B CA  1 
ATOM   4081 C  C   . VAL B 1 246 ? -2.119  22.280  -35.687 1.00 17.14 ? 385 VAL B C   1 
ATOM   4082 O  O   . VAL B 1 246 ? -2.643  22.515  -34.589 1.00 22.06 ? 385 VAL B O   1 
ATOM   4083 C  CB  . VAL B 1 246 ? -3.596  23.291  -37.447 1.00 24.69 ? 385 VAL B CB  1 
ATOM   4084 C  CG1 . VAL B 1 246 ? -2.548  24.391  -37.542 1.00 28.27 ? 385 VAL B CG1 1 
ATOM   4085 C  CG2 . VAL B 1 246 ? -4.255  23.044  -38.787 1.00 30.75 ? 385 VAL B CG2 1 
ATOM   4086 N  N   . ILE B 1 247 ? -0.802  22.239  -35.866 1.00 12.31 ? 386 ILE B N   1 
ATOM   4087 C  CA  . ILE B 1 247 ? 0.106   22.733  -34.837 1.00 9.44  ? 386 ILE B CA  1 
ATOM   4088 C  C   . ILE B 1 247 ? 0.432   24.183  -35.143 1.00 12.38 ? 386 ILE B C   1 
ATOM   4089 O  O   . ILE B 1 247 ? 0.837   24.505  -36.264 1.00 13.88 ? 386 ILE B O   1 
ATOM   4090 C  CB  . ILE B 1 247 ? 1.401   21.913  -34.774 1.00 11.24 ? 386 ILE B CB  1 
ATOM   4091 C  CG1 . ILE B 1 247 ? 1.069   20.454  -34.466 1.00 11.44 ? 386 ILE B CG1 1 
ATOM   4092 C  CG2 . ILE B 1 247 ? 2.366   22.482  -33.720 1.00 12.10 ? 386 ILE B CG2 1 
ATOM   4093 C  CD1 . ILE B 1 247 ? 2.292   19.566  -34.372 1.00 12.19 ? 386 ILE B CD1 1 
ATOM   4094 N  N   . GLU B 1 248 ? 0.218   25.060  -34.167 1.00 11.44 ? 387 GLU B N   1 
ATOM   4095 C  CA  . GLU B 1 248 ? 0.547   26.479  -34.330 1.00 11.44 ? 387 GLU B CA  1 
ATOM   4096 C  C   . GLU B 1 248 ? 1.954   26.777  -33.830 1.00 12.66 ? 387 GLU B C   1 
ATOM   4097 O  O   . GLU B 1 248 ? 2.473   26.079  -32.962 1.00 12.50 ? 387 GLU B O   1 
ATOM   4098 C  CB  . GLU B 1 248 ? -0.472  27.366  -33.596 1.00 13.80 ? 387 GLU B CB  1 
ATOM   4099 C  CG  . GLU B 1 248 ? -1.879  27.297  -34.182 1.00 17.91 ? 387 GLU B CG  1 
ATOM   4100 C  CD  . GLU B 1 248 ? -2.859  28.276  -33.546 1.00 22.82 ? 387 GLU B CD  1 
ATOM   4101 O  OE1 . GLU B 1 248 ? -4.003  28.368  -34.041 1.00 27.69 ? 387 GLU B OE1 1 
ATOM   4102 O  OE2 . GLU B 1 248 ? -2.503  28.951  -32.564 1.00 23.60 ? 387 GLU B OE2 1 
ATOM   4103 N  N   . ALA B 1 249 ? 2.573   27.813  -34.396 1.00 12.07 ? 388 ALA B N   1 
ATOM   4104 C  CA  . ALA B 1 249 ? 3.853   28.316  -33.898 1.00 12.92 ? 388 ALA B CA  1 
ATOM   4105 C  C   . ALA B 1 249 ? 3.724   29.803  -33.590 1.00 14.46 ? 388 ALA B C   1 
ATOM   4106 O  O   . ALA B 1 249 ? 3.074   30.540  -34.333 1.00 15.42 ? 388 ALA B O   1 
ATOM   4107 C  CB  . ALA B 1 249 ? 4.974   28.075  -34.914 1.00 13.39 ? 388 ALA B CB  1 
ATOM   4108 N  N   . SER B 1 250 ? 4.357   30.240  -32.508 1.00 11.86 ? 389 SER B N   1 
ATOM   4109 C  CA  . SER B 1 250 ? 4.303   31.634  -32.076 1.00 13.37 ? 389 SER B CA  1 
ATOM   4110 C  C   . SER B 1 250 ? 5.349   32.491  -32.780 1.00 15.70 ? 389 SER B C   1 
ATOM   4111 O  O   . SER B 1 250 ? 5.505   33.670  -32.453 1.00 17.50 ? 389 SER B O   1 
ATOM   4112 C  CB  . SER B 1 250 ? 4.536   31.719  -30.564 1.00 13.35 ? 389 SER B CB  1 
ATOM   4113 O  OG  . SER B 1 250 ? 5.894   31.424  -30.288 1.00 15.56 ? 389 SER B OG  1 
ATOM   4114 N  N   . PHE B 1 251 ? 6.064   31.880  -33.725 1.00 14.30 ? 390 PHE B N   1 
ATOM   4115 C  CA  . PHE B 1 251 ? 7.231   32.491  -34.369 1.00 15.75 ? 390 PHE B CA  1 
ATOM   4116 C  C   . PHE B 1 251 ? 7.416   31.863  -35.757 1.00 16.47 ? 390 PHE B C   1 
ATOM   4117 O  O   . PHE B 1 251 ? 6.903   30.775  -36.021 1.00 17.68 ? 390 PHE B O   1 
ATOM   4118 C  CB  . PHE B 1 251 ? 8.489   32.285  -33.516 1.00 15.02 ? 390 PHE B CB  1 
ATOM   4119 C  CG  . PHE B 1 251 ? 8.953   30.863  -33.467 1.00 14.99 ? 390 PHE B CG  1 
ATOM   4120 C  CD1 . PHE B 1 251 ? 8.255   29.910  -32.749 1.00 14.33 ? 390 PHE B CD1 1 
ATOM   4121 C  CD2 . PHE B 1 251 ? 10.116  30.485  -34.127 1.00 16.40 ? 390 PHE B CD2 1 
ATOM   4122 C  CE1 . PHE B 1 251 ? 8.681   28.600  -32.720 1.00 15.00 ? 390 PHE B CE1 1 
ATOM   4123 C  CE2 . PHE B 1 251 ? 10.563  29.172  -34.090 1.00 17.63 ? 390 PHE B CE2 1 
ATOM   4124 C  CZ  . PHE B 1 251 ? 9.845   28.231  -33.379 1.00 17.43 ? 390 PHE B CZ  1 
ATOM   4125 N  N   . PRO B 1 252 ? 8.133   32.545  -36.663 1.00 17.56 ? 391 PRO B N   1 
ATOM   4126 C  CA  . PRO B 1 252 ? 8.294   31.981  -38.011 1.00 15.38 ? 391 PRO B CA  1 
ATOM   4127 C  C   . PRO B 1 252 ? 9.276   30.799  -38.031 1.00 21.86 ? 391 PRO B C   1 
ATOM   4128 O  O   . PRO B 1 252 ? 10.464  30.962  -38.295 1.00 25.42 ? 391 PRO B O   1 
ATOM   4129 C  CB  . PRO B 1 252 ? 8.828   33.169  -38.823 1.00 14.78 ? 391 PRO B CB  1 
ATOM   4130 C  CG  . PRO B 1 252 ? 9.508   34.021  -37.832 1.00 19.17 ? 391 PRO B CG  1 
ATOM   4131 C  CD  . PRO B 1 252 ? 8.721   33.892  -36.554 1.00 18.22 ? 391 PRO B CD  1 
ATOM   4132 N  N   . ALA B 1 253 ? 8.761   29.606  -37.749 1.00 19.45 ? 392 ALA B N   1 
ATOM   4133 C  CA  . ALA B 1 253 ? 9.610   28.460  -37.425 1.00 24.06 ? 392 ALA B CA  1 
ATOM   4134 C  C   . ALA B 1 253 ? 10.380  27.878  -38.619 1.00 27.84 ? 392 ALA B C   1 
ATOM   4135 O  O   . ALA B 1 253 ? 11.429  27.264  -38.448 1.00 31.15 ? 392 ALA B O   1 
ATOM   4136 C  CB  . ALA B 1 253 ? 8.763   27.370  -36.767 1.00 23.08 ? 392 ALA B CB  1 
ATOM   4137 N  N   . GLY B 1 254 ? 9.872   28.058  -39.829 1.00 29.35 ? 393 GLY B N   1 
ATOM   4138 C  CA  . GLY B 1 254 ? 10.547  27.486  -40.981 1.00 39.02 ? 393 GLY B CA  1 
ATOM   4139 C  C   . GLY B 1 254 ? 11.502  28.385  -41.752 1.00 45.97 ? 393 GLY B C   1 
ATOM   4140 O  O   . GLY B 1 254 ? 11.820  28.086  -42.901 1.00 56.83 ? 393 GLY B O   1 
ATOM   4141 N  N   . VAL B 1 255 ? 11.976  29.467  -41.139 1.00 43.36 ? 394 VAL B N   1 
ATOM   4142 C  CA  . VAL B 1 255 ? 12.804  30.436  -41.864 1.00 47.44 ? 394 VAL B CA  1 
ATOM   4143 C  C   . VAL B 1 255 ? 14.311  30.170  -41.758 1.00 58.60 ? 394 VAL B C   1 
ATOM   4144 O  O   . VAL B 1 255 ? 14.787  29.671  -40.740 1.00 57.92 ? 394 VAL B O   1 
ATOM   4145 C  CB  . VAL B 1 255 ? 12.487  31.878  -41.389 1.00 40.32 ? 394 VAL B CB  1 
ATOM   4146 C  CG1 . VAL B 1 255 ? 13.225  32.912  -42.227 1.00 35.13 ? 394 VAL B CG1 1 
ATOM   4147 C  CG2 . VAL B 1 255 ? 10.999  32.124  -41.480 1.00 39.47 ? 394 VAL B CG2 1 
ATOM   4148 N  N   . ASP B 1 256 ? 15.019  30.492  -42.849 1.00 74.85 ? 395 ASP B N   1 
ATOM   4149 C  CA  . ASP B 1 256 ? 16.478  30.394  -43.031 1.00 87.64 ? 395 ASP B CA  1 
ATOM   4150 C  C   . ASP B 1 256 ? 16.911  29.003  -43.474 1.00 90.56 ? 395 ASP B C   1 
ATOM   4151 O  O   . ASP B 1 256 ? 17.753  28.869  -44.367 1.00 90.28 ? 395 ASP B O   1 
ATOM   4152 C  CB  . ASP B 1 256 ? 17.243  30.794  -41.765 1.00 94.94 ? 395 ASP B CB  1 
ATOM   4153 C  CG  . ASP B 1 256 ? 17.222  32.284  -41.525 1.00 98.68 ? 395 ASP B CG  1 
ATOM   4154 O  OD1 . ASP B 1 256 ? 17.115  33.037  -42.515 1.00 98.83 ? 395 ASP B OD1 1 
ATOM   4155 O  OD2 . ASP B 1 256 ? 17.322  32.703  -40.353 1.00 99.01 ? 395 ASP B OD2 1 
HETATM 4156 ZN ZN  . ZN  C 2 .   ? 1.795   -11.156 7.210   1.00 8.64  ? 401 ZN  A ZN  1 
HETATM 4157 ZN ZN  . ZN  D 2 .   ? 13.137  -14.165 13.897  1.00 11.32 ? 402 ZN  A ZN  1 
HETATM 4158 C  C1  . GOL E 3 .   ? -0.431  -18.777 12.741  1.00 34.50 ? 403 GOL A C1  1 
HETATM 4159 O  O1  . GOL E 3 .   ? -0.961  -17.595 13.301  1.00 25.47 ? 403 GOL A O1  1 
HETATM 4160 C  C2  . GOL E 3 .   ? 0.632   -18.431 11.705  1.00 39.84 ? 403 GOL A C2  1 
HETATM 4161 O  O2  . GOL E 3 .   ? 1.684   -17.746 12.345  1.00 47.00 ? 403 GOL A O2  1 
HETATM 4162 C  C3  . GOL E 3 .   ? 1.199   -19.714 11.112  1.00 38.10 ? 403 GOL A C3  1 
HETATM 4163 O  O3  . GOL E 3 .   ? 2.212   -20.213 11.956  1.00 43.33 ? 403 GOL A O3  1 
HETATM 4164 C  C1  . GOL F 3 .   ? -7.991  -19.906 -4.914  1.00 47.74 ? 404 GOL A C1  1 
HETATM 4165 O  O1  . GOL F 3 .   ? -8.767  -18.873 -5.468  1.00 36.20 ? 404 GOL A O1  1 
HETATM 4166 C  C2  . GOL F 3 .   ? -8.911  -20.978 -4.360  1.00 57.58 ? 404 GOL A C2  1 
HETATM 4167 O  O2  . GOL F 3 .   ? -8.934  -20.841 -2.959  1.00 66.17 ? 404 GOL A O2  1 
HETATM 4168 C  C3  . GOL F 3 .   ? -8.349  -22.351 -4.697  1.00 58.53 ? 404 GOL A C3  1 
HETATM 4169 O  O3  . GOL F 3 .   ? -7.578  -22.796 -3.604  1.00 56.30 ? 404 GOL A O3  1 
HETATM 4170 C  C1  . GOL G 3 .   ? -13.289 -23.304 -7.100  1.00 56.77 ? 405 GOL A C1  1 
HETATM 4171 O  O1  . GOL G 3 .   ? -12.521 -24.444 -6.790  1.00 59.33 ? 405 GOL A O1  1 
HETATM 4172 C  C2  . GOL G 3 .   ? -12.480 -22.407 -8.026  1.00 54.83 ? 405 GOL A C2  1 
HETATM 4173 O  O2  . GOL G 3 .   ? -11.992 -21.281 -7.333  1.00 47.54 ? 405 GOL A O2  1 
HETATM 4174 C  C3  . GOL G 3 .   ? -13.345 -21.964 -9.195  1.00 57.86 ? 405 GOL A C3  1 
HETATM 4175 O  O3  . GOL G 3 .   ? -14.473 -21.243 -8.750  1.00 58.72 ? 405 GOL A O3  1 
HETATM 4176 CL CL  . CL  H 4 .   ? 5.642   -26.664 -4.677  1.00 22.09 ? 406 CL  A CL  1 
HETATM 4177 CL CL  . CL  I 4 .   ? 0.955   -4.646  -15.119 1.00 21.12 ? 407 CL  A CL  1 
HETATM 4178 C  C   . TRS J 5 .   ? 13.449  -6.951  1.636   1.00 65.79 ? 408 TRS A C   1 
HETATM 4179 C  C1  . TRS J 5 .   ? 12.576  -8.030  1.014   1.00 61.71 ? 408 TRS A C1  1 
HETATM 4180 C  C2  . TRS J 5 .   ? 14.100  -6.112  0.541   1.00 69.28 ? 408 TRS A C2  1 
HETATM 4181 C  C3  . TRS J 5 .   ? 12.627  -6.071  2.564   1.00 59.27 ? 408 TRS A C3  1 
HETATM 4182 N  N   . TRS J 5 .   ? 14.483  -7.603  2.443   1.00 67.69 ? 408 TRS A N   1 
HETATM 4183 O  O1  . TRS J 5 .   ? 12.363  -9.041  1.974   1.00 62.50 ? 408 TRS A O1  1 
HETATM 4184 O  O2  . TRS J 5 .   ? 13.449  -6.348  -0.690  1.00 71.54 ? 408 TRS A O2  1 
HETATM 4185 O  O3  . TRS J 5 .   ? 13.314  -5.934  3.789   1.00 52.13 ? 408 TRS A O3  1 
HETATM 4186 ZN ZN  . ZN  K 2 .   ? 1.471   1.810   -13.241 1.00 12.48 ? 409 ZN  A ZN  1 
HETATM 4187 ZN ZN  . ZN  L 2 .   ? 4.467   13.633  -19.140 1.00 10.10 ? 401 ZN  B ZN  1 
HETATM 4188 C  C1  . GOL M 3 .   ? -2.445  15.840  -13.787 1.00 37.14 ? 402 GOL B C1  1 
HETATM 4189 O  O1  . GOL M 3 .   ? -1.722  16.041  -12.594 1.00 25.36 ? 402 GOL B O1  1 
HETATM 4190 C  C2  . GOL M 3 .   ? -2.752  14.361  -13.990 1.00 42.27 ? 402 GOL B C2  1 
HETATM 4191 O  O2  . GOL M 3 .   ? -2.397  13.630  -12.838 1.00 45.43 ? 402 GOL B O2  1 
HETATM 4192 C  C3  . GOL M 3 .   ? -4.242  14.190  -14.264 1.00 42.17 ? 402 GOL B C3  1 
HETATM 4193 O  O3  . GOL M 3 .   ? -4.545  12.821  -14.414 1.00 46.67 ? 402 GOL B O3  1 
HETATM 4194 C  C1  . GOL N 3 .   ? -9.243  25.019  -27.078 1.00 58.63 ? 403 GOL B C1  1 
HETATM 4195 O  O1  . GOL N 3 .   ? -10.273 24.392  -27.813 1.00 56.21 ? 403 GOL B O1  1 
HETATM 4196 C  C2  . GOL N 3 .   ? -9.696  25.237  -25.637 1.00 57.31 ? 403 GOL B C2  1 
HETATM 4197 O  O2  . GOL N 3 .   ? -11.041 24.849  -25.508 1.00 59.58 ? 403 GOL B O2  1 
HETATM 4198 C  C3  . GOL N 3 .   ? -9.576  26.706  -25.246 1.00 56.52 ? 403 GOL B C3  1 
HETATM 4199 O  O3  . GOL N 3 .   ? -8.300  26.948  -24.700 1.00 52.33 ? 403 GOL B O3  1 
HETATM 4200 C  C1  . GOL O 3 .   ? -11.600 18.201  -33.171 1.00 54.37 ? 404 GOL B C1  1 
HETATM 4201 O  O1  . GOL O 3 .   ? -12.813 18.910  -33.083 1.00 58.36 ? 404 GOL B O1  1 
HETATM 4202 C  C2  . GOL O 3 .   ? -10.569 19.077  -33.867 1.00 56.45 ? 404 GOL B C2  1 
HETATM 4203 O  O2  . GOL O 3 .   ? -10.606 18.830  -35.255 1.00 57.39 ? 404 GOL B O2  1 
HETATM 4204 C  C3  . GOL O 3 .   ? -9.179  18.771  -33.320 1.00 55.60 ? 404 GOL B C3  1 
HETATM 4205 O  O3  . GOL O 3 .   ? -9.131  19.048  -31.937 1.00 54.73 ? 404 GOL B O3  1 
HETATM 4206 CL CL  . CL  P 4 .   ? -11.991 11.014  -30.216 1.00 14.56 ? 405 CL  B CL  1 
HETATM 4207 O  O   . HOH Q 6 .   ? -9.298  -19.033 19.600  1.00 44.06 ? 501 HOH A O   1 
HETATM 4208 O  O   . HOH Q 6 .   ? 15.769  -19.108 11.382  1.00 34.10 ? 502 HOH A O   1 
HETATM 4209 O  O   . HOH Q 6 .   ? -4.591  -0.653  28.319  1.00 27.84 ? 503 HOH A O   1 
HETATM 4210 O  O   . HOH Q 6 .   ? 11.732  -22.798 14.522  1.00 42.07 ? 504 HOH A O   1 
HETATM 4211 O  O   . HOH Q 6 .   ? -2.734  11.455  12.852  1.00 28.67 ? 505 HOH A O   1 
HETATM 4212 O  O   . HOH Q 6 .   ? 3.478   -16.401 12.705  1.00 48.75 ? 506 HOH A O   1 
HETATM 4213 O  O   . HOH Q 6 .   ? 7.716   6.989   20.189  1.00 44.70 ? 507 HOH A O   1 
HETATM 4214 O  O   . HOH Q 6 .   ? -16.590 -19.819 11.129  1.00 28.15 ? 508 HOH A O   1 
HETATM 4215 O  O   . HOH Q 6 .   ? 2.581   -25.734 -12.875 1.00 42.23 ? 509 HOH A O   1 
HETATM 4216 O  O   . HOH Q 6 .   ? 8.922   -13.861 19.478  1.00 47.46 ? 510 HOH A O   1 
HETATM 4217 O  O   . HOH Q 6 .   ? -5.182  -6.596  30.626  1.00 40.63 ? 511 HOH A O   1 
HETATM 4218 O  O   . HOH Q 6 .   ? -10.546 -22.092 -1.839  1.00 23.09 ? 512 HOH A O   1 
HETATM 4219 O  O   . HOH Q 6 .   ? -17.694 4.126   -19.730 1.00 43.91 ? 513 HOH A O   1 
HETATM 4220 O  O   . HOH Q 6 .   ? 5.918   -14.209 19.516  1.00 49.58 ? 514 HOH A O   1 
HETATM 4221 O  O   . HOH Q 6 .   ? -13.619 -19.183 18.140  1.00 40.92 ? 515 HOH A O   1 
HETATM 4222 O  O   . HOH Q 6 .   ? -20.903 -16.441 11.721  1.00 43.31 ? 516 HOH A O   1 
HETATM 4223 O  O   . HOH Q 6 .   ? 4.458   9.130   6.735   1.00 38.91 ? 517 HOH A O   1 
HETATM 4224 O  O   . HOH Q 6 .   ? 1.118   -12.579 27.461  1.00 37.38 ? 518 HOH A O   1 
HETATM 4225 O  O   . HOH Q 6 .   ? -4.956  2.486   24.832  1.00 39.19 ? 519 HOH A O   1 
HETATM 4226 O  O   . HOH Q 6 .   ? -24.938 -13.348 -2.666  1.00 43.50 ? 520 HOH A O   1 
HETATM 4227 O  O   . HOH Q 6 .   ? -14.763 -19.060 -7.667  1.00 18.46 ? 521 HOH A O   1 
HETATM 4228 O  O   . HOH Q 6 .   ? -7.740  9.356   15.868  1.00 32.36 ? 522 HOH A O   1 
HETATM 4229 O  O   . HOH Q 6 .   ? -16.828 -7.502  27.853  1.00 24.84 ? 523 HOH A O   1 
HETATM 4230 O  O   . HOH Q 6 .   ? 16.116  -6.046  9.466   1.00 27.46 ? 524 HOH A O   1 
HETATM 4231 O  O   . HOH Q 6 .   ? -11.250 -23.896 3.129   1.00 37.25 ? 525 HOH A O   1 
HETATM 4232 O  O   . HOH Q 6 .   ? -6.197  7.749   0.886   1.00 27.92 ? 526 HOH A O   1 
HETATM 4233 O  O   . HOH Q 6 .   ? 11.716  6.474   10.334  1.00 41.96 ? 527 HOH A O   1 
HETATM 4234 O  O   . HOH Q 6 .   ? 0.916   -8.727  27.755  1.00 35.10 ? 528 HOH A O   1 
HETATM 4235 O  O   . HOH Q 6 .   ? -9.716  7.055   -20.073 1.00 21.53 ? 529 HOH A O   1 
HETATM 4236 O  O   . HOH Q 6 .   ? 1.084   -27.806 0.991   1.00 47.72 ? 530 HOH A O   1 
HETATM 4237 O  O   . HOH Q 6 .   ? -12.660 -24.143 6.069   1.00 23.40 ? 531 HOH A O   1 
HETATM 4238 O  O   . HOH Q 6 .   ? 7.136   -11.534 5.097   1.00 10.13 ? 532 HOH A O   1 
HETATM 4239 O  O   . HOH Q 6 .   ? -16.889 -3.944  -11.062 1.00 40.68 ? 533 HOH A O   1 
HETATM 4240 O  O   . HOH Q 6 .   ? 4.423   -8.514  -4.516  1.00 27.13 ? 534 HOH A O   1 
HETATM 4241 O  O   . HOH Q 6 .   ? -2.337  8.125   -0.854  1.00 30.41 ? 535 HOH A O   1 
HETATM 4242 O  O   . HOH Q 6 .   ? -7.863  5.257   -16.552 1.00 37.57 ? 536 HOH A O   1 
HETATM 4243 O  O   . HOH Q 6 .   ? -3.336  -24.246 4.875   1.00 18.29 ? 537 HOH A O   1 
HETATM 4244 O  O   . HOH Q 6 .   ? -11.334 -18.767 -5.061  1.00 15.86 ? 538 HOH A O   1 
HETATM 4245 O  O   . HOH Q 6 .   ? -1.029  4.711   -1.953  1.00 45.30 ? 539 HOH A O   1 
HETATM 4246 O  O   . HOH Q 6 .   ? 2.456   -29.195 11.471  1.00 41.05 ? 540 HOH A O   1 
HETATM 4247 O  O   . HOH Q 6 .   ? -0.823  -14.439 22.568  1.00 24.09 ? 541 HOH A O   1 
HETATM 4248 O  O   . HOH Q 6 .   ? -23.731 -17.952 4.746   1.00 36.96 ? 542 HOH A O   1 
HETATM 4249 O  O   . HOH Q 6 .   ? -9.205  -20.496 -9.894  1.00 34.26 ? 543 HOH A O   1 
HETATM 4250 O  O   . HOH Q 6 .   ? -13.862 -26.435 1.550   1.00 41.43 ? 544 HOH A O   1 
HETATM 4251 O  O   . HOH Q 6 .   ? 10.648  -18.513 -3.091  1.00 22.77 ? 545 HOH A O   1 
HETATM 4252 O  O   . HOH Q 6 .   ? -8.187  -16.656 18.207  1.00 24.08 ? 546 HOH A O   1 
HETATM 4253 O  O   . HOH Q 6 .   ? -7.849  7.960   7.521   1.00 27.18 ? 547 HOH A O   1 
HETATM 4254 O  O   . HOH Q 6 .   ? 10.737  -24.766 8.967   1.00 38.59 ? 548 HOH A O   1 
HETATM 4255 O  O   . HOH Q 6 .   ? 2.834   -26.530 2.602   1.00 45.16 ? 549 HOH A O   1 
HETATM 4256 O  O   . HOH Q 6 .   ? -5.581  1.260   22.530  1.00 23.83 ? 550 HOH A O   1 
HETATM 4257 O  O   . HOH Q 6 .   ? 19.571  -13.600 3.113   1.00 41.10 ? 551 HOH A O   1 
HETATM 4258 O  O   . HOH Q 6 .   ? -21.681 -6.161  15.816  1.00 33.12 ? 552 HOH A O   1 
HETATM 4259 O  O   . HOH Q 6 .   ? -3.094  9.055   20.341  1.00 31.76 ? 553 HOH A O   1 
HETATM 4260 O  O   . HOH Q 6 .   ? -19.155 -14.762 15.799  1.00 28.36 ? 554 HOH A O   1 
HETATM 4261 O  O   . HOH Q 6 .   ? 11.420  -12.493 21.599  1.00 12.76 ? 555 HOH A O   1 
HETATM 4262 O  O   . HOH Q 6 .   ? 4.069   -12.271 -8.651  1.00 13.98 ? 556 HOH A O   1 
HETATM 4263 O  O   . HOH Q 6 .   ? 9.171   -19.349 -11.978 1.00 28.01 ? 557 HOH A O   1 
HETATM 4264 O  O   . HOH Q 6 .   ? -21.177 -19.059 -4.158  1.00 37.95 ? 558 HOH A O   1 
HETATM 4265 O  O   . HOH Q 6 .   ? -10.636 -0.866  -14.043 1.00 55.65 ? 559 HOH A O   1 
HETATM 4266 O  O   . HOH Q 6 .   ? -3.623  -5.664  -14.670 1.00 16.18 ? 560 HOH A O   1 
HETATM 4267 O  O   . HOH Q 6 .   ? 10.375  -0.191  -0.575  1.00 24.13 ? 561 HOH A O   1 
HETATM 4268 O  O   . HOH Q 6 .   ? -20.302 -23.859 4.878   1.00 18.96 ? 562 HOH A O   1 
HETATM 4269 O  O   . HOH Q 6 .   ? -8.280  -1.213  29.635  1.00 33.96 ? 563 HOH A O   1 
HETATM 4270 O  O   . HOH Q 6 .   ? -14.837 -3.260  7.658   1.00 24.76 ? 564 HOH A O   1 
HETATM 4271 O  O   . HOH Q 6 .   ? 5.384   2.026   5.357   1.00 20.40 ? 565 HOH A O   1 
HETATM 4272 O  O   . HOH Q 6 .   ? 15.069  7.697   11.730  1.00 48.71 ? 566 HOH A O   1 
HETATM 4273 O  O   . HOH Q 6 .   ? -21.149 -9.210  3.940   1.00 28.99 ? 567 HOH A O   1 
HETATM 4274 O  O   . HOH Q 6 .   ? 8.558   -19.608 -5.772  1.00 24.07 ? 568 HOH A O   1 
HETATM 4275 O  O   . HOH Q 6 .   ? 9.854   5.560   9.514   1.00 41.18 ? 569 HOH A O   1 
HETATM 4276 O  O   . HOH Q 6 .   ? -22.372 -13.105 1.404   1.00 20.72 ? 570 HOH A O   1 
HETATM 4277 O  O   . HOH Q 6 .   ? 9.490   -13.882 17.179  1.00 18.36 ? 571 HOH A O   1 
HETATM 4278 O  O   . HOH Q 6 .   ? -9.724  1.621   8.774   1.00 23.85 ? 572 HOH A O   1 
HETATM 4279 O  O   . HOH Q 6 .   ? 10.012  -12.205 24.873  1.00 21.54 ? 573 HOH A O   1 
HETATM 4280 O  O   . HOH Q 6 .   ? -15.697 -24.717 6.730   1.00 29.82 ? 574 HOH A O   1 
HETATM 4281 O  O   . HOH Q 6 .   ? 11.736  -6.660  -2.736  1.00 35.82 ? 575 HOH A O   1 
HETATM 4282 O  O   . HOH Q 6 .   ? 7.622   -0.300  27.843  1.00 36.58 ? 576 HOH A O   1 
HETATM 4283 O  O   . HOH Q 6 .   ? -14.557 -15.740 -1.003  1.00 13.92 ? 577 HOH A O   1 
HETATM 4284 O  O   . HOH Q 6 .   ? -12.910 -4.121  -1.200  1.00 17.55 ? 578 HOH A O   1 
HETATM 4285 O  O   . HOH Q 6 .   ? 3.336   -2.864  -14.286 1.00 15.63 ? 579 HOH A O   1 
HETATM 4286 O  O   . HOH Q 6 .   ? -5.777  -1.376  -20.094 1.00 23.49 ? 580 HOH A O   1 
HETATM 4287 O  O   . HOH Q 6 .   ? -2.060  0.422   -11.611 1.00 33.93 ? 581 HOH A O   1 
HETATM 4288 O  O   . HOH Q 6 .   ? -18.929 -3.228  5.810   1.00 33.71 ? 582 HOH A O   1 
HETATM 4289 O  O   . HOH Q 6 .   ? -1.748  12.736  5.959   1.00 26.74 ? 583 HOH A O   1 
HETATM 4290 O  O   . HOH Q 6 .   ? -8.511  4.305   1.609   1.00 23.97 ? 584 HOH A O   1 
HETATM 4291 O  O   . HOH Q 6 .   ? 14.617  -6.666  23.779  1.00 16.44 ? 585 HOH A O   1 
HETATM 4292 O  O   . HOH Q 6 .   ? 6.655   -7.896  -2.231  1.00 12.95 ? 586 HOH A O   1 
HETATM 4293 O  O   . HOH Q 6 .   ? 6.230   4.823   6.703   1.00 34.70 ? 587 HOH A O   1 
HETATM 4294 O  O   . HOH Q 6 .   ? -6.785  -3.388  0.066   1.00 9.86  ? 588 HOH A O   1 
HETATM 4295 O  O   . HOH Q 6 .   ? -0.912  -17.083 -14.211 1.00 14.37 ? 589 HOH A O   1 
HETATM 4296 O  O   . HOH Q 6 .   ? -7.280  -29.791 2.915   1.00 37.83 ? 590 HOH A O   1 
HETATM 4297 O  O   . HOH Q 6 .   ? -3.608  0.262   -15.346 1.00 30.43 ? 591 HOH A O   1 
HETATM 4298 O  O   . HOH Q 6 .   ? -8.004  -5.180  -19.332 1.00 38.85 ? 592 HOH A O   1 
HETATM 4299 O  O   . HOH Q 6 .   ? -14.443 -1.883  22.158  1.00 26.82 ? 593 HOH A O   1 
HETATM 4300 O  O   . HOH Q 6 .   ? 2.952   -5.932  -13.065 1.00 15.62 ? 594 HOH A O   1 
HETATM 4301 O  O   . HOH Q 6 .   ? -7.616  -19.210 -7.914  1.00 32.05 ? 595 HOH A O   1 
HETATM 4302 O  O   . HOH Q 6 .   ? 17.284  -3.573  18.120  1.00 21.26 ? 596 HOH A O   1 
HETATM 4303 O  O   . HOH Q 6 .   ? -17.822 -7.088  10.946  1.00 28.75 ? 597 HOH A O   1 
HETATM 4304 O  O   . HOH Q 6 .   ? 4.222   -17.921 9.321   1.00 34.70 ? 598 HOH A O   1 
HETATM 4305 O  O   . HOH Q 6 .   ? -11.437 2.026   3.840   1.00 32.39 ? 599 HOH A O   1 
HETATM 4306 O  O   . HOH Q 6 .   ? -19.182 -12.175 -7.442  1.00 23.39 ? 600 HOH A O   1 
HETATM 4307 O  O   . HOH Q 6 .   ? 0.393   -23.778 -12.178 1.00 23.27 ? 601 HOH A O   1 
HETATM 4308 O  O   . HOH Q 6 .   ? -8.657  -15.595 2.654   1.00 9.60  ? 602 HOH A O   1 
HETATM 4309 O  O   . HOH Q 6 .   ? 0.196   -10.992 20.498  1.00 14.02 ? 603 HOH A O   1 
HETATM 4310 O  O   . HOH Q 6 .   ? -12.441 -7.647  24.268  1.00 16.27 ? 604 HOH A O   1 
HETATM 4311 O  O   . HOH Q 6 .   ? -13.079 1.035   20.418  1.00 39.92 ? 605 HOH A O   1 
HETATM 4312 O  O   . HOH Q 6 .   ? 2.598   -12.901 6.933   1.00 9.60  ? 606 HOH A O   1 
HETATM 4313 O  O   . HOH Q 6 .   ? -11.160 0.370   22.208  1.00 29.25 ? 607 HOH A O   1 
HETATM 4314 O  O   . HOH Q 6 .   ? -18.326 -16.952 -1.852  1.00 20.45 ? 608 HOH A O   1 
HETATM 4315 O  O   . HOH Q 6 .   ? -9.016  -3.336  -9.275  1.00 31.41 ? 609 HOH A O   1 
HETATM 4316 O  O   . HOH Q 6 .   ? -0.998  -14.308 18.625  1.00 15.76 ? 610 HOH A O   1 
HETATM 4317 O  O   . HOH Q 6 .   ? 15.748  -5.608  5.011   1.00 43.12 ? 611 HOH A O   1 
HETATM 4318 O  O   . HOH Q 6 .   ? -12.253 -8.126  -12.553 1.00 35.12 ? 612 HOH A O   1 
HETATM 4319 O  O   . HOH Q 6 .   ? -0.449  6.436   -0.062  1.00 23.13 ? 613 HOH A O   1 
HETATM 4320 O  O   . HOH Q 6 .   ? 17.613  -15.511 7.987   1.00 21.14 ? 614 HOH A O   1 
HETATM 4321 O  O   . HOH Q 6 .   ? -0.028  -30.246 8.948   1.00 32.66 ? 615 HOH A O   1 
HETATM 4322 O  O   . HOH Q 6 .   ? -11.583 -16.135 16.925  1.00 14.85 ? 616 HOH A O   1 
HETATM 4323 O  O   . HOH Q 6 .   ? -19.285 -8.161  -7.404  1.00 33.32 ? 617 HOH A O   1 
HETATM 4324 O  O   . HOH Q 6 .   ? 15.410  4.156   8.144   1.00 47.93 ? 618 HOH A O   1 
HETATM 4325 O  O   . HOH Q 6 .   ? -16.884 -21.319 -1.055  1.00 17.89 ? 619 HOH A O   1 
HETATM 4326 O  O   . HOH Q 6 .   ? 8.545   0.335   13.341  1.00 13.17 ? 620 HOH A O   1 
HETATM 4327 O  O   . HOH Q 6 .   ? -3.660  -2.733  31.002  1.00 36.03 ? 621 HOH A O   1 
HETATM 4328 O  O   . HOH Q 6 .   ? 17.874  -6.968  20.775  1.00 24.43 ? 622 HOH A O   1 
HETATM 4329 O  O   . HOH Q 6 .   ? 20.250  -25.359 0.864   1.00 41.39 ? 623 HOH A O   1 
HETATM 4330 O  O   . HOH Q 6 .   ? -23.193 -21.963 2.592   1.00 26.04 ? 624 HOH A O   1 
HETATM 4331 O  O   . HOH Q 6 .   ? -7.396  -0.654  21.791  1.00 19.37 ? 625 HOH A O   1 
HETATM 4332 O  O   . HOH Q 6 .   ? 10.779  3.960   19.566  1.00 19.07 ? 626 HOH A O   1 
HETATM 4333 O  O   . HOH Q 6 .   ? -18.449 -18.684 9.385   1.00 30.42 ? 627 HOH A O   1 
HETATM 4334 O  O   . HOH Q 6 .   ? 4.723   10.042  14.159  1.00 55.49 ? 628 HOH A O   1 
HETATM 4335 O  O   . HOH Q 6 .   ? 5.757   -6.727  -7.968  1.00 20.68 ? 629 HOH A O   1 
HETATM 4336 O  O   . HOH Q 6 .   ? 10.598  -10.424 -6.573  1.00 30.63 ? 630 HOH A O   1 
HETATM 4337 O  O   . HOH Q 6 .   ? 1.904   -12.233 -10.424 1.00 25.32 ? 631 HOH A O   1 
HETATM 4338 O  O   . HOH Q 6 .   ? -6.133  -2.141  -13.863 1.00 43.51 ? 632 HOH A O   1 
HETATM 4339 O  O   . HOH Q 6 .   ? 16.196  -8.980  20.990  1.00 15.20 ? 633 HOH A O   1 
HETATM 4340 O  O   . HOH Q 6 .   ? 3.681   -11.175 13.225  1.00 9.34  ? 634 HOH A O   1 
HETATM 4341 O  O   . HOH Q 6 .   ? 14.635  -6.006  11.898  1.00 15.22 ? 635 HOH A O   1 
HETATM 4342 O  O   . HOH Q 6 .   ? 4.440   8.282   17.283  1.00 37.78 ? 636 HOH A O   1 
HETATM 4343 O  O   . HOH Q 6 .   ? -18.491 -8.842  13.197  1.00 19.64 ? 637 HOH A O   1 
HETATM 4344 O  O   . HOH Q 6 .   ? -1.548  -18.022 15.995  1.00 24.51 ? 638 HOH A O   1 
HETATM 4345 O  O   . HOH Q 6 .   ? -25.623 -15.369 3.063   1.00 53.99 ? 639 HOH A O   1 
HETATM 4346 O  O   . HOH Q 6 .   ? 8.820   -17.461 11.393  1.00 15.85 ? 640 HOH A O   1 
HETATM 4347 O  O   . HOH Q 6 .   ? 4.053   -14.604 14.204  1.00 23.63 ? 641 HOH A O   1 
HETATM 4348 O  O   . HOH Q 6 .   ? -0.553  -23.779 5.314   1.00 16.01 ? 642 HOH A O   1 
HETATM 4349 O  O   . HOH Q 6 .   ? -7.801  -13.940 -17.183 1.00 28.35 ? 643 HOH A O   1 
HETATM 4350 O  O   . HOH Q 6 .   ? 6.448   -10.162 9.497   1.00 10.10 ? 644 HOH A O   1 
HETATM 4351 O  O   . HOH Q 6 .   ? 5.659   6.072   18.423  1.00 23.86 ? 645 HOH A O   1 
HETATM 4352 O  O   . HOH Q 6 .   ? -12.821 -21.156 -4.654  1.00 24.42 ? 646 HOH A O   1 
HETATM 4353 O  O   . HOH Q 6 .   ? 6.317   -16.011 11.395  1.00 22.46 ? 647 HOH A O   1 
HETATM 4354 O  O   . HOH Q 6 .   ? 8.281   7.268   16.289  1.00 41.62 ? 648 HOH A O   1 
HETATM 4355 O  O   . HOH Q 6 .   ? -4.479  14.551  9.691   1.00 41.10 ? 649 HOH A O   1 
HETATM 4356 O  O   . HOH Q 6 .   ? 6.436   4.418   4.459   1.00 41.74 ? 650 HOH A O   1 
HETATM 4357 O  O   . HOH Q 6 .   ? 11.564  1.451   13.150  1.00 17.15 ? 651 HOH A O   1 
HETATM 4358 O  O   . HOH Q 6 .   ? 7.958   -6.360  -6.888  1.00 33.70 ? 652 HOH A O   1 
HETATM 4359 O  O   . HOH Q 6 .   ? -13.575 12.477  -19.603 1.00 29.16 ? 653 HOH A O   1 
HETATM 4360 O  O   . HOH Q 6 .   ? 3.375   4.827   19.944  1.00 17.28 ? 654 HOH A O   1 
HETATM 4361 O  O   . HOH Q 6 .   ? 0.131   7.115   17.594  1.00 35.44 ? 655 HOH A O   1 
HETATM 4362 O  O   . HOH Q 6 .   ? 15.793  -13.742 7.432   1.00 17.30 ? 656 HOH A O   1 
HETATM 4363 O  O   . HOH Q 6 .   ? -11.890 4.224   16.853  1.00 39.10 ? 657 HOH A O   1 
HETATM 4364 O  O   . HOH Q 6 .   ? 2.906   3.574   23.809  1.00 23.76 ? 658 HOH A O   1 
HETATM 4365 O  O   . HOH Q 6 .   ? -18.947 -10.536 -3.907  1.00 18.31 ? 659 HOH A O   1 
HETATM 4366 O  O   . HOH Q 6 .   ? -19.038 -15.344 2.035   1.00 22.59 ? 660 HOH A O   1 
HETATM 4367 O  O   . HOH Q 6 .   ? -16.212 -2.911  18.972  1.00 24.45 ? 661 HOH A O   1 
HETATM 4368 O  O   . HOH Q 6 .   ? 3.705   -13.819 9.145   1.00 10.02 ? 662 HOH A O   1 
HETATM 4369 O  O   . HOH Q 6 .   ? -11.809 1.234   6.947   1.00 36.67 ? 663 HOH A O   1 
HETATM 4370 O  O   . HOH Q 6 .   ? 6.486   -25.526 5.587   1.00 27.90 ? 664 HOH A O   1 
HETATM 4371 O  O   . HOH Q 6 .   ? -12.682 -12.616 -16.095 1.00 26.15 ? 665 HOH A O   1 
HETATM 4372 O  O   . HOH Q 6 .   ? 5.932   -18.733 -5.882  1.00 11.46 ? 666 HOH A O   1 
HETATM 4373 O  O   . HOH Q 6 .   ? 20.681  -13.286 10.546  1.00 28.37 ? 667 HOH A O   1 
HETATM 4374 O  O   . HOH Q 6 .   ? -4.874  -21.532 -10.239 1.00 24.41 ? 668 HOH A O   1 
HETATM 4375 O  O   . HOH Q 6 .   ? 3.339   3.761   -2.284  1.00 22.40 ? 669 HOH A O   1 
HETATM 4376 O  O   . HOH Q 6 .   ? 6.304   -25.069 -0.265  1.00 24.37 ? 670 HOH A O   1 
HETATM 4377 O  O   . HOH Q 6 .   ? -1.508  -0.104  -8.928  1.00 22.17 ? 671 HOH A O   1 
HETATM 4378 O  O   . HOH Q 6 .   ? 9.474   0.987   25.371  1.00 35.08 ? 672 HOH A O   1 
HETATM 4379 O  O   . HOH Q 6 .   ? -3.893  4.797   23.660  1.00 27.14 ? 673 HOH A O   1 
HETATM 4380 O  O   . HOH Q 6 .   ? -13.740 1.697   4.006   1.00 42.85 ? 674 HOH A O   1 
HETATM 4381 O  O   A HOH Q 6 .   ? 12.264  -11.571 0.632   0.69 13.04 ? 675 HOH A O   1 
HETATM 4382 O  O   B HOH Q 6 .   ? 12.658  -13.144 2.139   0.31 18.65 ? 675 HOH A O   1 
HETATM 4383 O  O   . HOH Q 6 .   ? -7.778  9.891   5.414   1.00 29.56 ? 676 HOH A O   1 
HETATM 4384 O  O   . HOH Q 6 .   ? 15.005  -4.511  19.861  1.00 21.76 ? 677 HOH A O   1 
HETATM 4385 O  O   . HOH Q 6 .   ? -4.167  -11.589 -11.939 1.00 15.34 ? 678 HOH A O   1 
HETATM 4386 O  O   . HOH Q 6 .   ? 3.973   -9.512  -12.398 1.00 28.88 ? 679 HOH A O   1 
HETATM 4387 O  O   . HOH Q 6 .   ? 18.154  -2.448  10.796  1.00 25.98 ? 680 HOH A O   1 
HETATM 4388 O  O   . HOH Q 6 .   ? -1.490  -11.237 -11.367 1.00 16.89 ? 681 HOH A O   1 
HETATM 4389 O  O   . HOH Q 6 .   ? 17.754  -12.398 13.581  1.00 16.21 ? 682 HOH A O   1 
HETATM 4390 O  O   . HOH Q 6 .   ? -8.585  6.176   18.789  1.00 24.60 ? 683 HOH A O   1 
HETATM 4391 O  O   . HOH Q 6 .   ? 10.272  -23.529 -7.048  1.00 50.13 ? 684 HOH A O   1 
HETATM 4392 O  O   . HOH Q 6 .   ? 6.330   -20.822 -14.283 1.00 30.24 ? 685 HOH A O   1 
HETATM 4393 O  O   . HOH Q 6 .   ? 13.063  -8.221  11.277  1.00 11.96 ? 686 HOH A O   1 
HETATM 4394 O  O   . HOH Q 6 .   ? 16.549  -25.528 0.521   1.00 30.43 ? 687 HOH A O   1 
HETATM 4395 O  O   . HOH Q 6 .   ? -8.425  -7.812  30.524  1.00 25.14 ? 688 HOH A O   1 
HETATM 4396 O  O   . HOH Q 6 .   ? -6.552  6.472   -1.255  1.00 42.69 ? 689 HOH A O   1 
HETATM 4397 O  O   . HOH Q 6 .   ? -16.359 0.315   -2.768  1.00 38.92 ? 690 HOH A O   1 
HETATM 4398 O  O   . HOH Q 6 .   ? -21.079 -9.920  15.070  1.00 21.70 ? 691 HOH A O   1 
HETATM 4399 O  O   . HOH Q 6 .   ? -22.143 -12.004 9.062   1.00 40.42 ? 692 HOH A O   1 
HETATM 4400 O  O   . HOH Q 6 .   ? 16.322  -13.012 4.927   1.00 39.90 ? 693 HOH A O   1 
HETATM 4401 O  O   . HOH Q 6 .   ? -8.839  0.711   -4.734  1.00 43.04 ? 694 HOH A O   1 
HETATM 4402 O  O   . HOH Q 6 .   ? 4.808   -14.280 -11.921 1.00 21.04 ? 695 HOH A O   1 
HETATM 4403 O  O   . HOH Q 6 .   ? 20.778  -6.365  11.689  1.00 26.28 ? 696 HOH A O   1 
HETATM 4404 O  O   . HOH Q 6 .   ? -4.379  -19.461 -7.086  1.00 12.55 ? 697 HOH A O   1 
HETATM 4405 O  O   . HOH Q 6 .   ? -7.774  13.862  11.236  1.00 37.07 ? 698 HOH A O   1 
HETATM 4406 O  O   . HOH Q 6 .   ? 15.120  -4.279  7.565   1.00 27.74 ? 699 HOH A O   1 
HETATM 4407 O  O   . HOH Q 6 .   ? -7.035  -12.039 22.762  1.00 20.73 ? 700 HOH A O   1 
HETATM 4408 O  O   . HOH Q 6 .   ? 10.088  -1.894  24.812  1.00 18.76 ? 701 HOH A O   1 
HETATM 4409 O  O   . HOH Q 6 .   ? -11.479 4.454   12.189  1.00 32.52 ? 702 HOH A O   1 
HETATM 4410 O  O   . HOH Q 6 .   ? -13.741 -1.755  -4.169  1.00 28.13 ? 703 HOH A O   1 
HETATM 4411 O  O   . HOH Q 6 .   ? 5.609   -17.233 -12.966 1.00 19.96 ? 704 HOH A O   1 
HETATM 4412 O  O   . HOH Q 6 .   ? 1.628   -15.278 6.309   1.00 12.06 ? 705 HOH A O   1 
HETATM 4413 O  O   . HOH Q 6 .   ? -3.731  -23.562 17.064  1.00 39.81 ? 706 HOH A O   1 
HETATM 4414 O  O   . HOH Q 6 .   ? 22.563  -7.676  15.737  1.00 28.75 ? 707 HOH A O   1 
HETATM 4415 O  O   . HOH Q 6 .   ? -1.438  -12.087 27.244  1.00 44.11 ? 708 HOH A O   1 
HETATM 4416 O  O   . HOH Q 6 .   ? 5.991   -15.420 23.814  1.00 35.53 ? 709 HOH A O   1 
HETATM 4417 O  O   . HOH Q 6 .   ? 16.313  -4.986  22.534  1.00 31.45 ? 710 HOH A O   1 
HETATM 4418 O  O   . HOH Q 6 .   ? -11.247 7.189   11.486  1.00 30.81 ? 711 HOH A O   1 
HETATM 4419 O  O   . HOH Q 6 .   ? -8.850  -10.977 24.608  1.00 26.96 ? 712 HOH A O   1 
HETATM 4420 O  O   . HOH Q 6 .   ? -20.315 -9.545  7.518   1.00 27.05 ? 713 HOH A O   1 
HETATM 4421 O  O   . HOH Q 6 .   ? -22.524 -21.314 7.135   1.00 34.17 ? 714 HOH A O   1 
HETATM 4422 O  O   . HOH Q 6 .   ? -5.214  -16.764 18.989  1.00 25.50 ? 715 HOH A O   1 
HETATM 4423 O  O   . HOH Q 6 .   ? -19.738 -4.587  1.523   1.00 34.16 ? 716 HOH A O   1 
HETATM 4424 O  O   A HOH Q 6 .   ? 16.264  0.045   8.340   0.45 21.89 ? 717 HOH A O   1 
HETATM 4425 O  O   B HOH Q 6 .   ? 16.552  -1.977  8.408   0.55 27.04 ? 717 HOH A O   1 
HETATM 4426 O  O   . HOH Q 6 .   ? -18.980 -5.211  -7.593  1.00 36.00 ? 718 HOH A O   1 
HETATM 4427 O  O   . HOH Q 6 .   ? -10.206 -7.289  -11.778 1.00 30.33 ? 719 HOH A O   1 
HETATM 4428 O  O   . HOH Q 6 .   ? 13.125  5.501   8.476   1.00 31.35 ? 720 HOH A O   1 
HETATM 4429 O  O   . HOH Q 6 .   ? -19.314 -15.636 9.319   1.00 27.14 ? 721 HOH A O   1 
HETATM 4430 O  O   . HOH Q 6 .   ? -7.411  3.300   -3.444  1.00 34.47 ? 722 HOH A O   1 
HETATM 4431 O  O   . HOH Q 6 .   ? 1.867   -17.307 -14.222 1.00 16.34 ? 723 HOH A O   1 
HETATM 4432 O  O   . HOH Q 6 .   ? -4.769  -11.746 24.141  1.00 22.30 ? 724 HOH A O   1 
HETATM 4433 O  O   . HOH Q 6 .   ? -3.516  -23.061 -12.148 1.00 46.85 ? 725 HOH A O   1 
HETATM 4434 O  O   . HOH Q 6 .   ? -13.387 0.183   18.328  1.00 34.90 ? 726 HOH A O   1 
HETATM 4435 O  O   . HOH Q 6 .   ? -9.984  4.244   5.429   1.00 24.23 ? 727 HOH A O   1 
HETATM 4436 O  O   . HOH Q 6 .   ? 24.938  -15.649 9.030   1.00 43.34 ? 728 HOH A O   1 
HETATM 4437 O  O   . HOH Q 6 .   ? -1.329  -2.485  29.457  1.00 39.26 ? 729 HOH A O   1 
HETATM 4438 O  O   . HOH Q 6 .   ? -5.133  -11.089 26.880  1.00 31.53 ? 730 HOH A O   1 
HETATM 4439 O  O   . HOH Q 6 .   ? 0.595   -30.723 5.167   1.00 53.25 ? 731 HOH A O   1 
HETATM 4440 O  O   . HOH Q 6 .   ? 1.291   -16.736 15.728  1.00 21.62 ? 732 HOH A O   1 
HETATM 4441 O  O   . HOH Q 6 .   ? 6.234   -13.741 12.667  1.00 15.05 ? 733 HOH A O   1 
HETATM 4442 O  O   . HOH Q 6 .   ? 12.806  4.486   17.196  1.00 40.53 ? 734 HOH A O   1 
HETATM 4443 O  O   A HOH Q 6 .   ? 2.005   -14.722 10.968  0.60 11.15 ? 735 HOH A O   1 
HETATM 4444 O  O   B HOH Q 6 .   ? 1.446   -16.329 9.346   0.40 20.73 ? 735 HOH A O   1 
HETATM 4445 O  O   . HOH Q 6 .   ? -14.514 -0.115  7.938   1.00 38.15 ? 736 HOH A O   1 
HETATM 4446 O  O   . HOH Q 6 .   ? -1.235  9.938   14.930  1.00 30.65 ? 737 HOH A O   1 
HETATM 4447 O  O   . HOH Q 6 .   ? 18.023  -13.489 9.802   1.00 15.57 ? 738 HOH A O   1 
HETATM 4448 O  O   . HOH Q 6 .   ? 1.735   -27.490 -1.732  1.00 25.01 ? 739 HOH A O   1 
HETATM 4449 O  O   . HOH Q 6 .   ? -0.048  -23.016 -2.419  1.00 24.03 ? 740 HOH A O   1 
HETATM 4450 O  O   . HOH Q 6 .   ? -9.561  2.241   -2.233  1.00 22.91 ? 741 HOH A O   1 
HETATM 4451 O  O   . HOH Q 6 .   ? 22.043  -10.448 17.176  1.00 21.67 ? 742 HOH A O   1 
HETATM 4452 O  O   . HOH Q 6 .   ? 0.367   7.812   15.055  1.00 26.99 ? 743 HOH A O   1 
HETATM 4453 O  O   . HOH Q 6 .   ? -16.230 -28.246 6.505   1.00 50.64 ? 744 HOH A O   1 
HETATM 4454 O  O   . HOH Q 6 .   ? 17.446  -1.479  20.422  1.00 48.76 ? 745 HOH A O   1 
HETATM 4455 O  O   . HOH Q 6 .   ? 9.505   -21.109 -8.613  1.00 24.71 ? 746 HOH A O   1 
HETATM 4456 O  O   . HOH Q 6 .   ? -21.410 -16.458 8.147   1.00 44.93 ? 747 HOH A O   1 
HETATM 4457 O  O   . HOH Q 6 .   ? -1.053  -25.679 16.690  1.00 33.43 ? 748 HOH A O   1 
HETATM 4458 O  O   . HOH Q 6 .   ? -4.705  -14.280 -12.854 1.00 15.35 ? 749 HOH A O   1 
HETATM 4459 O  O   . HOH Q 6 .   ? 10.510  -26.476 5.020   1.00 23.95 ? 750 HOH A O   1 
HETATM 4460 O  O   . HOH Q 6 .   ? -10.912 -22.612 13.696  1.00 29.79 ? 751 HOH A O   1 
HETATM 4461 O  O   . HOH Q 6 .   ? -10.634 -1.097  28.120  1.00 28.06 ? 752 HOH A O   1 
HETATM 4462 O  O   . HOH Q 6 .   ? 11.793  -14.580 0.055   1.00 22.53 ? 753 HOH A O   1 
HETATM 4463 O  O   . HOH Q 6 .   ? 16.947  0.688   20.891  1.00 51.89 ? 754 HOH A O   1 
HETATM 4464 O  O   . HOH Q 6 .   ? 4.947   -18.899 11.608  1.00 36.84 ? 755 HOH A O   1 
HETATM 4465 O  O   . HOH Q 6 .   ? -0.131  13.542  9.094   1.00 27.28 ? 756 HOH A O   1 
HETATM 4466 O  O   . HOH Q 6 .   ? 12.352  -14.604 -2.520  1.00 25.73 ? 757 HOH A O   1 
HETATM 4467 O  O   . HOH Q 6 .   ? 9.762   -7.572  -4.435  1.00 29.75 ? 758 HOH A O   1 
HETATM 4468 O  O   . HOH Q 6 .   ? 22.746  -11.450 8.722   1.00 30.36 ? 759 HOH A O   1 
HETATM 4469 O  O   A HOH Q 6 .   ? -9.928  -26.849 5.340   0.58 22.92 ? 760 HOH A O   1 
HETATM 4470 O  O   B HOH Q 6 .   ? -8.708  -27.633 4.455   0.42 22.69 ? 760 HOH A O   1 
HETATM 4471 O  O   . HOH Q 6 .   ? 2.851   -3.584  29.302  1.00 45.34 ? 761 HOH A O   1 
HETATM 4472 O  O   . HOH Q 6 .   ? 14.422  -10.863 4.086   1.00 24.48 ? 762 HOH A O   1 
HETATM 4473 O  O   . HOH Q 6 .   ? -19.246 12.719  -26.083 1.00 36.98 ? 763 HOH A O   1 
HETATM 4474 O  O   . HOH Q 6 .   ? 19.275  -7.056  8.489   1.00 42.22 ? 764 HOH A O   1 
HETATM 4475 O  O   . HOH Q 6 .   ? -18.414 -25.438 6.495   1.00 42.32 ? 765 HOH A O   1 
HETATM 4476 O  O   . HOH Q 6 .   ? -19.258 -8.764  17.197  1.00 19.06 ? 766 HOH A O   1 
HETATM 4477 O  O   . HOH Q 6 .   ? -6.721  -2.816  -6.050  1.00 43.91 ? 767 HOH A O   1 
HETATM 4478 O  O   . HOH Q 6 .   ? -6.304  -23.230 17.727  1.00 52.55 ? 768 HOH A O   1 
HETATM 4479 O  O   . HOH Q 6 .   ? 3.908   -12.860 18.268  1.00 20.69 ? 769 HOH A O   1 
HETATM 4480 O  O   . HOH Q 6 .   ? 12.458  -17.258 0.510   1.00 19.27 ? 770 HOH A O   1 
HETATM 4481 O  O   . HOH Q 6 .   ? -16.241 -3.964  28.143  1.00 23.27 ? 771 HOH A O   1 
HETATM 4482 O  O   A HOH Q 6 .   ? 2.656   7.028   21.653  0.45 14.76 ? 772 HOH A O   1 
HETATM 4483 O  O   B HOH Q 6 .   ? 0.934   7.372   22.856  0.55 29.51 ? 772 HOH A O   1 
HETATM 4484 O  O   . HOH Q 6 .   ? 19.741  -3.865  20.838  1.00 45.00 ? 773 HOH A O   1 
HETATM 4485 O  O   . HOH Q 6 .   ? 0.223   -4.473  29.957  1.00 34.66 ? 774 HOH A O   1 
HETATM 4486 O  O   . HOH Q 6 .   ? 8.130   -14.201 25.316  1.00 27.65 ? 775 HOH A O   1 
HETATM 4487 O  O   . HOH Q 6 .   ? -3.329  -0.436  -18.236 1.00 31.87 ? 776 HOH A O   1 
HETATM 4488 O  O   . HOH Q 6 .   ? -12.039 -9.585  -14.812 1.00 40.92 ? 777 HOH A O   1 
HETATM 4489 O  O   . HOH Q 6 .   ? 15.131  -14.598 2.416   1.00 38.50 ? 778 HOH A O   1 
HETATM 4490 O  O   . HOH Q 6 .   ? -14.113 -25.456 14.827  1.00 50.62 ? 779 HOH A O   1 
HETATM 4491 O  O   . HOH Q 6 .   ? 1.500   -30.632 2.350   1.00 51.36 ? 780 HOH A O   1 
HETATM 4492 O  O   . HOH Q 6 .   ? -21.189 -17.018 2.163   1.00 31.53 ? 781 HOH A O   1 
HETATM 4493 O  O   . HOH Q 6 .   ? 11.101  -4.391  -5.248  1.00 41.75 ? 782 HOH A O   1 
HETATM 4494 O  O   . HOH Q 6 .   ? -6.266  -16.728 21.665  1.00 32.19 ? 783 HOH A O   1 
HETATM 4495 O  O   . HOH Q 6 .   ? 4.198   -24.669 -14.569 1.00 40.30 ? 784 HOH A O   1 
HETATM 4496 O  O   . HOH Q 6 .   ? -9.849  -28.043 0.506   1.00 42.05 ? 785 HOH A O   1 
HETATM 4497 O  O   . HOH Q 6 .   ? -17.235 -19.606 -3.243  1.00 27.81 ? 786 HOH A O   1 
HETATM 4498 O  O   . HOH Q 6 .   ? 11.815  -16.884 19.523  1.00 40.20 ? 787 HOH A O   1 
HETATM 4499 O  O   . HOH Q 6 .   ? -6.212  2.583   26.960  1.00 40.78 ? 788 HOH A O   1 
HETATM 4500 O  O   . HOH Q 6 .   ? 7.200   -14.814 15.572  1.00 39.28 ? 789 HOH A O   1 
HETATM 4501 O  O   . HOH Q 6 .   ? 23.678  -19.911 3.020   1.00 45.55 ? 790 HOH A O   1 
HETATM 4502 O  O   . HOH Q 6 .   ? -8.721  8.923   18.256  1.00 32.20 ? 791 HOH A O   1 
HETATM 4503 O  O   . HOH Q 6 .   ? -6.491  5.810   20.313  1.00 27.45 ? 792 HOH A O   1 
HETATM 4504 O  O   . HOH Q 6 .   ? -10.850 9.543   -19.234 1.00 32.90 ? 793 HOH A O   1 
HETATM 4505 O  O   . HOH Q 6 .   ? -7.110  -14.761 23.259  1.00 24.31 ? 794 HOH A O   1 
HETATM 4506 O  O   . HOH Q 6 .   ? 4.759   -26.530 1.475   1.00 24.76 ? 795 HOH A O   1 
HETATM 4507 O  O   . HOH Q 6 .   ? 1.786   -13.023 19.697  1.00 21.56 ? 796 HOH A O   1 
HETATM 4508 O  O   . HOH Q 6 .   ? -15.427 -0.518  19.286  1.00 49.07 ? 797 HOH A O   1 
HETATM 4509 O  O   . HOH Q 6 .   ? 8.360   -17.340 14.368  1.00 35.67 ? 798 HOH A O   1 
HETATM 4510 O  O   . HOH Q 6 .   ? 4.078   -21.924 -14.950 1.00 26.47 ? 799 HOH A O   1 
HETATM 4511 O  O   . HOH Q 6 .   ? -2.571  -16.577 18.180  1.00 30.19 ? 800 HOH A O   1 
HETATM 4512 O  O   . HOH Q 6 .   ? -24.880 -10.410 -2.165  1.00 41.56 ? 801 HOH A O   1 
HETATM 4513 O  O   . HOH Q 6 .   ? -6.749  0.918   29.055  1.00 47.16 ? 802 HOH A O   1 
HETATM 4514 O  O   . HOH Q 6 .   ? -0.146  3.674   -9.959  1.00 20.19 ? 803 HOH A O   1 
HETATM 4515 O  O   . HOH Q 6 .   ? 8.221   -12.463 -9.210  1.00 41.28 ? 804 HOH A O   1 
HETATM 4516 O  O   . HOH Q 6 .   ? -8.099  -18.566 21.763  1.00 35.14 ? 805 HOH A O   1 
HETATM 4517 O  O   . HOH Q 6 .   ? 21.976  -10.977 11.177  1.00 37.30 ? 806 HOH A O   1 
HETATM 4518 O  O   . HOH Q 6 .   ? 9.595   -15.935 23.319  1.00 41.77 ? 807 HOH A O   1 
HETATM 4519 O  O   . HOH Q 6 .   ? -10.375 -31.978 6.393   1.00 41.39 ? 808 HOH A O   1 
HETATM 4520 O  O   . HOH Q 6 .   ? -13.884 12.220  -16.705 1.00 48.80 ? 809 HOH A O   1 
HETATM 4521 O  O   . HOH Q 6 .   ? 5.292   5.067   1.671   1.00 37.86 ? 810 HOH A O   1 
HETATM 4522 O  O   . HOH Q 6 .   ? -15.511 -20.522 -5.258  1.00 22.95 ? 811 HOH A O   1 
HETATM 4523 O  O   . HOH Q 6 .   ? -10.588 -13.731 -17.339 1.00 40.81 ? 812 HOH A O   1 
HETATM 4524 O  O   . HOH Q 6 .   ? 12.879  3.492   21.254  1.00 31.44 ? 813 HOH A O   1 
HETATM 4525 O  O   . HOH Q 6 .   ? 10.962  -15.171 21.209  1.00 39.06 ? 814 HOH A O   1 
HETATM 4526 O  O   . HOH Q 6 .   ? -1.885  14.573  7.554   1.00 38.37 ? 815 HOH A O   1 
HETATM 4527 O  O   . HOH Q 6 .   ? -21.068 -9.280  -5.107  1.00 33.26 ? 816 HOH A O   1 
HETATM 4528 O  O   . HOH Q 6 .   ? 20.625  -7.987  21.000  1.00 33.46 ? 817 HOH A O   1 
HETATM 4529 O  O   . HOH Q 6 .   ? -10.412 7.531   8.740   1.00 31.10 ? 818 HOH A O   1 
HETATM 4530 O  O   . HOH Q 6 .   ? -16.643 -10.115 27.328  1.00 20.77 ? 819 HOH A O   1 
HETATM 4531 O  O   . HOH Q 6 .   ? 4.930   -15.098 17.009  1.00 31.57 ? 820 HOH A O   1 
HETATM 4532 O  O   . HOH Q 6 .   ? 8.591   -17.150 -13.011 1.00 37.63 ? 821 HOH A O   1 
HETATM 4533 O  O   . HOH Q 6 .   ? 13.206  -18.053 -2.342  1.00 32.39 ? 822 HOH A O   1 
HETATM 4534 O  O   . HOH Q 6 .   ? -11.516 11.761  -20.943 1.00 26.31 ? 823 HOH A O   1 
HETATM 4535 O  O   . HOH Q 6 .   ? 1.934   -7.381  29.440  1.00 37.57 ? 824 HOH A O   1 
HETATM 4536 O  O   . HOH Q 6 .   ? -2.202  -24.961 19.188  1.00 45.56 ? 825 HOH A O   1 
HETATM 4537 O  O   . HOH Q 6 .   ? 21.434  -8.244  8.967   1.00 40.20 ? 826 HOH A O   1 
HETATM 4538 O  O   A HOH Q 6 .   ? 4.447   5.189   25.561  0.45 15.59 ? 827 HOH A O   1 
HETATM 4539 O  O   B HOH Q 6 .   ? 6.602   3.959   26.581  0.55 22.40 ? 827 HOH A O   1 
HETATM 4540 O  O   . HOH Q 6 .   ? 18.698  -5.098  9.699   1.00 33.65 ? 828 HOH A O   1 
HETATM 4541 O  O   . HOH Q 6 .   ? -11.354 -7.794  31.789  1.00 30.86 ? 829 HOH A O   1 
HETATM 4542 O  O   . HOH Q 6 .   ? -0.696  -12.243 -13.741 1.00 26.11 ? 830 HOH A O   1 
HETATM 4543 O  O   . HOH Q 6 .   ? -10.250 -4.528  -11.647 1.00 30.97 ? 831 HOH A O   1 
HETATM 4544 O  O   . HOH Q 6 .   ? -5.116  7.965   21.222  1.00 32.25 ? 832 HOH A O   1 
HETATM 4545 O  O   . HOH Q 6 .   ? 6.825   -8.489  -9.593  1.00 27.64 ? 833 HOH A O   1 
HETATM 4546 O  O   . HOH Q 6 .   ? -1.759  -24.499 -11.037 1.00 46.52 ? 834 HOH A O   1 
HETATM 4547 O  O   . HOH Q 6 .   ? 5.017   -12.112 10.855  1.00 9.87  ? 835 HOH A O   1 
HETATM 4548 O  O   . HOH Q 6 .   ? -13.256 2.123   15.671  1.00 33.67 ? 836 HOH A O   1 
HETATM 4549 O  O   . HOH Q 6 .   ? 13.397  -19.035 18.377  1.00 46.32 ? 837 HOH A O   1 
HETATM 4550 O  O   . HOH Q 6 .   ? -3.702  2.706   -12.618 1.00 47.51 ? 838 HOH A O   1 
HETATM 4551 O  O   . HOH Q 6 .   ? -0.818  9.283   21.892  1.00 39.73 ? 839 HOH A O   1 
HETATM 4552 O  O   . HOH Q 6 .   ? -3.058  -13.806 24.860  1.00 33.48 ? 840 HOH A O   1 
HETATM 4553 O  O   . HOH Q 6 .   ? -4.281  -22.076 -7.541  1.00 26.81 ? 841 HOH A O   1 
HETATM 4554 O  O   . HOH Q 6 .   ? 3.151   -14.750 -14.138 1.00 24.00 ? 842 HOH A O   1 
HETATM 4555 O  O   . HOH Q 6 .   ? 5.777   -10.973 -10.472 1.00 36.98 ? 843 HOH A O   1 
HETATM 4556 O  O   . HOH Q 6 .   ? -0.835  2.216   -7.647  1.00 23.30 ? 844 HOH A O   1 
HETATM 4557 O  O   . HOH Q 6 .   ? -3.178  2.790   -7.191  1.00 45.77 ? 845 HOH A O   1 
HETATM 4558 O  O   A HOH Q 6 .   ? -13.761 -10.222 23.814  0.53 12.66 ? 846 HOH A O   1 
HETATM 4559 O  O   B HOH Q 6 .   ? -13.314 -12.262 24.977  0.47 15.36 ? 846 HOH A O   1 
HETATM 4560 O  O   . HOH Q 6 .   ? -11.012 1.157   26.942  1.00 30.95 ? 847 HOH A O   1 
HETATM 4561 O  O   . HOH Q 6 .   ? -10.239 -12.884 25.852  1.00 32.40 ? 848 HOH A O   1 
HETATM 4562 O  O   . HOH Q 6 .   ? -6.950  -13.921 -19.691 1.00 31.42 ? 849 HOH A O   1 
HETATM 4563 O  O   . HOH Q 6 .   ? -14.907 -12.233 27.549  1.00 31.87 ? 850 HOH A O   1 
HETATM 4564 O  O   . HOH Q 6 .   ? 5.533   -27.311 3.983   1.00 30.39 ? 851 HOH A O   1 
HETATM 4565 O  O   . HOH Q 6 .   ? 18.568  -27.168 -0.066  1.00 30.70 ? 852 HOH A O   1 
HETATM 4566 O  O   . HOH Q 6 .   ? 14.680  -19.961 -3.979  1.00 26.87 ? 853 HOH A O   1 
HETATM 4567 O  O   . HOH Q 6 .   ? -13.519 -13.327 29.387  1.00 37.50 ? 854 HOH A O   1 
HETATM 4568 O  O   . HOH Q 6 .   ? 11.909  -19.540 20.842  1.00 38.43 ? 855 HOH A O   1 
HETATM 4569 O  O   . HOH R 6 .   ? 9.729   20.950  -40.699 1.00 43.01 ? 501 HOH B O   1 
HETATM 4570 O  O   . HOH R 6 .   ? 10.058  18.814  4.508   1.00 39.78 ? 502 HOH B O   1 
HETATM 4571 O  O   . HOH R 6 .   ? 4.396   -6.549  -21.726 1.00 48.97 ? 503 HOH B O   1 
HETATM 4572 O  O   . HOH R 6 .   ? 15.492  18.062  2.073   1.00 37.54 ? 504 HOH B O   1 
HETATM 4573 O  O   . HOH R 6 .   ? 22.783  6.707   -7.346  1.00 49.52 ? 505 HOH B O   1 
HETATM 4574 O  O   . HOH R 6 .   ? 16.395  24.618  -3.773  1.00 56.16 ? 506 HOH B O   1 
HETATM 4575 O  O   . HOH R 6 .   ? 27.504  16.958  -14.373 1.00 35.64 ? 507 HOH B O   1 
HETATM 4576 O  O   . HOH R 6 .   ? 9.629   14.643  -41.726 1.00 22.12 ? 508 HOH B O   1 
HETATM 4577 O  O   . HOH R 6 .   ? 9.462   26.601  -1.241  1.00 32.27 ? 509 HOH B O   1 
HETATM 4578 O  O   . HOH R 6 .   ? 10.156  27.966  -44.656 1.00 54.05 ? 510 HOH B O   1 
HETATM 4579 O  O   . HOH R 6 .   ? -6.642  27.140  -26.490 1.00 29.03 ? 511 HOH B O   1 
HETATM 4580 O  O   . HOH R 6 .   ? -5.318  31.057  -9.158  1.00 92.44 ? 512 HOH B O   1 
HETATM 4581 O  O   . HOH R 6 .   ? -3.583  6.315   -31.222 1.00 42.69 ? 513 HOH B O   1 
HETATM 4582 O  O   . HOH R 6 .   ? -9.284  17.788  -37.063 1.00 49.69 ? 514 HOH B O   1 
HETATM 4583 O  O   . HOH R 6 .   ? -11.347 19.007  -26.980 1.00 41.47 ? 515 HOH B O   1 
HETATM 4584 O  O   . HOH R 6 .   ? 21.113  26.411  -9.739  1.00 50.81 ? 516 HOH B O   1 
HETATM 4585 O  O   . HOH R 6 .   ? -3.730  24.263  -33.091 1.00 31.15 ? 517 HOH B O   1 
HETATM 4586 O  O   A HOH R 6 .   ? 25.270  16.835  -6.578  0.51 17.65 ? 518 HOH B O   1 
HETATM 4587 O  O   B HOH R 6 .   ? 24.527  18.525  -5.660  0.49 26.07 ? 518 HOH B O   1 
HETATM 4588 O  O   . HOH R 6 .   ? 24.042  13.220  -26.478 1.00 41.69 ? 519 HOH B O   1 
HETATM 4589 O  O   . HOH R 6 .   ? 3.556   17.599  -37.450 1.00 27.59 ? 520 HOH B O   1 
HETATM 4590 O  O   . HOH R 6 .   ? 15.233  -0.877  -19.662 1.00 38.76 ? 521 HOH B O   1 
HETATM 4591 O  O   . HOH R 6 .   ? 3.734   8.508   -21.613 1.00 9.58  ? 522 HOH B O   1 
HETATM 4592 O  O   . HOH R 6 .   ? 7.689   29.254  -40.479 1.00 39.61 ? 523 HOH B O   1 
HETATM 4593 O  O   . HOH R 6 .   ? 25.735  21.859  -10.651 1.00 43.92 ? 524 HOH B O   1 
HETATM 4594 O  O   . HOH R 6 .   ? 9.656   -2.321  -8.100  1.00 25.40 ? 525 HOH B O   1 
HETATM 4595 O  O   . HOH R 6 .   ? 3.698   29.160  -3.700  1.00 28.49 ? 526 HOH B O   1 
HETATM 4596 O  O   . HOH R 6 .   ? 12.068  25.283  -34.760 1.00 32.97 ? 527 HOH B O   1 
HETATM 4597 O  O   . HOH R 6 .   ? 23.432  21.515  -25.682 1.00 29.80 ? 528 HOH B O   1 
HETATM 4598 O  O   . HOH R 6 .   ? 0.305   -3.613  -24.204 1.00 40.39 ? 529 HOH B O   1 
HETATM 4599 O  O   . HOH R 6 .   ? -2.886  34.532  -35.344 1.00 22.40 ? 530 HOH B O   1 
HETATM 4600 O  O   . HOH R 6 .   ? -3.137  27.776  -30.005 1.00 25.15 ? 531 HOH B O   1 
HETATM 4601 O  O   . HOH R 6 .   ? -3.515  31.570  -32.149 1.00 22.68 ? 532 HOH B O   1 
HETATM 4602 O  O   . HOH R 6 .   ? -1.160  34.452  -26.383 1.00 25.99 ? 533 HOH B O   1 
HETATM 4603 O  O   . HOH R 6 .   ? 7.322   35.595  -32.545 1.00 36.53 ? 534 HOH B O   1 
HETATM 4604 O  O   . HOH R 6 .   ? 7.208   9.313   -28.861 1.00 12.73 ? 535 HOH B O   1 
HETATM 4605 O  O   . HOH R 6 .   ? 3.003   38.228  -22.943 1.00 30.07 ? 536 HOH B O   1 
HETATM 4606 O  O   . HOH R 6 .   ? 20.700  1.668   -19.042 1.00 38.75 ? 537 HOH B O   1 
HETATM 4607 O  O   . HOH R 6 .   ? 3.465   2.707   -5.597  1.00 15.58 ? 538 HOH B O   1 
HETATM 4608 O  O   . HOH R 6 .   ? 13.976  29.755  -29.307 1.00 33.64 ? 539 HOH B O   1 
HETATM 4609 O  O   . HOH R 6 .   ? 12.833  29.904  -17.685 1.00 31.87 ? 540 HOH B O   1 
HETATM 4610 O  O   . HOH R 6 .   ? 2.345   12.809  -34.975 1.00 14.33 ? 541 HOH B O   1 
HETATM 4611 O  O   . HOH R 6 .   ? 8.198   13.052  1.049   1.00 38.39 ? 542 HOH B O   1 
HETATM 4612 O  O   . HOH R 6 .   ? -1.624  -5.950  -16.439 1.00 23.29 ? 543 HOH B O   1 
HETATM 4613 O  O   . HOH R 6 .   ? -2.750  30.536  -37.562 1.00 24.69 ? 544 HOH B O   1 
HETATM 4614 O  O   . HOH R 6 .   ? 21.309  17.171  -3.009  1.00 32.18 ? 545 HOH B O   1 
HETATM 4615 O  O   . HOH R 6 .   ? 9.294   -0.979  -18.380 1.00 26.17 ? 546 HOH B O   1 
HETATM 4616 O  O   . HOH R 6 .   ? -9.451  18.068  -29.432 1.00 44.60 ? 547 HOH B O   1 
HETATM 4617 O  O   . HOH R 6 .   ? -13.421 13.060  -14.156 1.00 26.27 ? 548 HOH B O   1 
HETATM 4618 O  O   . HOH R 6 .   ? 20.066  23.777  -24.711 1.00 27.11 ? 549 HOH B O   1 
HETATM 4619 O  O   . HOH R 6 .   ? 6.795   35.333  -17.286 1.00 45.60 ? 550 HOH B O   1 
HETATM 4620 O  O   . HOH R 6 .   ? 7.906   33.096  -11.848 1.00 29.14 ? 551 HOH B O   1 
HETATM 4621 O  O   . HOH R 6 .   ? 5.230   14.121  -5.821  1.00 21.04 ? 552 HOH B O   1 
HETATM 4622 O  O   . HOH R 6 .   ? 17.295  30.815  -10.567 1.00 47.07 ? 553 HOH B O   1 
HETATM 4623 O  O   . HOH R 6 .   ? 1.355   10.923  -12.117 1.00 25.84 ? 554 HOH B O   1 
HETATM 4624 O  O   . HOH R 6 .   ? 19.790  3.305   -8.128  1.00 22.25 ? 555 HOH B O   1 
HETATM 4625 O  O   A HOH R 6 .   ? -8.092  28.924  -18.574 0.53 22.65 ? 556 HOH B O   1 
HETATM 4626 O  O   B HOH R 6 .   ? -8.413  30.836  -17.647 0.47 20.13 ? 556 HOH B O   1 
HETATM 4627 O  O   . HOH R 6 .   ? 14.232  15.031  2.714   1.00 43.76 ? 557 HOH B O   1 
HETATM 4628 O  O   . HOH R 6 .   ? 17.637  24.425  -17.269 1.00 32.27 ? 558 HOH B O   1 
HETATM 4629 O  O   . HOH R 6 .   ? -5.464  6.265   -29.690 1.00 33.30 ? 559 HOH B O   1 
HETATM 4630 O  O   . HOH R 6 .   ? -0.053  30.708  -25.855 1.00 19.23 ? 560 HOH B O   1 
HETATM 4631 O  O   . HOH R 6 .   ? -5.136  8.477   -32.120 1.00 27.49 ? 561 HOH B O   1 
HETATM 4632 O  O   . HOH R 6 .   ? 4.712   11.278  -13.237 1.00 11.62 ? 562 HOH B O   1 
HETATM 4633 O  O   . HOH R 6 .   ? -8.718  19.187  -20.200 1.00 23.72 ? 563 HOH B O   1 
HETATM 4634 O  O   . HOH R 6 .   ? 15.792  21.328  -4.255  1.00 28.63 ? 564 HOH B O   1 
HETATM 4635 O  O   . HOH R 6 .   ? -0.336  22.867  -7.122  1.00 36.69 ? 565 HOH B O   1 
HETATM 4636 O  O   . HOH R 6 .   ? 11.677  28.737  -26.693 1.00 18.75 ? 566 HOH B O   1 
HETATM 4637 O  O   . HOH R 6 .   ? 0.256   24.542  -22.539 1.00 13.55 ? 567 HOH B O   1 
HETATM 4638 O  O   . HOH R 6 .   ? 8.322   13.279  -39.600 1.00 18.59 ? 568 HOH B O   1 
HETATM 4639 O  O   . HOH R 6 .   ? 17.982  26.513  -22.016 1.00 28.54 ? 569 HOH B O   1 
HETATM 4640 O  O   . HOH R 6 .   ? 7.273   3.367   -25.816 1.00 35.51 ? 570 HOH B O   1 
HETATM 4641 O  O   . HOH R 6 .   ? 1.918   11.609  -17.172 1.00 11.46 ? 571 HOH B O   1 
HETATM 4642 O  O   . HOH R 6 .   ? -0.419  8.875   -15.060 1.00 20.75 ? 572 HOH B O   1 
HETATM 4643 O  O   . HOH R 6 .   ? 1.996   5.154   -9.484  1.00 20.30 ? 573 HOH B O   1 
HETATM 4644 O  O   . HOH R 6 .   ? -0.436  19.816  -6.845  1.00 29.32 ? 574 HOH B O   1 
HETATM 4645 O  O   . HOH R 6 .   ? 2.723   12.870  -19.350 1.00 10.63 ? 575 HOH B O   1 
HETATM 4646 O  O   . HOH R 6 .   ? 3.939   21.043  -37.383 1.00 18.29 ? 576 HOH B O   1 
HETATM 4647 O  O   . HOH R 6 .   ? 3.623   35.667  -32.181 1.00 26.76 ? 577 HOH B O   1 
HETATM 4648 O  O   . HOH R 6 .   ? 15.955  6.107   -13.962 1.00 14.47 ? 578 HOH B O   1 
HETATM 4649 O  O   . HOH R 6 .   ? 14.591  5.375   -28.193 1.00 23.22 ? 579 HOH B O   1 
HETATM 4650 O  O   . HOH R 6 .   ? 13.913  30.505  -6.149  1.00 35.87 ? 580 HOH B O   1 
HETATM 4651 O  O   . HOH R 6 .   ? 24.002  22.518  -18.929 1.00 24.55 ? 581 HOH B O   1 
HETATM 4652 O  O   A HOH R 6 .   ? 4.731   13.467  -38.709 0.56 15.82 ? 582 HOH B O   1 
HETATM 4653 O  O   B HOH R 6 .   ? 4.718   11.149  -38.096 0.44 19.17 ? 582 HOH B O   1 
HETATM 4654 O  O   . HOH R 6 .   ? -8.378  22.641  -31.228 1.00 43.16 ? 583 HOH B O   1 
HETATM 4655 O  O   . HOH R 6 .   ? -14.050 23.586  -21.375 1.00 41.48 ? 584 HOH B O   1 
HETATM 4656 O  O   . HOH R 6 .   ? 11.838  33.910  -34.389 1.00 32.31 ? 585 HOH B O   1 
HETATM 4657 O  O   . HOH R 6 .   ? -0.495  11.717  -13.459 1.00 33.49 ? 586 HOH B O   1 
HETATM 4658 O  O   . HOH R 6 .   ? 7.729   10.543  -34.534 1.00 16.05 ? 587 HOH B O   1 
HETATM 4659 O  O   . HOH R 6 .   ? 22.599  22.519  -7.623  1.00 32.49 ? 588 HOH B O   1 
HETATM 4660 O  O   . HOH R 6 .   ? 1.827   14.995  -3.619  1.00 47.14 ? 589 HOH B O   1 
HETATM 4661 O  O   . HOH R 6 .   ? 0.282   26.318  -8.353  1.00 24.32 ? 590 HOH B O   1 
HETATM 4662 O  O   . HOH R 6 .   ? 16.748  2.987   -14.403 1.00 16.96 ? 591 HOH B O   1 
HETATM 4663 O  O   . HOH R 6 .   ? 5.449   8.752   -17.271 1.00 9.61  ? 592 HOH B O   1 
HETATM 4664 O  O   A HOH R 6 .   ? 20.950  10.592  -7.387  0.67 16.73 ? 593 HOH B O   1 
HETATM 4665 O  O   B HOH R 6 .   ? 22.098  8.463   -9.035  0.33 9.72  ? 593 HOH B O   1 
HETATM 4666 O  O   . HOH R 6 .   ? -1.260  1.055   -24.652 1.00 39.81 ? 594 HOH B O   1 
HETATM 4667 O  O   . HOH R 6 .   ? -2.235  17.910  -39.816 1.00 29.88 ? 595 HOH B O   1 
HETATM 4668 O  O   . HOH R 6 .   ? 6.016   27.580  -39.429 1.00 34.15 ? 596 HOH B O   1 
HETATM 4669 O  O   . HOH R 6 .   ? 12.576  34.278  -19.315 1.00 40.50 ? 597 HOH B O   1 
HETATM 4670 O  O   . HOH R 6 .   ? 17.523  9.780   -21.873 1.00 18.22 ? 598 HOH B O   1 
HETATM 4671 O  O   . HOH R 6 .   ? 20.870  4.706   -18.075 1.00 39.86 ? 599 HOH B O   1 
HETATM 4672 O  O   . HOH R 6 .   ? 8.975   2.314   -24.063 1.00 28.66 ? 600 HOH B O   1 
HETATM 4673 O  O   . HOH R 6 .   ? 9.508   0.265   -15.867 1.00 13.88 ? 601 HOH B O   1 
HETATM 4674 O  O   . HOH R 6 .   ? -2.107  16.616  -9.880  1.00 25.08 ? 602 HOH B O   1 
HETATM 4675 O  O   . HOH R 6 .   ? 0.820   34.919  -22.365 1.00 32.22 ? 603 HOH B O   1 
HETATM 4676 O  O   . HOH R 6 .   ? -12.340 14.780  -27.113 1.00 25.46 ? 604 HOH B O   1 
HETATM 4677 O  O   . HOH R 6 .   ? 28.379  16.413  -21.335 1.00 26.84 ? 605 HOH B O   1 
HETATM 4678 O  O   . HOH R 6 .   ? -4.930  8.032   -38.318 1.00 28.69 ? 606 HOH B O   1 
HETATM 4679 O  O   . HOH R 6 .   ? 24.143  9.792   -10.041 1.00 39.36 ? 607 HOH B O   1 
HETATM 4680 O  O   . HOH R 6 .   ? 4.448   15.611  1.052   1.00 43.58 ? 608 HOH B O   1 
HETATM 4681 O  O   . HOH R 6 .   ? 7.264   -2.038  -6.508  1.00 15.22 ? 609 HOH B O   1 
HETATM 4682 O  O   . HOH R 6 .   ? 9.241   -0.760  -4.221  1.00 31.98 ? 610 HOH B O   1 
HETATM 4683 O  O   . HOH R 6 .   ? -0.752  13.572  -10.561 1.00 24.81 ? 611 HOH B O   1 
HETATM 4684 O  O   . HOH R 6 .   ? 19.586  9.035   -23.170 1.00 42.99 ? 612 HOH B O   1 
HETATM 4685 O  O   . HOH R 6 .   ? 1.854   15.694  -7.464  1.00 18.89 ? 613 HOH B O   1 
HETATM 4686 O  O   . HOH R 6 .   ? -0.808  -1.823  -19.243 1.00 22.38 ? 614 HOH B O   1 
HETATM 4687 O  O   . HOH R 6 .   ? 10.973  0.233   -20.341 1.00 27.87 ? 615 HOH B O   1 
HETATM 4688 O  O   . HOH R 6 .   ? 12.200  22.400  -26.029 1.00 14.18 ? 616 HOH B O   1 
HETATM 4689 O  O   . HOH R 6 .   ? -5.677  33.403  -25.634 1.00 38.91 ? 617 HOH B O   1 
HETATM 4690 O  O   . HOH R 6 .   ? 3.139   12.462  0.778   1.00 54.71 ? 618 HOH B O   1 
HETATM 4691 O  O   . HOH R 6 .   ? -5.066  1.587   -18.694 1.00 31.44 ? 619 HOH B O   1 
HETATM 4692 O  O   . HOH R 6 .   ? 3.497   14.612  -41.233 1.00 41.99 ? 620 HOH B O   1 
HETATM 4693 O  O   . HOH R 6 .   ? 5.246   3.270   -24.873 1.00 44.44 ? 621 HOH B O   1 
HETATM 4694 O  O   . HOH R 6 .   ? -1.769  6.503   -14.992 1.00 22.04 ? 622 HOH B O   1 
HETATM 4695 O  O   . HOH R 6 .   ? 16.102  29.223  -17.520 1.00 39.73 ? 623 HOH B O   1 
HETATM 4696 O  O   . HOH R 6 .   ? 30.015  21.934  -15.581 1.00 34.02 ? 624 HOH B O   1 
HETATM 4697 O  O   . HOH R 6 .   ? 17.327  0.330   -25.088 1.00 39.78 ? 625 HOH B O   1 
HETATM 4698 O  O   . HOH R 6 .   ? -4.772  32.975  -34.185 1.00 31.34 ? 626 HOH B O   1 
HETATM 4699 O  O   . HOH R 6 .   ? 17.038  32.885  -24.384 1.00 46.43 ? 627 HOH B O   1 
HETATM 4700 O  O   . HOH R 6 .   ? -1.956  33.858  -14.922 1.00 45.18 ? 628 HOH B O   1 
HETATM 4701 O  O   . HOH R 6 .   ? 20.220  24.788  -20.610 1.00 27.52 ? 629 HOH B O   1 
HETATM 4702 O  O   . HOH R 6 .   ? 9.459   -8.287  -8.539  1.00 31.43 ? 630 HOH B O   1 
HETATM 4703 O  O   . HOH R 6 .   ? 8.812   21.632  4.537   1.00 37.60 ? 631 HOH B O   1 
HETATM 4704 O  O   . HOH R 6 .   ? 1.254   -0.270  -19.929 1.00 20.64 ? 632 HOH B O   1 
HETATM 4705 O  O   . HOH R 6 .   ? 6.930   -7.868  -12.331 1.00 32.03 ? 633 HOH B O   1 
HETATM 4706 O  O   A HOH R 6 .   ? 18.838  21.881  -30.546 0.56 24.69 ? 634 HOH B O   1 
HETATM 4707 O  O   B HOH R 6 .   ? 19.569  20.079  -31.376 0.44 22.19 ? 634 HOH B O   1 
HETATM 4708 O  O   . HOH R 6 .   ? 13.482  -3.130  -17.139 1.00 26.08 ? 635 HOH B O   1 
HETATM 4709 O  O   . HOH R 6 .   ? 23.514  17.727  -27.945 1.00 31.13 ? 636 HOH B O   1 
HETATM 4710 O  O   . HOH R 6 .   ? 4.361   6.342   -33.621 1.00 26.37 ? 637 HOH B O   1 
HETATM 4711 O  O   . HOH R 6 .   ? 23.460  25.644  -14.740 1.00 37.06 ? 638 HOH B O   1 
HETATM 4712 O  O   . HOH R 6 .   ? -3.984  10.902  -31.974 1.00 12.27 ? 639 HOH B O   1 
HETATM 4713 O  O   . HOH R 6 .   ? 17.737  1.010   -12.030 1.00 58.99 ? 640 HOH B O   1 
HETATM 4714 O  O   . HOH R 6 .   ? 8.151   33.756  -8.276  1.00 35.24 ? 641 HOH B O   1 
HETATM 4715 O  O   . HOH R 6 .   ? 23.908  13.671  -11.936 1.00 29.22 ? 642 HOH B O   1 
HETATM 4716 O  O   . HOH R 6 .   ? 17.227  19.298  -3.524  1.00 33.84 ? 643 HOH B O   1 
HETATM 4717 O  O   . HOH R 6 .   ? -12.332 17.084  -25.411 1.00 39.35 ? 644 HOH B O   1 
HETATM 4718 O  O   . HOH R 6 .   ? 5.330   35.099  -28.771 1.00 23.64 ? 645 HOH B O   1 
HETATM 4719 O  O   . HOH R 6 .   ? 7.732   -3.838  -19.672 1.00 39.28 ? 646 HOH B O   1 
HETATM 4720 O  O   . HOH R 6 .   ? 4.853   30.888  -5.290  1.00 26.63 ? 647 HOH B O   1 
HETATM 4721 O  O   . HOH R 6 .   ? 11.585  -0.995  -6.557  1.00 21.37 ? 648 HOH B O   1 
HETATM 4722 O  O   . HOH R 6 .   ? -2.235  11.414  -16.698 1.00 27.22 ? 649 HOH B O   1 
HETATM 4723 O  O   . HOH R 6 .   ? -7.740  16.758  -27.801 1.00 19.65 ? 650 HOH B O   1 
HETATM 4724 O  O   . HOH R 6 .   ? -8.066  16.545  -20.159 1.00 16.77 ? 651 HOH B O   1 
HETATM 4725 O  O   . HOH R 6 .   ? 24.743  9.791   -20.779 1.00 41.25 ? 652 HOH B O   1 
HETATM 4726 O  O   . HOH R 6 .   ? -5.235  30.517  -35.561 1.00 39.39 ? 653 HOH B O   1 
HETATM 4727 O  O   . HOH R 6 .   ? 19.865  10.695  -3.228  1.00 27.29 ? 654 HOH B O   1 
HETATM 4728 O  O   . HOH R 6 .   ? 5.888   23.091  -1.266  1.00 29.36 ? 655 HOH B O   1 
HETATM 4729 O  O   . HOH R 6 .   ? -0.035  4.407   -26.819 1.00 24.75 ? 656 HOH B O   1 
HETATM 4730 O  O   . HOH R 6 .   ? 0.597   21.421  -38.288 1.00 27.13 ? 657 HOH B O   1 
HETATM 4731 O  O   . HOH R 6 .   ? -11.045 12.401  -23.470 1.00 17.70 ? 658 HOH B O   1 
HETATM 4732 O  O   . HOH R 6 .   ? 4.524   21.281  -3.034  1.00 24.47 ? 659 HOH B O   1 
HETATM 4733 O  O   . HOH R 6 .   ? 5.651   19.164  0.717   1.00 34.19 ? 660 HOH B O   1 
HETATM 4734 O  O   . HOH R 6 .   ? 7.193   1.965   -16.158 1.00 13.55 ? 661 HOH B O   1 
HETATM 4735 O  O   . HOH R 6 .   ? 25.743  22.545  -21.198 1.00 25.49 ? 662 HOH B O   1 
HETATM 4736 O  O   . HOH R 6 .   ? 6.790   35.789  -10.028 1.00 36.76 ? 663 HOH B O   1 
HETATM 4737 O  O   . HOH R 6 .   ? 16.822  27.532  -7.518  1.00 48.12 ? 664 HOH B O   1 
HETATM 4738 O  O   . HOH R 6 .   ? 0.356   14.015  -19.744 1.00 14.20 ? 665 HOH B O   1 
HETATM 4739 O  O   . HOH R 6 .   ? 18.615  -0.775  -20.752 1.00 41.94 ? 666 HOH B O   1 
HETATM 4740 O  O   . HOH R 6 .   ? 3.280   3.843   -26.716 1.00 26.44 ? 667 HOH B O   1 
HETATM 4741 O  O   . HOH R 6 .   ? 21.984  15.565  -27.049 1.00 25.09 ? 668 HOH B O   1 
HETATM 4742 O  O   . HOH R 6 .   ? -4.338  21.086  -32.443 1.00 14.77 ? 669 HOH B O   1 
HETATM 4743 O  O   . HOH R 6 .   ? 3.229   10.718  -8.235  1.00 22.78 ? 670 HOH B O   1 
HETATM 4744 O  O   . HOH R 6 .   ? -0.343  2.450   -12.362 1.00 16.35 ? 671 HOH B O   1 
HETATM 4745 O  O   . HOH R 6 .   ? -9.099  4.486   -32.296 1.00 45.65 ? 672 HOH B O   1 
HETATM 4746 O  O   . HOH R 6 .   ? -6.247  29.111  -32.278 1.00 41.01 ? 673 HOH B O   1 
HETATM 4747 O  O   . HOH R 6 .   ? -3.113  11.791  -39.255 1.00 22.45 ? 674 HOH B O   1 
HETATM 4748 O  O   . HOH R 6 .   ? 12.645  7.389   0.175   1.00 38.33 ? 675 HOH B O   1 
HETATM 4749 O  O   . HOH R 6 .   ? 23.473  13.732  -9.608  1.00 42.17 ? 676 HOH B O   1 
HETATM 4750 O  O   . HOH R 6 .   ? -7.985  18.771  -8.086  1.00 31.72 ? 677 HOH B O   1 
HETATM 4751 O  O   . HOH R 6 .   ? 7.373   7.633   -31.240 1.00 23.77 ? 678 HOH B O   1 
HETATM 4752 O  O   . HOH R 6 .   ? 1.580   -2.672  -17.662 1.00 16.87 ? 679 HOH B O   1 
HETATM 4753 O  O   . HOH R 6 .   ? 20.581  9.574   -26.975 1.00 46.35 ? 680 HOH B O   1 
HETATM 4754 O  O   . HOH R 6 .   ? -10.197 10.679  -25.585 1.00 16.99 ? 681 HOH B O   1 
HETATM 4755 O  O   . HOH R 6 .   ? 4.727   18.731  -1.770  1.00 24.79 ? 682 HOH B O   1 
HETATM 4756 O  O   . HOH R 6 .   ? -3.215  10.172  -14.171 1.00 38.99 ? 683 HOH B O   1 
HETATM 4757 O  O   . HOH R 6 .   ? 7.872   18.925  4.368   1.00 46.34 ? 684 HOH B O   1 
HETATM 4758 O  O   . HOH R 6 .   ? -9.862  16.052  -8.843  1.00 28.60 ? 685 HOH B O   1 
HETATM 4759 O  O   . HOH R 6 .   ? -3.067  15.551  -40.163 1.00 26.83 ? 686 HOH B O   1 
HETATM 4760 O  O   . HOH R 6 .   ? 1.119   34.434  -15.108 1.00 36.79 ? 687 HOH B O   1 
HETATM 4761 O  O   . HOH R 6 .   ? 11.613  -5.693  -7.431  1.00 42.84 ? 688 HOH B O   1 
HETATM 4762 O  O   . HOH R 6 .   ? 9.120   -5.220  -17.306 1.00 23.80 ? 689 HOH B O   1 
HETATM 4763 O  O   . HOH R 6 .   ? 22.288  1.498   -11.551 1.00 45.39 ? 690 HOH B O   1 
HETATM 4764 O  O   . HOH R 6 .   ? -6.536  22.107  -35.379 1.00 23.50 ? 691 HOH B O   1 
HETATM 4765 O  O   . HOH R 6 .   ? 14.948  23.948  2.719   1.00 35.49 ? 692 HOH B O   1 
HETATM 4766 O  O   . HOH R 6 .   ? 20.371  8.953   -20.816 1.00 41.77 ? 693 HOH B O   1 
HETATM 4767 O  O   . HOH R 6 .   ? -13.178 13.971  -23.572 1.00 29.69 ? 694 HOH B O   1 
HETATM 4768 O  O   . HOH R 6 .   ? 29.242  14.687  -17.875 1.00 29.58 ? 695 HOH B O   1 
HETATM 4769 O  O   . HOH R 6 .   ? 0.183   12.615  -38.262 1.00 22.80 ? 696 HOH B O   1 
HETATM 4770 O  O   . HOH R 6 .   ? 11.689  35.404  -23.518 1.00 38.48 ? 697 HOH B O   1 
HETATM 4771 O  O   . HOH R 6 .   ? 4.027   1.385   -23.180 1.00 29.30 ? 698 HOH B O   1 
HETATM 4772 O  O   . HOH R 6 .   ? 17.845  25.279  -28.230 1.00 21.67 ? 699 HOH B O   1 
HETATM 4773 O  O   . HOH R 6 .   ? 12.359  10.224  2.484   1.00 44.53 ? 700 HOH B O   1 
HETATM 4774 O  O   . HOH R 6 .   ? -3.494  33.670  -27.372 1.00 35.24 ? 701 HOH B O   1 
HETATM 4775 O  O   . HOH R 6 .   ? 12.566  -1.118  -18.676 1.00 46.85 ? 702 HOH B O   1 
HETATM 4776 O  O   . HOH R 6 .   ? 3.148   32.749  -5.589  1.00 52.67 ? 703 HOH B O   1 
HETATM 4777 O  O   . HOH R 6 .   ? -6.606  36.750  -19.129 1.00 46.51 ? 704 HOH B O   1 
HETATM 4778 O  O   . HOH R 6 .   ? 0.022   4.120   -29.486 1.00 33.41 ? 705 HOH B O   1 
HETATM 4779 O  O   . HOH R 6 .   ? 14.307  17.104  4.504   1.00 43.60 ? 706 HOH B O   1 
HETATM 4780 O  O   . HOH R 6 .   ? -7.082  21.201  -32.663 1.00 25.84 ? 707 HOH B O   1 
HETATM 4781 O  O   . HOH R 6 .   ? 2.069   8.851   -13.889 1.00 19.01 ? 708 HOH B O   1 
HETATM 4782 O  O   A HOH R 6 .   ? 1.035   13.163  -15.239 0.50 10.89 ? 709 HOH B O   1 
HETATM 4783 O  O   B HOH R 6 .   ? -0.665  13.795  -16.905 0.50 21.52 ? 709 HOH B O   1 
HETATM 4784 O  O   . HOH R 6 .   ? 14.997  31.010  -14.245 1.00 50.36 ? 710 HOH B O   1 
HETATM 4785 O  O   A HOH R 6 .   ? 2.630   -5.783  -17.795 0.43 17.41 ? 711 HOH B O   1 
HETATM 4786 O  O   B HOH R 6 .   ? 4.439   -6.644  -17.719 0.57 29.12 ? 711 HOH B O   1 
HETATM 4787 O  O   . HOH R 6 .   ? 14.332  4.124   -2.358  1.00 24.31 ? 712 HOH B O   1 
HETATM 4788 O  O   . HOH R 6 .   ? 2.818   15.117  -37.574 1.00 46.79 ? 713 HOH B O   1 
HETATM 4789 O  O   . HOH R 6 .   ? -11.268 1.297   -25.833 1.00 32.15 ? 714 HOH B O   1 
HETATM 4790 O  O   . HOH R 6 .   ? 22.364  21.322  -28.321 1.00 44.13 ? 715 HOH B O   1 
HETATM 4791 O  O   . HOH R 6 .   ? 19.211  0.891   -6.481  1.00 45.98 ? 716 HOH B O   1 
HETATM 4792 O  O   . HOH R 6 .   ? 12.234  29.697  3.495   1.00 43.49 ? 717 HOH B O   1 
HETATM 4793 O  O   . HOH R 6 .   ? 16.430  5.499   0.632   1.00 41.20 ? 718 HOH B O   1 
HETATM 4794 O  O   . HOH R 6 .   ? 3.560   10.231  -35.867 1.00 39.90 ? 719 HOH B O   1 
HETATM 4795 O  O   . HOH R 6 .   ? 13.036  35.697  -25.463 1.00 59.33 ? 720 HOH B O   1 
HETATM 4796 O  O   . HOH R 6 .   ? -2.255  -7.915  -23.983 1.00 47.60 ? 721 HOH B O   1 
HETATM 4797 O  O   . HOH R 6 .   ? 11.267  17.541  -44.055 1.00 28.26 ? 722 HOH B O   1 
HETATM 4798 O  O   . HOH R 6 .   ? 30.118  16.937  -19.410 1.00 44.24 ? 723 HOH B O   1 
HETATM 4799 O  O   . HOH R 6 .   ? 23.250  11.160  -5.522  1.00 40.59 ? 724 HOH B O   1 
HETATM 4800 O  O   . HOH R 6 .   ? 1.915   21.421  -2.777  1.00 42.16 ? 725 HOH B O   1 
HETATM 4801 O  O   . HOH R 6 .   ? 11.591  3.697   -29.703 1.00 45.00 ? 726 HOH B O   1 
HETATM 4802 O  O   . HOH R 6 .   ? 17.145  3.810   -2.051  1.00 44.62 ? 727 HOH B O   1 
HETATM 4803 O  O   . HOH R 6 .   ? -2.805  3.692   -25.956 1.00 19.73 ? 728 HOH B O   1 
HETATM 4804 O  O   . HOH R 6 .   ? 12.357  13.204  3.303   1.00 35.60 ? 729 HOH B O   1 
HETATM 4805 O  O   . HOH R 6 .   ? 1.024   7.425   -11.015 1.00 35.07 ? 730 HOH B O   1 
HETATM 4806 O  O   . HOH R 6 .   ? 13.038  22.759  -31.845 1.00 45.71 ? 731 HOH B O   1 
HETATM 4807 O  O   . HOH R 6 .   ? 1.673   -0.220  -22.744 1.00 36.95 ? 732 HOH B O   1 
HETATM 4808 O  O   . HOH R 6 .   ? 7.974   5.058   -30.638 1.00 37.10 ? 733 HOH B O   1 
HETATM 4809 O  O   . HOH R 6 .   ? 19.898  1.367   -10.098 1.00 53.20 ? 734 HOH B O   1 
HETATM 4810 O  O   . HOH R 6 .   ? 1.503   8.461   -35.851 1.00 33.66 ? 735 HOH B O   1 
HETATM 4811 O  O   . HOH R 6 .   ? 22.197  14.744  -2.096  1.00 45.34 ? 736 HOH B O   1 
HETATM 4812 O  O   . HOH R 6 .   ? 6.603   6.675   -34.614 1.00 39.78 ? 737 HOH B O   1 
HETATM 4813 O  O   . HOH R 6 .   ? 22.310  20.394  -6.114  1.00 35.54 ? 738 HOH B O   1 
HETATM 4814 O  O   . HOH R 6 .   ? 7.162   25.614  -2.059  1.00 37.09 ? 739 HOH B O   1 
HETATM 4815 O  O   . HOH R 6 .   ? -0.876  37.010  -22.360 1.00 50.15 ? 740 HOH B O   1 
HETATM 4816 O  O   . HOH R 6 .   ? 2.023   7.526   0.060   1.00 46.45 ? 741 HOH B O   1 
HETATM 4817 O  O   . HOH R 6 .   ? -0.731  17.322  -7.872  1.00 42.42 ? 742 HOH B O   1 
HETATM 4818 O  O   . HOH R 6 .   ? -2.904  33.253  -37.820 1.00 21.68 ? 743 HOH B O   1 
HETATM 4819 O  O   . HOH R 6 .   ? 0.956   9.721   -9.421  1.00 51.62 ? 744 HOH B O   1 
HETATM 4820 O  O   A HOH R 6 .   ? 0.284   4.119   -3.624  0.61 33.53 ? 745 HOH B O   1 
HETATM 4821 O  O   B HOH R 6 .   ? 0.859   3.124   -5.931  0.39 21.58 ? 745 HOH B O   1 
HETATM 4822 O  O   . HOH R 6 .   ? -4.345  5.636   -13.893 1.00 48.88 ? 746 HOH B O   1 
HETATM 4823 O  O   . HOH R 6 .   ? 14.361  -3.688  -7.232  1.00 50.86 ? 747 HOH B O   1 
HETATM 4824 O  O   . HOH R 6 .   ? 6.573   22.236  -47.000 1.00 43.74 ? 748 HOH B O   1 
HETATM 4825 O  O   . HOH R 6 .   ? -3.950  25.097  -30.387 1.00 32.20 ? 749 HOH B O   1 
HETATM 4826 O  O   . HOH R 6 .   ? 3.173   12.552  -6.570  1.00 28.10 ? 750 HOH B O   1 
HETATM 4827 O  O   . HOH R 6 .   ? -3.649  37.085  -35.633 1.00 33.24 ? 751 HOH B O   1 
HETATM 4828 O  O   . HOH R 6 .   ? 9.713   -0.118  -22.690 1.00 39.15 ? 752 HOH B O   1 
HETATM 4829 O  O   . HOH R 6 .   ? -5.263  29.638  -29.748 1.00 30.61 ? 753 HOH B O   1 
HETATM 4830 O  O   . HOH R 6 .   ? -1.232  6.889   -12.216 1.00 40.02 ? 754 HOH B O   1 
HETATM 4831 O  O   . HOH R 6 .   ? 6.459   37.125  -30.086 1.00 38.67 ? 755 HOH B O   1 
HETATM 4832 O  O   . HOH R 6 .   ? 21.382  9.508   -1.701  1.00 31.48 ? 756 HOH B O   1 
HETATM 4833 O  O   . HOH R 6 .   ? 6.795   -6.272  -19.151 1.00 55.82 ? 757 HOH B O   1 
HETATM 4834 O  O   . HOH R 6 .   ? -4.484  32.344  -29.923 1.00 28.04 ? 758 HOH B O   1 
HETATM 4835 O  O   . HOH R 6 .   ? 0.051   19.105  -40.204 1.00 37.84 ? 759 HOH B O   1 
HETATM 4836 O  O   . HOH R 6 .   ? -5.379  12.350  -41.213 1.00 31.31 ? 760 HOH B O   1 
HETATM 4837 O  O   . HOH R 6 .   ? 7.349   3.360   -28.692 1.00 34.77 ? 761 HOH B O   1 
HETATM 4838 O  O   . HOH R 6 .   ? 25.408  22.347  -8.101  1.00 36.41 ? 762 HOH B O   1 
HETATM 4839 O  O   . HOH R 6 .   ? 3.654   10.131  -15.652 1.00 11.98 ? 763 HOH B O   1 
HETATM 4840 O  O   . HOH R 6 .   ? 16.870  -1.536  -22.643 1.00 41.79 ? 764 HOH B O   1 
HETATM 4841 O  O   . HOH R 6 .   ? 2.162   19.455  -38.812 1.00 32.34 ? 765 HOH B O   1 
HETATM 4842 O  O   . HOH R 6 .   ? -11.694 11.724  -12.688 1.00 35.84 ? 766 HOH B O   1 
HETATM 4843 O  O   . HOH R 6 .   ? -0.854  13.889  -40.406 1.00 35.45 ? 767 HOH B O   1 
HETATM 4844 O  O   . HOH R 6 .   ? 22.391  11.112  -24.846 1.00 41.00 ? 768 HOH B O   1 
HETATM 4845 O  O   . HOH R 6 .   ? 5.160   27.740  -1.555  1.00 28.36 ? 769 HOH B O   1 
HETATM 4846 O  O   . HOH R 6 .   ? -10.303 0.352   -28.115 1.00 30.22 ? 770 HOH B O   1 
HETATM 4847 O  O   . HOH R 6 .   ? 2.171   36.916  -40.124 1.00 19.02 ? 771 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . HIS A 1   ? 0.6695 0.6975 0.6914 0.0081  0.0045  0.0132  140 HIS A N   
2    C  CA  . HIS A 1   ? 0.5357 0.5601 0.5600 0.0035  0.0027  0.0105  140 HIS A CA  
3    C  C   . HIS A 1   ? 0.6191 0.6492 0.6465 -0.0004 0.0012  0.0123  140 HIS A C   
4    O  O   . HIS A 1   ? 0.8145 0.8476 0.8437 -0.0032 0.0007  0.0136  140 HIS A O   
5    C  CB  . HIS A 1   ? 0.5926 0.6134 0.6173 0.0023  0.0028  0.0089  140 HIS A CB  
6    C  CG  A HIS A 1   ? 0.5421 0.5596 0.5690 -0.0018 0.0011  0.0063  140 HIS A CG  
7    C  CG  B HIS A 1   ? 0.5421 0.5596 0.5690 -0.0018 0.0011  0.0063  140 HIS A CG  
8    N  ND1 A HIS A 1   ? 0.1956 0.2129 0.2234 -0.0039 -0.0003 0.0056  140 HIS A ND1 
9    N  ND1 B HIS A 1   ? 0.1956 0.2129 0.2234 -0.0039 -0.0003 0.0056  140 HIS A ND1 
10   C  CD2 A HIS A 1   ? 0.5420 0.5566 0.5699 -0.0038 0.0006  0.0046  140 HIS A CD2 
11   C  CD2 B HIS A 1   ? 0.5420 0.5566 0.5699 -0.0038 0.0006  0.0046  140 HIS A CD2 
12   C  CE1 A HIS A 1   ? 0.4103 0.4245 0.4393 -0.0067 -0.0014 0.0035  140 HIS A CE1 
13   C  CE1 B HIS A 1   ? 0.4103 0.4245 0.4393 -0.0067 -0.0014 0.0035  140 HIS A CE1 
14   N  NE2 A HIS A 1   ? 0.2709 0.2837 0.3002 -0.0068 -0.0010 0.0029  140 HIS A NE2 
15   N  NE2 B HIS A 1   ? 0.2709 0.2837 0.3002 -0.0068 -0.0010 0.0029  140 HIS A NE2 
16   N  N   . TRP A 2   ? 0.3562 0.3851 0.3835 -0.0013 0.0002  0.0115  141 TRP A N   
17   C  CA  . TRP A 2   ? 0.1715 0.2059 0.1990 -0.0013 -0.0001 0.0140  141 TRP A CA  
18   C  C   . TRP A 2   ? 0.1285 0.1625 0.1571 -0.0058 -0.0022 0.0137  141 TRP A C   
19   O  O   . TRP A 2   ? 0.1259 0.1554 0.1550 -0.0085 -0.0031 0.0115  141 TRP A O   
20   C  CB  . TRP A 2   ? 0.1472 0.1782 0.1723 0.0026  0.0007  0.0126  141 TRP A CB  
21   C  CG  . TRP A 2   ? 0.1370 0.1595 0.1614 0.0015  0.0000  0.0084  141 TRP A CG  
22   C  CD1 . TRP A 2   ? 0.1335 0.1502 0.1565 0.0024  0.0005  0.0060  141 TRP A CD1 
23   C  CD2 . TRP A 2   ? 0.1118 0.1316 0.1371 -0.0009 -0.0015 0.0064  141 TRP A CD2 
24   N  NE1 . TRP A 2   ? 0.1248 0.1362 0.1479 0.0005  -0.0006 0.0029  141 TRP A NE1 
25   C  CE2 . TRP A 2   ? 0.1399 0.1531 0.1644 -0.0012 -0.0017 0.0031  141 TRP A CE2 
26   C  CE3 . TRP A 2   ? 0.1286 0.1508 0.1548 -0.0028 -0.0026 0.0073  141 TRP A CE3 
27   C  CZ2 . TRP A 2   ? 0.1240 0.1340 0.1489 -0.0030 -0.0028 0.0008  141 TRP A CZ2 
28   C  CZ3 . TRP A 2   ? 0.1133 0.1312 0.1396 -0.0044 -0.0037 0.0048  141 TRP A CZ3 
29   C  CH2 . TRP A 2   ? 0.1068 0.1191 0.1326 -0.0042 -0.0037 0.0017  141 TRP A CH2 
30   N  N   . ARG A 3   ? 0.1244 0.1631 0.1531 -0.0063 -0.0028 0.0159  142 ARG A N   
31   C  CA  . ARG A 3   ? 0.1051 0.1419 0.1336 -0.0102 -0.0047 0.0154  142 ARG A CA  
32   C  C   . ARG A 3   ? 0.1482 0.1854 0.1761 -0.0086 -0.0049 0.0153  142 ARG A C   
33   O  O   . ARG A 3   ? 0.1447 0.1864 0.1725 -0.0052 -0.0038 0.0171  142 ARG A O   
34   C  CB  . ARG A 3   ? 0.1234 0.1656 0.1520 -0.0145 -0.0060 0.0189  142 ARG A CB  
35   C  CG  . ARG A 3   ? 0.1457 0.1974 0.1745 -0.0139 -0.0058 0.0234  142 ARG A CG  
36   C  CD  . ARG A 3   ? 0.1362 0.1940 0.1649 -0.0186 -0.0071 0.0272  142 ARG A CD  
37   N  NE  . ARG A 3   ? 0.1581 0.2183 0.1879 -0.0180 -0.0059 0.0280  142 ARG A NE  
38   C  CZ  . ARG A 3   ? 0.1442 0.2105 0.1741 -0.0215 -0.0066 0.0315  142 ARG A CZ  
39   N  NH1 . ARG A 3   ? 0.1589 0.2292 0.1875 -0.0264 -0.0086 0.0346  142 ARG A NH1 
40   N  NH2 . ARG A 3   ? 0.1888 0.2572 0.2200 -0.0205 -0.0054 0.0320  142 ARG A NH2 
41   N  N   . TYR A 4   ? 0.1388 0.1712 0.1661 -0.0106 -0.0062 0.0133  143 TYR A N   
42   C  CA  . TYR A 4   ? 0.1518 0.1848 0.1787 -0.0095 -0.0065 0.0133  143 TYR A CA  
43   C  C   . TYR A 4   ? 0.1929 0.2339 0.2198 -0.0106 -0.0070 0.0175  143 TYR A C   
44   O  O   . TYR A 4   ? 0.2122 0.2563 0.2388 -0.0144 -0.0082 0.0200  143 TYR A O   
45   C  CB  . TYR A 4   ? 0.1442 0.1710 0.1701 -0.0115 -0.0078 0.0106  143 TYR A CB  
46   C  CG  . TYR A 4   ? 0.1293 0.1499 0.1552 -0.0095 -0.0071 0.0068  143 TYR A CG  
47   C  CD1 . TYR A 4   ? 0.1209 0.1401 0.1467 -0.0067 -0.0064 0.0053  143 TYR A CD1 
48   C  CD2 . TYR A 4   ? 0.1302 0.1468 0.1561 -0.0107 -0.0072 0.0050  143 TYR A CD2 
49   C  CE1 . TYR A 4   ? 0.1086 0.1228 0.1341 -0.0055 -0.0060 0.0022  143 TYR A CE1 
50   C  CE2 . TYR A 4   ? 0.0993 0.1114 0.1253 -0.0093 -0.0067 0.0020  143 TYR A CE2 
51   C  CZ  . TYR A 4   ? 0.1213 0.1324 0.1470 -0.0069 -0.0062 0.0007  143 TYR A CZ  
52   O  OH  . TYR A 4   ? 0.1029 0.1101 0.1283 -0.0062 -0.0059 -0.0019 143 TYR A OH  
53   N  N   . GLY A 5   ? 0.1890 0.2337 0.2161 -0.0073 -0.0063 0.0186  144 GLY A N   
54   C  CA  . GLY A 5   ? 0.2176 0.2712 0.2449 -0.0078 -0.0067 0.0230  144 GLY A CA  
55   C  C   . GLY A 5   ? 0.2625 0.3241 0.2905 -0.0059 -0.0054 0.0265  144 GLY A C   
56   O  O   . GLY A 5   ? 0.2630 0.3340 0.2913 -0.0059 -0.0055 0.0309  144 GLY A O   
57   N  N   . GLY A 6   ? 0.2028 0.2613 0.2308 -0.0042 -0.0041 0.0250  145 GLY A N   
58   C  CA  . GLY A 6   ? 0.2034 0.2689 0.2317 -0.0022 -0.0027 0.0283  145 GLY A CA  
59   C  C   . GLY A 6   ? 0.2418 0.3102 0.2687 0.0043  -0.0005 0.0293  145 GLY A C   
60   O  O   . GLY A 6   ? 0.2532 0.3170 0.2788 0.0072  -0.0001 0.0271  145 GLY A O   
61   N  N   . ASP A 7   ? 0.3057 0.3814 0.3324 0.0070  0.0009  0.0329  146 ASP A N   
62   C  CA  . ASP A 7   ? 0.3003 0.3780 0.3246 0.0139  0.0033  0.0341  146 ASP A CA  
63   C  C   . ASP A 7   ? 0.2616 0.3367 0.2844 0.0168  0.0051  0.0336  146 ASP A C   
64   O  O   . ASP A 7   ? 0.2722 0.3490 0.2970 0.0133  0.0046  0.0342  146 ASP A O   
65   C  CB  . ASP A 7   ? 0.4679 0.5587 0.4926 0.0157  0.0036  0.0398  146 ASP A CB  
66   C  CG  . ASP A 7   ? 0.6674 0.7677 0.6923 0.0177  0.0051  0.0443  146 ASP A CG  
67   O  OD1 . ASP A 7   ? 0.6962 0.7980 0.7181 0.0247  0.0076  0.0457  146 ASP A OD1 
68   O  OD2 . ASP A 7   ? 0.7502 0.8559 0.7775 0.0125  0.0038  0.0465  146 ASP A OD2 
69   N  N   . PRO A 8   ? 0.2700 0.3402 0.2889 0.0230  0.0072  0.0324  147 PRO A N   
70   C  CA  . PRO A 8   ? 0.2666 0.3339 0.2821 0.0276  0.0080  0.0316  147 PRO A CA  
71   C  C   . PRO A 8   ? 0.2206 0.2770 0.2356 0.0254  0.0067  0.0264  147 PRO A C   
72   O  O   . PRO A 8   ? 0.2332 0.2836 0.2499 0.0211  0.0055  0.0233  147 PRO A O   
73   C  CB  . PRO A 8   ? 0.2511 0.3153 0.2613 0.0346  0.0107  0.0320  147 PRO A CB  
74   C  CG  . PRO A 8   ? 0.2975 0.3564 0.3080 0.0325  0.0108  0.0300  147 PRO A CG  
75   C  CD  . PRO A 8   ? 0.2733 0.3389 0.2897 0.0258  0.0089  0.0314  147 PRO A CD  
76   N  N   . PRO A 9   ? 0.1989 0.2532 0.2116 0.0283  0.0070  0.0257  148 PRO A N   
77   C  CA  . PRO A 9   ? 0.1791 0.2233 0.1907 0.0268  0.0060  0.0210  148 PRO A CA  
78   C  C   . PRO A 9   ? 0.1904 0.2242 0.1985 0.0276  0.0067  0.0176  148 PRO A C   
79   O  O   . PRO A 9   ? 0.1908 0.2237 0.1954 0.0315  0.0085  0.0187  148 PRO A O   
80   C  CB  . PRO A 9   ? 0.2523 0.2968 0.2606 0.0314  0.0069  0.0217  148 PRO A CB  
81   C  CG  . PRO A 9   ? 0.2928 0.3503 0.3031 0.0330  0.0073  0.0271  148 PRO A CG  
82   C  CD  . PRO A 9   ? 0.2658 0.3281 0.2769 0.0330  0.0082  0.0296  148 PRO A CD  
83   N  N   . TRP A 10  ? 0.2021 0.2283 0.2109 0.0239  0.0053  0.0136  149 TRP A N   
84   C  CA  . TRP A 10  ? 0.1839 0.2008 0.1898 0.0235  0.0055  0.0104  149 TRP A CA  
85   C  C   . TRP A 10  ? 0.1750 0.1846 0.1733 0.0288  0.0072  0.0098  149 TRP A C   
86   O  O   . TRP A 10  ? 0.2205 0.2250 0.2160 0.0294  0.0079  0.0088  149 TRP A O   
87   C  CB  . TRP A 10  ? 0.1947 0.2061 0.2023 0.0192  0.0037  0.0067  149 TRP A CB  
88   C  CG  . TRP A 10  ? 0.2113 0.2266 0.2246 0.0142  0.0021  0.0067  149 TRP A CG  
89   C  CD1 . TRP A 10  ? 0.2098 0.2319 0.2264 0.0125  0.0020  0.0093  149 TRP A CD1 
90   C  CD2 . TRP A 10  ? 0.1496 0.1618 0.1650 0.0103  0.0005  0.0041  149 TRP A CD2 
91   N  NE1 . TRP A 10  ? 0.1752 0.1974 0.1953 0.0078  0.0003  0.0082  149 TRP A NE1 
92   C  CE2 . TRP A 10  ? 0.1555 0.1719 0.1749 0.0068  -0.0005 0.0051  149 TRP A CE2 
93   C  CE3 . TRP A 10  ? 0.1574 0.1639 0.1714 0.0096  -0.0001 0.0012  149 TRP A CE3 
94   C  CZ2 . TRP A 10  ? 0.1807 0.1951 0.2022 0.0032  -0.0020 0.0032  149 TRP A CZ2 
95   C  CZ3 . TRP A 10  ? 0.1854 0.1914 0.2023 0.0060  -0.0015 -0.0005 149 TRP A CZ3 
96   C  CH2 . TRP A 10  ? 0.1789 0.1884 0.1993 0.0031  -0.0024 0.0005  149 TRP A CH2 
97   N  N   . PRO A 11  ? 0.1789 0.1872 0.1733 0.0326  0.0079  0.0101  150 PRO A N   
98   C  CA  . PRO A 11  ? 0.2187 0.2181 0.2044 0.0375  0.0095  0.0093  150 PRO A CA  
99   C  C   . PRO A 11  ? 0.2910 0.2924 0.2734 0.0422  0.0116  0.0121  150 PRO A C   
100  O  O   . PRO A 11  ? 0.2782 0.2705 0.2528 0.0456  0.0129  0.0110  150 PRO A O   
101  C  CB  . PRO A 11  ? 0.2123 0.2119 0.1949 0.0409  0.0099  0.0099  150 PRO A CB  
102  C  CG  . PRO A 11  ? 0.2694 0.2737 0.2588 0.0361  0.0080  0.0091  150 PRO A CG  
103  C  CD  . PRO A 11  ? 0.1882 0.2009 0.1850 0.0322  0.0071  0.0107  150 PRO A CD  
104  N  N   . ARG A 12  ? 0.2688 0.2820 0.2566 0.0422  0.0120  0.0157  151 ARG A N   
105  C  CA  . ARG A 12  ? 0.3401 0.3572 0.3258 0.0464  0.0140  0.0189  151 ARG A CA  
106  C  C   . ARG A 12  ? 0.4352 0.4466 0.4207 0.0439  0.0139  0.0169  151 ARG A C   
107  O  O   . ARG A 12  ? 0.5666 0.5738 0.5463 0.0482  0.0157  0.0176  151 ARG A O   
108  C  CB  . ARG A 12  ? 0.3629 0.3953 0.3550 0.0460  0.0141  0.0236  151 ARG A CB  
109  C  CG  . ARG A 12  ? 0.5606 0.6001 0.5519 0.0498  0.0148  0.0266  151 ARG A CG  
110  C  CD  . ARG A 12  ? 0.6112 0.6489 0.5942 0.0585  0.0177  0.0288  151 ARG A CD  
111  N  NE  . ARG A 12  ? 0.6914 0.7370 0.6746 0.0615  0.0194  0.0328  151 ARG A NE  
112  C  CZ  . ARG A 12  ? 0.7141 0.7546 0.6898 0.0680  0.0219  0.0335  151 ARG A CZ  
113  N  NH1 . ARG A 12  ? 0.6752 0.7243 0.6518 0.0705  0.0235  0.0375  151 ARG A NH1 
114  N  NH2 . ARG A 12  ? 0.6957 0.7221 0.6624 0.0718  0.0228  0.0304  151 ARG A NH2 
115  N  N   . VAL A 13  ? 0.4126 0.4235 0.4038 0.0373  0.0118  0.0146  152 VAL A N   
116  C  CA  . VAL A 13  ? 0.5082 0.5147 0.4998 0.0347  0.0115  0.0129  152 VAL A CA  
117  C  C   . VAL A 13  ? 0.4527 0.4462 0.4394 0.0332  0.0107  0.0086  152 VAL A C   
118  O  O   . VAL A 13  ? 0.4399 0.4271 0.4232 0.0334  0.0112  0.0074  152 VAL A O   
119  C  CB  . VAL A 13  ? 0.6024 0.6159 0.6026 0.0286  0.0098  0.0131  152 VAL A CB  
120  C  CG1 . VAL A 13  ? 0.6668 0.6902 0.6717 0.0273  0.0090  0.0157  152 VAL A CG1 
121  C  CG2 . VAL A 13  ? 0.5917 0.5982 0.5935 0.0234  0.0078  0.0090  152 VAL A CG2 
122  N  N   . SER A 14  ? 0.2716 0.2616 0.2578 0.0316  0.0095  0.0065  153 SER A N   
123  C  CA  . SER A 14  ? 0.2188 0.1974 0.2000 0.0297  0.0085  0.0028  153 SER A CA  
124  C  C   . SER A 14  ? 0.1599 0.1339 0.1357 0.0324  0.0087  0.0021  153 SER A C   
125  O  O   . SER A 14  ? 0.1786 0.1560 0.1586 0.0300  0.0075  0.0015  153 SER A O   
126  C  CB  . SER A 14  ? 0.3146 0.2939 0.3020 0.0232  0.0063  0.0004  153 SER A CB  
127  O  OG  . SER A 14  ? 0.3433 0.3258 0.3349 0.0209  0.0061  0.0008  153 SER A OG  
128  N  N   . PRO A 15  ? 0.2022 0.1684 0.1685 0.0375  0.0103  0.0024  154 PRO A N   
129  C  CA  . PRO A 15  ? 0.2217 0.1838 0.1824 0.0405  0.0106  0.0021  154 PRO A CA  
130  C  C   . PRO A 15  ? 0.1579 0.1142 0.1184 0.0356  0.0085  -0.0013 154 PRO A C   
131  O  O   . PRO A 15  ? 0.1956 0.1524 0.1554 0.0365  0.0083  -0.0014 154 PRO A O   
132  C  CB  . PRO A 15  ? 0.2621 0.2139 0.2109 0.0464  0.0126  0.0024  154 PRO A CB  
133  C  CG  . PRO A 15  ? 0.3046 0.2525 0.2523 0.0448  0.0126  0.0018  154 PRO A CG  
134  C  CD  . PRO A 15  ? 0.3194 0.2799 0.2790 0.0411  0.0119  0.0031  154 PRO A CD  
135  N  N   . ALA A 16  ? 0.1824 0.1343 0.1438 0.0305  0.0070  -0.0036 155 ALA A N   
136  C  CA  . ALA A 16  ? 0.1964 0.1443 0.1580 0.0256  0.0049  -0.0063 155 ALA A CA  
137  C  C   . ALA A 16  ? 0.1954 0.1528 0.1659 0.0233  0.0039  -0.0061 155 ALA A C   
138  O  O   . ALA A 16  ? 0.1863 0.1416 0.1565 0.0207  0.0027  -0.0077 155 ALA A O   
139  C  CB  . ALA A 16  ? 0.2414 0.1853 0.2035 0.0205  0.0035  -0.0083 155 ALA A CB  
140  N  N   . CYS A 17  ? 0.1767 0.1443 0.1545 0.0240  0.0044  -0.0038 156 CYS A N   
141  C  CA  . CYS A 17  ? 0.1431 0.1188 0.1283 0.0218  0.0035  -0.0034 156 CYS A CA  
142  C  C   . CYS A 17  ? 0.1603 0.1367 0.1433 0.0248  0.0039  -0.0027 156 CYS A C   
143  O  O   . CYS A 17  ? 0.1773 0.1585 0.1650 0.0229  0.0029  -0.0028 156 CYS A O   
144  C  CB  . CYS A 17  ? 0.1388 0.1243 0.1310 0.0215  0.0037  -0.0009 156 CYS A CB  
145  S  SG  . CYS A 17  ? 0.1626 0.1485 0.1589 0.0172  0.0029  -0.0018 156 CYS A SG  
146  N  N   . ALA A 18  ? 0.1548 0.1259 0.1300 0.0298  0.0054  -0.0020 157 ALA A N   
147  C  CA  . ALA A 18  ? 0.1720 0.1425 0.1437 0.0332  0.0059  -0.0015 157 ALA A CA  
148  C  C   . ALA A 18  ? 0.1920 0.1513 0.1560 0.0322  0.0052  -0.0044 157 ALA A C   
149  O  O   . ALA A 18  ? 0.2064 0.1622 0.1648 0.0357  0.0059  -0.0042 157 ALA A O   
150  C  CB  . ALA A 18  ? 0.1742 0.1467 0.1415 0.0400  0.0082  0.0015  157 ALA A CB  
151  N  N   . GLY A 19  ? 0.1934 0.1470 0.1566 0.0275  0.0039  -0.0068 158 GLY A N   
152  C  CA  . GLY A 19  ? 0.2033 0.1470 0.1595 0.0251  0.0027  -0.0093 158 GLY A CA  
153  C  C   . GLY A 19  ? 0.2229 0.1697 0.1820 0.0235  0.0018  -0.0100 158 GLY A C   
154  O  O   . GLY A 19  ? 0.2002 0.1568 0.1674 0.0235  0.0017  -0.0088 158 GLY A O   
155  N  N   . ARG A 20  ? 0.2021 0.1402 0.1540 0.0220  0.0009  -0.0118 159 ARG A N   
156  C  CA  . ARG A 20  ? 0.2245 0.1649 0.1781 0.0208  0.0001  -0.0124 159 ARG A CA  
157  C  C   . ARG A 20  ? 0.1875 0.1332 0.1484 0.0149  -0.0017 -0.0136 159 ARG A C   
158  O  O   . ARG A 20  ? 0.2077 0.1575 0.1719 0.0141  -0.0023 -0.0138 159 ARG A O   
159  C  CB  A ARG A 20  ? 0.2848 0.2134 0.2266 0.0217  0.0000  -0.0137 159 ARG A CB  
160  C  CB  B ARG A 20  ? 0.2940 0.2226 0.2358 0.0218  0.0000  -0.0137 159 ARG A CB  
161  C  CG  A ARG A 20  ? 0.3599 0.2816 0.2924 0.0284  0.0020  -0.0126 159 ARG A CG  
162  C  CG  B ARG A 20  ? 0.3660 0.2887 0.2992 0.0287  0.0021  -0.0125 159 ARG A CG  
163  C  CD  A ARG A 20  ? 0.4316 0.3405 0.3515 0.0291  0.0017  -0.0140 159 ARG A CD  
164  C  CD  B ARG A 20  ? 0.4429 0.3604 0.3691 0.0312  0.0023  -0.0129 159 ARG A CD  
165  N  NE  A ARG A 20  ? 0.4935 0.4053 0.4162 0.0264  0.0005  -0.0149 159 ARG A NE  
166  N  NE  B ARG A 20  ? 0.5069 0.4149 0.4263 0.0263  0.0005  -0.0152 159 ARG A NE  
167  C  CZ  A ARG A 20  ? 0.4717 0.3905 0.3986 0.0297  0.0013  -0.0138 159 ARG A CZ  
168  C  CZ  B ARG A 20  ? 0.4768 0.3862 0.3974 0.0237  -0.0007 -0.0161 159 ARG A CZ  
169  N  NH1 A ARG A 20  ? 0.4522 0.3764 0.3810 0.0358  0.0032  -0.0115 159 ARG A NH1 
170  N  NH1 B ARG A 20  ? 0.4753 0.3946 0.4037 0.0258  -0.0002 -0.0150 159 ARG A NH1 
171  N  NH2 A ARG A 20  ? 0.4669 0.3878 0.3960 0.0269  0.0001  -0.0147 159 ARG A NH2 
172  N  NH2 B ARG A 20  ? 0.4904 0.3914 0.4043 0.0187  -0.0024 -0.0179 159 ARG A NH2 
173  N  N   . PHE A 21  ? 0.1590 0.1049 0.1222 0.0111  -0.0026 -0.0142 160 PHE A N   
174  C  CA  . PHE A 21  ? 0.1578 0.1078 0.1263 0.0059  -0.0043 -0.0152 160 PHE A CA  
175  C  C   . PHE A 21  ? 0.1586 0.1165 0.1358 0.0045  -0.0043 -0.0145 160 PHE A C   
176  O  O   . PHE A 21  ? 0.1634 0.1209 0.1415 0.0011  -0.0052 -0.0152 160 PHE A O   
177  C  CB  . PHE A 21  ? 0.1604 0.1024 0.1218 0.0017  -0.0057 -0.0167 160 PHE A CB  
178  C  CG  . PHE A 21  ? 0.1929 0.1257 0.1443 0.0027  -0.0057 -0.0174 160 PHE A CG  
179  C  CD1 . PHE A 21  ? 0.2758 0.1968 0.2162 0.0028  -0.0058 -0.0181 160 PHE A CD1 
180  C  CD2 . PHE A 21  ? 0.2032 0.1386 0.1557 0.0036  -0.0058 -0.0175 160 PHE A CD2 
181  C  CE1 . PHE A 21  ? 0.2684 0.1794 0.1981 0.0038  -0.0059 -0.0188 160 PHE A CE1 
182  C  CE2 . PHE A 21  ? 0.2047 0.1311 0.1474 0.0046  -0.0058 -0.0182 160 PHE A CE2 
183  C  CZ  . PHE A 21  ? 0.2804 0.1944 0.2115 0.0047  -0.0059 -0.0188 160 PHE A CZ  
184  N  N   . GLN A 22  ? 0.1286 0.0936 0.1117 0.0071  -0.0035 -0.0131 161 GLN A N   
185  C  CA  . GLN A 22  ? 0.1126 0.0842 0.1028 0.0063  -0.0035 -0.0122 161 GLN A CA  
186  C  C   . GLN A 22  ? 0.1349 0.1129 0.1317 0.0037  -0.0044 -0.0124 161 GLN A C   
187  O  O   . GLN A 22  ? 0.1385 0.1174 0.1355 0.0031  -0.0049 -0.0130 161 GLN A O   
188  C  CB  . GLN A 22  ? 0.1601 0.1357 0.1521 0.0102  -0.0021 -0.0101 161 GLN A CB  
189  C  CG  . GLN A 22  ? 0.1324 0.1024 0.1179 0.0137  -0.0008 -0.0095 161 GLN A CG  
190  C  CD  . GLN A 22  ? 0.1289 0.0977 0.1149 0.0123  -0.0008 -0.0095 161 GLN A CD  
191  O  OE1 . GLN A 22  ? 0.1381 0.1131 0.1297 0.0120  -0.0006 -0.0083 161 GLN A OE1 
192  N  NE2 . GLN A 22  ? 0.1469 0.1074 0.1266 0.0110  -0.0011 -0.0110 161 GLN A NE2 
193  N  N   . SER A 23  ? 0.1042 0.0863 0.1060 0.0023  -0.0047 -0.0120 162 SER A N   
194  C  CA  . SER A 23  ? 0.1130 0.1007 0.1205 0.0005  -0.0054 -0.0119 162 SER A CA  
195  C  C   . SER A 23  ? 0.1041 0.0964 0.1156 0.0016  -0.0049 -0.0103 162 SER A C   
196  O  O   . SER A 23  ? 0.1188 0.1107 0.1296 0.0030  -0.0042 -0.0093 162 SER A O   
197  C  CB  . SER A 23  ? 0.1108 0.0985 0.1194 -0.0026 -0.0062 -0.0129 162 SER A CB  
198  O  OG  . SER A 23  ? 0.1031 0.0874 0.1078 -0.0044 -0.0069 -0.0141 162 SER A OG  
199  N  N   . PRO A 24  ? 0.0987 0.0950 0.1138 0.0010  -0.0054 -0.0099 163 PRO A N   
200  C  CA  . PRO A 24  ? 0.0988 0.0963 0.1150 -0.0002 -0.0061 -0.0108 163 PRO A CA  
201  C  C   . PRO A 24  ? 0.1030 0.1005 0.1177 0.0014  -0.0059 -0.0107 163 PRO A C   
202  O  O   . PRO A 24  ? 0.1231 0.1202 0.1362 0.0037  -0.0052 -0.0097 163 PRO A O   
203  C  CB  . PRO A 24  ? 0.1119 0.1128 0.1316 -0.0008 -0.0064 -0.0100 163 PRO A CB  
204  C  CG  . PRO A 24  ? 0.1099 0.1125 0.1302 0.0004  -0.0060 -0.0081 163 PRO A CG  
205  C  CD  . PRO A 24  ? 0.0939 0.0940 0.1120 0.0013  -0.0053 -0.0082 163 PRO A CD  
206  N  N   . VAL A 25  ? 0.1009 0.0994 0.1162 0.0004  -0.0064 -0.0115 164 VAL A N   
207  C  CA  . VAL A 25  ? 0.0927 0.0914 0.1068 0.0016  -0.0063 -0.0115 164 VAL A CA  
208  C  C   . VAL A 25  ? 0.1157 0.1184 0.1331 0.0012  -0.0067 -0.0113 164 VAL A C   
209  O  O   . VAL A 25  ? 0.1176 0.1218 0.1371 0.0000  -0.0070 -0.0114 164 VAL A O   
210  C  CB  . VAL A 25  ? 0.1162 0.1112 0.1263 0.0006  -0.0066 -0.0129 164 VAL A CB  
211  C  CG1 . VAL A 25  ? 0.1503 0.1398 0.1556 0.0011  -0.0062 -0.0132 164 VAL A CG1 
212  C  CG2 . VAL A 25  ? 0.1361 0.1327 0.1474 -0.0022 -0.0074 -0.0137 164 VAL A CG2 
213  N  N   . ASP A 26  ? 0.1187 0.1226 0.1360 0.0024  -0.0066 -0.0110 165 ASP A N   
214  C  CA  . ASP A 26  ? 0.1199 0.1270 0.1396 0.0022  -0.0070 -0.0109 165 ASP A CA  
215  C  C   . ASP A 26  ? 0.1294 0.1365 0.1482 0.0009  -0.0073 -0.0121 165 ASP A C   
216  O  O   . ASP A 26  ? 0.1383 0.1430 0.1541 0.0006  -0.0073 -0.0128 165 ASP A O   
217  C  CB  . ASP A 26  ? 0.1153 0.1243 0.1354 0.0040  -0.0068 -0.0098 165 ASP A CB  
218  C  CG  . ASP A 26  ? 0.1526 0.1645 0.1748 0.0038  -0.0072 -0.0096 165 ASP A CG  
219  O  OD1 . ASP A 26  ? 0.1900 0.2028 0.2118 0.0047  -0.0071 -0.0097 165 ASP A OD1 
220  O  OD2 . ASP A 26  ? 0.1344 0.1470 0.1581 0.0029  -0.0075 -0.0094 165 ASP A OD2 
221  N  N   . ILE A 27  ? 0.1010 0.1105 0.1217 0.0000  -0.0075 -0.0121 166 ILE A N   
222  C  CA  . ILE A 27  ? 0.0889 0.1002 0.1091 -0.0013 -0.0078 -0.0127 166 ILE A CA  
223  C  C   . ILE A 27  ? 0.1329 0.1470 0.1544 -0.0003 -0.0077 -0.0124 166 ILE A C   
224  O  O   . ILE A 27  ? 0.1307 0.1465 0.1540 0.0008  -0.0075 -0.0118 166 ILE A O   
225  C  CB  . ILE A 27  ? 0.1227 0.1360 0.1441 -0.0022 -0.0079 -0.0126 166 ILE A CB  
226  C  CG1 . ILE A 27  ? 0.1406 0.1514 0.1611 -0.0032 -0.0080 -0.0129 166 ILE A CG1 
227  C  CG2 . ILE A 27  ? 0.1323 0.1492 0.1534 -0.0035 -0.0081 -0.0127 166 ILE A CG2 
228  C  CD1 . ILE A 27  ? 0.1333 0.1459 0.1550 -0.0036 -0.0080 -0.0126 166 ILE A CD1 
229  N  N   . ARG A 28  ? 0.1395 0.1536 0.1593 -0.0008 -0.0078 -0.0129 167 ARG A N   
230  C  CA  . ARG A 28  ? 0.1628 0.1800 0.1838 -0.0001 -0.0077 -0.0127 167 ARG A CA  
231  C  C   . ARG A 28  ? 0.1488 0.1691 0.1694 -0.0019 -0.0080 -0.0128 167 ARG A C   
232  O  O   . ARG A 28  ? 0.1381 0.1571 0.1559 -0.0038 -0.0085 -0.0134 167 ARG A O   
233  C  CB  . ARG A 28  ? 0.1591 0.1742 0.1783 0.0009  -0.0077 -0.0129 167 ARG A CB  
234  C  CG  . ARG A 28  ? 0.1938 0.2074 0.2134 0.0029  -0.0074 -0.0122 167 ARG A CG  
235  C  CD  . ARG A 28  ? 0.2118 0.2236 0.2290 0.0044  -0.0072 -0.0123 167 ARG A CD  
236  N  NE  . ARG A 28  ? 0.2598 0.2742 0.2779 0.0050  -0.0072 -0.0122 167 ARG A NE  
237  C  CZ  . ARG A 28  ? 0.3371 0.3502 0.3528 0.0064  -0.0070 -0.0123 167 ARG A CZ  
238  N  NH1 . ARG A 28  ? 0.3627 0.3713 0.3743 0.0076  -0.0067 -0.0124 167 ARG A NH1 
239  N  NH2 . ARG A 28  ? 0.3370 0.3528 0.3539 0.0068  -0.0071 -0.0122 167 ARG A NH2 
240  N  N   . PRO A 29  ? 0.1428 0.1670 0.1655 -0.0015 -0.0078 -0.0122 168 PRO A N   
241  C  CA  . PRO A 29  ? 0.1416 0.1703 0.1641 -0.0031 -0.0080 -0.0118 168 PRO A CA  
242  C  C   . PRO A 29  ? 0.1420 0.1732 0.1637 -0.0042 -0.0082 -0.0118 168 PRO A C   
243  O  O   . PRO A 29  ? 0.1664 0.2003 0.1866 -0.0068 -0.0087 -0.0114 168 PRO A O   
244  C  CB  . PRO A 29  ? 0.1758 0.2080 0.2003 -0.0010 -0.0073 -0.0109 168 PRO A CB  
245  C  CG  . PRO A 29  ? 0.1668 0.1945 0.1916 0.0004  -0.0072 -0.0111 168 PRO A CG  
246  C  CD  . PRO A 29  ? 0.1814 0.2057 0.2058 0.0005  -0.0074 -0.0116 168 PRO A CD  
247  N  N   . GLN A 30  ? 0.1558 0.1862 0.1781 -0.0026 -0.0080 -0.0120 169 GLN A N   
248  C  CA  . GLN A 30  ? 0.1705 0.2031 0.1920 -0.0035 -0.0082 -0.0120 169 GLN A CA  
249  C  C   . GLN A 30  ? 0.1788 0.2069 0.1960 -0.0060 -0.0089 -0.0128 169 GLN A C   
250  O  O   . GLN A 30  ? 0.2232 0.2526 0.2385 -0.0079 -0.0094 -0.0128 169 GLN A O   
251  C  CB  . GLN A 30  ? 0.2364 0.2694 0.2598 -0.0009 -0.0077 -0.0119 169 GLN A CB  
252  C  CG  . GLN A 30  ? 0.2511 0.2877 0.2772 0.0012  -0.0071 -0.0110 169 GLN A CG  
253  C  CD  . GLN A 30  ? 0.3417 0.3785 0.3693 0.0034  -0.0067 -0.0107 169 GLN A CD  
254  O  OE1 . GLN A 30  ? 0.3623 0.4020 0.3905 0.0035  -0.0066 -0.0105 169 GLN A OE1 
255  N  NE2 . GLN A 30  ? 0.2758 0.3097 0.3040 0.0049  -0.0067 -0.0105 169 GLN A NE2 
256  N  N   . LEU A 31  ? 0.1474 0.1699 0.1626 -0.0060 -0.0090 -0.0135 170 LEU A N   
257  C  CA  . LEU A 31  ? 0.1733 0.1898 0.1830 -0.0079 -0.0097 -0.0143 170 LEU A CA  
258  C  C   . LEU A 31  ? 0.1587 0.1738 0.1659 -0.0111 -0.0104 -0.0144 170 LEU A C   
259  O  O   . LEU A 31  ? 0.2081 0.2175 0.2097 -0.0133 -0.0111 -0.0150 170 LEU A O   
260  C  CB  A LEU A 31  ? 0.1839 0.1946 0.1919 -0.0053 -0.0092 -0.0149 170 LEU A CB  
261  C  CB  B LEU A 31  ? 0.1849 0.1956 0.1930 -0.0052 -0.0092 -0.0149 170 LEU A CB  
262  C  CG  A LEU A 31  ? 0.2034 0.2141 0.2117 -0.0028 -0.0087 -0.0149 170 LEU A CG  
263  C  CG  B LEU A 31  ? 0.2037 0.2143 0.2121 -0.0026 -0.0087 -0.0149 170 LEU A CG  
264  C  CD1 A LEU A 31  ? 0.2189 0.2254 0.2258 0.0002  -0.0082 -0.0149 170 LEU A CD1 
265  C  CD1 B LEU A 31  ? 0.1785 0.1955 0.1925 -0.0010 -0.0083 -0.0141 170 LEU A CD1 
266  C  CD2 A LEU A 31  ? 0.2297 0.2385 0.2336 -0.0047 -0.0093 -0.0154 170 LEU A CD2 
267  C  CD2 B LEU A 31  ? 0.2176 0.2236 0.2242 0.0002  -0.0082 -0.0149 170 LEU A CD2 
268  N  N   . ALA A 32  ? 0.1328 0.1528 0.1435 -0.0112 -0.0103 -0.0136 171 ALA A N   
269  C  CA  . ALA A 32  ? 0.1233 0.1430 0.1322 -0.0142 -0.0110 -0.0134 171 ALA A CA  
270  C  C   . ALA A 32  ? 0.1696 0.1924 0.1756 -0.0183 -0.0121 -0.0127 171 ALA A C   
271  O  O   . ALA A 32  ? 0.2002 0.2287 0.2080 -0.0184 -0.0120 -0.0119 171 ALA A O   
272  C  CB  . ALA A 32  ? 0.1416 0.1660 0.1547 -0.0129 -0.0105 -0.0125 171 ALA A CB  
273  N  N   . ALA A 33  ? 0.1364 0.1553 0.1376 -0.0220 -0.0132 -0.0128 172 ALA A N   
274  C  CA  . ALA A 33  ? 0.1575 0.1790 0.1551 -0.0269 -0.0146 -0.0119 172 ALA A CA  
275  C  C   . ALA A 33  ? 0.1236 0.1542 0.1242 -0.0289 -0.0150 -0.0100 172 ALA A C   
276  O  O   . ALA A 33  ? 0.1508 0.1806 0.1512 -0.0298 -0.0154 -0.0099 172 ALA A O   
277  C  CB  . ALA A 33  ? 0.1602 0.1718 0.1496 -0.0303 -0.0159 -0.0129 172 ALA A CB  
278  N  N   . PHE A 34  ? 0.1658 0.2056 0.1689 -0.0296 -0.0150 -0.0084 173 PHE A N   
279  C  CA  . PHE A 34  ? 0.1576 0.2074 0.1631 -0.0312 -0.0153 -0.0061 173 PHE A CA  
280  C  C   . PHE A 34  ? 0.1367 0.1861 0.1369 -0.0376 -0.0174 -0.0052 173 PHE A C   
281  O  O   . PHE A 34  ? 0.2013 0.2481 0.1965 -0.0418 -0.0187 -0.0051 173 PHE A O   
282  C  CB  . PHE A 34  ? 0.1632 0.2235 0.1721 -0.0301 -0.0147 -0.0043 173 PHE A CB  
283  C  CG  . PHE A 34  ? 0.2008 0.2726 0.2112 -0.0321 -0.0151 -0.0014 173 PHE A CG  
284  C  CD1 . PHE A 34  ? 0.2367 0.3169 0.2461 -0.0357 -0.0160 0.0008  173 PHE A CD1 
285  C  CD2 . PHE A 34  ? 0.1824 0.2573 0.1952 -0.0304 -0.0147 -0.0005 173 PHE A CD2 
286  C  CE1 . PHE A 34  ? 0.2277 0.3201 0.2386 -0.0374 -0.0163 0.0041  173 PHE A CE1 
287  C  CE2 . PHE A 34  ? 0.2057 0.2921 0.2198 -0.0318 -0.0149 0.0025  173 PHE A CE2 
288  C  CZ  . PHE A 34  ? 0.2290 0.3246 0.2422 -0.0353 -0.0158 0.0049  173 PHE A CZ  
289  N  N   . SER A 35  ? 0.1598 0.2109 0.1607 -0.0385 -0.0177 -0.0044 174 SER A N   
290  C  CA  . SER A 35  ? 0.1511 0.2026 0.1472 -0.0448 -0.0198 -0.0032 174 SER A CA  
291  C  C   . SER A 35  ? 0.1875 0.2524 0.1874 -0.0458 -0.0200 -0.0001 174 SER A C   
292  O  O   . SER A 35  ? 0.1877 0.2550 0.1912 -0.0429 -0.0191 0.0002  174 SER A O   
293  C  CB  . SER A 35  ? 0.1811 0.2219 0.1735 -0.0456 -0.0203 -0.0049 174 SER A CB  
294  O  OG  . SER A 35  ? 0.2393 0.2806 0.2266 -0.0520 -0.0224 -0.0035 174 SER A OG  
295  N  N   . PRO A 36  ? 0.2383 0.3126 0.2372 -0.0498 -0.0210 0.0025  175 PRO A N   
296  C  CA  . PRO A 36  ? 0.3018 0.3904 0.3043 -0.0502 -0.0211 0.0060  175 PRO A CA  
297  C  C   . PRO A 36  ? 0.2921 0.3788 0.2920 -0.0529 -0.0218 0.0070  175 PRO A C   
298  O  O   . PRO A 36  ? 0.3007 0.3970 0.3034 -0.0515 -0.0211 0.0097  175 PRO A O   
299  C  CB  . PRO A 36  ? 0.3361 0.4309 0.3361 -0.0531 -0.0211 0.0088  175 PRO A CB  
300  C  CG  . PRO A 36  ? 0.2758 0.3593 0.2695 -0.0571 -0.0225 0.0067  175 PRO A CG  
301  C  CD  . PRO A 36  ? 0.3134 0.3865 0.3082 -0.0536 -0.0221 0.0027  175 PRO A CD  
302  N  N   . ALA A 37  ? 0.2929 0.3672 0.2872 -0.0562 -0.0231 0.0050  176 ALA A N   
303  C  CA  . ALA A 37  ? 0.2361 0.3070 0.2278 -0.0584 -0.0237 0.0055  176 ALA A CA  
304  C  C   . ALA A 37  ? 0.2471 0.3200 0.2444 -0.0541 -0.0229 0.0045  176 ALA A C   
305  O  O   . ALA A 37  ? 0.2751 0.3491 0.2721 -0.0550 -0.0231 0.0057  176 ALA A O   
306  C  CB  . ALA A 37  ? 0.3273 0.3832 0.3110 -0.0621 -0.0250 0.0035  176 ALA A CB  
307  N  N   . LEU A 38  ? 0.1855 0.2567 0.1873 -0.0484 -0.0212 0.0025  177 LEU A N   
308  C  CA  . LEU A 38  ? 0.1761 0.2459 0.1822 -0.0430 -0.0196 0.0015  177 LEU A CA  
309  C  C   . LEU A 38  ? 0.2080 0.2910 0.2193 -0.0396 -0.0185 0.0041  177 LEU A C   
310  O  O   . LEU A 38  ? 0.2282 0.3161 0.2425 -0.0354 -0.0170 0.0047  177 LEU A O   
311  C  CB  . LEU A 38  ? 0.1611 0.2219 0.1686 -0.0379 -0.0179 -0.0015 177 LEU A CB  
312  C  CG  . LEU A 38  ? 0.1557 0.2031 0.1580 -0.0398 -0.0186 -0.0040 177 LEU A CG  
313  C  CD1 . LEU A 38  ? 0.1479 0.1891 0.1523 -0.0345 -0.0169 -0.0062 177 LEU A CD1 
314  C  CD2 . LEU A 38  ? 0.1916 0.2330 0.1913 -0.0419 -0.0195 -0.0047 177 LEU A CD2 
315  N  N   . ARG A 39  ? 0.1836 0.2716 0.1953 -0.0412 -0.0192 0.0058  178 ARG A N   
316  C  CA  . ARG A 39  ? 0.2093 0.3103 0.2248 -0.0382 -0.0183 0.0088  178 ARG A CA  
317  C  C   . ARG A 39  ? 0.1511 0.2491 0.1700 -0.0315 -0.0163 0.0074  178 ARG A C   
318  O  O   . ARG A 39  ? 0.1627 0.2492 0.1810 -0.0304 -0.0159 0.0044  178 ARG A O   
319  C  CB  . ARG A 39  ? 0.2559 0.3619 0.2689 -0.0425 -0.0194 0.0116  178 ARG A CB  
320  C  CG  . ARG A 39  ? 0.4194 0.5223 0.4263 -0.0490 -0.0207 0.0127  178 ARG A CG  
321  C  CD  . ARG A 39  ? 0.5749 0.6874 0.5815 -0.0493 -0.0201 0.0158  178 ARG A CD  
322  N  NE  . ARG A 39  ? 0.6463 0.7581 0.6549 -0.0468 -0.0195 0.0142  178 ARG A NE  
323  C  CZ  . ARG A 39  ? 0.6910 0.8122 0.7034 -0.0421 -0.0179 0.0157  178 ARG A CZ  
324  N  NH1 . ARG A 39  ? 0.6597 0.7915 0.6739 -0.0390 -0.0166 0.0188  178 ARG A NH1 
325  N  NH2 . ARG A 39  ? 0.7302 0.8501 0.7443 -0.0401 -0.0174 0.0141  178 ARG A NH2 
326  N  N   . PRO A 40  ? 0.1455 0.2534 0.1672 -0.0269 -0.0148 0.0097  179 PRO A N   
327  C  CA  . PRO A 40  ? 0.1260 0.2298 0.1496 -0.0209 -0.0131 0.0085  179 PRO A CA  
328  C  C   . PRO A 40  ? 0.1319 0.2300 0.1551 -0.0229 -0.0139 0.0073  179 PRO A C   
329  O  O   . PRO A 40  ? 0.1407 0.2433 0.1628 -0.0277 -0.0156 0.0089  179 PRO A O   
330  C  CB  . PRO A 40  ? 0.1831 0.2996 0.2083 -0.0165 -0.0118 0.0119  179 PRO A CB  
331  C  CG  . PRO A 40  ? 0.2251 0.3503 0.2502 -0.0182 -0.0121 0.0140  179 PRO A CG  
332  C  CD  . PRO A 40  ? 0.1704 0.2928 0.1932 -0.0263 -0.0146 0.0136  179 PRO A CD  
333  N  N   . LEU A 41  ? 0.1564 0.2448 0.1801 -0.0194 -0.0129 0.0046  180 LEU A N   
334  C  CA  . LEU A 41  ? 0.1286 0.2116 0.1521 -0.0206 -0.0134 0.0035  180 LEU A CA  
335  C  C   . LEU A 41  ? 0.1562 0.2486 0.1810 -0.0195 -0.0133 0.0061  180 LEU A C   
336  O  O   . LEU A 41  ? 0.1942 0.2938 0.2201 -0.0148 -0.0119 0.0079  180 LEU A O   
337  C  CB  . LEU A 41  ? 0.1605 0.2329 0.1845 -0.0168 -0.0121 0.0006  180 LEU A CB  
338  C  CG  . LEU A 41  ? 0.1897 0.2539 0.2129 -0.0168 -0.0119 -0.0016 180 LEU A CG  
339  C  CD1 . LEU A 41  ? 0.2289 0.2844 0.2527 -0.0133 -0.0108 -0.0037 180 LEU A CD1 
340  C  CD2 . LEU A 41  ? 0.2250 0.2845 0.2455 -0.0223 -0.0136 -0.0025 180 LEU A CD2 
341  N  N   . GLU A 42  ? 0.1341 0.2262 0.1583 -0.0233 -0.0147 0.0063  181 GLU A N   
342  C  CA  . GLU A 42  ? 0.1386 0.2397 0.1641 -0.0226 -0.0148 0.0088  181 GLU A CA  
343  C  C   . GLU A 42  ? 0.2120 0.3058 0.2380 -0.0214 -0.0145 0.0069  181 GLU A C   
344  O  O   . GLU A 42  ? 0.2016 0.2880 0.2264 -0.0254 -0.0157 0.0052  181 GLU A O   
345  C  CB  . GLU A 42  ? 0.1463 0.2563 0.1706 -0.0290 -0.0170 0.0116  181 GLU A CB  
346  C  CG  . GLU A 42  ? 0.1762 0.2935 0.1993 -0.0301 -0.0169 0.0139  181 GLU A CG  
347  C  CD  . GLU A 42  ? 0.2430 0.3627 0.2618 -0.0358 -0.0179 0.0165  181 GLU A CD  
348  O  OE1 . GLU A 42  ? 0.2845 0.4088 0.3015 -0.0374 -0.0178 0.0184  181 GLU A OE1 
349  O  OE2 . GLU A 42  ? 0.2635 0.3805 0.2806 -0.0387 -0.0188 0.0168  181 GLU A OE2 
350  N  N   . LEU A 43  ? 0.1610 0.2567 0.1883 -0.0157 -0.0129 0.0074  182 LEU A N   
351  C  CA  . LEU A 43  ? 0.1612 0.2506 0.1890 -0.0140 -0.0124 0.0058  182 LEU A CA  
352  C  C   . LEU A 43  ? 0.2037 0.3027 0.2325 -0.0125 -0.0124 0.0085  182 LEU A C   
353  O  O   . LEU A 43  ? 0.2234 0.3326 0.2524 -0.0095 -0.0117 0.0113  182 LEU A O   
354  C  CB  . LEU A 43  ? 0.1546 0.2359 0.1821 -0.0085 -0.0106 0.0037  182 LEU A CB  
355  C  CG  . LEU A 43  ? 0.2644 0.3341 0.2913 -0.0094 -0.0105 0.0007  182 LEU A CG  
356  C  CD1 . LEU A 43  ? 0.3068 0.3768 0.3331 -0.0125 -0.0113 0.0005  182 LEU A CD1 
357  C  CD2 . LEU A 43  ? 0.2726 0.3369 0.2987 -0.0039 -0.0089 -0.0004 182 LEU A CD2 
358  N  N   . SER A 44  ? 0.1657 0.2620 0.1950 -0.0147 -0.0132 0.0078  183 SER A N   
359  C  CA  . SER A 44  ? 0.1530 0.2572 0.1832 -0.0125 -0.0129 0.0101  183 SER A CA  
360  C  C   . SER A 44  ? 0.1691 0.2648 0.1998 -0.0113 -0.0126 0.0079  183 SER A C   
361  O  O   . SER A 44  ? 0.1636 0.2495 0.1940 -0.0142 -0.0131 0.0052  183 SER A O   
362  C  CB  . SER A 44  ? 0.2341 0.3493 0.2648 -0.0178 -0.0149 0.0131  183 SER A CB  
363  O  OG  . SER A 44  ? 0.2799 0.3887 0.3099 -0.0238 -0.0167 0.0117  183 SER A OG  
364  N  N   . GLY A 45  ? 0.1516 0.2509 0.1824 -0.0066 -0.0114 0.0090  184 GLY A N   
365  C  CA  . GLY A 45  ? 0.1401 0.2323 0.1711 -0.0055 -0.0111 0.0073  184 GLY A CA  
366  C  C   . GLY A 45  ? 0.1072 0.1878 0.1368 -0.0018 -0.0097 0.0045  184 GLY A C   
367  O  O   . GLY A 45  ? 0.1364 0.2103 0.1660 -0.0017 -0.0095 0.0028  184 GLY A O   
368  N  N   . PHE A 46  ? 0.1315 0.2098 0.1595 0.0008  -0.0087 0.0041  185 PHE A N   
369  C  CA  . PHE A 46  ? 0.1316 0.1986 0.1577 0.0034  -0.0077 0.0016  185 PHE A CA  
370  C  C   . PHE A 46  ? 0.1863 0.2512 0.2093 0.0095  -0.0062 0.0020  185 PHE A C   
371  O  O   . PHE A 46  ? 0.1738 0.2289 0.1946 0.0111  -0.0055 0.0001  185 PHE A O   
372  C  CB  . PHE A 46  ? 0.1414 0.2061 0.1668 0.0033  -0.0075 0.0009  185 PHE A CB  
373  C  CG  . PHE A 46  ? 0.1570 0.2172 0.1839 -0.0019 -0.0087 -0.0008 185 PHE A CG  
374  C  CD1 . PHE A 46  ? 0.1837 0.2486 0.2120 -0.0068 -0.0102 0.0000  185 PHE A CD1 
375  C  CD2 . PHE A 46  ? 0.1556 0.2068 0.1817 -0.0018 -0.0083 -0.0029 185 PHE A CD2 
376  C  CE1 . PHE A 46  ? 0.1689 0.2284 0.1972 -0.0111 -0.0111 -0.0016 185 PHE A CE1 
377  C  CE2 . PHE A 46  ? 0.1439 0.1911 0.1708 -0.0058 -0.0092 -0.0043 185 PHE A CE2 
378  C  CZ  . PHE A 46  ? 0.1515 0.2023 0.1791 -0.0102 -0.0106 -0.0037 185 PHE A CZ  
379  N  N   . GLN A 47  ? 0.1765 0.2505 0.1988 0.0129  -0.0055 0.0046  186 GLN A N   
380  C  CA  . GLN A 47  ? 0.1932 0.2647 0.2113 0.0193  -0.0040 0.0052  186 GLN A CA  
381  C  C   . GLN A 47  ? 0.2060 0.2757 0.2245 0.0190  -0.0043 0.0048  186 GLN A C   
382  O  O   . GLN A 47  ? 0.2046 0.2833 0.2242 0.0198  -0.0044 0.0070  186 GLN A O   
383  C  CB  . GLN A 47  ? 0.1991 0.2814 0.2154 0.0242  -0.0029 0.0085  186 GLN A CB  
384  C  CG  . GLN A 47  ? 0.2148 0.2973 0.2294 0.0263  -0.0021 0.0089  186 GLN A CG  
385  C  CD  . GLN A 47  ? 0.3190 0.4069 0.3379 0.0205  -0.0035 0.0090  186 GLN A CD  
386  O  OE1 . GLN A 47  ? 0.3063 0.4048 0.3281 0.0173  -0.0045 0.0111  186 GLN A OE1 
387  N  NE2 . GLN A 47  ? 0.2941 0.3742 0.3127 0.0188  -0.0036 0.0068  186 GLN A NE2 
388  N  N   . LEU A 48  ? 0.1668 0.2252 0.1844 0.0176  -0.0044 0.0022  187 LEU A N   
389  C  CA  . LEU A 48  ? 0.1372 0.1930 0.1555 0.0167  -0.0047 0.0015  187 LEU A CA  
390  C  C   . LEU A 48  ? 0.1783 0.2315 0.1914 0.0227  -0.0034 0.0023  187 LEU A C   
391  O  O   . LEU A 48  ? 0.1845 0.2318 0.1923 0.0270  -0.0023 0.0020  187 LEU A O   
392  C  CB  . LEU A 48  ? 0.1500 0.1954 0.1691 0.0128  -0.0054 -0.0012 187 LEU A CB  
393  C  CG  . LEU A 48  ? 0.1656 0.2110 0.1884 0.0076  -0.0065 -0.0022 187 LEU A CG  
394  C  CD1 . LEU A 48  ? 0.1740 0.2098 0.1971 0.0049  -0.0068 -0.0045 187 LEU A CD1 
395  C  CD2 . LEU A 48  ? 0.1855 0.2395 0.2121 0.0037  -0.0077 -0.0011 187 LEU A CD2 
396  N  N   . PRO A 49  ? 0.1863 0.2436 0.2003 0.0233  -0.0035 0.0032  188 PRO A N   
397  C  CA  . PRO A 49  ? 0.2273 0.2811 0.2359 0.0290  -0.0023 0.0037  188 PRO A CA  
398  C  C   . PRO A 49  ? 0.2437 0.2835 0.2488 0.0282  -0.0023 0.0011  188 PRO A C   
399  O  O   . PRO A 49  ? 0.2067 0.2421 0.2152 0.0230  -0.0033 -0.0008 188 PRO A O   
400  C  CB  . PRO A 49  ? 0.1940 0.2574 0.2059 0.0285  -0.0028 0.0055  188 PRO A CB  
401  C  CG  . PRO A 49  ? 0.1998 0.2653 0.2182 0.0211  -0.0045 0.0045  188 PRO A CG  
402  C  CD  . PRO A 49  ? 0.1871 0.2520 0.2068 0.0184  -0.0049 0.0038  188 PRO A CD  
403  N  N   . PRO A 50  ? 0.2481 0.2809 0.2460 0.0334  -0.0012 0.0011  189 PRO A N   
404  C  CA  . PRO A 50  ? 0.3313 0.3506 0.3249 0.0322  -0.0014 -0.0010 189 PRO A CA  
405  C  C   . PRO A 50  ? 0.2748 0.2934 0.2732 0.0272  -0.0025 -0.0022 189 PRO A C   
406  O  O   . PRO A 50  ? 0.2765 0.2866 0.2745 0.0237  -0.0031 -0.0040 189 PRO A O   
407  C  CB  . PRO A 50  ? 0.3197 0.3337 0.3043 0.0391  0.0000  -0.0002 189 PRO A CB  
408  C  CG  . PRO A 50  ? 0.3127 0.3347 0.2956 0.0444  0.0012  0.0021  189 PRO A CG  
409  C  CD  . PRO A 50  ? 0.2688 0.3053 0.2611 0.0408  0.0004  0.0034  189 PRO A CD  
410  N  N   . LEU A 51  ? 0.2162 0.2442 0.2190 0.0269  -0.0027 -0.0010 190 LEU A N   
411  C  CA  . LEU A 51  ? 0.1789 0.2078 0.1868 0.0223  -0.0038 -0.0018 190 LEU A CA  
412  C  C   . LEU A 51  ? 0.2208 0.2611 0.2360 0.0186  -0.0047 -0.0008 190 LEU A C   
413  O  O   . LEU A 51  ? 0.2717 0.3215 0.2876 0.0209  -0.0045 0.0013  190 LEU A O   
414  C  CB  . LEU A 51  ? 0.2483 0.2760 0.2532 0.0253  -0.0033 -0.0013 190 LEU A CB  
415  C  CG  . LEU A 51  ? 0.2803 0.2951 0.2766 0.0282  -0.0026 -0.0024 190 LEU A CG  
416  C  CD1 . LEU A 51  ? 0.2767 0.2917 0.2699 0.0317  -0.0021 -0.0016 190 LEU A CD1 
417  C  CD2 . LEU A 51  ? 0.3242 0.3298 0.3212 0.0229  -0.0035 -0.0045 190 LEU A CD2 
418  N  N   . PRO A 52  ? 0.2074 0.2469 0.2275 0.0130  -0.0058 -0.0020 191 PRO A N   
419  C  CA  . PRO A 52  ? 0.2326 0.2629 0.2527 0.0101  -0.0061 -0.0040 191 PRO A CA  
420  C  C   . PRO A 52  ? 0.2301 0.2523 0.2478 0.0092  -0.0060 -0.0054 191 PRO A C   
421  O  O   . PRO A 52  ? 0.2212 0.2451 0.2386 0.0099  -0.0059 -0.0051 191 PRO A O   
422  C  CB  . PRO A 52  ? 0.2026 0.2372 0.2288 0.0050  -0.0072 -0.0043 191 PRO A CB  
423  C  CG  . PRO A 52  ? 0.2400 0.2829 0.2687 0.0039  -0.0077 -0.0031 191 PRO A CG  
424  C  CD  . PRO A 52  ? 0.2433 0.2917 0.2690 0.0090  -0.0069 -0.0012 191 PRO A CD  
425  N  N   . GLU A 53  ? 0.1858 0.1998 0.2021 0.0074  -0.0062 -0.0067 192 GLU A N   
426  C  CA  . GLU A 53  ? 0.1915 0.1981 0.2055 0.0061  -0.0062 -0.0077 192 GLU A CA  
427  C  C   . GLU A 53  ? 0.1761 0.1848 0.1954 0.0018  -0.0069 -0.0083 192 GLU A C   
428  O  O   . GLU A 53  ? 0.1849 0.1989 0.2088 -0.0005 -0.0073 -0.0082 192 GLU A O   
429  C  CB  . GLU A 53  ? 0.2062 0.2040 0.2162 0.0054  -0.0063 -0.0084 192 GLU A CB  
430  C  CG  . GLU A 53  ? 0.1957 0.1884 0.1980 0.0101  -0.0056 -0.0080 192 GLU A CG  
431  C  CD  . GLU A 53  ? 0.3556 0.3378 0.3520 0.0089  -0.0059 -0.0086 192 GLU A CD  
432  O  OE1 . GLU A 53  ? 0.3603 0.3420 0.3595 0.0055  -0.0064 -0.0090 192 GLU A OE1 
433  O  OE2 . GLU A 53  ? 0.4375 0.4119 0.4263 0.0113  -0.0056 -0.0087 192 GLU A OE2 
434  N  N   . LEU A 54  ? 0.1720 0.1759 0.1896 0.0010  -0.0069 -0.0089 193 LEU A N   
435  C  CA  . LEU A 54  ? 0.1391 0.1441 0.1605 -0.0022 -0.0073 -0.0094 193 LEU A CA  
436  C  C   . LEU A 54  ? 0.1112 0.1101 0.1318 -0.0045 -0.0075 -0.0099 193 LEU A C   
437  O  O   . LEU A 54  ? 0.1678 0.1608 0.1838 -0.0037 -0.0074 -0.0099 193 LEU A O   
438  C  CB  . LEU A 54  ? 0.1542 0.1606 0.1749 -0.0010 -0.0072 -0.0092 193 LEU A CB  
439  C  CG  . LEU A 54  ? 0.2139 0.2280 0.2362 0.0003  -0.0071 -0.0084 193 LEU A CG  
440  C  CD1 . LEU A 54  ? 0.2553 0.2719 0.2749 0.0042  -0.0066 -0.0073 193 LEU A CD1 
441  C  CD2 . LEU A 54  ? 0.1832 0.1977 0.2049 0.0007  -0.0071 -0.0084 193 LEU A CD2 
442  N  N   . ARG A 55  ? 0.1356 0.1359 0.1600 -0.0074 -0.0077 -0.0101 194 ARG A N   
443  C  CA  . ARG A 55  ? 0.1180 0.1144 0.1422 -0.0096 -0.0079 -0.0101 194 ARG A CA  
444  C  C   . ARG A 55  ? 0.1623 0.1564 0.1848 -0.0095 -0.0079 -0.0101 194 ARG A C   
445  O  O   . ARG A 55  ? 0.1486 0.1451 0.1724 -0.0090 -0.0078 -0.0103 194 ARG A O   
446  C  CB  . ARG A 55  ? 0.1212 0.1203 0.1496 -0.0119 -0.0079 -0.0102 194 ARG A CB  
447  C  CG  . ARG A 55  ? 0.1628 0.1597 0.1915 -0.0138 -0.0078 -0.0097 194 ARG A CG  
448  C  CD  . ARG A 55  ? 0.3052 0.3049 0.3373 -0.0151 -0.0076 -0.0097 194 ARG A CD  
449  N  NE  . ARG A 55  ? 0.4674 0.4666 0.5003 -0.0165 -0.0072 -0.0089 194 ARG A NE  
450  C  CZ  . ARG A 55  ? 0.4875 0.4878 0.5219 -0.0168 -0.0068 -0.0087 194 ARG A CZ  
451  N  NH1 . ARG A 55  ? 0.4526 0.4535 0.4873 -0.0163 -0.0068 -0.0093 194 ARG A NH1 
452  N  NH2 . ARG A 55  ? 0.3728 0.3737 0.4079 -0.0176 -0.0063 -0.0075 194 ARG A NH2 
453  N  N   . LEU A 56  ? 0.1478 0.1369 0.1667 -0.0101 -0.0081 -0.0097 195 LEU A N   
454  C  CA  . LEU A 56  ? 0.1152 0.1019 0.1323 -0.0105 -0.0083 -0.0094 195 LEU A CA  
455  C  C   . LEU A 56  ? 0.1447 0.1306 0.1625 -0.0135 -0.0086 -0.0086 195 LEU A C   
456  O  O   . LEU A 56  ? 0.1484 0.1315 0.1640 -0.0149 -0.0090 -0.0080 195 LEU A O   
457  C  CB  . LEU A 56  ? 0.1186 0.0999 0.1296 -0.0088 -0.0085 -0.0094 195 LEU A CB  
458  C  CG  . LEU A 56  ? 0.1278 0.1065 0.1364 -0.0091 -0.0088 -0.0091 195 LEU A CG  
459  C  CD1 . LEU A 56  ? 0.1319 0.1149 0.1434 -0.0074 -0.0084 -0.0095 195 LEU A CD1 
460  C  CD2 . LEU A 56  ? 0.1406 0.1119 0.1418 -0.0080 -0.0091 -0.0089 195 LEU A CD2 
461  N  N   . ARG A 57  ? 0.1082 0.0967 0.1287 -0.0143 -0.0085 -0.0082 196 ARG A N   
462  C  CA  . ARG A 57  ? 0.1188 0.1086 0.1408 -0.0166 -0.0086 -0.0070 196 ARG A CA  
463  C  C   . ARG A 57  ? 0.1400 0.1299 0.1612 -0.0173 -0.0088 -0.0060 196 ARG A C   
464  O  O   . ARG A 57  ? 0.1256 0.1166 0.1476 -0.0160 -0.0086 -0.0065 196 ARG A O   
465  C  CB  A ARG A 57  ? 0.1459 0.1397 0.1721 -0.0165 -0.0079 -0.0072 196 ARG A CB  
466  C  CB  B ARG A 57  ? 0.1445 0.1384 0.1708 -0.0165 -0.0079 -0.0072 196 ARG A CB  
467  C  CG  A ARG A 57  ? 0.1622 0.1583 0.1899 -0.0181 -0.0077 -0.0056 196 ARG A CG  
468  C  CG  B ARG A 57  ? 0.1901 0.1863 0.2179 -0.0178 -0.0076 -0.0057 196 ARG A CG  
469  C  CD  A ARG A 57  ? 0.1767 0.1754 0.2074 -0.0178 -0.0069 -0.0057 196 ARG A CD  
470  C  CD  B ARG A 57  ? 0.2051 0.2040 0.2360 -0.0172 -0.0068 -0.0060 196 ARG A CD  
471  N  NE  A ARG A 57  ? 0.2268 0.2276 0.2583 -0.0192 -0.0066 -0.0040 196 ARG A NE  
472  N  NE  B ARG A 57  ? 0.1729 0.1743 0.2048 -0.0177 -0.0063 -0.0043 196 ARG A NE  
473  C  CZ  A ARG A 57  ? 0.2145 0.2181 0.2469 -0.0189 -0.0060 -0.0025 196 ARG A CZ  
474  C  CZ  B ARG A 57  ? 0.2042 0.2071 0.2365 -0.0192 -0.0062 -0.0029 196 ARG A CZ  
475  N  NH1 A ARG A 57  ? 0.2144 0.2183 0.2467 -0.0172 -0.0057 -0.0028 196 ARG A NH1 
476  N  NH1 B ARG A 57  ? 0.1982 0.1994 0.2297 -0.0205 -0.0068 -0.0032 196 ARG A NH1 
477  N  NH2 A ARG A 57  ? 0.1984 0.2050 0.2315 -0.0201 -0.0057 -0.0005 196 ARG A NH2 
478  N  NH2 B ARG A 57  ? 0.2385 0.2448 0.2717 -0.0192 -0.0055 -0.0010 196 ARG A NH2 
479  N  N   . ASN A 58  ? 0.1149 0.1041 0.1343 -0.0197 -0.0094 -0.0043 197 ASN A N   
480  C  CA  . ASN A 58  ? 0.0982 0.0893 0.1176 -0.0208 -0.0096 -0.0027 197 ASN A CA  
481  C  C   . ASN A 58  ? 0.1225 0.1191 0.1459 -0.0207 -0.0088 -0.0017 197 ASN A C   
482  O  O   . ASN A 58  ? 0.1197 0.1183 0.1439 -0.0222 -0.0087 -0.0004 197 ASN A O   
483  C  CB  . ASN A 58  ? 0.0980 0.0863 0.1130 -0.0240 -0.0108 -0.0009 197 ASN A CB  
484  C  CG  . ASN A 58  ? 0.1032 0.0950 0.1185 -0.0257 -0.0113 0.0013  197 ASN A CG  
485  O  OD1 . ASN A 58  ? 0.1322 0.1287 0.1509 -0.0241 -0.0105 0.0017  197 ASN A OD1 
486  N  ND2 . ASN A 58  ? 0.1071 0.0964 0.1179 -0.0290 -0.0126 0.0031  197 ASN A ND2 
487  N  N   . ASN A 59  ? 0.1112 0.1100 0.1368 -0.0186 -0.0081 -0.0023 198 ASN A N   
488  C  CA  . ASN A 59  ? 0.1205 0.1232 0.1487 -0.0177 -0.0071 -0.0014 198 ASN A CA  
489  C  C   . ASN A 59  ? 0.1061 0.1126 0.1343 -0.0178 -0.0070 0.0009  198 ASN A C   
490  O  O   . ASN A 59  ? 0.1174 0.1272 0.1470 -0.0163 -0.0059 0.0019  198 ASN A O   
491  C  CB  . ASN A 59  ? 0.0975 0.0996 0.1269 -0.0154 -0.0064 -0.0034 198 ASN A CB  
492  C  CG  . ASN A 59  ? 0.1165 0.1175 0.1450 -0.0141 -0.0066 -0.0042 198 ASN A CG  
493  O  OD1 . ASN A 59  ? 0.1035 0.1057 0.1313 -0.0142 -0.0068 -0.0030 198 ASN A OD1 
494  N  ND2 . ASN A 59  ? 0.1170 0.1165 0.1457 -0.0131 -0.0066 -0.0061 198 ASN A ND2 
495  N  N   . GLY A 60  ? 0.0903 0.0962 0.1164 -0.0196 -0.0080 0.0020  199 GLY A N   
496  C  CA  . GLY A 60  ? 0.0933 0.1037 0.1193 -0.0202 -0.0081 0.0047  199 GLY A CA  
497  C  C   . GLY A 60  ? 0.1013 0.1121 0.1276 -0.0178 -0.0078 0.0040  199 GLY A C   
498  O  O   . GLY A 60  ? 0.1057 0.1199 0.1317 -0.0182 -0.0080 0.0061  199 GLY A O   
499  N  N   . HIS A 61  ? 0.0810 0.0888 0.1079 -0.0156 -0.0072 0.0014  200 HIS A N   
500  C  CA  . HIS A 61  ? 0.1009 0.1084 0.1276 -0.0136 -0.0070 0.0006  200 HIS A CA  
501  C  C   . HIS A 61  ? 0.1156 0.1191 0.1409 -0.0139 -0.0078 -0.0012 200 HIS A C   
502  O  O   . HIS A 61  ? 0.0945 0.0979 0.1192 -0.0133 -0.0080 -0.0013 200 HIS A O   
503  C  CB  . HIS A 61  ? 0.1054 0.1126 0.1330 -0.0110 -0.0059 -0.0007 200 HIS A CB  
504  C  CG  . HIS A 61  ? 0.1012 0.1113 0.1293 -0.0098 -0.0048 0.0008  200 HIS A CG  
505  N  ND1 . HIS A 61  ? 0.1321 0.1402 0.1601 -0.0085 -0.0040 -0.0005 200 HIS A ND1 
506  C  CD2 . HIS A 61  ? 0.1178 0.1327 0.1462 -0.0098 -0.0044 0.0037  200 HIS A CD2 
507  C  CE1 . HIS A 61  ? 0.1141 0.1252 0.1422 -0.0072 -0.0030 0.0014  200 HIS A CE1 
508  N  NE2 . HIS A 61  ? 0.1016 0.1174 0.1301 -0.0079 -0.0032 0.0041  200 HIS A NE2 
509  N  N   . SER A 62  ? 0.1174 0.1178 0.1421 -0.0147 -0.0081 -0.0025 201 SER A N   
510  C  CA  . SER A 62  ? 0.0952 0.0919 0.1180 -0.0144 -0.0086 -0.0040 201 SER A CA  
511  C  C   . SER A 62  ? 0.1100 0.1040 0.1315 -0.0152 -0.0089 -0.0046 201 SER A C   
512  O  O   . SER A 62  ? 0.1178 0.1129 0.1403 -0.0164 -0.0088 -0.0039 201 SER A O   
513  C  CB  . SER A 62  ? 0.1068 0.1037 0.1308 -0.0122 -0.0081 -0.0058 201 SER A CB  
514  O  OG  . SER A 62  ? 0.0993 0.0938 0.1215 -0.0115 -0.0085 -0.0069 201 SER A OG  
515  N  N   . VAL A 63  ? 0.0845 0.0752 0.1038 -0.0143 -0.0092 -0.0058 202 VAL A N   
516  C  CA  . VAL A 63  ? 0.0925 0.0809 0.1106 -0.0140 -0.0091 -0.0067 202 VAL A CA  
517  C  C   . VAL A 63  ? 0.0691 0.0599 0.0897 -0.0121 -0.0085 -0.0081 202 VAL A C   
518  O  O   . VAL A 63  ? 0.0967 0.0882 0.1174 -0.0107 -0.0084 -0.0087 202 VAL A O   
519  C  CB  . VAL A 63  ? 0.1124 0.0954 0.1253 -0.0140 -0.0098 -0.0067 202 VAL A CB  
520  C  CG1 . VAL A 63  ? 0.1291 0.1107 0.1401 -0.0121 -0.0098 -0.0072 202 VAL A CG1 
521  C  CG2 . VAL A 63  ? 0.1433 0.1243 0.1548 -0.0129 -0.0095 -0.0075 202 VAL A CG2 
522  N  N   . GLN A 64  ? 0.0958 0.0881 0.1184 -0.0123 -0.0082 -0.0085 203 GLN A N   
523  C  CA  . GLN A 64  ? 0.1013 0.0962 0.1260 -0.0113 -0.0079 -0.0095 203 GLN A CA  
524  C  C   . GLN A 64  ? 0.1369 0.1319 0.1613 -0.0106 -0.0079 -0.0100 203 GLN A C   
525  O  O   . GLN A 64  ? 0.1159 0.1097 0.1400 -0.0114 -0.0080 -0.0097 203 GLN A O   
526  C  CB  . GLN A 64  ? 0.0911 0.0880 0.1184 -0.0120 -0.0075 -0.0095 203 GLN A CB  
527  C  CG  . GLN A 64  ? 0.0995 0.0981 0.1279 -0.0118 -0.0075 -0.0104 203 GLN A CG  
528  C  CD  . GLN A 64  ? 0.1224 0.1210 0.1514 -0.0122 -0.0071 -0.0104 203 GLN A CD  
529  O  OE1 . GLN A 64  ? 0.1455 0.1437 0.1740 -0.0117 -0.0068 -0.0099 203 GLN A OE1 
530  N  NE2 . GLN A 64  ? 0.1215 0.1204 0.1510 -0.0129 -0.0072 -0.0108 203 GLN A NE2 
531  N  N   . LEU A 65  ? 0.0952 0.0920 0.1193 -0.0091 -0.0079 -0.0105 204 LEU A N   
532  C  CA  . LEU A 65  ? 0.1006 0.0990 0.1244 -0.0079 -0.0078 -0.0106 204 LEU A CA  
533  C  C   . LEU A 65  ? 0.1106 0.1134 0.1375 -0.0089 -0.0079 -0.0108 204 LEU A C   
534  O  O   . LEU A 65  ? 0.1179 0.1229 0.1456 -0.0092 -0.0081 -0.0110 204 LEU A O   
535  C  CB  . LEU A 65  ? 0.1055 0.1040 0.1266 -0.0053 -0.0076 -0.0105 204 LEU A CB  
536  C  CG  . LEU A 65  ? 0.1202 0.1213 0.1404 -0.0032 -0.0074 -0.0102 204 LEU A CG  
537  C  CD1 . LEU A 65  ? 0.1502 0.1468 0.1674 -0.0026 -0.0073 -0.0101 204 LEU A CD1 
538  C  CD2 . LEU A 65  ? 0.1250 0.1279 0.1430 -0.0003 -0.0070 -0.0097 204 LEU A CD2 
539  N  N   . THR A 66  ? 0.1045 0.1082 0.1326 -0.0096 -0.0080 -0.0108 205 THR A N   
540  C  CA  . THR A 66  ? 0.1199 0.1272 0.1501 -0.0110 -0.0083 -0.0109 205 THR A CA  
541  C  C   . THR A 66  ? 0.1365 0.1486 0.1666 -0.0098 -0.0085 -0.0104 205 THR A C   
542  O  O   . THR A 66  ? 0.1375 0.1502 0.1664 -0.0078 -0.0083 -0.0100 205 THR A O   
543  C  CB  . THR A 66  ? 0.1435 0.1503 0.1751 -0.0123 -0.0083 -0.0109 205 THR A CB  
544  O  OG1 . THR A 66  ? 0.1567 0.1603 0.1885 -0.0132 -0.0080 -0.0109 205 THR A OG1 
545  C  CG2 . THR A 66  ? 0.1285 0.1383 0.1615 -0.0139 -0.0088 -0.0109 205 THR A CG2 
546  N  N   . LEU A 67  ? 0.1197 0.1351 0.1504 -0.0110 -0.0090 -0.0102 206 LEU A N   
547  C  CA  . LEU A 67  ? 0.1017 0.1233 0.1325 -0.0101 -0.0093 -0.0093 206 LEU A CA  
548  C  C   . LEU A 67  ? 0.1218 0.1474 0.1540 -0.0122 -0.0100 -0.0087 206 LEU A C   
549  O  O   . LEU A 67  ? 0.1603 0.1839 0.1931 -0.0150 -0.0105 -0.0092 206 LEU A O   
550  C  CB  . LEU A 67  ? 0.1059 0.1294 0.1360 -0.0105 -0.0095 -0.0091 206 LEU A CB  
551  C  CG  . LEU A 67  ? 0.1072 0.1270 0.1358 -0.0084 -0.0089 -0.0095 206 LEU A CG  
552  C  CD1 . LEU A 67  ? 0.1186 0.1399 0.1470 -0.0092 -0.0091 -0.0095 206 LEU A CD1 
553  C  CD2 . LEU A 67  ? 0.1498 0.1700 0.1766 -0.0048 -0.0082 -0.0089 206 LEU A CD2 
554  N  N   . PRO A 68  ? 0.1290 0.1604 0.1615 -0.0107 -0.0101 -0.0074 207 PRO A N   
555  C  CA  . PRO A 68  ? 0.1404 0.1769 0.1744 -0.0128 -0.0109 -0.0065 207 PRO A CA  
556  C  C   . PRO A 68  ? 0.1759 0.2169 0.2099 -0.0161 -0.0121 -0.0057 207 PRO A C   
557  O  O   . PRO A 68  ? 0.1568 0.1975 0.1897 -0.0163 -0.0121 -0.0058 207 PRO A O   
558  C  CB  . PRO A 68  ? 0.1564 0.1981 0.1900 -0.0092 -0.0104 -0.0052 207 PRO A CB  
559  C  CG  . PRO A 68  ? 0.1590 0.2009 0.1907 -0.0061 -0.0096 -0.0048 207 PRO A CG  
560  C  CD  . PRO A 68  ? 0.1322 0.1658 0.1630 -0.0067 -0.0093 -0.0066 207 PRO A CD  
561  N  N   . PRO A 69  ? 0.1486 0.1934 0.1833 -0.0190 -0.0132 -0.0048 208 PRO A N   
562  C  CA  . PRO A 69  ? 0.1563 0.2059 0.1902 -0.0227 -0.0146 -0.0036 208 PRO A CA  
563  C  C   . PRO A 69  ? 0.1530 0.2111 0.1869 -0.0210 -0.0146 -0.0016 208 PRO A C   
564  O  O   . PRO A 69  ? 0.1550 0.2164 0.1894 -0.0166 -0.0135 -0.0009 208 PRO A O   
565  C  CB  . PRO A 69  ? 0.1988 0.2518 0.2334 -0.0257 -0.0157 -0.0026 208 PRO A CB  
566  C  CG  . PRO A 69  ? 0.2423 0.2889 0.2780 -0.0244 -0.0149 -0.0042 208 PRO A CG  
567  C  CD  . PRO A 69  ? 0.1869 0.2311 0.2230 -0.0196 -0.0133 -0.0049 208 PRO A CD  
568  N  N   . GLY A 70  ? 0.1529 0.2142 0.1854 -0.0245 -0.0158 -0.0006 209 GLY A N   
569  C  CA  . GLY A 70  ? 0.1599 0.2315 0.1927 -0.0237 -0.0160 0.0019  209 GLY A CA  
570  C  C   . GLY A 70  ? 0.1616 0.2329 0.1935 -0.0209 -0.0150 0.0017  209 GLY A C   
571  O  O   . GLY A 70  ? 0.1695 0.2498 0.2016 -0.0194 -0.0149 0.0039  209 GLY A O   
572  N  N   . LEU A 71  ? 0.1144 0.1762 0.1455 -0.0200 -0.0143 -0.0008 210 LEU A N   
573  C  CA  . LEU A 71  ? 0.1419 0.2032 0.1723 -0.0178 -0.0135 -0.0010 210 LEU A CA  
574  C  C   . LEU A 71  ? 0.1629 0.2236 0.1917 -0.0224 -0.0148 -0.0010 210 LEU A C   
575  O  O   . LEU A 71  ? 0.1697 0.2220 0.1970 -0.0246 -0.0151 -0.0029 210 LEU A O   
576  C  CB  . LEU A 71  ? 0.1082 0.1604 0.1383 -0.0147 -0.0121 -0.0033 210 LEU A CB  
577  C  CG  . LEU A 71  ? 0.1331 0.1849 0.1633 -0.0097 -0.0108 -0.0031 210 LEU A CG  
578  C  CD1 . LEU A 71  ? 0.1083 0.1578 0.1394 -0.0102 -0.0109 -0.0036 210 LEU A CD1 
579  C  CD2 . LEU A 71  ? 0.1122 0.1569 0.1411 -0.0066 -0.0096 -0.0046 210 LEU A CD2 
580  N  N   . GLU A 72  ? 0.1637 0.2333 0.1921 -0.0237 -0.0155 0.0013  211 GLU A N   
581  C  CA  . GLU A 72  ? 0.1515 0.2211 0.1776 -0.0288 -0.0170 0.0016  211 GLU A CA  
582  C  C   . GLU A 72  ? 0.1693 0.2384 0.1949 -0.0271 -0.0163 0.0012  211 GLU A C   
583  O  O   . GLU A 72  ? 0.1733 0.2481 0.2003 -0.0229 -0.0151 0.0024  211 GLU A O   
584  C  CB  A GLU A 72  ? 0.2169 0.2972 0.2427 -0.0328 -0.0187 0.0047  211 GLU A CB  
585  C  CB  B GLU A 72  ? 0.2053 0.2857 0.2311 -0.0328 -0.0187 0.0047  211 GLU A CB  
586  C  CG  A GLU A 72  ? 0.3230 0.4030 0.3486 -0.0346 -0.0194 0.0052  211 GLU A CG  
587  C  CG  B GLU A 72  ? 0.3269 0.4089 0.3533 -0.0338 -0.0192 0.0055  211 GLU A CG  
588  C  CD  A GLU A 72  ? 0.4068 0.4943 0.4303 -0.0365 -0.0198 0.0086  211 GLU A CD  
589  C  CD  B GLU A 72  ? 0.4441 0.5212 0.4657 -0.0389 -0.0204 0.0061  211 GLU A CD  
590  O  OE1 A GLU A 72  ? 0.4587 0.5457 0.4815 -0.0377 -0.0201 0.0093  211 GLU A OE1 
591  O  OE1 B GLU A 72  ? 0.4773 0.5596 0.4981 -0.0399 -0.0206 0.0085  211 GLU A OE1 
592  O  OE2 A GLU A 72  ? 0.4066 0.5007 0.4292 -0.0368 -0.0197 0.0107  211 GLU A OE2 
593  O  OE2 B GLU A 72  ? 0.4877 0.5558 0.5061 -0.0417 -0.0210 0.0044  211 GLU A OE2 
594  N  N   . MET A 73  ? 0.1400 0.2018 0.1631 -0.0299 -0.0169 -0.0003 212 MET A N   
595  C  CA  . MET A 73  ? 0.1222 0.1831 0.1447 -0.0286 -0.0164 -0.0008 212 MET A CA  
596  C  C   . MET A 73  ? 0.1288 0.1891 0.1477 -0.0341 -0.0181 -0.0004 212 MET A C   
597  O  O   . MET A 73  ? 0.1670 0.2196 0.1827 -0.0377 -0.0191 -0.0016 212 MET A O   
598  C  CB  A MET A 73  ? 0.1795 0.2304 0.2023 -0.0253 -0.0150 -0.0035 212 MET A CB  
599  C  CB  B MET A 73  ? 0.1723 0.2233 0.1950 -0.0254 -0.0150 -0.0035 212 MET A CB  
600  C  CG  A MET A 73  ? 0.1584 0.2087 0.1814 -0.0226 -0.0140 -0.0040 212 MET A CG  
601  C  CG  B MET A 73  ? 0.1739 0.2242 0.1959 -0.0245 -0.0146 -0.0039 212 MET A CG  
602  S  SD  A MET A 73  ? 0.1272 0.1726 0.1467 -0.0268 -0.0152 -0.0048 212 MET A SD  
603  S  SD  B MET A 73  ? 0.2852 0.3245 0.3065 -0.0223 -0.0136 -0.0066 212 MET A SD  
604  C  CE  A MET A 73  ? 0.1975 0.2303 0.2157 -0.0258 -0.0146 -0.0076 212 MET A CE  
605  C  CE  B MET A 73  ? 0.2037 0.2344 0.2212 -0.0266 -0.0148 -0.0079 212 MET A CE  
606  N  N   . LYS A 74  ? 0.1173 0.1854 0.1363 -0.0347 -0.0184 0.0015  213 LYS A N   
607  C  CA  . LYS A 74  ? 0.1044 0.1721 0.1194 -0.0403 -0.0201 0.0021  213 LYS A CA  
608  C  C   . LYS A 74  ? 0.1232 0.1882 0.1375 -0.0388 -0.0194 0.0011  213 LYS A C   
609  O  O   . LYS A 74  ? 0.1340 0.2059 0.1511 -0.0352 -0.0182 0.0022  213 LYS A O   
610  C  CB  . LYS A 74  ? 0.1021 0.1809 0.1164 -0.0433 -0.0211 0.0057  213 LYS A CB  
611  C  CG  . LYS A 74  ? 0.1547 0.2301 0.1631 -0.0484 -0.0223 0.0066  213 LYS A CG  
612  C  CD  . LYS A 74  ? 0.2154 0.3000 0.2221 -0.0507 -0.0225 0.0106  213 LYS A CD  
613  C  CE  . LYS A 74  ? 0.2113 0.2917 0.2113 -0.0565 -0.0238 0.0116  213 LYS A CE  
614  N  NZ  . LYS A 74  ? 0.2567 0.3471 0.2549 -0.0591 -0.0240 0.0159  213 LYS A NZ  
615  N  N   . LEU A 75  ? 0.1283 0.1831 0.1386 -0.0413 -0.0200 -0.0009 214 LEU A N   
616  C  CA  . LEU A 75  ? 0.1281 0.1798 0.1372 -0.0403 -0.0195 -0.0019 214 LEU A CA  
617  C  C   . LEU A 75  ? 0.1172 0.1742 0.1232 -0.0453 -0.0212 0.0000  214 LEU A C   
618  O  O   . LEU A 75  ? 0.1577 0.2160 0.1637 -0.0445 -0.0208 -0.0001 214 LEU A O   
619  C  CB  . LEU A 75  ? 0.1124 0.1508 0.1183 -0.0399 -0.0193 -0.0048 214 LEU A CB  
620  C  CG  . LEU A 75  ? 0.1346 0.1676 0.1435 -0.0349 -0.0175 -0.0066 214 LEU A CG  
621  C  CD1 . LEU A 75  ? 0.1526 0.1740 0.1577 -0.0346 -0.0173 -0.0089 214 LEU A CD1 
622  C  CD2 . LEU A 75  ? 0.1596 0.1977 0.1733 -0.0297 -0.0158 -0.0064 214 LEU A CD2 
623  N  N   . GLY A 76  ? 0.1511 0.2107 0.1541 -0.0502 -0.0228 0.0019  215 GLY A N   
624  C  CA  . GLY A 76  ? 0.1779 0.2404 0.1766 -0.0540 -0.0236 0.0042  215 GLY A CA  
625  C  C   . GLY A 76  ? 0.1344 0.1915 0.1271 -0.0584 -0.0247 0.0052  215 GLY A C   
626  O  O   . GLY A 76  ? 0.1647 0.2165 0.1573 -0.0580 -0.0247 0.0041  215 GLY A O   
627  N  N   . PRO A 77  ? 0.1652 0.2236 0.1528 -0.0628 -0.0255 0.0075  216 PRO A N   
628  C  CA  . PRO A 77  ? 0.2113 0.2642 0.1922 -0.0676 -0.0267 0.0088  216 PRO A CA  
629  C  C   . PRO A 77  ? 0.1722 0.2100 0.1485 -0.0677 -0.0271 0.0056  216 PRO A C   
630  O  O   . PRO A 77  ? 0.1646 0.1943 0.1388 -0.0667 -0.0270 0.0031  216 PRO A O   
631  C  CB  . PRO A 77  ? 0.2291 0.2832 0.2046 -0.0720 -0.0275 0.0109  216 PRO A CB  
632  C  CG  . PRO A 77  ? 0.2762 0.3425 0.2576 -0.0693 -0.0265 0.0123  216 PRO A CG  
633  C  CD  . PRO A 77  ? 0.1717 0.2368 0.1594 -0.0635 -0.0254 0.0091  216 PRO A CD  
634  N  N   . GLY A 78  ? 0.1559 0.1905 0.1308 -0.0685 -0.0274 0.0057  217 GLY A N   
635  C  CA  . GLY A 78  ? 0.1485 0.1692 0.1187 -0.0683 -0.0276 0.0031  217 GLY A CA  
636  C  C   . GLY A 78  ? 0.1717 0.1883 0.1465 -0.0633 -0.0264 -0.0001 217 GLY A C   
637  O  O   . GLY A 78  ? 0.1891 0.1943 0.1599 -0.0626 -0.0262 -0.0022 217 GLY A O   
638  N  N   . ARG A 79  ? 0.1499 0.1756 0.1328 -0.0599 -0.0255 -0.0003 218 ARG A N   
639  C  CA  . ARG A 79  ? 0.1214 0.1436 0.1085 -0.0556 -0.0244 -0.0030 218 ARG A CA  
640  C  C   . ARG A 79  ? 0.1634 0.1949 0.1581 -0.0527 -0.0236 -0.0023 218 ARG A C   
641  O  O   . ARG A 79  ? 0.1826 0.2227 0.1829 -0.0501 -0.0230 -0.0019 218 ARG A O   
642  C  CB  . ARG A 79  ? 0.1498 0.1711 0.1378 -0.0540 -0.0239 -0.0045 218 ARG A CB  
643  C  CG  . ARG A 79  ? 0.1760 0.1862 0.1558 -0.0562 -0.0245 -0.0056 218 ARG A CG  
644  C  CD  . ARG A 79  ? 0.1747 0.1819 0.1553 -0.0537 -0.0239 -0.0077 218 ARG A CD  
645  N  NE  . ARG A 79  ? 0.1538 0.1721 0.1395 -0.0528 -0.0236 -0.0062 218 ARG A NE  
646  C  CZ  . ARG A 79  ? 0.1695 0.1891 0.1593 -0.0478 -0.0218 -0.0071 218 ARG A CZ  
647  N  NH1 . ARG A 79  ? 0.1583 0.1881 0.1523 -0.0470 -0.0215 -0.0055 218 ARG A NH1 
648  N  NH2 . ARG A 79  ? 0.1847 0.1957 0.1743 -0.0437 -0.0204 -0.0093 218 ARG A NH2 
649  N  N   . GLU A 80  ? 0.1593 0.1889 0.1538 -0.0530 -0.0237 -0.0022 219 GLU A N   
650  C  CA  . GLU A 80  ? 0.1490 0.1871 0.1500 -0.0504 -0.0230 -0.0013 219 GLU A CA  
651  C  C   . GLU A 80  ? 0.1519 0.1830 0.1543 -0.0481 -0.0223 -0.0036 219 GLU A C   
652  O  O   . GLU A 80  ? 0.1748 0.1955 0.1725 -0.0492 -0.0225 -0.0050 219 GLU A O   
653  C  CB  . GLU A 80  ? 0.1755 0.2204 0.1755 -0.0527 -0.0237 0.0017  219 GLU A CB  
654  C  CG  . GLU A 80  ? 0.1963 0.2483 0.1943 -0.0553 -0.0242 0.0044  219 GLU A CG  
655  C  CD  . GLU A 80  ? 0.3807 0.4416 0.3785 -0.0572 -0.0246 0.0078  219 GLU A CD  
656  O  OE1 . GLU A 80  ? 0.4537 0.5229 0.4566 -0.0542 -0.0238 0.0089  219 GLU A OE1 
657  O  OE2 . GLU A 80  ? 0.4500 0.5097 0.4421 -0.0617 -0.0257 0.0097  219 GLU A OE2 
658  N  N   . TYR A 81  ? 0.1200 0.1564 0.1286 -0.0441 -0.0211 -0.0038 220 TYR A N   
659  C  CA  . TYR A 81  ? 0.1272 0.1568 0.1376 -0.0402 -0.0196 -0.0058 220 TYR A CA  
660  C  C   . TYR A 81  ? 0.1361 0.1720 0.1515 -0.0374 -0.0188 -0.0050 220 TYR A C   
661  O  O   . TYR A 81  ? 0.1656 0.2115 0.1835 -0.0370 -0.0189 -0.0030 220 TYR A O   
662  C  CB  . TYR A 81  ? 0.1218 0.1473 0.1335 -0.0359 -0.0179 -0.0074 220 TYR A CB  
663  C  CG  . TYR A 81  ? 0.1385 0.1567 0.1451 -0.0378 -0.0184 -0.0084 220 TYR A CG  
664  C  CD1 . TYR A 81  ? 0.1376 0.1592 0.1425 -0.0398 -0.0192 -0.0076 220 TYR A CD1 
665  C  CD2 . TYR A 81  ? 0.1859 0.1937 0.1889 -0.0375 -0.0181 -0.0101 220 TYR A CD2 
666  C  CE1 . TYR A 81  ? 0.1662 0.1801 0.1657 -0.0416 -0.0197 -0.0086 220 TYR A CE1 
667  C  CE2 . TYR A 81  ? 0.2046 0.2049 0.2020 -0.0387 -0.0185 -0.0110 220 TYR A CE2 
668  C  CZ  . TYR A 81  ? 0.1528 0.1557 0.1483 -0.0408 -0.0193 -0.0104 220 TYR A CZ  
669  O  OH  . TYR A 81  ? 0.2861 0.2803 0.2753 -0.0418 -0.0196 -0.0115 220 TYR A OH  
670  N  N   . ARG A 82  ? 0.1302 0.1604 0.1466 -0.0354 -0.0179 -0.0064 221 ARG A N   
671  C  CA  . ARG A 82  ? 0.1412 0.1757 0.1620 -0.0321 -0.0169 -0.0060 221 ARG A CA  
672  C  C   . ARG A 82  ? 0.1191 0.1478 0.1415 -0.0278 -0.0151 -0.0078 221 ARG A C   
673  O  O   . ARG A 82  ? 0.1302 0.1510 0.1507 -0.0279 -0.0148 -0.0092 221 ARG A O   
674  C  CB  . ARG A 82  ? 0.2252 0.2600 0.2458 -0.0346 -0.0178 -0.0056 221 ARG A CB  
675  C  CG  . ARG A 82  ? 0.2983 0.3248 0.3187 -0.0334 -0.0170 -0.0073 221 ARG A CG  
676  C  CD  . ARG A 82  ? 0.3962 0.4260 0.4190 -0.0334 -0.0171 -0.0067 221 ARG A CD  
677  N  NE  . ARG A 82  ? 0.3793 0.4016 0.4019 -0.0325 -0.0163 -0.0082 221 ARG A NE  
678  C  CZ  . ARG A 82  ? 0.3295 0.3448 0.3483 -0.0351 -0.0169 -0.0089 221 ARG A CZ  
679  N  NH1 . ARG A 82  ? 0.2789 0.2927 0.2932 -0.0389 -0.0184 -0.0084 221 ARG A NH1 
680  N  NH2 . ARG A 82  ? 0.3237 0.3332 0.3425 -0.0336 -0.0160 -0.0100 221 ARG A NH2 
681  N  N   . ALA A 83  ? 0.1094 0.1419 0.1348 -0.0239 -0.0140 -0.0074 222 ALA A N   
682  C  CA  . ALA A 83  ? 0.1026 0.1299 0.1289 -0.0204 -0.0126 -0.0087 222 ALA A CA  
683  C  C   . ALA A 83  ? 0.1349 0.1580 0.1621 -0.0201 -0.0122 -0.0095 222 ALA A C   
684  O  O   . ALA A 83  ? 0.1544 0.1808 0.1827 -0.0207 -0.0126 -0.0088 222 ALA A O   
685  C  CB  . ALA A 83  ? 0.1262 0.1577 0.1540 -0.0166 -0.0117 -0.0080 222 ALA A CB  
686  N  N   . LEU A 84  ? 0.0906 0.1074 0.1173 -0.0192 -0.0115 -0.0107 223 LEU A N   
687  C  CA  . LEU A 84  ? 0.1137 0.1267 0.1412 -0.0188 -0.0110 -0.0112 223 LEU A CA  
688  C  C   . LEU A 84  ? 0.1263 0.1383 0.1552 -0.0159 -0.0100 -0.0113 223 LEU A C   
689  O  O   . LEU A 84  ? 0.1280 0.1401 0.1581 -0.0154 -0.0098 -0.0112 223 LEU A O   
690  C  CB  . LEU A 84  ? 0.1430 0.1498 0.1682 -0.0198 -0.0109 -0.0120 223 LEU A CB  
691  C  CG  . LEU A 84  ? 0.1697 0.1745 0.1915 -0.0228 -0.0119 -0.0121 223 LEU A CG  
692  C  CD1 . LEU A 84  ? 0.2202 0.2180 0.2389 -0.0224 -0.0114 -0.0129 223 LEU A CD1 
693  C  CD2 . LEU A 84  ? 0.2306 0.2369 0.2523 -0.0252 -0.0128 -0.0116 223 LEU A CD2 
694  N  N   . GLN A 85  ? 0.1035 0.1141 0.1320 -0.0144 -0.0096 -0.0115 224 GLN A N   
695  C  CA  . GLN A 85  ? 0.0989 0.1071 0.1276 -0.0124 -0.0088 -0.0116 224 GLN A CA  
696  C  C   . GLN A 85  ? 0.1057 0.1136 0.1335 -0.0109 -0.0086 -0.0115 224 GLN A C   
697  O  O   . GLN A 85  ? 0.1190 0.1278 0.1463 -0.0115 -0.0089 -0.0117 224 GLN A O   
698  C  CB  . GLN A 85  ? 0.1052 0.1095 0.1341 -0.0129 -0.0085 -0.0118 224 GLN A CB  
699  C  CG  . GLN A 85  ? 0.1045 0.1065 0.1322 -0.0136 -0.0084 -0.0121 224 GLN A CG  
700  C  CD  . GLN A 85  ? 0.1095 0.1098 0.1367 -0.0123 -0.0079 -0.0120 224 GLN A CD  
701  O  OE1 . GLN A 85  ? 0.1161 0.1169 0.1435 -0.0113 -0.0079 -0.0117 224 GLN A OE1 
702  N  NE2 . GLN A 85  ? 0.1392 0.1371 0.1652 -0.0123 -0.0076 -0.0120 224 GLN A NE2 
703  N  N   . LEU A 86  ? 0.1021 0.1083 0.1293 -0.0092 -0.0082 -0.0114 225 LEU A N   
704  C  CA  . LEU A 86  ? 0.0837 0.0886 0.1096 -0.0080 -0.0080 -0.0113 225 LEU A CA  
705  C  C   . LEU A 86  ? 0.1081 0.1090 0.1332 -0.0080 -0.0079 -0.0111 225 LEU A C   
706  O  O   . LEU A 86  ? 0.1010 0.1005 0.1261 -0.0085 -0.0078 -0.0109 225 LEU A O   
707  C  CB  . LEU A 86  ? 0.0907 0.0978 0.1153 -0.0059 -0.0079 -0.0109 225 LEU A CB  
708  C  CG  . LEU A 86  ? 0.0945 0.1003 0.1171 -0.0039 -0.0076 -0.0105 225 LEU A CG  
709  C  CD1 . LEU A 86  ? 0.1157 0.1160 0.1355 -0.0032 -0.0074 -0.0105 225 LEU A CD1 
710  C  CD2 . LEU A 86  ? 0.1029 0.1132 0.1246 -0.0015 -0.0073 -0.0099 225 LEU A CD2 
711  N  N   . HIS A 87  ? 0.0813 0.0810 0.1058 -0.0078 -0.0078 -0.0110 226 HIS A N   
712  C  CA  . HIS A 87  ? 0.0796 0.0765 0.1031 -0.0082 -0.0079 -0.0103 226 HIS A CA  
713  C  C   . HIS A 87  ? 0.0909 0.0871 0.1131 -0.0074 -0.0080 -0.0101 226 HIS A C   
714  O  O   . HIS A 87  ? 0.1054 0.1034 0.1278 -0.0064 -0.0079 -0.0106 226 HIS A O   
715  C  CB  . HIS A 87  ? 0.0814 0.0785 0.1064 -0.0095 -0.0077 -0.0099 226 HIS A CB  
716  C  CG  . HIS A 87  ? 0.0824 0.0807 0.1082 -0.0092 -0.0075 -0.0102 226 HIS A CG  
717  N  ND1 . HIS A 87  ? 0.0935 0.0925 0.1197 -0.0096 -0.0074 -0.0110 226 HIS A ND1 
718  C  CD2 . HIS A 87  ? 0.0770 0.0754 0.1024 -0.0087 -0.0074 -0.0099 226 HIS A CD2 
719  C  CE1 . HIS A 87  ? 0.1005 0.0993 0.1261 -0.0093 -0.0073 -0.0111 226 HIS A CE1 
720  N  NE2 . HIS A 87  ? 0.0671 0.0659 0.0925 -0.0085 -0.0073 -0.0105 226 HIS A NE2 
721  N  N   . LEU A 88  ? 0.0946 0.0886 0.1154 -0.0081 -0.0083 -0.0092 227 LEU A N   
722  C  CA  . LEU A 88  ? 0.1063 0.0991 0.1253 -0.0076 -0.0085 -0.0089 227 LEU A CA  
723  C  C   . LEU A 88  ? 0.0998 0.0935 0.1196 -0.0088 -0.0087 -0.0078 227 LEU A C   
724  O  O   . LEU A 88  ? 0.1122 0.1068 0.1331 -0.0100 -0.0087 -0.0069 227 LEU A O   
725  C  CB  . LEU A 88  ? 0.1296 0.1180 0.1444 -0.0073 -0.0089 -0.0086 227 LEU A CB  
726  C  CG  . LEU A 88  ? 0.1441 0.1316 0.1573 -0.0054 -0.0085 -0.0093 227 LEU A CG  
727  C  CD1 . LEU A 88  ? 0.2102 0.1920 0.2183 -0.0053 -0.0088 -0.0089 227 LEU A CD1 
728  C  CD2 . LEU A 88  ? 0.2262 0.2156 0.2391 -0.0031 -0.0081 -0.0097 227 LEU A CD2 
729  N  N   . HIS A 89  ? 0.0886 0.0824 0.1078 -0.0082 -0.0089 -0.0076 228 HIS A N   
730  C  CA  . HIS A 89  ? 0.0976 0.0929 0.1172 -0.0090 -0.0092 -0.0062 228 HIS A CA  
731  C  C   . HIS A 89  ? 0.1133 0.1060 0.1298 -0.0095 -0.0099 -0.0055 228 HIS A C   
732  O  O   . HIS A 89  ? 0.1182 0.1092 0.1332 -0.0081 -0.0098 -0.0064 228 HIS A O   
733  C  CB  . HIS A 89  ? 0.1003 0.0986 0.1222 -0.0078 -0.0086 -0.0066 228 HIS A CB  
734  C  CG  . HIS A 89  ? 0.0900 0.0895 0.1136 -0.0074 -0.0080 -0.0073 228 HIS A CG  
735  N  ND1 . HIS A 89  ? 0.1072 0.1081 0.1315 -0.0076 -0.0076 -0.0063 228 HIS A ND1 
736  C  CD2 . HIS A 89  ? 0.0905 0.0898 0.1145 -0.0069 -0.0077 -0.0087 228 HIS A CD2 
737  C  CE1 . HIS A 89  ? 0.0927 0.0932 0.1175 -0.0072 -0.0071 -0.0072 228 HIS A CE1 
738  N  NE2 . HIS A 89  ? 0.0887 0.0883 0.1133 -0.0071 -0.0073 -0.0087 228 HIS A NE2 
739  N  N   . TRP A 90  ? 0.1039 0.0963 0.1190 -0.0116 -0.0107 -0.0037 229 TRP A N   
740  C  CA  . TRP A 90  ? 0.1266 0.1153 0.1375 -0.0128 -0.0117 -0.0029 229 TRP A CA  
741  C  C   . TRP A 90  ? 0.1262 0.1176 0.1371 -0.0151 -0.0125 -0.0005 229 TRP A C   
742  O  O   . TRP A 90  ? 0.1127 0.1092 0.1267 -0.0153 -0.0122 0.0007  229 TRP A O   
743  C  CB  . TRP A 90  ? 0.1490 0.1318 0.1553 -0.0138 -0.0122 -0.0030 229 TRP A CB  
744  C  CG  . TRP A 90  ? 0.1284 0.1118 0.1349 -0.0163 -0.0126 -0.0019 229 TRP A CG  
745  C  CD1 . TRP A 90  ? 0.1583 0.1420 0.1630 -0.0197 -0.0137 0.0004  229 TRP A CD1 
746  C  CD2 . TRP A 90  ? 0.1178 0.1020 0.1264 -0.0158 -0.0119 -0.0027 229 TRP A CD2 
747  N  NE1 . TRP A 90  ? 0.1277 0.1126 0.1333 -0.0212 -0.0137 0.0011  229 TRP A NE1 
748  C  CE2 . TRP A 90  ? 0.1111 0.0961 0.1191 -0.0188 -0.0125 -0.0009 229 TRP A CE2 
749  C  CE3 . TRP A 90  ? 0.1315 0.1165 0.1423 -0.0134 -0.0109 -0.0046 229 TRP A CE3 
750  C  CZ2 . TRP A 90  ? 0.1189 0.1049 0.1287 -0.0191 -0.0121 -0.0012 229 TRP A CZ2 
751  C  CZ3 . TRP A 90  ? 0.1197 0.1056 0.1322 -0.0139 -0.0105 -0.0048 229 TRP A CZ3 
752  C  CH2 . TRP A 90  ? 0.1178 0.1040 0.1298 -0.0165 -0.0111 -0.0032 229 TRP A CH2 
753  N  N   . GLY A 91  ? 0.1532 0.1410 0.1598 -0.0166 -0.0137 0.0005  230 GLY A N   
754  C  CA  . GLY A 91  ? 0.1380 0.1289 0.1442 -0.0191 -0.0147 0.0030  230 GLY A CA  
755  C  C   . GLY A 91  ? 0.1713 0.1593 0.1730 -0.0233 -0.0162 0.0051  230 GLY A C   
756  O  O   . GLY A 91  ? 0.1519 0.1414 0.1545 -0.0246 -0.0162 0.0058  230 GLY A O   
757  N  N   . ALA A 92  ? 0.1756 0.1595 0.1721 -0.0257 -0.0177 0.0063  231 ALA A N   
758  C  CA  . ALA A 92  ? 0.1541 0.1343 0.1449 -0.0305 -0.0196 0.0085  231 ALA A CA  
759  C  C   . ALA A 92  ? 0.2552 0.2267 0.2385 -0.0316 -0.0208 0.0083  231 ALA A C   
760  O  O   . ALA A 92  ? 0.2425 0.2116 0.2258 -0.0282 -0.0200 0.0064  231 ALA A O   
761  C  CB  . ALA A 92  ? 0.1791 0.1676 0.1724 -0.0337 -0.0205 0.0120  231 ALA A CB  
762  N  N   . ALA A 93  ? 0.2637 0.2299 0.2400 -0.0365 -0.0228 0.0104  232 ALA A N   
763  C  CA  . ALA A 93  ? 0.2817 0.2377 0.2490 -0.0376 -0.0241 0.0102  232 ALA A CA  
764  C  C   . ALA A 93  ? 0.2792 0.2389 0.2488 -0.0365 -0.0242 0.0106  232 ALA A C   
765  O  O   . ALA A 93  ? 0.3374 0.3047 0.3100 -0.0392 -0.0251 0.0132  232 ALA A O   
766  C  CB  . ALA A 93  ? 0.2992 0.2493 0.2581 -0.0440 -0.0266 0.0128  232 ALA A CB  
767  N  N   . GLY A 94  ? 0.3020 0.2572 0.2704 -0.0323 -0.0231 0.0082  233 GLY A N   
768  C  CA  . GLY A 94  ? 0.3112 0.2690 0.2812 -0.0310 -0.0230 0.0084  233 GLY A CA  
769  C  C   . GLY A 94  ? 0.3153 0.2842 0.2954 -0.0278 -0.0215 0.0079  233 GLY A C   
770  O  O   . GLY A 94  ? 0.3200 0.2914 0.3020 -0.0262 -0.0212 0.0078  233 GLY A O   
771  N  N   . ARG A 95  ? 0.2190 0.1942 0.2051 -0.0269 -0.0204 0.0076  234 ARG A N   
772  C  CA  . ARG A 95  ? 0.1864 0.1712 0.1808 -0.0242 -0.0191 0.0074  234 ARG A CA  
773  C  C   . ARG A 95  ? 0.1495 0.1347 0.1477 -0.0200 -0.0171 0.0045  234 ARG A C   
774  O  O   . ARG A 95  ? 0.1760 0.1586 0.1735 -0.0200 -0.0167 0.0036  234 ARG A O   
775  C  CB  A ARG A 95  ? 0.2577 0.2504 0.2553 -0.0268 -0.0196 0.0102  234 ARG A CB  
776  C  CB  B ARG A 95  ? 0.2559 0.2486 0.2536 -0.0268 -0.0196 0.0102  234 ARG A CB  
777  C  CG  A ARG A 95  ? 0.2671 0.2605 0.2607 -0.0317 -0.0218 0.0136  234 ARG A CG  
778  C  CG  B ARG A 95  ? 0.2700 0.2719 0.2742 -0.0242 -0.0185 0.0108  234 ARG A CG  
779  C  CD  A ARG A 95  ? 0.2611 0.2613 0.2563 -0.0349 -0.0225 0.0168  234 ARG A CD  
780  C  CD  B ARG A 95  ? 0.2682 0.2785 0.2748 -0.0262 -0.0190 0.0141  234 ARG A CD  
781  N  NE  A ARG A 95  ? 0.2725 0.2833 0.2748 -0.0321 -0.0211 0.0177  234 ARG A NE  
782  N  NE  B ARG A 95  ? 0.2652 0.2828 0.2775 -0.0224 -0.0173 0.0139  234 ARG A NE  
783  C  CZ  A ARG A 95  ? 0.2399 0.2582 0.2449 -0.0331 -0.0210 0.0203  234 ARG A CZ  
784  C  CZ  B ARG A 95  ? 0.2344 0.2601 0.2495 -0.0223 -0.0169 0.0165  234 ARG A CZ  
785  N  NH1 A ARG A 95  ? 0.2368 0.2537 0.2385 -0.0374 -0.0222 0.0221  234 ARG A NH1 
786  N  NH1 B ARG A 95  ? 0.2499 0.2788 0.2633 -0.0263 -0.0182 0.0198  234 ARG A NH1 
787  N  NH2 A ARG A 95  ? 0.2456 0.2725 0.2560 -0.0297 -0.0195 0.0211  234 ARG A NH2 
788  N  NH2 B ARG A 95  ? 0.2999 0.3305 0.3188 -0.0181 -0.0153 0.0161  234 ARG A NH2 
789  N  N   . PRO A 96  ? 0.1717 0.1605 0.1741 -0.0167 -0.0159 0.0031  235 PRO A N   
790  C  CA  . PRO A 96  ? 0.1777 0.1667 0.1829 -0.0133 -0.0143 0.0006  235 PRO A CA  
791  C  C   . PRO A 96  ? 0.1453 0.1398 0.1554 -0.0129 -0.0134 0.0006  235 PRO A C   
792  O  O   . PRO A 96  ? 0.1903 0.1898 0.2025 -0.0140 -0.0137 0.0025  235 PRO A O   
793  C  CB  . PRO A 96  ? 0.1796 0.1706 0.1868 -0.0107 -0.0136 -0.0005 235 PRO A CB  
794  C  CG  . PRO A 96  ? 0.1969 0.1921 0.2053 -0.0121 -0.0144 0.0016  235 PRO A CG  
795  C  CD  . PRO A 96  ? 0.2088 0.2009 0.2126 -0.0161 -0.0161 0.0038  235 PRO A CD  
796  N  N   . GLY A 97  ? 0.1275 0.1212 0.1390 -0.0111 -0.0124 -0.0013 236 GLY A N   
797  C  CA  . GLY A 97  ? 0.1104 0.1079 0.1256 -0.0107 -0.0117 -0.0014 236 GLY A CA  
798  C  C   . GLY A 97  ? 0.1221 0.1202 0.1396 -0.0083 -0.0105 -0.0036 236 GLY A C   
799  O  O   . GLY A 97  ? 0.1177 0.1168 0.1368 -0.0083 -0.0100 -0.0039 236 GLY A O   
800  N  N   . SER A 98  ? 0.1312 0.1290 0.1488 -0.0066 -0.0101 -0.0049 237 SER A N   
801  C  CA  . SER A 98  ? 0.0993 0.0987 0.1190 -0.0050 -0.0092 -0.0065 237 SER A CA  
802  C  C   . SER A 98  ? 0.1232 0.1257 0.1452 -0.0046 -0.0088 -0.0063 237 SER A C   
803  O  O   . SER A 98  ? 0.1200 0.1245 0.1424 -0.0048 -0.0090 -0.0048 237 SER A O   
804  C  CB  . SER A 98  ? 0.1178 0.1173 0.1371 -0.0034 -0.0090 -0.0075 237 SER A CB  
805  O  OG  . SER A 98  ? 0.1239 0.1253 0.1440 -0.0029 -0.0090 -0.0072 237 SER A OG  
806  N  N   . GLU A 99  ? 0.0978 0.1007 0.1208 -0.0040 -0.0082 -0.0075 238 GLU A N   
807  C  CA  . GLU A 99  ? 0.0828 0.0870 0.1065 -0.0032 -0.0077 -0.0075 238 GLU A CA  
808  C  C   . GLU A 99  ? 0.1009 0.1058 0.1245 -0.0021 -0.0075 -0.0083 238 GLU A C   
809  O  O   . GLU A 99  ? 0.1214 0.1276 0.1449 -0.0011 -0.0074 -0.0075 238 GLU A O   
810  C  CB  . GLU A 99  ? 0.1065 0.1094 0.1301 -0.0035 -0.0073 -0.0084 238 GLU A CB  
811  C  CG  . GLU A 99  ? 0.1001 0.1026 0.1240 -0.0046 -0.0074 -0.0075 238 GLU A CG  
812  C  CD  . GLU A 99  ? 0.1313 0.1335 0.1551 -0.0043 -0.0068 -0.0075 238 GLU A CD  
813  O  OE1 . GLU A 99  ? 0.1268 0.1305 0.1507 -0.0039 -0.0065 -0.0059 238 GLU A OE1 
814  O  OE2 . GLU A 99  ? 0.1083 0.1091 0.1317 -0.0045 -0.0067 -0.0088 238 GLU A OE2 
815  N  N   . HIS A 100 ? 0.1046 0.1091 0.1280 -0.0023 -0.0076 -0.0096 239 HIS A N   
816  C  CA  . HIS A 100 ? 0.0999 0.1055 0.1231 -0.0016 -0.0075 -0.0101 239 HIS A CA  
817  C  C   . HIS A 100 ? 0.1223 0.1291 0.1459 -0.0010 -0.0078 -0.0094 239 HIS A C   
818  O  O   . HIS A 100 ? 0.1207 0.1266 0.1440 -0.0014 -0.0081 -0.0088 239 HIS A O   
819  C  CB  . HIS A 100 ? 0.0952 0.1013 0.1181 -0.0023 -0.0076 -0.0113 239 HIS A CB  
820  C  CG  . HIS A 100 ? 0.0759 0.0805 0.0977 -0.0033 -0.0076 -0.0119 239 HIS A CG  
821  N  ND1 . HIS A 100 ? 0.1055 0.1091 0.1274 -0.0041 -0.0076 -0.0120 239 HIS A ND1 
822  C  CD2 . HIS A 100 ? 0.0872 0.0903 0.1070 -0.0037 -0.0076 -0.0126 239 HIS A CD2 
823  C  CE1 . HIS A 100 ? 0.1023 0.1041 0.1225 -0.0050 -0.0076 -0.0126 239 HIS A CE1 
824  N  NE2 . HIS A 100 ? 0.1159 0.1169 0.1344 -0.0048 -0.0077 -0.0129 239 HIS A NE2 
825  N  N   . THR A 101 ? 0.1081 0.1162 0.1318 -0.0002 -0.0077 -0.0095 240 THR A N   
826  C  CA  . THR A 101 ? 0.1161 0.1253 0.1401 0.0003  -0.0080 -0.0089 240 THR A CA  
827  C  C   . THR A 101 ? 0.1402 0.1508 0.1643 0.0008  -0.0078 -0.0098 240 THR A C   
828  O  O   . THR A 101 ? 0.1182 0.1290 0.1419 0.0004  -0.0076 -0.0107 240 THR A O   
829  C  CB  . THR A 101 ? 0.0819 0.0925 0.1062 0.0009  -0.0081 -0.0075 240 THR A CB  
830  O  OG1 . THR A 101 ? 0.1195 0.1306 0.1435 0.0019  -0.0076 -0.0079 240 THR A OG1 
831  C  CG2 . THR A 101 ? 0.1084 0.1189 0.1326 0.0000  -0.0084 -0.0060 240 THR A CG2 
832  N  N   . VAL A 102 ? 0.1002 0.1117 0.1244 0.0014  -0.0079 -0.0095 241 VAL A N   
833  C  CA  . VAL A 102 ? 0.0964 0.1101 0.1208 0.0020  -0.0076 -0.0101 241 VAL A CA  
834  C  C   . VAL A 102 ? 0.1033 0.1182 0.1282 0.0028  -0.0078 -0.0095 241 VAL A C   
835  O  O   . VAL A 102 ? 0.1397 0.1537 0.1641 0.0031  -0.0081 -0.0087 241 VAL A O   
836  C  CB  . VAL A 102 ? 0.1328 0.1474 0.1567 0.0026  -0.0074 -0.0102 241 VAL A CB  
837  C  CG1 . VAL A 102 ? 0.1413 0.1595 0.1657 0.0032  -0.0071 -0.0104 241 VAL A CG1 
838  C  CG2 . VAL A 102 ? 0.1477 0.1621 0.1714 0.0018  -0.0073 -0.0106 241 VAL A CG2 
839  N  N   . GLU A 103 ? 0.1258 0.1421 0.1511 0.0030  -0.0077 -0.0099 242 GLU A N   
840  C  CA  . GLU A 103 ? 0.1053 0.1231 0.1311 0.0039  -0.0078 -0.0093 242 GLU A CA  
841  C  C   . GLU A 103 ? 0.1423 0.1596 0.1683 0.0039  -0.0082 -0.0079 242 GLU A C   
842  O  O   . GLU A 103 ? 0.1536 0.1721 0.1800 0.0042  -0.0085 -0.0069 242 GLU A O   
843  C  CB  . GLU A 103 ? 0.1613 0.1809 0.1876 0.0045  -0.0077 -0.0093 242 GLU A CB  
844  C  CG  . GLU A 103 ? 0.1655 0.1872 0.1918 0.0042  -0.0074 -0.0102 242 GLU A CG  
845  C  CD  . GLU A 103 ? 0.2913 0.3159 0.3182 0.0052  -0.0071 -0.0100 242 GLU A CD  
846  O  OE1 . GLU A 103 ? 0.1966 0.2239 0.2236 0.0047  -0.0069 -0.0104 242 GLU A OE1 
847  O  OE2 . GLU A 103 ? 0.2648 0.2888 0.2915 0.0062  -0.0071 -0.0093 242 GLU A OE2 
848  N  N   . GLY A 104 ? 0.1058 0.1218 0.1314 0.0035  -0.0081 -0.0076 243 GLY A N   
849  C  CA  . GLY A 104 ? 0.1032 0.1200 0.1289 0.0033  -0.0085 -0.0059 243 GLY A CA  
850  C  C   . GLY A 104 ? 0.1089 0.1243 0.1340 0.0019  -0.0092 -0.0049 243 GLY A C   
851  O  O   . GLY A 104 ? 0.1130 0.1294 0.1379 0.0010  -0.0097 -0.0031 243 GLY A O   
852  N  N   . HIS A 105 ? 0.1265 0.1395 0.1506 0.0016  -0.0092 -0.0058 244 HIS A N   
853  C  CA  . HIS A 105 ? 0.1055 0.1155 0.1275 0.0004  -0.0098 -0.0051 244 HIS A CA  
854  C  C   . HIS A 105 ? 0.1275 0.1354 0.1489 -0.0004 -0.0096 -0.0056 244 HIS A C   
855  O  O   . HIS A 105 ? 0.1195 0.1275 0.1417 0.0003  -0.0090 -0.0069 244 HIS A O   
856  C  CB  . HIS A 105 ? 0.1113 0.1195 0.1316 0.0012  -0.0097 -0.0057 244 HIS A CB  
857  C  CG  . HIS A 105 ? 0.1351 0.1449 0.1557 0.0018  -0.0100 -0.0051 244 HIS A CG  
858  N  ND1 . HIS A 105 ? 0.1185 0.1272 0.1374 0.0006  -0.0110 -0.0035 244 HIS A ND1 
859  C  CD2 . HIS A 105 ? 0.1575 0.1701 0.1797 0.0032  -0.0094 -0.0058 244 HIS A CD2 
860  C  CE1 . HIS A 105 ? 0.1068 0.1175 0.1265 0.0015  -0.0110 -0.0034 244 HIS A CE1 
861  N  NE2 . HIS A 105 ? 0.1193 0.1325 0.1411 0.0031  -0.0100 -0.0048 244 HIS A NE2 
862  N  N   . ARG A 106 ? 0.1346 0.1405 0.1544 -0.0020 -0.0104 -0.0043 245 ARG A N   
863  C  CA  . ARG A 106 ? 0.1266 0.1304 0.1457 -0.0029 -0.0103 -0.0045 245 ARG A CA  
864  C  C   . ARG A 106 ? 0.1543 0.1533 0.1699 -0.0031 -0.0105 -0.0049 245 ARG A C   
865  O  O   . ARG A 106 ? 0.1728 0.1690 0.1853 -0.0035 -0.0112 -0.0042 245 ARG A O   
866  C  CB  . ARG A 106 ? 0.1151 0.1203 0.1344 -0.0046 -0.0109 -0.0027 245 ARG A CB  
867  C  CG  . ARG A 106 ? 0.1224 0.1266 0.1419 -0.0053 -0.0106 -0.0030 245 ARG A CG  
868  C  CD  . ARG A 106 ? 0.1743 0.1809 0.1941 -0.0070 -0.0111 -0.0008 245 ARG A CD  
869  N  NE  . ARG A 106 ? 0.1747 0.1862 0.1967 -0.0057 -0.0107 0.0003  245 ARG A NE  
870  C  CZ  . ARG A 106 ? 0.1820 0.1952 0.2056 -0.0038 -0.0096 -0.0005 245 ARG A CZ  
871  N  NH1 . ARG A 106 ? 0.1516 0.1623 0.1753 -0.0033 -0.0090 -0.0023 245 ARG A NH1 
872  N  NH2 . ARG A 106 ? 0.2273 0.2443 0.2517 -0.0022 -0.0092 0.0007  245 ARG A NH2 
873  N  N   . PHE A 107 ? 0.1220 0.1197 0.1374 -0.0025 -0.0100 -0.0060 246 PHE A N   
874  C  CA  . PHE A 107 ? 0.1109 0.1041 0.1226 -0.0019 -0.0100 -0.0064 246 PHE A CA  
875  C  C   . PHE A 107 ? 0.1330 0.1226 0.1423 -0.0039 -0.0106 -0.0056 246 PHE A C   
876  O  O   . PHE A 107 ? 0.1289 0.1208 0.1404 -0.0055 -0.0109 -0.0049 246 PHE A O   
877  C  CB  . PHE A 107 ? 0.1287 0.1238 0.1417 0.0000  -0.0090 -0.0077 246 PHE A CB  
878  C  CG  . PHE A 107 ? 0.1414 0.1399 0.1559 0.0018  -0.0084 -0.0082 246 PHE A CG  
879  C  CD1 . PHE A 107 ? 0.1793 0.1819 0.1973 0.0014  -0.0083 -0.0085 246 PHE A CD1 
880  C  CD2 . PHE A 107 ? 0.2299 0.2273 0.2419 0.0039  -0.0079 -0.0083 246 PHE A CD2 
881  C  CE1 . PHE A 107 ? 0.2342 0.2399 0.2534 0.0026  -0.0078 -0.0090 246 PHE A CE1 
882  C  CE2 . PHE A 107 ? 0.2318 0.2332 0.2453 0.0054  -0.0073 -0.0085 246 PHE A CE2 
883  C  CZ  . PHE A 107 ? 0.2306 0.2362 0.2478 0.0044  -0.0074 -0.0089 246 PHE A CZ  
884  N  N   . PRO A 108 ? 0.1433 0.1271 0.1474 -0.0037 -0.0109 -0.0055 247 PRO A N   
885  C  CA  . PRO A 108 ? 0.1308 0.1105 0.1319 -0.0061 -0.0117 -0.0047 247 PRO A CA  
886  C  C   . PRO A 108 ? 0.1399 0.1224 0.1444 -0.0066 -0.0113 -0.0051 247 PRO A C   
887  O  O   . PRO A 108 ? 0.1445 0.1277 0.1496 -0.0091 -0.0119 -0.0040 247 PRO A O   
888  C  CB  . PRO A 108 ? 0.1677 0.1401 0.1621 -0.0047 -0.0117 -0.0051 247 PRO A CB  
889  C  CG  . PRO A 108 ? 0.1707 0.1425 0.1635 -0.0028 -0.0115 -0.0051 247 PRO A CG  
890  C  CD  . PRO A 108 ? 0.1564 0.1362 0.1562 -0.0014 -0.0106 -0.0059 247 PRO A CD  
891  N  N   . ALA A 109 ? 0.1311 0.1156 0.1378 -0.0044 -0.0103 -0.0065 248 ALA A N   
892  C  CA  . ALA A 109 ? 0.1336 0.1204 0.1432 -0.0050 -0.0099 -0.0069 248 ALA A CA  
893  C  C   . ALA A 109 ? 0.1424 0.1333 0.1553 -0.0032 -0.0090 -0.0082 248 ALA A C   
894  O  O   . ALA A 109 ? 0.1276 0.1202 0.1408 -0.0016 -0.0086 -0.0086 248 ALA A O   
895  C  CB  . ALA A 109 ? 0.1439 0.1259 0.1497 -0.0055 -0.0101 -0.0069 248 ALA A CB  
896  N  N   . GLU A 110 ? 0.1143 0.1071 0.1296 -0.0037 -0.0087 -0.0086 249 GLU A N   
897  C  CA  . GLU A 110 ? 0.1001 0.0967 0.1181 -0.0029 -0.0082 -0.0096 249 GLU A CA  
898  C  C   . GLU A 110 ? 0.1212 0.1181 0.1399 -0.0034 -0.0080 -0.0099 249 GLU A C   
899  O  O   . GLU A 110 ? 0.1158 0.1112 0.1347 -0.0047 -0.0082 -0.0095 249 GLU A O   
900  C  CB  . GLU A 110 ? 0.1119 0.1112 0.1325 -0.0035 -0.0081 -0.0096 249 GLU A CB  
901  C  CG  . GLU A 110 ? 0.1063 0.1084 0.1285 -0.0034 -0.0078 -0.0105 249 GLU A CG  
902  C  CD  . GLU A 110 ? 0.1011 0.1043 0.1242 -0.0036 -0.0078 -0.0106 249 GLU A CD  
903  O  OE1 . GLU A 110 ? 0.1082 0.1112 0.1311 -0.0032 -0.0079 -0.0100 249 GLU A OE1 
904  O  OE2 . GLU A 110 ? 0.1022 0.1060 0.1256 -0.0042 -0.0077 -0.0112 249 GLU A OE2 
905  N  N   . ILE A 111 ? 0.0990 0.0983 0.1181 -0.0023 -0.0077 -0.0104 250 ILE A N   
906  C  CA  . ILE A 111 ? 0.0701 0.0705 0.0902 -0.0028 -0.0076 -0.0106 250 ILE A CA  
907  C  C   . ILE A 111 ? 0.0941 0.0979 0.1166 -0.0040 -0.0077 -0.0111 250 ILE A C   
908  O  O   . ILE A 111 ? 0.0926 0.0990 0.1156 -0.0038 -0.0076 -0.0113 250 ILE A O   
909  C  CB  . ILE A 111 ? 0.1171 0.1182 0.1353 -0.0008 -0.0073 -0.0104 250 ILE A CB  
910  C  CG1 . ILE A 111 ? 0.1127 0.1156 0.1322 -0.0015 -0.0073 -0.0105 250 ILE A CG1 
911  C  CG2 . ILE A 111 ? 0.1251 0.1303 0.1433 0.0009  -0.0069 -0.0102 250 ILE A CG2 
912  C  CD1 . ILE A 111 ? 0.1522 0.1553 0.1693 0.0009  -0.0069 -0.0101 250 ILE A CD1 
913  N  N   . HIS A 112 ? 0.0873 0.0907 0.1108 -0.0054 -0.0078 -0.0113 251 HIS A N   
914  C  CA  . HIS A 112 ? 0.0677 0.0728 0.0923 -0.0069 -0.0080 -0.0117 251 HIS A CA  
915  C  C   . HIS A 112 ? 0.0921 0.0989 0.1172 -0.0076 -0.0081 -0.0117 251 HIS A C   
916  O  O   . HIS A 112 ? 0.1092 0.1144 0.1345 -0.0076 -0.0080 -0.0116 251 HIS A O   
917  C  CB  . HIS A 112 ? 0.1084 0.1109 0.1330 -0.0077 -0.0079 -0.0119 251 HIS A CB  
918  C  CG  . HIS A 112 ? 0.0725 0.0744 0.0968 -0.0071 -0.0077 -0.0117 251 HIS A CG  
919  N  ND1 . HIS A 112 ? 0.0812 0.0815 0.1053 -0.0070 -0.0075 -0.0113 251 HIS A ND1 
920  C  CD2 . HIS A 112 ? 0.0679 0.0709 0.0919 -0.0063 -0.0078 -0.0117 251 HIS A CD2 
921  C  CE1 . HIS A 112 ? 0.0895 0.0900 0.1132 -0.0061 -0.0074 -0.0111 251 HIS A CE1 
922  N  NE2 . HIS A 112 ? 0.0932 0.0951 0.1169 -0.0059 -0.0076 -0.0114 251 HIS A NE2 
923  N  N   . VAL A 113 ? 0.0914 0.1017 0.1166 -0.0084 -0.0085 -0.0117 252 VAL A N   
924  C  CA  . VAL A 113 ? 0.0983 0.1111 0.1241 -0.0096 -0.0088 -0.0114 252 VAL A CA  
925  C  C   . VAL A 113 ? 0.1074 0.1191 0.1324 -0.0123 -0.0094 -0.0118 252 VAL A C   
926  O  O   . VAL A 113 ? 0.0917 0.1047 0.1156 -0.0134 -0.0099 -0.0118 252 VAL A O   
927  C  CB  . VAL A 113 ? 0.0999 0.1185 0.1258 -0.0086 -0.0089 -0.0105 252 VAL A CB  
928  C  CG1 . VAL A 113 ? 0.0934 0.1150 0.1199 -0.0097 -0.0093 -0.0099 252 VAL A CG1 
929  C  CG2 . VAL A 113 ? 0.1263 0.1444 0.1512 -0.0053 -0.0081 -0.0101 252 VAL A CG2 
930  N  N   . VAL A 114 ? 0.1027 0.1115 0.1277 -0.0133 -0.0095 -0.0121 253 VAL A N   
931  C  CA  . VAL A 114 ? 0.0988 0.1045 0.1218 -0.0154 -0.0099 -0.0126 253 VAL A CA  
932  C  C   . VAL A 114 ? 0.1047 0.1128 0.1271 -0.0179 -0.0108 -0.0122 253 VAL A C   
933  O  O   . VAL A 114 ? 0.1071 0.1177 0.1312 -0.0178 -0.0109 -0.0118 253 VAL A O   
934  C  CB  . VAL A 114 ? 0.0921 0.0934 0.1149 -0.0147 -0.0093 -0.0129 253 VAL A CB  
935  C  CG1 . VAL A 114 ? 0.1387 0.1355 0.1582 -0.0161 -0.0095 -0.0134 253 VAL A CG1 
936  C  CG2 . VAL A 114 ? 0.0924 0.0926 0.1159 -0.0125 -0.0085 -0.0128 253 VAL A CG2 
937  N  N   . HIS A 115 ? 0.0998 0.1071 0.1193 -0.0204 -0.0117 -0.0123 254 HIS A N   
938  C  CA  . HIS A 115 ? 0.0926 0.1027 0.1109 -0.0238 -0.0130 -0.0116 254 HIS A CA  
939  C  C   . HIS A 115 ? 0.1598 0.1633 0.1734 -0.0265 -0.0137 -0.0122 254 HIS A C   
940  O  O   . HIS A 115 ? 0.1395 0.1372 0.1500 -0.0260 -0.0134 -0.0130 254 HIS A O   
941  C  CB  . HIS A 115 ? 0.0875 0.1034 0.1054 -0.0252 -0.0138 -0.0106 254 HIS A CB  
942  C  CG  . HIS A 115 ? 0.1006 0.1232 0.1219 -0.0223 -0.0131 -0.0097 254 HIS A CG  
943  N  ND1 . HIS A 115 ? 0.1213 0.1425 0.1438 -0.0190 -0.0120 -0.0103 254 HIS A ND1 
944  C  CD2 . HIS A 115 ? 0.1074 0.1379 0.1305 -0.0221 -0.0133 -0.0082 254 HIS A CD2 
945  C  CE1 . HIS A 115 ? 0.1261 0.1531 0.1504 -0.0168 -0.0115 -0.0092 254 HIS A CE1 
946  N  NE2 . HIS A 115 ? 0.1194 0.1523 0.1441 -0.0183 -0.0122 -0.0079 254 HIS A NE2 
947  N  N   . LEU A 116 ? 0.1302 0.1349 0.1428 -0.0294 -0.0148 -0.0116 255 LEU A N   
948  C  CA  . LEU A 116 ? 0.1375 0.1357 0.1446 -0.0326 -0.0158 -0.0120 255 LEU A CA  
949  C  C   . LEU A 116 ? 0.1527 0.1536 0.1564 -0.0374 -0.0177 -0.0109 255 LEU A C   
950  O  O   . LEU A 116 ? 0.1701 0.1794 0.1768 -0.0388 -0.0185 -0.0095 255 LEU A O   
951  C  CB  . LEU A 116 ? 0.1498 0.1465 0.1577 -0.0328 -0.0157 -0.0120 255 LEU A CB  
952  C  CG  . LEU A 116 ? 0.1689 0.1587 0.1706 -0.0363 -0.0168 -0.0122 255 LEU A CG  
953  C  CD1 . LEU A 116 ? 0.1988 0.1786 0.1949 -0.0349 -0.0161 -0.0134 255 LEU A CD1 
954  C  CD2 . LEU A 116 ? 0.2107 0.2009 0.2144 -0.0362 -0.0166 -0.0120 255 LEU A CD2 
955  N  N   . SER A 117 ? 0.1336 0.1275 0.1308 -0.0398 -0.0186 -0.0114 256 SER A N   
956  C  CA  . SER A 117 ? 0.1370 0.1326 0.1299 -0.0452 -0.0207 -0.0102 256 SER A CA  
957  C  C   . SER A 117 ? 0.1679 0.1661 0.1605 -0.0469 -0.0213 -0.0087 256 SER A C   
958  O  O   . SER A 117 ? 0.1879 0.1809 0.1795 -0.0461 -0.0208 -0.0094 256 SER A O   
959  C  CB  . SER A 117 ? 0.1856 0.1708 0.1701 -0.0464 -0.0210 -0.0110 256 SER A CB  
960  O  OG  . SER A 117 ? 0.2217 0.2081 0.2018 -0.0502 -0.0223 -0.0093 256 SER A OG  
961  N  N   . THR A 118 ? 0.1930 0.1995 0.1864 -0.0492 -0.0222 -0.0065 257 THR A N   
962  C  CA  . THR A 118 ? 0.2497 0.2592 0.2424 -0.0512 -0.0228 -0.0048 257 THR A CA  
963  C  C   . THR A 118 ? 0.3024 0.3018 0.2868 -0.0539 -0.0236 -0.0049 257 THR A C   
964  O  O   . THR A 118 ? 0.2996 0.2992 0.2825 -0.0556 -0.0241 -0.0037 257 THR A O   
965  C  CB  . THR A 118 ? 0.2623 0.2831 0.2566 -0.0532 -0.0236 -0.0019 257 THR A CB  
966  O  OG1 . THR A 118 ? 0.2900 0.3094 0.2793 -0.0561 -0.0245 -0.0011 257 THR A OG1 
967  C  CG2 . THR A 118 ? 0.3525 0.3836 0.3544 -0.0500 -0.0228 -0.0015 257 THR A CG2 
968  N  N   . LYS A 119 ? 0.2769 0.2672 0.2556 -0.0542 -0.0236 -0.0062 258 LYS A N   
969  C  CA  . LYS A 119 ? 0.2941 0.2735 0.2637 -0.0563 -0.0241 -0.0064 258 LYS A CA  
970  C  C   . LYS A 119 ? 0.3960 0.3676 0.3647 -0.0537 -0.0231 -0.0080 258 LYS A C   
971  O  O   . LYS A 119 ? 0.3874 0.3503 0.3487 -0.0550 -0.0235 -0.0079 258 LYS A O   
972  C  CB  . LYS A 119 ? 0.3422 0.3141 0.3052 -0.0571 -0.0244 -0.0071 258 LYS A CB  
973  C  CG  . LYS A 119 ? 0.4594 0.4379 0.4221 -0.0601 -0.0254 -0.0053 258 LYS A CG  
974  C  CD  . LYS A 119 ? 0.6401 0.6109 0.5970 -0.0601 -0.0254 -0.0065 258 LYS A CD  
975  C  CE  . LYS A 119 ? 0.6808 0.6594 0.6391 -0.0623 -0.0261 -0.0050 258 LYS A CE  
976  N  NZ  . LYS A 119 ? 0.6797 0.6720 0.6478 -0.0608 -0.0257 -0.0042 258 LYS A NZ  
977  N  N   . TYR A 120 ? 0.2970 0.2716 0.2726 -0.0501 -0.0218 -0.0092 259 TYR A N   
978  C  CA  . TYR A 120 ? 0.3134 0.2812 0.2884 -0.0474 -0.0207 -0.0106 259 TYR A CA  
979  C  C   . TYR A 120 ? 0.3591 0.3344 0.3419 -0.0461 -0.0202 -0.0103 259 TYR A C   
980  O  O   . TYR A 120 ? 0.3546 0.3389 0.3443 -0.0452 -0.0200 -0.0099 259 TYR A O   
981  C  CB  . TYR A 120 ? 0.2827 0.2443 0.2568 -0.0441 -0.0194 -0.0125 259 TYR A CB  
982  C  CG  . TYR A 120 ? 0.3314 0.2840 0.2969 -0.0447 -0.0197 -0.0130 259 TYR A CG  
983  C  CD1 . TYR A 120 ? 0.3751 0.3166 0.3316 -0.0445 -0.0195 -0.0133 259 TYR A CD1 
984  C  CD2 . TYR A 120 ? 0.2672 0.2224 0.2332 -0.0452 -0.0201 -0.0131 259 TYR A CD2 
985  C  CE1 . TYR A 120 ? 0.3822 0.3150 0.3301 -0.0447 -0.0197 -0.0136 259 TYR A CE1 
986  C  CE2 . TYR A 120 ? 0.3642 0.3112 0.3222 -0.0456 -0.0203 -0.0135 259 TYR A CE2 
987  C  CZ  . TYR A 120 ? 0.4206 0.3563 0.3694 -0.0453 -0.0201 -0.0138 259 TYR A CZ  
988  O  OH  . TYR A 120 ? 0.4777 0.4047 0.4178 -0.0455 -0.0203 -0.0141 259 TYR A OH  
989  N  N   . ALA A 121 ? 0.4640 0.4354 0.4453 -0.0457 -0.0199 -0.0104 260 ALA A N   
990  C  CA  . ALA A 121 ? 0.4393 0.4173 0.4273 -0.0446 -0.0194 -0.0100 260 ALA A CA  
991  C  C   . ALA A 121 ? 0.3612 0.3391 0.3543 -0.0410 -0.0179 -0.0114 260 ALA A C   
992  O  O   . ALA A 121 ? 0.3860 0.3714 0.3860 -0.0398 -0.0175 -0.0111 260 ALA A O   
993  C  CB  . ALA A 121 ? 0.4498 0.4237 0.4342 -0.0458 -0.0197 -0.0095 260 ALA A CB  
994  N  N   . ARG A 122 ? 0.3428 0.3121 0.3318 -0.0392 -0.0170 -0.0127 261 ARG A N   
995  C  CA  . ARG A 122 ? 0.3413 0.3100 0.3341 -0.0356 -0.0154 -0.0135 261 ARG A CA  
996  C  C   . ARG A 122 ? 0.3075 0.2728 0.2985 -0.0325 -0.0143 -0.0142 261 ARG A C   
997  O  O   . ARG A 122 ? 0.2864 0.2451 0.2705 -0.0338 -0.0149 -0.0146 261 ARG A O   
998  C  CB  . ARG A 122 ? 0.4595 0.4226 0.4502 -0.0342 -0.0145 -0.0138 261 ARG A CB  
999  C  CG  . ARG A 122 ? 0.5956 0.5628 0.5887 -0.0362 -0.0152 -0.0130 261 ARG A CG  
1000 C  CD  . ARG A 122 ? 0.7001 0.6594 0.6875 -0.0361 -0.0149 -0.0131 261 ARG A CD  
1001 N  NE  . ARG A 122 ? 0.7301 0.6857 0.7183 -0.0329 -0.0133 -0.0136 261 ARG A NE  
1002 C  CZ  . ARG A 122 ? 0.7194 0.6663 0.7013 -0.0301 -0.0120 -0.0140 261 ARG A CZ  
1003 N  NH1 . ARG A 122 ? 0.7061 0.6440 0.6788 -0.0316 -0.0128 -0.0145 261 ARG A NH1 
1004 N  NH2 . ARG A 122 ? 0.7206 0.6678 0.7049 -0.0258 -0.0099 -0.0137 261 ARG A NH2 
1005 N  N   . VAL A 123 ? 0.2667 0.2364 0.2637 -0.0286 -0.0127 -0.0142 262 VAL A N   
1006 C  CA  . VAL A 123 ? 0.2845 0.2523 0.2807 -0.0255 -0.0116 -0.0145 262 VAL A CA  
1007 C  C   . VAL A 123 ? 0.2721 0.2301 0.2608 -0.0237 -0.0107 -0.0149 262 VAL A C   
1008 O  O   . VAL A 123 ? 0.2758 0.2296 0.2600 -0.0230 -0.0107 -0.0153 262 VAL A O   
1009 C  CB  . VAL A 123 ? 0.2823 0.2558 0.2855 -0.0220 -0.0101 -0.0142 262 VAL A CB  
1010 C  CG1 . VAL A 123 ? 0.2972 0.2685 0.2991 -0.0187 -0.0088 -0.0142 262 VAL A CG1 
1011 C  CG2 . VAL A 123 ? 0.2954 0.2770 0.3043 -0.0229 -0.0107 -0.0138 262 VAL A CG2 
1012 N  N   . ASP A 124 ? 0.3041 0.2583 0.2908 -0.0226 -0.0100 -0.0148 263 ASP A N   
1013 C  CA  . ASP A 124 ? 0.3273 0.2724 0.3066 -0.0197 -0.0088 -0.0149 263 ASP A CA  
1014 C  C   . ASP A 124 ? 0.3854 0.3208 0.3545 -0.0224 -0.0102 -0.0156 263 ASP A C   
1015 O  O   . ASP A 124 ? 0.4267 0.3538 0.3883 -0.0198 -0.0093 -0.0159 263 ASP A O   
1016 C  CB  . ASP A 124 ? 0.4517 0.3953 0.4311 -0.0174 -0.0075 -0.0144 263 ASP A CB  
1017 C  CG  . ASP A 124 ? 0.6017 0.5449 0.5808 -0.0212 -0.0088 -0.0145 263 ASP A CG  
1018 O  OD1 . ASP A 124 ? 0.6639 0.6066 0.6410 -0.0257 -0.0108 -0.0148 263 ASP A OD1 
1019 O  OD2 . ASP A 124 ? 0.6616 0.6055 0.6426 -0.0197 -0.0078 -0.0140 263 ASP A OD2 
1020 N  N   . GLU A 125 ? 0.3486 0.2852 0.3170 -0.0277 -0.0123 -0.0157 264 GLU A N   
1021 C  CA  . GLU A 125 ? 0.3533 0.2814 0.3120 -0.0316 -0.0141 -0.0161 264 GLU A CA  
1022 C  C   . GLU A 125 ? 0.3586 0.2881 0.3169 -0.0318 -0.0145 -0.0164 264 GLU A C   
1023 O  O   . GLU A 125 ? 0.3932 0.3147 0.3429 -0.0325 -0.0150 -0.0166 264 GLU A O   
1024 C  CB  . GLU A 125 ? 0.4051 0.3384 0.3652 -0.0361 -0.0158 -0.0150 264 GLU A CB  
1025 C  CG  . GLU A 125 ? 0.5613 0.4931 0.5210 -0.0361 -0.0155 -0.0146 264 GLU A CG  
1026 C  CD  . GLU A 125 ? 0.7272 0.6660 0.6897 -0.0402 -0.0171 -0.0133 264 GLU A CD  
1027 O  OE1 . GLU A 125 ? 0.7191 0.6668 0.6869 -0.0421 -0.0180 -0.0126 264 GLU A OE1 
1028 O  OE2 . GLU A 125 ? 0.7979 0.7334 0.7570 -0.0412 -0.0174 -0.0127 264 GLU A OE2 
1029 N  N   . ALA A 126 ? 0.2883 0.2285 0.2560 -0.0308 -0.0141 -0.0160 265 ALA A N   
1030 C  CA  . ALA A 126 ? 0.2852 0.2285 0.2539 -0.0312 -0.0145 -0.0161 265 ALA A CA  
1031 C  C   . ALA A 126 ? 0.2855 0.2263 0.2537 -0.0261 -0.0127 -0.0165 265 ALA A C   
1032 O  O   . ALA A 126 ? 0.2578 0.1975 0.2237 -0.0263 -0.0130 -0.0168 265 ALA A O   
1033 C  CB  . ALA A 126 ? 0.2874 0.2430 0.2657 -0.0323 -0.0150 -0.0155 265 ALA A CB  
1034 N  N   . LEU A 127 ? 0.2694 0.2101 0.2399 -0.0217 -0.0107 -0.0163 266 LEU A N   
1035 C  CA  . LEU A 127 ? 0.2605 0.2009 0.2314 -0.0167 -0.0089 -0.0161 266 LEU A CA  
1036 C  C   . LEU A 127 ? 0.3015 0.2322 0.2627 -0.0156 -0.0088 -0.0167 266 LEU A C   
1037 O  O   . LEU A 127 ? 0.3558 0.2764 0.3078 -0.0158 -0.0090 -0.0170 266 LEU A O   
1038 C  CB  . LEU A 127 ? 0.2880 0.2291 0.2611 -0.0125 -0.0070 -0.0154 266 LEU A CB  
1039 C  CG  . LEU A 127 ? 0.3352 0.2865 0.3185 -0.0119 -0.0065 -0.0146 266 LEU A CG  
1040 C  CD1 . LEU A 127 ? 0.4121 0.3634 0.3963 -0.0086 -0.0049 -0.0137 266 LEU A CD1 
1041 C  CD2 . LEU A 127 ? 0.2505 0.2080 0.2390 -0.0104 -0.0062 -0.0143 266 LEU A CD2 
1042 N  N   . GLY A 128 ? 0.2870 0.2200 0.2495 -0.0143 -0.0086 -0.0168 267 GLY A N   
1043 C  CA  . GLY A 128 ? 0.3007 0.2251 0.2543 -0.0126 -0.0084 -0.0172 267 GLY A CA  
1044 C  C   . GLY A 128 ? 0.3017 0.2198 0.2478 -0.0177 -0.0105 -0.0180 267 GLY A C   
1045 O  O   . GLY A 128 ? 0.3376 0.2484 0.2760 -0.0170 -0.0106 -0.0185 267 GLY A O   
1046 N  N   . ARG A 129 ? 0.2888 0.2101 0.2370 -0.0230 -0.0123 -0.0180 268 ARG A N   
1047 C  CA  . ARG A 129 ? 0.2796 0.1964 0.2210 -0.0289 -0.0147 -0.0183 268 ARG A CA  
1048 C  C   . ARG A 129 ? 0.2766 0.2022 0.2239 -0.0307 -0.0155 -0.0180 268 ARG A C   
1049 O  O   . ARG A 129 ? 0.2627 0.1995 0.2202 -0.0301 -0.0151 -0.0175 268 ARG A O   
1050 C  CB  A ARG A 129 ? 0.3866 0.3046 0.3279 -0.0338 -0.0163 -0.0177 268 ARG A CB  
1051 C  CB  B ARG A 129 ? 0.3806 0.2985 0.3218 -0.0338 -0.0163 -0.0177 268 ARG A CB  
1052 C  CG  A ARG A 129 ? 0.4785 0.3903 0.4162 -0.0317 -0.0154 -0.0177 268 ARG A CG  
1053 C  CG  B ARG A 129 ? 0.4784 0.3894 0.4152 -0.0318 -0.0154 -0.0176 268 ARG A CG  
1054 C  CD  A ARG A 129 ? 0.5598 0.4589 0.4854 -0.0297 -0.0148 -0.0177 268 ARG A CD  
1055 C  CD  B ARG A 129 ? 0.5619 0.4604 0.4877 -0.0282 -0.0143 -0.0180 268 ARG A CD  
1056 N  NE  A ARG A 129 ? 0.6284 0.5223 0.5493 -0.0299 -0.0146 -0.0171 268 ARG A NE  
1057 N  NE  B ARG A 129 ? 0.6069 0.5005 0.5249 -0.0312 -0.0155 -0.0175 268 ARG A NE  
1058 C  CZ  A ARG A 129 ? 0.6830 0.5655 0.5928 -0.0282 -0.0141 -0.0168 268 ARG A CZ  
1059 C  CZ  B ARG A 129 ? 0.6024 0.4874 0.5121 -0.0285 -0.0148 -0.0179 268 ARG A CZ  
1060 N  NH1 A ARG A 129 ? 0.7198 0.5951 0.6221 -0.0260 -0.0136 -0.0171 268 ARG A NH1 
1061 N  NH1 B ARG A 129 ? 0.5837 0.4648 0.4923 -0.0223 -0.0127 -0.0186 268 ARG A NH1 
1062 N  NH2 A ARG A 129 ? 0.7027 0.5811 0.6087 -0.0285 -0.0141 -0.0162 268 ARG A NH2 
1063 N  NH2 B ARG A 129 ? 0.6280 0.5086 0.5305 -0.0318 -0.0162 -0.0173 268 ARG A NH2 
1064 N  N   . PRO A 130 ? 0.2799 0.2002 0.2201 -0.0328 -0.0165 -0.0184 269 PRO A N   
1065 C  CA  . PRO A 130 ? 0.2585 0.1876 0.2042 -0.0344 -0.0171 -0.0180 269 PRO A CA  
1066 C  C   . PRO A 130 ? 0.2423 0.1820 0.1948 -0.0389 -0.0186 -0.0169 269 PRO A C   
1067 O  O   . PRO A 130 ? 0.2831 0.2218 0.2319 -0.0434 -0.0202 -0.0161 269 PRO A O   
1068 C  CB  . PRO A 130 ? 0.3283 0.2480 0.2632 -0.0372 -0.0184 -0.0185 269 PRO A CB  
1069 C  CG  . PRO A 130 ? 0.4070 0.3138 0.3325 -0.0334 -0.0172 -0.0192 269 PRO A CG  
1070 C  CD  . PRO A 130 ? 0.3866 0.2934 0.3141 -0.0327 -0.0166 -0.0189 269 PRO A CD  
1071 N  N   . GLY A 131 ? 0.2017 0.1527 0.1646 -0.0367 -0.0177 -0.0164 270 GLY A N   
1072 C  CA  . GLY A 131 ? 0.2101 0.1722 0.1797 -0.0396 -0.0187 -0.0152 270 GLY A CA  
1073 C  C   . GLY A 131 ? 0.2504 0.2156 0.2242 -0.0395 -0.0185 -0.0148 270 GLY A C   
1074 O  O   . GLY A 131 ? 0.2450 0.2195 0.2242 -0.0413 -0.0192 -0.0136 270 GLY A O   
1075 N  N   . GLY A 132 ? 0.1889 0.1469 0.1602 -0.0369 -0.0175 -0.0156 271 GLY A N   
1076 C  CA  . GLY A 132 ? 0.1652 0.1254 0.1400 -0.0368 -0.0173 -0.0153 271 GLY A CA  
1077 C  C   . GLY A 132 ? 0.1754 0.1457 0.1603 -0.0338 -0.0161 -0.0148 271 GLY A C   
1078 O  O   . GLY A 132 ? 0.1740 0.1499 0.1630 -0.0351 -0.0165 -0.0141 271 GLY A O   
1079 N  N   . LEU A 133 ? 0.1694 0.1416 0.1578 -0.0299 -0.0147 -0.0151 272 LEU A N   
1080 C  CA  . LEU A 133 ? 0.1467 0.1270 0.1434 -0.0271 -0.0137 -0.0147 272 LEU A CA  
1081 C  C   . LEU A 133 ? 0.1304 0.1158 0.1296 -0.0265 -0.0137 -0.0144 272 LEU A C   
1082 O  O   . LEU A 133 ? 0.1495 0.1313 0.1449 -0.0267 -0.0139 -0.0148 272 LEU A O   
1083 C  CB  . LEU A 133 ? 0.1470 0.1247 0.1455 -0.0229 -0.0119 -0.0150 272 LEU A CB  
1084 C  CG  . LEU A 133 ? 0.1492 0.1220 0.1454 -0.0226 -0.0116 -0.0152 272 LEU A CG  
1085 C  CD1 . LEU A 133 ? 0.1746 0.1460 0.1724 -0.0182 -0.0098 -0.0151 272 LEU A CD1 
1086 C  CD2 . LEU A 133 ? 0.2161 0.1942 0.2166 -0.0243 -0.0121 -0.0147 272 LEU A CD2 
1087 N  N   . ALA A 134 ? 0.1163 0.1097 0.1215 -0.0256 -0.0135 -0.0137 273 ALA A N   
1088 C  CA  . ALA A 134 ? 0.1140 0.1127 0.1218 -0.0245 -0.0133 -0.0134 273 ALA A CA  
1089 C  C   . ALA A 134 ? 0.1185 0.1212 0.1317 -0.0210 -0.0121 -0.0132 273 ALA A C   
1090 O  O   . ALA A 134 ? 0.1420 0.1466 0.1576 -0.0206 -0.0119 -0.0128 273 ALA A O   
1091 C  CB  . ALA A 134 ? 0.1492 0.1541 0.1568 -0.0278 -0.0146 -0.0122 273 ALA A CB  
1092 N  N   . VAL A 135 ? 0.0993 0.1025 0.1138 -0.0187 -0.0114 -0.0133 274 VAL A N   
1093 C  CA  . VAL A 135 ? 0.0954 0.1014 0.1138 -0.0157 -0.0105 -0.0130 274 VAL A CA  
1094 C  C   . VAL A 135 ? 0.0992 0.1104 0.1191 -0.0148 -0.0104 -0.0124 274 VAL A C   
1095 O  O   . VAL A 135 ? 0.1188 0.1301 0.1375 -0.0152 -0.0106 -0.0125 274 VAL A O   
1096 C  CB  . VAL A 135 ? 0.1021 0.1040 0.1207 -0.0134 -0.0095 -0.0134 274 VAL A CB  
1097 C  CG1 . VAL A 135 ? 0.1164 0.1202 0.1380 -0.0113 -0.0089 -0.0130 274 VAL A CG1 
1098 C  CG2 . VAL A 135 ? 0.1188 0.1159 0.1355 -0.0138 -0.0094 -0.0138 274 VAL A CG2 
1099 N  N   . LEU A 136 ? 0.1116 0.1269 0.1339 -0.0133 -0.0101 -0.0118 275 LEU A N   
1100 C  CA  . LEU A 136 ? 0.0949 0.1143 0.1181 -0.0113 -0.0097 -0.0111 275 LEU A CA  
1101 C  C   . LEU A 136 ? 0.1144 0.1306 0.1382 -0.0086 -0.0089 -0.0114 275 LEU A C   
1102 O  O   . LEU A 136 ? 0.1211 0.1350 0.1454 -0.0079 -0.0086 -0.0115 275 LEU A O   
1103 C  CB  . LEU A 136 ? 0.1322 0.1576 0.1564 -0.0107 -0.0097 -0.0099 275 LEU A CB  
1104 C  CG  . LEU A 136 ? 0.1791 0.2103 0.2029 -0.0134 -0.0106 -0.0088 275 LEU A CG  
1105 C  CD1 . LEU A 136 ? 0.1717 0.2098 0.1966 -0.0112 -0.0102 -0.0072 275 LEU A CD1 
1106 C  CD2 . LEU A 136 ? 0.1711 0.2039 0.1935 -0.0155 -0.0112 -0.0086 275 LEU A CD2 
1107 N  N   . ALA A 137 ? 0.0800 0.0962 0.1036 -0.0075 -0.0086 -0.0115 276 ALA A N   
1108 C  CA  . ALA A 137 ? 0.0677 0.0807 0.0914 -0.0055 -0.0081 -0.0116 276 ALA A CA  
1109 C  C   . ALA A 137 ? 0.1271 0.1423 0.1505 -0.0033 -0.0077 -0.0110 276 ALA A C   
1110 O  O   . ALA A 137 ? 0.1286 0.1475 0.1520 -0.0033 -0.0077 -0.0107 276 ALA A O   
1111 C  CB  . ALA A 137 ? 0.1086 0.1186 0.1320 -0.0060 -0.0081 -0.0121 276 ALA A CB  
1112 N  N   . ALA A 138 ? 0.0912 0.1037 0.1136 -0.0015 -0.0073 -0.0108 277 ALA A N   
1113 C  CA  . ALA A 138 ? 0.0948 0.1076 0.1156 0.0010  -0.0068 -0.0103 277 ALA A CA  
1114 C  C   . ALA A 138 ? 0.1028 0.1102 0.1220 0.0015  -0.0069 -0.0103 277 ALA A C   
1115 O  O   . ALA A 138 ? 0.1160 0.1200 0.1348 0.0005  -0.0072 -0.0104 277 ALA A O   
1116 C  CB  . ALA A 138 ? 0.1363 0.1512 0.1556 0.0032  -0.0063 -0.0095 277 ALA A CB  
1117 N  N   . PHE A 139 ? 0.1042 0.1112 0.1223 0.0027  -0.0068 -0.0101 278 PHE A N   
1118 C  CA  . PHE A 139 ? 0.1154 0.1174 0.1312 0.0029  -0.0070 -0.0098 278 PHE A CA  
1119 C  C   . PHE A 139 ? 0.1204 0.1182 0.1318 0.0048  -0.0068 -0.0094 278 PHE A C   
1120 O  O   . PHE A 139 ? 0.1344 0.1340 0.1443 0.0073  -0.0061 -0.0091 278 PHE A O   
1121 C  CB  . PHE A 139 ? 0.1283 0.1312 0.1443 0.0034  -0.0070 -0.0096 278 PHE A CB  
1122 C  CG  . PHE A 139 ? 0.1209 0.1267 0.1401 0.0019  -0.0073 -0.0100 278 PHE A CG  
1123 C  CD1 . PHE A 139 ? 0.1166 0.1265 0.1372 0.0023  -0.0070 -0.0102 278 PHE A CD1 
1124 C  CD2 . PHE A 139 ? 0.1339 0.1383 0.1542 0.0002  -0.0077 -0.0100 278 PHE A CD2 
1125 C  CE1 . PHE A 139 ? 0.1069 0.1182 0.1292 0.0009  -0.0072 -0.0107 278 PHE A CE1 
1126 C  CE2 . PHE A 139 ? 0.1333 0.1395 0.1554 -0.0006 -0.0077 -0.0103 278 PHE A CE2 
1127 C  CZ  . PHE A 139 ? 0.1149 0.1239 0.1376 -0.0002 -0.0075 -0.0107 278 PHE A CZ  
1128 N  N   . LEU A 140 ? 0.1233 0.1156 0.1322 0.0036  -0.0074 -0.0091 279 LEU A N   
1129 C  CA  . LEU A 140 ? 0.1408 0.1270 0.1438 0.0052  -0.0073 -0.0087 279 LEU A CA  
1130 C  C   . LEU A 140 ? 0.1306 0.1125 0.1302 0.0049  -0.0079 -0.0082 279 LEU A C   
1131 O  O   . LEU A 140 ? 0.1600 0.1415 0.1609 0.0023  -0.0087 -0.0078 279 LEU A O   
1132 C  CB  . LEU A 140 ? 0.1423 0.1244 0.1436 0.0034  -0.0078 -0.0086 279 LEU A CB  
1133 C  CG  . LEU A 140 ? 0.2984 0.2839 0.3036 0.0021  -0.0078 -0.0090 279 LEU A CG  
1134 C  CD1 . LEU A 140 ? 0.2225 0.2030 0.2241 0.0017  -0.0080 -0.0089 279 LEU A CD1 
1135 C  CD2 . LEU A 140 ? 0.2377 0.2296 0.2464 0.0035  -0.0071 -0.0095 279 LEU A CD2 
1136 N  N   . GLU A 141 ? 0.1762 0.1549 0.1710 0.0079  -0.0073 -0.0080 280 GLU A N   
1137 C  CA  . GLU A 141 ? 0.2482 0.2219 0.2386 0.0079  -0.0078 -0.0074 280 GLU A CA  
1138 C  C   . GLU A 141 ? 0.2090 0.1730 0.1905 0.0091  -0.0080 -0.0070 280 GLU A C   
1139 O  O   . GLU A 141 ? 0.2146 0.1768 0.1935 0.0111  -0.0073 -0.0072 280 GLU A O   
1140 C  CB  . GLU A 141 ? 0.2967 0.2743 0.2881 0.0107  -0.0069 -0.0074 280 GLU A CB  
1141 C  CG  . GLU A 141 ? 0.3819 0.3674 0.3804 0.0094  -0.0069 -0.0077 280 GLU A CG  
1142 C  CD  . GLU A 141 ? 0.3169 0.3054 0.3156 0.0119  -0.0062 -0.0075 280 GLU A CD  
1143 O  OE1 . GLU A 141 ? 0.3181 0.3094 0.3159 0.0151  -0.0050 -0.0074 280 GLU A OE1 
1144 O  OE2 . GLU A 141 ? 0.3892 0.3779 0.3889 0.0107  -0.0067 -0.0074 280 GLU A OE2 
1145 N  N   . GLU A 142 ? 0.2270 0.1847 0.2033 0.0079  -0.0089 -0.0064 281 GLU A N   
1146 C  CA  . GLU A 142 ? 0.2300 0.1767 0.1960 0.0090  -0.0092 -0.0060 281 GLU A CA  
1147 C  C   . GLU A 142 ? 0.3115 0.2566 0.2730 0.0146  -0.0076 -0.0061 281 GLU A C   
1148 O  O   . GLU A 142 ? 0.2929 0.2426 0.2573 0.0161  -0.0071 -0.0060 281 GLU A O   
1149 C  CB  A GLU A 142 ? 0.2599 0.1997 0.2208 0.0052  -0.0110 -0.0051 281 GLU A CB  
1150 C  CB  B GLU A 142 ? 0.2658 0.2058 0.2269 0.0052  -0.0110 -0.0051 281 GLU A CB  
1151 C  CG  A GLU A 142 ? 0.3390 0.2656 0.2877 0.0057  -0.0115 -0.0047 281 GLU A CG  
1152 C  CG  B GLU A 142 ? 0.3414 0.2681 0.2902 0.0055  -0.0116 -0.0047 281 GLU A CG  
1153 C  CD  A GLU A 142 ? 0.4073 0.3265 0.3497 0.0017  -0.0135 -0.0036 281 GLU A CD  
1154 C  CD  B GLU A 142 ? 0.4070 0.3273 0.3506 0.0008  -0.0137 -0.0035 281 GLU A CD  
1155 O  OE1 A GLU A 142 ? 0.4409 0.3481 0.3718 0.0025  -0.0139 -0.0033 281 GLU A OE1 
1156 O  OE1 B GLU A 142 ? 0.4482 0.3654 0.3882 0.0016  -0.0139 -0.0031 281 GLU A OE1 
1157 O  OE2 A GLU A 142 ? 0.4321 0.3572 0.3803 -0.0021 -0.0146 -0.0028 281 GLU A OE2 
1158 O  OE2 B GLU A 142 ? 0.4098 0.3286 0.3530 -0.0040 -0.0153 -0.0027 281 GLU A OE2 
1159 N  N   . GLY A 143 ? 0.2666 0.2053 0.2209 0.0178  -0.0069 -0.0061 282 GLY A N   
1160 C  CA  . GLY A 143 ? 0.3658 0.3012 0.3136 0.0236  -0.0054 -0.0058 282 GLY A CA  
1161 C  C   . GLY A 143 ? 0.3492 0.2703 0.2840 0.0250  -0.0057 -0.0055 282 GLY A C   
1162 O  O   . GLY A 143 ? 0.3345 0.2491 0.2660 0.0211  -0.0071 -0.0056 282 GLY A O   
1163 N  N   . PRO A 144 ? 0.3543 0.2699 0.2808 0.0307  -0.0043 -0.0051 283 PRO A N   
1164 C  CA  . PRO A 144 ? 0.4160 0.3160 0.3278 0.0329  -0.0044 -0.0048 283 PRO A CA  
1165 C  C   . PRO A 144 ? 0.4377 0.3344 0.3454 0.0353  -0.0037 -0.0050 283 PRO A C   
1166 O  O   . PRO A 144 ? 0.4391 0.3221 0.3354 0.0349  -0.0045 -0.0050 283 PRO A O   
1167 C  CB  . PRO A 144 ? 0.4348 0.3324 0.3404 0.0393  -0.0027 -0.0042 283 PRO A CB  
1168 C  CG  . PRO A 144 ? 0.4338 0.3476 0.3509 0.0421  -0.0010 -0.0040 283 PRO A CG  
1169 C  CD  . PRO A 144 ? 0.3253 0.2488 0.2550 0.0355  -0.0025 -0.0046 283 PRO A CD  
1170 N  N   . GLU A 145 ? 0.3568 0.2654 0.2732 0.0376  -0.0024 -0.0050 284 GLU A N   
1171 C  CA  . GLU A 145 ? 0.3460 0.2528 0.2587 0.0407  -0.0015 -0.0050 284 GLU A CA  
1172 C  C   . GLU A 145 ? 0.4006 0.3119 0.3209 0.0354  -0.0027 -0.0057 284 GLU A C   
1173 O  O   . GLU A 145 ? 0.3416 0.2628 0.2730 0.0311  -0.0035 -0.0060 284 GLU A O   
1174 C  CB  . GLU A 145 ? 0.4519 0.3689 0.3676 0.0476  0.0009  -0.0041 284 GLU A CB  
1175 C  CG  . GLU A 145 ? 0.5858 0.5014 0.4960 0.0532  0.0025  -0.0031 284 GLU A CG  
1176 C  CD  . GLU A 145 ? 0.7636 0.6621 0.6572 0.0575  0.0029  -0.0029 284 GLU A CD  
1177 O  OE1 . GLU A 145 ? 0.8063 0.6951 0.6922 0.0575  0.0025  -0.0032 284 GLU A OE1 
1178 O  OE2 . GLU A 145 ? 0.8619 0.7560 0.7494 0.0609  0.0037  -0.0023 284 GLU A OE2 
1179 N  N   . GLU A 146 ? 0.3394 0.2432 0.2529 0.0362  -0.0028 -0.0058 285 GLU A N   
1180 C  CA  . GLU A 146 ? 0.3313 0.2398 0.2516 0.0322  -0.0037 -0.0063 285 GLU A CA  
1181 C  C   . GLU A 146 ? 0.3520 0.2753 0.2827 0.0347  -0.0023 -0.0061 285 GLU A C   
1182 O  O   . GLU A 146 ? 0.3272 0.2533 0.2553 0.0409  -0.0005 -0.0054 285 GLU A O   
1183 C  CB  . GLU A 146 ? 0.4006 0.2970 0.3104 0.0327  -0.0040 -0.0064 285 GLU A CB  
1184 C  CG  . GLU A 146 ? 0.5026 0.4041 0.4189 0.0293  -0.0046 -0.0069 285 GLU A CG  
1185 C  CD  . GLU A 146 ? 0.6263 0.5145 0.5323 0.0276  -0.0057 -0.0070 285 GLU A CD  
1186 O  OE1 . GLU A 146 ? 0.5848 0.4721 0.4880 0.0309  -0.0048 -0.0071 285 GLU A OE1 
1187 O  OE2 . GLU A 146 ? 0.6555 0.5345 0.5559 0.0226  -0.0075 -0.0070 285 GLU A OE2 
1188 N  N   . ASN A 147 ? 0.2558 0.1885 0.1977 0.0298  -0.0031 -0.0066 286 ASN A N   
1189 C  CA  . ASN A 147 ? 0.2383 0.1842 0.1895 0.0311  -0.0022 -0.0064 286 ASN A CA  
1190 C  C   . ASN A 147 ? 0.2422 0.1878 0.1928 0.0315  -0.0021 -0.0065 286 ASN A C   
1191 O  O   . ASN A 147 ? 0.2407 0.1841 0.1935 0.0268  -0.0034 -0.0072 286 ASN A O   
1192 C  CB  . ASN A 147 ? 0.2156 0.1707 0.1779 0.0260  -0.0032 -0.0069 286 ASN A CB  
1193 C  CG  . ASN A 147 ? 0.1891 0.1572 0.1601 0.0268  -0.0024 -0.0066 286 ASN A CG  
1194 O  OD1 . ASN A 147 ? 0.2276 0.1989 0.1999 0.0276  -0.0021 -0.0064 286 ASN A OD1 
1195 N  ND2 . ASN A 147 ? 0.2315 0.2072 0.2082 0.0261  -0.0023 -0.0065 286 ASN A ND2 
1196 N  N   . SER A 148 ? 0.2700 0.2182 0.2175 0.0373  -0.0005 -0.0056 287 SER A N   
1197 C  CA  . SER A 148 ? 0.2610 0.2077 0.2063 0.0385  -0.0003 -0.0056 287 SER A CA  
1198 C  C   . SER A 148 ? 0.2726 0.2294 0.2289 0.0342  -0.0010 -0.0059 287 SER A C   
1199 O  O   . SER A 148 ? 0.2835 0.2370 0.2392 0.0322  -0.0016 -0.0064 287 SER A O   
1200 C  CB  A SER A 148 ? 0.3274 0.2760 0.2671 0.0463  0.0017  -0.0042 287 SER A CB  
1201 C  CB  B SER A 148 ? 0.3283 0.2771 0.2682 0.0462  0.0017  -0.0042 287 SER A CB  
1202 O  OG  A SER A 148 ? 0.3685 0.3314 0.3160 0.0482  0.0026  -0.0030 287 SER A OG  
1203 O  OG  B SER A 148 ? 0.3495 0.2978 0.2878 0.0476  0.0019  -0.0040 287 SER A OG  
1204 N  N   . ALA A 149 ? 0.2625 0.2309 0.2279 0.0328  -0.0010 -0.0057 288 ALA A N   
1205 C  CA  . ALA A 149 ? 0.2156 0.1926 0.1904 0.0287  -0.0017 -0.0060 288 ALA A CA  
1206 C  C   . ALA A 149 ? 0.1907 0.1628 0.1679 0.0228  -0.0032 -0.0073 288 ALA A C   
1207 O  O   . ALA A 149 ? 0.2294 0.2017 0.2089 0.0203  -0.0038 -0.0077 288 ALA A O   
1208 C  CB  . ALA A 149 ? 0.2256 0.2146 0.2081 0.0281  -0.0015 -0.0055 288 ALA A CB  
1209 N  N   . TYR A 150 ? 0.2045 0.1725 0.1808 0.0207  -0.0038 -0.0077 289 TYR A N   
1210 C  CA  . TYR A 150 ? 0.1777 0.1424 0.1563 0.0152  -0.0052 -0.0084 289 TYR A CA  
1211 C  C   . TYR A 150 ? 0.2397 0.1943 0.2113 0.0142  -0.0059 -0.0085 289 TYR A C   
1212 O  O   . TYR A 150 ? 0.2249 0.1790 0.1991 0.0100  -0.0068 -0.0087 289 TYR A O   
1213 C  CB  . TYR A 150 ? 0.1826 0.1460 0.1617 0.0134  -0.0058 -0.0084 289 TYR A CB  
1214 C  CG  . TYR A 150 ? 0.1625 0.1357 0.1504 0.0117  -0.0058 -0.0086 289 TYR A CG  
1215 C  CD1 . TYR A 150 ? 0.1961 0.1759 0.1862 0.0146  -0.0049 -0.0083 289 TYR A CD1 
1216 C  CD2 . TYR A 150 ? 0.1885 0.1643 0.1821 0.0074  -0.0066 -0.0090 289 TYR A CD2 
1217 C  CE1 . TYR A 150 ? 0.1697 0.1574 0.1668 0.0127  -0.0050 -0.0084 289 TYR A CE1 
1218 C  CE2 . TYR A 150 ? 0.1818 0.1650 0.1820 0.0061  -0.0066 -0.0092 289 TYR A CE2 
1219 C  CZ  . TYR A 150 ? 0.1744 0.1632 0.1762 0.0085  -0.0059 -0.0090 289 TYR A CZ  
1220 O  OH  . TYR A 150 ? 0.1750 0.1701 0.1823 0.0068  -0.0060 -0.0093 289 TYR A OH  
1221 N  N   . GLU A 151 ? 0.2672 0.2136 0.2292 0.0180  -0.0053 -0.0082 290 GLU A N   
1222 C  CA  . GLU A 151 ? 0.2318 0.1672 0.1854 0.0170  -0.0060 -0.0082 290 GLU A CA  
1223 C  C   . GLU A 151 ? 0.2547 0.1931 0.2116 0.0160  -0.0061 -0.0085 290 GLU A C   
1224 O  O   . GLU A 151 ? 0.2682 0.2006 0.2222 0.0125  -0.0071 -0.0086 290 GLU A O   
1225 C  CB  . GLU A 151 ? 0.2500 0.1756 0.1917 0.0222  -0.0052 -0.0079 290 GLU A CB  
1226 C  CG  . GLU A 151 ? 0.2772 0.1890 0.2081 0.0207  -0.0062 -0.0080 290 GLU A CG  
1227 C  CD  . GLU A 151 ? 0.3168 0.2220 0.2453 0.0147  -0.0081 -0.0079 290 GLU A CD  
1228 O  OE1 . GLU A 151 ? 0.3328 0.2421 0.2657 0.0131  -0.0084 -0.0078 290 GLU A OE1 
1229 O  OE2 . GLU A 151 ? 0.3719 0.2680 0.2937 0.0114  -0.0093 -0.0078 290 GLU A OE2 
1230 N  N   . GLN A 152 ? 0.2176 0.1656 0.1805 0.0186  -0.0050 -0.0083 291 GLN A N   
1231 C  CA  . GLN A 152 ? 0.2781 0.2301 0.2450 0.0176  -0.0051 -0.0084 291 GLN A CA  
1232 C  C   . GLN A 152 ? 0.2297 0.1836 0.2028 0.0115  -0.0063 -0.0089 291 GLN A C   
1233 O  O   . GLN A 152 ? 0.2582 0.2102 0.2312 0.0095  -0.0067 -0.0090 291 GLN A O   
1234 C  CB  A GLN A 152 ? 0.3039 0.2675 0.2772 0.0203  -0.0040 -0.0080 291 GLN A CB  
1235 C  CB  B GLN A 152 ? 0.2977 0.2613 0.2708 0.0205  -0.0040 -0.0079 291 GLN A CB  
1236 C  CG  A GLN A 152 ? 0.3889 0.3552 0.3589 0.0262  -0.0027 -0.0070 291 GLN A CG  
1237 C  CG  B GLN A 152 ? 0.3269 0.2901 0.2937 0.0273  -0.0026 -0.0070 291 GLN A CG  
1238 C  CD  A GLN A 152 ? 0.4325 0.4060 0.4036 0.0300  -0.0017 -0.0060 291 GLN A CD  
1239 C  CD  B GLN A 152 ? 0.4499 0.4258 0.4228 0.0298  -0.0016 -0.0059 291 GLN A CD  
1240 O  OE1 A GLN A 152 ? 0.4414 0.4223 0.4195 0.0275  -0.0021 -0.0060 291 GLN A OE1 
1241 O  OE1 B GLN A 152 ? 0.4205 0.4023 0.3993 0.0275  -0.0020 -0.0060 291 GLN A OE1 
1242 N  NE2 A GLN A 152 ? 0.4974 0.4695 0.4616 0.0363  -0.0003 -0.0049 291 GLN A NE2 
1243 N  NE2 B GLN A 152 ? 0.4021 0.3824 0.3732 0.0345  -0.0006 -0.0047 291 GLN A NE2 
1244 N  N   . LEU A 153 ? 0.2056 0.1637 0.1842 0.0088  -0.0067 -0.0090 292 LEU A N   
1245 C  CA  . LEU A 153 ? 0.1782 0.1387 0.1624 0.0037  -0.0077 -0.0092 292 LEU A CA  
1246 C  C   . LEU A 153 ? 0.1896 0.1422 0.1689 0.0003  -0.0089 -0.0088 292 LEU A C   
1247 O  O   . LEU A 153 ? 0.2041 0.1555 0.1841 -0.0033 -0.0097 -0.0085 292 LEU A O   
1248 C  CB  . LEU A 153 ? 0.1797 0.1488 0.1719 0.0026  -0.0076 -0.0093 292 LEU A CB  
1249 C  CG  . LEU A 153 ? 0.2375 0.2150 0.2347 0.0047  -0.0068 -0.0094 292 LEU A CG  
1250 C  CD1 . LEU A 153 ? 0.2166 0.2008 0.2204 0.0029  -0.0069 -0.0097 292 LEU A CD1 
1251 C  CD2 . LEU A 153 ? 0.2371 0.2164 0.2361 0.0042  -0.0067 -0.0095 292 LEU A CD2 
1252 N  N   . LEU A 154 ? 0.1955 0.1434 0.1698 0.0013  -0.0090 -0.0086 293 LEU A N   
1253 C  CA  . LEU A 154 ? 0.1880 0.1292 0.1576 -0.0024 -0.0104 -0.0079 293 LEU A CA  
1254 C  C   . LEU A 154 ? 0.2424 0.1742 0.2038 -0.0040 -0.0112 -0.0075 293 LEU A C   
1255 O  O   . LEU A 154 ? 0.2368 0.1660 0.1969 -0.0088 -0.0125 -0.0067 293 LEU A O   
1256 C  CB  . LEU A 154 ? 0.2145 0.1517 0.1794 -0.0007 -0.0103 -0.0077 293 LEU A CB  
1257 C  CG  . LEU A 154 ? 0.2196 0.1655 0.1922 0.0001  -0.0098 -0.0079 293 LEU A CG  
1258 C  CD1 . LEU A 154 ? 0.2364 0.1781 0.2039 0.0020  -0.0097 -0.0077 293 LEU A CD1 
1259 C  CD2 . LEU A 154 ? 0.2436 0.1953 0.2231 -0.0043 -0.0106 -0.0075 293 LEU A CD2 
1260 N  N   . SER A 155 ? 0.2503 0.1775 0.2061 0.0000  -0.0104 -0.0080 294 SER A N   
1261 C  CA  . SER A 155 ? 0.2568 0.1738 0.2035 -0.0010 -0.0111 -0.0078 294 SER A CA  
1262 C  C   . SER A 155 ? 0.2190 0.1398 0.1706 -0.0047 -0.0116 -0.0077 294 SER A C   
1263 O  O   . SER A 155 ? 0.2594 0.1723 0.2041 -0.0069 -0.0125 -0.0073 294 SER A O   
1264 C  CB  . SER A 155 ? 0.2528 0.1645 0.1921 0.0051  -0.0098 -0.0083 294 SER A CB  
1265 O  OG  . SER A 155 ? 0.2828 0.2041 0.2295 0.0082  -0.0085 -0.0087 294 SER A OG  
1266 N  N   . ARG A 156 ? 0.2179 0.1500 0.1805 -0.0053 -0.0110 -0.0079 295 ARG A N   
1267 C  CA  . ARG A 156 ? 0.2398 0.1763 0.2077 -0.0082 -0.0113 -0.0077 295 ARG A CA  
1268 C  C   . ARG A 156 ? 0.2111 0.1524 0.1846 -0.0132 -0.0122 -0.0068 295 ARG A C   
1269 O  O   . ARG A 156 ? 0.2456 0.1911 0.2237 -0.0157 -0.0123 -0.0064 295 ARG A O   
1270 C  CB  A ARG A 156 ? 0.2557 0.2009 0.2311 -0.0052 -0.0100 -0.0085 295 ARG A CB  
1271 C  CB  B ARG A 156 ? 0.2446 0.1897 0.2198 -0.0051 -0.0100 -0.0085 295 ARG A CB  
1272 C  CG  A ARG A 156 ? 0.2758 0.2190 0.2468 0.0002  -0.0090 -0.0090 295 ARG A CG  
1273 C  CG  B ARG A 156 ? 0.2919 0.2349 0.2627 0.0003  -0.0090 -0.0090 295 ARG A CG  
1274 C  CD  A ARG A 156 ? 0.2895 0.2242 0.2525 0.0006  -0.0092 -0.0089 295 ARG A CD  
1275 C  CD  B ARG A 156 ? 0.2905 0.2239 0.2522 0.0008  -0.0093 -0.0089 295 ARG A CD  
1276 N  NE  A ARG A 156 ? 0.2887 0.2273 0.2531 0.0046  -0.0081 -0.0092 295 ARG A NE  
1277 N  NE  B ARG A 156 ? 0.2657 0.2020 0.2315 -0.0019 -0.0096 -0.0089 295 ARG A NE  
1278 C  CZ  A ARG A 156 ? 0.2973 0.2404 0.2667 0.0032  -0.0082 -0.0093 295 ARG A CZ  
1279 C  CZ  B ARG A 156 ? 0.2894 0.2309 0.2588 0.0005  -0.0088 -0.0092 295 ARG A CZ  
1280 N  NH1 A ARG A 156 ? 0.2931 0.2374 0.2663 -0.0020 -0.0091 -0.0091 295 ARG A NH1 
1281 N  NH1 B ARG A 156 ? 0.3083 0.2534 0.2779 0.0056  -0.0076 -0.0093 295 ARG A NH1 
1282 N  NH2 A ARG A 156 ? 0.3020 0.2491 0.2724 0.0069  -0.0072 -0.0093 295 ARG A NH2 
1283 N  NH2 B ARG A 156 ? 0.3150 0.2588 0.2880 -0.0023 -0.0091 -0.0091 295 ARG A NH2 
1284 N  N   . LEU A 157 ? 0.1815 0.1223 0.1543 -0.0145 -0.0128 -0.0062 296 LEU A N   
1285 C  CA  . LEU A 157 ? 0.1730 0.1194 0.1510 -0.0186 -0.0135 -0.0049 296 LEU A CA  
1286 C  C   . LEU A 157 ? 0.2200 0.1626 0.1939 -0.0237 -0.0149 -0.0033 296 LEU A C   
1287 O  O   . LEU A 157 ? 0.1894 0.1385 0.1688 -0.0266 -0.0151 -0.0022 296 LEU A O   
1288 C  CB  . LEU A 157 ? 0.1703 0.1177 0.1487 -0.0186 -0.0137 -0.0046 296 LEU A CB  
1289 C  CG  . LEU A 157 ? 0.1608 0.1137 0.1445 -0.0145 -0.0124 -0.0058 296 LEU A CG  
1290 C  CD1 . LEU A 157 ? 0.1868 0.1409 0.1709 -0.0150 -0.0128 -0.0053 296 LEU A CD1 
1291 C  CD2 . LEU A 157 ? 0.1492 0.1109 0.1416 -0.0140 -0.0115 -0.0063 296 LEU A CD2 
1292 N  N   . GLU A 158 ? 0.2023 0.1344 0.1660 -0.0248 -0.0159 -0.0031 297 GLU A N   
1293 C  CA  . GLU A 158 ? 0.2188 0.1468 0.1775 -0.0304 -0.0176 -0.0013 297 GLU A CA  
1294 C  C   . GLU A 158 ? 0.2283 0.1611 0.1916 -0.0318 -0.0173 -0.0010 297 GLU A C   
1295 O  O   . GLU A 158 ? 0.2349 0.1730 0.2007 -0.0356 -0.0179 0.0009  297 GLU A O   
1296 C  CB  . GLU A 158 ? 0.2713 0.1865 0.2172 -0.0305 -0.0185 -0.0013 297 GLU A CB  
1297 C  CG  . GLU A 158 ? 0.3951 0.3097 0.3365 -0.0349 -0.0196 0.0009  297 GLU A CG  
1298 C  CD  . GLU A 158 ? 0.5281 0.4506 0.4737 -0.0393 -0.0206 0.0033  297 GLU A CD  
1299 O  OE1 . GLU A 158 ? 0.5842 0.5127 0.5326 -0.0423 -0.0209 0.0050  297 GLU A OE1 
1300 O  OE2 . GLU A 158 ? 0.5925 0.5156 0.5384 -0.0396 -0.0210 0.0037  297 GLU A OE2 
1301 N  N   . GLU A 159 ? 0.1961 0.1298 0.1619 -0.0278 -0.0160 -0.0028 298 GLU A N   
1302 C  CA  . GLU A 159 ? 0.2293 0.1670 0.1990 -0.0290 -0.0157 -0.0026 298 GLU A CA  
1303 C  C   . GLU A 159 ? 0.2217 0.1712 0.2024 -0.0295 -0.0149 -0.0022 298 GLU A C   
1304 O  O   . GLU A 159 ? 0.2215 0.1752 0.2061 -0.0310 -0.0147 -0.0016 298 GLU A O   
1305 C  CB  . GLU A 159 ? 0.3131 0.2478 0.2811 -0.0247 -0.0146 -0.0044 298 GLU A CB  
1306 C  CG  . GLU A 159 ? 0.3375 0.2782 0.3117 -0.0196 -0.0131 -0.0058 298 GLU A CG  
1307 C  CD  . GLU A 159 ? 0.3926 0.3286 0.3620 -0.0149 -0.0123 -0.0071 298 GLU A CD  
1308 O  OE1 . GLU A 159 ? 0.3266 0.2540 0.2872 -0.0130 -0.0125 -0.0072 298 GLU A OE1 
1309 O  OE2 . GLU A 159 ? 0.3837 0.3247 0.3577 -0.0129 -0.0114 -0.0077 298 GLU A OE2 
1310 N  N   . ILE A 160 ? 0.1643 0.1188 0.1497 -0.0280 -0.0144 -0.0023 299 ILE A N   
1311 C  CA  . ILE A 160 ? 0.1517 0.1160 0.1458 -0.0284 -0.0137 -0.0016 299 ILE A CA  
1312 C  C   . ILE A 160 ? 0.1655 0.1329 0.1603 -0.0310 -0.0144 0.0003  299 ILE A C   
1313 O  O   . ILE A 160 ? 0.1508 0.1251 0.1516 -0.0298 -0.0136 0.0005  299 ILE A O   
1314 C  CB  . ILE A 160 ? 0.1516 0.1207 0.1518 -0.0241 -0.0122 -0.0035 299 ILE A CB  
1315 C  CG1 . ILE A 160 ? 0.1536 0.1203 0.1517 -0.0215 -0.0121 -0.0044 299 ILE A CG1 
1316 C  CG2 . ILE A 160 ? 0.1787 0.1474 0.1797 -0.0221 -0.0116 -0.0048 299 ILE A CG2 
1317 C  CD1 . ILE A 160 ? 0.1401 0.1124 0.1441 -0.0182 -0.0109 -0.0058 299 ILE A CD1 
1318 N  N   . ALA A 161 ? 0.1466 0.1088 0.1346 -0.0347 -0.0159 0.0019  300 ALA A N   
1319 C  CA  . ALA A 161 ? 0.1599 0.1253 0.1480 -0.0374 -0.0168 0.0041  300 ALA A CA  
1320 C  C   . ALA A 161 ? 0.1312 0.1070 0.1262 -0.0389 -0.0164 0.0062  300 ALA A C   
1321 O  O   . ALA A 161 ? 0.1370 0.1183 0.1354 -0.0383 -0.0161 0.0072  300 ALA A O   
1322 C  CB  . ALA A 161 ? 0.2031 0.1619 0.1822 -0.0408 -0.0184 0.0057  300 ALA A CB  
1323 N  N   . GLU A 162 ? 0.1839 0.1626 0.1805 -0.0398 -0.0160 0.0069  301 GLU A N   
1324 C  CA  . GLU A 162 ? 0.1855 0.1742 0.1879 -0.0404 -0.0153 0.0091  301 GLU A CA  
1325 C  C   . GLU A 162 ? 0.1362 0.1300 0.1459 -0.0368 -0.0137 0.0078  301 GLU A C   
1326 O  O   . GLU A 162 ? 0.1443 0.1353 0.1552 -0.0339 -0.0128 0.0051  301 GLU A O   
1327 C  CB  . GLU A 162 ? 0.1955 0.1857 0.1966 -0.0418 -0.0151 0.0103  301 GLU A CB  
1328 C  CG  . GLU A 162 ? 0.2386 0.2239 0.2316 -0.0449 -0.0167 0.0118  301 GLU A CG  
1329 C  CD  . GLU A 162 ? 0.4689 0.4583 0.4603 -0.0474 -0.0178 0.0147  301 GLU A CD  
1330 O  OE1 . GLU A 162 ? 0.4774 0.4757 0.4743 -0.0470 -0.0171 0.0165  301 GLU A OE1 
1331 O  OE2 . GLU A 162 ? 0.5201 0.5036 0.5042 -0.0497 -0.0194 0.0153  301 GLU A OE2 
1332 N  N   . GLU A 163 ? 0.1276 0.1291 0.1413 -0.0362 -0.0130 0.0096  302 GLU A N   
1333 C  CA  . GLU A 163 ? 0.1271 0.1327 0.1462 -0.0319 -0.0112 0.0083  302 GLU A CA  
1334 C  C   . GLU A 163 ? 0.1527 0.1586 0.1743 -0.0309 -0.0103 0.0071  302 GLU A C   
1335 O  O   . GLU A 163 ? 0.1385 0.1460 0.1597 -0.0334 -0.0106 0.0087  302 GLU A O   
1336 C  CB  . GLU A 163 ? 0.1250 0.1388 0.1470 -0.0313 -0.0105 0.0110  302 GLU A CB  
1337 C  CG  . GLU A 163 ? 0.1240 0.1403 0.1499 -0.0267 -0.0088 0.0096  302 GLU A CG  
1338 C  CD  . GLU A 163 ? 0.1298 0.1481 0.1584 -0.0252 -0.0075 0.0092  302 GLU A CD  
1339 O  OE1 . GLU A 163 ? 0.1375 0.1540 0.1677 -0.0221 -0.0065 0.0070  302 GLU A OE1 
1340 O  OE2 . GLU A 163 ? 0.1454 0.1670 0.1743 -0.0273 -0.0076 0.0113  302 GLU A OE2 
1341 N  N   . GLY A 164 ? 0.0986 0.1030 0.1225 -0.0275 -0.0093 0.0045  303 GLY A N   
1342 C  CA  . GLY A 164 ? 0.0910 0.0958 0.1173 -0.0264 -0.0084 0.0033  303 GLY A CA  
1343 C  C   . GLY A 164 ? 0.1313 0.1308 0.1554 -0.0271 -0.0091 0.0016  303 GLY A C   
1344 O  O   . GLY A 164 ? 0.1765 0.1764 0.2027 -0.0262 -0.0085 0.0006  303 GLY A O   
1345 N  N   . SER A 165 ? 0.1175 0.1118 0.1370 -0.0284 -0.0102 0.0014  304 SER A N   
1346 C  CA  . SER A 165 ? 0.1347 0.1232 0.1508 -0.0285 -0.0107 -0.0001 304 SER A CA  
1347 C  C   . SER A 165 ? 0.1833 0.1699 0.2002 -0.0250 -0.0101 -0.0026 304 SER A C   
1348 O  O   . SER A 165 ? 0.1460 0.1338 0.1642 -0.0231 -0.0098 -0.0032 304 SER A O   
1349 C  CB  A SER A 165 ? 0.1351 0.1173 0.1443 -0.0310 -0.0121 0.0007  304 SER A CB  
1350 C  CB  B SER A 165 ? 0.1399 0.1223 0.1492 -0.0312 -0.0121 0.0008  304 SER A CB  
1351 O  OG  A SER A 165 ? 0.1439 0.1280 0.1516 -0.0351 -0.0130 0.0034  304 SER A OG  
1352 O  OG  B SER A 165 ? 0.1360 0.1175 0.1437 -0.0309 -0.0125 0.0011  304 SER A OG  
1353 N  N   . GLU A 166 ? 0.1361 0.1203 0.1521 -0.0241 -0.0100 -0.0038 305 GLU A N   
1354 C  CA  . GLU A 166 ? 0.1461 0.1295 0.1626 -0.0208 -0.0095 -0.0057 305 GLU A CA  
1355 C  C   . GLU A 166 ? 0.1981 0.1762 0.2098 -0.0200 -0.0099 -0.0063 305 GLU A C   
1356 O  O   . GLU A 166 ? 0.1969 0.1720 0.2056 -0.0219 -0.0104 -0.0057 305 GLU A O   
1357 C  CB  A GLU A 166 ? 0.1703 0.1588 0.1922 -0.0197 -0.0087 -0.0064 305 GLU A CB  
1358 C  CB  B GLU A 166 ? 0.1716 0.1603 0.1937 -0.0196 -0.0087 -0.0064 305 GLU A CB  
1359 C  CG  A GLU A 166 ? 0.1941 0.1871 0.2200 -0.0205 -0.0082 -0.0055 305 GLU A CG  
1360 C  CG  B GLU A 166 ? 0.1732 0.1633 0.1971 -0.0206 -0.0085 -0.0062 305 GLU A CG  
1361 C  CD  A GLU A 166 ? 0.2976 0.2937 0.3273 -0.0200 -0.0076 -0.0060 305 GLU A CD  
1362 C  CD  B GLU A 166 ? 0.2979 0.2924 0.3266 -0.0195 -0.0078 -0.0069 305 GLU A CD  
1363 O  OE1 A GLU A 166 ? 0.3019 0.2976 0.3316 -0.0205 -0.0076 -0.0062 305 GLU A OE1 
1364 O  OE1 B GLU A 166 ? 0.2711 0.2660 0.3003 -0.0180 -0.0078 -0.0080 305 GLU A OE1 
1365 O  OE2 A GLU A 166 ? 0.2265 0.2251 0.2586 -0.0192 -0.0070 -0.0062 305 GLU A OE2 
1366 O  OE2 B GLU A 166 ? 0.3582 0.3556 0.3895 -0.0200 -0.0073 -0.0063 305 GLU A OE2 
1367 N  N   . THR A 167 ? 0.1458 0.1230 0.1563 -0.0168 -0.0095 -0.0075 306 THR A N   
1368 C  CA  . THR A 167 ? 0.1577 0.1303 0.1633 -0.0148 -0.0095 -0.0081 306 THR A CA  
1369 C  C   . THR A 167 ? 0.2118 0.1883 0.2198 -0.0112 -0.0088 -0.0090 306 THR A C   
1370 O  O   . THR A 167 ? 0.1868 0.1681 0.1991 -0.0108 -0.0085 -0.0093 306 THR A O   
1371 C  CB  . THR A 167 ? 0.1962 0.1606 0.1937 -0.0147 -0.0102 -0.0078 306 THR A CB  
1372 O  OG1 . THR A 167 ? 0.2256 0.1841 0.2168 -0.0128 -0.0102 -0.0082 306 THR A OG1 
1373 C  CG2 . THR A 167 ? 0.1988 0.1633 0.1956 -0.0124 -0.0099 -0.0082 306 THR A CG2 
1374 N  N   . GLN A 168 ? 0.1954 0.1702 0.2005 -0.0087 -0.0085 -0.0093 307 GLN A N   
1375 C  CA  . GLN A 168 ? 0.1917 0.1712 0.1986 -0.0052 -0.0079 -0.0097 307 GLN A CA  
1376 C  C   . GLN A 168 ? 0.2145 0.1898 0.2150 -0.0015 -0.0076 -0.0096 307 GLN A C   
1377 O  O   . GLN A 168 ? 0.2313 0.1987 0.2245 -0.0007 -0.0077 -0.0096 307 GLN A O   
1378 C  CB  . GLN A 168 ? 0.2259 0.2085 0.2347 -0.0045 -0.0077 -0.0097 307 GLN A CB  
1379 C  CG  . GLN A 168 ? 0.2336 0.2204 0.2486 -0.0078 -0.0079 -0.0097 307 GLN A CG  
1380 C  CD  . GLN A 168 ? 0.3374 0.3313 0.3583 -0.0082 -0.0078 -0.0098 307 GLN A CD  
1381 O  OE1 . GLN A 168 ? 0.4039 0.4020 0.4257 -0.0061 -0.0076 -0.0097 307 GLN A OE1 
1382 N  NE2 . GLN A 168 ? 0.2862 0.2812 0.3103 -0.0108 -0.0079 -0.0098 307 GLN A NE2 
1383 N  N   . VAL A 169 ? 0.1696 0.1495 0.1720 0.0007  -0.0071 -0.0096 308 VAL A N   
1384 C  CA  . VAL A 169 ? 0.1799 0.1564 0.1763 0.0047  -0.0066 -0.0094 308 VAL A CA  
1385 C  C   . VAL A 169 ? 0.1842 0.1679 0.1822 0.0086  -0.0058 -0.0088 308 VAL A C   
1386 O  O   . VAL A 169 ? 0.1858 0.1776 0.1903 0.0073  -0.0060 -0.0086 308 VAL A O   
1387 C  CB  . VAL A 169 ? 0.1883 0.1631 0.1841 0.0039  -0.0068 -0.0095 308 VAL A CB  
1388 C  CG1 . VAL A 169 ? 0.1922 0.1612 0.1865 -0.0001 -0.0077 -0.0096 308 VAL A CG1 
1389 C  CG2 . VAL A 169 ? 0.1994 0.1829 0.2025 0.0030  -0.0067 -0.0095 308 VAL A CG2 
1390 N  N   . PRO A 170 ? 0.2002 0.1809 0.1916 0.0134  -0.0051 -0.0083 309 PRO A N   
1391 C  CA  . PRO A 170 ? 0.1927 0.1817 0.1855 0.0174  -0.0042 -0.0072 309 PRO A CA  
1392 C  C   . PRO A 170 ? 0.1942 0.1916 0.1928 0.0164  -0.0043 -0.0068 309 PRO A C   
1393 O  O   . PRO A 170 ? 0.2044 0.1992 0.2031 0.0148  -0.0046 -0.0074 309 PRO A O   
1394 C  CB  . PRO A 170 ? 0.2394 0.2219 0.2227 0.0230  -0.0033 -0.0066 309 PRO A CB  
1395 C  CG  . PRO A 170 ? 0.2759 0.2459 0.2524 0.0215  -0.0038 -0.0075 309 PRO A CG  
1396 C  CD  . PRO A 170 ? 0.2394 0.2088 0.2211 0.0153  -0.0050 -0.0084 309 PRO A CD  
1397 N  N   . GLY A 171 ? 0.2081 0.2155 0.2111 0.0171  -0.0042 -0.0057 310 GLY A N   
1398 C  CA  . GLY A 171 ? 0.1750 0.1905 0.1820 0.0166  -0.0043 -0.0050 310 GLY A CA  
1399 C  C   . GLY A 171 ? 0.1880 0.2018 0.1900 0.0208  -0.0033 -0.0044 310 GLY A C   
1400 O  O   . GLY A 171 ? 0.2199 0.2286 0.2151 0.0255  -0.0024 -0.0039 310 GLY A O   
1401 N  N   . LEU A 172 ? 0.1532 0.1707 0.1580 0.0194  -0.0036 -0.0043 311 LEU A N   
1402 C  CA  . LEU A 172 ? 0.1471 0.1635 0.1478 0.0231  -0.0027 -0.0037 311 LEU A CA  
1403 C  C   . LEU A 172 ? 0.1810 0.2072 0.1866 0.0217  -0.0029 -0.0027 311 LEU A C   
1404 O  O   . LEU A 172 ? 0.2133 0.2450 0.2246 0.0174  -0.0039 -0.0028 311 LEU A O   
1405 C  CB  . LEU A 172 ? 0.2120 0.2174 0.2088 0.0221  -0.0029 -0.0051 311 LEU A CB  
1406 C  CG  . LEU A 172 ? 0.2394 0.2440 0.2410 0.0169  -0.0039 -0.0064 311 LEU A CG  
1407 C  CD1 . LEU A 172 ? 0.3726 0.3687 0.3697 0.0171  -0.0039 -0.0071 311 LEU A CD1 
1408 C  CD2 . LEU A 172 ? 0.2142 0.2171 0.2193 0.0126  -0.0048 -0.0073 311 LEU A CD2 
1409 N  N   . ASP A 173 ? 0.1676 0.1955 0.1703 0.0253  -0.0021 -0.0017 312 ASP A N   
1410 C  CA  . ASP A 173 ? 0.1850 0.2216 0.1917 0.0238  -0.0023 -0.0007 312 ASP A CA  
1411 C  C   . ASP A 173 ? 0.1353 0.1671 0.1444 0.0194  -0.0032 -0.0025 312 ASP A C   
1412 O  O   . ASP A 173 ? 0.1861 0.2115 0.1920 0.0208  -0.0028 -0.0033 312 ASP A O   
1413 C  CB  . ASP A 173 ? 0.2025 0.2426 0.2050 0.0296  -0.0009 0.0011  312 ASP A CB  
1414 C  CG  . ASP A 173 ? 0.2413 0.2911 0.2477 0.0281  -0.0011 0.0024  312 ASP A CG  
1415 O  OD1 . ASP A 173 ? 0.2098 0.2631 0.2215 0.0225  -0.0024 0.0018  312 ASP A OD1 
1416 O  OD2 . ASP A 173 ? 0.2685 0.3223 0.2720 0.0327  0.0001  0.0041  312 ASP A OD2 
1417 N  N   . ILE A 174 ? 0.1213 0.1561 0.1356 0.0144  -0.0044 -0.0032 313 ILE A N   
1418 C  CA  . ILE A 174 ? 0.1308 0.1613 0.1472 0.0104  -0.0051 -0.0048 313 ILE A CA  
1419 C  C   . ILE A 174 ? 0.1408 0.1740 0.1572 0.0110  -0.0049 -0.0043 313 ILE A C   
1420 O  O   . ILE A 174 ? 0.1452 0.1728 0.1610 0.0101  -0.0050 -0.0055 313 ILE A O   
1421 C  CB  . ILE A 174 ? 0.1294 0.1627 0.1504 0.0055  -0.0063 -0.0053 313 ILE A CB  
1422 C  CG1 . ILE A 174 ? 0.1655 0.1962 0.1867 0.0049  -0.0065 -0.0057 313 ILE A CG1 
1423 C  CG2 . ILE A 174 ? 0.1345 0.1631 0.1569 0.0021  -0.0069 -0.0067 313 ILE A CG2 
1424 C  CD1 . ILE A 174 ? 0.1649 0.1858 0.1835 0.0054  -0.0062 -0.0070 313 ILE A CD1 
1425 N  N   . SER A 175 ? 0.1748 0.2171 0.1917 0.0127  -0.0046 -0.0024 314 SER A N   
1426 C  CA  . SER A 175 ? 0.1947 0.2401 0.2115 0.0133  -0.0043 -0.0018 314 SER A CA  
1427 C  C   . SER A 175 ? 0.1591 0.1985 0.1713 0.0178  -0.0031 -0.0020 314 SER A C   
1428 O  O   . SER A 175 ? 0.1905 0.2295 0.2025 0.0180  -0.0030 -0.0022 314 SER A O   
1429 C  CB  A SER A 175 ? 0.2361 0.2937 0.2543 0.0140  -0.0042 0.0007  314 SER A CB  
1430 C  CB  B SER A 175 ? 0.2397 0.2974 0.2581 0.0137  -0.0043 0.0007  314 SER A CB  
1431 O  OG  A SER A 175 ? 0.2334 0.2961 0.2552 0.0089  -0.0056 0.0010  314 SER A OG  
1432 O  OG  B SER A 175 ? 0.2054 0.2671 0.2208 0.0192  -0.0030 0.0026  314 SER A OG  
1433 N  N   . ALA A 176 ? 0.1536 0.1875 0.1613 0.0215  -0.0023 -0.0020 315 ALA A N   
1434 C  CA  . ALA A 176 ? 0.1458 0.1720 0.1476 0.0255  -0.0014 -0.0023 315 ALA A CA  
1435 C  C   . ALA A 176 ? 0.1743 0.1907 0.1755 0.0225  -0.0022 -0.0043 315 ALA A C   
1436 O  O   . ALA A 176 ? 0.2271 0.2366 0.2234 0.0246  -0.0017 -0.0046 315 ALA A O   
1437 C  CB  . ALA A 176 ? 0.1813 0.2033 0.1771 0.0302  -0.0004 -0.0017 315 ALA A CB  
1438 N  N   . LEU A 177 ? 0.1520 0.1682 0.1579 0.0175  -0.0033 -0.0055 316 LEU A N   
1439 C  CA  . LEU A 177 ? 0.1475 0.1568 0.1537 0.0144  -0.0041 -0.0069 316 LEU A CA  
1440 C  C   . LEU A 177 ? 0.1735 0.1866 0.1831 0.0126  -0.0044 -0.0071 316 LEU A C   
1441 O  O   . LEU A 177 ? 0.1720 0.1807 0.1820 0.0105  -0.0049 -0.0080 316 LEU A O   
1442 C  CB  . LEU A 177 ? 0.1279 0.1353 0.1371 0.0106  -0.0049 -0.0079 316 LEU A CB  
1443 C  CG  . LEU A 177 ? 0.1518 0.1552 0.1582 0.0115  -0.0048 -0.0079 316 LEU A CG  
1444 C  CD1 . LEU A 177 ? 0.1744 0.1781 0.1848 0.0076  -0.0056 -0.0086 316 LEU A CD1 
1445 C  CD2 . LEU A 177 ? 0.1613 0.1549 0.1613 0.0130  -0.0047 -0.0082 316 LEU A CD2 
1446 N  N   . LEU A 178 ? 0.1444 0.1660 0.1561 0.0133  -0.0041 -0.0060 317 LEU A N   
1447 C  CA  . LEU A 178 ? 0.1599 0.1856 0.1744 0.0113  -0.0044 -0.0060 317 LEU A CA  
1448 C  C   . LEU A 178 ? 0.1657 0.1949 0.1781 0.0150  -0.0035 -0.0048 317 LEU A C   
1449 O  O   . LEU A 178 ? 0.1653 0.1956 0.1744 0.0191  -0.0025 -0.0036 317 LEU A O   
1450 C  CB  . LEU A 178 ? 0.1591 0.1919 0.1776 0.0079  -0.0052 -0.0056 317 LEU A CB  
1451 C  CG  . LEU A 178 ? 0.1798 0.2097 0.2003 0.0044  -0.0061 -0.0067 317 LEU A CG  
1452 C  CD1 . LEU A 178 ? 0.1873 0.2237 0.2103 0.0012  -0.0070 -0.0061 317 LEU A CD1 
1453 C  CD2 . LEU A 178 ? 0.1882 0.2116 0.2091 0.0024  -0.0065 -0.0082 317 LEU A CD2 
1454 N  N   . PRO A 179 ? 0.1565 0.1873 0.1704 0.0137  -0.0037 -0.0050 318 PRO A N   
1455 C  CA  . PRO A 179 ? 0.1729 0.2081 0.1854 0.0169  -0.0028 -0.0037 318 PRO A CA  
1456 C  C   . PRO A 179 ? 0.1647 0.2105 0.1782 0.0183  -0.0023 -0.0015 318 PRO A C   
1457 O  O   . PRO A 179 ? 0.1844 0.2350 0.2006 0.0153  -0.0031 -0.0012 318 PRO A O   
1458 C  CB  . PRO A 179 ? 0.1571 0.1929 0.1722 0.0141  -0.0034 -0.0044 318 PRO A CB  
1459 C  CG  . PRO A 179 ? 0.1589 0.1876 0.1752 0.0108  -0.0043 -0.0063 318 PRO A CG  
1460 C  CD  . PRO A 179 ? 0.1462 0.1746 0.1630 0.0096  -0.0047 -0.0064 318 PRO A CD  
1461 N  N   . SER A 180 ? 0.2311 0.2810 0.2420 0.0228  -0.0010 0.0002  319 SER A N   
1462 C  CA  . SER A 180 ? 0.2262 0.2877 0.2379 0.0245  -0.0005 0.0028  319 SER A CA  
1463 C  C   . SER A 180 ? 0.1821 0.2529 0.1978 0.0209  -0.0013 0.0039  319 SER A C   
1464 O  O   . SER A 180 ? 0.2394 0.3204 0.2569 0.0196  -0.0016 0.0060  319 SER A O   
1465 C  CB  . SER A 180 ? 0.2739 0.3366 0.2806 0.0316  0.0014  0.0047  319 SER A CB  
1466 O  OG  . SER A 180 ? 0.3770 0.4361 0.3818 0.0334  0.0020  0.0043  319 SER A OG  
1467 N  N   . ASP A 181 ? 0.1920 0.2592 0.2086 0.0190  -0.0016 0.0025  320 ASP A N   
1468 C  CA  . ASP A 181 ? 0.2165 0.2912 0.2360 0.0155  -0.0024 0.0033  320 ASP A CA  
1469 C  C   . ASP A 181 ? 0.1643 0.2378 0.1863 0.0091  -0.0042 0.0021  320 ASP A C   
1470 O  O   . ASP A 181 ? 0.2261 0.2913 0.2485 0.0068  -0.0049 -0.0003 320 ASP A O   
1471 C  CB  . ASP A 181 ? 0.2455 0.3165 0.2643 0.0165  -0.0020 0.0024  320 ASP A CB  
1472 C  CG  . ASP A 181 ? 0.3388 0.4173 0.3600 0.0131  -0.0027 0.0034  320 ASP A CG  
1473 O  OD1 . ASP A 181 ? 0.3356 0.4120 0.3567 0.0137  -0.0024 0.0027  320 ASP A OD1 
1474 O  OD2 . ASP A 181 ? 0.4133 0.4997 0.4362 0.0097  -0.0036 0.0048  320 ASP A OD2 
1475 N  N   . PHE A 182 ? 0.2029 0.2848 0.2262 0.0065  -0.0050 0.0039  321 PHE A N   
1476 C  CA  . PHE A 182 ? 0.1962 0.2770 0.2208 0.0003  -0.0068 0.0030  321 PHE A CA  
1477 C  C   . PHE A 182 ? 0.1537 0.2383 0.1787 -0.0040 -0.0079 0.0034  321 PHE A C   
1478 O  O   . PHE A 182 ? 0.1672 0.2505 0.1921 -0.0093 -0.0095 0.0029  321 PHE A O   
1479 C  CB  . PHE A 182 ? 0.1933 0.2807 0.2185 -0.0011 -0.0074 0.0048  321 PHE A CB  
1480 C  CG  . PHE A 182 ? 0.3167 0.3986 0.3414 0.0015  -0.0069 0.0038  321 PHE A CG  
1481 C  CD1 . PHE A 182 ? 0.4396 0.5269 0.4648 0.0007  -0.0073 0.0053  321 PHE A CD1 
1482 C  CD2 . PHE A 182 ? 0.3961 0.4677 0.4195 0.0044  -0.0060 0.0016  321 PHE A CD2 
1483 C  CE1 . PHE A 182 ? 0.4364 0.5186 0.4610 0.0030  -0.0068 0.0044  321 PHE A CE1 
1484 C  CE2 . PHE A 182 ? 0.4291 0.4956 0.4517 0.0064  -0.0056 0.0008  321 PHE A CE2 
1485 C  CZ  . PHE A 182 ? 0.4384 0.5100 0.4616 0.0058  -0.0059 0.0021  321 PHE A CZ  
1486 N  N   . SER A 183 ? 0.1375 0.2264 0.1626 -0.0019 -0.0071 0.0045  322 SER A N   
1487 C  CA  . SER A 183 ? 0.1670 0.2608 0.1922 -0.0061 -0.0082 0.0053  322 SER A CA  
1488 C  C   . SER A 183 ? 0.1597 0.2450 0.1846 -0.0072 -0.0084 0.0028  322 SER A C   
1489 O  O   . SER A 183 ? 0.1932 0.2791 0.2174 -0.0117 -0.0096 0.0027  322 SER A O   
1490 C  CB  A SER A 183 ? 0.1666 0.2727 0.1923 -0.0037 -0.0073 0.0085  322 SER A CB  
1491 C  CB  B SER A 183 ? 0.1705 0.2765 0.1961 -0.0036 -0.0072 0.0085  322 SER A CB  
1492 O  OG  A SER A 183 ? 0.1867 0.2903 0.2121 0.0012  -0.0057 0.0080  322 SER A OG  
1493 O  OG  B SER A 183 ? 0.1597 0.2742 0.1855 -0.0016 -0.0068 0.0112  322 SER A OG  
1494 N  N   . ARG A 184 ? 0.1363 0.2136 0.1611 -0.0033 -0.0073 0.0009  323 ARG A N   
1495 C  CA  . ARG A 184 ? 0.1441 0.2145 0.1687 -0.0037 -0.0073 -0.0011 323 ARG A CA  
1496 C  C   . ARG A 184 ? 0.1255 0.1853 0.1497 -0.0044 -0.0077 -0.0036 323 ARG A C   
1497 O  O   . ARG A 184 ? 0.1426 0.1977 0.1668 -0.0014 -0.0069 -0.0043 323 ARG A O   
1498 C  CB  A ARG A 184 ? 0.1834 0.2546 0.2081 0.0012  -0.0058 -0.0007 323 ARG A CB  
1499 C  CB  B ARG A 184 ? 0.1787 0.2497 0.2033 0.0012  -0.0058 -0.0007 323 ARG A CB  
1500 C  CG  A ARG A 184 ? 0.2005 0.2826 0.2256 0.0020  -0.0053 0.0019  323 ARG A CG  
1501 C  CG  B ARG A 184 ? 0.2034 0.2854 0.2284 0.0024  -0.0052 0.0020  323 ARG A CG  
1502 C  CD  A ARG A 184 ? 0.2254 0.3082 0.2496 0.0077  -0.0036 0.0027  323 ARG A CD  
1503 C  CD  B ARG A 184 ? 0.1962 0.2775 0.2205 0.0076  -0.0036 0.0022  323 ARG A CD  
1504 N  NE  A ARG A 184 ? 0.2096 0.2853 0.2337 0.0084  -0.0034 0.0008  323 ARG A NE  
1505 N  NE  B ARG A 184 ? 0.2104 0.3027 0.2349 0.0093  -0.0028 0.0050  323 ARG A NE  
1506 C  CZ  A ARG A 184 ? 0.2204 0.2990 0.2454 0.0071  -0.0036 0.0010  323 ARG A CZ  
1507 C  CZ  B ARG A 184 ? 0.2759 0.3761 0.2997 0.0126  -0.0018 0.0076  323 ARG A CZ  
1508 N  NH1 A ARG A 184 ? 0.2884 0.3767 0.3142 0.0049  -0.0040 0.0030  323 ARG A NH1 
1509 N  NH1 B ARG A 184 ? 0.3273 0.4384 0.3513 0.0142  -0.0010 0.0104  323 ARG A NH1 
1510 N  NH2 A ARG A 184 ? 0.2014 0.2736 0.2264 0.0079  -0.0035 -0.0007 323 ARG A NH2 
1511 N  NH2 B ARG A 184 ? 0.2679 0.3658 0.2906 0.0144  -0.0015 0.0076  323 ARG A NH2 
1512 N  N   . TYR A 185 ? 0.1006 0.1566 0.1241 -0.0085 -0.0089 -0.0048 324 TYR A N   
1513 C  CA  . TYR A 185 ? 0.1004 0.1473 0.1233 -0.0091 -0.0091 -0.0068 324 TYR A CA  
1514 C  C   . TYR A 185 ? 0.0989 0.1410 0.1201 -0.0119 -0.0099 -0.0080 324 TYR A C   
1515 O  O   . TYR A 185 ? 0.1061 0.1515 0.1261 -0.0143 -0.0106 -0.0074 324 TYR A O   
1516 C  CB  . TYR A 185 ? 0.1022 0.1487 0.1248 -0.0107 -0.0097 -0.0066 324 TYR A CB  
1517 C  CG  . TYR A 185 ? 0.1029 0.1544 0.1242 -0.0152 -0.0110 -0.0054 324 TYR A CG  
1518 C  CD1 . TYR A 185 ? 0.0998 0.1463 0.1183 -0.0193 -0.0122 -0.0064 324 TYR A CD1 
1519 C  CD2 . TYR A 185 ? 0.0941 0.1550 0.1163 -0.0152 -0.0110 -0.0031 324 TYR A CD2 
1520 C  CE1 . TYR A 185 ? 0.1139 0.1639 0.1301 -0.0240 -0.0137 -0.0052 324 TYR A CE1 
1521 C  CE2 . TYR A 185 ? 0.1257 0.1918 0.1465 -0.0200 -0.0125 -0.0016 324 TYR A CE2 
1522 C  CZ  . TYR A 185 ? 0.1256 0.1858 0.1433 -0.0247 -0.0140 -0.0028 324 TYR A CZ  
1523 O  OH  . TYR A 185 ? 0.1317 0.1961 0.1469 -0.0300 -0.0157 -0.0012 324 TYR A OH  
1524 N  N   . PHE A 186 ? 0.0969 0.1312 0.1175 -0.0114 -0.0098 -0.0096 325 PHE A N   
1525 C  CA  . PHE A 186 ? 0.1026 0.1312 0.1208 -0.0132 -0.0104 -0.0108 325 PHE A CA  
1526 C  C   . PHE A 186 ? 0.1106 0.1345 0.1263 -0.0157 -0.0111 -0.0114 325 PHE A C   
1527 O  O   . PHE A 186 ? 0.1148 0.1390 0.1319 -0.0151 -0.0109 -0.0112 325 PHE A O   
1528 C  CB  . PHE A 186 ? 0.1033 0.1272 0.1222 -0.0104 -0.0096 -0.0118 325 PHE A CB  
1529 C  CG  . PHE A 186 ? 0.1031 0.1307 0.1240 -0.0080 -0.0090 -0.0112 325 PHE A CG  
1530 C  CD1 . PHE A 186 ? 0.1416 0.1701 0.1644 -0.0050 -0.0082 -0.0108 325 PHE A CD1 
1531 C  CD2 . PHE A 186 ? 0.1282 0.1577 0.1484 -0.0088 -0.0092 -0.0111 325 PHE A CD2 
1532 C  CE1 . PHE A 186 ? 0.1511 0.1820 0.1747 -0.0028 -0.0076 -0.0103 325 PHE A CE1 
1533 C  CE2 . PHE A 186 ? 0.1566 0.1897 0.1786 -0.0065 -0.0085 -0.0106 325 PHE A CE2 
1534 C  CZ  . PHE A 186 ? 0.1538 0.1873 0.1774 -0.0034 -0.0077 -0.0102 325 PHE A CZ  
1535 N  N   . GLN A 187 ? 0.0877 0.1070 0.0994 -0.0184 -0.0120 -0.0121 326 GLN A N   
1536 C  CA  . GLN A 187 ? 0.0969 0.1110 0.1053 -0.0206 -0.0127 -0.0126 326 GLN A CA  
1537 C  C   . GLN A 187 ? 0.1093 0.1149 0.1128 -0.0210 -0.0128 -0.0138 326 GLN A C   
1538 O  O   . GLN A 187 ? 0.1236 0.1282 0.1244 -0.0220 -0.0132 -0.0140 326 GLN A O   
1539 C  CB  . GLN A 187 ? 0.1160 0.1344 0.1227 -0.0249 -0.0140 -0.0114 326 GLN A CB  
1540 C  CG  . GLN A 187 ? 0.1021 0.1164 0.1061 -0.0273 -0.0148 -0.0116 326 GLN A CG  
1541 C  CD  . GLN A 187 ? 0.1129 0.1339 0.1165 -0.0313 -0.0161 -0.0099 326 GLN A CD  
1542 O  OE1 . GLN A 187 ? 0.1314 0.1517 0.1304 -0.0358 -0.0176 -0.0094 326 GLN A OE1 
1543 N  NE2 . GLN A 187 ? 0.1056 0.1332 0.1135 -0.0299 -0.0157 -0.0089 326 GLN A NE2 
1544 N  N   . TYR A 188 ? 0.1053 0.1048 0.1073 -0.0199 -0.0124 -0.0145 327 TYR A N   
1545 C  CA  . TYR A 188 ? 0.1006 0.0916 0.0969 -0.0194 -0.0123 -0.0155 327 TYR A CA  
1546 C  C   . TYR A 188 ? 0.1088 0.0938 0.1022 -0.0195 -0.0123 -0.0159 327 TYR A C   
1547 O  O   . TYR A 188 ? 0.1168 0.1049 0.1137 -0.0196 -0.0122 -0.0155 327 TYR A O   
1548 C  CB  . TYR A 188 ? 0.1163 0.1068 0.1146 -0.0153 -0.0111 -0.0158 327 TYR A CB  
1549 C  CG  . TYR A 188 ? 0.0984 0.0894 0.1005 -0.0121 -0.0100 -0.0156 327 TYR A CG  
1550 C  CD1 . TYR A 188 ? 0.0800 0.0652 0.0792 -0.0100 -0.0093 -0.0158 327 TYR A CD1 
1551 C  CD2 . TYR A 188 ? 0.1074 0.1044 0.1153 -0.0111 -0.0097 -0.0149 327 TYR A CD2 
1552 C  CE1 . TYR A 188 ? 0.1119 0.0985 0.1145 -0.0075 -0.0084 -0.0152 327 TYR A CE1 
1553 C  CE2 . TYR A 188 ? 0.1065 0.1036 0.1172 -0.0088 -0.0089 -0.0146 327 TYR A CE2 
1554 C  CZ  . TYR A 188 ? 0.0946 0.0870 0.1029 -0.0073 -0.0083 -0.0147 327 TYR A CZ  
1555 O  OH  . TYR A 188 ? 0.1267 0.1200 0.1376 -0.0054 -0.0077 -0.0140 327 TYR A OH  
1556 N  N   . GLU A 189 ? 0.1207 0.0971 0.1074 -0.0191 -0.0122 -0.0166 328 GLU A N   
1557 C  CA  . GLU A 189 ? 0.1294 0.0995 0.1125 -0.0188 -0.0120 -0.0170 328 GLU A CA  
1558 C  C   . GLU A 189 ? 0.1546 0.1226 0.1388 -0.0138 -0.0103 -0.0170 328 GLU A C   
1559 O  O   . GLU A 189 ? 0.1514 0.1171 0.1335 -0.0113 -0.0097 -0.0171 328 GLU A O   
1560 C  CB  . GLU A 189 ? 0.1546 0.1154 0.1279 -0.0218 -0.0131 -0.0176 328 GLU A CB  
1561 C  CG  . GLU A 189 ? 0.2303 0.1849 0.1996 -0.0222 -0.0131 -0.0178 328 GLU A CG  
1562 C  CD  . GLU A 189 ? 0.4215 0.3667 0.3804 -0.0262 -0.0146 -0.0182 328 GLU A CD  
1563 O  OE1 . GLU A 189 ? 0.3930 0.3296 0.3458 -0.0251 -0.0143 -0.0186 328 GLU A OE1 
1564 O  OE2 . GLU A 189 ? 0.5440 0.4904 0.5006 -0.0306 -0.0162 -0.0180 328 GLU A OE2 
1565 N  N   . GLY A 190 ? 0.1225 0.0919 0.1099 -0.0125 -0.0097 -0.0166 329 GLY A N   
1566 C  CA  . GLY A 190 ? 0.1183 0.0875 0.1073 -0.0082 -0.0082 -0.0161 329 GLY A CA  
1567 C  C   . GLY A 190 ? 0.1344 0.1014 0.1230 -0.0076 -0.0077 -0.0158 329 GLY A C   
1568 O  O   . GLY A 190 ? 0.1453 0.1062 0.1284 -0.0093 -0.0082 -0.0163 329 GLY A O   
1569 N  N   . SER A 191 ? 0.1148 0.0865 0.1089 -0.0054 -0.0068 -0.0149 330 SER A N   
1570 C  CA  . SER A 191 ? 0.1219 0.0921 0.1157 -0.0042 -0.0060 -0.0144 330 SER A CA  
1571 C  C   . SER A 191 ? 0.1256 0.1022 0.1263 -0.0050 -0.0061 -0.0138 330 SER A C   
1572 O  O   . SER A 191 ? 0.1187 0.1005 0.1240 -0.0056 -0.0065 -0.0137 330 SER A O   
1573 C  CB  . SER A 191 ? 0.1304 0.0989 0.1220 0.0003  -0.0045 -0.0133 330 SER A CB  
1574 O  OG  . SER A 191 ? 0.1171 0.0926 0.1146 0.0019  -0.0040 -0.0121 330 SER A OG  
1575 N  N   . LEU A 192 ? 0.1140 0.0897 0.1150 -0.0047 -0.0057 -0.0134 331 LEU A N   
1576 C  CA  . LEU A 192 ? 0.1148 0.0960 0.1216 -0.0046 -0.0054 -0.0126 331 LEU A CA  
1577 C  C   . LEU A 192 ? 0.1216 0.1062 0.1306 -0.0021 -0.0047 -0.0112 331 LEU A C   
1578 O  O   . LEU A 192 ? 0.1407 0.1233 0.1466 0.0005  -0.0039 -0.0107 331 LEU A O   
1579 C  CB  . LEU A 192 ? 0.1403 0.1198 0.1465 -0.0045 -0.0050 -0.0122 331 LEU A CB  
1580 C  CG  . LEU A 192 ? 0.1653 0.1411 0.1686 -0.0073 -0.0059 -0.0133 331 LEU A CG  
1581 C  CD1 . LEU A 192 ? 0.2243 0.1980 0.2266 -0.0069 -0.0053 -0.0129 331 LEU A CD1 
1582 C  CD2 . LEU A 192 ? 0.1945 0.1749 0.2019 -0.0101 -0.0070 -0.0137 331 LEU A CD2 
1583 N  N   . THR A 193 ? 0.0898 0.0793 0.1036 -0.0027 -0.0049 -0.0106 332 THR A N   
1584 C  CA  . THR A 193 ? 0.0831 0.0761 0.0986 -0.0010 -0.0045 -0.0091 332 THR A CA  
1585 C  C   . THR A 193 ? 0.0839 0.0794 0.1009 -0.0002 -0.0039 -0.0073 332 THR A C   
1586 O  O   . THR A 193 ? 0.1238 0.1232 0.1425 0.0005  -0.0038 -0.0056 332 THR A O   
1587 C  CB  . THR A 193 ? 0.1131 0.1093 0.1317 -0.0021 -0.0053 -0.0091 332 THR A CB  
1588 O  OG1 . THR A 193 ? 0.1116 0.1094 0.1327 -0.0037 -0.0057 -0.0090 332 THR A OG1 
1589 C  CG2 . THR A 193 ? 0.0856 0.0807 0.1033 -0.0030 -0.0058 -0.0106 332 THR A CG2 
1590 N  N   . THR A 194 ? 0.1090 0.1027 0.1252 -0.0005 -0.0036 -0.0075 333 THR A N   
1591 C  CA  . THR A 194 ? 0.1100 0.1060 0.1270 0.0005  -0.0028 -0.0057 333 THR A CA  
1592 C  C   . THR A 194 ? 0.1205 0.1125 0.1335 0.0024  -0.0018 -0.0058 333 THR A C   
1593 O  O   . THR A 194 ? 0.1505 0.1372 0.1602 0.0019  -0.0020 -0.0075 333 THR A O   
1594 C  CB  . THR A 194 ? 0.1142 0.1123 0.1345 -0.0020 -0.0034 -0.0056 333 THR A CB  
1595 O  OG1 . THR A 194 ? 0.1301 0.1250 0.1501 -0.0037 -0.0039 -0.0075 333 THR A OG1 
1596 C  CG2 . THR A 194 ? 0.1098 0.1109 0.1327 -0.0035 -0.0042 -0.0050 333 THR A CG2 
1597 N  N   . PRO A 195 ? 0.1223 0.1166 0.1348 0.0047  -0.0006 -0.0037 334 PRO A N   
1598 C  CA  . PRO A 195 ? 0.1686 0.1584 0.1765 0.0070  0.0005  -0.0037 334 PRO A CA  
1599 C  C   . PRO A 195 ? 0.1690 0.1546 0.1765 0.0044  -0.0002 -0.0056 334 PRO A C   
1600 O  O   . PRO A 195 ? 0.1664 0.1549 0.1782 0.0017  -0.0009 -0.0058 334 PRO A O   
1601 C  CB  . PRO A 195 ? 0.1421 0.1373 0.1513 0.0092  0.0018  -0.0008 334 PRO A CB  
1602 C  CG  . PRO A 195 ? 0.1582 0.1600 0.1706 0.0091  0.0014  0.0010  334 PRO A CG  
1603 C  CD  . PRO A 195 ? 0.1406 0.1419 0.1561 0.0053  -0.0003 -0.0009 334 PRO A CD  
1604 N  N   . PRO A 196 ? 0.1789 0.1573 0.1807 0.0050  0.0000  -0.0069 335 PRO A N   
1605 C  CA  . PRO A 196 ? 0.1854 0.1583 0.1802 0.0086  0.0011  -0.0067 335 PRO A CA  
1606 C  C   . PRO A 196 ? 0.1942 0.1640 0.1861 0.0087  0.0005  -0.0078 335 PRO A C   
1607 O  O   . PRO A 196 ? 0.1732 0.1366 0.1579 0.0114  0.0012  -0.0080 335 PRO A O   
1608 C  CB  . PRO A 196 ? 0.2178 0.1830 0.2071 0.0080  0.0011  -0.0079 335 PRO A CB  
1609 C  CG  . PRO A 196 ? 0.2611 0.2271 0.2541 0.0031  -0.0007 -0.0095 335 PRO A CG  
1610 C  CD  . PRO A 196 ? 0.1870 0.1618 0.1881 0.0019  -0.0010 -0.0086 335 PRO A CD  
1611 N  N   . CYS A 197 ? 0.1352 0.1089 0.1317 0.0059  -0.0007 -0.0086 336 CYS A N   
1612 C  CA  . CYS A 197 ? 0.1457 0.1176 0.1402 0.0060  -0.0013 -0.0094 336 CYS A CA  
1613 C  C   . CYS A 197 ? 0.1512 0.1145 0.1385 0.0049  -0.0018 -0.0112 336 CYS A C   
1614 O  O   . CYS A 197 ? 0.1704 0.1300 0.1531 0.0065  -0.0017 -0.0115 336 CYS A O   
1615 C  CB  . CYS A 197 ? 0.1845 0.1585 0.1777 0.0102  0.0000  -0.0077 336 CYS A CB  
1616 S  SG  . CYS A 197 ? 0.1587 0.1433 0.1592 0.0111  0.0005  -0.0050 336 CYS A SG  
1617 N  N   . ALA A 198 ? 0.1700 0.1300 0.1560 0.0020  -0.0027 -0.0122 337 ALA A N   
1618 C  CA  . ALA A 198 ? 0.1505 0.1019 0.1289 0.0000  -0.0035 -0.0136 337 ALA A CA  
1619 C  C   . ALA A 198 ? 0.1641 0.1158 0.1423 -0.0026 -0.0049 -0.0146 337 ALA A C   
1620 O  O   . ALA A 198 ? 0.1580 0.1169 0.1431 -0.0045 -0.0056 -0.0147 337 ALA A O   
1621 C  CB  . ALA A 198 ? 0.2035 0.1531 0.1817 -0.0034 -0.0045 -0.0142 337 ALA A CB  
1622 N  N   . GLN A 199 ? 0.1714 0.1152 0.1414 -0.0025 -0.0051 -0.0154 338 GLN A N   
1623 C  CA  . GLN A 199 ? 0.1720 0.1159 0.1411 -0.0050 -0.0064 -0.0162 338 GLN A CA  
1624 C  C   . GLN A 199 ? 0.1687 0.1106 0.1357 -0.0107 -0.0083 -0.0171 338 GLN A C   
1625 O  O   . GLN A 199 ? 0.2034 0.1445 0.1704 -0.0126 -0.0088 -0.0171 338 GLN A O   
1626 C  CB  . GLN A 199 ? 0.1863 0.1228 0.1474 -0.0021 -0.0057 -0.0164 338 GLN A CB  
1627 C  CG  . GLN A 199 ? 0.1680 0.1101 0.1334 0.0028  -0.0041 -0.0152 338 GLN A CG  
1628 C  CD  . GLN A 199 ? 0.1788 0.1153 0.1371 0.0068  -0.0031 -0.0150 338 GLN A CD  
1629 O  OE1 . GLN A 199 ? 0.1871 0.1290 0.1490 0.0105  -0.0020 -0.0138 338 GLN A OE1 
1630 N  NE2 . GLN A 199 ? 0.2043 0.1297 0.1520 0.0062  -0.0036 -0.0161 338 GLN A NE2 
1631 N  N   . GLY A 200 ? 0.1718 0.1143 0.1376 -0.0135 -0.0096 -0.0175 339 GLY A N   
1632 C  CA  . GLY A 200 ? 0.1845 0.1272 0.1489 -0.0192 -0.0116 -0.0178 339 GLY A CA  
1633 C  C   . GLY A 200 ? 0.2052 0.1590 0.1790 -0.0212 -0.0122 -0.0172 339 GLY A C   
1634 O  O   . GLY A 200 ? 0.1996 0.1554 0.1732 -0.0256 -0.0137 -0.0170 339 GLY A O   
1635 N  N   . VAL A 201 ? 0.1354 0.0962 0.1169 -0.0180 -0.0110 -0.0168 340 VAL A N   
1636 C  CA  . VAL A 201 ? 0.1028 0.0730 0.0924 -0.0191 -0.0113 -0.0162 340 VAL A CA  
1637 C  C   . VAL A 201 ? 0.1423 0.1178 0.1339 -0.0205 -0.0120 -0.0160 340 VAL A C   
1638 O  O   . VAL A 201 ? 0.1487 0.1235 0.1398 -0.0187 -0.0115 -0.0162 340 VAL A O   
1639 C  CB  . VAL A 201 ? 0.1001 0.0745 0.0959 -0.0153 -0.0098 -0.0157 340 VAL A CB  
1640 C  CG1 . VAL A 201 ? 0.1370 0.1195 0.1396 -0.0161 -0.0101 -0.0152 340 VAL A CG1 
1641 C  CG2 . VAL A 201 ? 0.1477 0.1180 0.1418 -0.0139 -0.0090 -0.0156 340 VAL A CG2 
1642 N  N   . ILE A 202 ? 0.1235 0.1047 0.1175 -0.0237 -0.0131 -0.0154 341 ILE A N   
1643 C  CA  . ILE A 202 ? 0.1223 0.1098 0.1187 -0.0247 -0.0136 -0.0149 341 ILE A CA  
1644 C  C   . ILE A 202 ? 0.1401 0.1346 0.1436 -0.0216 -0.0126 -0.0144 341 ILE A C   
1645 O  O   . ILE A 202 ? 0.1204 0.1191 0.1275 -0.0216 -0.0125 -0.0139 341 ILE A O   
1646 C  CB  A ILE A 202 ? 0.1419 0.1333 0.1368 -0.0294 -0.0153 -0.0140 341 ILE A CB  
1647 C  CB  B ILE A 202 ? 0.1330 0.1245 0.1280 -0.0295 -0.0153 -0.0140 341 ILE A CB  
1648 C  CG1 A ILE A 202 ? 0.1828 0.1658 0.1691 -0.0332 -0.0166 -0.0144 341 ILE A CG1 
1649 C  CG1 B ILE A 202 ? 0.1910 0.1742 0.1778 -0.0332 -0.0166 -0.0144 341 ILE A CG1 
1650 C  CG2 A ILE A 202 ? 0.1348 0.1337 0.1323 -0.0300 -0.0156 -0.0131 341 ILE A CG2 
1651 C  CG2 B ILE A 202 ? 0.1332 0.1309 0.1295 -0.0304 -0.0157 -0.0132 341 ILE A CG2 
1652 C  CD1 A ILE A 202 ? 0.1700 0.1568 0.1542 -0.0387 -0.0186 -0.0132 341 ILE A CD1 
1653 C  CD1 B ILE A 202 ? 0.2179 0.1925 0.1981 -0.0327 -0.0165 -0.0153 341 ILE A CD1 
1654 N  N   . TRP A 203 ? 0.1118 0.1073 0.1168 -0.0192 -0.0118 -0.0146 342 TRP A N   
1655 C  CA  . TRP A 203 ? 0.0833 0.0841 0.0938 -0.0164 -0.0110 -0.0141 342 TRP A CA  
1656 C  C   . TRP A 203 ? 0.1003 0.1076 0.1127 -0.0171 -0.0113 -0.0134 342 TRP A C   
1657 O  O   . TRP A 203 ? 0.1251 0.1323 0.1352 -0.0183 -0.0118 -0.0134 342 TRP A O   
1658 C  CB  . TRP A 203 ? 0.1097 0.1078 0.1207 -0.0133 -0.0100 -0.0144 342 TRP A CB  
1659 C  CG  . TRP A 203 ? 0.1030 0.0975 0.1139 -0.0118 -0.0093 -0.0145 342 TRP A CG  
1660 C  CD1 . TRP A 203 ? 0.1268 0.1153 0.1335 -0.0115 -0.0091 -0.0149 342 TRP A CD1 
1661 C  CD2 . TRP A 203 ? 0.0927 0.0892 0.1073 -0.0102 -0.0087 -0.0141 342 TRP A CD2 
1662 N  NE1 . TRP A 203 ? 0.1093 0.0970 0.1175 -0.0098 -0.0083 -0.0146 342 TRP A NE1 
1663 C  CE2 . TRP A 203 ? 0.0942 0.0868 0.1073 -0.0093 -0.0082 -0.0140 342 TRP A CE2 
1664 C  CE3 . TRP A 203 ? 0.1149 0.1156 0.1331 -0.0095 -0.0086 -0.0136 342 TRP A CE3 
1665 C  CZ2 . TRP A 203 ? 0.1121 0.1058 0.1279 -0.0082 -0.0076 -0.0134 342 TRP A CZ2 
1666 C  CZ3 . TRP A 203 ? 0.1103 0.1107 0.1303 -0.0084 -0.0081 -0.0131 342 TRP A CZ3 
1667 C  CH2 . TRP A 203 ? 0.1155 0.1129 0.1346 -0.0080 -0.0077 -0.0130 342 TRP A CH2 
1668 N  N   . THR A 204 ? 0.0902 0.1029 0.1061 -0.0160 -0.0110 -0.0126 343 THR A N   
1669 C  CA  . THR A 204 ? 0.0727 0.0923 0.0905 -0.0156 -0.0110 -0.0116 343 THR A CA  
1670 C  C   . THR A 204 ? 0.0917 0.1121 0.1122 -0.0119 -0.0099 -0.0115 343 THR A C   
1671 O  O   . THR A 204 ? 0.1101 0.1298 0.1318 -0.0106 -0.0095 -0.0115 343 THR A O   
1672 C  CB  . THR A 204 ? 0.1086 0.1342 0.1268 -0.0176 -0.0117 -0.0103 343 THR A CB  
1673 O  OG1 . THR A 204 ? 0.1092 0.1331 0.1238 -0.0218 -0.0130 -0.0103 343 THR A OG1 
1674 C  CG2 . THR A 204 ? 0.1081 0.1418 0.1279 -0.0164 -0.0114 -0.0089 343 THR A CG2 
1675 N  N   . VAL A 205 ? 0.0834 0.1047 0.1044 -0.0103 -0.0095 -0.0115 344 VAL A N   
1676 C  CA  . VAL A 205 ? 0.0887 0.1097 0.1112 -0.0071 -0.0087 -0.0114 344 VAL A CA  
1677 C  C   . VAL A 205 ? 0.1171 0.1438 0.1403 -0.0055 -0.0083 -0.0103 344 VAL A C   
1678 O  O   . VAL A 205 ? 0.1240 0.1537 0.1470 -0.0061 -0.0084 -0.0100 344 VAL A O   
1679 C  CB  . VAL A 205 ? 0.1013 0.1183 0.1236 -0.0062 -0.0084 -0.0120 344 VAL A CB  
1680 C  CG1 . VAL A 205 ? 0.1346 0.1508 0.1577 -0.0036 -0.0078 -0.0117 344 VAL A CG1 
1681 C  CG2 . VAL A 205 ? 0.1233 0.1353 0.1445 -0.0071 -0.0086 -0.0127 344 VAL A CG2 
1682 N  N   . PHE A 206 ? 0.1114 0.1396 0.1350 -0.0034 -0.0077 -0.0096 345 PHE A N   
1683 C  CA  . PHE A 206 ? 0.1357 0.1690 0.1591 -0.0009 -0.0071 -0.0084 345 PHE A CA  
1684 C  C   . PHE A 206 ? 0.1203 0.1525 0.1435 0.0009  -0.0066 -0.0086 345 PHE A C   
1685 O  O   . PHE A 206 ? 0.1258 0.1524 0.1486 0.0014  -0.0066 -0.0094 345 PHE A O   
1686 C  CB  . PHE A 206 ? 0.1259 0.1590 0.1484 0.0019  -0.0064 -0.0078 345 PHE A CB  
1687 C  CG  . PHE A 206 ? 0.1504 0.1872 0.1734 0.0008  -0.0067 -0.0071 345 PHE A CG  
1688 C  CD1 . PHE A 206 ? 0.1287 0.1615 0.1520 -0.0009 -0.0072 -0.0079 345 PHE A CD1 
1689 C  CD2 . PHE A 206 ? 0.2073 0.2520 0.2303 0.0019  -0.0064 -0.0053 345 PHE A CD2 
1690 C  CE1 . PHE A 206 ? 0.1945 0.2308 0.2182 -0.0019 -0.0075 -0.0072 345 PHE A CE1 
1691 C  CE2 . PHE A 206 ? 0.2312 0.2801 0.2546 0.0009  -0.0067 -0.0044 345 PHE A CE2 
1692 C  CZ  . PHE A 206 ? 0.1987 0.2430 0.2225 -0.0011 -0.0073 -0.0054 345 PHE A CZ  
1693 N  N   . ASN A 207 ? 0.1201 0.1580 0.1434 0.0017  -0.0063 -0.0075 346 ASN A N   
1694 C  CA  . ASN A 207 ? 0.1362 0.1734 0.1591 0.0039  -0.0057 -0.0075 346 ASN A CA  
1695 C  C   . ASN A 207 ? 0.1381 0.1725 0.1589 0.0078  -0.0048 -0.0070 346 ASN A C   
1696 O  O   . ASN A 207 ? 0.1805 0.2099 0.2001 0.0089  -0.0047 -0.0075 346 ASN A O   
1697 C  CB  . ASN A 207 ? 0.1668 0.2114 0.1903 0.0036  -0.0056 -0.0063 346 ASN A CB  
1698 C  CG  . ASN A 207 ? 0.2257 0.2701 0.2490 0.0058  -0.0050 -0.0063 346 ASN A CG  
1699 O  OD1 . ASN A 207 ? 0.3354 0.3840 0.3580 0.0088  -0.0041 -0.0049 346 ASN A OD1 
1700 N  ND2 . ASN A 207 ? 0.1670 0.2066 0.1907 0.0047  -0.0054 -0.0075 346 ASN A ND2 
1701 N  N   . GLN A 208 ? 0.1385 0.1757 0.1582 0.0097  -0.0043 -0.0060 347 GLN A N   
1702 C  CA  . GLN A 208 ? 0.1906 0.2241 0.2068 0.0136  -0.0034 -0.0055 347 GLN A CA  
1703 C  C   . GLN A 208 ? 0.1911 0.2166 0.2061 0.0127  -0.0039 -0.0067 347 GLN A C   
1704 O  O   . GLN A 208 ? 0.1568 0.1823 0.1738 0.0099  -0.0045 -0.0073 347 GLN A O   
1705 C  CB  . GLN A 208 ? 0.2114 0.2511 0.2264 0.0164  -0.0025 -0.0038 347 GLN A CB  
1706 C  CG  . GLN A 208 ? 0.2025 0.2378 0.2125 0.0215  -0.0013 -0.0032 347 GLN A CG  
1707 C  CD  . GLN A 208 ? 0.2584 0.3008 0.2670 0.0250  -0.0002 -0.0011 347 GLN A CD  
1708 O  OE1 . GLN A 208 ? 0.3043 0.3513 0.3148 0.0234  -0.0006 -0.0006 347 GLN A OE1 
1709 N  NE2 . GLN A 208 ? 0.4097 0.4533 0.4145 0.0299  0.0012  0.0003  347 GLN A NE2 
1710 N  N   . THR A 209 ? 0.1596 0.1782 0.1709 0.0148  -0.0036 -0.0068 348 THR A N   
1711 C  CA  . THR A 209 ? 0.1597 0.1709 0.1691 0.0136  -0.0041 -0.0076 348 THR A CA  
1712 C  C   . THR A 209 ? 0.1854 0.1939 0.1907 0.0164  -0.0035 -0.0071 348 THR A C   
1713 O  O   . THR A 209 ? 0.2068 0.2191 0.2103 0.0198  -0.0025 -0.0060 348 THR A O   
1714 C  CB  . THR A 209 ? 0.2024 0.2068 0.2094 0.0132  -0.0046 -0.0079 348 THR A CB  
1715 O  OG1 . THR A 209 ? 0.2232 0.2244 0.2251 0.0168  -0.0038 -0.0073 348 THR A OG1 
1716 C  CG2 . THR A 209 ? 0.1811 0.1882 0.1918 0.0110  -0.0051 -0.0083 348 THR A CG2 
1717 N  N   . VAL A 210 ? 0.1444 0.1467 0.1480 0.0150  -0.0041 -0.0076 349 VAL A N   
1718 C  CA  . VAL A 210 ? 0.1970 0.1945 0.1953 0.0177  -0.0036 -0.0072 349 VAL A CA  
1719 C  C   . VAL A 210 ? 0.1796 0.1668 0.1720 0.0176  -0.0041 -0.0075 349 VAL A C   
1720 O  O   . VAL A 210 ? 0.1964 0.1812 0.1904 0.0143  -0.0051 -0.0079 349 VAL A O   
1721 C  CB  A VAL A 210 ? 0.2431 0.2413 0.2432 0.0161  -0.0039 -0.0075 349 VAL A CB  
1722 C  CB  B VAL A 210 ? 0.2404 0.2388 0.2408 0.0159  -0.0040 -0.0076 349 VAL A CB  
1723 C  CG1 A VAL A 210 ? 0.2554 0.2634 0.2607 0.0155  -0.0037 -0.0071 349 VAL A CG1 
1724 C  CG1 B VAL A 210 ? 0.2114 0.2027 0.2057 0.0179  -0.0037 -0.0074 349 VAL A CG1 
1725 C  CG2 A VAL A 210 ? 0.1997 0.1939 0.2015 0.0121  -0.0050 -0.0084 349 VAL A CG2 
1726 C  CG2 B VAL A 210 ? 0.2527 0.2607 0.2573 0.0162  -0.0036 -0.0070 349 VAL A CG2 
1727 N  N   . SER A 211 ? 0.2051 0.1863 0.1902 0.0213  -0.0034 -0.0069 350 SER A N   
1728 C  CA  . SER A 211 ? 0.2199 0.1903 0.1978 0.0209  -0.0040 -0.0070 350 SER A CA  
1729 C  C   . SER A 211 ? 0.2141 0.1765 0.1866 0.0203  -0.0045 -0.0072 350 SER A C   
1730 O  O   . SER A 211 ? 0.2193 0.1817 0.1891 0.0235  -0.0036 -0.0069 350 SER A O   
1731 C  CB  . SER A 211 ? 0.2915 0.2583 0.2628 0.0255  -0.0030 -0.0063 350 SER A CB  
1732 O  OG  . SER A 211 ? 0.3127 0.2853 0.2883 0.0253  -0.0028 -0.0062 350 SER A OG  
1733 N  N   . LEU A 212 ? 0.1860 0.1422 0.1567 0.0162  -0.0060 -0.0073 351 LEU A N   
1734 C  CA  . LEU A 212 ? 0.1777 0.1249 0.1420 0.0148  -0.0067 -0.0073 351 LEU A CA  
1735 C  C   . LEU A 212 ? 0.2150 0.1511 0.1699 0.0142  -0.0076 -0.0069 351 LEU A C   
1736 O  O   . LEU A 212 ? 0.2458 0.1825 0.2016 0.0131  -0.0081 -0.0066 351 LEU A O   
1737 C  CB  . LEU A 212 ? 0.2030 0.1530 0.1729 0.0097  -0.0079 -0.0075 351 LEU A CB  
1738 C  CG  . LEU A 212 ? 0.1937 0.1504 0.1697 0.0097  -0.0074 -0.0080 351 LEU A CG  
1739 C  CD1 . LEU A 212 ? 0.2172 0.1842 0.2003 0.0116  -0.0064 -0.0082 351 LEU A CD1 
1740 C  CD2 . LEU A 212 ? 0.2107 0.1687 0.1909 0.0049  -0.0085 -0.0080 351 LEU A CD2 
1741 N  N   . SER A 213 ? 0.2646 0.1900 0.2099 0.0146  -0.0080 -0.0067 352 SER A N   
1742 C  CA  . SER A 213 ? 0.2893 0.2026 0.2245 0.0129  -0.0092 -0.0062 352 SER A CA  
1743 C  C   . SER A 213 ? 0.3587 0.2722 0.2967 0.0060  -0.0113 -0.0056 352 SER A C   
1744 O  O   . SER A 213 ? 0.2808 0.2017 0.2269 0.0029  -0.0117 -0.0057 352 SER A O   
1745 C  CB  . SER A 213 ? 0.2781 0.1788 0.2011 0.0149  -0.0092 -0.0061 352 SER A CB  
1746 O  OG  . SER A 213 ? 0.3118 0.2110 0.2353 0.0109  -0.0103 -0.0062 352 SER A OG  
1747 N  N   . ALA A 214 ? 0.3524 0.2581 0.2834 0.0036  -0.0127 -0.0048 353 ALA A N   
1748 C  CA  . ALA A 214 ? 0.3143 0.2201 0.2467 -0.0031 -0.0149 -0.0037 353 ALA A CA  
1749 C  C   . ALA A 214 ? 0.3124 0.2154 0.2431 -0.0069 -0.0159 -0.0033 353 ALA A C   
1750 O  O   . ALA A 214 ? 0.2959 0.2063 0.2339 -0.0111 -0.0168 -0.0026 353 ALA A O   
1751 C  CB  . ALA A 214 ? 0.3510 0.2468 0.2736 -0.0052 -0.0164 -0.0027 353 ALA A CB  
1752 N  N   . LYS A 215 ? 0.3146 0.2072 0.2356 -0.0050 -0.0157 -0.0037 354 LYS A N   
1753 C  CA  . LYS A 215 ? 0.3471 0.2362 0.2655 -0.0082 -0.0166 -0.0034 354 LYS A CA  
1754 C  C   . LYS A 215 ? 0.3236 0.2248 0.2539 -0.0076 -0.0155 -0.0041 354 LYS A C   
1755 O  O   . LYS A 215 ? 0.3029 0.2072 0.2367 -0.0120 -0.0166 -0.0034 354 LYS A O   
1756 C  CB  . LYS A 215 ? 0.4084 0.2839 0.3137 -0.0050 -0.0163 -0.0040 354 LYS A CB  
1757 C  CG  . LYS A 215 ? 0.5661 0.4390 0.4698 -0.0069 -0.0167 -0.0040 354 LYS A CG  
1758 C  CD  . LYS A 215 ? 0.7263 0.5865 0.6174 -0.0024 -0.0159 -0.0047 354 LYS A CD  
1759 C  CE  . LYS A 215 ? 0.8692 0.7282 0.7585 -0.0052 -0.0165 -0.0044 354 LYS A CE  
1760 N  NZ  . LYS A 215 ? 0.9612 0.8208 0.8501 -0.0131 -0.0188 -0.0026 354 LYS A NZ  
1761 N  N   . GLN A 216 ? 0.2658 0.1738 0.2018 -0.0022 -0.0135 -0.0053 355 GLN A N   
1762 C  CA  . GLN A 216 ? 0.2867 0.2055 0.2331 -0.0016 -0.0125 -0.0059 355 GLN A CA  
1763 C  C   . GLN A 216 ? 0.2576 0.1863 0.2141 -0.0055 -0.0132 -0.0054 355 GLN A C   
1764 O  O   . GLN A 216 ? 0.2329 0.1669 0.1951 -0.0078 -0.0133 -0.0053 355 GLN A O   
1765 C  CB  . GLN A 216 ? 0.2460 0.1702 0.1957 0.0044  -0.0105 -0.0068 355 GLN A CB  
1766 C  CG  . GLN A 216 ? 0.2849 0.2026 0.2270 0.0087  -0.0095 -0.0071 355 GLN A CG  
1767 C  CD  . GLN A 216 ? 0.2726 0.1972 0.2179 0.0147  -0.0075 -0.0075 355 GLN A CD  
1768 O  OE1 . GLN A 216 ? 0.2715 0.2001 0.2189 0.0167  -0.0069 -0.0074 355 GLN A OE1 
1769 N  NE2 . GLN A 216 ? 0.2469 0.1736 0.1926 0.0173  -0.0066 -0.0077 355 GLN A NE2 
1770 N  N   . LEU A 217 ? 0.2341 0.1654 0.1925 -0.0057 -0.0134 -0.0050 356 LEU A N   
1771 C  CA  . LEU A 217 ? 0.1909 0.1312 0.1580 -0.0087 -0.0138 -0.0044 356 LEU A CA  
1772 C  C   . LEU A 217 ? 0.2740 0.2126 0.2394 -0.0143 -0.0156 -0.0028 356 LEU A C   
1773 O  O   . LEU A 217 ? 0.2289 0.1751 0.2013 -0.0165 -0.0157 -0.0022 356 LEU A O   
1774 C  CB  . LEU A 217 ? 0.2082 0.1510 0.1768 -0.0077 -0.0137 -0.0042 356 LEU A CB  
1775 C  CG  . LEU A 217 ? 0.2228 0.1711 0.1959 -0.0029 -0.0120 -0.0055 356 LEU A CG  
1776 C  CD1 . LEU A 217 ? 0.2210 0.1693 0.1932 -0.0018 -0.0120 -0.0053 356 LEU A CD1 
1777 C  CD2 . LEU A 217 ? 0.2100 0.1684 0.1928 -0.0032 -0.0113 -0.0061 356 LEU A CD2 
1778 N  N   . HIS A 218 ? 0.2777 0.2062 0.2333 -0.0166 -0.0170 -0.0019 357 HIS A N   
1779 C  CA  . HIS A 218 ? 0.2754 0.2020 0.2282 -0.0225 -0.0189 0.0000  357 HIS A CA  
1780 C  C   . HIS A 218 ? 0.2881 0.2163 0.2430 -0.0235 -0.0187 -0.0002 357 HIS A C   
1781 O  O   . HIS A 218 ? 0.2683 0.2029 0.2282 -0.0271 -0.0193 0.0012  357 HIS A O   
1782 C  CB  . HIS A 218 ? 0.3147 0.2284 0.2548 -0.0250 -0.0206 0.0010  357 HIS A CB  
1783 C  CG  . HIS A 218 ? 0.4271 0.3386 0.3633 -0.0318 -0.0229 0.0033  357 HIS A CG  
1784 N  ND1 . HIS A 218 ? 0.4969 0.4011 0.4265 -0.0341 -0.0237 0.0035  357 HIS A ND1 
1785 C  CD2 . HIS A 218 ? 0.4467 0.3631 0.3846 -0.0370 -0.0246 0.0058  357 HIS A CD2 
1786 C  CE1 . HIS A 218 ? 0.4491 0.3552 0.3770 -0.0400 -0.0255 0.0060  357 HIS A CE1 
1787 N  NE2 . HIS A 218 ? 0.4309 0.3436 0.3635 -0.0424 -0.0264 0.0076  357 HIS A NE2 
1788 N  N   . THR A 219 ? 0.2440 0.1671 0.1955 -0.0200 -0.0176 -0.0017 358 THR A N   
1789 C  CA  . THR A 219 ? 0.2165 0.1412 0.1702 -0.0204 -0.0173 -0.0021 358 THR A CA  
1790 C  C   . THR A 219 ? 0.2181 0.1554 0.1839 -0.0201 -0.0163 -0.0023 358 THR A C   
1791 O  O   . THR A 219 ? 0.2178 0.1590 0.1869 -0.0230 -0.0167 -0.0014 358 THR A O   
1792 C  CB  . THR A 219 ? 0.2313 0.1500 0.1802 -0.0156 -0.0160 -0.0037 358 THR A CB  
1793 O  OG1 . THR A 219 ? 0.3023 0.2076 0.2382 -0.0160 -0.0170 -0.0034 358 THR A OG1 
1794 C  CG2 . THR A 219 ? 0.2527 0.1743 0.2050 -0.0158 -0.0155 -0.0041 358 THR A CG2 
1795 N  N   . LEU A 220 ? 0.2071 0.1504 0.1787 -0.0166 -0.0150 -0.0033 359 LEU A N   
1796 C  CA  . LEU A 220 ? 0.1718 0.1255 0.1534 -0.0161 -0.0141 -0.0036 359 LEU A CA  
1797 C  C   . LEU A 220 ? 0.1733 0.1324 0.1587 -0.0200 -0.0150 -0.0018 359 LEU A C   
1798 O  O   . LEU A 220 ? 0.1800 0.1448 0.1706 -0.0210 -0.0146 -0.0014 359 LEU A O   
1799 C  CB  . LEU A 220 ? 0.1670 0.1251 0.1528 -0.0122 -0.0128 -0.0049 359 LEU A CB  
1800 C  CG  . LEU A 220 ? 0.1622 0.1296 0.1568 -0.0116 -0.0119 -0.0054 359 LEU A CG  
1801 C  CD1 . LEU A 220 ? 0.2111 0.1801 0.2081 -0.0114 -0.0114 -0.0059 359 LEU A CD1 
1802 C  CD2 . LEU A 220 ? 0.1474 0.1180 0.1446 -0.0083 -0.0110 -0.0064 359 LEU A CD2 
1803 N  N   . SER A 221 ? 0.2070 0.1646 0.1895 -0.0221 -0.0161 -0.0004 360 SER A N   
1804 C  CA  . SER A 221 ? 0.2021 0.1665 0.1886 -0.0251 -0.0168 0.0017  360 SER A CA  
1805 C  C   . SER A 221 ? 0.2085 0.1711 0.1909 -0.0303 -0.0185 0.0041  360 SER A C   
1806 O  O   . SER A 221 ? 0.2221 0.1920 0.2084 -0.0327 -0.0189 0.0063  360 SER A O   
1807 C  CB  . SER A 221 ? 0.2356 0.2015 0.2223 -0.0247 -0.0171 0.0022  360 SER A CB  
1808 O  OG  . SER A 221 ? 0.2386 0.1958 0.2168 -0.0263 -0.0184 0.0027  360 SER A OG  
1809 N  N   . ASP A 222 ? 0.1863 0.1396 0.1607 -0.0319 -0.0194 0.0040  361 ASP A N   
1810 C  CA  . ASP A 222 ? 0.2144 0.1646 0.1831 -0.0377 -0.0214 0.0065  361 ASP A CA  
1811 C  C   . ASP A 222 ? 0.2391 0.1886 0.2075 -0.0392 -0.0214 0.0066  361 ASP A C   
1812 O  O   . ASP A 222 ? 0.2611 0.2099 0.2260 -0.0443 -0.0230 0.0089  361 ASP A O   
1813 C  CB  . ASP A 222 ? 0.2776 0.2158 0.2351 -0.0395 -0.0230 0.0067  361 ASP A CB  
1814 C  CG  . ASP A 222 ? 0.4092 0.3432 0.3592 -0.0458 -0.0253 0.0094  361 ASP A CG  
1815 O  OD1 . ASP A 222 ? 0.4303 0.3712 0.3822 -0.0493 -0.0264 0.0121  361 ASP A OD1 
1816 O  OD2 . ASP A 222 ? 0.4393 0.3658 0.3821 -0.0457 -0.0254 0.0088  361 ASP A OD2 
1817 N  N   . THR A 223 ? 0.2064 0.1565 0.1783 -0.0351 -0.0197 0.0042  362 THR A N   
1818 C  CA  . THR A 223 ? 0.1709 0.1186 0.1414 -0.0361 -0.0196 0.0040  362 THR A CA  
1819 C  C   . THR A 223 ? 0.1740 0.1317 0.1527 -0.0370 -0.0189 0.0049  362 THR A C   
1820 O  O   . THR A 223 ? 0.1863 0.1434 0.1633 -0.0401 -0.0196 0.0061  362 THR A O   
1821 C  CB  . THR A 223 ? 0.1930 0.1354 0.1618 -0.0312 -0.0183 0.0011  362 THR A CB  
1822 O  OG1 . THR A 223 ? 0.2281 0.1607 0.1882 -0.0298 -0.0187 0.0005  362 THR A OG1 
1823 C  CG2 . THR A 223 ? 0.1880 0.1273 0.1546 -0.0320 -0.0183 0.0009  362 THR A CG2 
1824 N  N   . LEU A 224 ? 0.1508 0.1169 0.1377 -0.0341 -0.0175 0.0044  363 LEU A N   
1825 C  CA  . LEU A 224 ? 0.1192 0.0934 0.1131 -0.0337 -0.0165 0.0048  363 LEU A CA  
1826 C  C   . LEU A 224 ? 0.1274 0.1098 0.1246 -0.0364 -0.0169 0.0079  363 LEU A C   
1827 O  O   . LEU A 224 ? 0.1433 0.1284 0.1406 -0.0370 -0.0174 0.0092  363 LEU A O   
1828 C  CB  . LEU A 224 ? 0.1294 0.1073 0.1295 -0.0288 -0.0147 0.0025  363 LEU A CB  
1829 C  CG  . LEU A 224 ? 0.1440 0.1163 0.1420 -0.0256 -0.0141 -0.0002 363 LEU A CG  
1830 C  CD1 . LEU A 224 ? 0.1746 0.1515 0.1784 -0.0218 -0.0126 -0.0019 363 LEU A CD1 
1831 C  CD2 . LEU A 224 ? 0.1303 0.0991 0.1260 -0.0264 -0.0141 -0.0006 363 LEU A CD2 
1832 N  N   . TRP A 225 ? 0.1400 0.1269 0.1397 -0.0380 -0.0167 0.0092  364 TRP A N   
1833 C  CA  . TRP A 225 ? 0.1405 0.1370 0.1440 -0.0396 -0.0166 0.0124  364 TRP A CA  
1834 C  C   . TRP A 225 ? 0.1331 0.1363 0.1437 -0.0355 -0.0145 0.0116  364 TRP A C   
1835 O  O   . TRP A 225 ? 0.1445 0.1453 0.1570 -0.0328 -0.0135 0.0090  364 TRP A O   
1836 C  CB  . TRP A 225 ? 0.1783 0.1754 0.1788 -0.0446 -0.0179 0.0150  364 TRP A CB  
1837 C  CG  . TRP A 225 ? 0.3270 0.3177 0.3193 -0.0474 -0.0196 0.0159  364 TRP A CG  
1838 C  CD1 . TRP A 225 ? 0.5751 0.5551 0.5603 -0.0476 -0.0203 0.0140  364 TRP A CD1 
1839 C  CD2 . TRP A 225 ? 0.3725 0.3672 0.3623 -0.0502 -0.0209 0.0191  364 TRP A CD2 
1840 N  NE1 . TRP A 225 ? 0.6345 0.6108 0.6126 -0.0505 -0.0220 0.0157  364 TRP A NE1 
1841 C  CE2 . TRP A 225 ? 0.5306 0.5160 0.5115 -0.0524 -0.0225 0.0188  364 TRP A CE2 
1842 C  CE3 . TRP A 225 ? 0.3011 0.3065 0.2949 -0.0510 -0.0209 0.0224  364 TRP A CE3 
1843 C  CZ2 . TRP A 225 ? 0.5250 0.5112 0.5009 -0.0557 -0.0244 0.0216  364 TRP A CZ2 
1844 C  CZ3 . TRP A 225 ? 0.3348 0.3418 0.3240 -0.0541 -0.0227 0.0253  364 TRP A CZ3 
1845 C  CH2 . TRP A 225 ? 0.4158 0.4132 0.3963 -0.0567 -0.0245 0.0248  364 TRP A CH2 
1846 N  N   . GLY A 226 ? 0.1351 0.1465 0.1490 -0.0349 -0.0140 0.0139  365 GLY A N   
1847 C  CA  . GLY A 226 ? 0.1250 0.1417 0.1442 -0.0306 -0.0121 0.0134  365 GLY A CA  
1848 C  C   . GLY A 226 ? 0.1477 0.1720 0.1694 -0.0311 -0.0113 0.0162  365 GLY A C   
1849 O  O   . GLY A 226 ? 0.1450 0.1702 0.1650 -0.0349 -0.0123 0.0181  365 GLY A O   
1850 N  N   . PRO A 227 ? 0.1128 0.1421 0.1380 -0.0271 -0.0096 0.0164  366 PRO A N   
1851 C  CA  . PRO A 227 ? 0.1417 0.1784 0.1691 -0.0265 -0.0085 0.0191  366 PRO A CA  
1852 C  C   . PRO A 227 ? 0.1104 0.1549 0.1369 -0.0300 -0.0095 0.0239  366 PRO A C   
1853 O  O   . PRO A 227 ? 0.1692 0.2151 0.1942 -0.0314 -0.0106 0.0253  366 PRO A O   
1854 C  CB  . PRO A 227 ? 0.1459 0.1849 0.1754 -0.0211 -0.0065 0.0185  366 PRO A CB  
1855 C  CG  . PRO A 227 ? 0.1289 0.1600 0.1577 -0.0193 -0.0066 0.0143  366 PRO A CG  
1856 C  CD  . PRO A 227 ? 0.0963 0.1243 0.1227 -0.0228 -0.0085 0.0143  366 PRO A CD  
1857 N  N   . GLY A 228 ? 0.1780 0.2280 0.2054 -0.0316 -0.0092 0.0265  367 GLY A N   
1858 C  CA  . GLY A 228 ? 0.2033 0.2619 0.2298 -0.0355 -0.0103 0.0315  367 GLY A CA  
1859 C  C   . GLY A 228 ? 0.2168 0.2692 0.2379 -0.0405 -0.0129 0.0313  367 GLY A C   
1860 O  O   . GLY A 228 ? 0.2267 0.2698 0.2450 -0.0421 -0.0137 0.0283  367 GLY A O   
1861 N  N   . ASP A 229 ? 0.1996 0.2563 0.2183 -0.0422 -0.0141 0.0343  368 ASP A N   
1862 C  CA  . ASP A 229 ? 0.2133 0.2633 0.2254 -0.0465 -0.0167 0.0342  368 ASP A CA  
1863 C  C   . ASP A 229 ? 0.2579 0.3017 0.2694 -0.0467 -0.0173 0.0320  368 ASP A C   
1864 O  O   . ASP A 229 ? 0.2601 0.2988 0.2659 -0.0498 -0.0193 0.0322  368 ASP A O   
1865 C  CB  . ASP A 229 ? 0.2673 0.3249 0.2761 -0.0490 -0.0183 0.0388  368 ASP A CB  
1866 C  CG  . ASP A 229 ? 0.4719 0.5397 0.4841 -0.0468 -0.0176 0.0419  368 ASP A CG  
1867 O  OD1 . ASP A 229 ? 0.4710 0.5402 0.4882 -0.0431 -0.0157 0.0405  368 ASP A OD1 
1868 O  OD2 . ASP A 229 ? 0.6461 0.7208 0.6557 -0.0486 -0.0192 0.0458  368 ASP A OD2 
1869 N  N   . SER A 230 ? 0.2069 0.2510 0.2234 -0.0429 -0.0157 0.0298  369 SER A N   
1870 C  CA  . SER A 230 ? 0.2063 0.2459 0.2219 -0.0410 -0.0159 0.0277  369 SER A CA  
1871 C  C   . SER A 230 ? 0.1732 0.2003 0.1847 -0.0419 -0.0169 0.0238  369 SER A C   
1872 O  O   . SER A 230 ? 0.2047 0.2263 0.2153 -0.0422 -0.0167 0.0216  369 SER A O   
1873 C  CB  . SER A 230 ? 0.1826 0.2249 0.2027 -0.0345 -0.0136 0.0259  369 SER A CB  
1874 O  OG  . SER A 230 ? 0.1840 0.2201 0.2054 -0.0314 -0.0123 0.0219  369 SER A OG  
1875 N  N   . ARG A 231 ? 0.1790 0.2021 0.1880 -0.0422 -0.0178 0.0230  370 ARG A N   
1876 C  CA  . ARG A 231 ? 0.1861 0.1981 0.1914 -0.0415 -0.0182 0.0193  370 ARG A CA  
1877 C  C   . ARG A 231 ? 0.1806 0.1915 0.1900 -0.0357 -0.0163 0.0158  370 ARG A C   
1878 O  O   . ARG A 231 ? 0.1690 0.1859 0.1821 -0.0329 -0.0153 0.0164  370 ARG A O   
1879 C  CB  A ARG A 231 ? 0.2535 0.2615 0.2536 -0.0446 -0.0202 0.0203  370 ARG A CB  
1880 C  CB  B ARG A 231 ? 0.2540 0.2619 0.2541 -0.0444 -0.0201 0.0202  370 ARG A CB  
1881 C  CG  A ARG A 231 ? 0.3174 0.3132 0.3113 -0.0452 -0.0210 0.0175  370 ARG A CG  
1882 C  CG  B ARG A 231 ? 0.3324 0.3371 0.3258 -0.0510 -0.0226 0.0229  370 ARG A CG  
1883 C  CD  A ARG A 231 ? 0.3541 0.3446 0.3405 -0.0500 -0.0234 0.0194  370 ARG A CD  
1884 C  CD  B ARG A 231 ? 0.3952 0.3864 0.3809 -0.0517 -0.0236 0.0202  370 ARG A CD  
1885 N  NE  A ARG A 231 ? 0.4209 0.3985 0.3998 -0.0504 -0.0241 0.0169  370 ARG A NE  
1886 N  NE  B ARG A 231 ? 0.4248 0.4120 0.4057 -0.0532 -0.0250 0.0208  370 ARG A NE  
1887 C  CZ  A ARG A 231 ? 0.4687 0.4386 0.4388 -0.0529 -0.0257 0.0176  370 ARG A CZ  
1888 C  CZ  B ARG A 231 ? 0.4627 0.4382 0.4359 -0.0534 -0.0258 0.0189  370 ARG A CZ  
1889 N  NH1 A ARG A 231 ? 0.4680 0.4421 0.4360 -0.0561 -0.0272 0.0207  370 ARG A NH1 
1890 N  NH1 B ARG A 231 ? 0.4631 0.4301 0.4327 -0.0519 -0.0253 0.0163  370 ARG A NH1 
1891 N  NH2 A ARG A 231 ? 0.4586 0.4169 0.4215 -0.0518 -0.0258 0.0152  370 ARG A NH2 
1892 N  NH2 B ARG A 231 ? 0.4700 0.4423 0.4390 -0.0547 -0.0271 0.0196  370 ARG A NH2 
1901 N  N   . GLN A 233 ? 0.1303 0.1338 0.1411 -0.0278 -0.0148 0.0096  372 GLN A N   
1902 C  CA  . GLN A 233 ? 0.1230 0.1240 0.1322 -0.0270 -0.0153 0.0089  372 GLN A CA  
1903 C  C   . GLN A 233 ? 0.1155 0.1225 0.1293 -0.0236 -0.0140 0.0089  372 GLN A C   
1904 O  O   . GLN A 233 ? 0.1326 0.1459 0.1496 -0.0226 -0.0132 0.0103  372 GLN A O   
1905 C  CB  . GLN A 233 ? 0.1499 0.1500 0.1545 -0.0313 -0.0173 0.0117  372 GLN A CB  
1906 C  CG  . GLN A 233 ? 0.2117 0.2038 0.2099 -0.0348 -0.0187 0.0117  372 GLN A CG  
1907 C  CD  . GLN A 233 ? 0.1848 0.1742 0.1771 -0.0393 -0.0209 0.0141  372 GLN A CD  
1908 O  OE1 . GLN A 233 ? 0.2097 0.2063 0.2034 -0.0417 -0.0217 0.0173  372 GLN A OE1 
1909 N  NE2 . GLN A 233 ? 0.2020 0.1809 0.1871 -0.0404 -0.0218 0.0128  372 GLN A NE2 
1910 N  N   . LEU A 234 ? 0.1167 0.1215 0.1301 -0.0218 -0.0139 0.0073  373 LEU A N   
1911 C  CA  . LEU A 234 ? 0.1172 0.1268 0.1341 -0.0188 -0.0130 0.0072  373 LEU A CA  
1912 C  C   . LEU A 234 ? 0.1247 0.1363 0.1449 -0.0158 -0.0113 0.0059  373 LEU A C   
1913 O  O   . LEU A 234 ? 0.1180 0.1349 0.1404 -0.0140 -0.0105 0.0071  373 LEU A O   
1914 C  CB  . LEU A 234 ? 0.1644 0.1807 0.1818 -0.0201 -0.0136 0.0107  373 LEU A CB  
1915 C  CG  . LEU A 234 ? 0.1812 0.1955 0.1946 -0.0240 -0.0156 0.0125  373 LEU A CG  
1916 C  CD1 . LEU A 234 ? 0.2234 0.2459 0.2374 -0.0262 -0.0164 0.0167  373 LEU A CD1 
1917 C  CD2 . LEU A 234 ? 0.1676 0.1777 0.1797 -0.0227 -0.0158 0.0107  373 LEU A CD2 
1918 N  N   . ASN A 235 ? 0.1142 0.1215 0.1343 -0.0153 -0.0109 0.0035  374 ASN A N   
1919 C  CA  . ASN A 235 ? 0.0953 0.1039 0.1178 -0.0132 -0.0096 0.0024  374 ASN A CA  
1920 C  C   . ASN A 235 ? 0.0954 0.1027 0.1188 -0.0104 -0.0088 0.0001  374 ASN A C   
1921 O  O   . ASN A 235 ? 0.1260 0.1305 0.1496 -0.0096 -0.0084 -0.0020 374 ASN A O   
1922 C  CB  . ASN A 235 ? 0.0912 0.0967 0.1131 -0.0143 -0.0096 0.0014  374 ASN A CB  
1923 C  CG  . ASN A 235 ? 0.1210 0.1209 0.1408 -0.0144 -0.0101 -0.0006 374 ASN A CG  
1924 O  OD1 . ASN A 235 ? 0.1273 0.1250 0.1450 -0.0147 -0.0107 -0.0007 374 ASN A OD1 
1925 N  ND2 . ASN A 235 ? 0.1002 0.0982 0.1205 -0.0139 -0.0096 -0.0022 374 ASN A ND2 
1926 N  N   . PHE A 236 ? 0.0940 0.1039 0.1178 -0.0090 -0.0086 0.0008  375 PHE A N   
1927 C  CA  . PHE A 236 ? 0.0897 0.0987 0.1140 -0.0067 -0.0079 -0.0010 375 PHE A CA  
1928 C  C   . PHE A 236 ? 0.0913 0.1037 0.1159 -0.0044 -0.0071 0.0002  375 PHE A C   
1929 O  O   . PHE A 236 ? 0.1243 0.1410 0.1492 -0.0046 -0.0072 0.0028  375 PHE A O   
1930 C  CB  . PHE A 236 ? 0.1194 0.1269 0.1430 -0.0068 -0.0086 -0.0018 375 PHE A CB  
1931 C  CG  . PHE A 236 ? 0.1023 0.1123 0.1253 -0.0076 -0.0093 0.0003  375 PHE A CG  
1932 C  CD1 . PHE A 236 ? 0.1163 0.1294 0.1402 -0.0059 -0.0090 0.0010  375 PHE A CD1 
1933 C  CD2 . PHE A 236 ? 0.1136 0.1225 0.1348 -0.0104 -0.0105 0.0017  375 PHE A CD2 
1934 C  CE1 . PHE A 236 ? 0.1421 0.1583 0.1657 -0.0068 -0.0097 0.0031  375 PHE A CE1 
1935 C  CE2 . PHE A 236 ? 0.1744 0.1858 0.1948 -0.0117 -0.0114 0.0039  375 PHE A CE2 
1936 C  CZ  . PHE A 236 ? 0.1568 0.1722 0.1786 -0.0099 -0.0110 0.0047  375 PHE A CZ  
1937 N  N   . ARG A 237 ? 0.0900 0.1004 0.1141 -0.0024 -0.0063 -0.0015 376 ARG A N   
1938 C  CA  . ARG A 237 ? 0.0961 0.1080 0.1193 0.0004  -0.0053 -0.0008 376 ARG A CA  
1939 C  C   . ARG A 237 ? 0.1109 0.1239 0.1339 0.0014  -0.0056 -0.0007 376 ARG A C   
1940 O  O   . ARG A 237 ? 0.1323 0.1434 0.1556 0.0004  -0.0062 -0.0023 376 ARG A O   
1941 C  CB  . ARG A 237 ? 0.0837 0.0914 0.1049 0.0017  -0.0046 -0.0027 376 ARG A CB  
1942 C  CG  . ARG A 237 ? 0.1144 0.1221 0.1331 0.0050  -0.0034 -0.0018 376 ARG A CG  
1943 C  CD  . ARG A 237 ? 0.1211 0.1227 0.1363 0.0058  -0.0029 -0.0040 376 ARG A CD  
1944 N  NE  . ARG A 237 ? 0.1427 0.1429 0.1541 0.0094  -0.0016 -0.0030 376 ARG A NE  
1945 C  CZ  . ARG A 237 ? 0.1264 0.1203 0.1330 0.0106  -0.0011 -0.0045 376 ARG A CZ  
1946 N  NH1 . ARG A 237 ? 0.1351 0.1244 0.1407 0.0080  -0.0020 -0.0069 376 ARG A NH1 
1947 N  NH2 . ARG A 237 ? 0.1261 0.1182 0.1282 0.0145  0.0002  -0.0034 376 ARG A NH2 
1948 N  N   . ALA A 238 ? 0.1344 0.1509 0.1568 0.0035  -0.0050 0.0012  377 ALA A N   
1949 C  CA  . ALA A 238 ? 0.1954 0.2132 0.2175 0.0050  -0.0051 0.0013  377 ALA A CA  
1950 C  C   . ALA A 238 ? 0.1864 0.1991 0.2066 0.0060  -0.0047 -0.0015 377 ALA A C   
1951 O  O   . ALA A 238 ? 0.1570 0.1659 0.1753 0.0066  -0.0042 -0.0028 377 ALA A O   
1952 C  CB  . ALA A 238 ? 0.2046 0.2272 0.2259 0.0079  -0.0042 0.0041  377 ALA A CB  
1953 N  N   . THR A 239 ? 0.1443 0.1573 0.1650 0.0059  -0.0052 -0.0021 378 THR A N   
1954 C  CA  . THR A 239 ? 0.1385 0.1477 0.1573 0.0065  -0.0050 -0.0044 378 THR A CA  
1955 C  C   . THR A 239 ? 0.1511 0.1579 0.1661 0.0095  -0.0040 -0.0044 378 THR A C   
1956 O  O   . THR A 239 ? 0.1909 0.2006 0.2052 0.0121  -0.0033 -0.0024 378 THR A O   
1957 C  CB  . THR A 239 ? 0.2150 0.2261 0.2350 0.0064  -0.0056 -0.0045 378 THR A CB  
1958 O  OG1 . THR A 239 ? 0.3269 0.3399 0.3494 0.0042  -0.0065 -0.0039 378 THR A OG1 
1959 C  CG2 . THR A 239 ? 0.3077 0.3154 0.3262 0.0061  -0.0057 -0.0068 378 THR A CG2 
1960 N  N   . GLN A 240 ? 0.1405 0.1417 0.1523 0.0092  -0.0039 -0.0065 379 GLN A N   
1961 C  CA  . GLN A 240 ? 0.1424 0.1389 0.1488 0.0118  -0.0030 -0.0068 379 GLN A CA  
1962 C  C   . GLN A 240 ? 0.1309 0.1241 0.1341 0.0121  -0.0032 -0.0082 379 GLN A C   
1963 O  O   . GLN A 240 ? 0.1522 0.1460 0.1574 0.0096  -0.0041 -0.0095 379 GLN A O   
1964 C  CB  . GLN A 240 ? 0.1439 0.1353 0.1476 0.0106  -0.0029 -0.0080 379 GLN A CB  
1965 C  CG  . GLN A 240 ? 0.1420 0.1364 0.1488 0.0100  -0.0027 -0.0068 379 GLN A CG  
1966 C  CD  . GLN A 240 ? 0.1908 0.1880 0.1967 0.0135  -0.0016 -0.0043 379 GLN A CD  
1967 O  OE1 . GLN A 240 ? 0.2123 0.2057 0.2129 0.0167  -0.0005 -0.0041 379 GLN A OE1 
1968 N  NE2 . GLN A 240 ? 0.1759 0.1797 0.1861 0.0130  -0.0018 -0.0022 379 GLN A NE2 
1969 N  N   . PRO A 241 ? 0.1573 0.1474 0.1553 0.0155  -0.0023 -0.0078 380 PRO A N   
1970 C  CA  . PRO A 241 ? 0.1524 0.1391 0.1469 0.0159  -0.0025 -0.0091 380 PRO A CA  
1971 C  C   . PRO A 241 ? 0.1418 0.1220 0.1325 0.0127  -0.0034 -0.0114 380 PRO A C   
1972 O  O   . PRO A 241 ? 0.1860 0.1612 0.1732 0.0120  -0.0033 -0.0120 380 PRO A O   
1973 C  CB  . PRO A 241 ? 0.1738 0.1576 0.1624 0.0208  -0.0012 -0.0079 380 PRO A CB  
1974 C  CG  . PRO A 241 ? 0.2053 0.1879 0.1924 0.0224  -0.0003 -0.0069 380 PRO A CG  
1975 C  CD  . PRO A 241 ? 0.1803 0.1698 0.1750 0.0196  -0.0009 -0.0061 380 PRO A CD  
1976 N  N   . LEU A 242 ? 0.1606 0.1413 0.1520 0.0106  -0.0042 -0.0125 381 LEU A N   
1977 C  CA  . LEU A 242 ? 0.1770 0.1527 0.1647 0.0070  -0.0052 -0.0142 381 LEU A CA  
1978 C  C   . LEU A 242 ? 0.1618 0.1279 0.1399 0.0079  -0.0050 -0.0150 381 LEU A C   
1979 O  O   . LEU A 242 ? 0.1817 0.1423 0.1554 0.0049  -0.0058 -0.0161 381 LEU A O   
1980 C  CB  . LEU A 242 ? 0.2631 0.2422 0.2533 0.0046  -0.0061 -0.0149 381 LEU A CB  
1981 C  CG  . LEU A 242 ? 0.3348 0.3197 0.3310 0.0014  -0.0069 -0.0150 381 LEU A CG  
1982 C  CD1 . LEU A 242 ? 0.2558 0.2429 0.2525 -0.0004 -0.0076 -0.0155 381 LEU A CD1 
1983 C  CD2 . LEU A 242 ? 0.2008 0.1833 0.1956 -0.0016 -0.0075 -0.0156 381 LEU A CD2 
1984 N  N   . ASN A 243 ? 0.1868 0.1505 0.1609 0.0120  -0.0040 -0.0144 382 ASN A N   
1985 C  CA  . ASN A 243 ? 0.1633 0.1166 0.1267 0.0139  -0.0036 -0.0151 382 ASN A CA  
1986 C  C   . ASN A 243 ? 0.1722 0.1185 0.1295 0.0094  -0.0051 -0.0169 382 ASN A C   
1987 O  O   . ASN A 243 ? 0.2069 0.1439 0.1559 0.0082  -0.0054 -0.0177 382 ASN A O   
1988 C  CB  . ASN A 243 ? 0.2044 0.1534 0.1642 0.0160  -0.0027 -0.0146 382 ASN A CB  
1989 C  CG  . ASN A 243 ? 0.2397 0.1939 0.2023 0.0215  -0.0010 -0.0124 382 ASN A CG  
1990 O  OD1 . ASN A 243 ? 0.2584 0.2158 0.2214 0.0247  -0.0003 -0.0113 382 ASN A OD1 
1991 N  ND2 . ASN A 243 ? 0.1972 0.1528 0.1614 0.0224  -0.0003 -0.0114 382 ASN A ND2 
1992 N  N   . GLY A 244 ? 0.1818 0.1326 0.1427 0.0067  -0.0060 -0.0173 383 GLY A N   
1993 C  CA  . GLY A 244 ? 0.1644 0.1095 0.1191 0.0024  -0.0075 -0.0186 383 GLY A CA  
1994 C  C   . GLY A 244 ? 0.1891 0.1367 0.1464 -0.0034 -0.0090 -0.0190 383 GLY A C   
1995 O  O   . GLY A 244 ? 0.2039 0.1485 0.1567 -0.0078 -0.0104 -0.0196 383 GLY A O   
1996 N  N   . ARG A 245 ? 0.1687 0.1221 0.1329 -0.0035 -0.0087 -0.0184 384 ARG A N   
1997 C  CA  . ARG A 245 ? 0.1584 0.1157 0.1259 -0.0084 -0.0100 -0.0185 384 ARG A CA  
1998 C  C   . ARG A 245 ? 0.1516 0.1174 0.1252 -0.0107 -0.0107 -0.0182 384 ARG A C   
1999 O  O   . ARG A 245 ? 0.1633 0.1342 0.1417 -0.0081 -0.0099 -0.0178 384 ARG A O   
2000 C  CB  . ARG A 245 ? 0.1581 0.1194 0.1315 -0.0074 -0.0094 -0.0179 384 ARG A CB  
2001 C  CG  . ARG A 245 ? 0.1562 0.1094 0.1234 -0.0065 -0.0090 -0.0181 384 ARG A CG  
2002 C  CD  . ARG A 245 ? 0.1436 0.1018 0.1173 -0.0054 -0.0084 -0.0174 384 ARG A CD  
2003 N  NE  . ARG A 245 ? 0.1512 0.1137 0.1295 -0.0008 -0.0069 -0.0164 384 ARG A NE  
2004 C  CZ  . ARG A 245 ? 0.1298 0.0971 0.1139 0.0005  -0.0063 -0.0156 384 ARG A CZ  
2005 N  NH1 . ARG A 245 ? 0.1210 0.0894 0.1072 -0.0021 -0.0069 -0.0157 384 ARG A NH1 
2006 N  NH2 . ARG A 245 ? 0.1345 0.1058 0.1219 0.0041  -0.0052 -0.0143 384 ARG A NH2 
2007 N  N   . VAL A 246 ? 0.1419 0.1095 0.1150 -0.0156 -0.0121 -0.0182 385 VAL A N   
2008 C  CA  . VAL A 246 ? 0.1502 0.1271 0.1291 -0.0178 -0.0126 -0.0175 385 VAL A CA  
2009 C  C   . VAL A 246 ? 0.1440 0.1284 0.1303 -0.0179 -0.0124 -0.0167 385 VAL A C   
2010 O  O   . VAL A 246 ? 0.1923 0.1749 0.1775 -0.0195 -0.0128 -0.0167 385 VAL A O   
2011 C  CB  . VAL A 246 ? 0.1721 0.1478 0.1457 -0.0232 -0.0143 -0.0174 385 VAL A CB  
2012 C  CG1 . VAL A 246 ? 0.1697 0.1565 0.1498 -0.0253 -0.0148 -0.0162 385 VAL A CG1 
2013 C  CG2 . VAL A 246 ? 0.2122 0.1803 0.1781 -0.0231 -0.0146 -0.0182 385 VAL A CG2 
2014 N  N   . ILE A 247 ? 0.1104 0.1026 0.1038 -0.0159 -0.0118 -0.0161 386 ILE A N   
2015 C  CA  . ILE A 247 ? 0.1143 0.1136 0.1135 -0.0162 -0.0117 -0.0153 386 ILE A CA  
2016 C  C   . ILE A 247 ? 0.1320 0.1378 0.1321 -0.0193 -0.0125 -0.0144 386 ILE A C   
2017 O  O   . ILE A 247 ? 0.1611 0.1696 0.1618 -0.0190 -0.0125 -0.0143 386 ILE A O   
2018 C  CB  . ILE A 247 ? 0.1261 0.1292 0.1313 -0.0122 -0.0105 -0.0150 386 ILE A CB  
2019 C  CG1 . ILE A 247 ? 0.1401 0.1381 0.1445 -0.0094 -0.0097 -0.0154 386 ILE A CG1 
2020 C  CG2 . ILE A 247 ? 0.0987 0.1078 0.1085 -0.0124 -0.0104 -0.0142 386 ILE A CG2 
2021 C  CD1 . ILE A 247 ? 0.1593 0.1608 0.1688 -0.0064 -0.0088 -0.0148 386 ILE A CD1 
2022 N  N   . GLU A 248 ? 0.1244 0.1330 0.1243 -0.0223 -0.0134 -0.0137 387 GLU A N   
2023 C  CA  . GLU A 248 ? 0.1009 0.1175 0.1018 -0.0252 -0.0142 -0.0123 387 GLU A CA  
2024 C  C   . GLU A 248 ? 0.1444 0.1695 0.1519 -0.0223 -0.0132 -0.0112 387 GLU A C   
2025 O  O   . GLU A 248 ? 0.1374 0.1616 0.1477 -0.0195 -0.0123 -0.0115 387 GLU A O   
2026 C  CB  . GLU A 248 ? 0.1360 0.1523 0.1329 -0.0302 -0.0157 -0.0116 387 GLU A CB  
2027 C  CG  . GLU A 248 ? 0.1579 0.1646 0.1465 -0.0336 -0.0169 -0.0125 387 GLU A CG  
2028 C  CD  . GLU A 248 ? 0.2335 0.2399 0.2172 -0.0395 -0.0189 -0.0115 387 GLU A CD  
2029 O  OE1 . GLU A 248 ? 0.2573 0.2551 0.2327 -0.0430 -0.0201 -0.0122 387 GLU A OE1 
2030 O  OE2 . GLU A 248 ? 0.2253 0.2398 0.2128 -0.0408 -0.0192 -0.0100 387 GLU A OE2 
2031 N  N   . ALA A 249 ? 0.1192 0.1523 0.1284 -0.0230 -0.0133 -0.0098 388 ALA A N   
2032 C  CA  . ALA A 249 ? 0.1324 0.1738 0.1465 -0.0202 -0.0123 -0.0084 388 ALA A CA  
2033 C  C   . ALA A 249 ? 0.1418 0.1921 0.1557 -0.0233 -0.0131 -0.0062 388 ALA A C   
2034 O  O   . ALA A 249 ? 0.1424 0.1945 0.1534 -0.0274 -0.0143 -0.0055 388 ALA A O   
2035 C  CB  . ALA A 249 ? 0.1319 0.1758 0.1485 -0.0169 -0.0112 -0.0084 388 ALA A CB  
2036 N  N   . SER A 250 ? 0.1054 0.1614 0.1222 -0.0214 -0.0125 -0.0050 389 SER A N   
2037 C  CA  . SER A 250 ? 0.1322 0.1983 0.1493 -0.0237 -0.0131 -0.0024 389 SER A CA  
2038 C  C   . SER A 250 ? 0.1200 0.1958 0.1393 -0.0215 -0.0123 -0.0004 389 SER A C   
2039 O  O   . SER A 250 ? 0.1509 0.2369 0.1711 -0.0222 -0.0124 0.0023  389 SER A O   
2040 C  CB  . SER A 250 ? 0.1301 0.1981 0.1488 -0.0221 -0.0128 -0.0017 389 SER A CB  
2041 O  OG  . SER A 250 ? 0.1433 0.2127 0.1649 -0.0163 -0.0110 -0.0017 389 SER A OG  
2042 N  N   . PHE A 251 ? 0.1531 0.2262 0.1734 -0.0187 -0.0113 -0.0014 390 PHE A N   
2043 C  CA  . PHE A 251 ? 0.2117 0.2930 0.2340 -0.0158 -0.0102 0.0003  390 PHE A CA  
2044 C  C   . PHE A 251 ? 0.2379 0.3157 0.2597 -0.0160 -0.0102 -0.0010 390 PHE A C   
2045 O  O   . PHE A 251 ? 0.2051 0.2735 0.2259 -0.0159 -0.0104 -0.0033 390 PHE A O   
2046 C  CB  . PHE A 251 ? 0.1656 0.2475 0.1901 -0.0096 -0.0084 0.0005  390 PHE A CB  
2047 C  CG  . PHE A 251 ? 0.1531 0.2244 0.1777 -0.0070 -0.0078 -0.0021 390 PHE A CG  
2048 C  CD1 . PHE A 251 ? 0.1050 0.1691 0.1289 -0.0079 -0.0083 -0.0036 390 PHE A CD1 
2049 C  CD2 . PHE A 251 ? 0.2732 0.3423 0.2985 -0.0037 -0.0069 -0.0027 390 PHE A CD2 
2050 C  CE1 . PHE A 251 ? 0.1454 0.2010 0.1694 -0.0058 -0.0079 -0.0055 390 PHE A CE1 
2051 C  CE2 . PHE A 251 ? 0.2779 0.3380 0.3031 -0.0018 -0.0066 -0.0047 390 PHE A CE2 
2052 C  CZ  . PHE A 251 ? 0.2056 0.2594 0.2303 -0.0029 -0.0071 -0.0060 390 PHE A CZ  
2053 N  N   . PRO A 252 ? 0.2457 0.3317 0.2683 -0.0159 -0.0099 0.0008  391 PRO A N   
2054 C  CA  . PRO A 252 ? 0.2954 0.3793 0.3175 -0.0164 -0.0099 -0.0001 391 PRO A CA  
2055 C  C   . PRO A 252 ? 0.4022 0.4818 0.4264 -0.0112 -0.0085 -0.0015 391 PRO A C   
2056 O  O   . PRO A 252 ? 0.4093 0.4855 0.4345 -0.0075 -0.0075 -0.0020 391 PRO A O   
2057 C  CB  . PRO A 252 ? 0.2823 0.3782 0.3049 -0.0181 -0.0100 0.0028  391 PRO A CB  
2058 C  CG  . PRO A 252 ? 0.2877 0.3922 0.3121 -0.0153 -0.0091 0.0052  391 PRO A CG  
2059 C  CD  . PRO A 252 ? 0.2698 0.3685 0.2935 -0.0159 -0.0096 0.0041  391 PRO A CD  
2060 N  N   . ALA A 253 ? 0.6578 0.7376 0.6822 -0.0112 -0.0083 -0.0018 392 ALA A N   
2061 C  CA  . ALA A 253 ? 0.8271 0.9010 0.8526 -0.0075 -0.0075 -0.0034 392 ALA A CA  
2062 C  C   . ALA A 253 ? 0.8778 0.9543 0.9052 -0.0022 -0.0059 -0.0025 392 ALA A C   
2063 O  O   . ALA A 253 ? 0.9530 1.0247 0.9804 0.0001  -0.0054 -0.0032 392 ALA A O   
2064 C  CB  . ALA A 253 ? 0.8668 0.9414 0.8920 -0.0089 -0.0078 -0.0037 392 ALA A CB  
2065 N  N   . GLY A 254 ? 0.8442 0.9277 0.8726 -0.0003 -0.0050 -0.0010 393 GLY A N   
2066 C  CA  . GLY A 254 ? 0.7985 0.8836 0.8274 0.0050  -0.0034 0.0000  393 GLY A CA  
2067 C  C   . GLY A 254 ? 0.7597 0.8366 0.7886 0.0079  -0.0029 -0.0017 393 GLY A C   
2068 O  O   . GLY A 254 ? 0.7206 0.7896 0.7492 0.0068  -0.0036 -0.0036 393 GLY A O   
2069 N  N   . VAL A 255 ? 0.7396 0.8188 0.7685 0.0117  -0.0017 -0.0008 394 VAL A N   
2070 C  CA  . VAL A 255 ? 0.6853 0.7574 0.7137 0.0141  -0.0014 -0.0019 394 VAL A CA  
2071 C  C   . VAL A 255 ? 0.7251 0.7918 0.7509 0.0177  -0.0006 -0.0019 394 VAL A C   
2072 O  O   . VAL A 255 ? 0.7214 0.7916 0.7458 0.0201  0.0003  -0.0004 394 VAL A O   
2073 C  CB  . VAL A 255 ? 0.5086 0.5851 0.5376 0.0161  -0.0006 -0.0010 394 VAL A CB  
2074 C  CG1 . VAL A 255 ? 0.4327 0.5132 0.4637 0.0123  -0.0015 -0.0013 394 VAL A CG1 
2075 C  CG2 . VAL A 255 ? 0.4924 0.5767 0.5205 0.0197  0.0009  0.0014  394 VAL A CG2 
2076 N  N   . ASP A 256 ? 0.7627 0.8208 0.7876 0.0180  -0.0011 -0.0033 395 ASP A N   
2077 C  CA  . ASP A 256 ? 0.8572 0.9086 0.8786 0.0209  -0.0007 -0.0033 395 ASP A CA  
2078 C  C   . ASP A 256 ? 0.8283 0.8792 0.8465 0.0254  0.0006  -0.0021 395 ASP A C   
2079 O  O   . ASP A 256 ? 0.7662 0.8119 0.7801 0.0284  0.0013  -0.0017 395 ASP A O   
2080 C  CB  . ASP A 256 ? 0.9391 0.9819 0.9600 0.0191  -0.0018 -0.0048 395 ASP A CB  
2081 C  CG  . ASP A 256 ? 1.0352 1.0768 1.0578 0.0158  -0.0027 -0.0058 395 ASP A CG  
2082 O  OD1 . ASP A 256 ? 1.0574 1.1024 1.0801 0.0155  -0.0025 -0.0053 395 ASP A OD1 
2083 O  OD2 . ASP A 256 ? 1.0729 1.1102 1.0963 0.0138  -0.0037 -0.0068 395 ASP A OD2 
2084 N  N   . SER A 257 ? 0.8147 0.8705 0.8345 0.0259  0.0010  -0.0015 396 SER A N   
2085 C  CA  . SER A 257 ? 0.8073 0.8622 0.8240 0.0302  0.0023  -0.0005 396 SER A CA  
2086 C  C   . SER A 257 ? 0.8046 0.8686 0.8238 0.0307  0.0030  0.0007  396 SER A C   
2087 O  O   . SER A 257 ? 0.8276 0.8976 0.8509 0.0272  0.0023  0.0005  396 SER A O   
2088 C  CB  . SER A 257 ? 0.7473 0.7927 0.7616 0.0301  0.0015  -0.0015 396 SER A CB  
2089 O  OG  . SER A 257 ? 0.6786 0.7240 0.6970 0.0261  0.0001  -0.0028 396 SER A OG  
2090 N  N   . SER A 258 ? 0.7483 0.8129 0.7647 0.0351  0.0044  0.0020  397 SER A N   
2091 C  CA  . SER A 258 ? 0.6991 0.7729 0.7178 0.0360  0.0053  0.0034  397 SER A CA  
2092 C  C   . SER A 258 ? 0.6482 0.7187 0.6631 0.0405  0.0065  0.0042  397 SER A C   
2093 O  O   . SER A 258 ? 0.6436 0.7089 0.6527 0.0450  0.0076  0.0049  397 SER A O   
2094 C  CB  . SER A 258 ? 0.7070 0.7919 0.7267 0.0369  0.0063  0.0056  397 SER A CB  
2095 O  OG  . SER A 258 ? 0.6856 0.7754 0.7094 0.0316  0.0049  0.0051  397 SER A OG  
2096 N  N   . PRO A 259 ? 0.5128 0.5858 0.5303 0.0396  0.0063  0.0040  398 PRO A N   
2097 C  CA  . PRO A 259 ? 0.4428 0.5135 0.4569 0.0437  0.0074  0.0049  398 PRO A CA  
2098 C  C   . PRO A 259 ? 0.5337 0.6113 0.5450 0.0489  0.0097  0.0075  398 PRO A C   
2099 O  O   . PRO A 259 ? 0.5768 0.6629 0.5901 0.0469  0.0099  0.0088  398 PRO A O   
2100 C  CB  . PRO A 259 ? 0.2733 0.3480 0.2923 0.0407  0.0066  0.0042  398 PRO A CB  
2101 C  CG  . PRO A 259 ? 0.3542 0.4362 0.3786 0.0361  0.0056  0.0038  398 PRO A CG  
2102 C  CD  . PRO A 259 ? 0.4416 0.5190 0.4648 0.0346  0.0049  0.0029  398 PRO A CD  
2103 N  N   . ARG A 260 ? 0.5576 0.6286 0.5623 0.0538  0.0109  0.0083  399 ARG A N   
2104 C  CA  . ARG A 260 ? 0.5978 0.6713 0.5971 0.0577  0.0127  0.0109  399 ARG A CA  
2105 C  C   . ARG A 260 ? 0.6233 0.7064 0.6256 0.0556  0.0128  0.0125  399 ARG A C   
2106 O  O   . ARG A 260 ? 0.6301 0.7210 0.6319 0.0559  0.0135  0.0148  399 ARG A O   
2107 C  CB  . ARG A 260 ? 0.6235 0.6864 0.6142 0.0631  0.0138  0.0112  399 ARG A CB  
2108 C  CG  . ARG A 260 ? 0.6047 0.6553 0.5909 0.0649  0.0133  0.0094  399 ARG A CG  
2109 C  CD  . ARG A 260 ? 0.6384 0.6879 0.6211 0.0669  0.0139  0.0101  399 ARG A CD  
2110 N  NE  . ARG A 260 ? 0.6483 0.6831 0.6240 0.0676  0.0132  0.0086  399 ARG A NE  
2111 C  CZ  . ARG A 260 ? 0.6399 0.6703 0.6106 0.0700  0.0137  0.0088  399 ARG A CZ  
2112 N  NH1 . ARG A 260 ? 0.6505 0.6908 0.6228 0.0720  0.0150  0.0106  399 ARG A NH1 
2113 N  NH2 . ARG A 260 ? 0.4932 0.5092 0.4571 0.0693  0.0126  0.0075  399 ARG A NH2 
2114 N  N   . TRP B 2   ? 0.1561 0.1768 0.1823 0.0060  -0.0085 -0.0070 141 TRP B N   
2115 C  CA  . TRP B 2   ? 0.1629 0.1866 0.1907 0.0065  -0.0085 -0.0068 141 TRP B CA  
2116 C  C   . TRP B 2   ? 0.1476 0.1717 0.1755 0.0060  -0.0093 -0.0052 141 TRP B C   
2117 O  O   . TRP B 2   ? 0.1568 0.1787 0.1832 0.0049  -0.0099 -0.0041 141 TRP B O   
2118 C  CB  . TRP B 2   ? 0.1743 0.2001 0.2026 0.0075  -0.0082 -0.0070 141 TRP B CB  
2119 C  CG  . TRP B 2   ? 0.1316 0.1556 0.1582 0.0078  -0.0085 -0.0062 141 TRP B CG  
2120 C  CD1 . TRP B 2   ? 0.1410 0.1628 0.1655 0.0086  -0.0081 -0.0064 141 TRP B CD1 
2121 C  CD2 . TRP B 2   ? 0.1066 0.1302 0.1327 0.0075  -0.0093 -0.0048 141 TRP B CD2 
2122 N  NE1 . TRP B 2   ? 0.1499 0.1689 0.1719 0.0089  -0.0085 -0.0054 141 TRP B NE1 
2123 C  CE2 . TRP B 2   ? 0.1096 0.1297 0.1326 0.0079  -0.0094 -0.0044 141 TRP B CE2 
2124 C  CE3 . TRP B 2   ? 0.1506 0.1767 0.1782 0.0070  -0.0100 -0.0037 141 TRP B CE3 
2125 C  CZ2 . TRP B 2   ? 0.1349 0.1531 0.1559 0.0072  -0.0104 -0.0031 141 TRP B CZ2 
2126 C  CZ3 . TRP B 2   ? 0.1477 0.1733 0.1741 0.0063  -0.0109 -0.0022 141 TRP B CZ3 
2127 C  CH2 . TRP B 2   ? 0.1188 0.1401 0.1418 0.0061  -0.0112 -0.0019 141 TRP B CH2 
2128 N  N   . ARG B 3   ? 0.1518 0.1788 0.1810 0.0068  -0.0093 -0.0047 142 ARG B N   
2129 C  CA  . ARG B 3   ? 0.1323 0.1614 0.1618 0.0065  -0.0100 -0.0027 142 ARG B CA  
2130 C  C   . ARG B 3   ? 0.1738 0.2064 0.2046 0.0076  -0.0101 -0.0022 142 ARG B C   
2131 O  O   . ARG B 3   ? 0.1690 0.2022 0.2004 0.0088  -0.0094 -0.0036 142 ARG B O   
2132 C  CB  . ARG B 3   ? 0.1408 0.1708 0.1703 0.0068  -0.0098 -0.0019 142 ARG B CB  
2133 C  CG  . ARG B 3   ? 0.1437 0.1750 0.1733 0.0089  -0.0090 -0.0027 142 ARG B CG  
2134 C  CD  . ARG B 3   ? 0.1651 0.1964 0.1938 0.0097  -0.0086 -0.0019 142 ARG B CD  
2135 N  NE  . ARG B 3   ? 0.1570 0.1845 0.1847 0.0087  -0.0083 -0.0032 142 ARG B NE  
2136 C  CZ  . ARG B 3   ? 0.1655 0.1920 0.1919 0.0094  -0.0079 -0.0029 142 ARG B CZ  
2137 N  NH1 . ARG B 3   ? 0.1776 0.2068 0.2035 0.0114  -0.0075 -0.0012 142 ARG B NH1 
2138 N  NH2 . ARG B 3   ? 0.1688 0.1920 0.1945 0.0083  -0.0077 -0.0042 142 ARG B NH2 
2139 N  N   . TYR B 4   ? 0.1416 0.1764 0.1727 0.0070  -0.0110 -0.0002 143 TYR B N   
2140 C  CA  . TYR B 4   ? 0.1408 0.1794 0.1732 0.0081  -0.0111 0.0005  143 TYR B CA  
2141 C  C   . TYR B 4   ? 0.1752 0.2162 0.2083 0.0103  -0.0103 0.0003  143 TYR B C   
2142 O  O   . TYR B 4   ? 0.1951 0.2364 0.2276 0.0107  -0.0101 0.0010  143 TYR B O   
2143 C  CB  . TYR B 4   ? 0.1376 0.1786 0.1699 0.0067  -0.0124 0.0031  143 TYR B CB  
2144 C  CG  . TYR B 4   ? 0.1264 0.1637 0.1568 0.0051  -0.0131 0.0030  143 TYR B CG  
2145 C  CD1 . TYR B 4   ? 0.1570 0.1897 0.1845 0.0030  -0.0138 0.0034  143 TYR B CD1 
2146 C  CD2 . TYR B 4   ? 0.1245 0.1623 0.1553 0.0059  -0.0130 0.0025  143 TYR B CD2 
2147 C  CE1 . TYR B 4   ? 0.1129 0.1407 0.1371 0.0020  -0.0143 0.0033  143 TYR B CE1 
2148 C  CE2 . TYR B 4   ? 0.1273 0.1609 0.1554 0.0050  -0.0135 0.0025  143 TYR B CE2 
2149 C  CZ  . TYR B 4   ? 0.1216 0.1499 0.1461 0.0032  -0.0141 0.0029  143 TYR B CZ  
2150 O  OH  . TYR B 4   ? 0.1120 0.1349 0.1324 0.0027  -0.0145 0.0028  143 TYR B OH  
2151 N  N   . GLY B 5   ? 0.2052 0.2474 0.2389 0.0118  -0.0097 -0.0008 144 GLY B N   
2152 C  CA  . GLY B 5   ? 0.2554 0.2983 0.2883 0.0140  -0.0090 -0.0013 144 GLY B CA  
2153 C  C   . GLY B 5   ? 0.2964 0.3349 0.3273 0.0140  -0.0082 -0.0035 144 GLY B C   
2154 O  O   . GLY B 5   ? 0.3388 0.3759 0.3675 0.0157  -0.0076 -0.0041 144 GLY B O   
2155 N  N   . GLY B 6   ? 0.2388 0.2746 0.2696 0.0122  -0.0083 -0.0046 145 GLY B N   
2156 C  CA  . GLY B 6   ? 0.2312 0.2633 0.2602 0.0116  -0.0078 -0.0063 145 GLY B CA  
2157 C  C   . GLY B 6   ? 0.3138 0.3455 0.3421 0.0112  -0.0075 -0.0080 145 GLY B C   
2158 O  O   . GLY B 6   ? 0.2942 0.3285 0.3238 0.0116  -0.0076 -0.0079 145 GLY B O   
2159 N  N   . ASP B 7   ? 0.2598 0.2883 0.2859 0.0102  -0.0073 -0.0093 146 ASP B N   
2160 C  CA  . ASP B 7   ? 0.3189 0.3472 0.3438 0.0090  -0.0072 -0.0106 146 ASP B CA  
2161 C  C   . ASP B 7   ? 0.2913 0.3189 0.3161 0.0069  -0.0073 -0.0113 146 ASP B C   
2162 O  O   . ASP B 7   ? 0.2557 0.2812 0.2801 0.0066  -0.0073 -0.0112 146 ASP B O   
2163 C  CB  A ASP B 7   ? 0.4135 0.4383 0.4342 0.0094  -0.0071 -0.0114 146 ASP B CB  
2164 C  CB  B ASP B 7   ? 0.4178 0.4425 0.4384 0.0094  -0.0071 -0.0114 146 ASP B CB  
2165 C  CG  A ASP B 7   ? 0.5082 0.5346 0.5289 0.0115  -0.0069 -0.0109 146 ASP B CG  
2166 C  CG  B ASP B 7   ? 0.5098 0.5354 0.5301 0.0121  -0.0068 -0.0106 146 ASP B CG  
2167 O  OD1 A ASP B 7   ? 0.5466 0.5759 0.5687 0.0111  -0.0070 -0.0111 146 ASP B OD1 
2168 O  OD1 B ASP B 7   ? 0.5415 0.5702 0.5634 0.0127  -0.0069 -0.0103 146 ASP B OD1 
2169 O  OD2 A ASP B 7   ? 0.5507 0.5760 0.5698 0.0139  -0.0066 -0.0102 146 ASP B OD2 
2170 O  OD2 B ASP B 7   ? 0.5322 0.5556 0.5505 0.0139  -0.0065 -0.0100 146 ASP B OD2 
2171 N  N   . PRO B 8   ? 0.2477 0.2776 0.2727 0.0056  -0.0073 -0.0117 147 PRO B N   
2172 C  CA  . PRO B 8   ? 0.2452 0.2781 0.2706 0.0056  -0.0073 -0.0118 147 PRO B CA  
2173 C  C   . PRO B 8   ? 0.3024 0.3392 0.3313 0.0071  -0.0071 -0.0108 147 PRO B C   
2174 O  O   . PRO B 8   ? 0.2681 0.3045 0.2983 0.0078  -0.0070 -0.0102 147 PRO B O   
2175 C  CB  . PRO B 8   ? 0.3016 0.3360 0.3258 0.0031  -0.0074 -0.0122 147 PRO B CB  
2176 C  CG  . PRO B 8   ? 0.3833 0.4176 0.4082 0.0025  -0.0074 -0.0120 147 PRO B CG  
2177 C  CD  . PRO B 8   ? 0.2940 0.3242 0.3186 0.0037  -0.0074 -0.0120 147 PRO B CD  
2178 N  N   . PRO B 9   ? 0.2913 0.3310 0.3210 0.0075  -0.0070 -0.0107 148 PRO B N   
2179 C  CA  . PRO B 9   ? 0.2210 0.2640 0.2534 0.0089  -0.0068 -0.0098 148 PRO B CA  
2180 C  C   . PRO B 9   ? 0.2418 0.2863 0.2750 0.0090  -0.0064 -0.0094 148 PRO B C   
2181 O  O   . PRO B 9   ? 0.2150 0.2605 0.2473 0.0078  -0.0062 -0.0096 148 PRO B O   
2182 C  CB  . PRO B 9   ? 0.2440 0.2904 0.2769 0.0089  -0.0067 -0.0100 148 PRO B CB  
2183 C  CG  . PRO B 9   ? 0.3159 0.3592 0.3460 0.0082  -0.0069 -0.0108 148 PRO B CG  
2184 C  CD  . PRO B 9   ? 0.3197 0.3592 0.3474 0.0068  -0.0071 -0.0114 148 PRO B CD  
2185 N  N   . TRP B 10  ? 0.1956 0.2400 0.2297 0.0104  -0.0064 -0.0085 149 TRP B N   
2186 C  CA  . TRP B 10  ? 0.1795 0.2238 0.2129 0.0112  -0.0059 -0.0080 149 TRP B CA  
2187 C  C   . TRP B 10  ? 0.1728 0.2218 0.2064 0.0115  -0.0051 -0.0078 149 TRP B C   
2188 O  O   . TRP B 10  ? 0.2102 0.2595 0.2428 0.0119  -0.0047 -0.0075 149 TRP B O   
2189 C  CB  . TRP B 10  ? 0.2411 0.2837 0.2741 0.0126  -0.0061 -0.0071 149 TRP B CB  
2190 C  CG  . TRP B 10  ? 0.2429 0.2814 0.2751 0.0119  -0.0069 -0.0067 149 TRP B CG  
2191 C  CD1 . TRP B 10  ? 0.1960 0.2324 0.2279 0.0108  -0.0073 -0.0070 149 TRP B CD1 
2192 C  CD2 . TRP B 10  ? 0.1705 0.2070 0.2018 0.0121  -0.0076 -0.0055 149 TRP B CD2 
2193 N  NE1 . TRP B 10  ? 0.1959 0.2299 0.2272 0.0103  -0.0081 -0.0060 149 TRP B NE1 
2194 C  CE2 . TRP B 10  ? 0.1611 0.1951 0.1919 0.0108  -0.0084 -0.0051 149 TRP B CE2 
2195 C  CE3 . TRP B 10  ? 0.1672 0.2039 0.1979 0.0130  -0.0077 -0.0047 149 TRP B CE3 
2196 C  CZ2 . TRP B 10  ? 0.1987 0.2308 0.2283 0.0100  -0.0094 -0.0036 149 TRP B CZ2 
2197 C  CZ3 . TRP B 10  ? 0.1378 0.1716 0.1669 0.0122  -0.0088 -0.0035 149 TRP B CZ3 
2198 C  CH2 . TRP B 10  ? 0.1695 0.2013 0.1981 0.0105  -0.0097 -0.0029 149 TRP B CH2 
2199 N  N   . PRO B 11  ? 0.2056 0.2587 0.2404 0.0116  -0.0049 -0.0077 150 PRO B N   
2200 C  CA  . PRO B 11  ? 0.2513 0.3100 0.2865 0.0120  -0.0041 -0.0069 150 PRO B CA  
2201 C  C   . PRO B 11  ? 0.2801 0.3412 0.3144 0.0101  -0.0041 -0.0070 150 PRO B C   
2202 O  O   . PRO B 11  ? 0.2697 0.3359 0.3041 0.0108  -0.0034 -0.0058 150 PRO B O   
2203 C  CB  . PRO B 11  ? 0.2103 0.2729 0.2470 0.0117  -0.0041 -0.0069 150 PRO B CB  
2204 C  CG  . PRO B 11  ? 0.2132 0.2722 0.2504 0.0125  -0.0046 -0.0072 150 PRO B CG  
2205 C  CD  . PRO B 11  ? 0.1877 0.2414 0.2238 0.0116  -0.0053 -0.0078 150 PRO B CD  
2206 N  N   . ARG B 12  ? 0.2758 0.3337 0.3092 0.0077  -0.0049 -0.0079 151 ARG B N   
2207 C  CA  . ARG B 12  ? 0.3474 0.4075 0.3797 0.0053  -0.0051 -0.0078 151 ARG B CA  
2208 C  C   . ARG B 12  ? 0.3473 0.4083 0.3793 0.0066  -0.0046 -0.0070 151 ARG B C   
2209 O  O   . ARG B 12  ? 0.4243 0.4910 0.4562 0.0060  -0.0042 -0.0059 151 ARG B O   
2210 C  CB  . ARG B 12  ? 0.4319 0.4869 0.4622 0.0028  -0.0061 -0.0091 151 ARG B CB  
2211 C  CG  . ARG B 12  ? 0.5540 0.6082 0.5833 0.0015  -0.0066 -0.0098 151 ARG B CG  
2212 C  CD  . ARG B 12  ? 0.6361 0.6886 0.6618 -0.0022 -0.0074 -0.0103 151 ARG B CD  
2213 N  NE  . ARG B 12  ? 0.7330 0.7791 0.7565 -0.0027 -0.0078 -0.0112 151 ARG B NE  
2214 C  CZ  . ARG B 12  ? 0.7450 0.7892 0.7654 -0.0057 -0.0085 -0.0114 151 ARG B CZ  
2215 N  NH1 . ARG B 12  ? 0.7801 0.8288 0.7993 -0.0088 -0.0090 -0.0106 151 ARG B NH1 
2216 N  NH2 . ARG B 12  ? 0.6869 0.7250 0.7053 -0.0058 -0.0088 -0.0122 151 ARG B NH2 
2217 N  N   . VAL B 13  ? 0.2336 0.2894 0.2652 0.0083  -0.0045 -0.0074 152 VAL B N   
2218 C  CA  . VAL B 13  ? 0.3221 0.3773 0.3526 0.0098  -0.0040 -0.0067 152 VAL B CA  
2219 C  C   . VAL B 13  ? 0.2767 0.3319 0.3065 0.0134  -0.0030 -0.0058 152 VAL B C   
2220 O  O   . VAL B 13  ? 0.2556 0.3119 0.2838 0.0156  -0.0022 -0.0048 152 VAL B O   
2221 C  CB  . VAL B 13  ? 0.4022 0.4510 0.4318 0.0089  -0.0046 -0.0077 152 VAL B CB  
2222 C  CG1 . VAL B 13  ? 0.4017 0.4487 0.4298 0.0109  -0.0040 -0.0071 152 VAL B CG1 
2223 C  CG2 . VAL B 13  ? 0.4523 0.5013 0.4817 0.0058  -0.0053 -0.0083 152 VAL B CG2 
2224 N  N   . SER B 14  ? 0.2542 0.3078 0.2844 0.0143  -0.0031 -0.0059 153 SER B N   
2225 C  CA  . SER B 14  ? 0.2058 0.2581 0.2343 0.0176  -0.0023 -0.0051 153 SER B CA  
2226 C  C   . SER B 14  ? 0.1876 0.2449 0.2177 0.0184  -0.0019 -0.0045 153 SER B C   
2227 O  O   . SER B 14  ? 0.1876 0.2432 0.2187 0.0180  -0.0024 -0.0049 153 SER B O   
2228 C  CB  A SER B 14  ? 0.2147 0.2593 0.2416 0.0177  -0.0030 -0.0055 153 SER B CB  
2229 C  CB  B SER B 14  ? 0.2130 0.2577 0.2399 0.0177  -0.0030 -0.0055 153 SER B CB  
2230 O  OG  A SER B 14  ? 0.2209 0.2614 0.2469 0.0163  -0.0036 -0.0061 153 SER B OG  
2231 O  OG  B SER B 14  ? 0.2188 0.2608 0.2429 0.0204  -0.0025 -0.0047 153 SER B OG  
2232 N  N   . PRO B 15  ? 0.1778 0.2421 0.2082 0.0195  -0.0009 -0.0034 154 PRO B N   
2233 C  CA  . PRO B 15  ? 0.1474 0.2179 0.1796 0.0197  -0.0004 -0.0027 154 PRO B CA  
2234 C  C   . PRO B 15  ? 0.1464 0.2147 0.1777 0.0226  0.0001  -0.0023 154 PRO B C   
2235 O  O   . PRO B 15  ? 0.1732 0.2450 0.2066 0.0221  0.0001  -0.0022 154 PRO B O   
2236 C  CB  . PRO B 15  ? 0.2303 0.3090 0.2623 0.0209  0.0007  -0.0009 154 PRO B CB  
2237 C  CG  . PRO B 15  ? 0.2706 0.3481 0.3017 0.0196  0.0003  -0.0011 154 PRO B CG  
2238 C  CD  . PRO B 15  ? 0.2625 0.3302 0.2918 0.0200  -0.0003 -0.0024 154 PRO B CD  
2239 N  N   . ALA B 16  ? 0.1480 0.2105 0.1758 0.0253  0.0005  -0.0020 155 ALA B N   
2240 C  CA  . ALA B 16  ? 0.1645 0.2236 0.1904 0.0277  0.0008  -0.0015 155 ALA B CA  
2241 C  C   . ALA B 16  ? 0.1799 0.2356 0.2077 0.0253  -0.0006 -0.0026 155 ALA B C   
2242 O  O   . ALA B 16  ? 0.1487 0.2040 0.1763 0.0263  -0.0006 -0.0022 155 ALA B O   
2243 C  CB  . ALA B 16  ? 0.1916 0.2432 0.2118 0.0307  0.0013  -0.0010 155 ALA B CB  
2244 N  N   . CYS B 17  ? 0.1242 0.1780 0.1537 0.0222  -0.0018 -0.0037 156 CYS B N   
2245 C  CA  . CYS B 17  ? 0.1495 0.2011 0.1807 0.0203  -0.0030 -0.0043 156 CYS B CA  
2246 C  C   . CYS B 17  ? 0.1354 0.1927 0.1699 0.0197  -0.0030 -0.0044 156 CYS B C   
2247 O  O   . CYS B 17  ? 0.1451 0.2016 0.1809 0.0190  -0.0038 -0.0045 156 CYS B O   
2248 C  CB  . CYS B 17  ? 0.1391 0.1877 0.1708 0.0178  -0.0040 -0.0052 156 CYS B CB  
2249 S  SG  . CYS B 17  ? 0.1647 0.2060 0.1927 0.0180  -0.0044 -0.0050 156 CYS B SG  
2250 N  N   . ALA B 18  ? 0.1269 0.1905 0.1627 0.0200  -0.0021 -0.0041 157 ALA B N   
2251 C  CA  . ALA B 18  ? 0.1882 0.2573 0.2266 0.0192  -0.0021 -0.0041 157 ALA B CA  
2252 C  C   . ALA B 18  ? 0.1465 0.2186 0.1848 0.0219  -0.0011 -0.0029 157 ALA B C   
2253 O  O   . ALA B 18  ? 0.1507 0.2283 0.1912 0.0217  -0.0008 -0.0027 157 ALA B O   
2254 C  CB  . ALA B 18  ? 0.1754 0.2499 0.2148 0.0172  -0.0019 -0.0042 157 ALA B CB  
2255 N  N   . GLY B 19  ? 0.1257 0.1937 0.1609 0.0246  -0.0006 -0.0022 158 GLY B N   
2256 C  CA  . GLY B 19  ? 0.1293 0.1989 0.1633 0.0276  0.0005  -0.0011 158 GLY B CA  
2257 C  C   . GLY B 19  ? 0.0835 0.1533 0.1193 0.0273  -0.0002 -0.0012 158 GLY B C   
2258 O  O   . GLY B 19  ? 0.1157 0.1831 0.1531 0.0250  -0.0015 -0.0020 158 GLY B O   
2259 N  N   . ARG B 20  ? 0.0842 0.1571 0.1197 0.0298  0.0009  -0.0001 159 ARG B N   
2260 C  CA  . ARG B 20  ? 0.0878 0.1604 0.1244 0.0290  0.0004  0.0000  159 ARG B CA  
2261 C  C   . ARG B 20  ? 0.1053 0.1714 0.1391 0.0304  -0.0004 0.0003  159 ARG B C   
2262 O  O   . ARG B 20  ? 0.1371 0.2034 0.1723 0.0297  -0.0012 0.0005  159 ARG B O   
2263 C  CB  . ARG B 20  ? 0.1388 0.2143 0.1744 0.0296  0.0018  0.0010  159 ARG B CB  
2264 C  CG  . ARG B 20  ? 0.1620 0.2422 0.1993 0.0267  0.0020  0.0009  159 ARG B CG  
2265 C  CD  . ARG B 20  ? 0.1441 0.2278 0.1796 0.0279  0.0034  0.0024  159 ARG B CD  
2266 N  NE  . ARG B 20  ? 0.1277 0.2116 0.1598 0.0314  0.0047  0.0036  159 ARG B NE  
2267 C  CZ  . ARG B 20  ? 0.0991 0.1840 0.1281 0.0343  0.0060  0.0051  159 ARG B CZ  
2268 N  NH1 . ARG B 20  ? 0.1294 0.2138 0.1545 0.0379  0.0072  0.0063  159 ARG B NH1 
2269 N  NH2 . ARG B 20  ? 0.1367 0.2229 0.1660 0.0337  0.0062  0.0056  159 ARG B NH2 
2270 N  N   . PHE B 21  ? 0.1202 0.1793 0.1489 0.0316  -0.0003 0.0006  160 PHE B N   
2271 C  CA  . PHE B 21  ? 0.0999 0.1507 0.1235 0.0323  -0.0010 0.0012  160 PHE B CA  
2272 C  C   . PHE B 21  ? 0.1081 0.1512 0.1286 0.0301  -0.0024 0.0008  160 PHE B C   
2273 O  O   . PHE B 21  ? 0.1447 0.1804 0.1590 0.0315  -0.0022 0.0012  160 PHE B O   
2274 C  CB  . PHE B 21  ? 0.1383 0.1868 0.1565 0.0367  0.0007  0.0023  160 PHE B CB  
2275 C  CG  . PHE B 21  ? 0.1287 0.1858 0.1502 0.0388  0.0021  0.0030  160 PHE B CG  
2276 C  CD1 . PHE B 21  ? 0.1511 0.2143 0.1726 0.0419  0.0042  0.0038  160 PHE B CD1 
2277 C  CD2 . PHE B 21  ? 0.1370 0.1972 0.1619 0.0376  0.0014  0.0030  160 PHE B CD2 
2278 C  CE1 . PHE B 21  ? 0.1692 0.2380 0.1922 0.0415  0.0052  0.0045  160 PHE B CE1 
2279 C  CE2 . PHE B 21  ? 0.1695 0.2365 0.1969 0.0385  0.0027  0.0036  160 PHE B CE2 
2280 C  CZ  . PHE B 21  ? 0.1465 0.2163 0.1721 0.0395  0.0044  0.0043  160 PHE B CZ  
2281 N  N   . GLN B 22  ? 0.1074 0.1524 0.1321 0.0268  -0.0038 0.0002  161 GLN B N   
2282 C  CA  . GLN B 22  ? 0.0810 0.1210 0.1043 0.0243  -0.0051 -0.0001 161 GLN B CA  
2283 C  C   . GLN B 22  ? 0.1102 0.1451 0.1311 0.0221  -0.0070 0.0008  161 GLN B C   
2284 O  O   . GLN B 22  ? 0.1113 0.1475 0.1328 0.0220  -0.0075 0.0016  161 GLN B O   
2285 C  CB  . GLN B 22  ? 0.1101 0.1554 0.1386 0.0224  -0.0053 -0.0011 161 GLN B CB  
2286 C  CG  . GLN B 22  ? 0.1102 0.1601 0.1404 0.0236  -0.0038 -0.0019 161 GLN B CG  
2287 C  CD  . GLN B 22  ? 0.1183 0.1638 0.1451 0.0240  -0.0035 -0.0020 161 GLN B CD  
2288 O  OE1 . GLN B 22  ? 0.1165 0.1592 0.1434 0.0220  -0.0044 -0.0026 161 GLN B OE1 
2289 N  NE2 . GLN B 22  ? 0.1061 0.1511 0.1296 0.0270  -0.0021 -0.0015 161 GLN B NE2 
2290 N  N   . SER B 23  ? 0.0981 0.1277 0.1163 0.0200  -0.0081 0.0009  162 SER B N   
2291 C  CA  . SER B 23  ? 0.1167 0.1424 0.1327 0.0169  -0.0102 0.0022  162 SER B CA  
2292 C  C   . SER B 23  ? 0.1045 0.1334 0.1245 0.0145  -0.0110 0.0020  162 SER B C   
2293 O  O   . SER B 23  ? 0.1279 0.1586 0.1500 0.0151  -0.0101 0.0008  162 SER B O   
2294 C  CB  . SER B 23  ? 0.0912 0.1064 0.0987 0.0164  -0.0109 0.0029  162 SER B CB  
2295 O  OG  . SER B 23  ? 0.1154 0.1268 0.1183 0.0192  -0.0100 0.0032  162 SER B OG  
2296 N  N   . PRO B 24  ? 0.0840 0.1141 0.1048 0.0118  -0.0128 0.0034  163 PRO B N   
2297 C  CA  . PRO B 24  ? 0.0880 0.1165 0.1064 0.0102  -0.0143 0.0052  163 PRO B CA  
2298 C  C   . PRO B 24  ? 0.1015 0.1370 0.1246 0.0116  -0.0139 0.0052  163 PRO B C   
2299 O  O   . PRO B 24  ? 0.1094 0.1506 0.1373 0.0134  -0.0125 0.0039  163 PRO B O   
2300 C  CB  . PRO B 24  ? 0.1053 0.1348 0.1239 0.0066  -0.0163 0.0069  163 PRO B CB  
2301 C  CG  . PRO B 24  ? 0.1199 0.1559 0.1445 0.0076  -0.0153 0.0058  163 PRO B CG  
2302 C  CD  . PRO B 24  ? 0.1028 0.1365 0.1270 0.0101  -0.0134 0.0035  163 PRO B CD  
2303 N  N   . VAL B 25  ? 0.0869 0.1214 0.1079 0.0104  -0.0151 0.0068  164 VAL B N   
2304 C  CA  . VAL B 25  ? 0.0830 0.1239 0.1082 0.0116  -0.0149 0.0071  164 VAL B CA  
2305 C  C   . VAL B 25  ? 0.0670 0.1105 0.0926 0.0086  -0.0171 0.0095  164 VAL B C   
2306 O  O   . VAL B 25  ? 0.1044 0.1437 0.1259 0.0054  -0.0189 0.0111  164 VAL B O   
2307 C  CB  . VAL B 25  ? 0.1173 0.1551 0.1395 0.0140  -0.0138 0.0067  164 VAL B CB  
2308 C  CG1 . VAL B 25  ? 0.1232 0.1600 0.1451 0.0172  -0.0116 0.0048  164 VAL B CG1 
2309 C  CG2 . VAL B 25  ? 0.1069 0.1354 0.1210 0.0124  -0.0152 0.0081  164 VAL B CG2 
2310 N  N   . ASP B 26  ? 0.1079 0.1587 0.1383 0.0095  -0.0170 0.0098  165 ASP B N   
2311 C  CA  . ASP B 26  ? 0.1174 0.1720 0.1486 0.0072  -0.0190 0.0123  165 ASP B CA  
2312 C  C   . ASP B 26  ? 0.1216 0.1709 0.1478 0.0065  -0.0198 0.0133  165 ASP B C   
2313 O  O   . ASP B 26  ? 0.1557 0.2041 0.1820 0.0093  -0.0182 0.0119  165 ASP B O   
2314 C  CB  . ASP B 26  ? 0.0837 0.1481 0.1218 0.0089  -0.0184 0.0123  165 ASP B CB  
2315 C  CG  . ASP B 26  ? 0.1244 0.1943 0.1637 0.0068  -0.0204 0.0152  165 ASP B CG  
2316 O  OD1 . ASP B 26  ? 0.1580 0.2318 0.1999 0.0080  -0.0200 0.0152  165 ASP B OD1 
2317 O  OD2 . ASP B 26  ? 0.1089 0.1786 0.1462 0.0038  -0.0222 0.0174  165 ASP B OD2 
2318 N  N   . ILE B 27  ? 0.1123 0.1578 0.1337 0.0026  -0.0222 0.0157  166 ILE B N   
2319 C  CA  . ILE B 27  ? 0.1192 0.1583 0.1345 0.0012  -0.0234 0.0169  166 ILE B CA  
2320 C  C   . ILE B 27  ? 0.1250 0.1716 0.1437 -0.0003 -0.0248 0.0191  166 ILE B C   
2321 O  O   . ILE B 27  ? 0.1583 0.2113 0.1796 -0.0030 -0.0265 0.0213  166 ILE B O   
2322 C  CB  . ILE B 27  ? 0.1489 0.1781 0.1552 -0.0030 -0.0255 0.0185  166 ILE B CB  
2323 C  CG1 . ILE B 27  ? 0.1531 0.1746 0.1555 -0.0014 -0.0241 0.0165  166 ILE B CG1 
2324 C  CG2 . ILE B 27  ? 0.1926 0.2139 0.1912 -0.0046 -0.0269 0.0198  166 ILE B CG2 
2325 C  CD1 . ILE B 27  ? 0.1597 0.1723 0.1540 -0.0058 -0.0262 0.0180  166 ILE B CD1 
2326 N  N   . ARG B 28  ? 0.1379 0.1843 0.1566 0.0018  -0.0240 0.0186  167 ARG B N   
2327 C  CA  . ARG B 28  ? 0.1591 0.2123 0.1808 0.0005  -0.0254 0.0206  167 ARG B CA  
2328 C  C   . ARG B 28  ? 0.1610 0.2057 0.1747 -0.0017 -0.0270 0.0221  167 ARG B C   
2329 O  O   . ARG B 28  ? 0.1962 0.2368 0.2078 0.0013  -0.0255 0.0207  167 ARG B O   
2330 C  CB  . ARG B 28  ? 0.1799 0.2417 0.2094 0.0047  -0.0233 0.0190  167 ARG B CB  
2331 C  CG  . ARG B 28  ? 0.2128 0.2814 0.2487 0.0067  -0.0219 0.0175  167 ARG B CG  
2332 C  CD  . ARG B 28  ? 0.2513 0.3259 0.2930 0.0100  -0.0197 0.0155  167 ARG B CD  
2333 N  NE  . ARG B 28  ? 0.2434 0.3194 0.2854 0.0085  -0.0198 0.0162  167 ARG B NE  
2334 C  CZ  . ARG B 28  ? 0.2507 0.3270 0.2947 0.0100  -0.0177 0.0143  167 ARG B CZ  
2335 N  NH1 . ARG B 28  ? 0.2694 0.3443 0.3149 0.0123  -0.0155 0.0116  167 ARG B NH1 
2336 N  NH2 . ARG B 28  ? 0.2490 0.3267 0.2929 0.0088  -0.0180 0.0152  167 ARG B NH2 
2337 N  N   . PRO B 29  ? 0.2088 0.2504 0.2173 -0.0070 -0.0301 0.0250  168 PRO B N   
2338 C  CA  . PRO B 29  ? 0.1965 0.2269 0.1948 -0.0098 -0.0318 0.0264  168 PRO B CA  
2339 C  C   . PRO B 29  ? 0.2683 0.3003 0.2673 -0.0082 -0.0316 0.0267  168 PRO B C   
2340 O  O   . PRO B 29  ? 0.2711 0.2922 0.2617 -0.0078 -0.0316 0.0264  168 PRO B O   
2341 C  CB  . PRO B 29  ? 0.2540 0.2852 0.2490 -0.0165 -0.0354 0.0300  168 PRO B CB  
2342 C  CG  . PRO B 29  ? 0.2690 0.3060 0.2691 -0.0164 -0.0348 0.0296  168 PRO B CG  
2343 C  CD  . PRO B 29  ? 0.2019 0.2491 0.2124 -0.0108 -0.0319 0.0272  168 PRO B CD  
2344 N  N   . GLN B 30  ? 0.2889 0.3338 0.2973 -0.0069 -0.0313 0.0271  169 GLN B N   
2345 C  CA  . GLN B 30  ? 0.3660 0.4136 0.3761 -0.0053 -0.0310 0.0274  169 GLN B CA  
2346 C  C   . GLN B 30  ? 0.2940 0.3389 0.3049 0.0006  -0.0276 0.0243  169 GLN B C   
2347 O  O   . GLN B 30  ? 0.3217 0.3646 0.3307 0.0021  -0.0272 0.0243  169 GLN B O   
2348 C  CB  A GLN B 30  ? 0.3984 0.4611 0.4184 -0.0053 -0.0315 0.0288  169 GLN B CB  
2349 C  CB  B GLN B 30  ? 0.3958 0.4586 0.4160 -0.0052 -0.0314 0.0287  169 GLN B CB  
2350 C  CG  A GLN B 30  ? 0.4212 0.4884 0.4403 -0.0110 -0.0350 0.0328  169 GLN B CG  
2351 C  CG  B GLN B 30  ? 0.3684 0.4397 0.3977 -0.0001 -0.0284 0.0260  169 GLN B CG  
2352 C  CD  A GLN B 30  ? 0.4894 0.5558 0.5053 -0.0137 -0.0370 0.0352  169 GLN B CD  
2353 C  CD  B GLN B 30  ? 0.3389 0.4168 0.3735 -0.0002 -0.0266 0.0252  169 GLN B CD  
2354 O  OE1 A GLN B 30  ? 0.5457 0.6016 0.5543 -0.0135 -0.0369 0.0345  169 GLN B OE1 
2355 O  OE1 B GLN B 30  ? 0.1974 0.2763 0.2346 0.0015  -0.0246 0.0231  169 GLN B OE1 
2356 N  NE2 A GLN B 30  ? 0.4938 0.5661 0.5133 -0.0152 -0.0357 0.0358  169 GLN B NE2 
2357 N  NE2 B GLN B 30  ? 0.3308 0.4104 0.3652 -0.0018 -0.0269 0.0265  169 GLN B NE2 
2358 N  N   . LEU B 31  ? 0.2419 0.2872 0.2555 0.0037  -0.0253 0.0218  170 LEU B N   
2359 C  CA  . LEU B 31  ? 0.2422 0.2869 0.2572 0.0091  -0.0221 0.0192  170 LEU B CA  
2360 C  C   . LEU B 31  ? 0.1934 0.2255 0.1992 0.0107  -0.0210 0.0181  170 LEU B C   
2361 O  O   . LEU B 31  ? 0.2896 0.3208 0.2955 0.0153  -0.0184 0.0163  170 LEU B O   
2362 C  CB  . LEU B 31  ? 0.3017 0.3560 0.3258 0.0117  -0.0202 0.0172  170 LEU B CB  
2363 C  CG  . LEU B 31  ? 0.3656 0.4325 0.3989 0.0121  -0.0202 0.0175  170 LEU B CG  
2364 C  CD1 . LEU B 31  ? 0.3050 0.3782 0.3447 0.0147  -0.0182 0.0153  170 LEU B CD1 
2365 C  CD2 . LEU B 31  ? 0.3924 0.4616 0.4268 0.0141  -0.0195 0.0177  170 LEU B CD2 
2366 N  N   . ALA B 32  ? 0.1679 0.1905 0.1656 0.0071  -0.0231 0.0193  171 ALA B N   
2367 C  CA  . ALA B 32  ? 0.1356 0.1452 0.1235 0.0087  -0.0221 0.0183  171 ALA B CA  
2368 C  C   . ALA B 32  ? 0.1955 0.1963 0.1752 0.0108  -0.0217 0.0188  171 ALA B C   
2369 O  O   . ALA B 32  ? 0.2110 0.2116 0.1890 0.0081  -0.0236 0.0206  171 ALA B O   
2370 C  CB  . ALA B 32  ? 0.1611 0.1624 0.1419 0.0038  -0.0246 0.0196  171 ALA B CB  
2371 N  N   . ALA B 33  ? 0.1758 0.1694 0.1499 0.0156  -0.0192 0.0173  172 ALA B N   
2372 C  CA  . ALA B 33  ? 0.1604 0.1446 0.1254 0.0186  -0.0184 0.0177  172 ALA B CA  
2373 C  C   . ALA B 33  ? 0.1911 0.1585 0.1416 0.0154  -0.0206 0.0190  172 ALA B C   
2374 O  O   . ALA B 33  ? 0.2309 0.1902 0.1753 0.0157  -0.0203 0.0183  172 ALA B O   
2375 C  CB  . ALA B 33  ? 0.1714 0.1559 0.1363 0.0257  -0.0146 0.0160  172 ALA B CB  
2376 N  N   . PHE B 34  ? 0.1882 0.1500 0.1326 0.0119  -0.0230 0.0209  173 PHE B N   
2377 C  CA  . PHE B 34  ? 0.1958 0.1400 0.1245 0.0084  -0.0254 0.0223  173 PHE B CA  
2378 C  C   . PHE B 34  ? 0.1963 0.1268 0.1132 0.0147  -0.0228 0.0213  173 PHE B C   
2379 O  O   . PHE B 34  ? 0.2305 0.1604 0.1457 0.0190  -0.0211 0.0212  173 PHE B O   
2380 C  CB  . PHE B 34  ? 0.2040 0.1463 0.1292 0.0026  -0.0288 0.0249  173 PHE B CB  
2381 C  CG  . PHE B 34  ? 0.2387 0.1613 0.1460 -0.0011 -0.0313 0.0264  173 PHE B CG  
2382 C  CD1 . PHE B 34  ? 0.2490 0.1629 0.1473 -0.0015 -0.0324 0.0278  173 PHE B CD1 
2383 C  CD2 . PHE B 34  ? 0.2756 0.1877 0.1743 -0.0043 -0.0328 0.0265  173 PHE B CD2 
2384 C  CE1 . PHE B 34  ? 0.2834 0.1777 0.1637 -0.0052 -0.0348 0.0292  173 PHE B CE1 
2385 C  CE2 . PHE B 34  ? 0.3022 0.1952 0.1833 -0.0081 -0.0353 0.0280  173 PHE B CE2 
2386 C  CZ  . PHE B 34  ? 0.2977 0.1813 0.1691 -0.0086 -0.0363 0.0293  173 PHE B CZ  
2387 N  N   . SER B 35  ? 0.2205 0.1401 0.1287 0.0152  -0.0225 0.0205  174 SER B N   
2388 C  CA  . SER B 35  ? 0.2512 0.1579 0.1476 0.0219  -0.0198 0.0196  174 SER B CA  
2389 C  C   . SER B 35  ? 0.2946 0.1801 0.1724 0.0186  -0.0222 0.0207  174 SER B C   
2390 O  O   . SER B 35  ? 0.3134 0.1926 0.1867 0.0159  -0.0233 0.0204  174 SER B O   
2391 C  CB  A SER B 35  ? 0.2539 0.1664 0.1560 0.0268  -0.0168 0.0177  174 SER B CB  
2392 C  CB  B SER B 35  ? 0.2712 0.1836 0.1733 0.0269  -0.0167 0.0177  174 SER B CB  
2393 O  OG  A SER B 35  ? 0.2724 0.2042 0.1914 0.0285  -0.0151 0.0168  174 SER B OG  
2394 O  OG  B SER B 35  ? 0.2987 0.1999 0.1895 0.0340  -0.0139 0.0172  174 SER B OG  
2395 N  N   . PRO B 36  ? 0.3202 0.1938 0.1863 0.0187  -0.0231 0.0219  175 PRO B N   
2396 C  CA  . PRO B 36  ? 0.3810 0.2326 0.2275 0.0149  -0.0257 0.0231  175 PRO B CA  
2397 C  C   . PRO B 36  ? 0.4299 0.2667 0.2635 0.0207  -0.0234 0.0219  175 PRO B C   
2398 O  O   . PRO B 36  ? 0.4492 0.2696 0.2687 0.0170  -0.0252 0.0218  175 PRO B O   
2399 C  CB  . PRO B 36  ? 0.3781 0.2220 0.2162 0.0153  -0.0264 0.0245  175 PRO B CB  
2400 C  CG  . PRO B 36  ? 0.3976 0.2567 0.2484 0.0222  -0.0229 0.0236  175 PRO B CG  
2401 C  CD  . PRO B 36  ? 0.2886 0.1687 0.1590 0.0215  -0.0220 0.0225  175 PRO B CD  
2402 N  N   . ALA B 37  ? 0.3922 0.2374 0.2329 0.0289  -0.0191 0.0202  176 ALA B N   
2403 C  CA  . ALA B 37  ? 0.4134 0.2472 0.2436 0.0348  -0.0167 0.0191  176 ALA B CA  
2404 C  C   . ALA B 37  ? 0.4019 0.2343 0.2328 0.0296  -0.0187 0.0186  176 ALA B C   
2405 O  O   . ALA B 37  ? 0.4624 0.2828 0.2828 0.0319  -0.0177 0.0175  176 ALA B O   
2406 C  CB  . ALA B 37  ? 0.4351 0.2814 0.2745 0.0443  -0.0119 0.0179  176 ALA B CB  
2407 N  N   . LEU B 38  ? 0.3488 0.1952 0.1936 0.0227  -0.0210 0.0189  177 LEU B N   
2408 C  CA  . LEU B 38  ? 0.3272 0.1747 0.1745 0.0177  -0.0227 0.0185  177 LEU B CA  
2409 C  C   . LEU B 38  ? 0.4176 0.2486 0.2504 0.0096  -0.0270 0.0202  177 LEU B C   
2410 O  O   . LEU B 38  ? 0.4320 0.2664 0.2672 0.0021  -0.0304 0.0220  177 LEU B O   
2411 C  CB  . LEU B 38  ? 0.3110 0.1800 0.1783 0.0141  -0.0233 0.0184  177 LEU B CB  
2412 C  CG  . LEU B 38  ? 0.3086 0.1941 0.1904 0.0209  -0.0195 0.0167  177 LEU B CG  
2413 C  CD1 . LEU B 38  ? 0.2846 0.1890 0.1840 0.0168  -0.0205 0.0166  177 LEU B CD1 
2414 C  CD2 . LEU B 38  ? 0.3171 0.1982 0.1952 0.0265  -0.0167 0.0151  177 LEU B CD2 
2415 N  N   . ARG B 39  ? 0.3873 0.2028 0.2068 0.0109  -0.0265 0.0191  178 ARG B N   
2416 C  CA  . ARG B 39  ? 0.4259 0.2289 0.2343 0.0032  -0.0296 0.0187  178 ARG B CA  
2417 C  C   . ARG B 39  ? 0.4130 0.2197 0.2255 -0.0038 -0.0322 0.0194  178 ARG B C   
2418 O  O   . ARG B 39  ? 0.4022 0.2185 0.2241 -0.0014 -0.0311 0.0197  178 ARG B O   
2419 C  CB  . ARG B 39  ? 0.5173 0.3038 0.3105 0.0081  -0.0274 0.0160  178 ARG B CB  
2420 C  CG  . ARG B 39  ? 0.5845 0.3696 0.3750 0.0173  -0.0236 0.0152  178 ARG B CG  
2421 C  CD  . ARG B 39  ? 0.7435 0.5261 0.5310 0.0148  -0.0252 0.0162  178 ARG B CD  
2422 N  NE  . ARG B 39  ? 0.8172 0.5914 0.5974 0.0048  -0.0296 0.0167  178 ARG B NE  
2423 C  CZ  . ARG B 39  ? 0.8354 0.6166 0.6217 -0.0023 -0.0329 0.0190  178 ARG B CZ  
2424 N  NH1 . ARG B 39  ? 0.8845 0.6587 0.6639 -0.0114 -0.0370 0.0195  178 ARG B NH1 
2425 N  NH2 . ARG B 39  ? 0.7722 0.5681 0.5714 -0.0002 -0.0322 0.0209  178 ARG B NH2 
2426 N  N   . PRO B 40  ? 0.3977 0.1971 0.2031 -0.0125 -0.0358 0.0197  179 PRO B N   
2427 C  CA  . PRO B 40  ? 0.3671 0.1709 0.1766 -0.0191 -0.0382 0.0204  179 PRO B CA  
2428 C  C   . PRO B 40  ? 0.4098 0.2105 0.2179 -0.0144 -0.0358 0.0185  179 PRO B C   
2429 O  O   . PRO B 40  ? 0.4138 0.2030 0.2118 -0.0084 -0.0333 0.0161  179 PRO B O   
2430 C  CB  . PRO B 40  ? 0.4197 0.2129 0.2182 -0.0276 -0.0419 0.0203  179 PRO B CB  
2431 C  CG  . PRO B 40  ? 0.4171 0.2077 0.2122 -0.0280 -0.0426 0.0209  179 PRO B CG  
2432 C  CD  . PRO B 40  ? 0.4152 0.2040 0.2099 -0.0172 -0.0382 0.0196  179 PRO B CD  
2433 N  N   . LEU B 41  ? 0.4087 0.2202 0.2270 -0.0169 -0.0365 0.0196  180 LEU B N   
2434 C  CA  . LEU B 41  ? 0.4167 0.2264 0.2349 -0.0132 -0.0346 0.0181  180 LEU B CA  
2435 C  C   . LEU B 41  ? 0.4077 0.2030 0.2124 -0.0166 -0.0358 0.0162  180 LEU B C   
2436 O  O   . LEU B 41  ? 0.4130 0.2042 0.2125 -0.0246 -0.0393 0.0169  180 LEU B O   
2437 C  CB  . LEU B 41  ? 0.3742 0.1980 0.2054 -0.0166 -0.0357 0.0199  180 LEU B CB  
2438 C  CG  . LEU B 41  ? 0.3506 0.1953 0.2004 -0.0144 -0.0343 0.0198  180 LEU B CG  
2439 C  CD1 . LEU B 41  ? 0.3812 0.2418 0.2454 -0.0179 -0.0349 0.0199  180 LEU B CD1 
2440 C  CD2 . LEU B 41  ? 0.4010 0.2496 0.2554 -0.0043 -0.0298 0.0174  180 LEU B CD2 
2441 N  N   . GLU B 42  ? 0.4173 0.2056 0.2163 -0.0103 -0.0330 0.0140  181 GLU B N   
2442 C  CA  . GLU B 42  ? 0.4287 0.2035 0.2143 -0.0126 -0.0340 0.0121  181 GLU B CA  
2443 C  C   . GLU B 42  ? 0.4684 0.2468 0.2583 -0.0118 -0.0332 0.0115  181 GLU B C   
2444 O  O   . GLU B 42  ? 0.4492 0.2310 0.2432 -0.0041 -0.0297 0.0106  181 GLU B O   
2445 C  CB  . GLU B 42  ? 0.4710 0.2320 0.2426 -0.0055 -0.0314 0.0097  181 GLU B CB  
2446 C  CG  . GLU B 42  ? 0.5206 0.2764 0.2865 -0.0064 -0.0323 0.0100  181 GLU B CG  
2447 C  CD  . GLU B 42  ? 0.6491 0.3921 0.4014 0.0015  -0.0293 0.0078  181 GLU B CD  
2448 O  OE1 . GLU B 42  ? 0.7123 0.4509 0.4599 0.0019  -0.0296 0.0079  181 GLU B OE1 
2449 O  OE2 . GLU B 42  ? 0.6746 0.4127 0.4212 0.0074  -0.0267 0.0060  181 GLU B OE2 
2450 N  N   . LEU B 43  ? 0.4538 0.2322 0.2429 -0.0201 -0.0364 0.0122  182 LEU B N   
2451 C  CA  . LEU B 43  ? 0.5121 0.2938 0.3050 -0.0203 -0.0360 0.0118  182 LEU B CA  
2452 C  C   . LEU B 43  ? 0.5338 0.3016 0.3117 -0.0227 -0.0373 0.0099  182 LEU B C   
2453 O  O   . LEU B 43  ? 0.5783 0.3384 0.3467 -0.0290 -0.0404 0.0100  182 LEU B O   
2454 C  CB  . LEU B 43  ? 0.4920 0.2875 0.2978 -0.0276 -0.0386 0.0143  182 LEU B CB  
2455 C  CG  . LEU B 43  ? 0.5253 0.3362 0.3470 -0.0248 -0.0371 0.0161  182 LEU B CG  
2456 C  CD1 . LEU B 43  ? 0.6094 0.4232 0.4339 -0.0206 -0.0359 0.0167  182 LEU B CD1 
2457 C  CD2 . LEU B 43  ? 0.5156 0.3387 0.3469 -0.0331 -0.0402 0.0187  182 LEU B CD2 
2458 N  N   . SER B 44  ? 0.4792 0.2440 0.2546 -0.0177 -0.0349 0.0083  183 SER B N   
2459 C  CA  . SER B 44  ? 0.5808 0.3334 0.3423 -0.0199 -0.0361 0.0068  183 SER B CA  
2460 C  C   . SER B 44  ? 0.5822 0.3399 0.3492 -0.0195 -0.0354 0.0066  183 SER B C   
2461 O  O   . SER B 44  ? 0.4868 0.2530 0.2642 -0.0137 -0.0324 0.0066  183 SER B O   
2462 C  CB  A SER B 44  ? 0.6415 0.3800 0.3879 -0.0126 -0.0336 0.0045  183 SER B CB  
2463 C  CB  B SER B 44  ? 0.6430 0.3815 0.3894 -0.0126 -0.0336 0.0045  183 SER B CB  
2464 O  OG  A SER B 44  ? 0.6746 0.4181 0.4269 -0.0027 -0.0291 0.0039  183 SER B OG  
2465 O  OG  B SER B 44  ? 0.6653 0.3979 0.4054 -0.0134 -0.0345 0.0045  183 SER B OG  
2466 N  N   . GLY B 45  ? 0.5435 0.2960 0.3032 -0.0259 -0.0382 0.0065  184 GLY B N   
2467 C  CA  . GLY B 45  ? 0.4943 0.2504 0.2576 -0.0261 -0.0377 0.0063  184 GLY B CA  
2468 C  C   . GLY B 45  ? 0.5118 0.2829 0.2907 -0.0317 -0.0394 0.0085  184 GLY B C   
2469 O  O   . GLY B 45  ? 0.5032 0.2789 0.2869 -0.0317 -0.0388 0.0085  184 GLY B O   
2470 N  N   . PHE B 46  ? 0.4729 0.2519 0.2592 -0.0367 -0.0414 0.0105  185 PHE B N   
2471 C  CA  . PHE B 46  ? 0.5122 0.3069 0.3137 -0.0413 -0.0426 0.0128  185 PHE B CA  
2472 C  C   . PHE B 46  ? 0.5205 0.3171 0.3199 -0.0504 -0.0464 0.0141  185 PHE B C   
2473 O  O   . PHE B 46  ? 0.4418 0.2511 0.2525 -0.0540 -0.0473 0.0160  185 PHE B O   
2474 C  CB  . PHE B 46  ? 0.4794 0.2832 0.2900 -0.0425 -0.0432 0.0148  185 PHE B CB  
2475 C  CG  . PHE B 46  ? 0.4362 0.2453 0.2555 -0.0343 -0.0396 0.0145  185 PHE B CG  
2476 C  CD1 . PHE B 46  ? 0.4647 0.2647 0.2769 -0.0260 -0.0365 0.0123  185 PHE B CD1 
2477 C  CD2 . PHE B 46  ? 0.4389 0.2626 0.2729 -0.0349 -0.0394 0.0167  185 PHE B CD2 
2478 C  CE1 . PHE B 46  ? 0.4604 0.2663 0.2806 -0.0184 -0.0333 0.0122  185 PHE B CE1 
2479 C  CE2 . PHE B 46  ? 0.3958 0.2244 0.2370 -0.0275 -0.0364 0.0165  185 PHE B CE2 
2480 C  CZ  . PHE B 46  ? 0.3934 0.2133 0.2280 -0.0193 -0.0334 0.0142  185 PHE B CZ  
2481 N  N   . GLN B 47  ? 0.4604 0.2447 0.2448 -0.0539 -0.0487 0.0132  186 GLN B N   
2482 C  CA  . GLN B 47  ? 0.5516 0.3372 0.3326 -0.0625 -0.0525 0.0144  186 GLN B CA  
2483 C  C   . GLN B 47  ? 0.5480 0.3298 0.3254 -0.0605 -0.0513 0.0132  186 GLN B C   
2484 O  O   . GLN B 47  ? 0.5367 0.3065 0.3023 -0.0591 -0.0508 0.0121  186 GLN B O   
2485 C  CB  . GLN B 47  ? 0.5315 0.3084 0.3018 -0.0671 -0.0548 0.0149  186 GLN B CB  
2486 C  CG  . GLN B 47  ? 0.5850 0.3681 0.3599 -0.0715 -0.0570 0.0168  186 GLN B CG  
2487 C  CD  . GLN B 47  ? 0.7928 0.5711 0.5659 -0.0656 -0.0553 0.0151  186 GLN B CD  
2488 O  OE1 . GLN B 47  ? 0.8419 0.6066 0.6035 -0.0601 -0.0534 0.0128  186 GLN B OE1 
2489 N  NE2 . GLN B 47  ? 0.8548 0.6466 0.6421 -0.0656 -0.0547 0.0172  186 GLN B NE2 
2490 N  N   . LEU B 48  ? 0.4942 0.2878 0.2841 -0.0600 -0.0502 0.0141  187 LEU B N   
2491 C  CA  . LEU B 48  ? 0.4920 0.2834 0.2802 -0.0577 -0.0489 0.0131  187 LEU B CA  
2492 C  C   . LEU B 48  ? 0.4906 0.2833 0.2760 -0.0648 -0.0515 0.0146  187 LEU B C   
2493 O  O   . LEU B 48  ? 0.5073 0.3098 0.2993 -0.0715 -0.0540 0.0172  187 LEU B O   
2494 C  CB  . LEU B 48  ? 0.4112 0.2153 0.2155 -0.0538 -0.0461 0.0136  187 LEU B CB  
2495 C  CG  . LEU B 48  ? 0.4723 0.2777 0.2829 -0.0460 -0.0426 0.0126  187 LEU B CG  
2496 C  CD1 . LEU B 48  ? 0.4809 0.2993 0.3073 -0.0434 -0.0406 0.0132  187 LEU B CD1 
2497 C  CD2 . LEU B 48  ? 0.4791 0.2712 0.2783 -0.0384 -0.0400 0.0099  187 LEU B CD2 
2498 N  N   . PRO B 49  ? 0.5267 0.3105 0.3038 -0.0628 -0.0505 0.0134  188 PRO B N   
2499 C  CA  . PRO B 49  ? 0.5477 0.3331 0.3236 -0.0685 -0.0523 0.0148  188 PRO B CA  
2500 C  C   . PRO B 49  ? 0.6763 0.4756 0.4650 -0.0698 -0.0521 0.0160  188 PRO B C   
2501 O  O   . PRO B 49  ? 0.6021 0.4066 0.3983 -0.0654 -0.0503 0.0152  188 PRO B O   
2502 C  CB  . PRO B 49  ? 0.5245 0.2953 0.2875 -0.0642 -0.0506 0.0127  188 PRO B CB  
2503 C  CG  . PRO B 49  ? 0.5343 0.3019 0.2976 -0.0554 -0.0473 0.0104  188 PRO B CG  
2504 C  CD  . PRO B 49  ? 0.4513 0.2236 0.2201 -0.0546 -0.0474 0.0106  188 PRO B CD  
2505 N  N   . PRO B 50  ? 0.7088 0.5140 0.4999 -0.0756 -0.0539 0.0180  189 PRO B N   
2506 C  CA  . PRO B 50  ? 0.6886 0.5074 0.4917 -0.0769 -0.0536 0.0193  189 PRO B CA  
2507 C  C   . PRO B 50  ? 0.5920 0.4079 0.3957 -0.0709 -0.0510 0.0172  189 PRO B C   
2508 O  O   . PRO B 50  ? 0.5498 0.3763 0.3643 -0.0698 -0.0502 0.0177  189 PRO B O   
2509 C  CB  . PRO B 50  ? 0.7863 0.6080 0.5878 -0.0835 -0.0558 0.0214  189 PRO B CB  
2510 C  CG  . PRO B 50  ? 0.7865 0.5931 0.5733 -0.0844 -0.0567 0.0204  189 PRO B CG  
2511 C  CD  . PRO B 50  ? 0.7575 0.5578 0.5404 -0.0815 -0.0563 0.0192  189 PRO B CD  
2512 N  N   . LEU B 51  ? 0.5055 0.3077 0.2978 -0.0668 -0.0496 0.0150  190 LEU B N   
2513 C  CA  . LEU B 51  ? 0.5069 0.3061 0.2992 -0.0604 -0.0469 0.0130  190 LEU B CA  
2514 C  C   . LEU B 51  ? 0.4994 0.2868 0.2832 -0.0528 -0.0444 0.0104  190 LEU B C   
2515 O  O   . LEU B 51  ? 0.5658 0.3432 0.3394 -0.0527 -0.0448 0.0099  190 LEU B O   
2516 C  CB  . LEU B 51  ? 0.5815 0.3774 0.3694 -0.0620 -0.0470 0.0130  190 LEU B CB  
2517 C  CG  . LEU B 51  ? 0.6274 0.4358 0.4243 -0.0683 -0.0488 0.0154  190 LEU B CG  
2518 C  CD1 . LEU B 51  ? 0.6160 0.4194 0.4068 -0.0699 -0.0490 0.0154  190 LEU B CD1 
2519 C  CD2 . LEU B 51  ? 0.6010 0.4218 0.4111 -0.0665 -0.0477 0.0158  190 LEU B CD2 
2520 N  N   . PRO B 52  ? 0.5304 0.3214 0.3226 -0.0456 -0.0408 0.0091  191 PRO B N   
2521 C  CA  . PRO B 52  ? 0.5363 0.3398 0.3437 -0.0445 -0.0392 0.0095  191 PRO B CA  
2522 C  C   . PRO B 52  ? 0.6151 0.4326 0.4370 -0.0475 -0.0399 0.0113  191 PRO B C   
2523 O  O   . PRO B 52  ? 0.4732 0.2912 0.2948 -0.0492 -0.0410 0.0120  191 PRO B O   
2524 C  CB  . PRO B 52  ? 0.5016 0.3021 0.3105 -0.0352 -0.0353 0.0073  191 PRO B CB  
2525 C  CG  . PRO B 52  ? 0.5413 0.3331 0.3416 -0.0315 -0.0347 0.0064  191 PRO B CG  
2526 C  CD  . PRO B 52  ? 0.5197 0.3020 0.3059 -0.0374 -0.0379 0.0071  191 PRO B CD  
2527 N  N   . GLU B 53  ? 0.5262 0.3549 0.3605 -0.0482 -0.0391 0.0120  192 GLU B N   
2528 C  CA  . GLU B 53  ? 0.5269 0.3695 0.3750 -0.0508 -0.0396 0.0137  192 GLU B CA  
2529 C  C   . GLU B 53  ? 0.4445 0.2895 0.3004 -0.0445 -0.0369 0.0124  192 GLU B C   
2530 O  O   . GLU B 53  ? 0.3806 0.2183 0.2328 -0.0378 -0.0344 0.0101  192 GLU B O   
2531 C  CB  . GLU B 53  ? 0.5642 0.4177 0.4218 -0.0538 -0.0398 0.0150  192 GLU B CB  
2532 C  CG  . GLU B 53  ? 0.5363 0.3909 0.3882 -0.0610 -0.0429 0.0171  192 GLU B CG  
2533 C  CD  . GLU B 53  ? 0.5769 0.4446 0.4395 -0.0639 -0.0431 0.0189  192 GLU B CD  
2534 O  OE1 . GLU B 53  ? 0.5428 0.4122 0.4109 -0.0603 -0.0408 0.0174  192 GLU B OE1 
2535 O  OE2 . GLU B 53  ? 0.6715 0.5483 0.5370 -0.0696 -0.0455 0.0217  192 GLU B OE2 
2536 N  N   . LEU B 54  ? 0.4110 0.2669 0.2778 -0.0465 -0.0373 0.0140  193 LEU B N   
2537 C  CA  . LEU B 54  ? 0.3759 0.2349 0.2504 -0.0413 -0.0351 0.0131  193 LEU B CA  
2538 C  C   . LEU B 54  ? 0.2972 0.1737 0.1883 -0.0399 -0.0336 0.0127  193 LEU B C   
2539 O  O   . LEU B 54  ? 0.3602 0.2457 0.2569 -0.0453 -0.0352 0.0149  193 LEU B O   
2540 C  CB  . LEU B 54  ? 0.3679 0.2279 0.2418 -0.0430 -0.0364 0.0146  193 LEU B CB  
2541 C  CG  . LEU B 54  ? 0.4076 0.2550 0.2683 -0.0415 -0.0368 0.0138  193 LEU B CG  
2542 C  CD1 . LEU B 54  ? 0.4370 0.2775 0.2861 -0.0467 -0.0394 0.0142  193 LEU B CD1 
2543 C  CD2 . LEU B 54  ? 0.3694 0.2197 0.2324 -0.0423 -0.0376 0.0152  193 LEU B CD2 
2544 N  N   . ARG B 55  ? 0.3043 0.1863 0.2032 -0.0325 -0.0304 0.0101  194 ARG B N   
2545 C  CA  . ARG B 55  ? 0.2885 0.1867 0.2026 -0.0304 -0.0287 0.0094  194 ARG B CA  
2546 C  C   . ARG B 55  ? 0.3090 0.2194 0.2325 -0.0315 -0.0291 0.0106  194 ARG B C   
2547 O  O   . ARG B 55  ? 0.3223 0.2317 0.2450 -0.0290 -0.0286 0.0102  194 ARG B O   
2548 C  CB  . ARG B 55  ? 0.2992 0.1989 0.2175 -0.0228 -0.0256 0.0064  194 ARG B CB  
2549 C  CG  . ARG B 55  ? 0.3741 0.2883 0.3064 -0.0207 -0.0239 0.0055  194 ARG B CG  
2550 C  CD  . ARG B 55  ? 0.4883 0.4030 0.4229 -0.0138 -0.0210 0.0030  194 ARG B CD  
2551 N  NE  . ARG B 55  ? 0.6502 0.5769 0.5965 -0.0123 -0.0196 0.0020  194 ARG B NE  
2552 C  CZ  . ARG B 55  ? 0.7948 0.7263 0.7463 -0.0071 -0.0173 0.0002  194 ARG B CZ  
2553 N  NH1 . ARG B 55  ? 0.8163 0.7426 0.7628 -0.0024 -0.0160 -0.0007 194 ARG B NH1 
2554 N  NH2 . ARG B 55  ? 0.8192 0.7606 0.7804 -0.0066 -0.0164 -0.0005 194 ARG B NH2 
2555 N  N   . LEU B 56  ? 0.2880 0.2100 0.2200 -0.0348 -0.0298 0.0123  195 LEU B N   
2556 C  CA  . LEU B 56  ? 0.2661 0.2009 0.2076 -0.0352 -0.0299 0.0136  195 LEU B CA  
2557 C  C   . LEU B 56  ? 0.2549 0.2017 0.2084 -0.0318 -0.0277 0.0123  195 LEU B C   
2558 O  O   . LEU B 56  ? 0.2716 0.2215 0.2274 -0.0336 -0.0279 0.0129  195 LEU B O   
2559 C  CB  . LEU B 56  ? 0.2331 0.1712 0.1726 -0.0425 -0.0329 0.0174  195 LEU B CB  
2560 C  CG  . LEU B 56  ? 0.2546 0.2054 0.2024 -0.0430 -0.0332 0.0193  195 LEU B CG  
2561 C  CD1 . LEU B 56  ? 0.2380 0.1841 0.1822 -0.0414 -0.0334 0.0188  195 LEU B CD1 
2562 C  CD2 . LEU B 56  ? 0.2701 0.2274 0.2177 -0.0499 -0.0359 0.0236  195 LEU B CD2 
2563 N  N   . ARG B 57  ? 0.2218 0.1748 0.1824 -0.0269 -0.0258 0.0106  196 ARG B N   
2564 C  CA  . ARG B 57  ? 0.1780 0.1396 0.1481 -0.0231 -0.0236 0.0088  196 ARG B CA  
2565 C  C   . ARG B 57  ? 0.1822 0.1555 0.1614 -0.0217 -0.0229 0.0092  196 ARG B C   
2566 O  O   . ARG B 57  ? 0.2126 0.1866 0.1920 -0.0205 -0.0229 0.0093  196 ARG B O   
2567 C  CB  A ARG B 57  ? 0.2088 0.1656 0.1778 -0.0179 -0.0214 0.0058  196 ARG B CB  
2568 C  CB  B ARG B 57  ? 0.2026 0.1594 0.1717 -0.0179 -0.0214 0.0058  196 ARG B CB  
2569 C  CG  A ARG B 57  ? 0.2516 0.2162 0.2292 -0.0145 -0.0194 0.0041  196 ARG B CG  
2570 C  CG  B ARG B 57  ? 0.2467 0.2119 0.2248 -0.0142 -0.0193 0.0040  196 ARG B CG  
2571 C  CD  A ARG B 57  ? 0.2981 0.2577 0.2734 -0.0104 -0.0177 0.0018  196 ARG B CD  
2572 C  CD  B ARG B 57  ? 0.2990 0.2602 0.2755 -0.0097 -0.0175 0.0016  196 ARG B CD  
2573 N  NE  A ARG B 57  ? 0.3355 0.3028 0.3187 -0.0076 -0.0160 0.0002  196 ARG B NE  
2574 N  NE  B ARG B 57  ? 0.3569 0.3265 0.3419 -0.0070 -0.0158 0.0002  196 ARG B NE  
2575 C  CZ  A ARG B 57  ? 0.3208 0.2934 0.3089 -0.0043 -0.0146 -0.0010 196 ARG B CZ  
2576 C  CZ  B ARG B 57  ? 0.3218 0.2941 0.3101 -0.0073 -0.0153 -0.0003 196 ARG B CZ  
2577 N  NH1 A ARG B 57  ? 0.3543 0.3259 0.3407 -0.0029 -0.0145 -0.0009 196 ARG B NH1 
2578 N  NH1 B ARG B 57  ? 0.3748 0.3427 0.3592 -0.0101 -0.0163 0.0006  196 ARG B NH1 
2579 N  NH2 A ARG B 57  ? 0.3487 0.3274 0.3429 -0.0026 -0.0133 -0.0022 196 ARG B NH2 
2580 N  NH2 B ARG B 57  ? 0.2675 0.2466 0.2624 -0.0051 -0.0140 -0.0015 196 ARG B NH2 
2581 N  N   . ASN B 58  ? 0.1538 0.1356 0.1399 -0.0216 -0.0223 0.0096  197 ASN B N   
2582 C  CA  . ASN B 58  ? 0.1380 0.1298 0.1322 -0.0191 -0.0212 0.0095  197 ASN B CA  
2583 C  C   . ASN B 58  ? 0.1699 0.1620 0.1678 -0.0143 -0.0189 0.0063  197 ASN B C   
2584 O  O   . ASN B 58  ? 0.1438 0.1365 0.1438 -0.0133 -0.0180 0.0052  197 ASN B O   
2585 C  CB  . ASN B 58  ? 0.1701 0.1703 0.1688 -0.0208 -0.0215 0.0116  197 ASN B CB  
2586 C  CG  . ASN B 58  ? 0.1348 0.1442 0.1408 -0.0176 -0.0202 0.0114  197 ASN B CG  
2587 O  OD1 . ASN B 58  ? 0.1505 0.1600 0.1586 -0.0143 -0.0190 0.0094  197 ASN B OD1 
2588 N  ND2 . ASN B 58  ? 0.1264 0.1435 0.1358 -0.0183 -0.0202 0.0135  197 ASN B ND2 
2589 N  N   . ASN B 59  ? 0.1480 0.1398 0.1465 -0.0115 -0.0181 0.0051  198 ASN B N   
2590 C  CA  . ASN B 59  ? 0.1411 0.1337 0.1426 -0.0075 -0.0161 0.0024  198 ASN B CA  
2591 C  C   . ASN B 59  ? 0.1341 0.1350 0.1426 -0.0055 -0.0151 0.0019  198 ASN B C   
2592 O  O   . ASN B 59  ? 0.1388 0.1410 0.1497 -0.0027 -0.0137 -0.0001 198 ASN B O   
2593 C  CB  . ASN B 59  ? 0.1476 0.1346 0.1450 -0.0052 -0.0156 0.0013  198 ASN B CB  
2594 C  CG  . ASN B 59  ? 0.1521 0.1407 0.1495 -0.0053 -0.0162 0.0022  198 ASN B CG  
2595 O  OD1 . ASN B 59  ? 0.1377 0.1336 0.1404 -0.0053 -0.0162 0.0027  198 ASN B OD1 
2596 N  ND2 . ASN B 59  ? 0.1866 0.1680 0.1774 -0.0052 -0.0167 0.0025  198 ASN B ND2 
2597 N  N   . GLY B 60  ? 0.1235 0.1299 0.1346 -0.0070 -0.0158 0.0037  199 GLY B N   
2598 C  CA  . GLY B 60  ? 0.1310 0.1444 0.1475 -0.0049 -0.0149 0.0034  199 GLY B CA  
2599 C  C   . GLY B 60  ? 0.1198 0.1356 0.1376 -0.0035 -0.0148 0.0033  199 GLY B C   
2600 O  O   . GLY B 60  ? 0.1222 0.1436 0.1436 -0.0021 -0.0143 0.0035  199 GLY B O   
2601 N  N   . HIS B 61  ? 0.1073 0.1187 0.1217 -0.0037 -0.0152 0.0031  200 HIS B N   
2602 C  CA  . HIS B 61  ? 0.1105 0.1239 0.1258 -0.0026 -0.0152 0.0032  200 HIS B CA  
2603 C  C   . HIS B 61  ? 0.1308 0.1432 0.1429 -0.0055 -0.0171 0.0057  200 HIS B C   
2604 O  O   . HIS B 61  ? 0.0962 0.1128 0.1102 -0.0054 -0.0175 0.0067  200 HIS B O   
2605 C  CB  . HIS B 61  ? 0.1220 0.1316 0.1356 -0.0002 -0.0141 0.0012  200 HIS B CB  
2606 C  CG  . HIS B 61  ? 0.1039 0.1143 0.1197 0.0020  -0.0126 -0.0009 200 HIS B CG  
2607 N  ND1 . HIS B 61  ? 0.1730 0.1792 0.1861 0.0035  -0.0118 -0.0021 200 HIS B ND1 
2608 C  CD2 . HIS B 61  ? 0.1308 0.1456 0.1507 0.0028  -0.0118 -0.0017 200 HIS B CD2 
2609 C  CE1 . HIS B 61  ? 0.1391 0.1480 0.1550 0.0048  -0.0107 -0.0035 200 HIS B CE1 
2610 N  NE2 . HIS B 61  ? 0.1199 0.1334 0.1397 0.0042  -0.0107 -0.0034 200 HIS B NE2 
2611 N  N   . SER B 62  ? 0.1255 0.1322 0.1325 -0.0084 -0.0183 0.0067  201 SER B N   
2612 C  CA  . SER B 62  ? 0.1099 0.1143 0.1124 -0.0121 -0.0204 0.0093  201 SER B CA  
2613 C  C   . SER B 62  ? 0.1434 0.1418 0.1405 -0.0155 -0.0216 0.0103  201 SER B C   
2614 O  O   . SER B 62  ? 0.1443 0.1412 0.1421 -0.0145 -0.0206 0.0089  201 SER B O   
2615 C  CB  . SER B 62  ? 0.1388 0.1377 0.1370 -0.0114 -0.0207 0.0088  201 SER B CB  
2616 O  OG  . SER B 62  ? 0.1438 0.1401 0.1371 -0.0155 -0.0230 0.0115  201 SER B OG  
2617 N  N   . VAL B 63  ? 0.1232 0.1181 0.1147 -0.0198 -0.0238 0.0127  202 VAL B N   
2618 C  CA  . VAL B 63  ? 0.1528 0.1394 0.1371 -0.0232 -0.0251 0.0134  202 VAL B CA  
2619 C  C   . VAL B 63  ? 0.1693 0.1444 0.1452 -0.0227 -0.0254 0.0123  202 VAL B C   
2620 O  O   . VAL B 63  ? 0.1617 0.1359 0.1355 -0.0233 -0.0263 0.0132  202 VAL B O   
2621 C  CB  . VAL B 63  ? 0.1676 0.1574 0.1499 -0.0290 -0.0276 0.0172  202 VAL B CB  
2622 C  CG1 . VAL B 63  ? 0.1950 0.1884 0.1768 -0.0314 -0.0293 0.0197  202 VAL B CG1 
2623 C  CG2 . VAL B 63  ? 0.1833 0.1626 0.1565 -0.0330 -0.0292 0.0178  202 VAL B CG2 
2624 N  N   . GLN B 64  ? 0.1791 0.1458 0.1503 -0.0210 -0.0245 0.0104  203 GLN B N   
2625 C  CA  . GLN B 64  ? 0.1761 0.1318 0.1391 -0.0190 -0.0242 0.0092  203 GLN B CA  
2626 C  C   . GLN B 64  ? 0.2315 0.1750 0.1835 -0.0222 -0.0257 0.0099  203 GLN B C   
2627 O  O   . GLN B 64  ? 0.2189 0.1613 0.1706 -0.0230 -0.0256 0.0096  203 GLN B O   
2628 C  CB  . GLN B 64  ? 0.1909 0.1476 0.1573 -0.0128 -0.0214 0.0063  203 GLN B CB  
2629 C  CG  . GLN B 64  ? 0.2255 0.1720 0.1837 -0.0095 -0.0206 0.0052  203 GLN B CG  
2630 C  CD  . GLN B 64  ? 0.2278 0.1789 0.1910 -0.0036 -0.0179 0.0030  203 GLN B CD  
2631 O  OE1 . GLN B 64  ? 0.2161 0.1773 0.1880 -0.0024 -0.0171 0.0027  203 GLN B OE1 
2632 N  NE2 . GLN B 64  ? 0.2436 0.1877 0.2010 0.0002  -0.0166 0.0019  203 GLN B NE2 
2633 N  N   . LEU B 65  ? 0.2279 0.1617 0.1702 -0.0240 -0.0272 0.0109  204 LEU B N   
2634 C  CA  . LEU B 65  ? 0.2294 0.1489 0.1587 -0.0271 -0.0289 0.0115  204 LEU B CA  
2635 C  C   . LEU B 65  ? 0.2599 0.1682 0.1814 -0.0216 -0.0271 0.0093  204 LEU B C   
2636 O  O   . LEU B 65  ? 0.2770 0.1837 0.1971 -0.0184 -0.0262 0.0088  204 LEU B O   
2637 C  CB  . LEU B 65  ? 0.2288 0.1440 0.1510 -0.0334 -0.0320 0.0145  204 LEU B CB  
2638 C  CG  . LEU B 65  ? 0.2682 0.1675 0.1752 -0.0380 -0.0343 0.0157  204 LEU B CG  
2639 C  CD1 . LEU B 65  ? 0.3056 0.2061 0.2128 -0.0422 -0.0354 0.0167  204 LEU B CD1 
2640 C  CD2 . LEU B 65  ? 0.2772 0.1726 0.1774 -0.0438 -0.0374 0.0185  204 LEU B CD2 
2641 N  N   . THR B 66  ? 0.2505 0.1517 0.1671 -0.0201 -0.0263 0.0081  205 THR B N   
2642 C  CA  . THR B 66  ? 0.2501 0.1408 0.1585 -0.0143 -0.0244 0.0063  205 THR B CA  
2643 C  C   . THR B 66  ? 0.2842 0.1581 0.1765 -0.0168 -0.0264 0.0074  205 THR B C   
2644 O  O   . THR B 66  ? 0.3292 0.1959 0.2141 -0.0226 -0.0288 0.0088  205 THR B O   
2645 C  CB  . THR B 66  ? 0.2778 0.1675 0.1867 -0.0113 -0.0228 0.0047  205 THR B CB  
2646 O  OG1 . THR B 66  ? 0.2807 0.1852 0.2037 -0.0093 -0.0212 0.0037  205 THR B OG1 
2647 C  CG2 . THR B 66  ? 0.3115 0.1912 0.2116 -0.0047 -0.0208 0.0032  205 THR B CG2 
2648 N  N   . LEU B 67  ? 0.2860 0.1535 0.1723 -0.0126 -0.0254 0.0069  206 LEU B N   
2649 C  CA  . LEU B 67  ? 0.3340 0.1843 0.2038 -0.0146 -0.0271 0.0079  206 LEU B CA  
2650 C  C   . LEU B 67  ? 0.3699 0.2062 0.2277 -0.0090 -0.0254 0.0064  206 LEU B C   
2651 O  O   . LEU B 67  ? 0.3664 0.2076 0.2290 -0.0018 -0.0223 0.0047  206 LEU B O   
2652 C  CB  . LEU B 67  ? 0.3546 0.2053 0.2239 -0.0137 -0.0273 0.0085  206 LEU B CB  
2653 C  CG  . LEU B 67  ? 0.2947 0.1584 0.1745 -0.0192 -0.0292 0.0102  206 LEU B CG  
2654 C  CD1 . LEU B 67  ? 0.2612 0.1271 0.1422 -0.0166 -0.0286 0.0104  206 LEU B CD1 
2655 C  CD2 . LEU B 67  ? 0.3015 0.1597 0.1743 -0.0283 -0.0330 0.0129  206 LEU B CD2 
2656 N  N   . PRO B 68  ? 0.3894 0.2106 0.2320 -0.0122 -0.0272 0.0069  207 PRO B N   
2657 C  CA  . PRO B 68  ? 0.5059 0.3178 0.3381 -0.0067 -0.0253 0.0051  207 PRO B CA  
2658 C  C   . PRO B 68  ? 0.5303 0.3362 0.3554 0.0001  -0.0231 0.0042  207 PRO B C   
2659 O  O   . PRO B 68  ? 0.4357 0.2430 0.2624 -0.0006 -0.0237 0.0051  207 PRO B O   
2660 C  CB  . PRO B 68  ? 0.4679 0.2716 0.2891 -0.0133 -0.0280 0.0055  207 PRO B CB  
2661 C  CG  . PRO B 68  ? 0.4536 0.2592 0.2754 -0.0203 -0.0310 0.0072  207 PRO B CG  
2662 C  CD  . PRO B 68  ? 0.3492 0.1682 0.1868 -0.0209 -0.0307 0.0085  207 PRO B CD  
2663 N  N   . PRO B 69  ? 0.5234 0.3232 0.3406 0.0068  -0.0207 0.0028  208 PRO B N   
2664 C  CA  . PRO B 69  ? 0.5062 0.2997 0.3147 0.0132  -0.0186 0.0022  208 PRO B CA  
2665 C  C   . PRO B 69  ? 0.4625 0.2452 0.2586 0.0083  -0.0211 0.0024  208 PRO B C   
2666 O  O   . PRO B 69  ? 0.5346 0.3132 0.3263 0.0008  -0.0241 0.0029  208 PRO B O   
2667 C  CB  . PRO B 69  ? 0.5572 0.3462 0.3584 0.0198  -0.0160 0.0010  208 PRO B CB  
2668 C  CG  . PRO B 69  ? 0.5906 0.3881 0.4024 0.0191  -0.0157 0.0010  208 PRO B CG  
2669 C  CD  . PRO B 69  ? 0.5524 0.3528 0.3699 0.0095  -0.0192 0.0019  208 PRO B CD  
2670 N  N   . GLY B 70  ? 0.5342 0.3129 0.3250 0.0125  -0.0198 0.0022  209 GLY B N   
2671 C  CA  . GLY B 70  ? 0.5325 0.2995 0.3099 0.0089  -0.0219 0.0020  209 GLY B CA  
2672 C  C   . GLY B 70  ? 0.5590 0.3291 0.3409 0.0028  -0.0245 0.0033  209 GLY B C   
2673 O  O   . GLY B 70  ? 0.4914 0.2523 0.2627 -0.0012 -0.0267 0.0033  209 GLY B O   
2674 N  N   . LEU B 71  ? 0.4925 0.2755 0.2898 0.0020  -0.0244 0.0046  210 LEU B N   
2675 C  CA  . LEU B 71  ? 0.4446 0.2322 0.2473 -0.0029 -0.0266 0.0062  210 LEU B CA  
2676 C  C   . LEU B 71  ? 0.4603 0.2499 0.2650 0.0040  -0.0241 0.0061  210 LEU B C   
2677 O  O   . LEU B 71  ? 0.4403 0.2390 0.2549 0.0097  -0.0216 0.0062  210 LEU B O   
2678 C  CB  . LEU B 71  ? 0.4130 0.2136 0.2303 -0.0081 -0.0282 0.0080  210 LEU B CB  
2679 C  CG  . LEU B 71  ? 0.4689 0.2694 0.2848 -0.0174 -0.0317 0.0090  210 LEU B CG  
2680 C  CD1 . LEU B 71  ? 0.5276 0.3245 0.3399 -0.0162 -0.0309 0.0077  210 LEU B CD1 
2681 C  CD2 . LEU B 71  ? 0.4307 0.2450 0.2607 -0.0229 -0.0335 0.0114  210 LEU B CD2 
2682 N  N   . GLU B 72  ? 0.4755 0.2564 0.2701 0.0037  -0.0247 0.0059  211 GLU B N   
2683 C  CA  . GLU B 72  ? 0.5780 0.3599 0.3729 0.0106  -0.0222 0.0057  211 GLU B CA  
2684 C  C   . GLU B 72  ? 0.5090 0.2966 0.3105 0.0064  -0.0241 0.0075  211 GLU B C   
2685 O  O   . GLU B 72  ? 0.4593 0.2437 0.2574 -0.0017 -0.0276 0.0084  211 GLU B O   
2686 C  CB  . GLU B 72  ? 0.7297 0.4976 0.5080 0.0148  -0.0208 0.0041  211 GLU B CB  
2687 C  CG  . GLU B 72  ? 0.9047 0.6682 0.6762 0.0211  -0.0181 0.0025  211 GLU B CG  
2688 C  CD  . GLU B 72  ? 1.0259 0.7961 0.8018 0.0315  -0.0136 0.0023  211 GLU B CD  
2689 O  OE1 . GLU B 72  ? 1.0597 0.8335 0.8386 0.0347  -0.0124 0.0028  211 GLU B OE1 
2690 O  OE2 . GLU B 72  ? 1.0748 0.8477 0.8515 0.0365  -0.0113 0.0018  211 GLU B OE2 
2691 N  N   . MET B 73  ? 0.4998 0.2967 0.3106 0.0119  -0.0219 0.0082  212 MET B N   
2692 C  CA  . MET B 73  ? 0.4586 0.2615 0.2755 0.0090  -0.0234 0.0100  212 MET B CA  
2693 C  C   . MET B 73  ? 0.3983 0.2002 0.2126 0.0169  -0.0205 0.0094  212 MET B C   
2694 O  O   . MET B 73  ? 0.3821 0.1897 0.2009 0.0250  -0.0170 0.0088  212 MET B O   
2695 C  CB  A MET B 73  ? 0.4299 0.2504 0.2644 0.0068  -0.0238 0.0110  212 MET B CB  
2696 C  CB  B MET B 73  ? 0.4138 0.2352 0.2490 0.0069  -0.0238 0.0111  212 MET B CB  
2697 C  CG  A MET B 73  ? 0.4023 0.2327 0.2453 0.0011  -0.0261 0.0125  212 MET B CG  
2698 C  CG  B MET B 73  ? 0.3382 0.1708 0.1828 0.0058  -0.0242 0.0119  212 MET B CG  
2699 S  SD  A MET B 73  ? 0.3282 0.1676 0.1783 0.0087  -0.0229 0.0117  212 MET B SD  
2700 S  SD  B MET B 73  ? 0.3141 0.1727 0.1825 0.0030  -0.0243 0.0119  212 MET B SD  
2701 C  CE  A MET B 73  ? 0.3384 0.1979 0.2072 0.0136  -0.0197 0.0099  212 MET B CE  
2702 C  CE  B MET B 73  ? 0.2799 0.1500 0.1588 0.0123  -0.0196 0.0096  212 MET B CE  
2703 N  N   . LYS B 74  ? 0.4174 0.2128 0.2247 0.0146  -0.0218 0.0097  213 LYS B N   
2704 C  CA  . LYS B 74  ? 0.3750 0.1694 0.1794 0.0218  -0.0190 0.0093  213 LYS B CA  
2705 C  C   . LYS B 74  ? 0.3639 0.1670 0.1770 0.0198  -0.0202 0.0113  213 LYS B C   
2706 O  O   . LYS B 74  ? 0.3850 0.1857 0.1962 0.0122  -0.0236 0.0125  213 LYS B O   
2707 C  CB  . LYS B 74  ? 0.4235 0.2018 0.2108 0.0223  -0.0190 0.0077  213 LYS B CB  
2708 C  CG  . LYS B 74  ? 0.5136 0.2903 0.2969 0.0301  -0.0159 0.0072  213 LYS B CG  
2709 C  CD  . LYS B 74  ? 0.6100 0.3695 0.3747 0.0308  -0.0159 0.0055  213 LYS B CD  
2710 C  CE  . LYS B 74  ? 0.6503 0.4083 0.4103 0.0395  -0.0123 0.0050  213 LYS B CE  
2711 N  NZ  . LYS B 74  ? 0.6800 0.4203 0.4207 0.0401  -0.0123 0.0033  213 LYS B NZ  
2712 N  N   . LEU B 75  ? 0.3578 0.1718 0.1802 0.0268  -0.0175 0.0117  214 LEU B N   
2713 C  CA  . LEU B 75  ? 0.3229 0.1500 0.1568 0.0256  -0.0178 0.0125  214 LEU B CA  
2714 C  C   . LEU B 75  ? 0.3851 0.2028 0.2086 0.0300  -0.0167 0.0132  214 LEU B C   
2715 O  O   . LEU B 75  ? 0.3803 0.2040 0.2090 0.0277  -0.0178 0.0140  214 LEU B O   
2716 C  CB  . LEU B 75  ? 0.2859 0.1343 0.1386 0.0297  -0.0149 0.0113  214 LEU B CB  
2717 C  CG  . LEU B 75  ? 0.2848 0.1449 0.1499 0.0252  -0.0159 0.0106  214 LEU B CG  
2718 C  CD1 . LEU B 75  ? 0.3060 0.1859 0.1882 0.0291  -0.0132 0.0095  214 LEU B CD1 
2719 C  CD2 . LEU B 75  ? 0.2974 0.1596 0.1657 0.0157  -0.0199 0.0120  214 LEU B CD2 
2720 N  N   . GLY B 76  ? 0.4245 0.2326 0.2374 0.0355  -0.0141 0.0113  215 GLY B N   
2721 C  CA  . GLY B 76  ? 0.4693 0.2711 0.2739 0.0398  -0.0123 0.0107  215 GLY B CA  
2722 C  C   . GLY B 76  ? 0.5143 0.3120 0.3114 0.0487  -0.0082 0.0090  215 GLY B C   
2723 O  O   . GLY B 76  ? 0.4562 0.2557 0.2545 0.0509  -0.0069 0.0082  215 GLY B O   
2724 N  N   . PRO B 77  ? 0.5361 0.3286 0.3253 0.0538  -0.0060 0.0084  216 PRO B N   
2725 C  CA  . PRO B 77  ? 0.5549 0.3446 0.3362 0.0628  -0.0017 0.0072  216 PRO B CA  
2726 C  C   . PRO B 77  ? 0.4788 0.2846 0.2723 0.0690  0.0015  0.0077  216 PRO B C   
2727 O  O   . PRO B 77  ? 0.4754 0.2958 0.2824 0.0705  0.0022  0.0090  216 PRO B O   
2728 C  CB  . PRO B 77  ? 0.6198 0.4063 0.3953 0.0668  0.0000  0.0073  216 PRO B CB  
2729 C  CG  . PRO B 77  ? 0.6372 0.4162 0.4102 0.0581  -0.0044 0.0078  216 PRO B CG  
2730 C  CD  . PRO B 77  ? 0.5329 0.3219 0.3194 0.0513  -0.0075 0.0092  216 PRO B CD  
2731 N  N   . GLY B 78  ? 0.5455 0.3492 0.3343 0.0723  0.0033  0.0068  217 GLY B N   
2732 C  CA  . GLY B 78  ? 0.4988 0.3177 0.2982 0.0779  0.0063  0.0074  217 GLY B CA  
2733 C  C   . GLY B 78  ? 0.4938 0.3233 0.3080 0.0733  0.0041  0.0080  217 GLY B C   
2734 O  O   . GLY B 78  ? 0.5081 0.3517 0.3329 0.0770  0.0062  0.0084  217 GLY B O   
2735 N  N   . ARG B 79  ? 0.4266 0.2500 0.2412 0.0649  0.0000  0.0081  218 ARG B N   
2736 C  CA  . ARG B 79  ? 0.4194 0.2525 0.2472 0.0603  -0.0022 0.0089  218 ARG B CA  
2737 C  C   . ARG B 79  ? 0.4501 0.2732 0.2725 0.0530  -0.0054 0.0083  218 ARG B C   
2738 O  O   . ARG B 79  ? 0.4227 0.2407 0.2437 0.0452  -0.0090 0.0090  218 ARG B O   
2739 C  CB  . ARG B 79  ? 0.3865 0.2280 0.2242 0.0567  -0.0041 0.0103  218 ARG B CB  
2740 C  CG  . ARG B 79  ? 0.3550 0.2100 0.2011 0.0633  -0.0009 0.0106  218 ARG B CG  
2741 C  CD  . ARG B 79  ? 0.3822 0.2539 0.2450 0.0580  -0.0023 0.0105  218 ARG B CD  
2742 N  NE  . ARG B 79  ? 0.4031 0.2666 0.2610 0.0516  -0.0056 0.0112  218 ARG B NE  
2743 C  CZ  . ARG B 79  ? 0.3528 0.2268 0.2224 0.0447  -0.0080 0.0113  218 ARG B CZ  
2744 N  NH1 . ARG B 79  ? 0.3380 0.2296 0.2240 0.0434  -0.0075 0.0105  218 ARG B NH1 
2745 N  NH2 . ARG B 79  ? 0.3538 0.2201 0.2178 0.0391  -0.0110 0.0124  218 ARG B NH2 
2746 N  N   . GLU B 80  ? 0.3973 0.2184 0.2165 0.0554  -0.0040 0.0072  219 GLU B N   
2747 C  CA  . GLU B 80  ? 0.4080 0.2197 0.2212 0.0492  -0.0066 0.0065  219 GLU B CA  
2748 C  C   . GLU B 80  ? 0.3708 0.1915 0.1940 0.0492  -0.0063 0.0065  219 GLU B C   
2749 O  O   . GLU B 80  ? 0.3871 0.2179 0.2170 0.0559  -0.0033 0.0064  219 GLU B O   
2750 C  CB  A GLU B 80  ? 0.5527 0.3497 0.3488 0.0516  -0.0055 0.0050  219 GLU B CB  
2751 C  CB  B GLU B 80  ? 0.5642 0.3612 0.3604 0.0515  -0.0055 0.0050  219 GLU B CB  
2752 C  CG  A GLU B 80  ? 0.6321 0.4188 0.4172 0.0514  -0.0059 0.0048  219 GLU B CG  
2753 C  CG  B GLU B 80  ? 0.6362 0.4219 0.4208 0.0503  -0.0064 0.0048  219 GLU B CG  
2754 C  CD  A GLU B 80  ? 0.6927 0.4642 0.4596 0.0541  -0.0048 0.0032  219 GLU B CD  
2755 C  CD  B GLU B 80  ? 0.6929 0.4631 0.4593 0.0526  -0.0055 0.0032  219 GLU B CD  
2756 O  OE1 A GLU B 80  ? 0.7054 0.4647 0.4625 0.0478  -0.0078 0.0024  219 GLU B OE1 
2757 O  OE1 B GLU B 80  ? 0.7099 0.4796 0.4706 0.0610  -0.0018 0.0028  219 GLU B OE1 
2758 O  OE2 A GLU B 80  ? 0.7041 0.4763 0.4663 0.0626  -0.0010 0.0029  219 GLU B OE2 
2759 O  OE2 B GLU B 80  ? 0.7067 0.4655 0.4641 0.0460  -0.0085 0.0024  219 GLU B OE2 
2760 N  N   . TYR B 81  ? 0.3728 0.1905 0.1972 0.0415  -0.0097 0.0068  220 TYR B N   
2761 C  CA  . TYR B 81  ? 0.3711 0.1995 0.2076 0.0397  -0.0099 0.0066  220 TYR B CA  
2762 C  C   . TYR B 81  ? 0.4321 0.2503 0.2614 0.0340  -0.0123 0.0063  220 TYR B C   
2763 O  O   . TYR B 81  ? 0.4927 0.2997 0.3114 0.0287  -0.0146 0.0062  220 TYR B O   
2764 C  CB  . TYR B 81  ? 0.3561 0.2021 0.2099 0.0342  -0.0113 0.0067  220 TYR B CB  
2765 C  CG  . TYR B 81  ? 0.3362 0.1948 0.1991 0.0392  -0.0089 0.0067  220 TYR B CG  
2766 C  CD1 . TYR B 81  ? 0.3327 0.1870 0.1909 0.0395  -0.0093 0.0075  220 TYR B CD1 
2767 C  CD2 . TYR B 81  ? 0.3165 0.1912 0.1925 0.0432  -0.0063 0.0059  220 TYR B CD2 
2768 C  CE1 . TYR B 81  ? 0.2988 0.1649 0.1654 0.0441  -0.0071 0.0076  220 TYR B CE1 
2769 C  CE2 . TYR B 81  ? 0.3143 0.2006 0.1982 0.0473  -0.0043 0.0060  220 TYR B CE2 
2770 C  CZ  . TYR B 81  ? 0.3334 0.2155 0.2128 0.0479  -0.0046 0.0069  220 TYR B CZ  
2771 O  OH  . TYR B 81  ? 0.4971 0.3913 0.3846 0.0519  -0.0025 0.0071  220 TYR B OH  
2772 N  N   . ARG B 82  ? 0.3967 0.2228 0.2341 0.0341  -0.0117 0.0056  221 ARG B N   
2773 C  CA  . ARG B 82  ? 0.4455 0.2641 0.2782 0.0283  -0.0140 0.0056  221 ARG B CA  
2774 C  C   . ARG B 82  ? 0.3286 0.1641 0.1785 0.0224  -0.0153 0.0053  221 ARG B C   
2775 O  O   . ARG B 82  ? 0.3221 0.1735 0.1859 0.0255  -0.0132 0.0045  221 ARG B O   
2776 C  CB  . ARG B 82  ? 0.5420 0.3569 0.3689 0.0334  -0.0117 0.0041  221 ARG B CB  
2777 C  CG  . ARG B 82  ? 0.7449 0.5543 0.5615 0.0410  -0.0086 0.0034  221 ARG B CG  
2778 C  CD  . ARG B 82  ? 0.9292 0.7380 0.7420 0.0460  -0.0063 0.0025  221 ARG B CD  
2779 N  NE  . ARG B 82  ? 1.0586 0.8750 0.8735 0.0553  -0.0024 0.0027  221 ARG B NE  
2780 C  CZ  . ARG B 82  ? 1.0682 0.8997 0.8970 0.0589  -0.0007 0.0032  221 ARG B CZ  
2781 N  NH1 . ARG B 82  ? 1.0681 0.9074 0.9094 0.0545  -0.0025 0.0034  221 ARG B NH1 
2782 N  NH2 . ARG B 82  ? 1.0090 0.8482 0.8388 0.0668  0.0028  0.0037  221 ARG B NH2 
2783 N  N   . ALA B 83  ? 0.3319 0.1636 0.1801 0.0140  -0.0187 0.0062  222 ALA B N   
2784 C  CA  . ALA B 83  ? 0.3090 0.1562 0.1724 0.0085  -0.0200 0.0064  222 ALA B CA  
2785 C  C   . ALA B 83  ? 0.3220 0.1751 0.1916 0.0099  -0.0187 0.0052  222 ALA B C   
2786 O  O   . ALA B 83  ? 0.3640 0.2056 0.2234 0.0111  -0.0186 0.0048  222 ALA B O   
2787 C  CB  . ALA B 83  ? 0.3351 0.1774 0.1943 -0.0008 -0.0240 0.0082  222 ALA B CB  
2788 N  N   . LEU B 84  ? 0.2853 0.1558 0.1712 0.0099  -0.0178 0.0046  223 LEU B N   
2789 C  CA  . LEU B 84  ? 0.2832 0.1610 0.1766 0.0111  -0.0166 0.0035  223 LEU B CA  
2790 C  C   . LEU B 84  ? 0.3366 0.2210 0.2372 0.0039  -0.0189 0.0042  223 LEU B C   
2791 O  O   . LEU B 84  ? 0.2984 0.1805 0.1978 0.0023  -0.0192 0.0039  223 LEU B O   
2792 C  CB  . LEU B 84  ? 0.2833 0.1756 0.1889 0.0165  -0.0137 0.0024  223 LEU B CB  
2793 C  CG  . LEU B 84  ? 0.3002 0.1906 0.2015 0.0242  -0.0110 0.0020  223 LEU B CG  
2794 C  CD1 . LEU B 84  ? 0.3878 0.2950 0.3029 0.0276  -0.0089 0.0013  223 LEU B CD1 
2795 C  CD2 . LEU B 84  ? 0.3970 0.2766 0.2874 0.0288  -0.0096 0.0016  223 LEU B CD2 
2796 N  N   . GLN B 85  ? 0.2618 0.1554 0.1704 0.0001  -0.0202 0.0051  224 GLN B N   
2797 C  CA  . GLN B 85  ? 0.2667 0.1696 0.1841 -0.0055 -0.0218 0.0060  224 GLN B CA  
2798 C  C   . GLN B 85  ? 0.2481 0.1580 0.1704 -0.0091 -0.0235 0.0076  224 GLN B C   
2799 O  O   . GLN B 85  ? 0.2698 0.1800 0.1918 -0.0065 -0.0228 0.0075  224 GLN B O   
2800 C  CB  . GLN B 85  ? 0.2315 0.1471 0.1613 -0.0026 -0.0198 0.0045  224 GLN B CB  
2801 C  CG  . GLN B 85  ? 0.2192 0.1439 0.1568 0.0030  -0.0173 0.0032  224 GLN B CG  
2802 C  CD  . GLN B 85  ? 0.1976 0.1361 0.1474 0.0012  -0.0175 0.0036  224 GLN B CD  
2803 O  OE1 . GLN B 85  ? 0.2045 0.1456 0.1561 -0.0038 -0.0196 0.0051  224 GLN B OE1 
2804 N  NE2 . GLN B 85  ? 0.2094 0.1568 0.1671 0.0054  -0.0154 0.0023  224 GLN B NE2 
2805 N  N   . LEU B 86  ? 0.2211 0.1371 0.1480 -0.0149 -0.0255 0.0092  225 LEU B N   
2806 C  CA  . LEU B 86  ? 0.1824 0.1083 0.1163 -0.0178 -0.0268 0.0108  225 LEU B CA  
2807 C  C   . LEU B 86  ? 0.2163 0.1561 0.1623 -0.0190 -0.0265 0.0111  225 LEU B C   
2808 O  O   . LEU B 86  ? 0.2098 0.1498 0.1567 -0.0200 -0.0264 0.0108  225 LEU B O   
2809 C  CB  . LEU B 86  ? 0.2030 0.1218 0.1280 -0.0243 -0.0301 0.0136  225 LEU B CB  
2810 C  CG  . LEU B 86  ? 0.2035 0.1176 0.1226 -0.0310 -0.0327 0.0157  225 LEU B CG  
2811 C  CD1 . LEU B 86  ? 0.2228 0.1516 0.1524 -0.0348 -0.0338 0.0177  225 LEU B CD1 
2812 C  CD2 . LEU B 86  ? 0.2841 0.1853 0.1895 -0.0361 -0.0357 0.0178  225 LEU B CD2 
2813 N  N   . HIS B 87  ? 0.1631 0.1142 0.1179 -0.0189 -0.0264 0.0118  226 HIS B N   
2814 C  CA  . HIS B 87  ? 0.1680 0.1319 0.1333 -0.0196 -0.0262 0.0123  226 HIS B CA  
2815 C  C   . HIS B 87  ? 0.1700 0.1430 0.1406 -0.0211 -0.0272 0.0142  226 HIS B C   
2816 O  O   . HIS B 87  ? 0.1775 0.1469 0.1440 -0.0217 -0.0280 0.0149  226 HIS B O   
2817 C  CB  . HIS B 87  ? 0.1284 0.0976 0.1011 -0.0142 -0.0233 0.0095  226 HIS B CB  
2818 C  CG  . HIS B 87  ? 0.1358 0.1074 0.1115 -0.0096 -0.0216 0.0080  226 HIS B CG  
2819 N  ND1 . HIS B 87  ? 0.1636 0.1278 0.1340 -0.0058 -0.0201 0.0064  226 HIS B ND1 
2820 C  CD2 . HIS B 87  ? 0.1176 0.0984 0.1005 -0.0083 -0.0210 0.0080  226 HIS B CD2 
2821 C  CE1 . HIS B 87  ? 0.1790 0.1483 0.1537 -0.0026 -0.0188 0.0056  226 HIS B CE1 
2822 N  NE2 . HIS B 87  ? 0.1084 0.0874 0.0907 -0.0041 -0.0194 0.0065  226 HIS B NE2 
2823 N  N   . LEU B 88  ? 0.1409 0.1255 0.1202 -0.0215 -0.0269 0.0150  227 LEU B N   
2824 C  CA  . LEU B 88  ? 0.1486 0.1430 0.1328 -0.0231 -0.0280 0.0174  227 LEU B CA  
2825 C  C   . LEU B 88  ? 0.1711 0.1764 0.1654 -0.0188 -0.0260 0.0162  227 LEU B C   
2826 O  O   . LEU B 88  ? 0.1527 0.1597 0.1509 -0.0159 -0.0241 0.0141  227 LEU B O   
2827 C  CB  A LEU B 88  ? 0.1571 0.1553 0.1401 -0.0288 -0.0305 0.0210  227 LEU B CB  
2828 C  CB  B LEU B 88  ? 0.1702 0.1687 0.1535 -0.0287 -0.0304 0.0210  227 LEU B CB  
2829 C  CG  A LEU B 88  ? 0.2220 0.2095 0.1941 -0.0344 -0.0330 0.0229  227 LEU B CG  
2830 C  CG  B LEU B 88  ? 0.2329 0.2234 0.2063 -0.0351 -0.0334 0.0237  227 LEU B CG  
2831 C  CD1 A LEU B 88  ? 0.1963 0.1888 0.1683 -0.0396 -0.0349 0.0261  227 LEU B CD1 
2832 C  CD1 B LEU B 88  ? 0.2551 0.2414 0.2233 -0.0371 -0.0350 0.0250  227 LEU B CD1 
2833 C  CD2 A LEU B 88  ? 0.2606 0.2447 0.2276 -0.0369 -0.0349 0.0245  227 LEU B CD2 
2834 C  CD2 B LEU B 88  ? 0.1793 0.1574 0.1451 -0.0356 -0.0332 0.0220  227 LEU B CD2 
2835 N  N   . HIS B 89  ? 0.1159 0.1285 0.1140 -0.0187 -0.0264 0.0176  228 HIS B N   
2836 C  CA  . HIS B 89  ? 0.0977 0.1205 0.1043 -0.0151 -0.0248 0.0169  228 HIS B CA  
2837 C  C   . HIS B 89  ? 0.1137 0.1462 0.1232 -0.0176 -0.0264 0.0206  228 HIS B C   
2838 O  O   . HIS B 89  ? 0.1339 0.1661 0.1401 -0.0209 -0.0284 0.0230  228 HIS B O   
2839 C  CB  . HIS B 89  ? 0.1055 0.1280 0.1141 -0.0113 -0.0234 0.0147  228 HIS B CB  
2840 C  CG  . HIS B 89  ? 0.1062 0.1208 0.1120 -0.0086 -0.0218 0.0117  228 HIS B CG  
2841 N  ND1 . HIS B 89  ? 0.1043 0.1208 0.1142 -0.0052 -0.0197 0.0092  228 HIS B ND1 
2842 C  CD2 . HIS B 89  ? 0.1150 0.1200 0.1140 -0.0086 -0.0219 0.0109  228 HIS B CD2 
2843 C  CE1 . HIS B 89  ? 0.1067 0.1163 0.1130 -0.0033 -0.0186 0.0072  228 HIS B CE1 
2844 N  NE2 . HIS B 89  ? 0.1153 0.1178 0.1150 -0.0049 -0.0198 0.0082  228 HIS B NE2 
2845 N  N   . TRP B 90  ? 0.0993 0.1401 0.1143 -0.0157 -0.0254 0.0211  229 TRP B N   
2846 C  CA  . TRP B 90  ? 0.0834 0.1344 0.1008 -0.0176 -0.0267 0.0251  229 TRP B CA  
2847 C  C   . TRP B 90  ? 0.1011 0.1613 0.1250 -0.0131 -0.0249 0.0248  229 TRP B C   
2848 O  O   . TRP B 90  ? 0.1119 0.1699 0.1381 -0.0091 -0.0228 0.0215  229 TRP B O   
2849 C  CB  . TRP B 90  ? 0.1064 0.1573 0.1206 -0.0221 -0.0284 0.0278  229 TRP B CB  
2850 C  CG  . TRP B 90  ? 0.1051 0.1540 0.1204 -0.0204 -0.0268 0.0259  229 TRP B CG  
2851 C  CD1 . TRP B 90  ? 0.1210 0.1772 0.1409 -0.0174 -0.0253 0.0262  229 TRP B CD1 
2852 C  CD2 . TRP B 90  ? 0.1387 0.1773 0.1497 -0.0212 -0.0265 0.0234  229 TRP B CD2 
2853 N  NE1 . TRP B 90  ? 0.1351 0.1864 0.1544 -0.0168 -0.0243 0.0241  229 TRP B NE1 
2854 C  CE2 . TRP B 90  ? 0.1296 0.1705 0.1437 -0.0191 -0.0250 0.0224  229 TRP B CE2 
2855 C  CE3 . TRP B 90  ? 0.1227 0.1500 0.1271 -0.0232 -0.0273 0.0221  229 TRP B CE3 
2856 C  CZ2 . TRP B 90  ? 0.1012 0.1343 0.1127 -0.0192 -0.0243 0.0202  229 TRP B CZ2 
2857 C  CZ3 . TRP B 90  ? 0.1200 0.1394 0.1214 -0.0229 -0.0265 0.0199  229 TRP B CZ3 
2858 C  CH2 . TRP B 90  ? 0.1333 0.1562 0.1387 -0.0211 -0.0251 0.0190  229 TRP B CH2 
2859 N  N   . GLY B 91  ? 0.1313 0.2017 0.1576 -0.0136 -0.0257 0.0286  230 GLY B N   
2860 C  CA  . GLY B 91  ? 0.1383 0.2167 0.1695 -0.0088 -0.0239 0.0285  230 GLY B CA  
2861 C  C   . GLY B 91  ? 0.1540 0.2371 0.1861 -0.0078 -0.0231 0.0301  230 GLY B C   
2862 O  O   . GLY B 91  ? 0.1413 0.2194 0.1724 -0.0078 -0.0225 0.0283  230 GLY B O   
2863 N  N   A ALA B 92  ? 0.1455 0.2343 0.1775 -0.0064 -0.0215 0.0323  231 ALA B N   
2864 N  N   B ALA B 92  ? 0.1429 0.2316 0.1748 -0.0069 -0.0217 0.0325  231 ALA B N   
2865 C  CA  A ALA B 92  ? 0.1233 0.2163 0.1554 -0.0048 -0.0200 0.0339  231 ALA B CA  
2866 C  CA  B ALA B 92  ? 0.1110 0.2037 0.1425 -0.0062 -0.0206 0.0345  231 ALA B CA  
2867 C  C   A ALA B 92  ? 0.1557 0.2555 0.1868 -0.0050 -0.0189 0.0374  231 ALA B C   
2868 C  C   B ALA B 92  ? 0.1798 0.2784 0.2096 -0.0089 -0.0205 0.0386  231 ALA B C   
2869 O  O   A ALA B 92  ? 0.1600 0.2616 0.1918 -0.0025 -0.0179 0.0371  231 ALA B O   
2870 O  O   B ALA B 92  ? 0.1764 0.2749 0.2049 -0.0121 -0.0218 0.0399  231 ALA B O   
2871 C  CB  A ALA B 92  ? 0.1426 0.2346 0.1767 0.0009  -0.0180 0.0310  231 ALA B CB  
2872 C  CB  B ALA B 92  ? 0.1786 0.2728 0.2120 -0.0001 -0.0180 0.0326  231 ALA B CB  
2873 N  N   . ALA B 93  ? 0.2121 0.3161 0.2418 -0.0075 -0.0189 0.0408  232 ALA B N   
2874 C  CA  . ALA B 93  ? 0.2815 0.3929 0.3102 -0.0091 -0.0180 0.0449  232 ALA B CA  
2875 C  C   . ALA B 93  ? 0.3080 0.4221 0.3374 -0.0067 -0.0170 0.0450  232 ALA B C   
2876 O  O   . ALA B 93  ? 0.4427 0.5580 0.4729 -0.0013 -0.0149 0.0436  232 ALA B O   
2877 C  CB  . ALA B 93  ? 0.4079 0.5251 0.4367 -0.0066 -0.0159 0.0469  232 ALA B CB  
2878 N  N   . GLY B 94  ? 0.2005 0.3149 0.2288 -0.0110 -0.0184 0.0467  233 GLY B N   
2879 C  CA  . GLY B 94  ? 0.1796 0.2965 0.2085 -0.0095 -0.0177 0.0470  233 GLY B CA  
2880 C  C   . GLY B 94  ? 0.2507 0.3615 0.2807 -0.0070 -0.0181 0.0429  233 GLY B C   
2881 O  O   . GLY B 94  ? 0.2038 0.3156 0.2341 -0.0068 -0.0180 0.0431  233 GLY B O   
2882 N  N   . ARG B 95  ? 0.1557 0.2606 0.1867 -0.0054 -0.0186 0.0395  234 ARG B N   
2883 C  CA  . ARG B 95  ? 0.1300 0.2301 0.1624 -0.0027 -0.0186 0.0357  234 ARG B CA  
2884 C  C   . ARG B 95  ? 0.1536 0.2478 0.1854 -0.0064 -0.0210 0.0344  234 ARG B C   
2885 O  O   . ARG B 95  ? 0.1692 0.2608 0.1998 -0.0090 -0.0224 0.0347  234 ARG B O   
2886 C  CB  . ARG B 95  ? 0.2196 0.3180 0.2535 0.0026  -0.0168 0.0327  234 ARG B CB  
2887 C  CG  . ARG B 95  ? 0.3774 0.4717 0.4128 0.0056  -0.0162 0.0291  234 ARG B CG  
2888 C  CD  . ARG B 95  ? 0.3656 0.4576 0.4016 0.0101  -0.0146 0.0264  234 ARG B CD  
2889 N  NE  . ARG B 95  ? 0.3706 0.4579 0.4082 0.0115  -0.0146 0.0228  234 ARG B NE  
2890 C  CZ  . ARG B 95  ? 0.3984 0.4829 0.4364 0.0148  -0.0134 0.0202  234 ARG B CZ  
2891 N  NH1 . ARG B 95  ? 0.3378 0.4233 0.3746 0.0174  -0.0122 0.0207  234 ARG B NH1 
2892 N  NH2 . ARG B 95  ? 0.4275 0.5084 0.4668 0.0155  -0.0133 0.0172  234 ARG B NH2 
2893 N  N   . PRO B 96  ? 0.1405 0.2325 0.1725 -0.0067 -0.0217 0.0333  235 PRO B N   
2894 C  CA  . PRO B 96  ? 0.1259 0.2124 0.1564 -0.0102 -0.0242 0.0326  235 PRO B CA  
2895 C  C   . PRO B 96  ? 0.1006 0.1823 0.1328 -0.0079 -0.0242 0.0290  235 PRO B C   
2896 O  O   . PRO B 96  ? 0.1212 0.2037 0.1561 -0.0033 -0.0221 0.0266  235 PRO B O   
2897 C  CB  . PRO B 96  ? 0.1251 0.2119 0.1555 -0.0106 -0.0246 0.0329  235 PRO B CB  
2898 C  CG  . PRO B 96  ? 0.1339 0.2240 0.1671 -0.0053 -0.0218 0.0313  235 PRO B CG  
2899 C  CD  . PRO B 96  ? 0.1495 0.2439 0.1827 -0.0039 -0.0203 0.0329  235 PRO B CD  
2900 N  N   . GLY B 97  ? 0.0941 0.1699 0.1237 -0.0112 -0.0264 0.0287  236 GLY B N   
2901 C  CA  . GLY B 97  ? 0.0925 0.1594 0.1213 -0.0089 -0.0246 0.0242  236 GLY B CA  
2902 C  C   . GLY B 97  ? 0.1417 0.1987 0.1660 -0.0105 -0.0251 0.0224  236 GLY B C   
2903 O  O   . GLY B 97  ? 0.1060 0.1552 0.1282 -0.0096 -0.0240 0.0196  236 GLY B O   
2904 N  N   . SER B 98  ? 0.0969 0.1539 0.1194 -0.0124 -0.0266 0.0239  237 SER B N   
2905 C  CA  . SER B 98  ? 0.0723 0.1194 0.0901 -0.0127 -0.0266 0.0219  237 SER B CA  
2906 C  C   . SER B 98  ? 0.0925 0.1385 0.1137 -0.0077 -0.0240 0.0181  237 SER B C   
2907 O  O   . SER B 98  ? 0.1175 0.1706 0.1443 -0.0045 -0.0227 0.0174  237 SER B O   
2908 C  CB  . SER B 98  ? 0.1200 0.1668 0.1347 -0.0157 -0.0287 0.0243  237 SER B CB  
2909 O  OG  . SER B 98  ? 0.1089 0.1634 0.1288 -0.0132 -0.0281 0.0245  237 SER B OG  
2910 N  N   . GLU B 99  ? 0.1046 0.1417 0.1217 -0.0069 -0.0233 0.0159  238 GLU B N   
2911 C  CA  . GLU B 99  ? 0.0762 0.1128 0.0960 -0.0026 -0.0210 0.0128  238 GLU B CA  
2912 C  C   . GLU B 99  ? 0.0868 0.1253 0.1075 -0.0013 -0.0210 0.0129  238 GLU B C   
2913 O  O   . GLU B 99  ? 0.1164 0.1610 0.1423 0.0015  -0.0197 0.0119  238 GLU B O   
2914 C  CB  . GLU B 99  ? 0.0933 0.1207 0.1083 -0.0017 -0.0201 0.0107  238 GLU B CB  
2915 C  CG  . GLU B 99  ? 0.0879 0.1138 0.1027 -0.0025 -0.0199 0.0103  238 GLU B CG  
2916 C  CD  . GLU B 99  ? 0.1040 0.1262 0.1186 0.0005  -0.0178 0.0074  238 GLU B CD  
2917 O  OE1 . GLU B 99  ? 0.1112 0.1380 0.1305 0.0024  -0.0165 0.0061  238 GLU B OE1 
2918 O  OE2 . GLU B 99  ? 0.1284 0.1431 0.1378 0.0012  -0.0175 0.0067  238 GLU B OE2 
2919 N  N   . HIS B 100 ? 0.1069 0.1395 0.1219 -0.0036 -0.0224 0.0142  239 HIS B N   
2920 C  CA  . HIS B 100 ? 0.1036 0.1379 0.1191 -0.0029 -0.0227 0.0147  239 HIS B CA  
2921 C  C   . HIS B 100 ? 0.0937 0.1374 0.1134 -0.0047 -0.0241 0.0174  239 HIS B C   
2922 O  O   . HIS B 100 ? 0.1151 0.1620 0.1348 -0.0075 -0.0256 0.0196  239 HIS B O   
2923 C  CB  . HIS B 100 ? 0.1036 0.1277 0.1106 -0.0047 -0.0238 0.0153  239 HIS B CB  
2924 C  CG  . HIS B 100 ? 0.1083 0.1244 0.1113 -0.0014 -0.0219 0.0128  239 HIS B CG  
2925 N  ND1 . HIS B 100 ? 0.1241 0.1332 0.1227 -0.0018 -0.0216 0.0119  239 HIS B ND1 
2926 C  CD2 . HIS B 100 ? 0.1184 0.1334 0.1216 0.0025  -0.0200 0.0111  239 HIS B CD2 
2927 C  CE1 . HIS B 100 ? 0.1201 0.1242 0.1161 0.0020  -0.0197 0.0099  239 HIS B CE1 
2928 N  NE2 . HIS B 100 ? 0.1233 0.1311 0.1221 0.0046  -0.0186 0.0095  239 HIS B NE2 
2929 N  N   . THR B 101 ? 0.0983 0.1473 0.1216 -0.0028 -0.0237 0.0173  240 THR B N   
2930 C  CA  . THR B 101 ? 0.1120 0.1701 0.1390 -0.0041 -0.0251 0.0201  240 THR B CA  
2931 C  C   . THR B 101 ? 0.1309 0.1874 0.1553 -0.0054 -0.0263 0.0213  240 THR B C   
2932 O  O   . THR B 101 ? 0.1016 0.1507 0.1225 -0.0041 -0.0255 0.0195  240 THR B O   
2933 C  CB  . THR B 101 ? 0.0566 0.1240 0.0910 -0.0002 -0.0234 0.0190  240 THR B CB  
2934 O  OG1 . THR B 101 ? 0.0853 0.1512 0.1214 0.0032  -0.0214 0.0161  240 THR B OG1 
2935 C  CG2 . THR B 101 ? 0.1045 0.1733 0.1406 0.0008  -0.0224 0.0182  240 THR B CG2 
2936 N  N   . VAL B 102 ? 0.1087 0.1719 0.1344 -0.0079 -0.0283 0.0245  241 VAL B N   
2937 C  CA  . VAL B 102 ? 0.1219 0.1845 0.1458 -0.0091 -0.0295 0.0257  241 VAL B CA  
2938 C  C   . VAL B 102 ? 0.0982 0.1716 0.1289 -0.0070 -0.0287 0.0264  241 VAL B C   
2939 O  O   . VAL B 102 ? 0.0961 0.1730 0.1275 -0.0077 -0.0277 0.0274  241 VAL B O   
2940 C  CB  . VAL B 102 ? 0.1181 0.1763 0.1349 -0.0151 -0.0327 0.0292  241 VAL B CB  
2941 C  CG1 . VAL B 102 ? 0.1397 0.1983 0.1549 -0.0165 -0.0341 0.0307  241 VAL B CG1 
2942 C  CG2 . VAL B 102 ? 0.1685 0.2131 0.1768 -0.0169 -0.0329 0.0279  241 VAL B CG2 
2943 N  N   . GLU B 103 ? 0.1097 0.1836 0.1428 -0.0037 -0.0273 0.0244  242 GLU B N   
2944 C  CA  . GLU B 103 ? 0.1365 0.2139 0.1731 -0.0009 -0.0246 0.0228  242 GLU B CA  
2945 C  C   . GLU B 103 ? 0.1077 0.1871 0.1465 0.0012  -0.0223 0.0213  242 GLU B C   
2946 O  O   . GLU B 103 ? 0.1210 0.2030 0.1603 0.0017  -0.0211 0.0217  242 GLU B O   
2947 C  CB  A GLU B 103 ? 0.1842 0.2634 0.2191 -0.0037 -0.0257 0.0253  242 GLU B CB  
2948 C  CB  B GLU B 103 ? 0.2047 0.2836 0.2394 -0.0037 -0.0258 0.0253  242 GLU B CB  
2949 C  CG  A GLU B 103 ? 0.1821 0.2589 0.2146 -0.0052 -0.0277 0.0265  242 GLU B CG  
2950 C  CG  B GLU B 103 ? 0.2458 0.3219 0.2778 -0.0054 -0.0281 0.0266  242 GLU B CG  
2951 C  CD  A GLU B 103 ? 0.2558 0.3335 0.2915 -0.0012 -0.0255 0.0239  242 GLU B CD  
2952 C  CD  B GLU B 103 ? 0.3548 0.4297 0.3820 -0.0107 -0.0309 0.0303  242 GLU B CD  
2953 O  OE1 A GLU B 103 ? 0.4342 0.5100 0.4683 -0.0012 -0.0268 0.0245  242 GLU B OE1 
2954 O  OE1 B GLU B 103 ? 0.4863 0.5603 0.5105 -0.0143 -0.0323 0.0323  242 GLU B OE1 
2955 O  OE2 A GLU B 103 ? 0.3597 0.4392 0.3987 0.0018  -0.0227 0.0214  242 GLU B OE2 
2956 O  OE2 B GLU B 103 ? 0.4345 0.5092 0.4607 -0.0114 -0.0316 0.0311  242 GLU B OE2 
2957 N  N   . GLY B 104 ? 0.0989 0.1767 0.1384 0.0024  -0.0218 0.0198  243 GLY B N   
2958 C  CA  . GLY B 104 ? 0.1038 0.1824 0.1449 0.0046  -0.0199 0.0183  243 GLY B CA  
2959 C  C   . GLY B 104 ? 0.1199 0.2002 0.1595 0.0027  -0.0206 0.0205  243 GLY B C   
2960 O  O   . GLY B 104 ? 0.1215 0.2024 0.1620 0.0046  -0.0192 0.0195  243 GLY B O   
2961 N  N   . HIS B 105 ? 0.0944 0.1754 0.1315 -0.0013 -0.0228 0.0236  244 HIS B N   
2962 C  CA  . HIS B 105 ? 0.0812 0.1644 0.1166 -0.0038 -0.0234 0.0263  244 HIS B CA  
2963 C  C   . HIS B 105 ? 0.1187 0.1988 0.1522 -0.0061 -0.0252 0.0268  244 HIS B C   
2964 O  O   . HIS B 105 ? 0.1095 0.1854 0.1409 -0.0080 -0.0273 0.0269  244 HIS B O   
2965 C  CB  . HIS B 105 ? 0.0911 0.1766 0.1242 -0.0075 -0.0247 0.0298  244 HIS B CB  
2966 C  CG  . HIS B 105 ? 0.0938 0.1828 0.1285 -0.0053 -0.0230 0.0296  244 HIS B CG  
2967 N  ND1 . HIS B 105 ? 0.1167 0.2099 0.1521 -0.0034 -0.0212 0.0304  244 HIS B ND1 
2968 C  CD2 . HIS B 105 ? 0.1119 0.2006 0.1472 -0.0046 -0.0229 0.0289  244 HIS B CD2 
2969 C  CE1 . HIS B 105 ? 0.0757 0.1708 0.1119 -0.0018 -0.0201 0.0301  244 HIS B CE1 
2970 N  NE2 . HIS B 105 ? 0.0926 0.1850 0.1290 -0.0026 -0.0211 0.0292  244 HIS B NE2 
2971 N  N   . ARG B 106 ? 0.0910 0.1728 0.1247 -0.0060 -0.0245 0.0274  245 ARG B N   
2972 C  CA  . ARG B 106 ? 0.0977 0.1764 0.1297 -0.0081 -0.0260 0.0277  245 ARG B CA  
2973 C  C   . ARG B 106 ? 0.1310 0.2100 0.1590 -0.0133 -0.0280 0.0314  245 ARG B C   
2974 O  O   . ARG B 106 ? 0.1454 0.2292 0.1735 -0.0142 -0.0272 0.0337  245 ARG B O   
2975 C  CB  . ARG B 106 ? 0.1092 0.1891 0.1439 -0.0044 -0.0238 0.0256  245 ARG B CB  
2976 C  CG  . ARG B 106 ? 0.1083 0.1847 0.1422 -0.0055 -0.0250 0.0250  245 ARG B CG  
2977 C  CD  . ARG B 106 ? 0.1243 0.2019 0.1607 -0.0019 -0.0228 0.0230  245 ARG B CD  
2978 N  NE  . ARG B 106 ? 0.1764 0.2543 0.2156 0.0025  -0.0205 0.0201  245 ARG B NE  
2979 C  CZ  . ARG B 106 ? 0.1564 0.2313 0.1968 0.0043  -0.0199 0.0174  245 ARG B CZ  
2980 N  NH1 . ARG B 106 ? 0.1321 0.1989 0.1690 0.0024  -0.0201 0.0160  245 ARG B NH1 
2981 N  NH2 . ARG B 106 ? 0.2386 0.3138 0.2808 0.0077  -0.0179 0.0150  245 ARG B NH2 
2982 N  N   . PHE B 107 ? 0.0997 0.1729 0.1236 -0.0171 -0.0306 0.0320  246 PHE B N   
2983 C  CA  . PHE B 107 ? 0.1188 0.1900 0.1375 -0.0229 -0.0328 0.0352  246 PHE B CA  
2984 C  C   . PHE B 107 ? 0.1084 0.1805 0.1277 -0.0228 -0.0322 0.0352  246 PHE B C   
2985 O  O   . PHE B 107 ? 0.1129 0.1848 0.1354 -0.0190 -0.0310 0.0325  246 PHE B O   
2986 C  CB  . PHE B 107 ? 0.1291 0.1899 0.1403 -0.0272 -0.0358 0.0354  246 PHE B CB  
2987 C  CG  . PHE B 107 ? 0.1358 0.1958 0.1453 -0.0283 -0.0370 0.0363  246 PHE B CG  
2988 C  CD1 . PHE B 107 ? 0.1603 0.2194 0.1730 -0.0234 -0.0350 0.0332  246 PHE B CD1 
2989 C  CD2 . PHE B 107 ? 0.2042 0.2630 0.2087 -0.0338 -0.0389 0.0396  246 PHE B CD2 
2990 C  CE1 . PHE B 107 ? 0.2137 0.2723 0.2251 -0.0242 -0.0360 0.0340  246 PHE B CE1 
2991 C  CE2 . PHE B 107 ? 0.2310 0.2884 0.2338 -0.0347 -0.0398 0.0402  246 PHE B CE2 
2992 C  CZ  . PHE B 107 ? 0.2345 0.2925 0.2407 -0.0300 -0.0389 0.0377  246 PHE B CZ  
2993 N  N   . PRO B 108 ? 0.1201 0.1935 0.1364 -0.0272 -0.0330 0.0384  247 PRO B N   
2994 C  CA  . PRO B 108 ? 0.1362 0.2111 0.1532 -0.0269 -0.0322 0.0386  247 PRO B CA  
2995 C  C   . PRO B 108 ? 0.1481 0.2157 0.1633 -0.0269 -0.0336 0.0361  247 PRO B C   
2996 O  O   . PRO B 108 ? 0.1269 0.1958 0.1455 -0.0233 -0.0316 0.0341  247 PRO B O   
2997 C  CB  . PRO B 108 ? 0.1437 0.2198 0.1567 -0.0328 -0.0334 0.0427  247 PRO B CB  
2998 C  CG  . PRO B 108 ? 0.1507 0.2314 0.1642 -0.0336 -0.0329 0.0448  247 PRO B CG  
2999 C  CD  . PRO B 108 ? 0.1371 0.2126 0.1504 -0.0319 -0.0339 0.0421  247 PRO B CD  
3000 N  N   . ALA B 109 ? 0.1112 0.1671 0.1196 -0.0298 -0.0348 0.0349  248 ALA B N   
3001 C  CA  . ALA B 109 ? 0.1278 0.1724 0.1328 -0.0284 -0.0334 0.0312  248 ALA B CA  
3002 C  C   . ALA B 109 ? 0.1505 0.1831 0.1490 -0.0288 -0.0337 0.0291  248 ALA B C   
3003 O  O   . ALA B 109 ? 0.1436 0.1762 0.1404 -0.0302 -0.0349 0.0304  248 ALA B O   
3004 C  CB  . ALA B 109 ? 0.1548 0.1972 0.1561 -0.0324 -0.0346 0.0328  248 ALA B CB  
3005 N  N   . GLU B 110 ? 0.1257 0.1479 0.1204 -0.0272 -0.0324 0.0260  249 GLU B N   
3006 C  CA  . GLU B 110 ? 0.1306 0.1414 0.1190 -0.0261 -0.0321 0.0239  249 GLU B CA  
3007 C  C   . GLU B 110 ? 0.1721 0.1713 0.1536 -0.0265 -0.0318 0.0222  249 GLU B C   
3008 O  O   . GLU B 110 ? 0.1560 0.1570 0.1409 -0.0246 -0.0303 0.0207  249 GLU B O   
3009 C  CB  . GLU B 110 ? 0.1296 0.1434 0.1239 -0.0200 -0.0294 0.0209  249 GLU B CB  
3010 C  CG  . GLU B 110 ? 0.1270 0.1309 0.1155 -0.0180 -0.0287 0.0190  249 GLU B CG  
3011 C  CD  . GLU B 110 ? 0.1224 0.1319 0.1173 -0.0129 -0.0265 0.0169  249 GLU B CD  
3012 O  OE1 . GLU B 110 ? 0.1184 0.1386 0.1207 -0.0121 -0.0263 0.0177  249 GLU B OE1 
3013 O  OE2 . GLU B 110 ? 0.1289 0.1322 0.1211 -0.0095 -0.0249 0.0147  249 GLU B OE2 
3014 N  N   . ILE B 111 ? 0.1829 0.1698 0.1541 -0.0289 -0.0331 0.0224  250 ILE B N   
3015 C  CA  . ILE B 111 ? 0.1629 0.1373 0.1262 -0.0287 -0.0327 0.0207  250 ILE B CA  
3016 C  C   . ILE B 111 ? 0.1535 0.1200 0.1136 -0.0232 -0.0305 0.0177  250 ILE B C   
3017 O  O   . ILE B 111 ? 0.1631 0.1282 0.1216 -0.0222 -0.0306 0.0179  250 ILE B O   
3018 C  CB  . ILE B 111 ? 0.1707 0.1348 0.1223 -0.0354 -0.0359 0.0234  250 ILE B CB  
3019 C  CG1 . ILE B 111 ? 0.1901 0.1410 0.1332 -0.0346 -0.0353 0.0214  250 ILE B CG1 
3020 C  CG2 . ILE B 111 ? 0.1973 0.1558 0.1419 -0.0381 -0.0379 0.0251  250 ILE B CG2 
3021 C  CD1 . ILE B 111 ? 0.2172 0.1586 0.1492 -0.0417 -0.0384 0.0240  250 ILE B CD1 
3022 N  N   . HIS B 112 ? 0.1562 0.1185 0.1158 -0.0195 -0.0284 0.0151  251 HIS B N   
3023 C  CA  . HIS B 112 ? 0.1375 0.0930 0.0936 -0.0140 -0.0261 0.0126  251 HIS B CA  
3024 C  C   . HIS B 112 ? 0.1973 0.1389 0.1424 -0.0140 -0.0262 0.0120  251 HIS B C   
3025 O  O   . HIS B 112 ? 0.2115 0.1529 0.1572 -0.0151 -0.0262 0.0116  251 HIS B O   
3026 C  CB  . HIS B 112 ? 0.1527 0.1172 0.1187 -0.0087 -0.0232 0.0102  251 HIS B CB  
3027 C  CG  . HIS B 112 ? 0.1197 0.0961 0.0952 -0.0074 -0.0226 0.0103  251 HIS B CG  
3028 N  ND1 . HIS B 112 ? 0.1245 0.1102 0.1093 -0.0041 -0.0206 0.0086  251 HIS B ND1 
3029 C  CD2 . HIS B 112 ? 0.1649 0.1449 0.1416 -0.0091 -0.0239 0.0119  251 HIS B CD2 
3030 C  CE1 . HIS B 112 ? 0.1204 0.1145 0.1113 -0.0036 -0.0206 0.0091  251 HIS B CE1 
3031 N  NE2 . HIS B 112 ? 0.1309 0.1222 0.1174 -0.0064 -0.0225 0.0111  251 HIS B NE2 
3032 N  N   . VAL B 113 ? 0.2028 0.1327 0.1377 -0.0124 -0.0262 0.0117  252 VAL B N   
3033 C  CA  . VAL B 113 ? 0.1853 0.1010 0.1087 -0.0109 -0.0257 0.0108  252 VAL B CA  
3034 C  C   . VAL B 113 ? 0.2270 0.1415 0.1504 -0.0032 -0.0225 0.0086  252 VAL B C   
3035 O  O   . VAL B 113 ? 0.2413 0.1538 0.1622 -0.0005 -0.0219 0.0087  252 VAL B O   
3036 C  CB  . VAL B 113 ? 0.2181 0.1186 0.1266 -0.0151 -0.0284 0.0126  252 VAL B CB  
3037 C  CG1 . VAL B 113 ? 0.2396 0.1250 0.1357 -0.0137 -0.0280 0.0117  252 VAL B CG1 
3038 C  CG2 . VAL B 113 ? 0.2422 0.1462 0.1514 -0.0234 -0.0319 0.0155  252 VAL B CG2 
3039 N  N   . VAL B 114 ? 0.2120 0.1286 0.1384 0.0004  -0.0205 0.0070  253 VAL B N   
3040 C  CA  . VAL B 114 ? 0.1913 0.1106 0.1199 0.0076  -0.0173 0.0053  253 VAL B CA  
3041 C  C   . VAL B 114 ? 0.2648 0.1695 0.1799 0.0115  -0.0163 0.0049  253 VAL B C   
3042 O  O   . VAL B 114 ? 0.2701 0.1658 0.1779 0.0095  -0.0173 0.0050  253 VAL B O   
3043 C  CB  . VAL B 114 ? 0.1966 0.1274 0.1363 0.0094  -0.0157 0.0039  253 VAL B CB  
3044 C  CG1 . VAL B 114 ? 0.2241 0.1596 0.1668 0.0161  -0.0126 0.0027  253 VAL B CG1 
3045 C  CG2 . VAL B 114 ? 0.2079 0.1513 0.1592 0.0057  -0.0167 0.0044  253 VAL B CG2 
3046 N  N   . HIS B 115 ? 0.2556 0.1580 0.1671 0.0171  -0.0144 0.0046  254 HIS B N   
3047 C  CA  . HIS B 115 ? 0.2551 0.1431 0.1524 0.0218  -0.0132 0.0046  254 HIS B CA  
3048 C  C   . HIS B 115 ? 0.2593 0.1528 0.1592 0.0301  -0.0096 0.0037  254 HIS B C   
3049 O  O   . HIS B 115 ? 0.2576 0.1647 0.1685 0.0321  -0.0082 0.0034  254 HIS B O   
3050 C  CB  . HIS B 115 ? 0.2697 0.1462 0.1558 0.0213  -0.0144 0.0057  254 HIS B CB  
3051 C  CG  . HIS B 115 ? 0.3034 0.1736 0.1851 0.0130  -0.0181 0.0071  254 HIS B CG  
3052 N  ND1 . HIS B 115 ? 0.2935 0.1755 0.1862 0.0076  -0.0200 0.0079  254 HIS B ND1 
3053 C  CD2 . HIS B 115 ? 0.2662 0.1197 0.1329 0.0093  -0.0205 0.0081  254 HIS B CD2 
3054 C  CE1 . HIS B 115 ? 0.2778 0.1519 0.1633 0.0007  -0.0232 0.0096  254 HIS B CE1 
3055 N  NE2 . HIS B 115 ? 0.3231 0.1795 0.1926 0.0012  -0.0237 0.0098  254 HIS B NE2 
3056 N  N   . LEU B 116 ? 0.2834 0.1660 0.1721 0.0348  -0.0082 0.0035  255 LEU B N   
3057 C  CA  . LEU B 116 ? 0.2657 0.1517 0.1537 0.0432  -0.0048 0.0033  255 LEU B CA  
3058 C  C   . LEU B 116 ? 0.2901 0.1634 0.1640 0.0485  -0.0037 0.0041  255 LEU B C   
3059 O  O   . LEU B 116 ? 0.3428 0.1989 0.2023 0.0472  -0.0051 0.0045  255 LEU B O   
3060 C  CB  . LEU B 116 ? 0.3034 0.1875 0.1891 0.0455  -0.0037 0.0027  255 LEU B CB  
3061 C  CG  . LEU B 116 ? 0.2913 0.1778 0.1742 0.0545  -0.0002 0.0030  255 LEU B CG  
3062 C  CD1 . LEU B 116 ? 0.3042 0.2094 0.2012 0.0569  0.0016  0.0031  255 LEU B CD1 
3063 C  CD2 . LEU B 116 ? 0.3396 0.2218 0.2184 0.0561  0.0003  0.0026  255 LEU B CD2 
3064 N  N   . SER B 117 ? 0.2914 0.1728 0.1691 0.0542  -0.0012 0.0046  256 SER B N   
3065 C  CA  . SER B 117 ? 0.3676 0.2383 0.2324 0.0604  0.0004  0.0055  256 SER B CA  
3066 C  C   . SER B 117 ? 0.3912 0.2491 0.2419 0.0660  0.0020  0.0056  256 SER B C   
3067 O  O   . SER B 117 ? 0.4014 0.2659 0.2563 0.0686  0.0035  0.0053  256 SER B O   
3068 C  CB  . SER B 117 ? 0.3419 0.2264 0.2147 0.0661  0.0032  0.0061  256 SER B CB  
3069 O  OG  . SER B 117 ? 0.3599 0.2344 0.2196 0.0734  0.0053  0.0072  256 SER B OG  
3070 N  N   . THR B 118 ? 0.3525 0.1967 0.1887 0.0659  0.0019  0.0054  257 THR B N   
3071 C  CA  . THR B 118 ? 0.4206 0.2569 0.2446 0.0699  0.0038  0.0048  257 THR B CA  
3072 C  C   . THR B 118 ? 0.5133 0.3601 0.3390 0.0786  0.0079  0.0057  257 THR B C   
3073 O  O   . THR B 118 ? 0.5552 0.3983 0.3721 0.0829  0.0099  0.0058  257 THR B O   
3074 C  CB  . THR B 118 ? 0.4443 0.2631 0.2514 0.0681  0.0027  0.0042  257 THR B CB  
3075 O  OG1 . THR B 118 ? 0.4648 0.2842 0.2704 0.0706  0.0037  0.0047  257 THR B OG1 
3076 C  CG2 . THR B 118 ? 0.4156 0.2249 0.2203 0.0587  -0.0015 0.0037  257 THR B CG2 
3077 N  N   . LYS B 119 ? 0.4431 0.3035 0.2798 0.0811  0.0092  0.0066  258 LYS B N   
3078 C  CA  . LYS B 119 ? 0.5011 0.3741 0.3408 0.0883  0.0129  0.0080  258 LYS B CA  
3079 C  C   . LYS B 119 ? 0.5338 0.4202 0.3841 0.0895  0.0138  0.0084  258 LYS B C   
3080 O  O   . LYS B 119 ? 0.5284 0.4256 0.3807 0.0947  0.0165  0.0100  258 LYS B O   
3081 C  CB  . LYS B 119 ? 0.5861 0.4696 0.4338 0.0898  0.0138  0.0089  258 LYS B CB  
3082 C  CG  . LYS B 119 ? 0.7138 0.5855 0.5516 0.0894  0.0132  0.0087  258 LYS B CG  
3083 C  CD  . LYS B 119 ? 0.8216 0.7049 0.6695 0.0900  0.0137  0.0096  258 LYS B CD  
3084 C  CE  . LYS B 119 ? 0.9285 0.8000 0.7686 0.0877  0.0122  0.0093  258 LYS B CE  
3085 N  NZ  . LYS B 119 ? 1.0148 0.8775 0.8404 0.0928  0.0146  0.0095  258 LYS B NZ  
3086 N  N   . TYR B 120 ? 0.4407 0.3268 0.2977 0.0843  0.0114  0.0072  259 TYR B N   
3087 C  CA  . TYR B 120 ? 0.4350 0.3334 0.3024 0.0846  0.0119  0.0071  259 TYR B CA  
3088 C  C   . TYR B 120 ? 0.4565 0.3446 0.3184 0.0817  0.0104  0.0061  259 TYR B C   
3089 O  O   . TYR B 120 ? 0.4546 0.3301 0.3113 0.0764  0.0077  0.0051  259 TYR B O   
3090 C  CB  . TYR B 120 ? 0.3559 0.2675 0.2396 0.0813  0.0108  0.0066  259 TYR B CB  
3091 C  CG  . TYR B 120 ? 0.3997 0.3249 0.2910 0.0840  0.0125  0.0077  259 TYR B CG  
3092 C  CD1 . TYR B 120 ? 0.3655 0.3069 0.2639 0.0874  0.0149  0.0091  259 TYR B CD1 
3093 C  CD2 . TYR B 120 ? 0.3829 0.3051 0.2740 0.0826  0.0116  0.0077  259 TYR B CD2 
3094 C  CE1 . TYR B 120 ? 0.4471 0.4012 0.3522 0.0889  0.0162  0.0103  259 TYR B CE1 
3095 C  CE2 . TYR B 120 ? 0.3825 0.3174 0.2805 0.0849  0.0132  0.0087  259 TYR B CE2 
3096 C  CZ  . TYR B 120 ? 0.3925 0.3434 0.2975 0.0877  0.0155  0.0100  259 TYR B CZ  
3097 O  OH  . TYR B 120 ? 0.4676 0.4312 0.3792 0.0889  0.0168  0.0113  259 TYR B OH  
3098 N  N   . ALA B 121 ? 0.5150 0.4092 0.3781 0.0847  0.0120  0.0066  260 ALA B N   
3099 C  CA  . ALA B 121 ? 0.4605 0.3457 0.3181 0.0825  0.0108  0.0057  260 ALA B CA  
3100 C  C   . ALA B 121 ? 0.3945 0.2841 0.2635 0.0769  0.0085  0.0044  260 ALA B C   
3101 O  O   . ALA B 121 ? 0.4241 0.3031 0.2887 0.0723  0.0063  0.0034  260 ALA B O   
3102 C  CB  . ALA B 121 ? 0.4422 0.3321 0.2963 0.0881  0.0133  0.0069  260 ALA B CB  
3103 N  N   . ARG B 122 ? 0.4008 0.3065 0.2842 0.0769  0.0090  0.0044  261 ARG B N   
3104 C  CA  . ARG B 122 ? 0.4010 0.3157 0.2971 0.0695  0.0070  0.0032  261 ARG B CA  
3105 C  C   . ARG B 122 ? 0.3516 0.2784 0.2603 0.0650  0.0061  0.0029  261 ARG B C   
3106 O  O   . ARG B 122 ? 0.3394 0.2731 0.2504 0.0685  0.0076  0.0038  261 ARG B O   
3107 C  CB  . ARG B 122 ? 0.4592 0.3848 0.3616 0.0719  0.0085  0.0034  261 ARG B CB  
3108 C  CG  . ARG B 122 ? 0.4995 0.4147 0.3900 0.0771  0.0097  0.0039  261 ARG B CG  
3109 C  CD  . ARG B 122 ? 0.5489 0.4776 0.4445 0.0818  0.0120  0.0051  261 ARG B CD  
3110 N  NE  . ARG B 122 ? 0.7082 0.6469 0.6156 0.0768  0.0108  0.0042  261 ARG B NE  
3111 C  CZ  . ARG B 122 ? 0.8170 0.7729 0.7371 0.0757  0.0113  0.0047  261 ARG B CZ  
3112 N  NH1 . ARG B 122 ? 0.8850 0.8506 0.8077 0.0797  0.0131  0.0062  261 ARG B NH1 
3113 N  NH2 . ARG B 122 ? 0.8142 0.7775 0.7437 0.0704  0.0100  0.0037  261 ARG B NH2 
3114 N  N   . VAL B 123 ? 0.3192 0.2487 0.2358 0.0575  0.0037  0.0017  262 VAL B N   
3115 C  CA  . VAL B 123 ? 0.2961 0.2367 0.2244 0.0531  0.0027  0.0014  262 VAL B CA  
3116 C  C   . VAL B 123 ? 0.3469 0.3039 0.2853 0.0559  0.0046  0.0018  262 VAL B C   
3117 O  O   . VAL B 123 ? 0.3162 0.2803 0.2596 0.0560  0.0050  0.0022  262 VAL B O   
3118 C  CB  . VAL B 123 ? 0.3243 0.2661 0.2593 0.0455  0.0001  0.0003  262 VAL B CB  
3119 C  CG1 . VAL B 123 ? 0.3396 0.2942 0.2871 0.0420  -0.0005 -0.0001 262 VAL B CG1 
3120 C  CG2 . VAL B 123 ? 0.3192 0.2467 0.2452 0.0416  -0.0022 0.0003  262 VAL B CG2 
3121 N  N   . ASP B 124 ? 0.3020 0.2652 0.2431 0.0580  0.0058  0.0020  263 ASP B N   
3122 C  CA  . ASP B 124 ? 0.3156 0.2951 0.2666 0.0591  0.0071  0.0027  263 ASP B CA  
3123 C  C   . ASP B 124 ? 0.3234 0.3073 0.2713 0.0657  0.0096  0.0045  263 ASP B C   
3124 O  O   . ASP B 124 ? 0.3658 0.3630 0.3216 0.0661  0.0105  0.0053  263 ASP B O   
3125 C  CB  . ASP B 124 ? 0.3923 0.3781 0.3470 0.0592  0.0076  0.0027  263 ASP B CB  
3126 C  CG  . ASP B 124 ? 0.5509 0.5296 0.4957 0.0650  0.0091  0.0036  263 ASP B CG  
3127 O  OD1 . ASP B 124 ? 0.5860 0.5561 0.5206 0.0702  0.0103  0.0045  263 ASP B OD1 
3128 O  OD2 . ASP B 124 ? 0.5929 0.5744 0.5396 0.0646  0.0091  0.0035  263 ASP B OD2 
3129 N  N   . GLU B 125 ? 0.2894 0.2618 0.2252 0.0709  0.0107  0.0052  264 GLU B N   
3130 C  CA  . GLU B 125 ? 0.3108 0.2856 0.2422 0.0777  0.0131  0.0070  264 GLU B CA  
3131 C  C   . GLU B 125 ? 0.3408 0.3142 0.2735 0.0756  0.0123  0.0067  264 GLU B C   
3132 O  O   . GLU B 125 ? 0.3679 0.3493 0.3026 0.0791  0.0139  0.0081  264 GLU B O   
3133 C  CB  . GLU B 125 ? 0.4167 0.3784 0.3333 0.0842  0.0146  0.0080  264 GLU B CB  
3134 C  CG  . GLU B 125 ? 0.5124 0.4768 0.4271 0.0863  0.0156  0.0088  264 GLU B CG  
3135 C  CD  . GLU B 125 ? 0.6153 0.5658 0.5148 0.0901  0.0164  0.0096  264 GLU B CD  
3136 O  OE1 . GLU B 125 ? 0.5917 0.5271 0.4816 0.0894  0.0155  0.0087  264 GLU B OE1 
3137 O  OE2 . GLU B 125 ? 0.6582 0.6129 0.5548 0.0937  0.0179  0.0112  264 GLU B OE2 
3138 N  N   . ALA B 126 ? 0.3111 0.2747 0.2423 0.0699  0.0097  0.0052  265 ALA B N   
3139 C  CA  . ALA B 126 ? 0.2956 0.2565 0.2270 0.0677  0.0087  0.0050  265 ALA B CA  
3140 C  C   . ALA B 126 ? 0.2846 0.2588 0.2298 0.0623  0.0075  0.0044  265 ALA B C   
3141 O  O   . ALA B 126 ? 0.2755 0.2527 0.2235 0.0617  0.0074  0.0046  265 ALA B O   
3142 C  CB  . ALA B 126 ? 0.2652 0.2097 0.1878 0.0638  0.0063  0.0042  265 ALA B CB  
3143 N  N   . LEU B 127 ? 0.2679 0.2496 0.2213 0.0587  0.0068  0.0035  266 LEU B N   
3144 C  CA  . LEU B 127 ? 0.2440 0.2366 0.2093 0.0536  0.0056  0.0028  266 LEU B CA  
3145 C  C   . LEU B 127 ? 0.2525 0.2570 0.2233 0.0559  0.0071  0.0038  266 LEU B C   
3146 O  O   . LEU B 127 ? 0.2835 0.2955 0.2545 0.0603  0.0092  0.0051  266 LEU B O   
3147 C  CB  . LEU B 127 ? 0.2444 0.2430 0.2160 0.0506  0.0051  0.0020  266 LEU B CB  
3148 C  CG  . LEU B 127 ? 0.3877 0.3902 0.3677 0.0441  0.0030  0.0006  266 LEU B CG  
3149 C  CD1 . LEU B 127 ? 0.2859 0.2779 0.2624 0.0403  0.0009  -0.0001 266 LEU B CD1 
3150 C  CD2 . LEU B 127 ? 0.4375 0.4447 0.4215 0.0426  0.0030  0.0001  266 LEU B CD2 
3151 N  N   . GLY B 128 ? 0.2224 0.2292 0.1976 0.0529  0.0061  0.0033  267 GLY B N   
3152 C  CA  . GLY B 128 ? 0.2168 0.2349 0.1978 0.0543  0.0073  0.0042  267 GLY B CA  
3153 C  C   . GLY B 128 ? 0.2368 0.2530 0.2114 0.0601  0.0091  0.0057  267 GLY B C   
3154 O  O   . GLY B 128 ? 0.3045 0.3300 0.2836 0.0613  0.0101  0.0066  267 GLY B O   
3155 N  N   . ARG B 129 ? 0.2545 0.2585 0.2182 0.0639  0.0097  0.0062  268 ARG B N   
3156 C  CA  . ARG B 129 ? 0.2839 0.2837 0.2396 0.0700  0.0116  0.0077  268 ARG B CA  
3157 C  C   . ARG B 129 ? 0.3126 0.3034 0.2648 0.0677  0.0100  0.0071  268 ARG B C   
3158 O  O   . ARG B 129 ? 0.2692 0.2508 0.2193 0.0629  0.0077  0.0060  268 ARG B O   
3159 C  CB  . ARG B 129 ? 0.3659 0.3554 0.3097 0.0758  0.0131  0.0085  268 ARG B CB  
3160 C  CG  . ARG B 129 ? 0.4650 0.4626 0.4112 0.0782  0.0145  0.0092  268 ARG B CG  
3161 C  CD  . ARG B 129 ? 0.5925 0.6055 0.5440 0.0798  0.0163  0.0113  268 ARG B CD  
3162 N  NE  . ARG B 129 ? 0.7315 0.7513 0.6835 0.0810  0.0172  0.0126  268 ARG B NE  
3163 C  CZ  . ARG B 129 ? 0.8136 0.8476 0.7709 0.0807  0.0181  0.0147  268 ARG B CZ  
3164 N  NH1 . ARG B 129 ? 0.8061 0.8484 0.7685 0.0791  0.0181  0.0155  268 ARG B NH1 
3165 N  NH2 . ARG B 129 ? 0.8623 0.9018 0.8194 0.0818  0.0187  0.0161  268 ARG B NH2 
3166 N  N   . PRO B 130 ? 0.3393 0.3331 0.2907 0.0710  0.0113  0.0082  269 PRO B N   
3167 C  CA  . PRO B 130 ? 0.3053 0.2905 0.2531 0.0688  0.0098  0.0079  269 PRO B CA  
3168 C  C   . PRO B 130 ? 0.3280 0.2944 0.2622 0.0692  0.0087  0.0077  269 PRO B C   
3169 O  O   . PRO B 130 ? 0.3219 0.2804 0.2454 0.0752  0.0106  0.0087  269 PRO B O   
3170 C  CB  . PRO B 130 ? 0.3883 0.3793 0.3355 0.0740  0.0120  0.0095  269 PRO B CB  
3171 C  CG  . PRO B 130 ? 0.4756 0.4831 0.4316 0.0760  0.0139  0.0103  269 PRO B CG  
3172 C  CD  . PRO B 130 ? 0.4296 0.4356 0.3839 0.0764  0.0141  0.0100  269 PRO B CD  
3173 N  N   . GLY B 131 ? 0.2897 0.2490 0.2236 0.0627  0.0057  0.0067  270 GLY B N   
3174 C  CA  . GLY B 131 ? 0.2437 0.1851 0.1646 0.0616  0.0042  0.0067  270 GLY B CA  
3175 C  C   . GLY B 131 ? 0.2780 0.2119 0.1932 0.0616  0.0040  0.0062  270 GLY B C   
3176 O  O   . GLY B 131 ? 0.2997 0.2178 0.2028 0.0608  0.0028  0.0063  270 GLY B O   
3177 N  N   . GLY B 132 ? 0.2784 0.2232 0.2019 0.0622  0.0051  0.0058  271 GLY B N   
3178 C  CA  . GLY B 132 ? 0.2701 0.2092 0.1891 0.0626  0.0051  0.0053  271 GLY B CA  
3179 C  C   . GLY B 132 ? 0.3057 0.2368 0.2236 0.0555  0.0020  0.0043  271 GLY B C   
3180 O  O   . GLY B 132 ? 0.2812 0.2007 0.1898 0.0556  0.0015  0.0042  271 GLY B O   
3181 N  N   . LEU B 133 ? 0.2218 0.1598 0.1492 0.0493  -0.0001 0.0039  272 LEU B N   
3182 C  CA  . LEU B 133 ? 0.2116 0.1445 0.1392 0.0423  -0.0031 0.0034  272 LEU B CA  
3183 C  C   . LEU B 133 ? 0.2104 0.1412 0.1379 0.0380  -0.0052 0.0040  272 LEU B C   
3184 O  O   . LEU B 133 ? 0.2288 0.1665 0.1609 0.0397  -0.0044 0.0043  272 LEU B O   
3185 C  CB  . LEU B 133 ? 0.2311 0.1761 0.1712 0.0388  -0.0035 0.0025  272 LEU B CB  
3186 C  CG  . LEU B 133 ? 0.2110 0.1601 0.1530 0.0419  -0.0018 0.0020  272 LEU B CG  
3187 C  CD1 . LEU B 133 ? 0.2467 0.2079 0.2012 0.0382  -0.0023 0.0011  272 LEU B CD1 
3188 C  CD2 . LEU B 133 ? 0.2608 0.1965 0.1919 0.0422  -0.0023 0.0019  272 LEU B CD2 
3189 N  N   . ALA B 134 ? 0.2431 0.1648 0.1653 0.0324  -0.0080 0.0043  273 ALA B N   
3190 C  CA  . ALA B 134 ? 0.2101 0.1306 0.1324 0.0275  -0.0103 0.0053  273 ALA B CA  
3191 C  C   . ALA B 134 ? 0.2371 0.1589 0.1631 0.0202  -0.0132 0.0056  273 ALA B C   
3192 O  O   . ALA B 134 ? 0.2589 0.1739 0.1798 0.0183  -0.0140 0.0055  273 ALA B O   
3193 C  CB  . ALA B 134 ? 0.2565 0.1611 0.1638 0.0285  -0.0110 0.0063  273 ALA B CB  
3194 N  N   . VAL B 135 ? 0.2112 0.1421 0.1456 0.0164  -0.0146 0.0062  274 VAL B N   
3195 C  CA  . VAL B 135 ? 0.2174 0.1505 0.1550 0.0097  -0.0173 0.0071  274 VAL B CA  
3196 C  C   . VAL B 135 ? 0.2018 0.1309 0.1349 0.0049  -0.0200 0.0091  274 VAL B C   
3197 O  O   . VAL B 135 ? 0.1984 0.1310 0.1337 0.0062  -0.0197 0.0094  274 VAL B O   
3198 C  CB  . VAL B 135 ? 0.1907 0.1396 0.1429 0.0089  -0.0168 0.0065  274 VAL B CB  
3199 C  CG1 . VAL B 135 ? 0.2213 0.1725 0.1759 0.0027  -0.0193 0.0077  274 VAL B CG1 
3200 C  CG2 . VAL B 135 ? 0.1713 0.1249 0.1280 0.0133  -0.0142 0.0047  274 VAL B CG2 
3201 N  N   . LEU B 136 ? 0.2107 0.1321 0.1370 -0.0007 -0.0227 0.0104  275 LEU B N   
3202 C  CA  . LEU B 136 ? 0.2190 0.1380 0.1416 -0.0068 -0.0258 0.0128  275 LEU B CA  
3203 C  C   . LEU B 136 ? 0.2302 0.1625 0.1637 -0.0114 -0.0273 0.0140  275 LEU B C   
3204 O  O   . LEU B 136 ? 0.2178 0.1521 0.1537 -0.0130 -0.0275 0.0138  275 LEU B O   
3205 C  CB  . LEU B 136 ? 0.2748 0.1766 0.1817 -0.0106 -0.0281 0.0140  275 LEU B CB  
3206 C  CG  . LEU B 136 ? 0.3564 0.2508 0.2545 -0.0169 -0.0315 0.0166  275 LEU B CG  
3207 C  CD1 . LEU B 136 ? 0.3691 0.2639 0.2670 -0.0140 -0.0308 0.0167  275 LEU B CD1 
3208 C  CD2 . LEU B 136 ? 0.3346 0.2096 0.2154 -0.0192 -0.0330 0.0170  275 LEU B CD2 
3209 N  N   . ALA B 137 ? 0.1683 0.1098 0.1083 -0.0132 -0.0283 0.0153  276 ALA B N   
3210 C  CA  . ALA B 137 ? 0.1649 0.1204 0.1158 -0.0163 -0.0293 0.0166  276 ALA B CA  
3211 C  C   . ALA B 137 ? 0.1732 0.1305 0.1221 -0.0224 -0.0325 0.0199  276 ALA B C   
3212 O  O   . ALA B 137 ? 0.2034 0.1567 0.1478 -0.0227 -0.0333 0.0207  276 ALA B O   
3213 C  CB  . ALA B 137 ? 0.1652 0.1337 0.1284 -0.0114 -0.0268 0.0150  276 ALA B CB  
3214 N  N   . ALA B 138 ? 0.1818 0.1454 0.1337 -0.0272 -0.0344 0.0220  277 ALA B N   
3215 C  CA  . ALA B 138 ? 0.1680 0.1370 0.1199 -0.0331 -0.0374 0.0257  277 ALA B CA  
3216 C  C   . ALA B 138 ? 0.1761 0.1610 0.1393 -0.0339 -0.0375 0.0272  277 ALA B C   
3217 O  O   . ALA B 138 ? 0.1827 0.1707 0.1499 -0.0327 -0.0363 0.0262  277 ALA B O   
3218 C  CB  . ALA B 138 ? 0.2122 0.1696 0.1515 -0.0400 -0.0407 0.0282  277 ALA B CB  
3219 N  N   . PHE B 139 ? 0.1661 0.1609 0.1340 -0.0358 -0.0388 0.0297  278 PHE B N   
3220 C  CA  . PHE B 139 ? 0.1515 0.1616 0.1288 -0.0366 -0.0391 0.0318  278 PHE B CA  
3221 C  C   . PHE B 139 ? 0.1666 0.1778 0.1398 -0.0435 -0.0420 0.0357  278 PHE B C   
3222 O  O   . PHE B 139 ? 0.1974 0.2007 0.1612 -0.0492 -0.0449 0.0380  278 PHE B O   
3223 C  CB  . PHE B 139 ? 0.1549 0.1759 0.1386 -0.0357 -0.0394 0.0334  278 PHE B CB  
3224 C  CG  . PHE B 139 ? 0.1455 0.1678 0.1346 -0.0291 -0.0365 0.0300  278 PHE B CG  
3225 C  CD1 . PHE B 139 ? 0.1513 0.1703 0.1378 -0.0286 -0.0368 0.0299  278 PHE B CD1 
3226 C  CD2 . PHE B 139 ? 0.1523 0.1790 0.1485 -0.0238 -0.0335 0.0271  278 PHE B CD2 
3227 C  CE1 . PHE B 139 ? 0.1523 0.1731 0.1438 -0.0227 -0.0341 0.0269  278 PHE B CE1 
3228 C  CE2 . PHE B 139 ? 0.1254 0.1538 0.1262 -0.0184 -0.0310 0.0242  278 PHE B CE2 
3229 C  CZ  . PHE B 139 ? 0.1352 0.1609 0.1338 -0.0178 -0.0313 0.0242  278 PHE B CZ  
3230 N  N   . LEU B 140 ? 0.1464 0.1675 0.1262 -0.0431 -0.0414 0.0366  279 LEU B N   
3231 C  CA  . LEU B 140 ? 0.1422 0.1684 0.1200 -0.0493 -0.0441 0.0409  279 LEU B CA  
3232 C  C   . LEU B 140 ? 0.2022 0.2444 0.1890 -0.0486 -0.0432 0.0437  279 LEU B C   
3233 O  O   . LEU B 140 ? 0.1822 0.2331 0.1775 -0.0428 -0.0408 0.0421  279 LEU B O   
3234 C  CB  . LEU B 140 ? 0.1840 0.2089 0.1624 -0.0489 -0.0430 0.0398  279 LEU B CB  
3235 C  CG  . LEU B 140 ? 0.3589 0.3707 0.3330 -0.0459 -0.0411 0.0354  279 LEU B CG  
3236 C  CD1 . LEU B 140 ? 0.2182 0.2293 0.1908 -0.0485 -0.0415 0.0363  279 LEU B CD1 
3237 C  CD2 . LEU B 140 ? 0.3150 0.3109 0.2785 -0.0470 -0.0419 0.0339  279 LEU B CD2 
3238 N  N   . GLU B 141 ? 0.2161 0.2605 0.2007 -0.0537 -0.0437 0.0472  280 GLU B N   
3239 C  CA  . GLU B 141 ? 0.2178 0.2755 0.2097 -0.0527 -0.0415 0.0498  280 GLU B CA  
3240 C  C   . GLU B 141 ? 0.2070 0.2695 0.1984 -0.0576 -0.0413 0.0535  280 GLU B C   
3241 O  O   . GLU B 141 ? 0.2170 0.2717 0.2018 -0.0628 -0.0433 0.0543  280 GLU B O   
3242 C  CB  . GLU B 141 ? 0.2447 0.3027 0.2356 -0.0544 -0.0423 0.0511  280 GLU B CB  
3243 C  CG  . GLU B 141 ? 0.3156 0.3719 0.3086 -0.0494 -0.0419 0.0480  280 GLU B CG  
3244 C  CD  . GLU B 141 ? 0.3113 0.3697 0.3041 -0.0511 -0.0423 0.0497  280 GLU B CD  
3245 O  OE1 . GLU B 141 ? 0.2955 0.3462 0.2808 -0.0571 -0.0448 0.0515  280 GLU B OE1 
3246 O  OE2 . GLU B 141 ? 0.4211 0.4882 0.4208 -0.0465 -0.0400 0.0493  280 GLU B OE2 
3247 N  N   . GLU B 142 ? 0.2018 0.2767 0.1993 -0.0558 -0.0389 0.0559  281 GLU B N   
3248 C  CA  . GLU B 142 ? 0.2194 0.3005 0.2166 -0.0607 -0.0387 0.0602  281 GLU B CA  
3249 C  C   . GLU B 142 ? 0.2198 0.2993 0.2127 -0.0681 -0.0407 0.0637  281 GLU B C   
3250 O  O   . GLU B 142 ? 0.2368 0.3176 0.2305 -0.0676 -0.0407 0.0639  281 GLU B O   
3251 C  CB  . GLU B 142 ? 0.1928 0.2874 0.1972 -0.0561 -0.0353 0.0617  281 GLU B CB  
3252 C  CG  . GLU B 142 ? 0.2385 0.3404 0.2428 -0.0609 -0.0348 0.0663  281 GLU B CG  
3253 C  CD  . GLU B 142 ? 0.3344 0.4497 0.3444 -0.0568 -0.0315 0.0685  281 GLU B CD  
3254 O  OE1 . GLU B 142 ? 0.3517 0.4749 0.3622 -0.0611 -0.0311 0.0730  281 GLU B OE1 
3255 O  OE2 . GLU B 142 ? 0.3959 0.5139 0.4097 -0.0496 -0.0294 0.0660  281 GLU B OE2 
3256 N  N   . GLY B 143 ? 0.2050 0.2816 0.1934 -0.0752 -0.0423 0.0662  282 GLY B N   
3257 C  CA  . GLY B 143 ? 0.2618 0.3381 0.2466 -0.0825 -0.0443 0.0695  282 GLY B CA  
3258 C  C   . GLY B 143 ? 0.2552 0.3387 0.2411 -0.0844 -0.0439 0.0717  282 GLY B C   
3259 O  O   . GLY B 143 ? 0.2515 0.3388 0.2402 -0.0819 -0.0424 0.0714  282 GLY B O   
3260 N  N   . PRO B 144 ? 0.2668 0.3521 0.2504 -0.0890 -0.0455 0.0738  283 PRO B N   
3261 C  CA  . PRO B 144 ? 0.3131 0.4063 0.2981 -0.0912 -0.0453 0.0763  283 PRO B CA  
3262 C  C   . PRO B 144 ? 0.3502 0.4352 0.3296 -0.0950 -0.0473 0.0753  283 PRO B C   
3263 O  O   . PRO B 144 ? 0.4040 0.4963 0.3858 -0.0952 -0.0464 0.0769  283 PRO B O   
3264 C  CB  . PRO B 144 ? 0.3341 0.4298 0.3174 -0.0955 -0.0469 0.0788  283 PRO B CB  
3265 C  CG  . PRO B 144 ? 0.3339 0.4168 0.3110 -0.0979 -0.0493 0.0767  283 PRO B CG  
3266 C  CD  . PRO B 144 ? 0.2939 0.3743 0.2737 -0.0924 -0.0476 0.0742  283 PRO B CD  
3267 N  N   . GLU B 145 ? 0.3050 0.3750 0.2767 -0.0977 -0.0498 0.0727  284 GLU B N   
3268 C  CA  . GLU B 145 ? 0.3163 0.3771 0.2812 -0.1017 -0.0519 0.0715  284 GLU B CA  
3269 C  C   . GLU B 145 ? 0.3745 0.4287 0.3386 -0.0984 -0.0511 0.0686  284 GLU B C   
3270 O  O   . GLU B 145 ? 0.3642 0.4157 0.3298 -0.0944 -0.0501 0.0667  284 GLU B O   
3271 C  CB  A GLU B 145 ? 0.4282 0.4750 0.3831 -0.1072 -0.0555 0.0703  284 GLU B CB  
3272 C  CB  B GLU B 145 ? 0.4131 0.4600 0.3680 -0.1072 -0.0555 0.0703  284 GLU B CB  
3273 C  CG  A GLU B 145 ? 0.5117 0.5635 0.4656 -0.1122 -0.0570 0.0733  284 GLU B CG  
3274 C  CG  B GLU B 145 ? 0.4750 0.5270 0.4300 -0.1110 -0.0566 0.0731  284 GLU B CG  
3275 C  CD  A GLU B 145 ? 0.5897 0.6476 0.5443 -0.1155 -0.0574 0.0754  284 GLU B CD  
3276 C  CD  B GLU B 145 ? 0.5623 0.6256 0.5205 -0.1138 -0.0565 0.0765  284 GLU B CD  
3277 O  OE1 A GLU B 145 ? 0.5829 0.6557 0.5451 -0.1140 -0.0554 0.0784  284 GLU B OE1 
3278 O  OE1 B GLU B 145 ? 0.6029 0.6618 0.5568 -0.1171 -0.0579 0.0761  284 GLU B OE1 
3279 O  OE2 A GLU B 145 ? 0.6147 0.6623 0.5617 -0.1192 -0.0597 0.0739  284 GLU B OE2 
3280 O  OE2 B GLU B 145 ? 0.5631 0.6395 0.5279 -0.1127 -0.0549 0.0794  284 GLU B OE2 
3281 N  N   . GLU B 146 ? 0.3695 0.4217 0.3312 -0.1002 -0.0516 0.0683  285 GLU B N   
3282 C  CA  . GLU B 146 ? 0.3571 0.4013 0.3165 -0.0980 -0.0513 0.0654  285 GLU B CA  
3283 C  C   . GLU B 146 ? 0.3667 0.3928 0.3159 -0.0999 -0.0539 0.0621  285 GLU B C   
3284 O  O   . GLU B 146 ? 0.3531 0.3710 0.2946 -0.1048 -0.0565 0.0618  285 GLU B O   
3285 C  CB  . GLU B 146 ? 0.4284 0.4751 0.3877 -0.0996 -0.0513 0.0660  285 GLU B CB  
3286 C  CG  . GLU B 146 ? 0.5847 0.6221 0.5406 -0.0978 -0.0513 0.0630  285 GLU B CG  
3287 C  CD  . GLU B 146 ? 0.6502 0.6938 0.6089 -0.0979 -0.0503 0.0639  285 GLU B CD  
3288 O  OE1 . GLU B 146 ? 0.5202 0.5550 0.4724 -0.1011 -0.0522 0.0625  285 GLU B OE1 
3289 O  OE2 . GLU B 146 ? 0.7100 0.7672 0.6772 -0.0944 -0.0477 0.0660  285 GLU B OE2 
3290 N  N   . ASN B 147 ? 0.3000 0.3198 0.2487 -0.0960 -0.0532 0.0594  286 ASN B N   
3291 C  CA  . ASN B 147 ? 0.2773 0.2792 0.2156 -0.0967 -0.0552 0.0559  286 ASN B CA  
3292 C  C   . ASN B 147 ? 0.3114 0.3029 0.2426 -0.0977 -0.0562 0.0535  286 ASN B C   
3293 O  O   . ASN B 147 ? 0.2882 0.2811 0.2225 -0.0945 -0.0547 0.0525  286 ASN B O   
3294 C  CB  . ASN B 147 ? 0.2482 0.2480 0.1890 -0.0920 -0.0541 0.0542  286 ASN B CB  
3295 C  CG  . ASN B 147 ? 0.2844 0.2655 0.2139 -0.0921 -0.0561 0.0506  286 ASN B CG  
3296 O  OD1 . ASN B 147 ? 0.3140 0.2825 0.2346 -0.0928 -0.0571 0.0481  286 ASN B OD1 
3297 N  ND2 . ASN B 147 ? 0.2751 0.2543 0.2044 -0.0910 -0.0564 0.0503  286 ASN B ND2 
3298 N  N   . SER B 148 ? 0.3427 0.3237 0.2639 -0.1021 -0.0587 0.0526  287 SER B N   
3299 C  CA  . SER B 148 ? 0.4794 0.4519 0.3936 -0.1033 -0.0597 0.0508  287 SER B CA  
3300 C  C   . SER B 148 ? 0.4274 0.3866 0.3353 -0.0994 -0.0592 0.0469  287 SER B C   
3301 O  O   . SER B 148 ? 0.3609 0.3189 0.2683 -0.0981 -0.0585 0.0459  287 SER B O   
3302 C  CB  . SER B 148 ? 0.5585 0.5222 0.4623 -0.1088 -0.0626 0.0508  287 SER B CB  
3303 O  OG  . SER B 148 ? 0.6241 0.5726 0.5173 -0.1089 -0.0640 0.0484  287 SER B OG  
3304 N  N   . ALA B 149 ? 0.4181 0.3677 0.3211 -0.0973 -0.0594 0.0450  288 ALA B N   
3305 C  CA  . ALA B 149 ? 0.3791 0.3156 0.2757 -0.0931 -0.0588 0.0414  288 ALA B CA  
3306 C  C   . ALA B 149 ? 0.3497 0.2952 0.2562 -0.0889 -0.0565 0.0415  288 ALA B C   
3307 O  O   . ALA B 149 ? 0.3833 0.3229 0.2870 -0.0866 -0.0558 0.0395  288 ALA B O   
3308 C  CB  . ALA B 149 ? 0.3591 0.2845 0.2490 -0.0915 -0.0593 0.0395  288 ALA B CB  
3309 N  N   . TYR B 150 ? 0.2729 0.2328 0.1909 -0.0878 -0.0553 0.0440  289 TYR B N   
3310 C  CA  . TYR B 150 ? 0.2359 0.2051 0.1632 -0.0827 -0.0529 0.0442  289 TYR B CA  
3311 C  C   . TYR B 150 ? 0.2867 0.2645 0.2192 -0.0841 -0.0521 0.0457  289 TYR B C   
3312 O  O   . TYR B 150 ? 0.2941 0.2737 0.2299 -0.0801 -0.0506 0.0446  289 TYR B O   
3313 C  CB  . TYR B 150 ? 0.2490 0.2323 0.1865 -0.0792 -0.0514 0.0460  289 TYR B CB  
3314 C  CG  . TYR B 150 ? 0.2300 0.2067 0.1648 -0.0738 -0.0510 0.0434  289 TYR B CG  
3315 C  CD1 . TYR B 150 ? 0.2511 0.2191 0.1791 -0.0758 -0.0523 0.0432  289 TYR B CD1 
3316 C  CD2 . TYR B 150 ? 0.2504 0.2297 0.1926 -0.0657 -0.0477 0.0396  289 TYR B CD2 
3317 C  CE1 . TYR B 150 ? 0.2522 0.2141 0.1782 -0.0704 -0.0512 0.0409  289 TYR B CE1 
3318 C  CE2 . TYR B 150 ? 0.2723 0.2465 0.2152 -0.0599 -0.0457 0.0362  289 TYR B CE2 
3319 C  CZ  . TYR B 150 ? 0.2528 0.2187 0.1878 -0.0621 -0.0473 0.0369  289 TYR B CZ  
3320 O  OH  . TYR B 150 ? 0.2502 0.2117 0.1861 -0.0561 -0.0452 0.0336  289 TYR B OH  
3321 N  N   . GLU B 151 ? 0.2892 0.2723 0.2219 -0.0881 -0.0528 0.0478  290 GLU B N   
3322 C  CA  . GLU B 151 ? 0.2974 0.2891 0.2347 -0.0887 -0.0518 0.0492  290 GLU B CA  
3323 C  C   . GLU B 151 ? 0.3191 0.3000 0.2498 -0.0879 -0.0523 0.0462  290 GLU B C   
3324 O  O   . GLU B 151 ? 0.3088 0.2961 0.2445 -0.0864 -0.0509 0.0467  290 GLU B O   
3325 C  CB  . GLU B 151 ? 0.3584 0.3556 0.2953 -0.0936 -0.0530 0.0517  290 GLU B CB  
3326 C  CG  . GLU B 151 ? 0.4237 0.4317 0.3663 -0.0941 -0.0518 0.0537  290 GLU B CG  
3327 C  CD  . GLU B 151 ? 0.4187 0.4421 0.3728 -0.0898 -0.0487 0.0560  290 GLU B CD  
3328 O  OE1 . GLU B 151 ? 0.3796 0.4083 0.3382 -0.0874 -0.0477 0.0569  290 GLU B OE1 
3329 O  OE2 . GLU B 151 ? 0.4144 0.4445 0.3726 -0.0886 -0.0473 0.0569  290 GLU B OE2 
3330 N  N   . GLN B 152 ? 0.2977 0.2619 0.2164 -0.0884 -0.0540 0.0433  291 GLN B N   
3331 C  CA  . GLN B 152 ? 0.3450 0.2974 0.2561 -0.0869 -0.0539 0.0406  291 GLN B CA  
3332 C  C   . GLN B 152 ? 0.3125 0.2665 0.2290 -0.0822 -0.0520 0.0394  291 GLN B C   
3333 O  O   . GLN B 152 ? 0.3638 0.3155 0.2798 -0.0809 -0.0509 0.0383  291 GLN B O   
3334 C  CB  . GLN B 152 ? 0.4071 0.3406 0.3043 -0.0871 -0.0552 0.0376  291 GLN B CB  
3335 C  CG  . GLN B 152 ? 0.5515 0.4809 0.4416 -0.0919 -0.0573 0.0385  291 GLN B CG  
3336 C  CD  . GLN B 152 ? 0.7291 0.6391 0.6046 -0.0913 -0.0581 0.0354  291 GLN B CD  
3337 O  OE1 . GLN B 152 ? 0.8039 0.7078 0.6751 -0.0912 -0.0587 0.0348  291 GLN B OE1 
3338 N  NE2 . GLN B 152 ? 0.8228 0.7230 0.6904 -0.0906 -0.0578 0.0335  291 GLN B NE2 
3339 N  N   . LEU B 153 ? 0.2825 0.2400 0.2052 -0.0786 -0.0502 0.0396  292 LEU B N   
3340 C  CA  . LEU B 153 ? 0.2458 0.2071 0.1776 -0.0710 -0.0464 0.0367  292 LEU B CA  
3341 C  C   . LEU B 153 ? 0.2370 0.2172 0.1817 -0.0695 -0.0453 0.0386  292 LEU B C   
3342 O  O   . LEU B 153 ? 0.2555 0.2398 0.2064 -0.0657 -0.0430 0.0368  292 LEU B O   
3343 C  CB  . LEU B 153 ? 0.2709 0.2283 0.2044 -0.0646 -0.0443 0.0333  292 LEU B CB  
3344 C  CG  . LEU B 153 ? 0.3353 0.2740 0.2560 -0.0643 -0.0448 0.0311  292 LEU B CG  
3345 C  CD1 . LEU B 153 ? 0.3760 0.3136 0.3000 -0.0573 -0.0423 0.0280  292 LEU B CD1 
3346 C  CD2 . LEU B 153 ? 0.4056 0.3330 0.3199 -0.0634 -0.0440 0.0289  292 LEU B CD2 
3347 N  N   . LEU B 154 ? 0.2393 0.2308 0.1876 -0.0722 -0.0468 0.0424  293 LEU B N   
3348 C  CA  . LEU B 154 ? 0.1877 0.1970 0.1475 -0.0698 -0.0455 0.0444  293 LEU B CA  
3349 C  C   . LEU B 154 ? 0.2592 0.2735 0.2208 -0.0720 -0.0447 0.0464  293 LEU B C   
3350 O  O   . LEU B 154 ? 0.2615 0.2858 0.2314 -0.0678 -0.0429 0.0460  293 LEU B O   
3351 C  CB  . LEU B 154 ? 0.2321 0.2511 0.1960 -0.0712 -0.0451 0.0478  293 LEU B CB  
3352 C  CG  . LEU B 154 ? 0.2102 0.2273 0.1745 -0.0679 -0.0454 0.0459  293 LEU B CG  
3353 C  CD1 . LEU B 154 ? 0.2451 0.2716 0.2132 -0.0697 -0.0449 0.0493  293 LEU B CD1 
3354 C  CD2 . LEU B 154 ? 0.2754 0.2963 0.2480 -0.0595 -0.0425 0.0419  293 LEU B CD2 
3355 N  N   . SER B 155 ? 0.2548 0.2616 0.2084 -0.0782 -0.0461 0.0482  294 SER B N   
3356 C  CA  . SER B 155 ? 0.2817 0.2932 0.2365 -0.0793 -0.0454 0.0493  294 SER B CA  
3357 C  C   . SER B 155 ? 0.3276 0.3340 0.2812 -0.0770 -0.0451 0.0471  294 SER B C   
3358 O  O   . SER B 155 ? 0.3262 0.3382 0.2824 -0.0769 -0.0442 0.0480  294 SER B O   
3359 C  CB  . SER B 155 ? 0.2740 0.2793 0.2217 -0.0845 -0.0477 0.0490  294 SER B CB  
3360 O  OG  . SER B 155 ? 0.3169 0.3054 0.2523 -0.0850 -0.0500 0.0458  294 SER B OG  
3361 N  N   . ARG B 156 ? 0.2869 0.2833 0.2392 -0.0740 -0.0449 0.0425  295 ARG B N   
3362 C  CA  . ARG B 156 ? 0.2950 0.2857 0.2489 -0.0695 -0.0424 0.0385  295 ARG B CA  
3363 C  C   . ARG B 156 ? 0.2793 0.2779 0.2443 -0.0612 -0.0389 0.0354  295 ARG B C   
3364 O  O   . ARG B 156 ? 0.2953 0.2902 0.2623 -0.0571 -0.0367 0.0321  295 ARG B O   
3365 C  CB  A ARG B 156 ? 0.3036 0.2758 0.2472 -0.0691 -0.0426 0.0351  295 ARG B CB  
3366 C  CB  B ARG B 156 ? 0.3145 0.2867 0.2582 -0.0691 -0.0426 0.0351  295 ARG B CB  
3367 C  CG  A ARG B 156 ? 0.3881 0.3506 0.3190 -0.0753 -0.0457 0.0369  295 ARG B CG  
3368 C  CG  B ARG B 156 ? 0.3887 0.3512 0.3199 -0.0751 -0.0459 0.0370  295 ARG B CG  
3369 C  CD  A ARG B 156 ? 0.4783 0.4414 0.4071 -0.0768 -0.0460 0.0372  295 ARG B CD  
3370 C  CD  B ARG B 156 ? 0.4400 0.4042 0.3659 -0.0793 -0.0480 0.0389  295 ARG B CD  
3371 N  NE  A ARG B 156 ? 0.5617 0.5095 0.4777 -0.0783 -0.0473 0.0351  295 ARG B NE  
3372 N  NE  B ARG B 156 ? 0.5292 0.4786 0.4453 -0.0790 -0.0481 0.0359  295 ARG B NE  
3373 C  CZ  A ARG B 156 ? 0.5691 0.5081 0.4820 -0.0758 -0.0458 0.0323  295 ARG B CZ  
3374 C  CZ  B ARG B 156 ? 0.5389 0.4866 0.4569 -0.0768 -0.0462 0.0343  295 ARG B CZ  
3375 N  NH1 A ARG B 156 ? 0.5057 0.4494 0.4275 -0.0722 -0.0432 0.0310  295 ARG B NH1 
3376 N  NH1 B ARG B 156 ? 0.4979 0.4574 0.4272 -0.0749 -0.0443 0.0350  295 ARG B NH1 
3377 N  NH2 A ARG B 156 ? 0.6942 0.6197 0.5948 -0.0769 -0.0471 0.0307  295 ARG B NH2 
3378 N  NH2 B ARG B 156 ? 0.6041 0.5385 0.5127 -0.0763 -0.0463 0.0318  295 ARG B NH2 
3379 N  N   . LEU B 157 ? 0.2301 0.2390 0.2016 -0.0589 -0.0384 0.0366  296 LEU B N   
3380 C  CA  . LEU B 157 ? 0.2133 0.2283 0.1940 -0.0513 -0.0351 0.0337  296 LEU B CA  
3381 C  C   . LEU B 157 ? 0.2191 0.2429 0.2062 -0.0493 -0.0336 0.0342  296 LEU B C   
3382 O  O   . LEU B 157 ? 0.2164 0.2396 0.2080 -0.0438 -0.0310 0.0308  296 LEU B O   
3383 C  CB  . LEU B 157 ? 0.1737 0.1976 0.1594 -0.0492 -0.0350 0.0349  296 LEU B CB  
3384 C  CG  . LEU B 157 ? 0.2298 0.2459 0.2108 -0.0496 -0.0359 0.0338  296 LEU B CG  
3385 C  CD1 . LEU B 157 ? 0.2031 0.2292 0.1904 -0.0468 -0.0353 0.0348  296 LEU B CD1 
3386 C  CD2 . LEU B 157 ? 0.2196 0.2232 0.1977 -0.0455 -0.0341 0.0289  296 LEU B CD2 
3387 N  N   . GLU B 158 ? 0.2225 0.2546 0.2095 -0.0538 -0.0351 0.0387  297 GLU B N   
3388 C  CA  . GLU B 158 ? 0.2568 0.2979 0.2495 -0.0518 -0.0336 0.0397  297 GLU B CA  
3389 C  C   . GLU B 158 ? 0.2546 0.2872 0.2463 -0.0499 -0.0321 0.0360  297 GLU B C   
3390 O  O   . GLU B 158 ? 0.2535 0.2902 0.2510 -0.0451 -0.0297 0.0343  297 GLU B O   
3391 C  CB  . GLU B 158 ? 0.2841 0.3347 0.2755 -0.0578 -0.0358 0.0455  297 GLU B CB  
3392 C  CG  . GLU B 158 ? 0.4820 0.5417 0.4785 -0.0555 -0.0339 0.0470  297 GLU B CG  
3393 C  CD  . GLU B 158 ? 0.6345 0.7025 0.6391 -0.0479 -0.0311 0.0456  297 GLU B CD  
3394 O  OE1 . GLU B 158 ? 0.7133 0.7804 0.7208 -0.0439 -0.0289 0.0432  297 GLU B OE1 
3395 O  OE2 . GLU B 158 ? 0.6739 0.7478 0.6810 -0.0455 -0.0307 0.0467  297 GLU B OE2 
3396 N  N   . GLU B 159 ? 0.2352 0.2555 0.2191 -0.0536 -0.0336 0.0348  298 GLU B N   
3397 C  CA  . GLU B 159 ? 0.2855 0.2983 0.2681 -0.0522 -0.0324 0.0318  298 GLU B CA  
3398 C  C   . GLU B 159 ? 0.2521 0.2587 0.2370 -0.0457 -0.0299 0.0267  298 GLU B C   
3399 O  O   . GLU B 159 ? 0.2720 0.2743 0.2575 -0.0434 -0.0284 0.0241  298 GLU B O   
3400 C  CB  . GLU B 159 ? 0.3282 0.3297 0.3007 -0.0582 -0.0347 0.0325  298 GLU B CB  
3401 C  CG  . GLU B 159 ? 0.3803 0.3692 0.3447 -0.0592 -0.0359 0.0309  298 GLU B CG  
3402 C  CD  . GLU B 159 ? 0.4626 0.4425 0.4158 -0.0668 -0.0391 0.0333  298 GLU B CD  
3403 O  OE1 . GLU B 159 ? 0.4485 0.4148 0.3939 -0.0670 -0.0392 0.0309  298 GLU B OE1 
3404 O  OE2 . GLU B 159 ? 0.4394 0.4258 0.3908 -0.0715 -0.0412 0.0375  298 GLU B OE2 
3405 N  N   . ILE B 160 ? 0.1794 0.1863 0.1660 -0.0430 -0.0294 0.0256  299 ILE B N   
3406 C  CA  . ILE B 160 ? 0.1840 0.1875 0.1738 -0.0369 -0.0270 0.0213  299 ILE B CA  
3407 C  C   . ILE B 160 ? 0.1752 0.1887 0.1729 -0.0325 -0.0253 0.0212  299 ILE B C   
3408 O  O   . ILE B 160 ? 0.1585 0.1703 0.1582 -0.0285 -0.0240 0.0185  299 ILE B O   
3409 C  CB  . ILE B 160 ? 0.2190 0.2117 0.2027 -0.0364 -0.0274 0.0192  299 ILE B CB  
3410 C  CG1 . ILE B 160 ? 0.2028 0.1973 0.1844 -0.0389 -0.0291 0.0216  299 ILE B CG1 
3411 C  CG2 . ILE B 160 ? 0.2358 0.2164 0.2106 -0.0391 -0.0285 0.0185  299 ILE B CG2 
3412 C  CD1 . ILE B 160 ? 0.2329 0.2174 0.2090 -0.0374 -0.0292 0.0194  299 ILE B CD1 
3413 N  N   . ALA B 161 ? 0.1531 0.1771 0.1549 -0.0331 -0.0254 0.0241  300 ALA B N   
3414 C  CA  . ALA B 161 ? 0.1476 0.1808 0.1558 -0.0288 -0.0238 0.0243  300 ALA B CA  
3415 C  C   . ALA B 161 ? 0.1585 0.1895 0.1705 -0.0233 -0.0213 0.0203  300 ALA B C   
3416 O  O   . ALA B 161 ? 0.1589 0.1921 0.1739 -0.0196 -0.0201 0.0189  300 ALA B O   
3417 C  CB  . ALA B 161 ? 0.1768 0.2213 0.1880 -0.0297 -0.0240 0.0284  300 ALA B CB  
3418 N  N   . GLU B 162 ? 0.1559 0.1824 0.1673 -0.0230 -0.0205 0.0185  301 GLU B N   
3419 C  CA  . GLU B 162 ? 0.1602 0.1851 0.1747 -0.0185 -0.0183 0.0150  301 GLU B CA  
3420 C  C   . GLU B 162 ? 0.1366 0.1543 0.1495 -0.0168 -0.0179 0.0118  301 GLU B C   
3421 O  O   . GLU B 162 ? 0.1667 0.1774 0.1748 -0.0190 -0.0190 0.0114  301 GLU B O   
3422 C  CB  . GLU B 162 ? 0.2291 0.2516 0.2433 -0.0190 -0.0178 0.0142  301 GLU B CB  
3423 C  CG  . GLU B 162 ? 0.3660 0.3957 0.3815 -0.0205 -0.0180 0.0175  301 GLU B CG  
3424 C  CD  . GLU B 162 ? 0.6109 0.6490 0.6307 -0.0167 -0.0166 0.0186  301 GLU B CD  
3425 O  OE1 . GLU B 162 ? 0.6334 0.6702 0.6553 -0.0127 -0.0150 0.0159  301 GLU B OE1 
3426 O  OE2 . GLU B 162 ? 0.7684 0.8146 0.7891 -0.0177 -0.0170 0.0224  301 GLU B OE2 
3427 N  N   . GLU B 163 ? 0.1249 0.1440 0.1412 -0.0128 -0.0163 0.0096  302 GLU B N   
3428 C  CA  . GLU B 163 ? 0.1358 0.1497 0.1511 -0.0110 -0.0158 0.0068  302 GLU B CA  
3429 C  C   . GLU B 163 ? 0.1490 0.1556 0.1611 -0.0115 -0.0156 0.0050  302 GLU B C   
3430 O  O   . GLU B 163 ? 0.1598 0.1662 0.1727 -0.0115 -0.0151 0.0045  302 GLU B O   
3431 C  CB  . GLU B 163 ? 0.1359 0.1527 0.1551 -0.0072 -0.0141 0.0048  302 GLU B CB  
3432 C  CG  . GLU B 163 ? 0.1221 0.1355 0.1408 -0.0054 -0.0135 0.0024  302 GLU B CG  
3433 C  CD  . GLU B 163 ? 0.1298 0.1384 0.1473 -0.0046 -0.0128 0.0002  302 GLU B CD  
3434 O  OE1 . GLU B 163 ? 0.1489 0.1577 0.1674 -0.0046 -0.0123 -0.0002 302 GLU B OE1 
3435 O  OE2 . GLU B 163 ? 0.1409 0.1458 0.1562 -0.0038 -0.0127 -0.0009 302 GLU B OE2 
3436 N  N   . GLY B 164 ? 0.1292 0.1299 0.1374 -0.0116 -0.0160 0.0041  303 GLY B N   
3437 C  CA  . GLY B 164 ? 0.1590 0.1527 0.1635 -0.0112 -0.0157 0.0025  303 GLY B CA  
3438 C  C   . GLY B 164 ? 0.2084 0.1967 0.2075 -0.0147 -0.0171 0.0039  303 GLY B C   
3439 O  O   . GLY B 164 ? 0.2695 0.2512 0.2646 -0.0142 -0.0169 0.0027  303 GLY B O   
3440 N  N   . SER B 165 ? 0.1737 0.1648 0.1722 -0.0182 -0.0186 0.0067  304 SER B N   
3441 C  CA  . SER B 165 ? 0.1882 0.1741 0.1809 -0.0224 -0.0203 0.0083  304 SER B CA  
3442 C  C   . SER B 165 ? 0.2268 0.2046 0.2117 -0.0244 -0.0218 0.0090  304 SER B C   
3443 O  O   . SER B 165 ? 0.2218 0.2005 0.2069 -0.0235 -0.0219 0.0091  304 SER B O   
3444 C  CB  A SER B 165 ? 0.1830 0.1761 0.1780 -0.0257 -0.0213 0.0114  304 SER B CB  
3445 C  CB  B SER B 165 ? 0.1853 0.1785 0.1802 -0.0258 -0.0214 0.0115  304 SER B CB  
3446 O  OG  A SER B 165 ? 0.2318 0.2305 0.2281 -0.0269 -0.0222 0.0137  304 SER B OG  
3447 O  OG  B SER B 165 ? 0.1519 0.1525 0.1533 -0.0235 -0.0199 0.0112  304 SER B OG  
3448 N  N   . GLU B 166 ? 0.2110 0.1805 0.1885 -0.0274 -0.0230 0.0095  305 GLU B N   
3449 C  CA  . GLU B 166 ? 0.2253 0.1850 0.1934 -0.0296 -0.0246 0.0102  305 GLU B CA  
3450 C  C   . GLU B 166 ? 0.2490 0.2035 0.2100 -0.0355 -0.0269 0.0125  305 GLU B C   
3451 O  O   . GLU B 166 ? 0.2375 0.1949 0.2006 -0.0371 -0.0269 0.0131  305 GLU B O   
3452 C  CB  . GLU B 166 ? 0.2654 0.2159 0.2287 -0.0254 -0.0232 0.0074  305 GLU B CB  
3453 C  CG  . GLU B 166 ? 0.3072 0.2532 0.2685 -0.0242 -0.0224 0.0059  305 GLU B CG  
3454 C  CD  . GLU B 166 ? 0.4064 0.3454 0.3638 -0.0191 -0.0208 0.0035  305 GLU B CD  
3455 O  OE1 . GLU B 166 ? 0.4596 0.4047 0.4236 -0.0147 -0.0189 0.0019  305 GLU B OE1 
3456 O  OE2 . GLU B 166 ? 0.5015 0.4290 0.4487 -0.0194 -0.0214 0.0034  305 GLU B OE2 
3457 N  N   . THR B 167 ? 0.2250 0.1716 0.1772 -0.0390 -0.0289 0.0140  306 THR B N   
3458 C  CA  . THR B 167 ? 0.2609 0.2006 0.2043 -0.0453 -0.0315 0.0163  306 THR B CA  
3459 C  C   . THR B 167 ? 0.3470 0.2719 0.2777 -0.0464 -0.0328 0.0160  306 THR B C   
3460 O  O   . THR B 167 ? 0.3544 0.2771 0.2847 -0.0428 -0.0319 0.0146  306 THR B O   
3461 C  CB  . THR B 167 ? 0.2690 0.2186 0.2153 -0.0511 -0.0336 0.0204  306 THR B CB  
3462 O  OG1 . THR B 167 ? 0.3514 0.2958 0.2901 -0.0575 -0.0359 0.0227  306 THR B OG1 
3463 C  CG2 . THR B 167 ? 0.3071 0.2578 0.2517 -0.0529 -0.0350 0.0222  306 THR B CG2 
3464 N  N   . GLN B 168 ? 0.3274 0.2418 0.2472 -0.0514 -0.0349 0.0173  307 GLN B N   
3465 C  CA  . GLN B 168 ? 0.3449 0.2432 0.2506 -0.0528 -0.0363 0.0172  307 GLN B CA  
3466 C  C   . GLN B 168 ? 0.3781 0.2781 0.2789 -0.0593 -0.0394 0.0205  307 GLN B C   
3467 O  O   . GLN B 168 ? 0.3759 0.2838 0.2787 -0.0638 -0.0408 0.0229  307 GLN B O   
3468 C  CB  . GLN B 168 ? 0.3467 0.2337 0.2431 -0.0515 -0.0359 0.0155  307 GLN B CB  
3469 C  CG  . GLN B 168 ? 0.3581 0.2430 0.2581 -0.0448 -0.0330 0.0123  307 GLN B CG  
3470 C  CD  . GLN B 168 ? 0.5150 0.3923 0.4107 -0.0383 -0.0312 0.0099  307 GLN B CD  
3471 O  OE1 . GLN B 168 ? 0.6127 0.4772 0.4958 -0.0386 -0.0321 0.0100  307 GLN B OE1 
3472 N  NE2 . GLN B 168 ? 0.4389 0.3256 0.3451 -0.0319 -0.0284 0.0079  307 GLN B NE2 
3473 N  N   . VAL B 169 ? 0.3659 0.2597 0.2604 -0.0594 -0.0403 0.0206  308 VAL B N   
3474 C  CA  . VAL B 169 ? 0.3465 0.2431 0.2367 -0.0652 -0.0433 0.0235  308 VAL B CA  
3475 C  C   . VAL B 169 ? 0.3699 0.2516 0.2449 -0.0658 -0.0447 0.0223  308 VAL B C   
3476 O  O   . VAL B 169 ? 0.3735 0.2440 0.2428 -0.0606 -0.0429 0.0196  308 VAL B O   
3477 C  CB  . VAL B 169 ? 0.3729 0.2788 0.2711 -0.0659 -0.0436 0.0254  308 VAL B CB  
3478 C  CG1 . VAL B 169 ? 0.3246 0.2458 0.2377 -0.0647 -0.0420 0.0263  308 VAL B CG1 
3479 C  CG2 . VAL B 169 ? 0.3481 0.2446 0.2429 -0.0612 -0.0422 0.0233  308 VAL B CG2 
3480 N  N   . PRO B 170 ? 0.4101 0.2918 0.2782 -0.0720 -0.0480 0.0242  309 PRO B N   
3481 C  CA  . PRO B 170 ? 0.4805 0.3478 0.3332 -0.0734 -0.0498 0.0230  309 PRO B CA  
3482 C  C   . PRO B 170 ? 0.5436 0.4045 0.3933 -0.0704 -0.0492 0.0219  309 PRO B C   
3483 O  O   . PRO B 170 ? 0.4592 0.3293 0.3180 -0.0705 -0.0490 0.0233  309 PRO B O   
3484 C  CB  . PRO B 170 ? 0.4885 0.3613 0.3388 -0.0810 -0.0534 0.0259  309 PRO B CB  
3485 C  CG  . PRO B 170 ? 0.5100 0.3976 0.3715 -0.0828 -0.0532 0.0281  309 PRO B CG  
3486 C  CD  . PRO B 170 ? 0.3949 0.2900 0.2684 -0.0779 -0.0504 0.0276  309 PRO B CD  
3487 N  N   . GLY B 171 ? 0.5153 0.3609 0.3522 -0.0676 -0.0488 0.0195  310 GLY B N   
3488 C  CA  . GLY B 171 ? 0.5380 0.3763 0.3699 -0.0651 -0.0484 0.0186  310 GLY B CA  
3489 C  C   . GLY B 171 ? 0.5087 0.3522 0.3406 -0.0717 -0.0518 0.0209  310 GLY B C   
3490 O  O   . GLY B 171 ? 0.4639 0.3123 0.2952 -0.0780 -0.0544 0.0229  310 GLY B O   
3491 N  N   . LEU B 172 ? 0.4597 0.3034 0.2939 -0.0697 -0.0512 0.0209  311 LEU B N   
3492 C  CA  . LEU B 172 ? 0.4223 0.2719 0.2577 -0.0756 -0.0542 0.0232  311 LEU B CA  
3493 C  C   . LEU B 172 ? 0.3698 0.2110 0.2000 -0.0725 -0.0535 0.0219  311 LEU B C   
3494 O  O   . LEU B 172 ? 0.4281 0.2608 0.2552 -0.0654 -0.0505 0.0196  311 LEU B O   
3495 C  CB  . LEU B 172 ? 0.4799 0.3482 0.3313 -0.0775 -0.0543 0.0261  311 LEU B CB  
3496 C  CG  . LEU B 172 ? 0.4263 0.3009 0.2889 -0.0716 -0.0510 0.0260  311 LEU B CG  
3497 C  CD1 . LEU B 172 ? 0.5407 0.4332 0.4165 -0.0748 -0.0518 0.0294  311 LEU B CD1 
3498 C  CD2 . LEU B 172 ? 0.3647 0.2372 0.2309 -0.0654 -0.0476 0.0240  311 LEU B CD2 
3499 N  N   . ASP B 173 ? 0.3968 0.2406 0.2258 -0.0777 -0.0564 0.0236  312 ASP B N   
3500 C  CA  . ASP B 173 ? 0.4081 0.2456 0.2334 -0.0752 -0.0558 0.0228  312 ASP B CA  
3501 C  C   . ASP B 173 ? 0.3906 0.2392 0.2298 -0.0708 -0.0532 0.0239  312 ASP B C   
3502 O  O   . ASP B 173 ? 0.3909 0.2532 0.2402 -0.0744 -0.0545 0.0267  312 ASP B O   
3503 C  CB  . ASP B 173 ? 0.4526 0.2899 0.2734 -0.0821 -0.0592 0.0245  312 ASP B CB  
3504 C  CG  . ASP B 173 ? 0.5205 0.3499 0.3355 -0.0802 -0.0593 0.0235  312 ASP B CG  
3505 O  OD1 . ASP B 173 ? 0.4357 0.2601 0.2510 -0.0725 -0.0559 0.0217  312 ASP B OD1 
3506 O  OD2 . ASP B 173 ? 0.4804 0.3105 0.2934 -0.0851 -0.0615 0.0252  312 ASP B OD2 
3507 N  N   . ILE B 174 ? 0.3587 0.2016 0.1980 -0.0627 -0.0496 0.0218  313 ILE B N   
3508 C  CA  . ILE B 174 ? 0.3308 0.1832 0.1822 -0.0579 -0.0472 0.0227  313 ILE B CA  
3509 C  C   . ILE B 174 ? 0.4004 0.2564 0.2538 -0.0591 -0.0481 0.0242  313 ILE B C   
3510 O  O   . ILE B 174 ? 0.3489 0.2179 0.2136 -0.0588 -0.0477 0.0264  313 ILE B O   
3511 C  CB  . ILE B 174 ? 0.3444 0.1891 0.1941 -0.0489 -0.0434 0.0200  313 ILE B CB  
3512 C  CG1 . ILE B 174 ? 0.4121 0.2539 0.2603 -0.0477 -0.0424 0.0185  313 ILE B CG1 
3513 C  CG2 . ILE B 174 ? 0.3299 0.1862 0.1928 -0.0436 -0.0409 0.0203  313 ILE B CG2 
3514 C  CD1 . ILE B 174 ? 0.3816 0.2370 0.2417 -0.0512 -0.0429 0.0204  313 ILE B CD1 
3515 N  N   . SER B 175 ? 0.4202 0.2649 0.2621 -0.0604 -0.0495 0.0232  314 SER B N   
3516 C  CA  . SER B 175 ? 0.3987 0.2460 0.2418 -0.0616 -0.0505 0.0245  314 SER B CA  
3517 C  C   . SER B 175 ? 0.4127 0.2738 0.2635 -0.0695 -0.0536 0.0279  314 SER B C   
3518 O  O   . SER B 175 ? 0.4026 0.2712 0.2590 -0.0703 -0.0541 0.0297  314 SER B O   
3519 C  CB  . SER B 175 ? 0.4086 0.2395 0.2366 -0.0613 -0.0512 0.0225  314 SER B CB  
3520 O  OG  . SER B 175 ? 0.5734 0.3984 0.3920 -0.0685 -0.0547 0.0225  314 SER B OG  
3521 N  N   . ALA B 176 ? 0.3540 0.2195 0.2055 -0.0752 -0.0557 0.0288  315 ALA B N   
3522 C  CA  . ALA B 176 ? 0.3601 0.2404 0.2199 -0.0823 -0.0585 0.0321  315 ALA B CA  
3523 C  C   . ALA B 176 ? 0.3381 0.2363 0.2139 -0.0799 -0.0566 0.0345  315 ALA B C   
3524 O  O   . ALA B 176 ? 0.3602 0.2728 0.2449 -0.0842 -0.0580 0.0375  315 ALA B O   
3525 C  CB  . ALA B 176 ? 0.4017 0.2819 0.2573 -0.0886 -0.0612 0.0325  315 ALA B CB  
3526 N  N   . LEU B 177 ? 0.3154 0.2126 0.1946 -0.0727 -0.0533 0.0331  316 LEU B N   
3527 C  CA  . LEU B 177 ? 0.2951 0.2078 0.1876 -0.0692 -0.0516 0.0349  316 LEU B CA  
3528 C  C   . LEU B 177 ? 0.3628 0.2796 0.2597 -0.0649 -0.0504 0.0346  316 LEU B C   
3529 O  O   . LEU B 177 ? 0.3085 0.2408 0.2194 -0.0609 -0.0485 0.0340  316 LEU B O   
3530 C  CB  . LEU B 177 ? 0.2862 0.1989 0.1835 -0.0628 -0.0483 0.0318  316 LEU B CB  
3531 C  CG  . LEU B 177 ? 0.2881 0.1972 0.1818 -0.0662 -0.0490 0.0322  316 LEU B CG  
3532 C  CD1 . LEU B 177 ? 0.3015 0.2091 0.1995 -0.0587 -0.0453 0.0281  316 LEU B CD1 
3533 C  CD2 . LEU B 177 ? 0.3018 0.2268 0.2040 -0.0715 -0.0507 0.0358  316 LEU B CD2 
3534 N  N   . LEU B 178 ? 0.3228 0.2261 0.2089 -0.0652 -0.0512 0.0339  317 LEU B N   
3535 C  CA  . LEU B 178 ? 0.2864 0.1915 0.1752 -0.0608 -0.0500 0.0332  317 LEU B CA  
3536 C  C   . LEU B 178 ? 0.3276 0.2334 0.2132 -0.0668 -0.0529 0.0355  317 LEU B C   
3537 O  O   . LEU B 178 ? 0.3226 0.2237 0.2023 -0.0733 -0.0553 0.0359  317 LEU B O   
3538 C  CB  . LEU B 178 ? 0.2935 0.1834 0.1740 -0.0540 -0.0474 0.0295  317 LEU B CB  
3539 C  CG  . LEU B 178 ? 0.2913 0.1811 0.1763 -0.0469 -0.0438 0.0259  317 LEU B CG  
3540 C  CD1 . LEU B 178 ? 0.3572 0.2318 0.2321 -0.0407 -0.0416 0.0232  317 LEU B CD1 
3541 C  CD2 . LEU B 178 ? 0.3158 0.2245 0.2188 -0.0419 -0.0410 0.0245  317 LEU B CD2 
3542 N  N   . PRO B 179 ? 0.2762 0.1886 0.1667 -0.0644 -0.0526 0.0365  318 PRO B N   
3543 C  CA  . PRO B 179 ? 0.2554 0.1686 0.1440 -0.0694 -0.0548 0.0379  318 PRO B CA  
3544 C  C   . PRO B 179 ? 0.3016 0.1950 0.1749 -0.0709 -0.0557 0.0358  318 PRO B C   
3545 O  O   . PRO B 179 ? 0.3678 0.2481 0.2332 -0.0658 -0.0538 0.0330  318 PRO B O   
3546 C  CB  . PRO B 179 ? 0.2814 0.2034 0.1773 -0.0645 -0.0536 0.0385  318 PRO B CB  
3547 C  CG  . PRO B 179 ? 0.2784 0.2123 0.1875 -0.0578 -0.0502 0.0362  318 PRO B CG  
3548 C  CD  . PRO B 179 ? 0.2586 0.1814 0.1615 -0.0560 -0.0489 0.0338  318 PRO B CD  
3549 N  N   . SER B 180 ? 0.3293 0.2212 0.1985 -0.0775 -0.0587 0.0370  319 SER B N   
3550 C  CA  . SER B 180 ? 0.3823 0.2556 0.2361 -0.0793 -0.0601 0.0349  319 SER B CA  
3551 C  C   . SER B 180 ? 0.4350 0.3008 0.2840 -0.0747 -0.0588 0.0338  319 SER B C   
3552 O  O   . SER B 180 ? 0.4537 0.3025 0.2895 -0.0728 -0.0586 0.0313  319 SER B O   
3553 C  CB  . SER B 180 ? 0.4547 0.3289 0.3050 -0.0891 -0.0643 0.0365  319 SER B CB  
3554 O  OG  . SER B 180 ? 0.5436 0.4334 0.4046 -0.0927 -0.0655 0.0399  319 SER B OG  
3555 N  N   . ASP B 181 ? 0.3659 0.2445 0.2255 -0.0726 -0.0580 0.0357  320 ASP B N   
3556 C  CA  . ASP B 181 ? 0.3707 0.2441 0.2271 -0.0682 -0.0568 0.0351  320 ASP B CA  
3557 C  C   . ASP B 181 ? 0.3648 0.2322 0.2198 -0.0586 -0.0530 0.0327  320 ASP B C   
3558 O  O   . ASP B 181 ? 0.3804 0.2595 0.2460 -0.0541 -0.0512 0.0333  320 ASP B O   
3559 C  CB  . ASP B 181 ? 0.3596 0.2501 0.2281 -0.0697 -0.0575 0.0380  320 ASP B CB  
3560 C  CG  . ASP B 181 ? 0.4406 0.3269 0.3064 -0.0654 -0.0565 0.0374  320 ASP B CG  
3561 O  OD1 . ASP B 181 ? 0.4780 0.3483 0.3327 -0.0611 -0.0551 0.0349  320 ASP B OD1 
3562 O  OD2 . ASP B 181 ? 0.3850 0.2847 0.2601 -0.0662 -0.0571 0.0396  320 ASP B OD2 
3563 N  N   . PHE B 182 ? 0.3873 0.2370 0.2292 -0.0553 -0.0518 0.0299  321 PHE B N   
3564 C  CA  . PHE B 182 ? 0.3733 0.2164 0.2129 -0.0457 -0.0480 0.0276  321 PHE B CA  
3565 C  C   . PHE B 182 ? 0.3684 0.2101 0.2074 -0.0401 -0.0463 0.0273  321 PHE B C   
3566 O  O   . PHE B 182 ? 0.3960 0.2325 0.2327 -0.0317 -0.0429 0.0255  321 PHE B O   
3567 C  CB  . PHE B 182 ? 0.3824 0.2079 0.2081 -0.0438 -0.0471 0.0246  321 PHE B CB  
3568 C  CG  . PHE B 182 ? 0.4468 0.2729 0.2731 -0.0465 -0.0477 0.0242  321 PHE B CG  
3569 C  CD1 . PHE B 182 ? 0.6041 0.4158 0.4185 -0.0448 -0.0469 0.0215  321 PHE B CD1 
3570 C  CD2 . PHE B 182 ? 0.4920 0.3335 0.3307 -0.0505 -0.0488 0.0264  321 PHE B CD2 
3571 C  CE1 . PHE B 182 ? 0.5668 0.3792 0.3817 -0.0472 -0.0475 0.0211  321 PHE B CE1 
3572 C  CE2 . PHE B 182 ? 0.5372 0.3793 0.3765 -0.0529 -0.0493 0.0261  321 PHE B CE2 
3573 C  CZ  . PHE B 182 ? 0.5494 0.3769 0.3769 -0.0514 -0.0487 0.0234  321 PHE B CZ  
3574 N  N   . SER B 183 ? 0.3553 0.2019 0.1963 -0.0446 -0.0484 0.0292  322 SER B N   
3575 C  CA  . SER B 183 ? 0.3419 0.1857 0.1808 -0.0399 -0.0471 0.0289  322 SER B CA  
3576 C  C   . SER B 183 ? 0.3340 0.1946 0.1866 -0.0368 -0.0463 0.0308  322 SER B C   
3577 O  O   . SER B 183 ? 0.3642 0.2257 0.2189 -0.0304 -0.0437 0.0293  322 SER B O   
3578 C  CB  . SER B 183 ? 0.3920 0.2289 0.2230 -0.0462 -0.0500 0.0296  322 SER B CB  
3579 O  OG  . SER B 183 ? 0.4239 0.2753 0.2645 -0.0534 -0.0529 0.0326  322 SER B OG  
3580 N  N   . ARG B 184 ? 0.3535 0.2312 0.2197 -0.0405 -0.0473 0.0320  323 ARG B N   
3581 C  CA  . ARG B 184 ? 0.2833 0.1815 0.1673 -0.0375 -0.0457 0.0317  323 ARG B CA  
3582 C  C   . ARG B 184 ? 0.2732 0.1839 0.1706 -0.0327 -0.0426 0.0293  323 ARG B C   
3583 O  O   . ARG B 184 ? 0.2664 0.1836 0.1684 -0.0365 -0.0439 0.0303  323 ARG B O   
3584 C  CB  . ARG B 184 ? 0.2541 0.1637 0.1434 -0.0453 -0.0494 0.0355  323 ARG B CB  
3585 C  CG  . ARG B 184 ? 0.3074 0.2071 0.1852 -0.0507 -0.0525 0.0379  323 ARG B CG  
3586 C  CD  . ARG B 184 ? 0.3169 0.2322 0.2042 -0.0573 -0.0551 0.0409  323 ARG B CD  
3587 N  NE  . ARG B 184 ? 0.4160 0.3245 0.2965 -0.0617 -0.0570 0.0416  323 ARG B NE  
3588 C  CZ  . ARG B 184 ? 0.5089 0.4057 0.3790 -0.0680 -0.0592 0.0415  323 ARG B CZ  
3589 N  NH1 . ARG B 184 ? 0.4719 0.3627 0.3374 -0.0708 -0.0599 0.0407  323 ARG B NH1 
3590 N  NH2 . ARG B 184 ? 0.5077 0.3989 0.3719 -0.0718 -0.0611 0.0422  323 ARG B NH2 
3591 N  N   . TYR B 185 ? 0.2332 0.1475 0.1367 -0.0245 -0.0387 0.0264  324 TYR B N   
3592 C  CA  . TYR B 185 ? 0.2064 0.1315 0.1217 -0.0198 -0.0358 0.0241  324 TYR B CA  
3593 C  C   . TYR B 185 ? 0.2215 0.1566 0.1469 -0.0127 -0.0324 0.0220  324 TYR B C   
3594 O  O   . TYR B 185 ? 0.2238 0.1553 0.1457 -0.0103 -0.0318 0.0221  324 TYR B O   
3595 C  CB  . TYR B 185 ? 0.2190 0.1319 0.1258 -0.0174 -0.0345 0.0223  324 TYR B CB  
3596 C  CG  . TYR B 185 ? 0.2318 0.1290 0.1258 -0.0123 -0.0328 0.0210  324 TYR B CG  
3597 C  CD1 . TYR B 185 ? 0.2424 0.1432 0.1409 -0.0041 -0.0289 0.0187  324 TYR B CD1 
3598 C  CD2 . TYR B 185 ? 0.2469 0.1254 0.1236 -0.0158 -0.0350 0.0223  324 TYR B CD2 
3599 C  CE1 . TYR B 185 ? 0.2372 0.1246 0.1240 0.0013  -0.0271 0.0179  324 TYR B CE1 
3600 C  CE2 . TYR B 185 ? 0.2971 0.1604 0.1609 -0.0105 -0.0333 0.0212  324 TYR B CE2 
3601 C  CZ  . TYR B 185 ? 0.2816 0.1498 0.1508 -0.0016 -0.0292 0.0191  324 TYR B CZ  
3602 O  OH  . TYR B 185 ? 0.3140 0.1680 0.1704 0.0044  -0.0272 0.0183  324 TYR B OH  
3603 N  N   . PHE B 186 ? 0.1928 0.1400 0.1302 -0.0096 -0.0303 0.0204  325 PHE B N   
3604 C  CA  . PHE B 186 ? 0.1619 0.1185 0.1087 -0.0031 -0.0270 0.0183  325 PHE B CA  
3605 C  C   . PHE B 186 ? 0.1757 0.1274 0.1202 0.0023  -0.0240 0.0158  325 PHE B C   
3606 O  O   . PHE B 186 ? 0.2022 0.1483 0.1427 0.0008  -0.0245 0.0155  325 PHE B O   
3607 C  CB  . PHE B 186 ? 0.1711 0.1450 0.1325 -0.0040 -0.0269 0.0183  325 PHE B CB  
3608 C  CG  . PHE B 186 ? 0.1570 0.1373 0.1212 -0.0088 -0.0296 0.0210  325 PHE B CG  
3609 C  CD1 . PHE B 186 ? 0.2056 0.1876 0.1691 -0.0150 -0.0326 0.0235  325 PHE B CD1 
3610 C  CD2 . PHE B 186 ? 0.1810 0.1658 0.1482 -0.0071 -0.0293 0.0214  325 PHE B CD2 
3611 C  CE1 . PHE B 186 ? 0.2109 0.1999 0.1768 -0.0194 -0.0351 0.0264  325 PHE B CE1 
3612 C  CE2 . PHE B 186 ? 0.1972 0.1883 0.1669 -0.0114 -0.0318 0.0240  325 PHE B CE2 
3613 C  CZ  . PHE B 186 ? 0.1992 0.1928 0.1684 -0.0175 -0.0347 0.0266  325 PHE B CZ  
3614 N  N   . GLN B 187 ? 0.1747 0.1292 0.1218 0.0086  -0.0210 0.0143  326 GLN B N   
3615 C  CA  . GLN B 187 ? 0.1647 0.1156 0.1095 0.0140  -0.0182 0.0125  326 GLN B CA  
3616 C  C   . GLN B 187 ? 0.1752 0.1386 0.1303 0.0193  -0.0152 0.0110  326 GLN B C   
3617 O  O   . GLN B 187 ? 0.1829 0.1510 0.1409 0.0210  -0.0146 0.0114  326 GLN B O   
3618 C  CB  . GLN B 187 ? 0.2001 0.1345 0.1297 0.0167  -0.0177 0.0127  326 GLN B CB  
3619 C  CG  . GLN B 187 ? 0.1990 0.1279 0.1240 0.0218  -0.0153 0.0113  326 GLN B CG  
3620 C  CD  . GLN B 187 ? 0.2146 0.1249 0.1225 0.0238  -0.0153 0.0118  326 GLN B CD  
3621 O  OE1 . GLN B 187 ? 0.2717 0.1779 0.1741 0.0293  -0.0133 0.0118  326 GLN B OE1 
3622 N  NE2 . GLN B 187 ? 0.2544 0.1531 0.1530 0.0192  -0.0176 0.0123  326 GLN B NE2 
3623 N  N   . TYR B 188 ? 0.1571 0.1259 0.1176 0.0216  -0.0134 0.0096  327 TYR B N   
3624 C  CA  . TYR B 188 ? 0.1552 0.1355 0.1246 0.0261  -0.0107 0.0084  327 TYR B CA  
3625 C  C   . TYR B 188 ? 0.1532 0.1336 0.1225 0.0292  -0.0087 0.0072  327 TYR B C   
3626 O  O   . TYR B 188 ? 0.1706 0.1431 0.1344 0.0276  -0.0095 0.0071  327 TYR B O   
3627 C  CB  . TYR B 188 ? 0.1323 0.1261 0.1140 0.0234  -0.0114 0.0083  327 TYR B CB  
3628 C  CG  . TYR B 188 ? 0.1276 0.1258 0.1148 0.0204  -0.0122 0.0077  327 TYR B CG  
3629 C  CD1 . TYR B 188 ? 0.1233 0.1294 0.1174 0.0225  -0.0104 0.0062  327 TYR B CD1 
3630 C  CD2 . TYR B 188 ? 0.1120 0.1063 0.0968 0.0153  -0.0149 0.0088  327 TYR B CD2 
3631 C  CE1 . TYR B 188 ? 0.1187 0.1280 0.1170 0.0200  -0.0111 0.0056  327 TYR B CE1 
3632 C  CE2 . TYR B 188 ? 0.1323 0.1307 0.1218 0.0130  -0.0155 0.0084  327 TYR B CE2 
3633 C  CZ  . TYR B 188 ? 0.1245 0.1299 0.1206 0.0156  -0.0135 0.0067  327 TYR B CZ  
3634 O  OH  . TYR B 188 ? 0.1175 0.1263 0.1176 0.0135  -0.0140 0.0063  327 TYR B OH  
3635 N  N   . GLU B 189 ? 0.1519 0.1415 0.1273 0.0333  -0.0062 0.0064  328 GLU B N   
3636 C  CA  . GLU B 189 ? 0.1510 0.1427 0.1274 0.0362  -0.0043 0.0055  328 GLU B CA  
3637 C  C   . GLU B 189 ? 0.1462 0.1494 0.1336 0.0338  -0.0045 0.0045  328 GLU B C   
3638 O  O   . GLU B 189 ? 0.1550 0.1680 0.1503 0.0333  -0.0042 0.0043  328 GLU B O   
3639 C  CB  . GLU B 189 ? 0.2195 0.2135 0.1937 0.0425  -0.0014 0.0058  328 GLU B CB  
3640 C  CG  . GLU B 189 ? 0.2751 0.2698 0.2479 0.0458  0.0005  0.0054  328 GLU B CG  
3641 C  CD  . GLU B 189 ? 0.4664 0.4622 0.4349 0.0526  0.0034  0.0064  328 GLU B CD  
3642 O  OE1 . GLU B 189 ? 0.4876 0.4911 0.4595 0.0554  0.0053  0.0064  328 GLU B OE1 
3643 O  OE2 . GLU B 189 ? 0.5252 0.5144 0.4867 0.0552  0.0038  0.0073  328 GLU B OE2 
3644 N  N   . GLY B 190 ? 0.1265 0.1281 0.1140 0.0323  -0.0048 0.0038  329 GLY B N   
3645 C  CA  . GLY B 190 ? 0.1355 0.1462 0.1321 0.0299  -0.0051 0.0029  329 GLY B CA  
3646 C  C   . GLY B 190 ? 0.1510 0.1606 0.1467 0.0307  -0.0043 0.0021  329 GLY B C   
3647 O  O   . GLY B 190 ? 0.1554 0.1636 0.1473 0.0347  -0.0025 0.0023  329 GLY B O   
3648 N  N   . SER B 191 ? 0.1416 0.1526 0.1410 0.0272  -0.0055 0.0015  330 SER B N   
3649 C  CA  . SER B 191 ? 0.1130 0.1246 0.1132 0.0275  -0.0049 0.0007  330 SER B CA  
3650 C  C   . SER B 191 ? 0.1362 0.1415 0.1339 0.0239  -0.0066 0.0007  330 SER B C   
3651 O  O   . SER B 191 ? 0.1368 0.1392 0.1334 0.0207  -0.0085 0.0014  330 SER B O   
3652 C  CB  . SER B 191 ? 0.1144 0.1367 0.1232 0.0269  -0.0042 -0.0001 330 SER B CB  
3653 O  OG  . SER B 191 ? 0.1173 0.1422 0.1307 0.0232  -0.0058 -0.0004 330 SER B OG  
3654 N  N   . LEU B 192 ? 0.1456 0.1496 0.1425 0.0244  -0.0061 0.0001  331 LEU B N   
3655 C  CA  . LEU B 192 ? 0.1498 0.1509 0.1467 0.0208  -0.0076 -0.0001 331 LEU B CA  
3656 C  C   . LEU B 192 ? 0.1371 0.1464 0.1422 0.0181  -0.0084 -0.0004 331 LEU B C   
3657 O  O   . LEU B 192 ? 0.1119 0.1289 0.1225 0.0194  -0.0073 -0.0010 331 LEU B O   
3658 C  CB  . LEU B 192 ? 0.1466 0.1459 0.1419 0.0220  -0.0067 -0.0008 331 LEU B CB  
3659 C  CG  . LEU B 192 ? 0.1925 0.1838 0.1792 0.0257  -0.0056 -0.0004 331 LEU B CG  
3660 C  CD1 . LEU B 192 ? 0.1578 0.1491 0.1439 0.0273  -0.0045 -0.0010 331 LEU B CD1 
3661 C  CD2 . LEU B 192 ? 0.2058 0.1855 0.1838 0.0239  -0.0072 0.0004  331 LEU B CD2 
3662 N  N   . THR B 193 ? 0.1290 0.1368 0.1344 0.0145  -0.0102 0.0003  332 THR B N   
3663 C  CA  . THR B 193 ? 0.1061 0.1217 0.1185 0.0127  -0.0107 0.0002  332 THR B CA  
3664 C  C   . THR B 193 ? 0.1057 0.1236 0.1213 0.0119  -0.0105 -0.0006 332 THR B C   
3665 O  O   . THR B 193 ? 0.1148 0.1378 0.1349 0.0106  -0.0109 -0.0006 332 THR B O   
3666 C  CB  . THR B 193 ? 0.0862 0.1015 0.0982 0.0096  -0.0127 0.0019  332 THR B CB  
3667 O  OG1 . THR B 193 ? 0.1215 0.1321 0.1302 0.0068  -0.0140 0.0028  332 THR B OG1 
3668 C  CG2 . THR B 193 ? 0.1247 0.1365 0.1326 0.0099  -0.0133 0.0030  332 THR B CG2 
3669 N  N   . THR B 194 ? 0.1102 0.1243 0.1229 0.0128  -0.0097 -0.0013 333 THR B N   
3670 C  CA  . THR B 194 ? 0.1061 0.1224 0.1216 0.0124  -0.0093 -0.0023 333 THR B CA  
3671 C  C   . THR B 194 ? 0.1345 0.1519 0.1496 0.0151  -0.0076 -0.0033 333 THR B C   
3672 O  O   . THR B 194 ? 0.1541 0.1688 0.1655 0.0174  -0.0069 -0.0030 333 THR B O   
3673 C  CB  . THR B 194 ? 0.1311 0.1422 0.1436 0.0101  -0.0103 -0.0018 333 THR B CB  
3674 O  OG1 . THR B 194 ? 0.1465 0.1497 0.1522 0.0109  -0.0104 -0.0015 333 THR B OG1 
3675 C  CG2 . THR B 194 ? 0.1217 0.1339 0.1353 0.0072  -0.0120 -0.0004 333 THR B CG2 
3676 N  N   . PRO B 195 ? 0.1249 0.1462 0.1434 0.0148  -0.0071 -0.0042 334 PRO B N   
3677 C  CA  . PRO B 195 ? 0.1358 0.1590 0.1538 0.0170  -0.0057 -0.0047 334 PRO B CA  
3678 C  C   . PRO B 195 ? 0.1735 0.1901 0.1855 0.0187  -0.0053 -0.0042 334 PRO B C   
3679 O  O   . PRO B 195 ? 0.1974 0.2083 0.2067 0.0172  -0.0062 -0.0041 334 PRO B O   
3680 C  CB  . PRO B 195 ? 0.1435 0.1696 0.1647 0.0154  -0.0057 -0.0056 334 PRO B CB  
3681 C  CG  . PRO B 195 ? 0.1592 0.1875 0.1838 0.0134  -0.0066 -0.0057 334 PRO B CG  
3682 C  CD  . PRO B 195 ? 0.1349 0.1593 0.1574 0.0128  -0.0076 -0.0047 334 PRO B CD  
3683 N  N   . PRO B 196 ? 0.1473 0.1648 0.1570 0.0221  -0.0039 -0.0038 335 PRO B N   
3684 C  CA  . PRO B 196 ? 0.1699 0.1956 0.1831 0.0237  -0.0027 -0.0037 335 PRO B CA  
3685 C  C   . PRO B 196 ? 0.2135 0.2419 0.2279 0.0245  -0.0026 -0.0033 335 PRO B C   
3686 O  O   . PRO B 196 ? 0.2024 0.2376 0.2192 0.0259  -0.0015 -0.0030 335 PRO B O   
3687 C  CB  . PRO B 196 ? 0.1760 0.2014 0.1852 0.0275  -0.0012 -0.0030 335 PRO B CB  
3688 C  CG  . PRO B 196 ? 0.2131 0.2284 0.2151 0.0288  -0.0015 -0.0026 335 PRO B CG  
3689 C  CD  . PRO B 196 ? 0.1606 0.1710 0.1632 0.0247  -0.0034 -0.0033 335 PRO B CD  
3690 N  N   . CYS B 197 ? 0.1547 0.1784 0.1676 0.0233  -0.0037 -0.0030 336 CYS B N   
3691 C  CA  . CYS B 197 ? 0.1107 0.1368 0.1248 0.0238  -0.0038 -0.0026 336 CYS B CA  
3692 C  C   . CYS B 197 ? 0.1654 0.1924 0.1766 0.0278  -0.0022 -0.0018 336 CYS B C   
3693 O  O   . CYS B 197 ? 0.1265 0.1592 0.1405 0.0286  -0.0016 -0.0015 336 CYS B O   
3694 C  CB  . CYS B 197 ? 0.1523 0.1864 0.1731 0.0222  -0.0039 -0.0032 336 CYS B CB  
3695 S  SG  . CYS B 197 ? 0.1541 0.1886 0.1785 0.0185  -0.0053 -0.0040 336 CYS B SG  
3696 N  N   . ALA B 198 ? 0.1478 0.1692 0.1528 0.0305  -0.0014 -0.0013 337 ALA B N   
3697 C  CA  . ALA B 198 ? 0.1602 0.1822 0.1614 0.0351  0.0004  -0.0003 337 ALA B CA  
3698 C  C   . ALA B 198 ? 0.1566 0.1752 0.1551 0.0360  0.0001  0.0003  337 ALA B C   
3699 O  O   . ALA B 198 ? 0.1813 0.1924 0.1767 0.0337  -0.0015 0.0003  337 ALA B O   
3700 C  CB  . ALA B 198 ? 0.1836 0.1987 0.1775 0.0383  0.0013  0.0001  337 ALA B CB  
3701 N  N   . GLN B 199 ? 0.1421 0.1667 0.1417 0.0391  0.0017  0.0011  338 GLN B N   
3702 C  CA  . GLN B 199 ? 0.1407 0.1630 0.1380 0.0403  0.0016  0.0017  338 GLN B CA  
3703 C  C   . GLN B 199 ? 0.1779 0.1909 0.1652 0.0448  0.0027  0.0027  338 GLN B C   
3704 O  O   . GLN B 199 ? 0.2283 0.2362 0.2101 0.0471  0.0034  0.0029  338 GLN B O   
3705 C  CB  . GLN B 199 ? 0.1287 0.1624 0.1325 0.0412  0.0027  0.0021  338 GLN B CB  
3706 C  CG  . GLN B 199 ? 0.1084 0.1480 0.1201 0.0365  0.0012  0.0010  338 GLN B CG  
3707 C  CD  . GLN B 199 ? 0.1265 0.1767 0.1443 0.0365  0.0020  0.0012  338 GLN B CD  
3708 O  OE1 . GLN B 199 ? 0.1269 0.1808 0.1499 0.0332  0.0008  0.0004  338 GLN B OE1 
3709 N  NE2 . GLN B 199 ? 0.1645 0.2197 0.1812 0.0403  0.0039  0.0025  338 GLN B NE2 
3710 N  N   . GLY B 200 ? 0.1894 0.1993 0.1735 0.0460  0.0027  0.0034  339 GLY B N   
3711 C  CA  . GLY B 200 ? 0.2184 0.2173 0.1915 0.0501  0.0035  0.0043  339 GLY B CA  
3712 C  C   . GLY B 200 ? 0.2137 0.1987 0.1790 0.0470  0.0013  0.0040  339 GLY B C   
3713 O  O   . GLY B 200 ? 0.2554 0.2288 0.2097 0.0499  0.0017  0.0047  339 GLY B O   
3714 N  N   . VAL B 201 ? 0.1872 0.1730 0.1574 0.0412  -0.0010 0.0033  340 VAL B N   
3715 C  CA  . VAL B 201 ? 0.1708 0.1449 0.1342 0.0374  -0.0033 0.0034  340 VAL B CA  
3716 C  C   . VAL B 201 ? 0.1865 0.1555 0.1462 0.0355  -0.0048 0.0043  340 VAL B C   
3717 O  O   . VAL B 201 ? 0.1874 0.1646 0.1544 0.0339  -0.0053 0.0044  340 VAL B O   
3718 C  CB  . VAL B 201 ? 0.1751 0.1534 0.1455 0.0320  -0.0052 0.0027  340 VAL B CB  
3719 C  CG1 . VAL B 201 ? 0.1780 0.1454 0.1415 0.0275  -0.0077 0.0032  340 VAL B CG1 
3720 C  CG2 . VAL B 201 ? 0.1772 0.1602 0.1511 0.0335  -0.0038 0.0018  340 VAL B CG2 
3721 N  N   . ILE B 202 ? 0.2000 0.1549 0.1476 0.0356  -0.0057 0.0050  341 ILE B N   
3722 C  CA  . ILE B 202 ? 0.2132 0.1622 0.1562 0.0332  -0.0074 0.0060  341 ILE B CA  
3723 C  C   . ILE B 202 ? 0.2152 0.1627 0.1597 0.0259  -0.0107 0.0065  341 ILE B C   
3724 O  O   . ILE B 202 ? 0.2185 0.1574 0.1567 0.0234  -0.0120 0.0066  341 ILE B O   
3725 C  CB  . ILE B 202 ? 0.2392 0.1725 0.1670 0.0364  -0.0071 0.0067  341 ILE B CB  
3726 C  CG1 . ILE B 202 ? 0.2601 0.1950 0.1854 0.0445  -0.0036 0.0067  341 ILE B CG1 
3727 C  CG2 . ILE B 202 ? 0.2373 0.1648 0.1603 0.0335  -0.0090 0.0079  341 ILE B CG2 
3728 C  CD1 . ILE B 202 ? 0.3278 0.2761 0.2625 0.0472  -0.0018 0.0068  341 ILE B CD1 
3729 N  N   . TRP B 203 ? 0.1699 0.1262 0.1225 0.0227  -0.0119 0.0069  342 TRP B N   
3730 C  CA  . TRP B 203 ? 0.1657 0.1229 0.1205 0.0161  -0.0149 0.0079  342 TRP B CA  
3731 C  C   . TRP B 203 ? 0.1693 0.1189 0.1167 0.0127  -0.0172 0.0097  342 TRP B C   
3732 O  O   . TRP B 203 ? 0.1830 0.1340 0.1306 0.0146  -0.0167 0.0100  342 TRP B O   
3733 C  CB  . TRP B 203 ? 0.1730 0.1454 0.1414 0.0147  -0.0149 0.0076  342 TRP B CB  
3734 C  CG  . TRP B 203 ? 0.1306 0.1090 0.1053 0.0155  -0.0137 0.0062  342 TRP B CG  
3735 C  CD1 . TRP B 203 ? 0.1462 0.1303 0.1253 0.0199  -0.0112 0.0048  342 TRP B CD1 
3736 C  CD2 . TRP B 203 ? 0.1352 0.1145 0.1119 0.0116  -0.0151 0.0063  342 TRP B CD2 
3737 N  NE1 . TRP B 203 ? 0.1310 0.1188 0.1146 0.0188  -0.0110 0.0039  342 TRP B NE1 
3738 C  CE2 . TRP B 203 ? 0.1336 0.1185 0.1159 0.0140  -0.0133 0.0048  342 TRP B CE2 
3739 C  CE3 . TRP B 203 ? 0.1372 0.1136 0.1116 0.0062  -0.0178 0.0079  342 TRP B CE3 
3740 C  CZ2 . TRP B 203 ? 0.1187 0.1056 0.1041 0.0115  -0.0140 0.0045  342 TRP B CZ2 
3741 C  CZ3 . TRP B 203 ? 0.1462 0.1257 0.1242 0.0039  -0.0184 0.0078  342 TRP B CZ3 
3742 C  CH2 . TRP B 203 ? 0.1276 0.1118 0.1108 0.0067  -0.0164 0.0060  342 TRP B CH2 
3743 N  N   . THR B 204 ? 0.1908 0.1323 0.1315 0.0074  -0.0199 0.0109  343 THR B N   
3744 C  CA  . THR B 204 ? 0.1720 0.1063 0.1052 0.0028  -0.0227 0.0130  343 THR B CA  
3745 C  C   . THR B 204 ? 0.1833 0.1244 0.1218 -0.0040 -0.0255 0.0146  343 THR B C   
3746 O  O   . THR B 204 ? 0.1968 0.1358 0.1340 -0.0067 -0.0264 0.0148  343 THR B O   
3747 C  CB  . THR B 204 ? 0.2171 0.1327 0.1338 0.0025  -0.0235 0.0134  343 THR B CB  
3748 O  OG1 . THR B 204 ? 0.2298 0.1398 0.1413 0.0097  -0.0206 0.0120  343 THR B OG1 
3749 C  CG2 . THR B 204 ? 0.2220 0.1295 0.1300 -0.0032 -0.0268 0.0157  343 THR B CG2 
3750 N  N   . VAL B 205 ? 0.1701 0.1197 0.1145 -0.0065 -0.0269 0.0161  344 VAL B N   
3751 C  CA  . VAL B 205 ? 0.1618 0.1201 0.1120 -0.0123 -0.0294 0.0182  344 VAL B CA  
3752 C  C   . VAL B 205 ? 0.1595 0.1122 0.1019 -0.0183 -0.0328 0.0212  344 VAL B C   
3753 O  O   . VAL B 205 ? 0.1861 0.1387 0.1275 -0.0177 -0.0331 0.0218  344 VAL B O   
3754 C  CB  . VAL B 205 ? 0.1639 0.1388 0.1283 -0.0103 -0.0282 0.0178  344 VAL B CB  
3755 C  CG1 . VAL B 205 ? 0.1737 0.1580 0.1435 -0.0155 -0.0305 0.0203  344 VAL B CG1 
3756 C  CG2 . VAL B 205 ? 0.1908 0.1708 0.1621 -0.0049 -0.0250 0.0149  344 VAL B CG2 
3757 N  N   . PHE B 206 ? 0.1975 0.1453 0.1340 -0.0244 -0.0355 0.0232  345 PHE B N   
3758 C  CA  . PHE B 206 ? 0.2140 0.1568 0.1424 -0.0313 -0.0393 0.0265  345 PHE B CA  
3759 C  C   . PHE B 206 ? 0.2018 0.1592 0.1397 -0.0335 -0.0405 0.0288  345 PHE B C   
3760 O  O   . PHE B 206 ? 0.1926 0.1644 0.1424 -0.0323 -0.0396 0.0288  345 PHE B O   
3761 C  CB  . PHE B 206 ? 0.2072 0.1453 0.1294 -0.0380 -0.0420 0.0286  345 PHE B CB  
3762 C  CG  . PHE B 206 ? 0.2486 0.1688 0.1573 -0.0379 -0.0419 0.0273  345 PHE B CG  
3763 C  CD1 . PHE B 206 ? 0.3083 0.2274 0.2190 -0.0343 -0.0397 0.0249  345 PHE B CD1 
3764 C  CD2 . PHE B 206 ? 0.3440 0.2480 0.2371 -0.0417 -0.0443 0.0287  345 PHE B CD2 
3765 C  CE1 . PHE B 206 ? 0.3432 0.2459 0.2411 -0.0339 -0.0396 0.0239  345 PHE B CE1 
3766 C  CE2 . PHE B 206 ? 0.4268 0.3132 0.3062 -0.0413 -0.0442 0.0276  345 PHE B CE2 
3767 C  CZ  . PHE B 206 ? 0.3940 0.2801 0.2760 -0.0373 -0.0418 0.0252  345 PHE B CZ  
3768 N  N   . ASN B 207 ? 0.2189 0.1721 0.1507 -0.0367 -0.0427 0.0309  346 ASN B N   
3769 C  CA  . ASN B 207 ? 0.2247 0.1914 0.1640 -0.0399 -0.0445 0.0337  346 ASN B CA  
3770 C  C   . ASN B 207 ? 0.2504 0.2230 0.1896 -0.0475 -0.0479 0.0376  346 ASN B C   
3771 O  O   . ASN B 207 ? 0.2553 0.2439 0.2051 -0.0482 -0.0482 0.0395  346 ASN B O   
3772 C  CB  . ASN B 207 ? 0.2617 0.2220 0.1942 -0.0412 -0.0459 0.0349  346 ASN B CB  
3773 C  CG  . ASN B 207 ? 0.3051 0.2799 0.2458 -0.0439 -0.0476 0.0379  346 ASN B CG  
3774 O  OD1 . ASN B 207 ? 0.2786 0.2673 0.2319 -0.0396 -0.0455 0.0369  346 ASN B OD1 
3775 N  ND2 . ASN B 207 ? 0.3415 0.3129 0.2746 -0.0512 -0.0515 0.0416  346 ASN B ND2 
3776 N  N   . GLN B 208 ? 0.2384 0.1980 0.1651 -0.0531 -0.0503 0.0390  347 GLN B N   
3777 C  CA  . GLN B 208 ? 0.2345 0.1987 0.1597 -0.0608 -0.0536 0.0429  347 GLN B CA  
3778 C  C   . GLN B 208 ? 0.2778 0.2492 0.2106 -0.0586 -0.0518 0.0417  347 GLN B C   
3779 O  O   . GLN B 208 ? 0.2725 0.2368 0.2044 -0.0536 -0.0491 0.0380  347 GLN B O   
3780 C  CB  . GLN B 208 ? 0.2806 0.2279 0.1919 -0.0668 -0.0555 0.0431  347 GLN B CB  
3781 C  CG  . GLN B 208 ? 0.3197 0.2725 0.2329 -0.0746 -0.0574 0.0455  347 GLN B CG  
3782 C  CD  . GLN B 208 ? 0.3866 0.3226 0.2861 -0.0806 -0.0597 0.0449  347 GLN B CD  
3783 O  OE1 . GLN B 208 ? 0.3823 0.3025 0.2712 -0.0784 -0.0592 0.0421  347 GLN B OE1 
3784 N  NE2 . GLN B 208 ? 0.4726 0.4121 0.3721 -0.0880 -0.0622 0.0473  347 GLN B NE2 
3785 N  N   . THR B 209 ? 0.2460 0.2317 0.1867 -0.0620 -0.0527 0.0446  348 THR B N   
3786 C  CA  . THR B 209 ? 0.2330 0.2260 0.1799 -0.0604 -0.0516 0.0441  348 THR B CA  
3787 C  C   . THR B 209 ? 0.2810 0.2677 0.2216 -0.0666 -0.0528 0.0455  348 THR B C   
3788 O  O   . THR B 209 ? 0.2907 0.2691 0.2235 -0.0726 -0.0546 0.0468  348 THR B O   
3789 C  CB  . THR B 209 ? 0.2193 0.2320 0.1808 -0.0582 -0.0498 0.0454  348 THR B CB  
3790 O  OG1 . THR B 209 ? 0.2881 0.3069 0.2510 -0.0639 -0.0502 0.0491  348 THR B OG1 
3791 C  CG2 . THR B 209 ? 0.2168 0.2365 0.1855 -0.0522 -0.0484 0.0438  348 THR B CG2 
3792 N  N   . VAL B 210 ? 0.2165 0.2074 0.1609 -0.0654 -0.0519 0.0451  349 VAL B N   
3793 C  CA  . VAL B 210 ? 0.2382 0.2271 0.1793 -0.0716 -0.0528 0.0468  349 VAL B CA  
3794 C  C   . VAL B 210 ? 0.2508 0.2579 0.2040 -0.0718 -0.0512 0.0495  349 VAL B C   
3795 O  O   . VAL B 210 ? 0.2384 0.2569 0.2014 -0.0658 -0.0491 0.0487  349 VAL B O   
3796 C  CB  . VAL B 210 ? 0.4302 0.4067 0.3637 -0.0707 -0.0529 0.0445  349 VAL B CB  
3797 C  CG1 . VAL B 210 ? 0.4165 0.3743 0.3377 -0.0685 -0.0531 0.0419  349 VAL B CG1 
3798 C  CG2 . VAL B 210 ? 0.4552 0.4406 0.3975 -0.0649 -0.0507 0.0429  349 VAL B CG2 
3799 N  N   . SER B 211 ? 0.2289 0.2385 0.1811 -0.0785 -0.0521 0.0527  350 SER B N   
3800 C  CA  . SER B 211 ? 0.1832 0.2093 0.1452 -0.0787 -0.0502 0.0559  350 SER B CA  
3801 C  C   . SER B 211 ? 0.2208 0.2476 0.1827 -0.0804 -0.0498 0.0564  350 SER B C   
3802 O  O   . SER B 211 ? 0.2688 0.2851 0.2226 -0.0861 -0.0520 0.0565  350 SER B O   
3803 C  CB  . SER B 211 ? 0.2152 0.2470 0.1777 -0.0849 -0.0510 0.0600  350 SER B CB  
3804 O  OG  . SER B 211 ? 0.2926 0.3270 0.2573 -0.0827 -0.0507 0.0599  350 SER B OG  
3805 N  N   . LEU B 212 ? 0.2346 0.2735 0.2054 -0.0753 -0.0471 0.0566  351 LEU B N   
3806 C  CA  . LEU B 212 ? 0.2214 0.2643 0.1939 -0.0763 -0.0462 0.0577  351 LEU B CA  
3807 C  C   . LEU B 212 ? 0.1986 0.2576 0.1788 -0.0764 -0.0440 0.0617  351 LEU B C   
3808 O  O   . LEU B 212 ? 0.2053 0.2728 0.1910 -0.0729 -0.0424 0.0623  351 LEU B O   
3809 C  CB  . LEU B 212 ? 0.2008 0.2428 0.1762 -0.0696 -0.0449 0.0541  351 LEU B CB  
3810 C  CG  . LEU B 212 ? 0.2200 0.2468 0.1872 -0.0699 -0.0467 0.0507  351 LEU B CG  
3811 C  CD1 . LEU B 212 ? 0.2376 0.2521 0.1972 -0.0702 -0.0485 0.0487  351 LEU B CD1 
3812 C  CD2 . LEU B 212 ? 0.2492 0.2786 0.2215 -0.0633 -0.0451 0.0476  351 LEU B CD2 
3813 N  N   . SER B 213 ? 0.2362 0.2993 0.2167 -0.0802 -0.0438 0.0643  352 SER B N   
3814 C  CA  . SER B 213 ? 0.2834 0.3616 0.2706 -0.0786 -0.0415 0.0673  352 SER B CA  
3815 C  C   . SER B 213 ? 0.3076 0.3944 0.3021 -0.0707 -0.0382 0.0662  352 SER B C   
3816 O  O   . SER B 213 ? 0.2542 0.3349 0.2485 -0.0661 -0.0381 0.0622  352 SER B O   
3817 C  CB  . SER B 213 ? 0.2486 0.3281 0.2337 -0.0820 -0.0423 0.0685  352 SER B CB  
3818 O  OG  . SER B 213 ? 0.2506 0.3290 0.2366 -0.0798 -0.0413 0.0672  352 SER B OG  
3819 N  N   . ALA B 214 ? 0.2690 0.3689 0.2692 -0.0683 -0.0356 0.0689  353 ALA B N   
3820 C  CA  . ALA B 214 ? 0.2709 0.3779 0.2769 -0.0601 -0.0325 0.0672  353 ALA B CA  
3821 C  C   . ALA B 214 ? 0.2314 0.3366 0.2374 -0.0588 -0.0322 0.0659  353 ALA B C   
3822 O  O   . ALA B 214 ? 0.2293 0.3322 0.2375 -0.0527 -0.0312 0.0622  353 ALA B O   
3823 C  CB  . ALA B 214 ? 0.2661 0.3870 0.2768 -0.0586 -0.0299 0.0708  353 ALA B CB  
3824 N  N   . LYS B 215 ? 0.2353 0.3414 0.2390 -0.0649 -0.0331 0.0689  354 LYS B N   
3825 C  CA  . LYS B 215 ? 0.2327 0.3371 0.2360 -0.0645 -0.0328 0.0681  354 LYS B CA  
3826 C  C   . LYS B 215 ? 0.2609 0.3518 0.2602 -0.0634 -0.0347 0.0635  354 LYS B C   
3827 O  O   . LYS B 215 ? 0.2467 0.3367 0.2480 -0.0587 -0.0337 0.0608  354 LYS B O   
3828 C  CB  . LYS B 215 ? 0.2885 0.3932 0.2888 -0.0699 -0.0345 0.0699  354 LYS B CB  
3829 C  CG  . LYS B 215 ? 0.3773 0.4777 0.3757 -0.0706 -0.0349 0.0687  354 LYS B CG  
3830 C  CD  . LYS B 215 ? 0.5365 0.6356 0.5310 -0.0763 -0.0370 0.0701  354 LYS B CD  
3831 C  CE  . LYS B 215 ? 0.6849 0.7826 0.6787 -0.0764 -0.0369 0.0695  354 LYS B CE  
3832 N  NZ  . LYS B 215 ? 0.7996 0.9014 0.7923 -0.0806 -0.0379 0.0717  354 LYS B NZ  
3833 N  N   . GLN B 216 ? 0.2162 0.2966 0.2097 -0.0677 -0.0374 0.0625  355 GLN B N   
3834 C  CA  . GLN B 216 ? 0.2358 0.3029 0.2245 -0.0668 -0.0392 0.0583  355 GLN B CA  
3835 C  C   . GLN B 216 ? 0.2271 0.2949 0.2205 -0.0588 -0.0379 0.0543  355 GLN B C   
3836 O  O   . GLN B 216 ? 0.2170 0.2799 0.2105 -0.0557 -0.0380 0.0511  355 GLN B O   
3837 C  CB  . GLN B 216 ? 0.2003 0.2558 0.1810 -0.0727 -0.0422 0.0583  355 GLN B CB  
3838 C  CG  . GLN B 216 ? 0.2319 0.2816 0.2061 -0.0802 -0.0442 0.0601  355 GLN B CG  
3839 C  CD  . GLN B 216 ? 0.2429 0.2799 0.2082 -0.0847 -0.0472 0.0589  355 GLN B CD  
3840 O  OE1 . GLN B 216 ? 0.2864 0.3245 0.2519 -0.0854 -0.0476 0.0598  355 GLN B OE1 
3841 N  NE2 . GLN B 216 ? 0.2445 0.2687 0.2012 -0.0876 -0.0492 0.0569  355 GLN B NE2 
3842 N  N   . LEU B 217 ? 0.2004 0.2743 0.1979 -0.0556 -0.0367 0.0546  356 LEU B N   
3843 C  CA  . LEU B 217 ? 0.1821 0.2572 0.1845 -0.0483 -0.0353 0.0509  356 LEU B CA  
3844 C  C   . LEU B 217 ? 0.2348 0.3166 0.2428 -0.0429 -0.0327 0.0500  356 LEU B C   
3845 O  O   . LEU B 217 ? 0.2139 0.2929 0.2243 -0.0383 -0.0322 0.0463  356 LEU B O   
3846 C  CB  . LEU B 217 ? 0.1802 0.2604 0.1854 -0.0463 -0.0344 0.0516  356 LEU B CB  
3847 C  CG  . LEU B 217 ? 0.1972 0.2690 0.1971 -0.0501 -0.0369 0.0512  356 LEU B CG  
3848 C  CD1 . LEU B 217 ? 0.1994 0.2775 0.2018 -0.0495 -0.0360 0.0529  356 LEU B CD1 
3849 C  CD2 . LEU B 217 ? 0.2090 0.2716 0.2075 -0.0471 -0.0380 0.0468  356 LEU B CD2 
3850 N  N   . HIS B 218 ? 0.2132 0.3037 0.2229 -0.0436 -0.0311 0.0533  357 HIS B N   
3851 C  CA  . HIS B 218 ? 0.2148 0.3109 0.2285 -0.0388 -0.0288 0.0528  357 HIS B CA  
3852 C  C   . HIS B 218 ? 0.2235 0.3130 0.2354 -0.0399 -0.0299 0.0508  357 HIS B C   
3853 O  O   . HIS B 218 ? 0.2626 0.3516 0.2775 -0.0349 -0.0288 0.0480  357 HIS B O   
3854 C  CB  . HIS B 218 ? 0.2866 0.3933 0.3017 -0.0399 -0.0269 0.0573  357 HIS B CB  
3855 C  CG  . HIS B 218 ? 0.3209 0.4332 0.3392 -0.0351 -0.0245 0.0571  357 HIS B CG  
3856 N  ND1 . HIS B 218 ? 0.3966 0.5091 0.4139 -0.0374 -0.0247 0.0583  357 HIS B ND1 
3857 C  CD2 . HIS B 218 ? 0.3859 0.5029 0.4077 -0.0280 -0.0218 0.0558  357 HIS B CD2 
3858 C  CE1 . HIS B 218 ? 0.4009 0.5185 0.4212 -0.0319 -0.0222 0.0578  357 HIS B CE1 
3859 N  NE2 . HIS B 218 ? 0.3757 0.4957 0.3985 -0.0262 -0.0204 0.0563  357 HIS B NE2 
3860 N  N   . THR B 219 ? 0.2226 0.3065 0.2290 -0.0465 -0.0321 0.0525  358 THR B N   
3861 C  CA  . THR B 219 ? 0.1901 0.2664 0.1934 -0.0482 -0.0335 0.0506  358 THR B CA  
3862 C  C   . THR B 219 ? 0.1655 0.2334 0.1689 -0.0450 -0.0344 0.0458  358 THR B C   
3863 O  O   . THR B 219 ? 0.2063 0.2726 0.2117 -0.0422 -0.0339 0.0433  358 THR B O   
3864 C  CB  . THR B 219 ? 0.2494 0.3188 0.2452 -0.0564 -0.0359 0.0529  358 THR B CB  
3865 O  OG1 . THR B 219 ? 0.2269 0.3054 0.2240 -0.0596 -0.0349 0.0575  358 THR B OG1 
3866 C  CG2 . THR B 219 ? 0.2536 0.3130 0.2450 -0.0580 -0.0374 0.0506  358 THR B CG2 
3867 N  N   . LEU B 220 ? 0.1609 0.2241 0.1623 -0.0453 -0.0356 0.0446  359 LEU B N   
3868 C  CA  . LEU B 220 ? 0.1570 0.2112 0.1583 -0.0416 -0.0351 0.0397  359 LEU B CA  
3869 C  C   . LEU B 220 ? 0.1744 0.2335 0.1831 -0.0342 -0.0318 0.0369  359 LEU B C   
3870 O  O   . LEU B 220 ? 0.1871 0.2392 0.1963 -0.0309 -0.0299 0.0328  359 LEU B O   
3871 C  CB  . LEU B 220 ? 0.1774 0.2267 0.1755 -0.0427 -0.0363 0.0393  359 LEU B CB  
3872 C  CG  . LEU B 220 ? 0.1811 0.2200 0.1786 -0.0381 -0.0343 0.0341  359 LEU B CG  
3873 C  CD1 . LEU B 220 ? 0.1904 0.2170 0.1824 -0.0387 -0.0339 0.0313  359 LEU B CD1 
3874 C  CD2 . LEU B 220 ? 0.1761 0.2109 0.1702 -0.0393 -0.0355 0.0342  359 LEU B CD2 
3875 N  N   . SER B 221 ? 0.1887 0.2597 0.2027 -0.0317 -0.0313 0.0392  360 SER B N   
3876 C  CA  . SER B 221 ? 0.1589 0.2332 0.1786 -0.0247 -0.0284 0.0364  360 SER B CA  
3877 C  C   . SER B 221 ? 0.1728 0.2531 0.1957 -0.0218 -0.0267 0.0371  360 SER B C   
3878 O  O   . SER B 221 ? 0.2136 0.2938 0.2397 -0.0163 -0.0243 0.0343  360 SER B O   
3879 C  CB  . SER B 221 ? 0.2418 0.3229 0.2644 -0.0221 -0.0276 0.0375  360 SER B CB  
3880 O  OG  . SER B 221 ? 0.2189 0.3071 0.2410 -0.0233 -0.0266 0.0413  360 SER B OG  
3881 N  N   . ASP B 222 ? 0.1696 0.2533 0.1906 -0.0253 -0.0272 0.0404  361 ASP B N   
3882 C  CA  . ASP B 222 ? 0.2298 0.3195 0.2531 -0.0222 -0.0250 0.0414  361 ASP B CA  
3883 C  C   . ASP B 222 ? 0.2386 0.3245 0.2610 -0.0241 -0.0259 0.0406  361 ASP B C   
3884 O  O   . ASP B 222 ? 0.2586 0.3483 0.2830 -0.0212 -0.0242 0.0409  361 ASP B O   
3885 C  CB  . ASP B 222 ? 0.2616 0.3592 0.2839 -0.0241 -0.0240 0.0460  361 ASP B CB  
3886 C  CG  . ASP B 222 ? 0.3308 0.4350 0.3549 -0.0209 -0.0216 0.0475  361 ASP B CG  
3887 O  OD1 . ASP B 222 ? 0.3505 0.4578 0.3771 -0.0148 -0.0193 0.0463  361 ASP B OD1 
3888 O  OD2 . ASP B 222 ? 0.3880 0.4939 0.4105 -0.0245 -0.0220 0.0499  361 ASP B OD2 
3889 N  N   . THR B 223 ? 0.1481 0.2236 0.1660 -0.0283 -0.0274 0.0388  362 THR B N   
3890 C  CA  . THR B 223 ? 0.1710 0.2409 0.1863 -0.0308 -0.0276 0.0381  362 THR B CA  
3891 C  C   . THR B 223 ? 0.1952 0.2561 0.2112 -0.0268 -0.0254 0.0328  362 THR B C   
3892 O  O   . THR B 223 ? 0.1889 0.2493 0.2055 -0.0262 -0.0244 0.0323  362 THR B O   
3893 C  CB  . THR B 223 ? 0.1890 0.2516 0.1975 -0.0378 -0.0304 0.0393  362 THR B CB  
3894 O  OG1 . THR B 223 ? 0.2241 0.2948 0.2313 -0.0422 -0.0324 0.0445  362 THR B OG1 
3895 C  CG2 . THR B 223 ? 0.1918 0.2489 0.1972 -0.0405 -0.0307 0.0389  362 THR B CG2 
3896 N  N   . LEU B 224 ? 0.1486 0.2028 0.1646 -0.0242 -0.0245 0.0291  363 LEU B N   
3897 C  CA  . LEU B 224 ? 0.1304 0.1757 0.1462 -0.0215 -0.0229 0.0245  363 LEU B CA  
3898 C  C   . LEU B 224 ? 0.1418 0.1900 0.1623 -0.0157 -0.0203 0.0221  363 LEU B C   
3899 O  O   . LEU B 224 ? 0.1525 0.2060 0.1758 -0.0128 -0.0196 0.0225  363 LEU B O   
3900 C  CB  . LEU B 224 ? 0.1219 0.1579 0.1343 -0.0218 -0.0233 0.0218  363 LEU B CB  
3901 C  CG  . LEU B 224 ? 0.1359 0.1655 0.1416 -0.0273 -0.0258 0.0235  363 LEU B CG  
3902 C  CD1 . LEU B 224 ? 0.1569 0.1776 0.1593 -0.0262 -0.0257 0.0207  363 LEU B CD1 
3903 C  CD2 . LEU B 224 ? 0.1624 0.1871 0.1642 -0.0306 -0.0265 0.0239  363 LEU B CD2 
3904 N  N   . TRP B 225 ? 0.1310 0.1748 0.1518 -0.0142 -0.0190 0.0196  364 TRP B N   
3905 C  CA  . TRP B 225 ? 0.1472 0.1913 0.1710 -0.0093 -0.0168 0.0169  364 TRP B CA  
3906 C  C   . TRP B 225 ? 0.1441 0.1808 0.1672 -0.0080 -0.0162 0.0131  364 TRP B C   
3907 O  O   . TRP B 225 ? 0.1427 0.1728 0.1627 -0.0102 -0.0170 0.0121  364 TRP B O   
3908 C  CB  . TRP B 225 ? 0.1898 0.2335 0.2142 -0.0084 -0.0157 0.0164  364 TRP B CB  
3909 C  CG  . TRP B 225 ? 0.3105 0.3620 0.3358 -0.0088 -0.0158 0.0200  364 TRP B CG  
3910 C  CD1 . TRP B 225 ? 0.3777 0.4308 0.4014 -0.0127 -0.0171 0.0226  364 TRP B CD1 
3911 C  CD2 . TRP B 225 ? 0.3772 0.4365 0.4046 -0.0051 -0.0147 0.0219  364 TRP B CD2 
3912 N  NE1 . TRP B 225 ? 0.3714 0.4337 0.3968 -0.0115 -0.0166 0.0261  364 TRP B NE1 
3913 C  CE2 . TRP B 225 ? 0.4422 0.5083 0.4697 -0.0066 -0.0151 0.0258  364 TRP B CE2 
3914 C  CE3 . TRP B 225 ? 0.3317 0.3926 0.3605 -0.0005 -0.0133 0.0207  364 TRP B CE3 
3915 C  CZ2 . TRP B 225 ? 0.4767 0.5518 0.5057 -0.0031 -0.0140 0.0286  364 TRP B CZ2 
3916 C  CZ3 . TRP B 225 ? 0.4154 0.4839 0.4450 0.0029  -0.0122 0.0233  364 TRP B CZ3 
3917 C  CH2 . TRP B 225 ? 0.5049 0.5807 0.5347 0.0019  -0.0125 0.0273  364 TRP B CH2 
3918 N  N   . GLY B 226 ? 0.1341 0.1718 0.1595 -0.0043 -0.0148 0.0111  365 GLY B N   
3919 C  CA  . GLY B 226 ? 0.1380 0.1704 0.1632 -0.0029 -0.0141 0.0078  365 GLY B CA  
3920 C  C   . GLY B 226 ? 0.1149 0.1443 0.1406 -0.0011 -0.0127 0.0053  365 GLY B C   
3921 O  O   . GLY B 226 ? 0.1288 0.1588 0.1546 -0.0014 -0.0124 0.0059  365 GLY B O   
3922 N  N   . PRO B 227 ? 0.1095 0.1362 0.1356 0.0006  -0.0118 0.0027  366 PRO B N   
3923 C  CA  . PRO B 227 ? 0.1121 0.1361 0.1384 0.0017  -0.0107 0.0004  366 PRO B CA  
3924 C  C   . PRO B 227 ? 0.1286 0.1551 0.1557 0.0036  -0.0099 0.0007  366 PRO B C   
3925 O  O   . PRO B 227 ? 0.1475 0.1778 0.1752 0.0052  -0.0097 0.0019  366 PRO B O   
3926 C  CB  . PRO B 227 ? 0.1316 0.1541 0.1582 0.0029  -0.0102 -0.0017 366 PRO B CB  
3927 C  CG  . PRO B 227 ? 0.1402 0.1626 0.1660 0.0020  -0.0111 -0.0008 366 PRO B CG  
3928 C  CD  . PRO B 227 ? 0.1083 0.1346 0.1346 0.0012  -0.0119 0.0019  366 PRO B CD  
3929 N  N   . GLY B 228 ? 0.1281 0.1522 0.1546 0.0037  -0.0093 -0.0003 367 GLY B N   
3930 C  CA  . GLY B 228 ? 0.1356 0.1606 0.1616 0.0058  -0.0083 -0.0002 367 GLY B CA  
3931 C  C   . GLY B 228 ? 0.1481 0.1781 0.1745 0.0064  -0.0085 0.0029  367 GLY B C   
3932 O  O   . GLY B 228 ? 0.1929 0.2247 0.2197 0.0042  -0.0093 0.0048  367 GLY B O   
3933 N  N   . ASP B 229 ? 0.2100 0.2425 0.2358 0.0093  -0.0077 0.0037  368 ASP B N   
3934 C  CA  . ASP B 229 ? 0.3602 0.3988 0.3862 0.0107  -0.0075 0.0070  368 ASP B CA  
3935 C  C   . ASP B 229 ? 0.3452 0.3893 0.3727 0.0099  -0.0085 0.0093  368 ASP B C   
3936 O  O   . ASP B 229 ? 0.3000 0.3507 0.3279 0.0107  -0.0086 0.0126  368 ASP B O   
3937 C  CB  A ASP B 229 ? 0.4241 0.4625 0.4478 0.0150  -0.0060 0.0069  368 ASP B CB  
3938 C  CB  B ASP B 229 ? 0.4219 0.4603 0.4456 0.0150  -0.0060 0.0070  368 ASP B CB  
3939 C  CG  A ASP B 229 ? 0.4398 0.4760 0.4626 0.0168  -0.0057 0.0050  368 ASP B CG  
3940 C  CG  B ASP B 229 ? 0.4226 0.4572 0.4443 0.0157  -0.0051 0.0061  368 ASP B CG  
3941 O  OD1 A ASP B 229 ? 0.5152 0.5558 0.5379 0.0191  -0.0055 0.0068  368 ASP B OD1 
3942 O  OD1 B ASP B 229 ? 0.4268 0.4630 0.4497 0.0137  -0.0055 0.0073  368 ASP B OD1 
3943 O  OD2 A ASP B 229 ? 0.4626 0.4933 0.4847 0.0156  -0.0058 0.0021  368 ASP B OD2 
3944 O  OD2 B ASP B 229 ? 0.4416 0.4712 0.4602 0.0180  -0.0041 0.0042  368 ASP B OD2 
3945 N  N   . SER B 230 ? 0.2557 0.2977 0.2839 0.0084  -0.0093 0.0079  369 SER B N   
3946 C  CA  . SER B 230 ? 0.2002 0.2467 0.2294 0.0084  -0.0100 0.0096  369 SER B CA  
3947 C  C   . SER B 230 ? 0.1472 0.1977 0.1769 0.0050  -0.0117 0.0127  369 SER B C   
3948 O  O   . SER B 230 ? 0.1562 0.2043 0.1851 0.0019  -0.0125 0.0129  369 SER B O   
3949 C  CB  . SER B 230 ? 0.1594 0.2022 0.1889 0.0084  -0.0101 0.0069  369 SER B CB  
3950 O  OG  . SER B 230 ? 0.1816 0.2203 0.2108 0.0054  -0.0109 0.0058  369 SER B OG  
3951 N  N   . ARG B 231 ? 0.1599 0.2165 0.1905 0.0054  -0.0123 0.0152  370 ARG B N   
3952 C  CA  . ARG B 231 ? 0.1230 0.1831 0.1535 0.0015  -0.0142 0.0181  370 ARG B CA  
3953 C  C   . ARG B 231 ? 0.1275 0.1826 0.1573 -0.0003 -0.0151 0.0163  370 ARG B C   
3954 O  O   . ARG B 231 ? 0.1388 0.1925 0.1694 0.0021  -0.0143 0.0141  370 ARG B O   
3955 C  CB  . ARG B 231 ? 0.1881 0.2580 0.2197 0.0028  -0.0145 0.0221  370 ARG B CB  
3956 C  CG  . ARG B 231 ? 0.2616 0.3371 0.2935 0.0055  -0.0133 0.0243  370 ARG B CG  
3957 C  CD  . ARG B 231 ? 0.4514 0.5345 0.4833 0.0022  -0.0148 0.0290  370 ARG B CD  
3958 N  NE  . ARG B 231 ? 0.3882 0.4807 0.4212 0.0025  -0.0156 0.0328  370 ARG B NE  
3959 C  CZ  . ARG B 231 ? 0.4928 0.5903 0.5247 -0.0017 -0.0169 0.0366  370 ARG B CZ  
3960 N  NH1 . ARG B 231 ? 0.4251 0.5217 0.4559 -0.0066 -0.0185 0.0380  370 ARG B NH1 
3961 N  NH2 . ARG B 231 ? 0.5266 0.6285 0.5577 -0.0014 -0.0162 0.0387  370 ARG B NH2 
3962 N  N   . LEU B 232 ? 0.1189 0.1709 0.1465 -0.0045 -0.0167 0.0171  371 LEU B N   
3963 C  CA  . LEU B 232 ? 0.1196 0.1664 0.1457 -0.0059 -0.0175 0.0156  371 LEU B CA  
3964 C  C   . LEU B 232 ? 0.1165 0.1689 0.1430 -0.0069 -0.0187 0.0183  371 LEU B C   
3965 O  O   . LEU B 232 ? 0.1094 0.1629 0.1336 -0.0109 -0.0207 0.0212  371 LEU B O   
3966 C  CB  . LEU B 232 ? 0.1390 0.1782 0.1610 -0.0094 -0.0186 0.0150  371 LEU B CB  
3967 C  CG  . LEU B 232 ? 0.1562 0.1876 0.1765 -0.0084 -0.0180 0.0117  371 LEU B CG  
3968 C  CD1 . LEU B 232 ? 0.1454 0.1689 0.1605 -0.0115 -0.0191 0.0116  371 LEU B CD1 
3969 C  CD2 . LEU B 232 ? 0.1904 0.2229 0.2113 -0.0073 -0.0181 0.0115  371 LEU B CD2 
3970 N  N   . GLN B 233 ? 0.1235 0.1795 0.1527 -0.0034 -0.0177 0.0176  372 GLN B N   
3971 C  CA  . GLN B 233 ? 0.1339 0.1962 0.1643 -0.0034 -0.0186 0.0200  372 GLN B CA  
3972 C  C   . GLN B 233 ? 0.1120 0.1723 0.1436 -0.0008 -0.0177 0.0174  372 GLN B C   
3973 O  O   . GLN B 233 ? 0.1022 0.1586 0.1345 0.0019  -0.0161 0.0141  372 GLN B O   
3974 C  CB  . GLN B 233 ? 0.1527 0.2246 0.1853 -0.0011 -0.0180 0.0230  372 GLN B CB  
3975 C  CG  . GLN B 233 ? 0.1495 0.2257 0.1812 -0.0038 -0.0190 0.0264  372 GLN B CG  
3976 C  CD  . GLN B 233 ? 0.1262 0.2132 0.1598 -0.0009 -0.0184 0.0300  372 GLN B CD  
3977 O  OE1 . GLN B 233 ? 0.1796 0.2680 0.2146 0.0042  -0.0165 0.0287  372 GLN B OE1 
3978 N  NE2 . GLN B 233 ? 0.2092 0.3014 0.2415 -0.0041 -0.0193 0.0339  372 GLN B NE2 
3979 N  N   . LEU B 234 ? 0.0949 0.1585 0.1269 -0.0016 -0.0188 0.0190  373 LEU B N   
3980 C  CA  . LEU B 234 ? 0.1157 0.1789 0.1493 0.0009  -0.0180 0.0170  373 LEU B CA  
3981 C  C   . LEU B 234 ? 0.0997 0.1544 0.1318 0.0010  -0.0172 0.0134  373 LEU B C   
3982 O  O   . LEU B 234 ? 0.1237 0.1772 0.1572 0.0039  -0.0158 0.0107  373 LEU B O   
3983 C  CB  . LEU B 234 ? 0.1557 0.2236 0.1919 0.0054  -0.0163 0.0164  373 LEU B CB  
3984 C  CG  . LEU B 234 ? 0.1822 0.2592 0.2195 0.0065  -0.0165 0.0202  373 LEU B CG  
3985 C  CD1 . LEU B 234 ? 0.2573 0.3360 0.2954 0.0116  -0.0146 0.0190  373 LEU B CD1 
3986 C  CD2 . LEU B 234 ? 0.1753 0.2579 0.2133 0.0051  -0.0179 0.0230  373 LEU B CD2 
3987 N  N   . ASN B 235 ? 0.1013 0.1502 0.1300 -0.0021 -0.0183 0.0134  374 ASN B N   
3988 C  CA  . ASN B 235 ? 0.0984 0.1396 0.1252 -0.0015 -0.0174 0.0104  374 ASN B CA  
3989 C  C   . ASN B 235 ? 0.1032 0.1417 0.1286 -0.0014 -0.0177 0.0097  374 ASN B C   
3990 O  O   . ASN B 235 ? 0.1233 0.1554 0.1443 -0.0033 -0.0185 0.0098  374 ASN B O   
3991 C  CB  . ASN B 235 ? 0.0928 0.1282 0.1159 -0.0040 -0.0181 0.0105  374 ASN B CB  
3992 C  CG  . ASN B 235 ? 0.0986 0.1322 0.1176 -0.0082 -0.0203 0.0133  374 ASN B CG  
3993 O  OD1 . ASN B 235 ? 0.1281 0.1674 0.1480 -0.0098 -0.0215 0.0161  374 ASN B OD1 
3994 N  ND2 . ASN B 235 ? 0.0940 0.1196 0.1080 -0.0103 -0.0209 0.0127  374 ASN B ND2 
3995 N  N   . PHE B 236 ? 0.0950 0.1380 0.1236 0.0009  -0.0170 0.0093  375 PHE B N   
3996 C  CA  . PHE B 236 ? 0.0875 0.1291 0.1156 0.0015  -0.0170 0.0086  375 PHE B CA  
3997 C  C   . PHE B 236 ? 0.0932 0.1366 0.1243 0.0049  -0.0153 0.0062  375 PHE B C   
3998 O  O   . PHE B 236 ? 0.1109 0.1581 0.1449 0.0066  -0.0144 0.0055  375 PHE B O   
3999 C  CB  . PHE B 236 ? 0.1008 0.1469 0.1292 0.0000  -0.0186 0.0114  375 PHE B CB  
4000 C  CG  . PHE B 236 ? 0.1097 0.1647 0.1425 0.0016  -0.0183 0.0127  375 PHE B CG  
4001 C  CD1 . PHE B 236 ? 0.1160 0.1745 0.1518 0.0045  -0.0173 0.0116  375 PHE B CD1 
4002 C  CD2 . PHE B 236 ? 0.1198 0.1795 0.1532 0.0006  -0.0190 0.0152  375 PHE B CD2 
4003 C  CE1 . PHE B 236 ? 0.1512 0.2170 0.1900 0.0065  -0.0170 0.0128  375 PHE B CE1 
4004 C  CE2 . PHE B 236 ? 0.1063 0.1740 0.1429 0.0028  -0.0186 0.0166  375 PHE B CE2 
4005 C  CZ  . PHE B 236 ? 0.1138 0.1842 0.1529 0.0059  -0.0176 0.0153  375 PHE B CZ  
4006 N  N   . ARG B 237 ? 0.0890 0.1295 0.1190 0.0058  -0.0148 0.0049  376 ARG B N   
4007 C  CA  . ARG B 237 ? 0.0862 0.1291 0.1188 0.0084  -0.0133 0.0030  376 ARG B CA  
4008 C  C   . ARG B 237 ? 0.1139 0.1618 0.1488 0.0091  -0.0136 0.0039  376 ARG B C   
4009 O  O   . ARG B 237 ? 0.1232 0.1710 0.1568 0.0076  -0.0149 0.0057  376 ARG B O   
4010 C  CB  . ARG B 237 ? 0.1056 0.1439 0.1358 0.0094  -0.0124 0.0015  376 ARG B CB  
4011 C  CG  . ARG B 237 ? 0.1214 0.1627 0.1542 0.0116  -0.0109 -0.0003 376 ARG B CG  
4012 C  CD  . ARG B 237 ? 0.1206 0.1589 0.1509 0.0130  -0.0100 -0.0010 376 ARG B CD  
4013 N  NE  . ARG B 237 ? 0.1235 0.1652 0.1560 0.0146  -0.0086 -0.0024 376 ARG B NE  
4014 C  CZ  . ARG B 237 ? 0.0923 0.1339 0.1234 0.0163  -0.0075 -0.0028 376 ARG B CZ  
4015 N  NH1 . ARG B 237 ? 0.1018 0.1389 0.1289 0.0172  -0.0075 -0.0020 376 ARG B NH1 
4016 N  NH2 . ARG B 237 ? 0.1114 0.1572 0.1447 0.0171  -0.0064 -0.0037 376 ARG B NH2 
4017 N  N   . ALA B 238 ? 0.1334 0.1853 0.1714 0.0111  -0.0126 0.0027  377 ALA B N   
4018 C  CA  . ALA B 238 ? 0.1950 0.2516 0.2353 0.0121  -0.0127 0.0033  377 ALA B CA  
4019 C  C   . ALA B 238 ? 0.1203 0.1752 0.1595 0.0121  -0.0127 0.0032  377 ALA B C   
4020 O  O   . ALA B 238 ? 0.1204 0.1713 0.1576 0.0125  -0.0119 0.0020  377 ALA B O   
4021 C  CB  . ALA B 238 ? 0.2422 0.3019 0.2848 0.0141  -0.0115 0.0017  377 ALA B CB  
4022 N  N   . THR B 239 ? 0.1484 0.2064 0.1886 0.0120  -0.0135 0.0047  378 THR B N   
4023 C  CA  . THR B 239 ? 0.1101 0.1665 0.1490 0.0124  -0.0134 0.0047  378 THR B CA  
4024 C  C   . THR B 239 ? 0.1358 0.1943 0.1768 0.0147  -0.0117 0.0026  378 THR B C   
4025 O  O   . THR B 239 ? 0.1444 0.2067 0.1882 0.0157  -0.0110 0.0016  378 THR B O   
4026 C  CB  A THR B 239 ? 0.1889 0.2491 0.2288 0.0114  -0.0148 0.0068  378 THR B CB  
4027 C  CB  B THR B 239 ? 0.1979 0.2575 0.2374 0.0114  -0.0148 0.0068  378 THR B CB  
4028 O  OG1 A THR B 239 ? 0.2232 0.2807 0.2599 0.0085  -0.0166 0.0090  378 THR B OG1 
4029 O  OG1 B THR B 239 ? 0.1774 0.2441 0.2211 0.0126  -0.0146 0.0071  378 THR B OG1 
4030 C  CG2 A THR B 239 ? 0.1647 0.2242 0.2039 0.0123  -0.0145 0.0067  378 THR B CG2 
4031 C  CG2 B THR B 239 ? 0.1933 0.2503 0.2295 0.0082  -0.0168 0.0093  378 THR B CG2 
4032 N  N   . GLN B 240 ? 0.1033 0.1587 0.1420 0.0155  -0.0110 0.0022  379 GLN B N   
4033 C  CA  . GLN B 240 ? 0.1219 0.1792 0.1617 0.0176  -0.0094 0.0008  379 GLN B CA  
4034 C  C   . GLN B 240 ? 0.1223 0.1824 0.1631 0.0188  -0.0091 0.0013  379 GLN B C   
4035 O  O   . GLN B 240 ? 0.1295 0.1872 0.1680 0.0183  -0.0100 0.0026  379 GLN B O   
4036 C  CB  . GLN B 240 ? 0.0938 0.1460 0.1298 0.0183  -0.0086 0.0002  379 GLN B CB  
4037 C  CG  . GLN B 240 ? 0.1306 0.1797 0.1656 0.0169  -0.0089 -0.0002 379 GLN B CG  
4038 C  CD  . GLN B 240 ? 0.1878 0.2408 0.2260 0.0169  -0.0082 -0.0015 379 GLN B CD  
4039 O  OE1 . GLN B 240 ? 0.2444 0.3004 0.2838 0.0180  -0.0070 -0.0024 379 GLN B OE1 
4040 N  NE2 . GLN B 240 ? 0.1733 0.2264 0.2124 0.0157  -0.0089 -0.0015 379 GLN B NE2 
4041 N  N   . PRO B 241 ? 0.1319 0.1970 0.1755 0.0202  -0.0078 0.0003  380 PRO B N   
4042 C  CA  . PRO B 241 ? 0.1513 0.2188 0.1958 0.0211  -0.0074 0.0008  380 PRO B CA  
4043 C  C   . PRO B 241 ? 0.1238 0.1887 0.1651 0.0230  -0.0068 0.0014  380 PRO B C   
4044 O  O   . PRO B 241 ? 0.1445 0.2064 0.1829 0.0241  -0.0058 0.0010  380 PRO B O   
4045 C  CB  . PRO B 241 ? 0.1912 0.2594 0.2364 0.0203  -0.0058 -0.0003 380 PRO B CB  
4046 C  CG  . PRO B 241 ? 0.2401 0.3085 0.2851 0.0204  -0.0054 -0.0013 380 PRO B CG  
4047 C  CD  . PRO B 241 ? 0.1573 0.2245 0.2024 0.0201  -0.0068 -0.0011 380 PRO B CD  
4048 N  N   . LEU B 242 ? 0.1416 0.2064 0.1821 0.0234  -0.0073 0.0025  381 LEU B N   
4049 C  CA  . LEU B 242 ? 0.1335 0.1935 0.1692 0.0252  -0.0067 0.0033  381 LEU B CA  
4050 C  C   . LEU B 242 ? 0.1437 0.2077 0.1801 0.0282  -0.0045 0.0028  381 LEU B C   
4051 O  O   . LEU B 242 ? 0.1395 0.1993 0.1712 0.0305  -0.0034 0.0031  381 LEU B O   
4052 C  CB  . LEU B 242 ? 0.1576 0.2170 0.1925 0.0245  -0.0080 0.0046  381 LEU B CB  
4053 C  CG  . LEU B 242 ? 0.2222 0.2747 0.2526 0.0217  -0.0101 0.0060  381 LEU B CG  
4054 C  CD1 . LEU B 242 ? 0.2680 0.3204 0.2974 0.0210  -0.0114 0.0075  381 LEU B CD1 
4055 C  CD2 . LEU B 242 ? 0.1701 0.2129 0.1931 0.0220  -0.0100 0.0060  381 LEU B CD2 
4056 N  N   . ASN B 243 ? 0.1466 0.2153 0.1868 0.0269  -0.0037 0.0021  382 ASN B N   
4057 C  CA  . ASN B 243 ? 0.1255 0.1958 0.1650 0.0275  -0.0018 0.0019  382 ASN B CA  
4058 C  C   . ASN B 243 ? 0.1584 0.2283 0.1949 0.0307  -0.0008 0.0030  382 ASN B C   
4059 O  O   . ASN B 243 ? 0.1931 0.2634 0.2270 0.0329  0.0008  0.0034  382 ASN B O   
4060 C  CB  . ASN B 243 ? 0.1299 0.2008 0.1688 0.0277  -0.0010 0.0013  382 ASN B CB  
4061 C  CG  . ASN B 243 ? 0.1713 0.2432 0.2127 0.0246  -0.0016 0.0002  382 ASN B CG  
4062 O  OD1 . ASN B 243 ? 0.2110 0.2835 0.2541 0.0225  -0.0019 -0.0001 382 ASN B OD1 
4063 N  ND2 . ASN B 243 ? 0.1657 0.2373 0.2070 0.0246  -0.0018 -0.0003 382 ASN B ND2 
4064 N  N   . GLY B 244 ? 0.2009 0.2700 0.2374 0.0310  -0.0017 0.0037  383 GLY B N   
4065 C  CA  . GLY B 244 ? 0.2248 0.2931 0.2582 0.0340  -0.0007 0.0048  383 GLY B CA  
4066 C  C   . GLY B 244 ? 0.2148 0.2767 0.2424 0.0373  -0.0012 0.0059  383 GLY B C   
4067 O  O   . GLY B 244 ? 0.2108 0.2693 0.2340 0.0397  -0.0006 0.0069  383 GLY B O   
4068 N  N   . ARG B 245 ? 0.1752 0.2309 0.1999 0.0355  -0.0023 0.0054  384 ARG B N   
4069 C  CA  . ARG B 245 ? 0.1619 0.2061 0.1778 0.0358  -0.0029 0.0061  384 ARG B CA  
4070 C  C   . ARG B 245 ? 0.1877 0.2272 0.2011 0.0335  -0.0050 0.0071  384 ARG B C   
4071 O  O   . ARG B 245 ? 0.1878 0.2321 0.2065 0.0304  -0.0066 0.0072  384 ARG B O   
4072 C  CB  . ARG B 245 ? 0.1247 0.1637 0.1386 0.0337  -0.0038 0.0055  384 ARG B CB  
4073 C  CG  . ARG B 245 ? 0.1536 0.1943 0.1671 0.0364  -0.0019 0.0048  384 ARG B CG  
4074 C  CD  . ARG B 245 ? 0.1652 0.2013 0.1774 0.0339  -0.0030 0.0041  384 ARG B CD  
4075 N  NE  . ARG B 245 ? 0.1165 0.1592 0.1361 0.0306  -0.0040 0.0033  384 ARG B NE  
4076 C  CZ  . ARG B 245 ? 0.1040 0.1444 0.1239 0.0280  -0.0051 0.0027  384 ARG B CZ  
4077 N  NH1 . ARG B 245 ? 0.1236 0.1553 0.1371 0.0280  -0.0054 0.0029  384 ARG B NH1 
4078 N  NH2 . ARG B 245 ? 0.0844 0.1305 0.1104 0.0257  -0.0058 0.0021  384 ARG B NH2 
4079 N  N   . VAL B 246 ? 0.1798 0.2096 0.1843 0.0351  -0.0050 0.0081  385 VAL B N   
4080 C  CA  . VAL B 246 ? 0.2318 0.2549 0.2316 0.0324  -0.0072 0.0093  385 VAL B CA  
4081 C  C   . VAL B 246 ? 0.2153 0.2279 0.2081 0.0291  -0.0092 0.0097  385 VAL B C   
4082 O  O   . VAL B 246 ? 0.2822 0.2873 0.2686 0.0310  -0.0083 0.0092  385 VAL B O   
4083 C  CB  . VAL B 246 ? 0.3094 0.3268 0.3022 0.0360  -0.0061 0.0102  385 VAL B CB  
4084 C  CG1 . VAL B 246 ? 0.3605 0.3679 0.3458 0.0326  -0.0087 0.0116  385 VAL B CG1 
4085 C  CG2 . VAL B 246 ? 0.3799 0.4084 0.3801 0.0384  -0.0045 0.0102  385 VAL B CG2 
4086 N  N   . ILE B 247 ? 0.1535 0.1664 0.1477 0.0242  -0.0119 0.0106  386 ILE B N   
4087 C  CA  . ILE B 247 ? 0.1232 0.1259 0.1098 0.0203  -0.0142 0.0115  386 ILE B CA  
4088 C  C   . ILE B 247 ? 0.1670 0.1595 0.1439 0.0192  -0.0157 0.0131  386 ILE B C   
4089 O  O   . ILE B 247 ? 0.1837 0.1804 0.1633 0.0180  -0.0166 0.0141  386 ILE B O   
4090 C  CB  . ILE B 247 ? 0.1419 0.1507 0.1345 0.0153  -0.0165 0.0122  386 ILE B CB  
4091 C  CG1 . ILE B 247 ? 0.1387 0.1562 0.1397 0.0166  -0.0150 0.0106  386 ILE B CG1 
4092 C  CG2 . ILE B 247 ? 0.1589 0.1577 0.1432 0.0107  -0.0191 0.0136  386 ILE B CG2 
4093 C  CD1 . ILE B 247 ? 0.1443 0.1679 0.1508 0.0126  -0.0169 0.0113  386 ILE B CD1 
4094 N  N   . GLU B 248 ? 0.1636 0.1423 0.1288 0.0197  -0.0158 0.0133  387 GLU B N   
4095 C  CA  . GLU B 248 ? 0.1716 0.1379 0.1252 0.0183  -0.0174 0.0148  387 GLU B CA  
4096 C  C   . GLU B 248 ? 0.1906 0.1511 0.1394 0.0111  -0.0212 0.0165  387 GLU B C   
4097 O  O   . GLU B 248 ? 0.1872 0.1493 0.1383 0.0083  -0.0221 0.0164  387 GLU B O   
4098 C  CB  . GLU B 248 ? 0.2101 0.1629 0.1514 0.0232  -0.0155 0.0143  387 GLU B CB  
4099 C  CG  . GLU B 248 ? 0.2591 0.2176 0.2036 0.0305  -0.0118 0.0133  387 GLU B CG  
4100 C  CD  . GLU B 248 ? 0.3301 0.2755 0.2615 0.0362  -0.0098 0.0132  387 GLU B CD  
4101 O  OE1 . GLU B 248 ? 0.3898 0.3396 0.3226 0.0424  -0.0068 0.0130  387 GLU B OE1 
4102 O  OE2 . GLU B 248 ? 0.3489 0.2796 0.2683 0.0346  -0.0111 0.0136  387 GLU B OE2 
4103 N  N   . ALA B 249 ? 0.1874 0.1417 0.1295 0.0078  -0.0234 0.0184  388 ALA B N   
4104 C  CA  . ALA B 249 ? 0.2028 0.1500 0.1379 0.0005  -0.0273 0.0206  388 ALA B CA  
4105 C  C   . ALA B 249 ? 0.2343 0.1627 0.1524 -0.0001 -0.0284 0.0215  388 ALA B C   
4106 O  O   . ALA B 249 ? 0.2492 0.1736 0.1632 0.0036  -0.0271 0.0214  388 ALA B O   
4107 C  CB  . ALA B 249 ? 0.2023 0.1610 0.1454 -0.0044 -0.0298 0.0227  388 ALA B CB  
4108 N  N   . SER B 250 ? 0.2087 0.1254 0.1164 -0.0049 -0.0308 0.0225  389 SER B N   
4109 C  CA  . SER B 250 ? 0.2406 0.1372 0.1301 -0.0060 -0.0321 0.0234  389 SER B CA  
4110 C  C   . SER B 250 ? 0.2732 0.1662 0.1571 -0.0129 -0.0359 0.0262  389 SER B C   
4111 O  O   . SER B 250 ? 0.3072 0.1827 0.1749 -0.0155 -0.0378 0.0274  389 SER B O   
4112 C  CB  . SER B 250 ? 0.2476 0.1322 0.1273 -0.0086 -0.0332 0.0232  389 SER B CB  
4113 O  OG  . SER B 250 ? 0.2733 0.1624 0.1555 -0.0172 -0.0369 0.0254  389 SER B OG  
4114 N  N   . PHE B 251 ? 0.2457 0.1551 0.1426 -0.0159 -0.0371 0.0275  390 PHE B N   
4115 C  CA  . PHE B 251 ? 0.2648 0.1748 0.1589 -0.0234 -0.0411 0.0308  390 PHE B CA  
4116 C  C   . PHE B 251 ? 0.2626 0.1913 0.1720 -0.0222 -0.0406 0.0312  390 PHE B C   
4117 O  O   . PHE B 251 ? 0.2691 0.2110 0.1916 -0.0173 -0.0377 0.0293  390 PHE B O   
4118 C  CB  . PHE B 251 ? 0.2561 0.1664 0.1483 -0.0318 -0.0448 0.0332  390 PHE B CB  
4119 C  CG  . PHE B 251 ? 0.2441 0.1731 0.1524 -0.0320 -0.0442 0.0330  390 PHE B CG  
4120 C  CD1 . PHE B 251 ? 0.2326 0.1650 0.1469 -0.0270 -0.0411 0.0302  390 PHE B CD1 
4121 C  CD2 . PHE B 251 ? 0.2545 0.1976 0.1711 -0.0373 -0.0467 0.0360  390 PHE B CD2 
4122 C  CE1 . PHE B 251 ? 0.2312 0.1796 0.1592 -0.0270 -0.0405 0.0301  390 PHE B CE1 
4123 C  CE2 . PHE B 251 ? 0.2599 0.2196 0.1904 -0.0370 -0.0460 0.0360  390 PHE B CE2 
4124 C  CZ  . PHE B 251 ? 0.2549 0.2166 0.1907 -0.0319 -0.0429 0.0330  390 PHE B CZ  
4125 N  N   . PRO B 252 ? 0.2766 0.2064 0.1841 -0.0268 -0.0433 0.0339  391 PRO B N   
4126 C  CA  . PRO B 252 ? 0.2385 0.1859 0.1601 -0.0253 -0.0427 0.0344  391 PRO B CA  
4127 C  C   . PRO B 252 ? 0.3104 0.2751 0.2450 -0.0286 -0.0439 0.0357  391 PRO B C   
4128 O  O   . PRO B 252 ? 0.3536 0.3236 0.2886 -0.0353 -0.0473 0.0391  391 PRO B O   
4129 C  CB  . PRO B 252 ? 0.2355 0.1770 0.1490 -0.0298 -0.0457 0.0371  391 PRO B CB  
4130 C  CG  . PRO B 252 ? 0.3014 0.2273 0.1996 -0.0369 -0.0492 0.0392  391 PRO B CG  
4131 C  CD  . PRO B 252 ? 0.2955 0.2099 0.1870 -0.0330 -0.0470 0.0365  391 PRO B CD  
4132 N  N   . ALA B 253 ? 0.2736 0.2472 0.2184 -0.0238 -0.0409 0.0332  392 ALA B N   
4133 C  CA  . ALA B 253 ? 0.3243 0.3109 0.2788 -0.0263 -0.0417 0.0342  392 ALA B CA  
4134 C  C   . ALA B 253 ? 0.3625 0.3666 0.3288 -0.0274 -0.0425 0.0361  392 ALA B C   
4135 O  O   . ALA B 253 ? 0.3995 0.4133 0.3709 -0.0311 -0.0443 0.0384  392 ALA B O   
4136 C  CB  . ALA B 253 ? 0.3089 0.2984 0.2696 -0.0207 -0.0382 0.0308  392 ALA B CB  
4137 N  N   . GLY B 254 ? 0.3787 0.3872 0.3493 -0.0238 -0.0412 0.0354  393 GLY B N   
4138 C  CA  . GLY B 254 ? 0.4920 0.5169 0.4736 -0.0242 -0.0418 0.0371  393 GLY B CA  
4139 C  C   . GLY B 254 ? 0.5805 0.6071 0.5589 -0.0298 -0.0453 0.0410  393 GLY B C   
4140 O  O   . GLY B 254 ? 0.7111 0.7503 0.6980 -0.0289 -0.0454 0.0421  393 GLY B O   
4141 N  N   . VAL B 255 ? 0.5558 0.5700 0.5216 -0.0358 -0.0484 0.0432  394 VAL B N   
4142 C  CA  . VAL B 255 ? 0.6090 0.6233 0.5702 -0.0416 -0.0519 0.0469  394 VAL B CA  
4143 C  C   . VAL B 255 ? 0.7452 0.7691 0.7122 -0.0472 -0.0522 0.0491  394 VAL B C   
4144 O  O   . VAL B 255 ? 0.7365 0.7607 0.7035 -0.0494 -0.0522 0.0494  394 VAL B O   
4145 C  CB  . VAL B 255 ? 0.5314 0.5249 0.4755 -0.0447 -0.0536 0.0472  394 VAL B CB  
4146 C  CG1 . VAL B 255 ? 0.4669 0.4596 0.4082 -0.0497 -0.0554 0.0494  394 VAL B CG1 
4147 C  CG2 . VAL B 255 ? 0.5249 0.5086 0.4662 -0.0369 -0.0498 0.0431  394 VAL B CG2 
4148 N  N   . ASP B 256 ? 0.9468 0.9785 0.9186 -0.0492 -0.0520 0.0508  395 ASP B N   
4149 C  CA  . ASP B 256 ? 1.1041 1.1451 1.0808 -0.0542 -0.0518 0.0537  395 ASP B CA  
4150 C  C   . ASP B 256 ? 1.1315 1.1882 1.1212 -0.0496 -0.0481 0.0532  395 ASP B C   
4151 O  O   . ASP B 256 ? 1.1230 1.1890 1.1182 -0.0500 -0.0465 0.0549  395 ASP B O   
4152 C  CB  . ASP B 256 ? 1.2016 1.2351 1.1706 -0.0612 -0.0540 0.0557  395 ASP B CB  
4153 C  CG  . ASP B 256 ? 1.2586 1.2765 1.2143 -0.0671 -0.0573 0.0566  395 ASP B CG  
4154 O  OD1 . ASP B 256 ? 1.2614 1.2780 1.2156 -0.0675 -0.0580 0.0571  395 ASP B OD1 
4155 O  OD2 . ASP B 256 ? 1.2697 1.2761 1.2161 -0.0713 -0.0591 0.0566  395 ASP B OD2 
4156 ZN ZN  . ZN  C .   ? 0.1016 0.1005 0.1261 -0.0073 -0.0071 -0.0104 401 ZN  A ZN  
4157 ZN ZN  . ZN  D .   ? 0.1258 0.1494 0.1548 -0.0063 -0.0017 0.0084  402 ZN  A ZN  
4158 C  C1  . GOL E .   ? 0.4347 0.4233 0.4527 -0.0149 -0.0078 -0.0130 403 GOL A C1  
4159 O  O1  . GOL E .   ? 0.3175 0.3108 0.3393 -0.0151 -0.0081 -0.0128 403 GOL A O1  
4160 C  C2  . GOL E .   ? 0.5030 0.4905 0.5202 -0.0126 -0.0070 -0.0127 403 GOL A C2  
4161 O  O2  . GOL E .   ? 0.5920 0.5817 0.6121 -0.0112 -0.0062 -0.0118 403 GOL A O2  
4162 C  C3  . GOL E .   ? 0.4845 0.4663 0.4966 -0.0116 -0.0065 -0.0128 403 GOL A C3  
4163 O  O3  . GOL E .   ? 0.5512 0.5319 0.5631 -0.0102 -0.0055 -0.0121 403 GOL A O3  
4164 C  C1  . GOL F .   ? 0.6172 0.5994 0.5975 -0.0318 -0.0165 -0.0152 404 GOL A C1  
4165 O  O1  . GOL F .   ? 0.4660 0.4577 0.4515 -0.0320 -0.0165 -0.0143 404 GOL A O1  
4166 C  C2  . GOL F .   ? 0.7443 0.7243 0.7192 -0.0374 -0.0183 -0.0146 404 GOL A C2  
4167 O  O2  . GOL F .   ? 0.8506 0.8338 0.8296 -0.0369 -0.0181 -0.0142 404 GOL A O2  
4168 C  C3  . GOL F .   ? 0.7641 0.7308 0.7288 -0.0386 -0.0189 -0.0158 404 GOL A C3  
4169 O  O3  . GOL F .   ? 0.7378 0.6996 0.7018 -0.0365 -0.0182 -0.0163 404 GOL A O3  
4170 C  C1  . GOL G .   ? 0.7403 0.7232 0.6937 -0.0601 -0.0259 -0.0097 405 GOL A C1  
4171 O  O1  . GOL G .   ? 0.7798 0.7491 0.7255 -0.0596 -0.0258 -0.0110 405 GOL A O1  
4172 C  C2  . GOL G .   ? 0.7146 0.6974 0.6712 -0.0559 -0.0247 -0.0115 405 GOL A C2  
4173 O  O2  . GOL G .   ? 0.6166 0.6066 0.5832 -0.0502 -0.0226 -0.0117 405 GOL A O2  
4174 C  C3  . GOL G .   ? 0.7503 0.7404 0.7076 -0.0585 -0.0254 -0.0102 405 GOL A C3  
4175 O  O3  . GOL G .   ? 0.7541 0.7587 0.7183 -0.0601 -0.0257 -0.0078 405 GOL A O3  
4176 CL CL  . CL  H .   ? 0.3336 0.2437 0.2618 0.0191  -0.0001 -0.0149 406 CL  A CL  
4177 CL CL  . CL  I .   ? 0.2513 0.2734 0.2776 0.0061  -0.0076 -0.0094 407 CL  A CL  
4178 C  C   . TRS J .   ? 0.8138 0.8465 0.8394 -0.0060 -0.0084 0.0117  408 TRS A C   
4179 C  C1  . TRS J .   ? 0.7635 0.7924 0.7888 -0.0023 -0.0070 0.0088  408 TRS A C1  
4180 C  C2  . TRS J .   ? 0.8566 0.8937 0.8821 -0.0068 -0.0093 0.0140  408 TRS A C2  
4181 C  C3  . TRS J .   ? 0.7336 0.7604 0.7581 -0.0094 -0.0095 0.0099  408 TRS A C3  
4182 N  N   . TRS J .   ? 0.8361 0.8738 0.8621 -0.0057 -0.0077 0.0143  408 TRS A N   
4183 O  O1  . TRS J .   ? 0.7743 0.8010 0.7994 -0.0014 -0.0061 0.0078  408 TRS A O1  
4184 O  O2  . TRS J .   ? 0.8858 0.9210 0.9114 -0.0040 -0.0088 0.0120  408 TRS A O2  
4185 O  O3  . TRS J .   ? 0.6426 0.6712 0.6668 -0.0119 -0.0099 0.0118  408 TRS A O3  
4186 ZN ZN  . ZN  K .   ? 0.1449 0.1614 0.1681 0.0051  -0.0095 -0.0053 409 ZN  A ZN  
4187 ZN ZN  . ZN  L .   ? 0.1345 0.1243 0.1250 -0.0018 -0.0186 0.0064  401 ZN  B ZN  
4188 C  C1  . GOL M .   ? 0.5016 0.4518 0.4576 0.0211  -0.0089 -0.0001 402 GOL B C1  
4189 O  O1  . GOL M .   ? 0.3572 0.2990 0.3074 0.0180  -0.0104 0.0001  402 GOL B O1  
4190 C  C2  . GOL M .   ? 0.5583 0.5217 0.5261 0.0210  -0.0080 -0.0009 402 GOL B C2  
4191 O  O2  . GOL M .   ? 0.5979 0.5611 0.5671 0.0188  -0.0085 -0.0014 402 GOL B O2  
4192 C  C3  . GOL M .   ? 0.5545 0.5236 0.5241 0.0264  -0.0056 -0.0013 402 GOL B C3  
4193 O  O3  . GOL M .   ? 0.6046 0.5848 0.5839 0.0257  -0.0050 -0.0020 402 GOL B O3  
4194 C  C1  . GOL N .   ? 0.7801 0.7377 0.7100 0.0654  0.0059  0.0091  403 GOL B C1  
4195 O  O1  . GOL N .   ? 0.7410 0.7143 0.6802 0.0687  0.0082  0.0096  403 GOL B O1  
4196 C  C2  . GOL N .   ? 0.7693 0.7181 0.6901 0.0689  0.0069  0.0091  403 GOL B C2  
4197 O  O2  . GOL N .   ? 0.7936 0.7526 0.7175 0.0750  0.0101  0.0099  403 GOL B O2  
4198 C  C3  . GOL N .   ? 0.7714 0.7011 0.6750 0.0719  0.0069  0.0098  403 GOL B C3  
4199 O  O3  . GOL N .   ? 0.7240 0.6417 0.6223 0.0654  0.0036  0.0091  403 GOL B O3  
4200 C  C1  . GOL O .   ? 0.6673 0.7245 0.6742 0.0534  0.0084  0.0078  404 GOL B C1  
4201 O  O1  . GOL O .   ? 0.7196 0.7768 0.7209 0.0571  0.0105  0.0094  404 GOL B O1  
4202 C  C2  . GOL O .   ? 0.6959 0.7475 0.7013 0.0539  0.0072  0.0077  404 GOL B C2  
4203 O  O2  . GOL O .   ? 0.7037 0.7622 0.7146 0.0511  0.0070  0.0077  404 GOL B O2  
4204 C  C3  . GOL O .   ? 0.6876 0.7319 0.6929 0.0489  0.0045  0.0064  404 GOL B C3  
4205 O  O3  . GOL O .   ? 0.6820 0.7171 0.6805 0.0498  0.0045  0.0063  404 GOL B O3  
4206 CL CL  . CL  P .   ? 0.1486 0.2270 0.1775 0.0352  0.0047  0.0030  405 CL  B CL  
4207 O  O   . HOH Q .   ? 0.5395 0.5658 0.5690 -0.0276 -0.0146 -0.0081 501 HOH A O   
4208 O  O   . HOH Q .   ? 0.4179 0.4436 0.4343 0.0144  0.0061  0.0136  502 HOH A O   
4209 O  O   . HOH Q .   ? 0.3761 0.3305 0.3511 0.0091  -0.0065 -0.0093 503 HOH A O   
4210 O  O   . HOH Q .   ? 0.5326 0.5258 0.5403 0.0106  0.0055  0.0021  504 HOH A O   
4211 O  O   . HOH Q .   ? 0.4347 0.3153 0.3393 0.0164  -0.0094 -0.0065 505 HOH A O   
4212 O  O   . HOH Q .   ? 0.6118 0.6052 0.6353 -0.0093 -0.0052 -0.0098 506 HOH A O   
4213 O  O   . HOH Q .   ? 0.6194 0.5272 0.5517 -0.0368 -0.0217 0.0026  507 HOH A O   
4214 O  O   . HOH Q .   ? 0.3321 0.3914 0.3461 -0.0444 -0.0216 0.0023  508 HOH A O   
4215 O  O   . HOH Q .   ? 0.5987 0.4967 0.5092 0.0114  -0.0051 -0.0199 509 HOH A O   
4216 O  O   . HOH Q .   ? 0.5874 0.5957 0.6201 -0.0149 -0.0042 -0.0004 510 HOH A O   
4217 O  O   . HOH Q .   ? 0.5135 0.5057 0.5246 0.0008  -0.0069 -0.0091 511 HOH A O   
4218 O  O   . HOH Q .   ? 0.3061 0.2910 0.2801 -0.0455 -0.0211 -0.0125 512 HOH A O   
4219 O  O   . HOH Q .   ? 0.5103 0.6196 0.5385 0.0274  0.0048  0.0081  513 HOH A O   
4220 O  O   . HOH Q .   ? 0.6165 0.6183 0.6489 -0.0145 -0.0051 -0.0054 514 HOH A O   
4221 O  O   . HOH Q .   ? 0.4918 0.5433 0.5197 -0.0339 -0.0184 -0.0020 515 HOH A O   
4222 O  O   . HOH Q .   ? 0.5052 0.6121 0.5281 -0.0342 -0.0188 0.0137  516 HOH A O   
4223 O  O   . HOH Q .   ? 0.5372 0.4579 0.4834 -0.0170 -0.0186 -0.0004 517 HOH A O   
4224 O  O   . HOH Q .   ? 0.4617 0.4622 0.4963 -0.0173 -0.0074 -0.0090 518 HOH A O   
4225 O  O   . HOH Q .   ? 0.5319 0.4691 0.4881 0.0153  -0.0060 -0.0089 519 HOH A O   
4226 O  O   . HOH Q .   ? 0.4996 0.6411 0.5120 -0.0406 -0.0164 0.0236  520 HOH A O   
4227 O  O   . HOH Q .   ? 0.2320 0.2562 0.2134 -0.0527 -0.0230 -0.0062 521 HOH A O   
4228 O  O   . HOH Q .   ? 0.4681 0.3774 0.3840 0.0394  -0.0015 -0.0063 522 HOH A O   
4229 O  O   . HOH Q .   ? 0.2843 0.3566 0.3032 0.0243  -0.0044 0.0064  523 HOH A O   
4230 O  O   . HOH Q .   ? 0.3273 0.3652 0.3507 -0.0229 -0.0112 0.0200  524 HOH A O   
4231 O  O   . HOH Q .   ? 0.4845 0.4707 0.4600 -0.0509 -0.0228 -0.0105 525 HOH A O   
4232 O  O   . HOH Q .   ? 0.3752 0.3401 0.3457 0.0247  -0.0036 -0.0059 526 HOH A O   
4233 O  O   . HOH Q .   ? 0.5614 0.5114 0.5215 -0.0466 -0.0259 0.0124  527 HOH A O   
4234 O  O   . HOH Q .   ? 0.4407 0.4300 0.4632 -0.0154 -0.0083 -0.0088 528 HOH A O   
4235 O  O   . HOH Q .   ? 0.2494 0.2983 0.2701 0.0268  0.0003  -0.0024 529 HOH A O   
4236 O  O   . HOH Q .   ? 0.6556 0.5651 0.5924 -0.0072 -0.0074 -0.0181 530 HOH A O   
4237 O  O   . HOH Q .   ? 0.3023 0.3019 0.2849 -0.0528 -0.0234 -0.0071 531 HOH A O   
4238 O  O   . HOH Q .   ? 0.1188 0.1236 0.1424 -0.0030 -0.0053 -0.0041 532 HOH A O   
4239 O  O   . HOH Q .   ? 0.4751 0.5686 0.5020 0.0008  -0.0047 0.0032  533 HOH A O   
4240 O  O   . HOH Q .   ? 0.3335 0.3416 0.3559 0.0017  -0.0069 -0.0075 534 HOH A O   
4241 O  O   . HOH Q .   ? 0.4085 0.3657 0.3812 0.0119  -0.0084 -0.0056 535 HOH A O   
4242 O  O   . HOH Q .   ? 0.4575 0.4932 0.4769 0.0207  -0.0023 -0.0049 536 HOH A O   
4243 O  O   . HOH Q .   ? 0.2552 0.2088 0.2311 -0.0246 -0.0128 -0.0166 537 HOH A O   
4244 O  O   . HOH Q .   ? 0.2029 0.2095 0.1904 -0.0395 -0.0189 -0.0111 538 HOH A O   
4245 O  O   . HOH Q .   ? 0.5825 0.5612 0.5775 0.0055  -0.0091 -0.0064 539 HOH A O   
4246 O  O   . HOH Q .   ? 0.5580 0.4831 0.5186 -0.0091 -0.0049 -0.0146 540 HOH A O   
4247 O  O   . HOH Q .   ? 0.2925 0.2959 0.3270 -0.0156 -0.0077 -0.0107 541 HOH A O   
4248 O  O   . HOH Q .   ? 0.4278 0.5423 0.4343 -0.0515 -0.0213 0.0204  542 HOH A O   
4249 O  O   . HOH Q .   ? 0.4533 0.4298 0.4187 -0.0379 -0.0188 -0.0155 543 HOH A O   
4250 O  O   . HOH Q .   ? 0.5451 0.5268 0.5021 -0.0628 -0.0263 -0.0056 544 HOH A O   
4251 O  O   . HOH Q .   ? 0.2946 0.2843 0.2864 0.0243  0.0023  -0.0015 545 HOH A O   
4252 O  O   . HOH Q .   ? 0.2871 0.3103 0.3177 -0.0209 -0.0123 -0.0093 546 HOH A O   
4253 O  O   . HOH Q .   ? 0.3772 0.3265 0.3291 0.0333  -0.0016 -0.0057 547 HOH A O   
4254 O  O   . HOH Q .   ? 0.5049 0.4732 0.4884 0.0197  0.0062  -0.0020 548 HOH A O   
4255 O  O   . HOH Q .   ? 0.6130 0.5377 0.5654 -0.0008 -0.0045 -0.0159 549 HOH A O   
4256 O  O   . HOH Q .   ? 0.3270 0.2811 0.2974 0.0151  -0.0055 -0.0088 550 HOH A O   
4257 O  O   . HOH Q .   ? 0.4913 0.5570 0.5131 0.0165  0.0021  0.0280  551 HOH A O   
4258 O  O   . HOH Q .   ? 0.3722 0.4932 0.3929 0.0246  -0.0032 0.0179  552 HOH A O   
4259 O  O   . HOH Q .   ? 0.4734 0.3541 0.3791 0.0158  -0.0087 -0.0080 553 HOH A O   
4260 O  O   . HOH Q .   ? 0.3138 0.4178 0.3459 -0.0217 -0.0163 0.0103  554 HOH A O   
4261 O  O   . HOH Q .   ? 0.1451 0.1613 0.1783 -0.0206 -0.0049 0.0053  555 HOH A O   
4262 O  O   . HOH Q .   ? 0.1735 0.1732 0.1843 0.0071  -0.0054 -0.0101 556 HOH A O   
4263 O  O   . HOH Q .   ? 0.3751 0.3457 0.3433 0.0336  0.0021  -0.0065 557 HOH A O   
4264 O  O   . HOH Q .   ? 0.4586 0.5359 0.4475 -0.0633 -0.0246 0.0109  558 HOH A O   
4265 O  O   . HOH Q .   ? 0.6778 0.7320 0.7048 0.0092  -0.0037 -0.0057 559 HOH A O   
4266 O  O   . HOH Q .   ? 0.1882 0.2137 0.2128 0.0019  -0.0074 -0.0118 560 HOH A O   
4267 O  O   . HOH Q .   ? 0.2973 0.3077 0.3119 -0.0158 -0.0148 0.0074  561 HOH A O   
4268 O  O   . HOH Q .   ? 0.2291 0.2810 0.2104 -0.0685 -0.0272 0.0104  562 HOH A O   
4269 O  O   . HOH Q .   ? 0.4469 0.4193 0.4241 0.0224  -0.0037 -0.0072 563 HOH A O   
4270 O  O   . HOH Q .   ? 0.2904 0.3452 0.3051 0.0184  -0.0026 0.0006  564 HOH A O   
4271 O  O   . HOH Q .   ? 0.2681 0.2425 0.2644 -0.0146 -0.0141 -0.0016 565 HOH A O   
4272 O  O   . HOH Q .   ? 0.6485 0.6047 0.5976 -0.0600 -0.0306 0.0211  566 HOH A O   
4273 O  O   . HOH Q .   ? 0.3171 0.4402 0.3440 -0.0085 -0.0101 0.0143  567 HOH A O   
4274 O  O   . HOH Q .   ? 0.3207 0.2935 0.3004 0.0235  0.0012  -0.0068 568 HOH A O   
4275 O  O   . HOH Q .   ? 0.5481 0.5004 0.5163 -0.0367 -0.0224 0.0077  569 HOH A O   
4276 O  O   . HOH Q .   ? 0.2139 0.3394 0.2340 -0.0325 -0.0165 0.0166  570 HOH A O   
4277 O  O   . HOH Q .   ? 0.2191 0.2286 0.2501 -0.0123 -0.0038 0.0004  571 HOH A O   
4278 O  O   . HOH Q .   ? 0.3053 0.3039 0.2971 0.0244  -0.0019 -0.0057 572 HOH A O   
4279 O  O   . HOH Q .   ? 0.2580 0.2686 0.2919 -0.0240 -0.0058 0.0026  573 HOH A O   
4280 O  O   . HOH Q .   ? 0.3781 0.3951 0.3599 -0.0598 -0.0255 -0.0007 574 HOH A O   
4281 O  O   . HOH Q .   ? 0.4355 0.4646 0.4608 -0.0002 -0.0080 0.0074  575 HOH A O   
4282 O  O   . HOH Q .   ? 0.4886 0.4365 0.4646 -0.0352 -0.0156 0.0001  576 HOH A O   
4283 O  O   . HOH Q .   ? 0.1574 0.2051 0.1665 -0.0356 -0.0176 -0.0040 577 HOH A O   
4284 O  O   . HOH Q .   ? 0.1974 0.2500 0.2194 0.0067  -0.0048 -0.0034 578 HOH A O   
4285 O  O   . HOH Q .   ? 0.1809 0.2042 0.2087 0.0062  -0.0085 -0.0060 579 HOH A O   
4286 O  O   . HOH Q .   ? 0.2726 0.3165 0.3036 0.0072  -0.0059 -0.0093 580 HOH A O   
4287 O  O   . HOH Q .   ? 0.4159 0.4339 0.4392 0.0069  -0.0073 -0.0083 581 HOH A O   
4288 O  O   . HOH Q .   ? 0.3905 0.4828 0.4075 0.0226  -0.0012 0.0095  582 HOH A O   
4289 O  O   . HOH Q .   ? 0.4030 0.2952 0.3180 0.0128  -0.0109 -0.0048 583 HOH A O   
4290 O  O   . HOH Q .   ? 0.3089 0.3030 0.2988 0.0248  -0.0020 -0.0058 584 HOH A O   
4291 O  O   . HOH Q .   ? 0.1978 0.2118 0.2150 -0.0390 -0.0117 0.0143  585 HOH A O   
4292 O  O   . HOH Q .   ? 0.1525 0.1633 0.1763 0.0001  -0.0071 -0.0038 586 HOH A O   
4293 O  O   . HOH Q .   ? 0.4614 0.4173 0.4396 -0.0205 -0.0173 0.0007  587 HOH A O   
4294 O  O   . HOH Q .   ? 0.1126 0.1300 0.1322 0.0046  -0.0060 -0.0094 588 HOH A O   
4295 O  O   . HOH Q .   ? 0.1983 0.1705 0.1771 -0.0018 -0.0085 -0.0175 589 HOH A O   
4296 O  O   . HOH Q .   ? 0.5275 0.4497 0.4601 -0.0458 -0.0208 -0.0150 590 HOH A O   
4297 O  O   . HOH Q .   ? 0.3668 0.3957 0.3939 0.0086  -0.0064 -0.0086 591 HOH A O   
4298 O  O   . HOH Q .   ? 0.4683 0.5138 0.4940 -0.0013 -0.0073 -0.0104 592 HOH A O   
4299 O  O   . HOH Q .   ? 0.3329 0.3604 0.3260 0.0358  -0.0002 0.0008  593 HOH A O   
4300 O  O   . HOH Q .   ? 0.1835 0.2018 0.2081 0.0063  -0.0074 -0.0082 594 HOH A O   
4301 O  O   . HOH Q .   ? 0.4193 0.4007 0.3976 -0.0291 -0.0158 -0.0159 595 HOH A O   
4302 O  O   . HOH Q .   ? 0.2582 0.2822 0.2673 -0.0458 -0.0166 0.0238  596 HOH A O   
4303 O  O   . HOH Q .   ? 0.3273 0.4140 0.3510 0.0090  -0.0059 0.0067  597 HOH A O   
4304 O  O   . HOH Q .   ? 0.4388 0.4259 0.4539 -0.0051 -0.0042 -0.0100 598 HOH A O   
4305 O  O   . HOH Q .   ? 0.4055 0.4221 0.4032 0.0273  -0.0005 -0.0036 599 HOH A O   
4306 O  O   . HOH Q .   ? 0.2590 0.3558 0.2741 -0.0346 -0.0162 0.0062  600 HOH A O   
4307 O  O   . HOH Q .   ? 0.3446 0.2636 0.2761 -0.0002 -0.0082 -0.0201 601 HOH A O   
4308 O  O   . HOH Q .   ? 0.1122 0.1270 0.1255 -0.0225 -0.0131 -0.0116 602 HOH A O   
4309 O  O   . HOH Q .   ? 0.1685 0.1666 0.1977 -0.0131 -0.0077 -0.0101 603 HOH A O   
4310 O  O   . HOH Q .   ? 0.1863 0.2254 0.2064 0.0114  -0.0059 -0.0025 604 HOH A O   
4311 O  O   . HOH Q .   ? 0.5132 0.5141 0.4894 0.0407  0.0010  -0.0015 605 HOH A O   
4312 O  O   . HOH Q .   ? 0.1149 0.1120 0.1378 -0.0067 -0.0064 -0.0103 606 HOH A O   
4313 O  O   . HOH Q .   ? 0.3814 0.3708 0.3590 0.0331  -0.0009 -0.0042 607 HOH A O   
4314 O  O   . HOH Q .   ? 0.2334 0.3061 0.2375 -0.0495 -0.0222 0.0038  608 HOH A O   
4315 O  O   . HOH Q .   ? 0.3762 0.4158 0.4012 0.0040  -0.0057 -0.0082 609 HOH A O   
4316 O  O   . HOH Q .   ? 0.1886 0.1904 0.2199 -0.0143 -0.0078 -0.0113 610 HOH A O   
4317 O  O   . HOH Q .   ? 0.5245 0.5651 0.5487 -0.0165 -0.0110 0.0191  611 HOH A O   
4318 O  O   . HOH Q .   ? 0.4195 0.4746 0.4404 -0.0121 -0.0095 -0.0069 612 HOH A O   
4319 O  O   . HOH Q .   ? 0.3114 0.2743 0.2931 0.0043  -0.0102 -0.0055 613 HOH A O   
4320 O  O   . HOH Q .   ? 0.2449 0.2916 0.2669 0.0116  0.0031  0.0206  614 HOH A O   
4321 O  O   . HOH Q .   ? 0.4624 0.3724 0.4061 -0.0183 -0.0095 -0.0170 615 HOH A O   
4322 O  O   . HOH Q .   ? 0.1640 0.2059 0.1942 -0.0222 -0.0140 -0.0054 616 HOH A O   
4323 O  O   . HOH Q .   ? 0.3779 0.4860 0.4021 -0.0156 -0.0100 0.0078  617 HOH A O   
4324 O  O   . HOH Q .   ? 0.6154 0.6079 0.5979 -0.0509 -0.0262 0.0223  618 HOH A O   
4325 O  O   . HOH Q .   ? 0.2210 0.2550 0.2039 -0.0601 -0.0254 -0.0001 619 HOH A O   
4326 O  O   . HOH Q .   ? 0.1782 0.1504 0.1717 -0.0282 -0.0161 0.0028  620 HOH A O   
4327 O  O   . HOH Q .   ? 0.4733 0.4360 0.4597 0.0027  -0.0073 -0.0094 621 HOH A O   
4328 O  O   . HOH Q .   ? 0.2900 0.3277 0.3107 -0.0401 -0.0118 0.0245  622 HOH A O   
4329 O  O   . HOH Q .   ? 0.5356 0.5429 0.4941 0.0714  0.0210  0.0238  623 HOH A O   
4330 O  O   . HOH Q .   ? 0.3070 0.3903 0.2922 -0.0699 -0.0263 0.0184  624 HOH A O   
4331 O  O   . HOH Q .   ? 0.2582 0.2347 0.2432 0.0172  -0.0044 -0.0080 625 HOH A O   
4332 O  O   . HOH Q .   ? 0.2739 0.2173 0.2336 -0.0449 -0.0218 0.0079  626 HOH A O   
4333 O  O   . HOH Q .   ? 0.3551 0.4312 0.3697 -0.0441 -0.0215 0.0065  627 HOH A O   
4334 O  O   . HOH Q .   ? 0.7688 0.6546 0.6849 -0.0232 -0.0207 -0.0009 628 HOH A O   
4335 O  O   . HOH Q .   ? 0.2487 0.2641 0.2728 0.0042  -0.0074 -0.0048 629 HOH A O   
4336 O  O   . HOH Q .   ? 0.3742 0.3964 0.3932 0.0126  -0.0040 0.0024  630 HOH A O   
4337 O  O   . HOH Q .   ? 0.3181 0.3167 0.3272 0.0044  -0.0064 -0.0125 631 HOH A O   
4338 O  O   . HOH Q .   ? 0.5306 0.5650 0.5577 0.0057  -0.0060 -0.0096 632 HOH A O   
4339 O  O   . HOH Q .   ? 0.1719 0.2061 0.1995 -0.0330 -0.0088 0.0192  633 HOH A O   
4340 O  O   . HOH Q .   ? 0.1097 0.1081 0.1370 -0.0110 -0.0069 -0.0081 634 HOH A O   
4341 O  O   . HOH Q .   ? 0.1768 0.2028 0.1987 -0.0253 -0.0113 0.0155  635 HOH A O   
4342 O  O   . HOH Q .   ? 0.5398 0.4320 0.4636 -0.0227 -0.0192 -0.0022 636 HOH A O   
4343 O  O   . HOH Q .   ? 0.2081 0.3032 0.2350 0.0039  -0.0079 0.0085  637 HOH A O   
4344 O  O   . HOH Q .   ? 0.3035 0.2995 0.3284 -0.0171 -0.0085 -0.0125 638 HOH A O   
4345 O  O   . HOH Q .   ? 0.6329 0.7743 0.6441 -0.0434 -0.0177 0.0265  639 HOH A O   
4346 O  O   . HOH Q .   ? 0.1943 0.1935 0.2142 -0.0005 -0.0010 -0.0027 640 HOH A O   
4347 O  O   . HOH Q .   ? 0.2909 0.2884 0.3185 -0.0105 -0.0055 -0.0085 641 HOH A O   
4348 O  O   . HOH Q .   ? 0.2253 0.1779 0.2050 -0.0148 -0.0089 -0.0162 642 HOH A O   
4349 O  O   . HOH Q .   ? 0.3584 0.3667 0.3519 -0.0189 -0.0128 -0.0151 643 HOH A O   
4350 O  O   . HOH Q .   ? 0.1184 0.1210 0.1444 -0.0090 -0.0067 -0.0044 644 HOH A O   
4351 O  O   . HOH Q .   ? 0.3514 0.2624 0.2929 -0.0279 -0.0191 -0.0011 645 HOH A O   
4352 O  O   . HOH Q .   ? 0.3177 0.3183 0.2917 -0.0518 -0.0231 -0.0096 646 HOH A O   
4353 O  O   . HOH Q .   ? 0.2780 0.2748 0.3007 -0.0054 -0.0036 -0.0064 647 HOH A O   
4354 O  O   . HOH Q .   ? 0.5763 0.4906 0.5144 -0.0384 -0.0230 0.0041  648 HOH A O   
4355 O  O   . HOH Q .   ? 0.6052 0.4690 0.4875 0.0299  -0.0067 -0.0055 649 HOH A O   
4356 O  O   . HOH Q .   ? 0.5451 0.5104 0.5305 -0.0189 -0.0168 0.0011  650 HOH A O   
4357 O  O   . HOH Q .   ? 0.2289 0.2056 0.2172 -0.0388 -0.0197 0.0099  651 HOH A O   
4358 O  O   . HOH Q .   ? 0.4120 0.4318 0.4367 0.0037  -0.0077 -0.0008 652 HOH A O   
4359 O  O   . HOH Q .   ? 0.3554 0.4007 0.3518 0.0514  0.0084  0.0047  653 HOH A O   
4360 O  O   . HOH Q .   ? 0.2642 0.1799 0.2123 -0.0180 -0.0156 -0.0046 654 HOH A O   
4361 O  O   . HOH Q .   ? 0.5035 0.4065 0.4366 -0.0021 -0.0125 -0.0068 655 HOH A O   
4362 O  O   . HOH Q .   ? 0.1982 0.2365 0.2226 0.0048  -0.0002 0.0155  656 HOH A O   
4363 O  O   . HOH Q .   ? 0.5168 0.4929 0.4759 0.0444  0.0018  -0.0029 657 HOH A O   
4364 O  O   . HOH Q .   ? 0.3454 0.2619 0.2954 -0.0176 -0.0146 -0.0057 658 HOH A O   
4365 O  O   . HOH Q .   ? 0.1914 0.2911 0.2132 -0.0229 -0.0130 0.0067  659 HOH A O   
4366 O  O   . HOH Q .   ? 0.2508 0.3408 0.2667 -0.0396 -0.0196 0.0069  660 HOH A O   
4367 O  O   . HOH Q .   ? 0.2915 0.3431 0.2944 0.0334  -0.0005 0.0041  661 HOH A O   
4368 O  O   . HOH Q .   ? 0.1202 0.1168 0.1438 -0.0072 -0.0058 -0.0093 662 HOH A O   
4369 O  O   . HOH Q .   ? 0.4601 0.4766 0.4568 0.0276  -0.0006 -0.0033 663 HOH A O   
4370 O  O   . HOH Q .   ? 0.3825 0.3261 0.3513 0.0102  0.0008  -0.0106 664 HOH A O   
4371 O  O   . HOH Q .   ? 0.3165 0.3578 0.3191 -0.0286 -0.0146 -0.0088 665 HOH A O   
4372 O  O   . HOH Q .   ? 0.1598 0.1314 0.1444 0.0141  -0.0019 -0.0107 666 HOH A O   
4373 O  O   . HOH Q .   ? 0.3247 0.3993 0.3540 0.0005  0.0007  0.0328  667 HOH A O   
4374 O  O   . HOH Q .   ? 0.3402 0.2911 0.2963 -0.0227 -0.0144 -0.0190 668 HOH A O   
4375 O  O   . HOH Q .   ? 0.2890 0.2721 0.2898 -0.0052 -0.0127 -0.0030 669 HOH A O   
4376 O  O   . HOH Q .   ? 0.3453 0.2802 0.3005 0.0156  0.0005  -0.0121 670 HOH A O   
4377 O  O   . HOH Q .   ? 0.2695 0.2821 0.2909 0.0052  -0.0076 -0.0084 671 HOH A O   
4378 O  O   . HOH Q .   ? 0.4707 0.4201 0.4421 -0.0401 -0.0176 0.0039  672 HOH A O   
4379 O  O   . HOH Q .   ? 0.3922 0.3081 0.3307 0.0142  -0.0072 -0.0089 673 HOH A O   
4380 O  O   . HOH Q .   ? 0.5319 0.5651 0.5312 0.0318  0.0011  -0.0004 674 HOH A O   
4381 O  O   A HOH Q .   ? 0.1499 0.1739 0.1716 0.0066  -0.0032 0.0063  675 HOH A O   
4382 O  O   B HOH Q .   ? 0.2222 0.2444 0.2421 0.0085  -0.0016 0.0066  675 HOH A O   
4383 O  O   . HOH Q .   ? 0.4138 0.3535 0.3557 0.0366  -0.0012 -0.0050 676 HOH A O   
4384 O  O   . HOH Q .   ? 0.2676 0.2799 0.2793 -0.0420 -0.0148 0.0168  677 HOH A O   
4385 O  O   . HOH Q .   ? 0.1881 0.1964 0.1982 -0.0066 -0.0092 -0.0146 678 HOH A O   
4386 O  O   . HOH Q .   ? 0.3567 0.3670 0.3736 0.0087  -0.0061 -0.0090 679 HOH A O   
4387 O  O   . HOH Q .   ? 0.3117 0.3507 0.3245 -0.0406 -0.0179 0.0283  680 HOH A O   
4388 O  O   . HOH Q .   ? 0.2086 0.2130 0.2203 -0.0014 -0.0079 -0.0141 681 HOH A O   
4389 O  O   . HOH Q .   ? 0.1777 0.2297 0.2085 -0.0098 -0.0023 0.0228  682 HOH A O   
4390 O  O   . HOH Q .   ? 0.3539 0.2891 0.2918 0.0371  -0.0011 -0.0064 683 HOH A O   
4391 O  O   . HOH Q .   ? 0.6696 0.6170 0.6181 0.0388  0.0057  -0.0058 684 HOH A O   
4392 O  O   . HOH Q .   ? 0.4166 0.3646 0.3679 0.0273  -0.0004 -0.0128 685 HOH A O   
4393 O  O   . HOH Q .   ? 0.1354 0.1580 0.1612 -0.0170 -0.0082 0.0102  686 HOH A O   
4394 O  O   . HOH Q .   ? 0.4079 0.3852 0.3631 0.0576  0.0158  0.0110  687 HOH A O   
4395 O  O   . HOH Q .   ? 0.3083 0.3212 0.3259 0.0061  -0.0064 -0.0069 688 HOH A O   
4396 O  O   . HOH Q .   ? 0.5525 0.5336 0.5361 0.0230  -0.0034 -0.0061 689 HOH A O   
4397 O  O   . HOH Q .   ? 0.4643 0.5358 0.4786 0.0257  0.0010  0.0039  690 HOH A O   
4398 O  O   . HOH Q .   ? 0.2241 0.3467 0.2537 0.0025  -0.0094 0.0158  691 HOH A O   
4399 O  O   . HOH Q .   ? 0.4588 0.5899 0.4869 -0.0168 -0.0137 0.0177  692 HOH A O   
4400 O  O   . HOH Q .   ? 0.4831 0.5262 0.5066 0.0074  -0.0005 0.0173  693 HOH A O   
4401 O  O   . HOH Q .   ? 0.5319 0.5569 0.5466 0.0148  -0.0034 -0.0067 694 HOH A O   
4402 O  O   . HOH Q .   ? 0.2697 0.2614 0.2683 0.0132  -0.0041 -0.0107 695 HOH A O   
4403 O  O   . HOH Q .   ? 0.3010 0.3713 0.3261 -0.0310 -0.0119 0.0363  696 HOH A O   
4404 O  O   . HOH Q .   ? 0.1764 0.1459 0.1543 -0.0187 -0.0125 -0.0175 697 HOH A O   
4405 O  O   . HOH Q .   ? 0.5490 0.4268 0.4329 0.0479  -0.0007 -0.0049 698 HOH A O   
4406 O  O   . HOH Q .   ? 0.3346 0.3649 0.3546 -0.0241 -0.0131 0.0177  699 HOH A O   
4407 O  O   . HOH Q .   ? 0.2452 0.2652 0.2772 -0.0090 -0.0089 -0.0090 700 HOH A O   
4408 O  O   . HOH Q .   ? 0.2504 0.2205 0.2418 -0.0388 -0.0155 0.0045  701 HOH A O   
4409 O  O   . HOH Q .   ? 0.4284 0.4115 0.3959 0.0402  0.0014  -0.0033 702 HOH A O   
4410 O  O   . HOH Q .   ? 0.3300 0.3887 0.3503 0.0135  -0.0026 -0.0015 703 HOH A O   
4411 O  O   . HOH Q .   ? 0.2677 0.2427 0.2479 0.0193  -0.0025 -0.0115 704 HOH A O   
4412 O  O   . HOH Q .   ? 0.1494 0.1414 0.1674 -0.0073 -0.0064 -0.0120 705 HOH A O   
4413 O  O   . HOH Q .   ? 0.5063 0.4897 0.5166 -0.0276 -0.0122 -0.0132 706 HOH A O   
4414 O  O   . HOH Q .   ? 0.3283 0.4100 0.3542 -0.0346 -0.0107 0.0420  707 HOH A O   
4415 O  O   . HOH Q .   ? 0.5466 0.5496 0.5799 -0.0141 -0.0078 -0.0100 708 HOH A O   
4416 O  O   . HOH Q .   ? 0.4367 0.4404 0.4730 -0.0172 -0.0047 -0.0050 709 HOH A O   
4417 O  O   . HOH Q .   ? 0.3893 0.4063 0.3996 -0.0437 -0.0141 0.0192  710 HOH A O   
4418 O  O   . HOH Q .   ? 0.4202 0.3822 0.3681 0.0474  0.0026  -0.0031 711 HOH A O   
4419 O  O   . HOH Q .   ? 0.3223 0.3495 0.3527 -0.0041 -0.0084 -0.0072 712 HOH A O   
4420 O  O   . HOH Q .   ? 0.2954 0.4096 0.3230 -0.0057 -0.0100 0.0124  713 HOH A O   
4421 O  O   . HOH Q .   ? 0.4041 0.4928 0.4015 -0.0607 -0.0246 0.0171  714 HOH A O   
4422 O  O   . HOH Q .   ? 0.3089 0.3200 0.3398 -0.0191 -0.0105 -0.0112 715 HOH A O   
4423 O  O   . HOH Q .   ? 0.3892 0.4964 0.4121 0.0117  -0.0034 0.0109  716 HOH A O   
4424 O  O   A HOH Q .   ? 0.2690 0.2893 0.2736 -0.0407 -0.0204 0.0232  717 HOH A O   
4425 O  O   B HOH Q .   ? 0.3281 0.3586 0.3409 -0.0349 -0.0174 0.0232  717 HOH A O   
4426 O  O   . HOH Q .   ? 0.4111 0.5193 0.4374 -0.0018 -0.0057 0.0079  718 HOH A O   
4427 O  O   . HOH Q .   ? 0.3617 0.4064 0.3842 -0.0072 -0.0084 -0.0090 719 HOH A O   
4428 O  O   . HOH Q .   ? 0.4165 0.3862 0.3886 -0.0472 -0.0258 0.0161  720 HOH A O   
4429 O  O   . HOH Q .   ? 0.3032 0.4008 0.3271 -0.0333 -0.0187 0.0092  721 HOH A O   
4430 O  O   . HOH Q .   ? 0.4332 0.4398 0.4369 0.0185  -0.0033 -0.0067 722 HOH A O   
4431 O  O   . HOH Q .   ? 0.2247 0.1943 0.2020 0.0077  -0.0059 -0.0159 723 HOH A O   
4432 O  O   . HOH Q .   ? 0.2682 0.2791 0.2999 -0.0101 -0.0083 -0.0100 724 HOH A O   
4433 O  O   . HOH Q .   ? 0.6369 0.5679 0.5752 -0.0181 -0.0136 -0.0205 725 HOH A O   
4434 O  O   . HOH Q .   ? 0.4427 0.4552 0.4281 0.0369  0.0005  -0.0010 726 HOH A O   
4435 O  O   . HOH Q .   ? 0.3152 0.3075 0.2979 0.0306  -0.0005 -0.0047 727 HOH A O   
4436 O  O   . HOH Q .   ? 0.5035 0.6139 0.5292 0.0188  0.0076  0.0494  728 HOH A O   
4437 O  O   . HOH Q .   ? 0.5158 0.4731 0.5027 -0.0052 -0.0088 -0.0093 729 HOH A O   
4438 O  O   . HOH Q .   ? 0.3855 0.3964 0.4161 -0.0083 -0.0081 -0.0095 730 HOH A O   
4439 O  O   . HOH Q .   ? 0.7347 0.6283 0.6603 -0.0132 -0.0087 -0.0181 731 HOH A O   
4440 O  O   . HOH Q .   ? 0.2665 0.2616 0.2932 -0.0133 -0.0066 -0.0112 732 HOH A O   
4441 O  O   . HOH Q .   ? 0.1814 0.1821 0.2085 -0.0087 -0.0049 -0.0056 733 HOH A O   
4442 O  O   . HOH Q .   ? 0.5417 0.4956 0.5027 -0.0506 -0.0242 0.0131  734 HOH A O   
4443 O  O   A HOH Q .   ? 0.1347 0.1301 0.1588 -0.0097 -0.0064 -0.0109 735 HOH A O   
4444 O  O   B HOH Q .   ? 0.2591 0.2502 0.2784 -0.0095 -0.0065 -0.0120 735 HOH A O   
4445 O  O   . HOH Q .   ? 0.4691 0.5091 0.4713 0.0301  0.0003  0.0006  736 HOH A O   
4446 O  O   . HOH Q .   ? 0.4551 0.3410 0.3686 0.0070  -0.0115 -0.0067 737 HOH A O   
4447 O  O   . HOH Q .   ? 0.1702 0.2238 0.1977 0.0013  0.0001  0.0230  738 HOH A O   
4448 O  O   . HOH Q .   ? 0.3714 0.2770 0.3019 -0.0021 -0.0064 -0.0184 739 HOH A O   
4449 O  O   . HOH Q .   ? 0.3351 0.2783 0.2997 -0.0083 -0.0084 -0.0176 740 HOH A O   
4450 O  O   . HOH Q .   ? 0.2820 0.3002 0.2882 0.0208  -0.0020 -0.0055 741 HOH A O   
4451 O  O   . HOH Q .   ? 0.2358 0.3193 0.2683 -0.0260 -0.0055 0.0396  742 HOH A O   
4452 O  O   . HOH Q .   ? 0.3959 0.3001 0.3296 -0.0022 -0.0130 -0.0062 743 HOH A O   
4453 O  O   . HOH Q .   ? 0.6561 0.6522 0.6159 -0.0695 -0.0282 0.0013  744 HOH A O   
4454 O  O   . HOH Q .   ? 0.6162 0.6258 0.6106 -0.0515 -0.0194 0.0232  745 HOH A O   
4455 O  O   . HOH Q .   ? 0.3378 0.2999 0.3010 0.0333  0.0033  -0.0063 746 HOH A O   
4456 O  O   . HOH Q .   ? 0.5271 0.6347 0.5454 -0.0389 -0.0195 0.0144  747 HOH A O   
4457 O  O   . HOH Q .   ? 0.4351 0.4007 0.4343 -0.0229 -0.0095 -0.0138 748 HOH A O   
4458 O  O   . HOH Q .   ? 0.1962 0.1934 0.1935 -0.0112 -0.0106 -0.0160 749 HOH A O   
4459 O  O   . HOH Q .   ? 0.3342 0.2811 0.2947 0.0279  0.0072  -0.0041 750 HOH A O   
4460 O  O   . HOH Q .   ? 0.3703 0.3833 0.3782 -0.0421 -0.0197 -0.0078 751 HOH A O   
4461 O  O   . HOH Q .   ? 0.3667 0.3539 0.3456 0.0306  -0.0019 -0.0048 752 HOH A O   
4462 O  O   . HOH Q .   ? 0.2761 0.2900 0.2898 0.0138  -0.0004 0.0035  753 HOH A O   
4463 O  O   . HOH Q .   ? 0.6657 0.6594 0.6465 -0.0552 -0.0221 0.0219  754 HOH A O   
4464 O  O   . HOH Q .   ? 0.4657 0.4525 0.4815 -0.0053 -0.0033 -0.0091 755 HOH A O   
4465 O  O   . HOH Q .   ? 0.4239 0.2925 0.3200 0.0044  -0.0143 -0.0042 756 HOH A O   
4466 O  O   . HOH Q .   ? 0.3170 0.3330 0.3275 0.0187  0.0002  0.0047  757 HOH A O   
4467 O  O   . HOH Q .   ? 0.3613 0.3835 0.3856 0.0034  -0.0070 0.0022  758 HOH A O   
4468 O  O   . HOH Q .   ? 0.3428 0.4377 0.3730 -0.0028 -0.0016 0.0419  759 HOH A O   
4469 O  O   A HOH Q .   ? 0.3147 0.2785 0.2776 -0.0508 -0.0224 -0.0115 760 HOH A O   
4470 O  O   B HOH Q .   ? 0.3196 0.2689 0.2737 -0.0484 -0.0216 -0.0134 760 HOH A O   
4471 O  O   . HOH Q .   ? 0.5891 0.5497 0.5839 -0.0197 -0.0110 -0.0068 761 HOH A O   
4472 O  O   . HOH Q .   ? 0.2900 0.3248 0.3152 0.0009  -0.0038 0.0126  762 HOH A O   
4473 O  O   . HOH Q .   ? 0.4341 0.5310 0.4400 0.0525  0.0131  0.0153  763 HOH A O   
4474 O  O   . HOH Q .   ? 0.5048 0.5680 0.5314 -0.0204 -0.0098 0.0304  764 HOH A O   
4475 O  O   . HOH Q .   ? 0.5335 0.5640 0.5103 -0.0676 -0.0275 0.0059  765 HOH A O   
4476 O  O   . HOH Q .   ? 0.1985 0.3004 0.2254 0.0097  -0.0072 0.0111  766 HOH A O   
4477 O  O   . HOH Q .   ? 0.5402 0.5651 0.5629 0.0050  -0.0060 -0.0094 767 HOH A O   
4478 O  O   . HOH Q .   ? 0.6627 0.6578 0.6762 -0.0330 -0.0149 -0.0117 768 HOH A O   
4479 O  O   . HOH Q .   ? 0.2522 0.2512 0.2829 -0.0140 -0.0064 -0.0077 769 HOH A O   
4480 O  O   . HOH Q .   ? 0.2403 0.2469 0.2448 0.0207  0.0025  0.0039  770 HOH A O   
4481 O  O   . HOH Q .   ? 0.2789 0.3272 0.2782 0.0388  -0.0006 0.0049  771 HOH A O   
4482 O  O   A HOH Q .   ? 0.2492 0.1391 0.1726 -0.0156 -0.0163 -0.0052 772 HOH A O   
4483 O  O   B HOH Q .   ? 0.4404 0.3239 0.3567 -0.0071 -0.0142 -0.0068 772 HOH A O   
4484 O  O   . HOH Q .   ? 0.5566 0.5913 0.5620 -0.0493 -0.0171 0.0296  773 HOH A O   
4485 O  O   . HOH Q .   ? 0.4501 0.4172 0.4495 -0.0120 -0.0092 -0.0088 774 HOH A O   
4486 O  O   . HOH Q .   ? 0.3352 0.3432 0.3720 -0.0203 -0.0047 -0.0013 775 HOH A O   
4487 O  O   . HOH Q .   ? 0.3822 0.4166 0.4122 0.0085  -0.0066 -0.0089 776 HOH A O   
4488 O  O   . HOH Q .   ? 0.4962 0.5465 0.5120 -0.0173 -0.0111 -0.0081 777 HOH A O   
4489 O  O   . HOH Q .   ? 0.4713 0.5031 0.4884 0.0153  0.0013  0.0127  778 HOH A O   
4490 O  O   . HOH Q .   ? 0.6355 0.6543 0.6333 -0.0516 -0.0230 -0.0019 779 HOH A O   
4491 O  O   . HOH Q .   ? 0.7167 0.6023 0.6325 -0.0066 -0.0071 -0.0186 780 HOH A O   
4492 O  O   . HOH Q .   ? 0.3640 0.4614 0.3726 -0.0483 -0.0213 0.0125  781 HOH A O   
4493 O  O   . HOH Q .   ? 0.5105 0.5398 0.5360 -0.0017 -0.0100 0.0070  782 HOH A O   
4494 O  O   . HOH Q .   ? 0.3903 0.4081 0.4246 -0.0193 -0.0109 -0.0101 783 HOH A O   
4495 O  O   . HOH Q .   ? 0.5693 0.4766 0.4851 0.0211  -0.0026 -0.0181 784 HOH A O   
4496 O  O   . HOH Q .   ? 0.5718 0.5142 0.5116 -0.0534 -0.0236 -0.0127 785 HOH A O   
4497 O  O   . HOH Q .   ? 0.3411 0.3863 0.3291 -0.0577 -0.0246 0.0003  786 HOH A O   
4498 O  O   . HOH Q .   ? 0.4928 0.5097 0.5250 -0.0088 -0.0002 0.0049  787 HOH A O   
4499 O  O   . HOH Q .   ? 0.5540 0.4906 0.5049 0.0216  -0.0047 -0.0086 788 HOH A O   
4500 O  O   . HOH Q .   ? 0.4871 0.4895 0.5160 -0.0100 -0.0040 -0.0041 789 HOH A O   
4501 O  O   . HOH Q .   ? 0.5509 0.6290 0.5508 0.0529  0.0160  0.0410  790 HOH A O   
4502 O  O   . HOH Q .   ? 0.4666 0.3773 0.3796 0.0446  -0.0002 -0.0059 791 HOH A O   
4503 O  O   . HOH Q .   ? 0.3937 0.3184 0.3310 0.0273  -0.0039 -0.0078 792 HOH A O   
4504 O  O   . HOH Q .   ? 0.3992 0.4417 0.4090 0.0357  0.0029  -0.0001 793 HOH A O   
4505 O  O   . HOH Q .   ? 0.2883 0.3114 0.3239 -0.0149 -0.0102 -0.0091 794 HOH A O   
4506 O  O   . HOH Q .   ? 0.3560 0.2797 0.3049 0.0084  -0.0015 -0.0143 795 HOH A O   
4507 O  O   . HOH Q .   ? 0.2628 0.2619 0.2944 -0.0144 -0.0070 -0.0095 796 HOH A O   
4508 O  O   . HOH Q .   ? 0.6149 0.6460 0.6036 0.0415  0.0015  0.0026  797 HOH A O   
4509 O  O   . HOH Q .   ? 0.4434 0.4439 0.4677 -0.0047 -0.0016 -0.0031 798 HOH A O   
4510 O  O   . HOH Q .   ? 0.3774 0.3107 0.3176 0.0191  -0.0031 -0.0166 799 HOH A O   
4511 O  O   . HOH Q .   ? 0.3714 0.3743 0.4013 -0.0171 -0.0089 -0.0119 800 HOH A O   
4512 O  O   . HOH Q .   ? 0.4688 0.6215 0.4890 -0.0243 -0.0120 0.0242  801 HOH A O   
4513 O  O   . HOH Q .   ? 0.6273 0.5763 0.5884 0.0211  -0.0044 -0.0083 802 HOH A O   
4514 O  O   . HOH Q .   ? 0.2499 0.2538 0.2635 0.0058  -0.0091 -0.0058 803 HOH A O   
4515 O  O   . HOH Q .   ? 0.5168 0.5246 0.5269 0.0159  -0.0032 -0.0039 804 HOH A O   
4516 O  O   . HOH Q .   ? 0.4261 0.4500 0.4593 -0.0246 -0.0132 -0.0088 805 HOH A O   
4517 O  O   . HOH Q .   ? 0.4332 0.5198 0.4642 -0.0106 -0.0032 0.0390  806 HOH A O   
4518 O  O   . HOH Q .   ? 0.5129 0.5247 0.5493 -0.0161 -0.0026 0.0008  807 HOH A O   
4519 O  O   . HOH Q .   ? 0.5695 0.5023 0.5008 -0.0587 -0.0249 -0.0089 808 HOH A O   
4520 O  O   . HOH Q .   ? 0.6090 0.6468 0.5985 0.0535  0.0087  0.0047  809 HOH A O   
4521 O  O   . HOH Q .   ? 0.4947 0.4621 0.4817 -0.0138 -0.0159 -0.0002 810 HOH A O   
4522 O  O   . HOH Q .   ? 0.2903 0.3136 0.2681 -0.0586 -0.0251 -0.0044 811 HOH A O   
4523 O  O   . HOH Q .   ? 0.5110 0.5336 0.5059 -0.0265 -0.0146 -0.0124 812 HOH A O   
4524 O  O   . HOH Q .   ? 0.4265 0.3805 0.3876 -0.0506 -0.0226 0.0122  813 HOH A O   
4525 O  O   . HOH Q .   ? 0.4780 0.4936 0.5126 -0.0148 -0.0024 0.0036  814 HOH A O   
4526 O  O   . HOH Q .   ? 0.5670 0.4333 0.4574 0.0151  -0.0114 -0.0046 815 HOH A O   
4527 O  O   . HOH Q .   ? 0.3722 0.4955 0.3962 -0.0201 -0.0118 0.0127  816 HOH A O   
4528 O  O   . HOH Q .   ? 0.3970 0.4549 0.4195 -0.0391 -0.0107 0.0326  817 HOH A O   
4529 O  O   . HOH Q .   ? 0.4224 0.3847 0.3745 0.0432  0.0016  -0.0038 818 HOH A O   
4530 O  O   . HOH Q .   ? 0.2263 0.3069 0.2559 0.0116  -0.0076 0.0061  819 HOH A O   
4531 O  O   . HOH Q .   ? 0.3902 0.3893 0.4201 -0.0120 -0.0050 -0.0072 820 HOH A O   
4532 O  O   . HOH Q .   ? 0.4884 0.4719 0.4695 0.0292  0.0002  -0.0064 821 HOH A O   
4533 O  O   . HOH Q .   ? 0.4101 0.4147 0.4061 0.0291  0.0042  0.0050  822 HOH A O   
4534 O  O   . HOH Q .   ? 0.3180 0.3597 0.3219 0.0427  0.0050  0.0020  823 HOH A O   
4535 O  O   . HOH Q .   ? 0.4765 0.4584 0.4925 -0.0177 -0.0089 -0.0079 824 HOH A O   
4536 O  O   . HOH Q .   ? 0.5815 0.5588 0.5907 -0.0262 -0.0107 -0.0131 825 HOH A O   
4537 O  O   . HOH Q .   ? 0.4722 0.5542 0.5011 -0.0177 -0.0079 0.0381  826 HOH A O   
4538 O  O   A HOH Q .   ? 0.2527 0.1536 0.1859 -0.0250 -0.0172 -0.0035 827 HOH A O   
4539 O  O   B HOH Q .   ? 0.3302 0.2463 0.2746 -0.0333 -0.0181 -0.0006 827 HOH A O   
4540 O  O   . HOH Q .   ? 0.4010 0.4543 0.4232 -0.0296 -0.0133 0.0291  828 HOH A O   
4541 O  O   . HOH Q .   ? 0.3752 0.4048 0.3925 0.0140  -0.0056 -0.0033 829 HOH A O   
4542 O  O   . HOH Q .   ? 0.3290 0.3287 0.3346 0.0009  -0.0077 -0.0146 830 HOH A O   
4543 O  O   . HOH Q .   ? 0.3675 0.4160 0.3933 0.0002  -0.0064 -0.0077 831 HOH A O   
4544 O  O   . HOH Q .   ? 0.4719 0.3675 0.3861 0.0250  -0.0057 -0.0082 832 HOH A O   
4545 O  O   . HOH Q .   ? 0.3376 0.3539 0.3587 0.0087  -0.0061 -0.0041 833 HOH A O   
4546 O  O   . HOH Q .   ? 0.6410 0.5572 0.5694 -0.0116 -0.0116 -0.0210 834 HOH A O   
4547 O  O   . HOH Q .   ? 0.1163 0.1161 0.1427 -0.0087 -0.0060 -0.0070 835 HOH A O   
4548 O  O   . HOH Q .   ? 0.4328 0.4365 0.4099 0.0413  0.0017  -0.0011 836 HOH A O   
4549 O  O   . HOH Q .   ? 0.5710 0.5903 0.5986 -0.0008 0.0032  0.0080  837 HOH A O   
4550 O  O   . HOH Q .   ? 0.5888 0.6077 0.6088 0.0110  -0.0062 -0.0074 838 HOH A O   
4551 O  O   . HOH Q .   ? 0.5808 0.4490 0.4796 0.0036  -0.0124 -0.0075 839 HOH A O   
4552 O  O   . HOH Q .   ? 0.4092 0.4181 0.4447 -0.0145 -0.0084 -0.0105 840 HOH A O   
4553 O  O   . HOH Q .   ? 0.3703 0.3195 0.3290 -0.0218 -0.0138 -0.0188 841 HOH A O   
4554 O  O   . HOH Q .   ? 0.3108 0.2973 0.3037 0.0110  -0.0051 -0.0132 842 HOH A O   
4555 O  O   . HOH Q .   ? 0.4613 0.4688 0.4751 0.0109  -0.0050 -0.0073 843 HOH A O   
4556 O  O   . HOH Q .   ? 0.2892 0.2925 0.3036 0.0054  -0.0084 -0.0070 844 HOH A O   
4557 O  O   . HOH Q .   ? 0.5743 0.5786 0.5861 0.0095  -0.0067 -0.0076 845 HOH A O   
4558 O  O   A HOH Q .   ? 0.1317 0.1886 0.1608 0.0038  -0.0082 -0.0003 846 HOH A O   
4559 O  O   B HOH Q .   ? 0.1637 0.2218 0.1980 -0.0034 -0.0100 -0.0009 846 HOH A O   
4560 O  O   . HOH Q .   ? 0.4130 0.3869 0.3762 0.0383  -0.0004 -0.0044 847 HOH A O   
4561 O  O   . HOH Q .   ? 0.3856 0.4247 0.4209 -0.0075 -0.0098 -0.0054 848 HOH A O   
4562 O  O   . HOH Q .   ? 0.3999 0.4041 0.3899 -0.0161 -0.0123 -0.0160 849 HOH A O   
4563 O  O   . HOH Q .   ? 0.3680 0.4395 0.4035 0.0005  -0.0099 0.0025  850 HOH A O   
4564 O  O   . HOH Q .   ? 0.4267 0.3507 0.3772 0.0098  -0.0001 -0.0130 851 HOH A O   
4565 O  O   . HOH Q .   ? 0.4166 0.3930 0.3570 0.0734  0.0210  0.0166  852 HOH A O   
4566 O  O   . HOH Q .   ? 0.3461 0.3463 0.3286 0.0416  0.0078  0.0078  853 HOH A O   
4567 O  O   . HOH Q .   ? 0.4409 0.5047 0.4794 -0.0036 -0.0106 0.0002  854 HOH A O   
4568 O  O   . HOH Q .   ? 0.4720 0.4859 0.5023 -0.0050 0.0023  0.0046  855 HOH A O   
4569 O  O   . HOH R .   ? 0.5131 0.5825 0.5386 -0.0067 -0.0313 0.0286  501 HOH B O   
4570 O  O   . HOH R .   ? 0.5959 0.4540 0.4614 -0.0504 -0.0368 0.0130  502 HOH B O   
4571 O  O   . HOH R .   ? 0.6035 0.6317 0.6256 0.0160  -0.0066 -0.0071 503 HOH B O   
4572 O  O   . HOH R .   ? 0.5453 0.4498 0.4311 -0.0745 -0.0463 0.0266  504 HOH B O   
4573 O  O   . HOH R .   ? 0.5995 0.6791 0.6031 -0.0509 -0.0312 0.0524  505 HOH B O   
4574 O  O   . HOH R .   ? 0.8038 0.6780 0.6523 -0.0864 -0.0567 0.0285  506 HOH B O   
4575 O  O   . HOH R .   ? 0.4340 0.5076 0.4126 -0.0878 -0.0442 0.0682  507 HOH B O   
4576 O  O   . HOH R .   ? 0.2393 0.3190 0.2823 0.0067  -0.0185 0.0169  508 HOH B O   
4577 O  O   . HOH R .   ? 0.5402 0.3428 0.3430 -0.0517 -0.0440 0.0120  509 HOH B O   
4578 O  O   . HOH R .   ? 0.6712 0.7155 0.6669 -0.0188 -0.0406 0.0380  510 HOH B O   
4579 O  O   . HOH R .   ? 0.4255 0.3462 0.3312 0.0558  -0.0005 0.0094  511 HOH B O   
4580 O  O   . HOH R .   ? 1.3193 1.0978 1.0950 0.0497  -0.0054 0.0011  512 HOH B O   
4581 O  O   . HOH R .   ? 0.5051 0.5692 0.5479 0.0186  -0.0054 -0.0039 513 HOH B O   
4582 O  O   . HOH R .   ? 0.6003 0.6655 0.6222 0.0434  0.0043  0.0063  514 HOH B O   
4583 O  O   . HOH R .   ? 0.5248 0.5461 0.5047 0.0596  0.0085  0.0070  515 HOH B O   
4584 O  O   . HOH R .   ? 0.7113 0.6332 0.5862 -0.1058 -0.0641 0.0426  516 HOH B O   
4585 O  O   . HOH R .   ? 0.4114 0.3948 0.3772 0.0368  -0.0065 0.0097  517 HOH B O   
4586 O  O   A HOH R .   ? 0.2309 0.2568 0.1828 -0.0940 -0.0494 0.0563  518 HOH B O   
4587 O  O   B HOH R .   ? 0.3508 0.3543 0.2854 -0.0980 -0.0539 0.0523  518 HOH B O   
4588 O  O   . HOH R .   ? 0.4854 0.5962 0.5026 -0.0388 -0.0283 0.0581  519 HOH B O   
4589 O  O   . HOH R .   ? 0.3223 0.3752 0.3508 0.0122  -0.0174 0.0122  520 HOH B O   
4590 O  O   . HOH R .   ? 0.4532 0.5315 0.4881 0.0115  -0.0131 0.0216  521 HOH B O   
4591 O  O   . HOH R .   ? 0.1064 0.1307 0.1271 0.0055  -0.0138 0.0023  522 HOH B O   
4592 O  O   . HOH R .   ? 0.5166 0.5096 0.4788 -0.0147 -0.0370 0.0314  523 HOH B O   
4593 O  O   . HOH R .   ? 0.5768 0.5829 0.5093 -0.1066 -0.0574 0.0579  524 HOH B O   
4594 O  O   . HOH R .   ? 0.3043 0.3312 0.3296 -0.0016 -0.0113 0.0050  525 HOH B O   
4595 O  O   . HOH R .   ? 0.5120 0.2803 0.2900 -0.0147 -0.0308 0.0040  526 HOH B O   
4596 O  O   . HOH R .   ? 0.4238 0.4346 0.3945 -0.0341 -0.0438 0.0370  527 HOH B O   
4597 O  O   . HOH R .   ? 0.3640 0.4244 0.3437 -0.0785 -0.0467 0.0643  528 HOH B O   
4598 O  O   . HOH R .   ? 0.4893 0.5264 0.5189 0.0113  -0.0073 -0.0094 529 HOH B O   
4599 O  O   . HOH R .   ? 0.3654 0.2489 0.2370 0.0414  -0.0121 0.0188  530 HOH B O   
4600 O  O   . HOH R .   ? 0.3700 0.2975 0.2880 0.0368  -0.0093 0.0115  531 HOH B O   
4601 O  O   . HOH R .   ? 0.3584 0.2570 0.2463 0.0426  -0.0094 0.0149  532 HOH B O   
4602 O  O   . HOH R .   ? 0.4512 0.2663 0.2700 0.0277  -0.0187 0.0155  533 HOH B O   
4603 O  O   . HOH R .   ? 0.5621 0.4180 0.4081 -0.0303 -0.0455 0.0322  534 HOH B O   
4604 O  O   . HOH R .   ? 0.1310 0.1866 0.1662 0.0058  -0.0173 0.0099  535 HOH B O   
4605 O  O   . HOH R .   ? 0.5400 0.2967 0.3059 -0.0064 -0.0333 0.0124  536 HOH B O   
4606 O  O   . HOH R .   ? 0.4455 0.5504 0.4764 -0.0010 -0.0160 0.0394  537 HOH B O   
4607 O  O   . HOH R .   ? 0.1952 0.1913 0.2056 -0.0028 -0.0119 -0.0031 538 HOH B O   
4608 O  O   . HOH R .   ? 0.4788 0.4169 0.3826 -0.0637 -0.0561 0.0430  539 HOH B O   
4609 O  O   . HOH R .   ? 0.5026 0.3597 0.3486 -0.0697 -0.0552 0.0293  540 HOH B O   
4610 O  O   . HOH R .   ? 0.1483 0.2087 0.1875 0.0157  -0.0130 0.0059  541 HOH B O   
4611 O  O   . HOH R .   ? 0.5374 0.4525 0.4685 -0.0332 -0.0273 0.0087  542 HOH B O   
4612 O  O   . HOH R .   ? 0.2792 0.3025 0.3032 0.0041  -0.0074 -0.0117 543 HOH B O   
4613 O  O   . HOH R .   ? 0.3532 0.3017 0.2833 0.0379  -0.0104 0.0165  544 HOH B O   
4614 O  O   . HOH R .   ? 0.4407 0.4177 0.3641 -0.0890 -0.0516 0.0444  545 HOH B O   
4615 O  O   . HOH R .   ? 0.3057 0.3510 0.3377 0.0091  -0.0111 0.0054  546 HOH B O   
4616 O  O   . HOH R .   ? 0.5562 0.5868 0.5516 0.0494  0.0047  0.0053  547 HOH B O   
4617 O  O   . HOH R .   ? 0.3341 0.3533 0.3107 0.0567  0.0087  0.0041  548 HOH B O   
4618 O  O   . HOH R .   ? 0.3545 0.3677 0.3078 -0.0793 -0.0533 0.0547  549 HOH B O   
4619 O  O   . HOH R .   ? 0.7299 0.4978 0.5049 -0.0355 -0.0438 0.0135  550 HOH B O   
4620 O  O   . HOH R .   ? 0.5204 0.2912 0.2956 -0.0438 -0.0458 0.0117  551 HOH B O   
4621 O  O   . HOH R .   ? 0.3089 0.2374 0.2530 -0.0152 -0.0222 0.0052  552 HOH B O   
4622 O  O   . HOH R .   ? 0.7056 0.5552 0.5277 -0.0980 -0.0654 0.0311  553 HOH B O   
4623 O  O   . HOH R .   ? 0.3403 0.3158 0.3257 0.0046  -0.0132 -0.0004 554 HOH B O   
4624 O  O   . HOH R .   ? 0.2506 0.3263 0.2685 -0.0295 -0.0250 0.0395  555 HOH B O   
4625 O  O   A HOH R .   ? 0.3875 0.2421 0.2310 0.0693  0.0028  0.0077  556 HOH B O   
4626 O  O   B HOH R .   ? 0.3711 0.2039 0.1898 0.0720  0.0041  0.0065  556 HOH B O   
4627 O  O   . HOH R .   ? 0.6110 0.5299 0.5218 -0.0653 -0.0399 0.0236  557 HOH B O   
4628 O  O   . HOH R .   ? 0.4571 0.4032 0.3659 -0.0845 -0.0571 0.0434  558 HOH B O   
4629 O  O   . HOH R .   ? 0.3871 0.4510 0.4272 0.0194  -0.0038 -0.0042 559 HOH B O   
4630 O  O   . HOH R .   ? 0.3359 0.1961 0.1988 0.0190  -0.0199 0.0143  560 HOH B O   
4631 O  O   . HOH R .   ? 0.3119 0.3793 0.3534 0.0224  -0.0037 -0.0024 561 HOH B O   
4632 O  O   . HOH R .   ? 0.1580 0.1382 0.1451 -0.0054 -0.0180 0.0042  562 HOH B O   
4633 O  O   . HOH R .   ? 0.3255 0.2978 0.2777 0.0522  0.0032  0.0036  563 HOH B O   
4634 O  O   . HOH R .   ? 0.4366 0.3369 0.3141 -0.0791 -0.0522 0.0297  564 HOH B O   
4635 O  O   . HOH R .   ? 0.5651 0.4049 0.4241 0.0134  -0.0170 0.0031  565 HOH B O   
4636 O  O   . HOH R .   ? 0.2997 0.2172 0.1955 -0.0517 -0.0503 0.0358  566 HOH B O   
4637 O  O   . HOH R .   ? 0.2295 0.1412 0.1443 0.0149  -0.0173 0.0093  567 HOH B O   
4638 O  O   . HOH R .   ? 0.1953 0.2717 0.2392 0.0087  -0.0176 0.0141  568 HOH B O   
4639 O  O   . HOH R .   ? 0.4054 0.3606 0.3185 -0.0853 -0.0589 0.0471  569 HOH B O   
4640 O  O   . HOH R .   ? 0.4183 0.4742 0.4569 0.0111  -0.0128 0.0050  570 HOH B O   
4641 O  O   . HOH R .   ? 0.1494 0.1409 0.1451 0.0055  -0.0138 0.0014  571 HOH B O   
4642 O  O   . HOH R .   ? 0.2621 0.2606 0.2655 0.0104  -0.0099 -0.0026 572 HOH B O   
4643 O  O   . HOH R .   ? 0.2556 0.2522 0.2634 0.0018  -0.0115 -0.0032 573 HOH B O   
4644 O  O   . HOH R .   ? 0.4491 0.3237 0.3414 0.0126  -0.0151 0.0015  574 HOH B O   
4645 O  O   . HOH R .   ? 0.1384 0.1319 0.1335 0.0041  -0.0154 0.0035  575 HOH B O   
4646 O  O   . HOH R .   ? 0.2176 0.2502 0.2273 0.0084  -0.0207 0.0157  576 HOH B O   
4647 O  O   . HOH R .   ? 0.4450 0.2874 0.2844 -0.0045 -0.0342 0.0255  577 HOH B O   
4648 O  O   . HOH R .   ? 0.1591 0.2142 0.1763 -0.0221 -0.0251 0.0284  578 HOH B O   
4649 O  O   . HOH R .   ? 0.2531 0.3380 0.2913 0.0059  -0.0175 0.0229  579 HOH B O   
4650 O  O   . HOH R .   ? 0.5865 0.3957 0.3808 -0.0805 -0.0583 0.0207  580 HOH B O   
4651 O  O   . HOH R .   ? 0.3191 0.3431 0.2706 -0.0960 -0.0539 0.0615  581 HOH B O   
4652 O  O   A HOH R .   ? 0.1613 0.2335 0.2065 0.0134  -0.0152 0.0097  582 HOH B O   
4653 O  O   B HOH R .   ? 0.2037 0.2745 0.2503 0.0142  -0.0132 0.0071  582 HOH B O   
4654 O  O   . HOH R .   ? 0.5564 0.5570 0.5264 0.0548  0.0037  0.0082  583 HOH B O   
4655 O  O   . HOH R .   ? 0.5639 0.5312 0.4809 0.0873  0.0162  0.0114  584 HOH B O   
4656 O  O   . HOH R .   ? 0.4768 0.3900 0.3608 -0.0549 -0.0556 0.0421  585 HOH B O   
4657 O  O   . HOH R .   ? 0.4373 0.4139 0.4213 0.0112  -0.0108 -0.0013 586 HOH B O   
4658 O  O   . HOH R .   ? 0.1643 0.2374 0.2082 0.0094  -0.0175 0.0123  587 HOH B O   
4659 O  O   . HOH R .   ? 0.4561 0.4175 0.3608 -0.1024 -0.0595 0.0470  588 HOH B O   
4660 O  O   . HOH R .   ? 0.6518 0.5596 0.5796 -0.0012 -0.0172 0.0006  589 HOH B O   
4661 O  O   . HOH R .   ? 0.4305 0.2376 0.2558 0.0105  -0.0202 0.0048  590 HOH B O   
4662 O  O   . HOH R .   ? 0.1821 0.2534 0.2089 -0.0118 -0.0207 0.0289  591 HOH B O   
4663 O  O   . HOH R .   ? 0.1147 0.1252 0.1252 -0.0018 -0.0165 0.0045  592 HOH B O   
4664 O  O   A HOH R .   ? 0.2034 0.2468 0.1853 -0.0640 -0.0392 0.0484  593 HOH B O   
4665 O  O   B HOH R .   ? 0.0999 0.1706 0.0987 -0.0537 -0.0339 0.0511  593 HOH B O   
4666 O  O   . HOH R .   ? 0.4772 0.5222 0.5131 0.0120  -0.0072 -0.0072 594 HOH B O   
4667 O  O   . HOH R .   ? 0.3463 0.4089 0.3800 0.0282  -0.0074 0.0071  595 HOH B O   
4668 O  O   . HOH R .   ? 0.4432 0.4401 0.4143 -0.0051 -0.0310 0.0259  596 HOH B O   
4669 O  O   . HOH R .   ? 0.6374 0.4551 0.4462 -0.0739 -0.0596 0.0261  597 HOH B O   
4670 O  O   . HOH R .   ? 0.1979 0.2757 0.2187 -0.0233 -0.0297 0.0371  598 HOH B O   
4671 O  O   . HOH R .   ? 0.4626 0.5627 0.4892 -0.0155 -0.0217 0.0428  599 HOH B O   
4672 O  O   . HOH R .   ? 0.3315 0.3887 0.3687 0.0103  -0.0132 0.0075  600 HOH B O   
4673 O  O   . HOH R .   ? 0.1525 0.1927 0.1822 0.0035  -0.0127 0.0066  601 HOH B O   
4674 O  O   . HOH R .   ? 0.3643 0.2889 0.2996 0.0197  -0.0101 -0.0003 602 HOH B O   
4675 O  O   . HOH R .   ? 0.5468 0.3341 0.3434 0.0111  -0.0248 0.0126  603 HOH B O   
4676 O  O   . HOH R .   ? 0.3018 0.3571 0.3083 0.0505  0.0079  0.0055  604 HOH B O   
4677 O  O   . HOH R .   ? 0.3029 0.4136 0.3032 -0.0745 -0.0368 0.0744  605 HOH B O   
4678 O  O   . HOH R .   ? 0.3241 0.3964 0.3697 0.0185  -0.0031 -0.0016 606 HOH B O   
4679 O  O   . HOH R .   ? 0.4728 0.5532 0.4695 -0.0616 -0.0340 0.0588  607 HOH B O   
4680 O  O   . HOH R .   ? 0.6228 0.5047 0.5283 -0.0170 -0.0232 0.0032  608 HOH B O   
4681 O  O   . HOH R .   ? 0.1796 0.1958 0.2029 -0.0026 -0.0109 0.0003  609 HOH B O   
4682 O  O   . HOH R .   ? 0.3933 0.4088 0.4130 -0.0088 -0.0131 0.0047  610 HOH B O   
4683 O  O   . HOH R .   ? 0.3428 0.2945 0.3054 0.0120  -0.0114 -0.0010 611 HOH B O   
4684 O  O   . HOH R .   ? 0.5057 0.5979 0.5297 -0.0207 -0.0261 0.0414  612 HOH B O   
4685 O  O   . HOH R .   ? 0.2879 0.2067 0.2233 0.0003  -0.0172 0.0017  613 HOH B O   
4686 O  O   . HOH R .   ? 0.2626 0.2948 0.2930 0.0082  -0.0074 -0.0089 614 HOH B O   
4687 O  O   . HOH R .   ? 0.3227 0.3793 0.3569 0.0093  -0.0127 0.0104  615 HOH B O   
4688 O  O   . HOH R .   ? 0.2000 0.1832 0.1555 -0.0393 -0.0418 0.0319  616 HOH B O   
4689 O  O   . HOH R .   ? 0.6055 0.4398 0.4332 0.0587  -0.0041 0.0122  617 HOH B O   
4690 O  O   . HOH R .   ? 0.7434 0.6563 0.6791 -0.0091 -0.0183 0.0001  618 HOH B O   
4691 O  O   . HOH R .   ? 0.3756 0.4141 0.4050 0.0115  -0.0054 -0.0078 619 HOH B O   
4692 O  O   . HOH R .   ? 0.4924 0.5647 0.5384 0.0153  -0.0133 0.0086  620 HOH B O   
4693 O  O   . HOH R .   ? 0.5344 0.5827 0.5713 0.0109  -0.0115 0.0012  621 HOH B O   
4694 O  O   . HOH R .   ? 0.2715 0.2815 0.2844 0.0120  -0.0079 -0.0047 622 HOH B O   
4695 O  O   . HOH R .   ? 0.5871 0.4738 0.4488 -0.0880 -0.0620 0.0360  623 HOH B O   
4696 O  O   . HOH R .   ? 0.4238 0.4854 0.3835 -0.1096 -0.0541 0.0733  624 HOH B O   
4697 O  O   . HOH R .   ? 0.4614 0.5545 0.4958 0.0156  -0.0120 0.0267  625 HOH B O   
4698 O  O   . HOH R .   ? 0.4697 0.3684 0.3527 0.0521  -0.0059 0.0163  626 HOH B O   
4699 O  O   . HOH R .   ? 0.6690 0.5633 0.5318 -0.0950 -0.0671 0.0425  627 HOH B O   
4700 O  O   . HOH R .   ? 0.7267 0.4917 0.4982 0.0285  -0.0158 0.0039  628 HOH B O   
4701 O  O   . HOH R .   ? 0.3779 0.3598 0.3077 -0.0921 -0.0580 0.0526  629 HOH B O   
4702 O  O   . HOH R .   ? 0.3826 0.4064 0.4050 0.0098  -0.0059 0.0011  630 HOH B O   
4703 O  O   . HOH R .   ? 0.5885 0.4166 0.4235 -0.0456 -0.0370 0.0104  631 HOH B O   
4704 O  O   . HOH R .   ? 0.2398 0.2731 0.2715 0.0093  -0.0083 -0.0064 632 HOH B O   
4705 O  O   . HOH R .   ? 0.3917 0.4119 0.4133 0.0111  -0.0063 -0.0037 633 HOH B O   
4706 O  O   A HOH R .   ? 0.3000 0.3517 0.2865 -0.0550 -0.0452 0.0512  634 HOH B O   
4707 O  O   B HOH R .   ? 0.2573 0.3280 0.2577 -0.0477 -0.0403 0.0512  634 HOH B O   
4708 O  O   . HOH R .   ? 0.2995 0.3607 0.3307 0.0134  -0.0101 0.0145  635 HOH B O   
4709 O  O   . HOH R .   ? 0.3617 0.4548 0.3663 -0.0551 -0.0364 0.0611  636 HOH B O   
4710 O  O   . HOH R .   ? 0.2959 0.3638 0.3424 0.0159  -0.0114 0.0030  637 HOH B O   
4711 O  O   . HOH R .   ? 0.5083 0.4803 0.4194 -0.1084 -0.0625 0.0537  638 HOH B O   
4712 O  O   . HOH R .   ? 0.1240 0.1822 0.1600 0.0238  -0.0047 -0.0006 639 HOH B O   
4713 O  O   . HOH R .   ? 0.7125 0.7886 0.7402 -0.0101 -0.0186 0.0307  640 HOH B O   
4714 O  O   . HOH R .   ? 0.6128 0.3629 0.3630 -0.0471 -0.0475 0.0086  641 HOH B O   
4715 O  O   . HOH R .   ? 0.3558 0.4166 0.3379 -0.0748 -0.0403 0.0600  642 HOH B O   
4716 O  O   . HOH R .   ? 0.4879 0.4145 0.3835 -0.0820 -0.0519 0.0340  643 HOH B O   
4717 O  O   . HOH R .   ? 0.4916 0.5248 0.4788 0.0584  0.0093  0.0065  644 HOH B O   
4718 O  O   . HOH R .   ? 0.4134 0.2425 0.2424 -0.0184 -0.0392 0.0254  645 HOH B O   
4719 O  O   . HOH R .   ? 0.4744 0.5142 0.5038 0.0148  -0.0082 0.0003  646 HOH B O   
4720 O  O   . HOH R .   ? 0.4958 0.2546 0.2616 -0.0229 -0.0353 0.0049  647 HOH B O   
4721 O  O   . HOH R .   ? 0.2529 0.2831 0.2760 -0.0077 -0.0137 0.0102  648 HOH B O   
4722 O  O   . HOH R .   ? 0.3488 0.3421 0.3434 0.0172  -0.0080 -0.0019 649 HOH B O   
4723 O  O   . HOH R .   ? 0.2416 0.2656 0.2395 0.0414  0.0012  0.0032  650 HOH B O   
4724 O  O   . HOH R .   ? 0.2247 0.2154 0.1972 0.0439  0.0014  0.0018  651 HOH B O   
4725 O  O   . HOH R .   ? 0.4786 0.5925 0.4964 -0.0374 -0.0259 0.0586  652 HOH B O   
4726 O  O   . HOH R .   ? 0.5462 0.4857 0.4648 0.0517  -0.0038 0.0149  653 HOH B O   
4727 O  O   . HOH R .   ? 0.3502 0.3680 0.3187 -0.0697 -0.0405 0.0436  654 HOH B O   
4728 O  O   . HOH R .   ? 0.4861 0.3065 0.3230 -0.0279 -0.0321 0.0078  655 HOH B O   
4729 O  O   . HOH R .   ? 0.2846 0.3333 0.3225 0.0140  -0.0082 -0.0040 656 HOH B O   
4730 O  O   . HOH R .   ? 0.3296 0.3619 0.3395 0.0202  -0.0141 0.0119  657 HOH B O   
4731 O  O   . HOH R .   ? 0.2064 0.2520 0.2142 0.0421  0.0047  0.0021  658 HOH B O   
4732 O  O   . HOH R .   ? 0.4107 0.2482 0.2708 -0.0185 -0.0279 0.0069  659 HOH B O   
4733 O  O   . HOH R .   ? 0.5280 0.3740 0.3971 -0.0260 -0.0288 0.0066  660 HOH B O   
4734 O  O   . HOH R .   ? 0.1519 0.1833 0.1796 0.0024  -0.0129 0.0030  661 HOH B O   
4735 O  O   . HOH R .   ? 0.3189 0.3671 0.2824 -0.0961 -0.0520 0.0675  662 HOH B O   
4736 O  O   . HOH R .   ? 0.6445 0.3750 0.3770 -0.0382 -0.0450 0.0062  663 HOH B O   
4737 O  O   . HOH R .   ? 0.7083 0.5733 0.5467 -0.0916 -0.0608 0.0300  664 HOH B O   
4738 O  O   . HOH R .   ? 0.1876 0.1752 0.1767 0.0116  -0.0124 0.0018  665 HOH B O   
4739 O  O   . HOH R .   ? 0.4879 0.5846 0.5210 0.0125  -0.0123 0.0311  666 HOH B O   
4740 O  O   . HOH R .   ? 0.3053 0.3553 0.3439 0.0128  -0.0104 -0.0010 667 HOH B O   
4741 O  O   . HOH R .   ? 0.2841 0.3752 0.2942 -0.0437 -0.0338 0.0542  668 HOH B O   
4742 O  O   . HOH R .   ? 0.1888 0.1960 0.1762 0.0359  -0.0047 0.0070  669 HOH B O   
4743 O  O   . HOH R .   ? 0.3089 0.2715 0.2851 -0.0037 -0.0162 0.0010  670 HOH B O   
4744 O  O   . HOH R .   ? 0.1957 0.2093 0.2161 0.0067  -0.0085 -0.0064 671 HOH B O   
4745 O  O   . HOH R .   ? 0.5360 0.6190 0.5795 0.0167  -0.0017 -0.0036 672 HOH B O   
4746 O  O   . HOH R .   ? 0.5691 0.5046 0.4845 0.0557  -0.0012 0.0126  673 HOH B O   
4747 O  O   . HOH R .   ? 0.2461 0.3158 0.2910 0.0213  -0.0046 0.0012  674 HOH B O   
4748 O  O   . HOH R .   ? 0.4988 0.4801 0.4774 -0.0390 -0.0263 0.0168  675 HOH B O   
4749 O  O   . HOH R .   ? 0.5269 0.5743 0.5010 -0.0776 -0.0421 0.0573  676 HOH B O   
4750 O  O   . HOH R .   ? 0.4620 0.3741 0.3690 0.0521  0.0011  0.0004  677 HOH B O   
4751 O  O   . HOH R .   ? 0.2637 0.3323 0.3071 0.0109  -0.0156 0.0092  678 HOH B O   
4752 O  O   . HOH R .   ? 0.1945 0.2226 0.2237 0.0081  -0.0079 -0.0077 679 HOH B O   
4753 O  O   . HOH R .   ? 0.5438 0.6463 0.5709 -0.0165 -0.0233 0.0433  680 HOH B O   
4754 O  O   . HOH R .   ? 0.1893 0.2463 0.2100 0.0348  0.0026  0.0006  681 HOH B O   
4755 O  O   . HOH R .   ? 0.3989 0.2605 0.2827 -0.0188 -0.0261 0.0057  682 HOH B O   
4756 O  O   . HOH R .   ? 0.4981 0.4906 0.4925 0.0184  -0.0067 -0.0033 683 HOH B O   
4757 O  O   . HOH R .   ? 0.6835 0.5311 0.5462 -0.0390 -0.0327 0.0089  684 HOH B O   
4758 O  O   . HOH R .   ? 0.3999 0.3513 0.3354 0.0546  0.0042  0.0006  685 HOH B O   
4759 O  O   . HOH R .   ? 0.3029 0.3726 0.3439 0.0262  -0.0052 0.0043  686 HOH B O   
4760 O  O   . HOH R .   ? 0.6243 0.3816 0.3919 0.0060  -0.0256 0.0057  687 HOH B O   
4761 O  O   . HOH R .   ? 0.5223 0.5569 0.5484 0.0043  -0.0084 0.0076  688 HOH B O   
4762 O  O   . HOH R .   ? 0.2797 0.3180 0.3066 0.0154  -0.0075 0.0021  689 HOH B O   
4763 O  O   . HOH R .   ? 0.5312 0.6365 0.5571 -0.0171 -0.0196 0.0467  690 HOH B O   
4764 O  O   . HOH R .   ? 0.2930 0.3149 0.2850 0.0457  0.0000  0.0084  691 HOH B O   
4765 O  O   . HOH R .   ? 0.5580 0.4053 0.3851 -0.0799 -0.0526 0.0222  692 HOH B O   
4766 O  O   . HOH R .   ? 0.4918 0.5831 0.5121 -0.0265 -0.0275 0.0443  693 HOH B O   
4767 O  O   . HOH R .   ? 0.3593 0.4095 0.3593 0.0525  0.0087  0.0055  694 HOH B O   
4768 O  O   . HOH R .   ? 0.3362 0.4505 0.3370 -0.0744 -0.0357 0.0745  695 HOH B O   
4769 O  O   . HOH R .   ? 0.2507 0.3196 0.2960 0.0197  -0.0092 0.0038  696 HOH B O   
4770 O  O   . HOH R .   ? 0.6076 0.4312 0.4232 -0.0666 -0.0576 0.0286  697 HOH B O   
4771 O  O   . HOH R .   ? 0.3451 0.3878 0.3804 0.0112  -0.0099 -0.0020 698 HOH B O   
4772 O  O   . HOH R .   ? 0.2896 0.2940 0.2398 -0.0696 -0.0537 0.0504  699 HOH B O   
4773 O  O   . HOH R .   ? 0.5966 0.5468 0.5487 -0.0479 -0.0304 0.0171  700 HOH B O   
4774 O  O   . HOH R .   ? 0.5569 0.3921 0.3899 0.0444  -0.0110 0.0145  701 HOH B O   
4775 O  O   . HOH R .   ? 0.5622 0.6227 0.5953 0.0102  -0.0120 0.0134  702 HOH B O   
4776 O  O   . HOH R .   ? 0.8401 0.5779 0.5831 -0.0113 -0.0316 0.0021  703 HOH B O   
4777 O  O   . HOH R .   ? 0.7471 0.5152 0.5048 0.0641  -0.0008 0.0037  704 HOH B O   
4778 O  O   . HOH R .   ? 0.3905 0.4469 0.4322 0.0154  -0.0080 -0.0039 705 HOH B O   
4779 O  O   . HOH R .   ? 0.6244 0.5216 0.5105 -0.0687 -0.0426 0.0226  706 HOH B O   
4780 O  O   . HOH R .   ? 0.3264 0.3418 0.3135 0.0465  0.0009  0.0071  707 HOH B O   
4781 O  O   . HOH R .   ? 0.2423 0.2363 0.2436 0.0037  -0.0129 -0.0006 708 HOH B O   
4782 O  O   A HOH R .   ? 0.1533 0.1269 0.1338 0.0072  -0.0135 0.0011  709 HOH B O   
4783 O  O   B HOH R .   ? 0.2864 0.2636 0.2677 0.0138  -0.0110 0.0004  709 HOH B O   
4784 O  O   . HOH R .   ? 0.7487 0.5917 0.5732 -0.0873 -0.0631 0.0281  710 HOH B O   
4785 O  O   A HOH R .   ? 0.2044 0.2283 0.2290 0.0097  -0.0072 -0.0086 711 HOH B O   
4786 O  O   B HOH R .   ? 0.3533 0.3769 0.3761 0.0123  -0.0068 -0.0070 711 HOH B O   
4787 O  O   . HOH R .   ? 0.3014 0.3184 0.3039 -0.0315 -0.0230 0.0203  712 HOH B O   
4788 O  O   . HOH R .   ? 0.5583 0.6223 0.5973 0.0156  -0.0146 0.0090  713 HOH B O   
4789 O  O   . HOH R .   ? 0.3681 0.4484 0.4052 0.0109  -0.0024 -0.0040 714 HOH B O   
4790 O  O   . HOH R .   ? 0.5410 0.6073 0.5283 -0.0680 -0.0445 0.0609  715 HOH B O   
4791 O  O   . HOH R .   ? 0.5504 0.6242 0.5724 -0.0221 -0.0205 0.0355  716 HOH B O   
4792 O  O   . HOH R .   ? 0.7043 0.4799 0.4682 -0.0703 -0.0514 0.0142  717 HOH B O   
4793 O  O   . HOH R .   ? 0.5204 0.5340 0.5109 -0.0461 -0.0278 0.0273  718 HOH B O   
4794 O  O   . HOH R .   ? 0.4668 0.5360 0.5131 0.0154  -0.0125 0.0053  719 HOH B O   
4795 O  O   . HOH R .   ? 0.8625 0.7030 0.6888 -0.0746 -0.0612 0.0331  720 HOH B O   
4796 O  O   . HOH R .   ? 0.5893 0.6142 0.6050 0.0051  -0.0077 -0.0135 721 HOH B O   
4797 O  O   . HOH R .   ? 0.3165 0.4007 0.3564 0.0014  -0.0215 0.0227  722 HOH B O   
4798 O  O   . HOH R .   ? 0.5242 0.6366 0.5202 -0.0824 -0.0393 0.0772  723 HOH B O   
4799 O  O   . HOH R .   ? 0.5060 0.5540 0.4821 -0.0739 -0.0396 0.0551  724 HOH B O   
4800 O  O   . HOH R .   ? 0.6377 0.4702 0.4941 -0.0023 -0.0220 0.0034  725 HOH B O   
4801 O  O   . HOH R .   ? 0.5302 0.6077 0.5718 0.0137  -0.0142 0.0142  726 HOH B O   
4802 O  O   . HOH R .   ? 0.5517 0.5873 0.5562 -0.0376 -0.0251 0.0292  727 HOH B O   
4803 O  O   . HOH R .   ? 0.2211 0.2708 0.2579 0.0144  -0.0063 -0.0060 728 HOH B O   
4804 O  O   . HOH R .   ? 0.5031 0.4228 0.4268 -0.0560 -0.0349 0.0183  729 HOH B O   
4805 O  O   . HOH R .   ? 0.4468 0.4379 0.4479 0.0048  -0.0114 -0.0028 730 HOH B O   
4806 O  O   . HOH R .   ? 0.5795 0.5994 0.5579 -0.0357 -0.0428 0.0367  731 HOH B O   
4807 O  O   . HOH R .   ? 0.4435 0.4829 0.4775 0.0113  -0.0083 -0.0059 732 HOH B O   
4808 O  O   . HOH R .   ? 0.4313 0.5024 0.4759 0.0139  -0.0140 0.0082  733 HOH B O   
4809 O  O   . HOH R .   ? 0.6360 0.7236 0.6618 -0.0175 -0.0210 0.0388  734 HOH B O   
4810 O  O   . HOH R .   ? 0.3882 0.4556 0.4352 0.0171  -0.0094 0.0015  735 HOH B O   
4811 O  O   . HOH R .   ? 0.5942 0.5943 0.5340 -0.0854 -0.0482 0.0475  736 HOH B O   
4812 O  O   . HOH R .   ? 0.4650 0.5354 0.5110 0.0148  -0.0126 0.0064  737 HOH B O   
4813 O  O   . HOH R .   ? 0.4883 0.4594 0.4027 -0.0973 -0.0564 0.0465  738 HOH B O   
4814 O  O   . HOH R .   ? 0.5966 0.4016 0.4110 -0.0366 -0.0372 0.0093  739 HOH B O   
4815 O  O   . HOH R .   ? 0.7887 0.5549 0.5618 0.0232  -0.0199 0.0091  740 HOH B O   
4816 O  O   . HOH R .   ? 0.6130 0.5654 0.5864 -0.0030 -0.0135 -0.0033 741 HOH B O   
4817 O  O   . HOH R .   ? 0.5947 0.5010 0.5162 0.0132  -0.0132 0.0004  742 HOH B O   
4818 O  O   . HOH R .   ? 0.3343 0.2532 0.2362 0.0408  -0.0111 0.0187  743 HOH B O   
4819 O  O   . HOH R .   ? 0.6677 0.6406 0.6528 0.0045  -0.0124 -0.0018 744 HOH B O   
4820 O  O   A HOH R .   ? 0.4293 0.4142 0.4304 0.0026  -0.0100 -0.0057 745 HOH B O   
4821 O  O   B HOH R .   ? 0.2720 0.2668 0.2811 0.0021  -0.0100 -0.0056 745 HOH B O   
4822 O  O   . HOH R .   ? 0.6095 0.6245 0.6230 0.0157  -0.0054 -0.0059 746 HOH B O   
4823 O  O   . HOH R .   ? 0.6189 0.6677 0.6460 -0.0012 -0.0112 0.0163  747 HOH B O   
4824 O  O   . HOH R .   ? 0.5148 0.5939 0.5531 0.0071  -0.0230 0.0221  748 HOH B O   
4825 O  O   . HOH R .   ? 0.4394 0.3988 0.3853 0.0385  -0.0065 0.0094  749 HOH B O   
4826 O  O   . HOH R .   ? 0.3889 0.3313 0.3473 -0.0051 -0.0175 0.0015  750 HOH B O   
4827 O  O   . HOH R .   ? 0.5237 0.3756 0.3638 0.0489  -0.0108 0.0205  751 HOH B O   
4828 O  O   . HOH R .   ? 0.4651 0.5217 0.5008 0.0132  -0.0114 0.0073  752 HOH B O   
4829 O  O   . HOH R .   ? 0.4526 0.3617 0.3486 0.0511  -0.0042 0.0121  753 HOH B O   
4830 O  O   . HOH R .   ? 0.5053 0.5043 0.5110 0.0103  -0.0087 -0.0045 754 HOH B O   
4831 O  O   . HOH R .   ? 0.6107 0.4301 0.4286 -0.0275 -0.0435 0.0269  755 HOH B O   
4832 O  O   . HOH R .   ? 0.3975 0.4292 0.3694 -0.0706 -0.0392 0.0482  756 HOH B O   
4833 O  O   . HOH R .   ? 0.6887 0.7198 0.7126 0.0165  -0.0067 -0.0031 757 HOH B O   
4834 O  O   . HOH R .   ? 0.4419 0.3164 0.3072 0.0496  -0.0071 0.0143  758 HOH B O   
4835 O  O   . HOH R .   ? 0.4503 0.5073 0.4803 0.0228  -0.0117 0.0099  759 HOH B O   
4836 O  O   . HOH R .   ? 0.3578 0.4302 0.4017 0.0221  -0.0019 0.0014  760 HOH B O   
4837 O  O   . HOH R .   ? 0.4049 0.4691 0.4471 0.0144  -0.0125 0.0054  761 HOH B O   
4838 O  O   . HOH R .   ? 0.4921 0.4809 0.4104 -0.1093 -0.0601 0.0541  762 HOH B O   
4839 O  O   . HOH R .   ? 0.1535 0.1484 0.1532 0.0002  -0.0155 0.0024  763 HOH B O   
4840 O  O   . HOH R .   ? 0.4881 0.5778 0.5221 0.0186  -0.0110 0.0252  764 HOH B O   
4841 O  O   . HOH R .   ? 0.3856 0.4339 0.4093 0.0160  -0.0159 0.0122  765 HOH B O   
4842 O  O   . HOH R .   ? 0.4565 0.4680 0.4373 0.0476  0.0053  0.0011  766 HOH B O   
4843 O  O   . HOH R .   ? 0.4107 0.4804 0.4557 0.0209  -0.0076 0.0040  767 HOH B O   
4844 O  O   . HOH R .   ? 0.4778 0.5819 0.4980 -0.0301 -0.0268 0.0512  768 HOH B O   
4845 O  O   . HOH R .   ? 0.5043 0.2821 0.2910 -0.0247 -0.0338 0.0054  769 HOH B O   
4846 O  O   . HOH R .   ? 0.3436 0.4229 0.3819 0.0080  -0.0036 -0.0056 770 HOH B O   
4847 O  O   . HOH R .   ? 0.3201 0.2083 0.1941 0.0094  -0.0290 0.0280  771 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   140 140 HIS HIS A . n 
A 1 2   TRP 2   141 141 TRP TRP A . n 
A 1 3   ARG 3   142 142 ARG ARG A . n 
A 1 4   TYR 4   143 143 TYR TYR A . n 
A 1 5   GLY 5   144 144 GLY GLY A . n 
A 1 6   GLY 6   145 145 GLY GLY A . n 
A 1 7   ASP 7   146 146 ASP ASP A . n 
A 1 8   PRO 8   147 147 PRO PRO A . n 
A 1 9   PRO 9   148 148 PRO PRO A . n 
A 1 10  TRP 10  149 149 TRP TRP A . n 
A 1 11  PRO 11  150 150 PRO PRO A . n 
A 1 12  ARG 12  151 151 ARG ARG A . n 
A 1 13  VAL 13  152 152 VAL VAL A . n 
A 1 14  SER 14  153 153 SER SER A . n 
A 1 15  PRO 15  154 154 PRO PRO A . n 
A 1 16  ALA 16  155 155 ALA ALA A . n 
A 1 17  CYS 17  156 156 CYS CYS A . n 
A 1 18  ALA 18  157 157 ALA ALA A . n 
A 1 19  GLY 19  158 158 GLY GLY A . n 
A 1 20  ARG 20  159 159 ARG ARG A . n 
A 1 21  PHE 21  160 160 PHE PHE A . n 
A 1 22  GLN 22  161 161 GLN GLN A . n 
A 1 23  SER 23  162 162 SER SER A . n 
A 1 24  PRO 24  163 163 PRO PRO A . n 
A 1 25  VAL 25  164 164 VAL VAL A . n 
A 1 26  ASP 26  165 165 ASP ASP A . n 
A 1 27  ILE 27  166 166 ILE ILE A . n 
A 1 28  ARG 28  167 167 ARG ARG A . n 
A 1 29  PRO 29  168 168 PRO PRO A . n 
A 1 30  GLN 30  169 169 GLN GLN A . n 
A 1 31  LEU 31  170 170 LEU LEU A . n 
A 1 32  ALA 32  171 171 ALA ALA A . n 
A 1 33  ALA 33  172 172 ALA ALA A . n 
A 1 34  PHE 34  173 173 PHE PHE A . n 
A 1 35  SER 35  174 174 SER SER A . n 
A 1 36  PRO 36  175 175 PRO PRO A . n 
A 1 37  ALA 37  176 176 ALA ALA A . n 
A 1 38  LEU 38  177 177 LEU LEU A . n 
A 1 39  ARG 39  178 178 ARG ARG A . n 
A 1 40  PRO 40  179 179 PRO PRO A . n 
A 1 41  LEU 41  180 180 LEU LEU A . n 
A 1 42  GLU 42  181 181 GLU GLU A . n 
A 1 43  LEU 43  182 182 LEU LEU A . n 
A 1 44  SER 44  183 183 SER SER A . n 
A 1 45  GLY 45  184 184 GLY GLY A . n 
A 1 46  PHE 46  185 185 PHE PHE A . n 
A 1 47  GLN 47  186 186 GLN GLN A . n 
A 1 48  LEU 48  187 187 LEU LEU A . n 
A 1 49  PRO 49  188 188 PRO PRO A . n 
A 1 50  PRO 50  189 189 PRO PRO A . n 
A 1 51  LEU 51  190 190 LEU LEU A . n 
A 1 52  PRO 52  191 191 PRO PRO A . n 
A 1 53  GLU 53  192 192 GLU GLU A . n 
A 1 54  LEU 54  193 193 LEU LEU A . n 
A 1 55  ARG 55  194 194 ARG ARG A . n 
A 1 56  LEU 56  195 195 LEU LEU A . n 
A 1 57  ARG 57  196 196 ARG ARG A . n 
A 1 58  ASN 58  197 197 ASN ASN A . n 
A 1 59  ASN 59  198 198 ASN ASN A . n 
A 1 60  GLY 60  199 199 GLY GLY A . n 
A 1 61  HIS 61  200 200 HIS HIS A . n 
A 1 62  SER 62  201 201 SER SER A . n 
A 1 63  VAL 63  202 202 VAL VAL A . n 
A 1 64  GLN 64  203 203 GLN GLN A . n 
A 1 65  LEU 65  204 204 LEU LEU A . n 
A 1 66  THR 66  205 205 THR THR A . n 
A 1 67  LEU 67  206 206 LEU LEU A . n 
A 1 68  PRO 68  207 207 PRO PRO A . n 
A 1 69  PRO 69  208 208 PRO PRO A . n 
A 1 70  GLY 70  209 209 GLY GLY A . n 
A 1 71  LEU 71  210 210 LEU LEU A . n 
A 1 72  GLU 72  211 211 GLU GLU A . n 
A 1 73  MET 73  212 212 MET MET A . n 
A 1 74  LYS 74  213 213 LYS LYS A . n 
A 1 75  LEU 75  214 214 LEU LEU A . n 
A 1 76  GLY 76  215 215 GLY GLY A . n 
A 1 77  PRO 77  216 216 PRO PRO A . n 
A 1 78  GLY 78  217 217 GLY GLY A . n 
A 1 79  ARG 79  218 218 ARG ARG A . n 
A 1 80  GLU 80  219 219 GLU GLU A . n 
A 1 81  TYR 81  220 220 TYR TYR A . n 
A 1 82  ARG 82  221 221 ARG ARG A . n 
A 1 83  ALA 83  222 222 ALA ALA A . n 
A 1 84  LEU 84  223 223 LEU LEU A . n 
A 1 85  GLN 85  224 224 GLN GLN A . n 
A 1 86  LEU 86  225 225 LEU LEU A . n 
A 1 87  HIS 87  226 226 HIS HIS A . n 
A 1 88  LEU 88  227 227 LEU LEU A . n 
A 1 89  HIS 89  228 228 HIS HIS A . n 
A 1 90  TRP 90  229 229 TRP TRP A . n 
A 1 91  GLY 91  230 230 GLY GLY A . n 
A 1 92  ALA 92  231 231 ALA ALA A . n 
A 1 93  ALA 93  232 232 ALA ALA A . n 
A 1 94  GLY 94  233 233 GLY GLY A . n 
A 1 95  ARG 95  234 234 ARG ARG A . n 
A 1 96  PRO 96  235 235 PRO PRO A . n 
A 1 97  GLY 97  236 236 GLY GLY A . n 
A 1 98  SER 98  237 237 SER SER A . n 
A 1 99  GLU 99  238 238 GLU GLU A . n 
A 1 100 HIS 100 239 239 HIS HIS A . n 
A 1 101 THR 101 240 240 THR THR A . n 
A 1 102 VAL 102 241 241 VAL VAL A . n 
A 1 103 GLU 103 242 242 GLU GLU A . n 
A 1 104 GLY 104 243 243 GLY GLY A . n 
A 1 105 HIS 105 244 244 HIS HIS A . n 
A 1 106 ARG 106 245 245 ARG ARG A . n 
A 1 107 PHE 107 246 246 PHE PHE A . n 
A 1 108 PRO 108 247 247 PRO PRO A . n 
A 1 109 ALA 109 248 248 ALA ALA A . n 
A 1 110 GLU 110 249 249 GLU GLU A . n 
A 1 111 ILE 111 250 250 ILE ILE A . n 
A 1 112 HIS 112 251 251 HIS HIS A . n 
A 1 113 VAL 113 252 252 VAL VAL A . n 
A 1 114 VAL 114 253 253 VAL VAL A . n 
A 1 115 HIS 115 254 254 HIS HIS A . n 
A 1 116 LEU 116 255 255 LEU LEU A . n 
A 1 117 SER 117 256 256 SER SER A . n 
A 1 118 THR 118 257 257 THR THR A . n 
A 1 119 LYS 119 258 258 LYS LYS A . n 
A 1 120 TYR 120 259 259 TYR TYR A . n 
A 1 121 ALA 121 260 260 ALA ALA A . n 
A 1 122 ARG 122 261 261 ARG ARG A . n 
A 1 123 VAL 123 262 262 VAL VAL A . n 
A 1 124 ASP 124 263 263 ASP ASP A . n 
A 1 125 GLU 125 264 264 GLU GLU A . n 
A 1 126 ALA 126 265 265 ALA ALA A . n 
A 1 127 LEU 127 266 266 LEU LEU A . n 
A 1 128 GLY 128 267 267 GLY GLY A . n 
A 1 129 ARG 129 268 268 ARG ARG A . n 
A 1 130 PRO 130 269 269 PRO PRO A . n 
A 1 131 GLY 131 270 270 GLY GLY A . n 
A 1 132 GLY 132 271 271 GLY GLY A . n 
A 1 133 LEU 133 272 272 LEU LEU A . n 
A 1 134 ALA 134 273 273 ALA ALA A . n 
A 1 135 VAL 135 274 274 VAL VAL A . n 
A 1 136 LEU 136 275 275 LEU LEU A . n 
A 1 137 ALA 137 276 276 ALA ALA A . n 
A 1 138 ALA 138 277 277 ALA ALA A . n 
A 1 139 PHE 139 278 278 PHE PHE A . n 
A 1 140 LEU 140 279 279 LEU LEU A . n 
A 1 141 GLU 141 280 280 GLU GLU A . n 
A 1 142 GLU 142 281 281 GLU GLU A . n 
A 1 143 GLY 143 282 282 GLY GLY A . n 
A 1 144 PRO 144 283 283 PRO PRO A . n 
A 1 145 GLU 145 284 284 GLU GLU A . n 
A 1 146 GLU 146 285 285 GLU GLU A . n 
A 1 147 ASN 147 286 286 ASN ASN A . n 
A 1 148 SER 148 287 287 SER SER A . n 
A 1 149 ALA 149 288 288 ALA ALA A . n 
A 1 150 TYR 150 289 289 TYR TYR A . n 
A 1 151 GLU 151 290 290 GLU GLU A . n 
A 1 152 GLN 152 291 291 GLN GLN A . n 
A 1 153 LEU 153 292 292 LEU LEU A . n 
A 1 154 LEU 154 293 293 LEU LEU A . n 
A 1 155 SER 155 294 294 SER SER A . n 
A 1 156 ARG 156 295 295 ARG ARG A . n 
A 1 157 LEU 157 296 296 LEU LEU A . n 
A 1 158 GLU 158 297 297 GLU GLU A . n 
A 1 159 GLU 159 298 298 GLU GLU A . n 
A 1 160 ILE 160 299 299 ILE ILE A . n 
A 1 161 ALA 161 300 300 ALA ALA A . n 
A 1 162 GLU 162 301 301 GLU GLU A . n 
A 1 163 GLU 163 302 302 GLU GLU A . n 
A 1 164 GLY 164 303 303 GLY GLY A . n 
A 1 165 SER 165 304 304 SER SER A . n 
A 1 166 GLU 166 305 305 GLU GLU A . n 
A 1 167 THR 167 306 306 THR THR A . n 
A 1 168 GLN 168 307 307 GLN GLN A . n 
A 1 169 VAL 169 308 308 VAL VAL A . n 
A 1 170 PRO 170 309 309 PRO PRO A . n 
A 1 171 GLY 171 310 310 GLY GLY A . n 
A 1 172 LEU 172 311 311 LEU LEU A . n 
A 1 173 ASP 173 312 312 ASP ASP A . n 
A 1 174 ILE 174 313 313 ILE ILE A . n 
A 1 175 SER 175 314 314 SER SER A . n 
A 1 176 ALA 176 315 315 ALA ALA A . n 
A 1 177 LEU 177 316 316 LEU LEU A . n 
A 1 178 LEU 178 317 317 LEU LEU A . n 
A 1 179 PRO 179 318 318 PRO PRO A . n 
A 1 180 SER 180 319 319 SER SER A . n 
A 1 181 ASP 181 320 320 ASP ASP A . n 
A 1 182 PHE 182 321 321 PHE PHE A . n 
A 1 183 SER 183 322 322 SER SER A . n 
A 1 184 ARG 184 323 323 ARG ARG A . n 
A 1 185 TYR 185 324 324 TYR TYR A . n 
A 1 186 PHE 186 325 325 PHE PHE A . n 
A 1 187 GLN 187 326 326 GLN GLN A . n 
A 1 188 TYR 188 327 327 TYR TYR A . n 
A 1 189 GLU 189 328 328 GLU GLU A . n 
A 1 190 GLY 190 329 329 GLY GLY A . n 
A 1 191 SER 191 330 330 SER SER A . n 
A 1 192 LEU 192 331 331 LEU LEU A . n 
A 1 193 THR 193 332 332 THR THR A . n 
A 1 194 THR 194 333 333 THR THR A . n 
A 1 195 PRO 195 334 334 PRO PRO A . n 
A 1 196 PRO 196 335 335 PRO PRO A . n 
A 1 197 CYS 197 336 336 CYS CYS A . n 
A 1 198 ALA 198 337 337 ALA ALA A . n 
A 1 199 GLN 199 338 338 GLN GLN A . n 
A 1 200 GLY 200 339 339 GLY GLY A . n 
A 1 201 VAL 201 340 340 VAL VAL A . n 
A 1 202 ILE 202 341 341 ILE ILE A . n 
A 1 203 TRP 203 342 342 TRP TRP A . n 
A 1 204 THR 204 343 343 THR THR A . n 
A 1 205 VAL 205 344 344 VAL VAL A . n 
A 1 206 PHE 206 345 345 PHE PHE A . n 
A 1 207 ASN 207 346 346 ASN ASN A . n 
A 1 208 GLN 208 347 347 GLN GLN A . n 
A 1 209 THR 209 348 348 THR THR A . n 
A 1 210 VAL 210 349 349 VAL VAL A . n 
A 1 211 SER 211 350 350 SER SER A . n 
A 1 212 LEU 212 351 351 LEU LEU A . n 
A 1 213 SER 213 352 352 SER SER A . n 
A 1 214 ALA 214 353 353 ALA ALA A . n 
A 1 215 LYS 215 354 354 LYS LYS A . n 
A 1 216 GLN 216 355 355 GLN GLN A . n 
A 1 217 LEU 217 356 356 LEU LEU A . n 
A 1 218 HIS 218 357 357 HIS HIS A . n 
A 1 219 THR 219 358 358 THR THR A . n 
A 1 220 LEU 220 359 359 LEU LEU A . n 
A 1 221 SER 221 360 360 SER SER A . n 
A 1 222 ASP 222 361 361 ASP ASP A . n 
A 1 223 THR 223 362 362 THR THR A . n 
A 1 224 LEU 224 363 363 LEU LEU A . n 
A 1 225 TRP 225 364 364 TRP TRP A . n 
A 1 226 GLY 226 365 365 GLY GLY A . n 
A 1 227 PRO 227 366 366 PRO PRO A . n 
A 1 228 GLY 228 367 367 GLY GLY A . n 
A 1 229 ASP 229 368 368 ASP ASP A . n 
A 1 230 SER 230 369 369 SER SER A . n 
A 1 231 ARG 231 370 370 ARG ARG A . n 
A 1 232 LEU 232 371 371 LEU LEU A . n 
A 1 233 GLN 233 372 372 GLN GLN A . n 
A 1 234 LEU 234 373 373 LEU LEU A . n 
A 1 235 ASN 235 374 374 ASN ASN A . n 
A 1 236 PHE 236 375 375 PHE PHE A . n 
A 1 237 ARG 237 376 376 ARG ARG A . n 
A 1 238 ALA 238 377 377 ALA ALA A . n 
A 1 239 THR 239 378 378 THR THR A . n 
A 1 240 GLN 240 379 379 GLN GLN A . n 
A 1 241 PRO 241 380 380 PRO PRO A . n 
A 1 242 LEU 242 381 381 LEU LEU A . n 
A 1 243 ASN 243 382 382 ASN ASN A . n 
A 1 244 GLY 244 383 383 GLY GLY A . n 
A 1 245 ARG 245 384 384 ARG ARG A . n 
A 1 246 VAL 246 385 385 VAL VAL A . n 
A 1 247 ILE 247 386 386 ILE ILE A . n 
A 1 248 GLU 248 387 387 GLU GLU A . n 
A 1 249 ALA 249 388 388 ALA ALA A . n 
A 1 250 SER 250 389 389 SER SER A . n 
A 1 251 PHE 251 390 390 PHE PHE A . n 
A 1 252 PRO 252 391 391 PRO PRO A . n 
A 1 253 ALA 253 392 392 ALA ALA A . n 
A 1 254 GLY 254 393 393 GLY GLY A . n 
A 1 255 VAL 255 394 394 VAL VAL A . n 
A 1 256 ASP 256 395 395 ASP ASP A . n 
A 1 257 SER 257 396 396 SER SER A . n 
A 1 258 SER 258 397 397 SER SER A . n 
A 1 259 PRO 259 398 398 PRO PRO A . n 
A 1 260 ARG 260 399 399 ARG ARG A . n 
B 1 1   HIS 1   140 ?   ?   ?   B . n 
B 1 2   TRP 2   141 141 TRP TRP B . n 
B 1 3   ARG 3   142 142 ARG ARG B . n 
B 1 4   TYR 4   143 143 TYR TYR B . n 
B 1 5   GLY 5   144 144 GLY GLY B . n 
B 1 6   GLY 6   145 145 GLY GLY B . n 
B 1 7   ASP 7   146 146 ASP ASP B . n 
B 1 8   PRO 8   147 147 PRO PRO B . n 
B 1 9   PRO 9   148 148 PRO PRO B . n 
B 1 10  TRP 10  149 149 TRP TRP B . n 
B 1 11  PRO 11  150 150 PRO PRO B . n 
B 1 12  ARG 12  151 151 ARG ARG B . n 
B 1 13  VAL 13  152 152 VAL VAL B . n 
B 1 14  SER 14  153 153 SER SER B . n 
B 1 15  PRO 15  154 154 PRO PRO B . n 
B 1 16  ALA 16  155 155 ALA ALA B . n 
B 1 17  CYS 17  156 156 CYS CYS B . n 
B 1 18  ALA 18  157 157 ALA ALA B . n 
B 1 19  GLY 19  158 158 GLY GLY B . n 
B 1 20  ARG 20  159 159 ARG ARG B . n 
B 1 21  PHE 21  160 160 PHE PHE B . n 
B 1 22  GLN 22  161 161 GLN GLN B . n 
B 1 23  SER 23  162 162 SER SER B . n 
B 1 24  PRO 24  163 163 PRO PRO B . n 
B 1 25  VAL 25  164 164 VAL VAL B . n 
B 1 26  ASP 26  165 165 ASP ASP B . n 
B 1 27  ILE 27  166 166 ILE ILE B . n 
B 1 28  ARG 28  167 167 ARG ARG B . n 
B 1 29  PRO 29  168 168 PRO PRO B . n 
B 1 30  GLN 30  169 169 GLN GLN B . n 
B 1 31  LEU 31  170 170 LEU LEU B . n 
B 1 32  ALA 32  171 171 ALA ALA B . n 
B 1 33  ALA 33  172 172 ALA ALA B . n 
B 1 34  PHE 34  173 173 PHE PHE B . n 
B 1 35  SER 35  174 174 SER SER B . n 
B 1 36  PRO 36  175 175 PRO PRO B . n 
B 1 37  ALA 37  176 176 ALA ALA B . n 
B 1 38  LEU 38  177 177 LEU LEU B . n 
B 1 39  ARG 39  178 178 ARG ARG B . n 
B 1 40  PRO 40  179 179 PRO PRO B . n 
B 1 41  LEU 41  180 180 LEU LEU B . n 
B 1 42  GLU 42  181 181 GLU GLU B . n 
B 1 43  LEU 43  182 182 LEU LEU B . n 
B 1 44  SER 44  183 183 SER SER B . n 
B 1 45  GLY 45  184 184 GLY GLY B . n 
B 1 46  PHE 46  185 185 PHE PHE B . n 
B 1 47  GLN 47  186 186 GLN GLN B . n 
B 1 48  LEU 48  187 187 LEU LEU B . n 
B 1 49  PRO 49  188 188 PRO PRO B . n 
B 1 50  PRO 50  189 189 PRO PRO B . n 
B 1 51  LEU 51  190 190 LEU LEU B . n 
B 1 52  PRO 52  191 191 PRO PRO B . n 
B 1 53  GLU 53  192 192 GLU GLU B . n 
B 1 54  LEU 54  193 193 LEU LEU B . n 
B 1 55  ARG 55  194 194 ARG ARG B . n 
B 1 56  LEU 56  195 195 LEU LEU B . n 
B 1 57  ARG 57  196 196 ARG ARG B . n 
B 1 58  ASN 58  197 197 ASN ASN B . n 
B 1 59  ASN 59  198 198 ASN ASN B . n 
B 1 60  GLY 60  199 199 GLY GLY B . n 
B 1 61  HIS 61  200 200 HIS HIS B . n 
B 1 62  SER 62  201 201 SER SER B . n 
B 1 63  VAL 63  202 202 VAL VAL B . n 
B 1 64  GLN 64  203 203 GLN GLN B . n 
B 1 65  LEU 65  204 204 LEU LEU B . n 
B 1 66  THR 66  205 205 THR THR B . n 
B 1 67  LEU 67  206 206 LEU LEU B . n 
B 1 68  PRO 68  207 207 PRO PRO B . n 
B 1 69  PRO 69  208 208 PRO PRO B . n 
B 1 70  GLY 70  209 209 GLY GLY B . n 
B 1 71  LEU 71  210 210 LEU LEU B . n 
B 1 72  GLU 72  211 211 GLU GLU B . n 
B 1 73  MET 73  212 212 MET MET B . n 
B 1 74  LYS 74  213 213 LYS LYS B . n 
B 1 75  LEU 75  214 214 LEU LEU B . n 
B 1 76  GLY 76  215 215 GLY GLY B . n 
B 1 77  PRO 77  216 216 PRO PRO B . n 
B 1 78  GLY 78  217 217 GLY GLY B . n 
B 1 79  ARG 79  218 218 ARG ARG B . n 
B 1 80  GLU 80  219 219 GLU GLU B . n 
B 1 81  TYR 81  220 220 TYR TYR B . n 
B 1 82  ARG 82  221 221 ARG ARG B . n 
B 1 83  ALA 83  222 222 ALA ALA B . n 
B 1 84  LEU 84  223 223 LEU LEU B . n 
B 1 85  GLN 85  224 224 GLN GLN B . n 
B 1 86  LEU 86  225 225 LEU LEU B . n 
B 1 87  HIS 87  226 226 HIS HIS B . n 
B 1 88  LEU 88  227 227 LEU LEU B . n 
B 1 89  HIS 89  228 228 HIS HIS B . n 
B 1 90  TRP 90  229 229 TRP TRP B . n 
B 1 91  GLY 91  230 230 GLY GLY B . n 
B 1 92  ALA 92  231 231 ALA ALA B . n 
B 1 93  ALA 93  232 232 ALA ALA B . n 
B 1 94  GLY 94  233 233 GLY GLY B . n 
B 1 95  ARG 95  234 234 ARG ARG B . n 
B 1 96  PRO 96  235 235 PRO PRO B . n 
B 1 97  GLY 97  236 236 GLY GLY B . n 
B 1 98  SER 98  237 237 SER SER B . n 
B 1 99  GLU 99  238 238 GLU GLU B . n 
B 1 100 HIS 100 239 239 HIS HIS B . n 
B 1 101 THR 101 240 240 THR THR B . n 
B 1 102 VAL 102 241 241 VAL VAL B . n 
B 1 103 GLU 103 242 242 GLU GLU B . n 
B 1 104 GLY 104 243 243 GLY GLY B . n 
B 1 105 HIS 105 244 244 HIS HIS B . n 
B 1 106 ARG 106 245 245 ARG ARG B . n 
B 1 107 PHE 107 246 246 PHE PHE B . n 
B 1 108 PRO 108 247 247 PRO PRO B . n 
B 1 109 ALA 109 248 248 ALA ALA B . n 
B 1 110 GLU 110 249 249 GLU GLU B . n 
B 1 111 ILE 111 250 250 ILE ILE B . n 
B 1 112 HIS 112 251 251 HIS HIS B . n 
B 1 113 VAL 113 252 252 VAL VAL B . n 
B 1 114 VAL 114 253 253 VAL VAL B . n 
B 1 115 HIS 115 254 254 HIS HIS B . n 
B 1 116 LEU 116 255 255 LEU LEU B . n 
B 1 117 SER 117 256 256 SER SER B . n 
B 1 118 THR 118 257 257 THR THR B . n 
B 1 119 LYS 119 258 258 LYS LYS B . n 
B 1 120 TYR 120 259 259 TYR TYR B . n 
B 1 121 ALA 121 260 260 ALA ALA B . n 
B 1 122 ARG 122 261 261 ARG ARG B . n 
B 1 123 VAL 123 262 262 VAL VAL B . n 
B 1 124 ASP 124 263 263 ASP ASP B . n 
B 1 125 GLU 125 264 264 GLU GLU B . n 
B 1 126 ALA 126 265 265 ALA ALA B . n 
B 1 127 LEU 127 266 266 LEU LEU B . n 
B 1 128 GLY 128 267 267 GLY GLY B . n 
B 1 129 ARG 129 268 268 ARG ARG B . n 
B 1 130 PRO 130 269 269 PRO PRO B . n 
B 1 131 GLY 131 270 270 GLY GLY B . n 
B 1 132 GLY 132 271 271 GLY GLY B . n 
B 1 133 LEU 133 272 272 LEU LEU B . n 
B 1 134 ALA 134 273 273 ALA ALA B . n 
B 1 135 VAL 135 274 274 VAL VAL B . n 
B 1 136 LEU 136 275 275 LEU LEU B . n 
B 1 137 ALA 137 276 276 ALA ALA B . n 
B 1 138 ALA 138 277 277 ALA ALA B . n 
B 1 139 PHE 139 278 278 PHE PHE B . n 
B 1 140 LEU 140 279 279 LEU LEU B . n 
B 1 141 GLU 141 280 280 GLU GLU B . n 
B 1 142 GLU 142 281 281 GLU GLU B . n 
B 1 143 GLY 143 282 282 GLY GLY B . n 
B 1 144 PRO 144 283 283 PRO PRO B . n 
B 1 145 GLU 145 284 284 GLU GLU B . n 
B 1 146 GLU 146 285 285 GLU GLU B . n 
B 1 147 ASN 147 286 286 ASN ASN B . n 
B 1 148 SER 148 287 287 SER SER B . n 
B 1 149 ALA 149 288 288 ALA ALA B . n 
B 1 150 TYR 150 289 289 TYR TYR B . n 
B 1 151 GLU 151 290 290 GLU GLU B . n 
B 1 152 GLN 152 291 291 GLN GLN B . n 
B 1 153 LEU 153 292 292 LEU LEU B . n 
B 1 154 LEU 154 293 293 LEU LEU B . n 
B 1 155 SER 155 294 294 SER SER B . n 
B 1 156 ARG 156 295 295 ARG ARG B . n 
B 1 157 LEU 157 296 296 LEU LEU B . n 
B 1 158 GLU 158 297 297 GLU GLU B . n 
B 1 159 GLU 159 298 298 GLU GLU B . n 
B 1 160 ILE 160 299 299 ILE ILE B . n 
B 1 161 ALA 161 300 300 ALA ALA B . n 
B 1 162 GLU 162 301 301 GLU GLU B . n 
B 1 163 GLU 163 302 302 GLU GLU B . n 
B 1 164 GLY 164 303 303 GLY GLY B . n 
B 1 165 SER 165 304 304 SER SER B . n 
B 1 166 GLU 166 305 305 GLU GLU B . n 
B 1 167 THR 167 306 306 THR THR B . n 
B 1 168 GLN 168 307 307 GLN GLN B . n 
B 1 169 VAL 169 308 308 VAL VAL B . n 
B 1 170 PRO 170 309 309 PRO PRO B . n 
B 1 171 GLY 171 310 310 GLY GLY B . n 
B 1 172 LEU 172 311 311 LEU LEU B . n 
B 1 173 ASP 173 312 312 ASP ASP B . n 
B 1 174 ILE 174 313 313 ILE ILE B . n 
B 1 175 SER 175 314 314 SER SER B . n 
B 1 176 ALA 176 315 315 ALA ALA B . n 
B 1 177 LEU 177 316 316 LEU LEU B . n 
B 1 178 LEU 178 317 317 LEU LEU B . n 
B 1 179 PRO 179 318 318 PRO PRO B . n 
B 1 180 SER 180 319 319 SER SER B . n 
B 1 181 ASP 181 320 320 ASP ASP B . n 
B 1 182 PHE 182 321 321 PHE PHE B . n 
B 1 183 SER 183 322 322 SER SER B . n 
B 1 184 ARG 184 323 323 ARG ARG B . n 
B 1 185 TYR 185 324 324 TYR TYR B . n 
B 1 186 PHE 186 325 325 PHE PHE B . n 
B 1 187 GLN 187 326 326 GLN GLN B . n 
B 1 188 TYR 188 327 327 TYR TYR B . n 
B 1 189 GLU 189 328 328 GLU GLU B . n 
B 1 190 GLY 190 329 329 GLY GLY B . n 
B 1 191 SER 191 330 330 SER SER B . n 
B 1 192 LEU 192 331 331 LEU LEU B . n 
B 1 193 THR 193 332 332 THR THR B . n 
B 1 194 THR 194 333 333 THR THR B . n 
B 1 195 PRO 195 334 334 PRO PRO B . n 
B 1 196 PRO 196 335 335 PRO PRO B . n 
B 1 197 CYS 197 336 336 CYS CYS B . n 
B 1 198 ALA 198 337 337 ALA ALA B . n 
B 1 199 GLN 199 338 338 GLN GLN B . n 
B 1 200 GLY 200 339 339 GLY GLY B . n 
B 1 201 VAL 201 340 340 VAL VAL B . n 
B 1 202 ILE 202 341 341 ILE ILE B . n 
B 1 203 TRP 203 342 342 TRP TRP B . n 
B 1 204 THR 204 343 343 THR THR B . n 
B 1 205 VAL 205 344 344 VAL VAL B . n 
B 1 206 PHE 206 345 345 PHE PHE B . n 
B 1 207 ASN 207 346 346 ASN ASN B . n 
B 1 208 GLN 208 347 347 GLN GLN B . n 
B 1 209 THR 209 348 348 THR THR B . n 
B 1 210 VAL 210 349 349 VAL VAL B . n 
B 1 211 SER 211 350 350 SER SER B . n 
B 1 212 LEU 212 351 351 LEU LEU B . n 
B 1 213 SER 213 352 352 SER SER B . n 
B 1 214 ALA 214 353 353 ALA ALA B . n 
B 1 215 LYS 215 354 354 LYS LYS B . n 
B 1 216 GLN 216 355 355 GLN GLN B . n 
B 1 217 LEU 217 356 356 LEU LEU B . n 
B 1 218 HIS 218 357 357 HIS HIS B . n 
B 1 219 THR 219 358 358 THR THR B . n 
B 1 220 LEU 220 359 359 LEU LEU B . n 
B 1 221 SER 221 360 360 SER SER B . n 
B 1 222 ASP 222 361 361 ASP ASP B . n 
B 1 223 THR 223 362 362 THR THR B . n 
B 1 224 LEU 224 363 363 LEU LEU B . n 
B 1 225 TRP 225 364 364 TRP TRP B . n 
B 1 226 GLY 226 365 365 GLY GLY B . n 
B 1 227 PRO 227 366 366 PRO PRO B . n 
B 1 228 GLY 228 367 367 GLY GLY B . n 
B 1 229 ASP 229 368 368 ASP ASP B . n 
B 1 230 SER 230 369 369 SER SER B . n 
B 1 231 ARG 231 370 370 ARG ARG B . n 
B 1 232 LEU 232 371 371 LEU LEU B . n 
B 1 233 GLN 233 372 372 GLN GLN B . n 
B 1 234 LEU 234 373 373 LEU LEU B . n 
B 1 235 ASN 235 374 374 ASN ASN B . n 
B 1 236 PHE 236 375 375 PHE PHE B . n 
B 1 237 ARG 237 376 376 ARG ARG B . n 
B 1 238 ALA 238 377 377 ALA ALA B . n 
B 1 239 THR 239 378 378 THR THR B . n 
B 1 240 GLN 240 379 379 GLN GLN B . n 
B 1 241 PRO 241 380 380 PRO PRO B . n 
B 1 242 LEU 242 381 381 LEU LEU B . n 
B 1 243 ASN 243 382 382 ASN ASN B . n 
B 1 244 GLY 244 383 383 GLY GLY B . n 
B 1 245 ARG 245 384 384 ARG ARG B . n 
B 1 246 VAL 246 385 385 VAL VAL B . n 
B 1 247 ILE 247 386 386 ILE ILE B . n 
B 1 248 GLU 248 387 387 GLU GLU B . n 
B 1 249 ALA 249 388 388 ALA ALA B . n 
B 1 250 SER 250 389 389 SER SER B . n 
B 1 251 PHE 251 390 390 PHE PHE B . n 
B 1 252 PRO 252 391 391 PRO PRO B . n 
B 1 253 ALA 253 392 392 ALA ALA B . n 
B 1 254 GLY 254 393 393 GLY GLY B . n 
B 1 255 VAL 255 394 394 VAL VAL B . n 
B 1 256 ASP 256 395 395 ASP ASP B . n 
B 1 257 SER 257 396 ?   ?   ?   B . n 
B 1 258 SER 258 397 ?   ?   ?   B . n 
B 1 259 PRO 259 398 ?   ?   ?   B . n 
B 1 260 ARG 260 399 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   401 262  ZN  ZN  A . 
D 2 ZN  1   402 266  ZN  ZN  A . 
E 3 GOL 1   403 400  GOL GOL A . 
F 3 GOL 1   404 402  GOL GOL A . 
G 3 GOL 1   405 403  GOL GOL A . 
H 4 CL  1   406 2    CL  CL  A . 
I 4 CL  1   407 3    CL  CL  A . 
J 5 TRS 1   408 7002 TRS TRS A . 
K 2 ZN  1   409 265  ZN  ZN  A . 
L 2 ZN  1   401 263  ZN  ZN  B . 
M 3 GOL 1   402 401  GOL GOL B . 
N 3 GOL 1   403 405  GOL GOL B . 
O 3 GOL 1   404 406  GOL GOL B . 
P 4 CL  1   405 1    CL  CL  B . 
Q 6 HOH 1   501 568  HOH HOH A . 
Q 6 HOH 2   502 630  HOH HOH A . 
Q 6 HOH 3   503 265  HOH HOH A . 
Q 6 HOH 4   504 642  HOH HOH A . 
Q 6 HOH 5   505 212  HOH HOH A . 
Q 6 HOH 6   506 523  HOH HOH A . 
Q 6 HOH 7   507 648  HOH HOH A . 
Q 6 HOH 8   508 156  HOH HOH A . 
Q 6 HOH 9   509 358  HOH HOH A . 
Q 6 HOH 10  510 560  HOH HOH A . 
Q 6 HOH 11  511 371  HOH HOH A . 
Q 6 HOH 12  512 205  HOH HOH A . 
Q 6 HOH 13  513 657  HOH HOH A . 
Q 6 HOH 14  514 540  HOH HOH A . 
Q 6 HOH 15  515 267  HOH HOH A . 
Q 6 HOH 16  516 651  HOH HOH A . 
Q 6 HOH 17  517 556  HOH HOH A . 
Q 6 HOH 18  518 315  HOH HOH A . 
Q 6 HOH 19  519 469  HOH HOH A . 
Q 6 HOH 20  520 522  HOH HOH A . 
Q 6 HOH 21  521 96   HOH HOH A . 
Q 6 HOH 22  522 201  HOH HOH A . 
Q 6 HOH 23  523 222  HOH HOH A . 
Q 6 HOH 24  524 415  HOH HOH A . 
Q 6 HOH 25  525 458  HOH HOH A . 
Q 6 HOH 26  526 253  HOH HOH A . 
Q 6 HOH 27  527 500  HOH HOH A . 
Q 6 HOH 28  528 262  HOH HOH A . 
Q 6 HOH 29  529 176  HOH HOH A . 
Q 6 HOH 30  530 545  HOH HOH A . 
Q 6 HOH 31  531 180  HOH HOH A . 
Q 6 HOH 32  532 26   HOH HOH A . 
Q 6 HOH 33  533 350  HOH HOH A . 
Q 6 HOH 34  534 338  HOH HOH A . 
Q 6 HOH 35  535 206  HOH HOH A . 
Q 6 HOH 36  536 610  HOH HOH A . 
Q 6 HOH 37  537 68   HOH HOH A . 
Q 6 HOH 38  538 33   HOH HOH A . 
Q 6 HOH 39  539 534  HOH HOH A . 
Q 6 HOH 40  540 477  HOH HOH A . 
Q 6 HOH 41  541 131  HOH HOH A . 
Q 6 HOH 42  542 449  HOH HOH A . 
Q 6 HOH 43  543 399  HOH HOH A . 
Q 6 HOH 44  544 614  HOH HOH A . 
Q 6 HOH 45  545 234  HOH HOH A . 
Q 6 HOH 46  546 217  HOH HOH A . 
Q 6 HOH 47  547 252  HOH HOH A . 
Q 6 HOH 48  548 543  HOH HOH A . 
Q 6 HOH 49  549 441  HOH HOH A . 
Q 6 HOH 50  550 198  HOH HOH A . 
Q 6 HOH 51  551 557  HOH HOH A . 
Q 6 HOH 52  552 287  HOH HOH A . 
Q 6 HOH 53  553 380  HOH HOH A . 
Q 6 HOH 54  554 292  HOH HOH A . 
Q 6 HOH 55  555 35   HOH HOH A . 
Q 6 HOH 56  556 62   HOH HOH A . 
Q 6 HOH 57  557 306  HOH HOH A . 
Q 6 HOH 58  558 238  HOH HOH A . 
Q 6 HOH 59  559 583  HOH HOH A . 
Q 6 HOH 60  560 178  HOH HOH A . 
Q 6 HOH 61  561 117  HOH HOH A . 
Q 6 HOH 62  562 31   HOH HOH A . 
Q 6 HOH 63  563 488  HOH HOH A . 
Q 6 HOH 64  564 344  HOH HOH A . 
Q 6 HOH 65  565 95   HOH HOH A . 
Q 6 HOH 66  566 551  HOH HOH A . 
Q 6 HOH 67  567 235  HOH HOH A . 
Q 6 HOH 68  568 203  HOH HOH A . 
Q 6 HOH 69  569 499  HOH HOH A . 
Q 6 HOH 70  570 65   HOH HOH A . 
Q 6 HOH 71  571 629  HOH HOH A . 
Q 6 HOH 72  572 191  HOH HOH A . 
Q 6 HOH 73  573 97   HOH HOH A . 
Q 6 HOH 74  574 324  HOH HOH A . 
Q 6 HOH 75  575 612  HOH HOH A . 
Q 6 HOH 76  576 513  HOH HOH A . 
Q 6 HOH 77  577 45   HOH HOH A . 
Q 6 HOH 78  578 81   HOH HOH A . 
Q 6 HOH 79  579 44   HOH HOH A . 
Q 6 HOH 80  580 76   HOH HOH A . 
Q 6 HOH 81  581 591  HOH HOH A . 
Q 6 HOH 82  582 181  HOH HOH A . 
Q 6 HOH 83  583 211  HOH HOH A . 
Q 6 HOH 84  584 232  HOH HOH A . 
Q 6 HOH 85  585 40   HOH HOH A . 
Q 6 HOH 86  586 12   HOH HOH A . 
Q 6 HOH 87  587 430  HOH HOH A . 
Q 6 HOH 88  588 21   HOH HOH A . 
Q 6 HOH 89  589 391  HOH HOH A . 
Q 6 HOH 90  590 347  HOH HOH A . 
Q 6 HOH 91  591 256  HOH HOH A . 
Q 6 HOH 92  592 434  HOH HOH A . 
Q 6 HOH 93  593 400  HOH HOH A . 
Q 6 HOH 94  594 49   HOH HOH A . 
Q 6 HOH 95  595 406  HOH HOH A . 
Q 6 HOH 96  596 259  HOH HOH A . 
Q 6 HOH 97  597 179  HOH HOH A . 
Q 6 HOH 98  598 448  HOH HOH A . 
Q 6 HOH 99  599 422  HOH HOH A . 
Q 6 HOH 100 600 302  HOH HOH A . 
Q 6 HOH 101 601 215  HOH HOH A . 
Q 6 HOH 102 602 20   HOH HOH A . 
Q 6 HOH 103 603 57   HOH HOH A . 
Q 6 HOH 104 604 160  HOH HOH A . 
Q 6 HOH 105 605 593  HOH HOH A . 
Q 6 HOH 106 606 38   HOH HOH A . 
Q 6 HOH 107 607 397  HOH HOH A . 
Q 6 HOH 108 608 83   HOH HOH A . 
Q 6 HOH 109 609 275  HOH HOH A . 
Q 6 HOH 110 610 39   HOH HOH A . 
Q 6 HOH 111 611 600  HOH HOH A . 
Q 6 HOH 112 612 485  HOH HOH A . 
Q 6 HOH 113 613 92   HOH HOH A . 
Q 6 HOH 114 614 157  HOH HOH A . 
Q 6 HOH 115 615 337  HOH HOH A . 
Q 6 HOH 116 616 47   HOH HOH A . 
Q 6 HOH 117 617 343  HOH HOH A . 
Q 6 HOH 118 618 504  HOH HOH A . 
Q 6 HOH 119 619 77   HOH HOH A . 
Q 6 HOH 120 620 32   HOH HOH A . 
Q 6 HOH 121 621 169  HOH HOH A . 
Q 6 HOH 122 622 192  HOH HOH A . 
Q 6 HOH 123 623 527  HOH HOH A . 
Q 6 HOH 124 624 339  HOH HOH A . 
Q 6 HOH 125 625 93   HOH HOH A . 
Q 6 HOH 126 626 114  HOH HOH A . 
Q 6 HOH 127 627 197  HOH HOH A . 
Q 6 HOH 128 628 624  HOH HOH A . 
Q 6 HOH 129 629 100  HOH HOH A . 
Q 6 HOH 130 630 416  HOH HOH A . 
Q 6 HOH 131 631 341  HOH HOH A . 
Q 6 HOH 132 632 535  HOH HOH A . 
Q 6 HOH 133 633 46   HOH HOH A . 
Q 6 HOH 134 634 5    HOH HOH A . 
Q 6 HOH 135 635 84   HOH HOH A . 
Q 6 HOH 136 636 474  HOH HOH A . 
Q 6 HOH 137 637 120  HOH HOH A . 
Q 6 HOH 138 638 116  HOH HOH A . 
Q 6 HOH 139 639 605  HOH HOH A . 
Q 6 HOH 140 640 30   HOH HOH A . 
Q 6 HOH 141 641 88   HOH HOH A . 
Q 6 HOH 142 642 148  HOH HOH A . 
Q 6 HOH 143 643 119  HOH HOH A . 
Q 6 HOH 144 644 10   HOH HOH A . 
Q 6 HOH 145 645 227  HOH HOH A . 
Q 6 HOH 146 646 243  HOH HOH A . 
Q 6 HOH 147 647 121  HOH HOH A . 
Q 6 HOH 148 648 381  HOH HOH A . 
Q 6 HOH 149 649 532  HOH HOH A . 
Q 6 HOH 150 650 647  HOH HOH A . 
Q 6 HOH 151 651 123  HOH HOH A . 
Q 6 HOH 152 652 273  HOH HOH A . 
Q 6 HOH 153 653 281  HOH HOH A . 
Q 6 HOH 154 654 55   HOH HOH A . 
Q 6 HOH 155 655 369  HOH HOH A . 
Q 6 HOH 156 656 99   HOH HOH A . 
Q 6 HOH 157 657 320  HOH HOH A . 
Q 6 HOH 158 658 229  HOH HOH A . 
Q 6 HOH 159 659 159  HOH HOH A . 
Q 6 HOH 160 660 225  HOH HOH A . 
Q 6 HOH 161 661 138  HOH HOH A . 
Q 6 HOH 162 662 6    HOH HOH A . 
Q 6 HOH 163 663 297  HOH HOH A . 
Q 6 HOH 164 664 163  HOH HOH A . 
Q 6 HOH 165 665 312  HOH HOH A . 
Q 6 HOH 166 666 13   HOH HOH A . 
Q 6 HOH 167 667 209  HOH HOH A . 
Q 6 HOH 168 668 79   HOH HOH A . 
Q 6 HOH 169 669 231  HOH HOH A . 
Q 6 HOH 170 670 334  HOH HOH A . 
Q 6 HOH 171 671 276  HOH HOH A . 
Q 6 HOH 172 672 272  HOH HOH A . 
Q 6 HOH 173 673 142  HOH HOH A . 
Q 6 HOH 174 674 536  HOH HOH A . 
Q 6 HOH 175 675 71   HOH HOH A . 
Q 6 HOH 176 676 269  HOH HOH A . 
Q 6 HOH 177 677 183  HOH HOH A . 
Q 6 HOH 178 678 24   HOH HOH A . 
Q 6 HOH 179 679 210  HOH HOH A . 
Q 6 HOH 180 680 214  HOH HOH A . 
Q 6 HOH 181 681 106  HOH HOH A . 
Q 6 HOH 182 682 124  HOH HOH A . 
Q 6 HOH 183 683 113  HOH HOH A . 
Q 6 HOH 184 684 636  HOH HOH A . 
Q 6 HOH 185 685 289  HOH HOH A . 
Q 6 HOH 186 686 34   HOH HOH A . 
Q 6 HOH 187 687 249  HOH HOH A . 
Q 6 HOH 188 688 291  HOH HOH A . 
Q 6 HOH 189 689 619  HOH HOH A . 
Q 6 HOH 190 690 460  HOH HOH A . 
Q 6 HOH 191 691 393  HOH HOH A . 
Q 6 HOH 192 692 356  HOH HOH A . 
Q 6 HOH 193 693 519  HOH HOH A . 
Q 6 HOH 194 694 490  HOH HOH A . 
Q 6 HOH 195 695 89   HOH HOH A . 
Q 6 HOH 196 696 240  HOH HOH A . 
Q 6 HOH 197 697 23   HOH HOH A . 
Q 6 HOH 198 698 404  HOH HOH A . 
Q 6 HOH 199 699 228  HOH HOH A . 
Q 6 HOH 200 700 193  HOH HOH A . 
Q 6 HOH 201 701 82   HOH HOH A . 
Q 6 HOH 202 702 331  HOH HOH A . 
Q 6 HOH 203 703 439  HOH HOH A . 
Q 6 HOH 204 704 196  HOH HOH A . 
Q 6 HOH 205 705 19   HOH HOH A . 
Q 6 HOH 206 706 368  HOH HOH A . 
Q 6 HOH 207 707 396  HOH HOH A . 
Q 6 HOH 208 708 491  HOH HOH A . 
Q 6 HOH 209 709 632  HOH HOH A . 
Q 6 HOH 210 710 378  HOH HOH A . 
Q 6 HOH 211 711 403  HOH HOH A . 
Q 6 HOH 212 712 376  HOH HOH A . 
Q 6 HOH 213 713 251  HOH HOH A . 
Q 6 HOH 214 714 463  HOH HOH A . 
Q 6 HOH 215 715 309  HOH HOH A . 
Q 6 HOH 216 716 471  HOH HOH A . 
Q 6 HOH 217 717 316  HOH HOH A . 
Q 6 HOH 218 718 261  HOH HOH A . 
Q 6 HOH 219 719 421  HOH HOH A . 
Q 6 HOH 220 720 411  HOH HOH A . 
Q 6 HOH 221 721 277  HOH HOH A . 
Q 6 HOH 222 722 507  HOH HOH A . 
Q 6 HOH 223 723 58   HOH HOH A . 
Q 6 HOH 224 724 283  HOH HOH A . 
Q 6 HOH 225 725 542  HOH HOH A . 
Q 6 HOH 226 726 486  HOH HOH A . 
Q 6 HOH 227 727 174  HOH HOH A . 
Q 6 HOH 228 728 219  HOH HOH A . 
Q 6 HOH 229 729 482  HOH HOH A . 
Q 6 HOH 230 730 330  HOH HOH A . 
Q 6 HOH 231 731 627  HOH HOH A . 
Q 6 HOH 232 732 59   HOH HOH A . 
Q 6 HOH 233 733 14   HOH HOH A . 
Q 6 HOH 234 734 313  HOH HOH A . 
Q 6 HOH 235 735 127  HOH HOH A . 
Q 6 HOH 236 736 506  HOH HOH A . 
Q 6 HOH 237 737 270  HOH HOH A . 
Q 6 HOH 238 738 43   HOH HOH A . 
Q 6 HOH 239 739 213  HOH HOH A . 
Q 6 HOH 240 740 414  HOH HOH A . 
Q 6 HOH 241 741 136  HOH HOH A . 
Q 6 HOH 242 742 187  HOH HOH A . 
Q 6 HOH 243 743 74   HOH HOH A . 
Q 6 HOH 244 744 561  HOH HOH A . 
Q 6 HOH 245 745 633  HOH HOH A . 
Q 6 HOH 246 746 145  HOH HOH A . 
Q 6 HOH 247 747 574  HOH HOH A . 
Q 6 HOH 248 748 144  HOH HOH A . 
Q 6 HOH 249 749 51   HOH HOH A . 
Q 6 HOH 250 750 285  HOH HOH A . 
Q 6 HOH 251 751 398  HOH HOH A . 
Q 6 HOH 252 752 141  HOH HOH A . 
Q 6 HOH 253 753 177  HOH HOH A . 
Q 6 HOH 254 754 505  HOH HOH A . 
Q 6 HOH 255 755 538  HOH HOH A . 
Q 6 HOH 256 756 101  HOH HOH A . 
Q 6 HOH 257 757 94   HOH HOH A . 
Q 6 HOH 258 758 255  HOH HOH A . 
Q 6 HOH 259 759 236  HOH HOH A . 
Q 6 HOH 260 760 437  HOH HOH A . 
Q 6 HOH 261 761 555  HOH HOH A . 
Q 6 HOH 262 762 154  HOH HOH A . 
Q 6 HOH 263 763 611  HOH HOH A . 
Q 6 HOH 264 764 554  HOH HOH A . 
Q 6 HOH 265 765 226  HOH HOH A . 
Q 6 HOH 266 766 200  HOH HOH A . 
Q 6 HOH 267 767 511  HOH HOH A . 
Q 6 HOH 268 768 550  HOH HOH A . 
Q 6 HOH 269 769 29   HOH HOH A . 
Q 6 HOH 270 770 70   HOH HOH A . 
Q 6 HOH 271 771 310  HOH HOH A . 
Q 6 HOH 272 772 167  HOH HOH A . 
Q 6 HOH 273 773 137  HOH HOH A . 
Q 6 HOH 274 774 459  HOH HOH A . 
Q 6 HOH 275 775 321  HOH HOH A . 
Q 6 HOH 276 776 364  HOH HOH A . 
Q 6 HOH 277 777 501  HOH HOH A . 
Q 6 HOH 278 778 479  HOH HOH A . 
Q 6 HOH 279 779 585  HOH HOH A . 
Q 6 HOH 280 780 581  HOH HOH A . 
Q 6 HOH 281 781 357  HOH HOH A . 
Q 6 HOH 282 782 622  HOH HOH A . 
Q 6 HOH 283 783 424  HOH HOH A . 
Q 6 HOH 284 784 374  HOH HOH A . 
Q 6 HOH 285 785 658  HOH HOH A . 
Q 6 HOH 286 786 151  HOH HOH A . 
Q 6 HOH 287 787 653  HOH HOH A . 
Q 6 HOH 288 788 571  HOH HOH A . 
Q 6 HOH 289 789 530  HOH HOH A . 
Q 6 HOH 290 790 615  HOH HOH A . 
Q 6 HOH 291 791 322  HOH HOH A . 
Q 6 HOH 292 792 247  HOH HOH A . 
Q 6 HOH 293 793 447  HOH HOH A . 
Q 6 HOH 294 794 202  HOH HOH A . 
Q 6 HOH 295 795 98   HOH HOH A . 
Q 6 HOH 296 796 155  HOH HOH A . 
Q 6 HOH 297 797 524  HOH HOH A . 
Q 6 HOH 298 798 237  HOH HOH A . 
Q 6 HOH 299 799 386  HOH HOH A . 
Q 6 HOH 300 800 146  HOH HOH A . 
Q 6 HOH 301 801 602  HOH HOH A . 
Q 6 HOH 302 802 649  HOH HOH A . 
Q 6 HOH 303 803 564  HOH HOH A . 
Q 6 HOH 304 804 539  HOH HOH A . 
Q 6 HOH 305 805 590  HOH HOH A . 
Q 6 HOH 306 806 366  HOH HOH A . 
Q 6 HOH 307 807 655  HOH HOH A . 
Q 6 HOH 308 808 569  HOH HOH A . 
Q 6 HOH 309 809 639  HOH HOH A . 
Q 6 HOH 310 810 498  HOH HOH A . 
Q 6 HOH 311 811 164  HOH HOH A . 
Q 6 HOH 312 812 453  HOH HOH A . 
Q 6 HOH 313 813 186  HOH HOH A . 
Q 6 HOH 314 814 643  HOH HOH A . 
Q 6 HOH 315 815 484  HOH HOH A . 
Q 6 HOH 316 816 351  HOH HOH A . 
Q 6 HOH 317 817 420  HOH HOH A . 
Q 6 HOH 318 818 274  HOH HOH A . 
Q 6 HOH 319 819 385  HOH HOH A . 
Q 6 HOH 320 820 442  HOH HOH A . 
Q 6 HOH 321 821 294  HOH HOH A . 
Q 6 HOH 322 822 425  HOH HOH A . 
Q 6 HOH 323 823 207  HOH HOH A . 
Q 6 HOH 324 824 646  HOH HOH A . 
Q 6 HOH 325 825 370  HOH HOH A . 
Q 6 HOH 326 826 616  HOH HOH A . 
Q 6 HOH 327 827 435  HOH HOH A . 
Q 6 HOH 328 828 445  HOH HOH A . 
Q 6 HOH 329 829 520  HOH HOH A . 
Q 6 HOH 330 830 279  HOH HOH A . 
Q 6 HOH 331 831 363  HOH HOH A . 
Q 6 HOH 332 832 325  HOH HOH A . 
Q 6 HOH 333 833 257  HOH HOH A . 
Q 6 HOH 334 834 328  HOH HOH A . 
Q 6 HOH 335 835 7    HOH HOH A . 
Q 6 HOH 336 836 360  HOH HOH A . 
Q 6 HOH 337 837 640  HOH HOH A . 
Q 6 HOH 338 838 634  HOH HOH A . 
Q 6 HOH 339 839 388  HOH HOH A . 
Q 6 HOH 340 840 517  HOH HOH A . 
Q 6 HOH 341 841 303  HOH HOH A . 
Q 6 HOH 342 842 195  HOH HOH A . 
Q 6 HOH 343 843 336  HOH HOH A . 
Q 6 HOH 344 844 78   HOH HOH A . 
Q 6 HOH 345 845 548  HOH HOH A . 
Q 6 HOH 346 846 384  HOH HOH A . 
Q 6 HOH 347 847 298  HOH HOH A . 
Q 6 HOH 348 848 589  HOH HOH A . 
Q 6 HOH 349 849 419  HOH HOH A . 
Q 6 HOH 350 850 389  HOH HOH A . 
Q 6 HOH 351 851 340  HOH HOH A . 
Q 6 HOH 352 852 417  HOH HOH A . 
Q 6 HOH 353 853 588  HOH HOH A . 
Q 6 HOH 354 854 464  HOH HOH A . 
Q 6 HOH 355 855 654  HOH HOH A . 
R 6 HOH 1   501 644  HOH HOH B . 
R 6 HOH 2   502 487  HOH HOH B . 
R 6 HOH 3   503 635  HOH HOH B . 
R 6 HOH 4   504 473  HOH HOH B . 
R 6 HOH 5   505 573  HOH HOH B . 
R 6 HOH 6   506 508  HOH HOH B . 
R 6 HOH 7   507 290  HOH HOH B . 
R 6 HOH 8   508 129  HOH HOH B . 
R 6 HOH 9   509 436  HOH HOH B . 
R 6 HOH 10  510 526  HOH HOH B . 
R 6 HOH 11  511 327  HOH HOH B . 
R 6 HOH 12  512 563  HOH HOH B . 
R 6 HOH 13  513 455  HOH HOH B . 
R 6 HOH 14  514 620  HOH HOH B . 
R 6 HOH 15  515 603  HOH HOH B . 
R 6 HOH 16  516 601  HOH HOH B . 
R 6 HOH 17  517 433  HOH HOH B . 
R 6 HOH 18  518 518  HOH HOH B . 
R 6 HOH 19  519 512  HOH HOH B . 
R 6 HOH 20  520 423  HOH HOH B . 
R 6 HOH 21  521 478  HOH HOH B . 
R 6 HOH 22  522 17   HOH HOH B . 
R 6 HOH 23  523 409  HOH HOH B . 
R 6 HOH 24  524 584  HOH HOH B . 
R 6 HOH 25  525 402  HOH HOH B . 
R 6 HOH 26  526 143  HOH HOH B . 
R 6 HOH 27  527 537  HOH HOH B . 
R 6 HOH 28  528 465  HOH HOH B . 
R 6 HOH 29  529 489  HOH HOH B . 
R 6 HOH 30  530 150  HOH HOH B . 
R 6 HOH 31  531 110  HOH HOH B . 
R 6 HOH 32  532 153  HOH HOH B . 
R 6 HOH 33  533 349  HOH HOH B . 
R 6 HOH 34  534 503  HOH HOH B . 
R 6 HOH 35  535 25   HOH HOH B . 
R 6 HOH 36  536 241  HOH HOH B . 
R 6 HOH 37  537 475  HOH HOH B . 
R 6 HOH 38  538 42   HOH HOH B . 
R 6 HOH 39  539 438  HOH HOH B . 
R 6 HOH 40  540 412  HOH HOH B . 
R 6 HOH 41  541 52   HOH HOH B . 
R 6 HOH 42  542 452  HOH HOH B . 
R 6 HOH 43  543 248  HOH HOH B . 
R 6 HOH 44  544 73   HOH HOH B . 
R 6 HOH 45  545 495  HOH HOH B . 
R 6 HOH 46  546 260  HOH HOH B . 
R 6 HOH 47  547 617  HOH HOH B . 
R 6 HOH 48  548 230  HOH HOH B . 
R 6 HOH 49  549 162  HOH HOH B . 
R 6 HOH 50  550 509  HOH HOH B . 
R 6 HOH 51  551 443  HOH HOH B . 
R 6 HOH 52  552 204  HOH HOH B . 
R 6 HOH 53  553 650  HOH HOH B . 
R 6 HOH 54  554 170  HOH HOH B . 
R 6 HOH 55  555 254  HOH HOH B . 
R 6 HOH 56  556 451  HOH HOH B . 
R 6 HOH 57  557 494  HOH HOH B . 
R 6 HOH 58  558 446  HOH HOH B . 
R 6 HOH 59  559 317  HOH HOH B . 
R 6 HOH 60  560 135  HOH HOH B . 
R 6 HOH 61  561 190  HOH HOH B . 
R 6 HOH 62  562 37   HOH HOH B . 
R 6 HOH 63  563 224  HOH HOH B . 
R 6 HOH 64  564 220  HOH HOH B . 
R 6 HOH 65  565 533  HOH HOH B . 
R 6 HOH 66  566 80   HOH HOH B . 
R 6 HOH 67  567 15   HOH HOH B . 
R 6 HOH 68  568 413  HOH HOH B . 
R 6 HOH 69  569 239  HOH HOH B . 
R 6 HOH 70  570 565  HOH HOH B . 
R 6 HOH 71  571 18   HOH HOH B . 
R 6 HOH 72  572 172  HOH HOH B . 
R 6 HOH 73  573 86   HOH HOH B . 
R 6 HOH 74  574 372  HOH HOH B . 
R 6 HOH 75  575 28   HOH HOH B . 
R 6 HOH 76  576 109  HOH HOH B . 
R 6 HOH 77  577 280  HOH HOH B . 
R 6 HOH 78  578 50   HOH HOH B . 
R 6 HOH 79  579 67   HOH HOH B . 
R 6 HOH 80  580 348  HOH HOH B . 
R 6 HOH 81  581 410  HOH HOH B . 
R 6 HOH 82  582 233  HOH HOH B . 
R 6 HOH 83  583 580  HOH HOH B . 
R 6 HOH 84  584 502  HOH HOH B . 
R 6 HOH 85  585 218  HOH HOH B . 
R 6 HOH 86  586 293  HOH HOH B . 
R 6 HOH 87  587 22   HOH HOH B . 
R 6 HOH 88  588 323  HOH HOH B . 
R 6 HOH 89  589 567  HOH HOH B . 
R 6 HOH 90  590 345  HOH HOH B . 
R 6 HOH 91  591 104  HOH HOH B . 
R 6 HOH 92  592 9    HOH HOH B . 
R 6 HOH 93  593 66   HOH HOH B . 
R 6 HOH 94  594 271  HOH HOH B . 
R 6 HOH 95  595 282  HOH HOH B . 
R 6 HOH 96  596 354  HOH HOH B . 
R 6 HOH 97  597 582  HOH HOH B . 
R 6 HOH 98  598 90   HOH HOH B . 
R 6 HOH 99  599 444  HOH HOH B . 
R 6 HOH 100 600 515  HOH HOH B . 
R 6 HOH 101 601 103  HOH HOH B . 
R 6 HOH 102 602 112  HOH HOH B . 
R 6 HOH 103 603 450  HOH HOH B . 
R 6 HOH 104 604 284  HOH HOH B . 
R 6 HOH 105 605 126  HOH HOH B . 
R 6 HOH 106 606 182  HOH HOH B . 
R 6 HOH 107 607 570  HOH HOH B . 
R 6 HOH 108 608 623  HOH HOH B . 
R 6 HOH 109 609 56   HOH HOH B . 
R 6 HOH 110 610 308  HOH HOH B . 
R 6 HOH 111 611 173  HOH HOH B . 
R 6 HOH 112 612 407  HOH HOH B . 
R 6 HOH 113 613 132  HOH HOH B . 
R 6 HOH 114 614 194  HOH HOH B . 
R 6 HOH 115 615 307  HOH HOH B . 
R 6 HOH 116 616 41   HOH HOH B . 
R 6 HOH 117 617 401  HOH HOH B . 
R 6 HOH 118 618 552  HOH HOH B . 
R 6 HOH 119 619 304  HOH HOH B . 
R 6 HOH 120 620 468  HOH HOH B . 
R 6 HOH 121 621 656  HOH HOH B . 
R 6 HOH 122 622 158  HOH HOH B . 
R 6 HOH 123 623 541  HOH HOH B . 
R 6 HOH 124 624 514  HOH HOH B . 
R 6 HOH 125 625 462  HOH HOH B . 
R 6 HOH 126 626 288  HOH HOH B . 
R 6 HOH 127 627 628  HOH HOH B . 
R 6 HOH 128 628 645  HOH HOH B . 
R 6 HOH 129 629 108  HOH HOH B . 
R 6 HOH 130 630 379  HOH HOH B . 
R 6 HOH 131 631 431  HOH HOH B . 
R 6 HOH 132 632 125  HOH HOH B . 
R 6 HOH 133 633 440  HOH HOH B . 
R 6 HOH 134 634 547  HOH HOH B . 
R 6 HOH 135 635 296  HOH HOH B . 
R 6 HOH 136 636 168  HOH HOH B . 
R 6 HOH 137 637 264  HOH HOH B . 
R 6 HOH 138 638 329  HOH HOH B . 
R 6 HOH 139 639 64   HOH HOH B . 
R 6 HOH 140 640 529  HOH HOH B . 
R 6 HOH 141 641 457  HOH HOH B . 
R 6 HOH 142 642 318  HOH HOH B . 
R 6 HOH 143 643 497  HOH HOH B . 
R 6 HOH 144 644 496  HOH HOH B . 
R 6 HOH 145 645 305  HOH HOH B . 
R 6 HOH 146 646 454  HOH HOH B . 
R 6 HOH 147 647 418  HOH HOH B . 
R 6 HOH 148 648 139  HOH HOH B . 
R 6 HOH 149 649 223  HOH HOH B . 
R 6 HOH 150 650 149  HOH HOH B . 
R 6 HOH 151 651 85   HOH HOH B . 
R 6 HOH 152 652 481  HOH HOH B . 
R 6 HOH 153 653 266  HOH HOH B . 
R 6 HOH 154 654 395  HOH HOH B . 
R 6 HOH 155 655 263  HOH HOH B . 
R 6 HOH 156 656 111  HOH HOH B . 
R 6 HOH 157 657 105  HOH HOH B . 
R 6 HOH 158 658 63   HOH HOH B . 
R 6 HOH 159 659 245  HOH HOH B . 
R 6 HOH 160 660 408  HOH HOH B . 
R 6 HOH 161 661 60   HOH HOH B . 
R 6 HOH 162 662 278  HOH HOH B . 
R 6 HOH 163 663 353  HOH HOH B . 
R 6 HOH 164 664 625  HOH HOH B . 
R 6 HOH 165 665 27   HOH HOH B . 
R 6 HOH 166 666 638  HOH HOH B . 
R 6 HOH 167 667 184  HOH HOH B . 
R 6 HOH 168 668 244  HOH HOH B . 
R 6 HOH 169 669 53   HOH HOH B . 
R 6 HOH 170 670 48   HOH HOH B . 
R 6 HOH 171 671 587  HOH HOH B . 
R 6 HOH 172 672 493  HOH HOH B . 
R 6 HOH 173 673 472  HOH HOH B . 
R 6 HOH 174 674 166  HOH HOH B . 
R 6 HOH 175 675 599  HOH HOH B . 
R 6 HOH 176 676 562  HOH HOH B . 
R 6 HOH 177 677 332  HOH HOH B . 
R 6 HOH 178 678 250  HOH HOH B . 
R 6 HOH 179 679 91   HOH HOH B . 
R 6 HOH 180 680 609  HOH HOH B . 
R 6 HOH 181 681 72   HOH HOH B . 
R 6 HOH 182 682 152  HOH HOH B . 
R 6 HOH 183 683 492  HOH HOH B . 
R 6 HOH 184 684 586  HOH HOH B . 
R 6 HOH 185 685 199  HOH HOH B . 
R 6 HOH 186 686 115  HOH HOH B . 
R 6 HOH 187 687 531  HOH HOH B . 
R 6 HOH 188 688 242  HOH HOH B . 
R 6 HOH 189 689 161  HOH HOH B . 
R 6 HOH 190 690 606  HOH HOH B . 
R 6 HOH 191 691 69   HOH HOH B . 
R 6 HOH 192 692 521  HOH HOH B . 
R 6 HOH 193 693 480  HOH HOH B . 
R 6 HOH 194 694 128  HOH HOH B . 
R 6 HOH 195 695 326  HOH HOH B . 
R 6 HOH 196 696 130  HOH HOH B . 
R 6 HOH 197 697 314  HOH HOH B . 
R 6 HOH 198 698 118  HOH HOH B . 
R 6 HOH 199 699 258  HOH HOH B . 
R 6 HOH 200 700 549  HOH HOH B . 
R 6 HOH 201 701 365  HOH HOH B . 
R 6 HOH 202 702 621  HOH HOH B . 
R 6 HOH 203 703 626  HOH HOH B . 
R 6 HOH 204 704 476  HOH HOH B . 
R 6 HOH 205 705 300  HOH HOH B . 
R 6 HOH 206 706 546  HOH HOH B . 
R 6 HOH 207 707 122  HOH HOH B . 
R 6 HOH 208 708 102  HOH HOH B . 
R 6 HOH 209 709 11   HOH HOH B . 
R 6 HOH 210 710 577  HOH HOH B . 
R 6 HOH 211 711 342  HOH HOH B . 
R 6 HOH 212 712 133  HOH HOH B . 
R 6 HOH 213 713 553  HOH HOH B . 
R 6 HOH 214 714 377  HOH HOH B . 
R 6 HOH 215 715 572  HOH HOH B . 
R 6 HOH 216 716 607  HOH HOH B . 
R 6 HOH 217 717 559  HOH HOH B . 
R 6 HOH 218 718 595  HOH HOH B . 
R 6 HOH 219 719 208  HOH HOH B . 
R 6 HOH 220 720 558  HOH HOH B . 
R 6 HOH 221 721 637  HOH HOH B . 
R 6 HOH 222 722 299  HOH HOH B . 
R 6 HOH 223 723 597  HOH HOH B . 
R 6 HOH 224 724 525  HOH HOH B . 
R 6 HOH 225 725 470  HOH HOH B . 
R 6 HOH 226 726 659  HOH HOH B . 
R 6 HOH 227 727 510  HOH HOH B . 
R 6 HOH 228 728 134  HOH HOH B . 
R 6 HOH 229 729 375  HOH HOH B . 
R 6 HOH 230 730 483  HOH HOH B . 
R 6 HOH 231 731 604  HOH HOH B . 
R 6 HOH 232 732 428  HOH HOH B . 
R 6 HOH 233 733 467  HOH HOH B . 
R 6 HOH 234 734 618  HOH HOH B . 
R 6 HOH 235 735 311  HOH HOH B . 
R 6 HOH 236 736 608  HOH HOH B . 
R 6 HOH 237 737 544  HOH HOH B . 
R 6 HOH 238 738 361  HOH HOH B . 
R 6 HOH 239 739 594  HOH HOH B . 
R 6 HOH 240 740 598  HOH HOH B . 
R 6 HOH 241 741 652  HOH HOH B . 
R 6 HOH 242 742 578  HOH HOH B . 
R 6 HOH 243 743 189  HOH HOH B . 
R 6 HOH 244 744 335  HOH HOH B . 
R 6 HOH 245 745 575  HOH HOH B . 
R 6 HOH 246 746 246  HOH HOH B . 
R 6 HOH 247 747 382  HOH HOH B . 
R 6 HOH 248 748 576  HOH HOH B . 
R 6 HOH 249 749 566  HOH HOH B . 
R 6 HOH 250 750 175  HOH HOH B . 
R 6 HOH 251 751 429  HOH HOH B . 
R 6 HOH 252 752 359  HOH HOH B . 
R 6 HOH 253 753 432  HOH HOH B . 
R 6 HOH 254 754 528  HOH HOH B . 
R 6 HOH 255 755 301  HOH HOH B . 
R 6 HOH 256 756 426  HOH HOH B . 
R 6 HOH 257 757 579  HOH HOH B . 
R 6 HOH 258 758 188  HOH HOH B . 
R 6 HOH 259 759 367  HOH HOH B . 
R 6 HOH 260 760 456  HOH HOH B . 
R 6 HOH 261 761 185  HOH HOH B . 
R 6 HOH 262 762 631  HOH HOH B . 
R 6 HOH 263 763 16   HOH HOH B . 
R 6 HOH 264 764 613  HOH HOH B . 
R 6 HOH 265 765 461  HOH HOH B . 
R 6 HOH 266 766 592  HOH HOH B . 
R 6 HOH 267 767 466  HOH HOH B . 
R 6 HOH 268 768 516  HOH HOH B . 
R 6 HOH 269 769 355  HOH HOH B . 
R 6 HOH 270 770 390  HOH HOH B . 
R 6 HOH 271 771 147  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,J,K,Q 
2 1 B,L,M,N,O,P,R         
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 A A HIS 1   ? A HIS 140 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 N   ? A TRP 2   ? A TRP 141 ? 1_555 96.3  ? 
2  ND1 A A HIS 1   ? A HIS 140 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O   ? A TRP 2   ? A TRP 141 ? 1_555 168.2 ? 
3  N   ? A TRP 2   ? A TRP 141 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 O   ? A TRP 2   ? A TRP 141 ? 1_555 77.7  ? 
4  ND1 A A HIS 1   ? A HIS 140 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 61  ? A HIS 200 ? 1_555 93.4  ? 
5  N   ? A TRP 2   ? A TRP 141 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 61  ? A HIS 200 ? 1_555 147.3 ? 
6  O   ? A TRP 2   ? A TRP 141 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? A HIS 61  ? A HIS 200 ? 1_555 86.8  ? 
7  ND1 A A HIS 1   ? A HIS 140 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? B HIS 105 ? B HIS 244 ? 1_555 136.3 ? 
8  N   ? A TRP 2   ? A TRP 141 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? B HIS 105 ? B HIS 244 ? 1_555 84.5  ? 
9  O   ? A TRP 2   ? A TRP 141 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? B HIS 105 ? B HIS 244 ? 1_555 33.9  ? 
10 NE2 ? A HIS 61  ? A HIS 200 ? 1_555 ZN ? D ZN . ? A ZN 402 ? 1_555 NE2 ? B HIS 105 ? B HIS 244 ? 1_555 67.3  ? 
11 NE2 ? A HIS 87  ? A HIS 226 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 89  ? A HIS 228 ? 1_555 105.0 ? 
12 NE2 ? A HIS 87  ? A HIS 226 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 112 ? A HIS 251 ? 1_555 113.8 ? 
13 NE2 ? A HIS 89  ? A HIS 228 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 112 ? A HIS 251 ? 1_555 97.2  ? 
14 NE2 ? A HIS 87  ? A HIS 226 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 O   ? Q HOH .   ? A HOH 606 ? 1_555 106.5 ? 
15 NE2 ? A HIS 89  ? A HIS 228 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 O   ? Q HOH .   ? A HOH 606 ? 1_555 115.3 ? 
16 ND1 ? A HIS 112 ? A HIS 251 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 O   ? Q HOH .   ? A HOH 606 ? 1_555 118.4 ? 
17 NE2 ? A HIS 105 ? A HIS 244 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 N   ? B TRP 2   ? B TRP 141 ? 1_555 108.0 ? 
18 NE2 ? A HIS 105 ? A HIS 244 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 O   ? B TRP 2   ? B TRP 141 ? 1_555 101.6 ? 
19 N   ? B TRP 2   ? B TRP 141 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 O   ? B TRP 2   ? B TRP 141 ? 1_555 76.8  ? 
20 NE2 ? A HIS 105 ? A HIS 244 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 NE2 ? B HIS 61  ? B HIS 200 ? 1_555 103.8 ? 
21 N   ? B TRP 2   ? B TRP 141 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 NE2 ? B HIS 61  ? B HIS 200 ? 1_555 147.1 ? 
22 O   ? B TRP 2   ? B TRP 141 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 NE2 ? B HIS 61  ? B HIS 200 ? 1_555 88.8  ? 
23 NE2 ? A HIS 105 ? A HIS 244 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 O   ? R HOH .   ? B HOH 671 ? 1_555 91.9  ? 
24 N   ? B TRP 2   ? B TRP 141 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 O   ? R HOH .   ? B HOH 671 ? 1_555 89.8  ? 
25 O   ? B TRP 2   ? B TRP 141 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 O   ? R HOH .   ? B HOH 671 ? 1_555 163.3 ? 
26 NE2 ? B HIS 61  ? B HIS 200 ? 1_555 ZN ? K ZN . ? A ZN 409 ? 1_555 O   ? R HOH .   ? B HOH 671 ? 1_555 97.6  ? 
27 NE2 ? B HIS 87  ? B HIS 226 ? 1_555 ZN ? L ZN . ? B ZN 401 ? 1_555 NE2 ? B HIS 89  ? B HIS 228 ? 1_555 105.5 ? 
28 NE2 ? B HIS 87  ? B HIS 226 ? 1_555 ZN ? L ZN . ? B ZN 401 ? 1_555 ND1 ? B HIS 112 ? B HIS 251 ? 1_555 114.9 ? 
29 NE2 ? B HIS 89  ? B HIS 228 ? 1_555 ZN ? L ZN . ? B ZN 401 ? 1_555 ND1 ? B HIS 112 ? B HIS 251 ? 1_555 98.3  ? 
30 NE2 ? B HIS 87  ? B HIS 226 ? 1_555 ZN ? L ZN . ? B ZN 401 ? 1_555 O   ? R HOH .   ? B HOH 575 ? 1_555 103.9 ? 
31 NE2 ? B HIS 89  ? B HIS 228 ? 1_555 ZN ? L ZN . ? B ZN 401 ? 1_555 O   ? R HOH .   ? B HOH 575 ? 1_555 114.1 ? 
32 ND1 ? B HIS 112 ? B HIS 251 ? 1_555 ZN ? L ZN . ? B ZN 401 ? 1_555 O   ? R HOH .   ? B HOH 575 ? 1_555 119.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-03 
2 'Structure model' 1 1 2016-08-17 
3 'Structure model' 1 2 2016-09-07 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         2.0796 
_pdbx_refine_tls.origin_y         3.4303 
_pdbx_refine_tls.origin_z         -6.2038 
_pdbx_refine_tls.T[1][1]          0.0689 
_pdbx_refine_tls.T[2][2]          0.0632 
_pdbx_refine_tls.T[3][3]          0.0775 
_pdbx_refine_tls.T[1][2]          -0.0000 
_pdbx_refine_tls.T[1][3]          -0.0111 
_pdbx_refine_tls.T[2][3]          -0.0043 
_pdbx_refine_tls.L[1][1]          0.0381 
_pdbx_refine_tls.L[2][2]          0.0295 
_pdbx_refine_tls.L[3][3]          0.7488 
_pdbx_refine_tls.L[1][2]          -0.0120 
_pdbx_refine_tls.L[1][3]          0.0289 
_pdbx_refine_tls.L[2][3]          -0.2685 
_pdbx_refine_tls.S[1][1]          0.0026 
_pdbx_refine_tls.S[1][2]          0.0280 
_pdbx_refine_tls.S[1][3]          0.0043 
_pdbx_refine_tls.S[2][1]          0.0472 
_pdbx_refine_tls.S[2][2]          -0.0303 
_pdbx_refine_tls.S[2][3]          -0.0048 
_pdbx_refine_tls.S[3][1]          -0.1097 
_pdbx_refine_tls.S[3][2]          0.0061 
_pdbx_refine_tls.S[3][3]          -0.0350 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? dev_1839 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .        6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 NH2 A ARG 221 ? ? O   A HOH 501 ? ? 1.25 
2  1 N   A HIS 140 ? ? O   A HOH 502 ? ? 1.58 
3  1 OE1 B GLU 242 ? A O   B HOH 501 ? ? 2.06 
4  1 CD  A ARG 221 ? ? O   A HOH 515 ? ? 2.12 
5  1 OE1 B GLU 192 ? ? O   B HOH 502 ? ? 2.12 
6  1 NH2 A ARG 295 ? A O   A HOH 503 ? ? 2.16 
7  1 NE2 A HIS 140 ? B O   A HOH 504 ? ? 2.17 
8  1 NH2 A ARG 194 ? ? OE2 A GLU 305 ? A 2.17 
9  1 OD2 B ASP 146 ? B O   B HOH 503 ? ? 2.17 
10 1 OE2 A GLU 285 ? ? O   A HOH 505 ? ? 2.18 
11 1 O   B HOH 502 ? ? O   B HOH 684 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A HIS 140 ? A CD2 A HIS 140 ? A 1.456 1.354 0.102  0.009 N 
2 1 CG A HIS 140 ? B CD2 A HIS 140 ? B 1.456 1.354 0.102  0.009 N 
3 1 CG A HIS 140 ? A ND1 A HIS 140 ? A 1.240 1.369 -0.129 0.015 N 
4 1 CG A HIS 140 ? B ND1 A HIS 140 ? B 1.241 1.369 -0.128 0.015 N 
5 1 C  A HIS 140 ? ? O   A HIS 140 ? ? 1.390 1.229 0.161  0.019 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 391 ? ? -75.77 -168.30 
2 1 ALA A 392 ? ? -67.47 -86.13  
3 1 ALA B 232 ? ? -8.64  108.38  
4 1 ALA B 232 ? ? -55.58 108.38  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    140 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   TRP 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    141 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -91.31 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B HIS 140 ? B HIS 1   
2 1 Y 1 B SER 396 ? B SER 257 
3 1 Y 1 B SER 397 ? B SER 258 
4 1 Y 1 B PRO 398 ? B PRO 259 
5 1 Y 1 B ARG 399 ? B ARG 260 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health/National Cancer Institute (NIH/NCI)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           CA165284 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                               ZN  
3 GLYCEROL                                 GOL 
4 'CHLORIDE ION'                           CL  
5 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
6 water                                    HOH 
#