data_5FL6
# 
_entry.id   5FL6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5FL6         
PDBE  EBI-65356    
WWPDB D_1290065356 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 5FL4 unspecified 
;THREE DIMENSIONAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE IX IN COMPLEX WITH 5-(1-NAPHTHALEN-1-YL-1,2,3- TRIAZOL-4-YL)THIOPHENE-2-SULFONAMIDE
;
PDB 5FL5 unspecified 
;THREE DIMENSIONAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE IX IN COMPLEX WITH 5-(1-(4-METHOXYPHENYL)-1H-1,2, 3-TRIAZOL-4-YL)THIOPHENE-2-SULFONAMIDE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5FL6 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-21 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leitans, J.'     1 
'Tars, K.'        2 
'Zalubovskis, R.' 3 
# 
_citation.id                        primary 
_citation.title                     
'An Efficient Expression and Crystallization System of the Cancer Asociated Carbonic Anhydrase Isoform Ix.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            58 
_citation.page_first                9004 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26522624 
_citation.pdbx_database_id_DOI      10.1021/ACS.JMEDCHEM.5B01343 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Leitans, J.'     1 ? 
primary 'Kazaks, A.'      2 ? 
primary 'Balode, A.'      3 ? 
primary 'Ivanova, J.'     4 ? 
primary 'Zalubovskis, R.' 5 ? 
primary 'Supuran, C.T.'   6 ? 
primary 'Tars, K.'        7 ? 
# 
_cell.entry_id           5FL6 
_cell.length_a           153.220 
_cell.length_b           153.220 
_cell.length_c           170.810 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5FL6 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CARBONIC ANHYDRASE IX'                                            28172.684 4    4.2.1.1 YES 
'UNP RESIDUES 137-391' ? 
2 non-polymer syn '5-[1-(4-methylphenyl)-1,2,3-triazol-4-yl]thiophene-2-sulfonamide' 320.390   4    ?       ?   ? ? 
3 non-polymer syn 'ZINC ION'                                                         65.409    4    ?       ?   ? ? 
4 non-polymer syn GLYCEROL                                                           92.094    4    ?       ?   ? ? 
5 non-polymer syn 'ACETIC ACID'                                                      60.052    2    ?       ?   ? ? 
6 water       nat water                                                              18.015    1145 ?       ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CARBONATE DEHYDRATASE IX, CARBONIC ANHYDRASE IX, CA-IX, CAI X, MEMBRANE ANTIGEN MN, P54/58N, RENAL CELL CARCINOMA-ASSOCIATED ANTIGEN G250, RCC-ASSOCIATED ANTIGEN G250, PMW1, CARBONIC ANHYDRASE IX
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMAL
GPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLS
RLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLN
FRATQPLNGRVIEASFP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFSPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMAL
GPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLS
RLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLN
FRATQPLNGRVIEASFP
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   ASP n 
1 4   GLN n 
1 5   SER n 
1 6   HIS n 
1 7   TRP n 
1 8   ARG n 
1 9   TYR n 
1 10  GLY n 
1 11  GLY n 
1 12  ASP n 
1 13  PRO n 
1 14  PRO n 
1 15  TRP n 
1 16  PRO n 
1 17  ARG n 
1 18  VAL n 
1 19  SER n 
1 20  PRO n 
1 21  ALA n 
1 22  CYS n 
1 23  ALA n 
1 24  GLY n 
1 25  ARG n 
1 26  PHE n 
1 27  GLN n 
1 28  SER n 
1 29  PRO n 
1 30  VAL n 
1 31  ASP n 
1 32  ILE n 
1 33  ARG n 
1 34  PRO n 
1 35  GLN n 
1 36  LEU n 
1 37  ALA n 
1 38  ALA n 
1 39  PHE n 
1 40  SER n 
1 41  PRO n 
1 42  ALA n 
1 43  LEU n 
1 44  ARG n 
1 45  PRO n 
1 46  LEU n 
1 47  GLU n 
1 48  LEU n 
1 49  LEU n 
1 50  GLY n 
1 51  PHE n 
1 52  GLN n 
1 53  LEU n 
1 54  PRO n 
1 55  PRO n 
1 56  LEU n 
1 57  PRO n 
1 58  GLU n 
1 59  LEU n 
1 60  ARG n 
1 61  LEU n 
1 62  ARG n 
1 63  ASN n 
1 64  ASN n 
1 65  GLY n 
1 66  HIS n 
1 67  SER n 
1 68  VAL n 
1 69  GLN n 
1 70  LEU n 
1 71  THR n 
1 72  LEU n 
1 73  PRO n 
1 74  PRO n 
1 75  GLY n 
1 76  LEU n 
1 77  GLU n 
1 78  MET n 
1 79  ALA n 
1 80  LEU n 
1 81  GLY n 
1 82  PRO n 
1 83  GLY n 
1 84  ARG n 
1 85  GLU n 
1 86  TYR n 
1 87  ARG n 
1 88  ALA n 
1 89  LEU n 
1 90  GLN n 
1 91  LEU n 
1 92  HIS n 
1 93  LEU n 
1 94  HIS n 
1 95  TRP n 
1 96  GLY n 
1 97  ALA n 
1 98  ALA n 
1 99  GLY n 
1 100 ARG n 
1 101 PRO n 
1 102 GLY n 
1 103 SER n 
1 104 GLU n 
1 105 HIS n 
1 106 THR n 
1 107 VAL n 
1 108 GLU n 
1 109 GLY n 
1 110 HIS n 
1 111 ARG n 
1 112 PHE n 
1 113 PRO n 
1 114 ALA n 
1 115 GLU n 
1 116 ILE n 
1 117 HIS n 
1 118 VAL n 
1 119 VAL n 
1 120 HIS n 
1 121 LEU n 
1 122 SER n 
1 123 THR n 
1 124 ALA n 
1 125 PHE n 
1 126 ALA n 
1 127 ARG n 
1 128 VAL n 
1 129 ASP n 
1 130 GLU n 
1 131 ALA n 
1 132 LEU n 
1 133 GLY n 
1 134 ARG n 
1 135 PRO n 
1 136 GLY n 
1 137 GLY n 
1 138 LEU n 
1 139 ALA n 
1 140 VAL n 
1 141 LEU n 
1 142 ALA n 
1 143 ALA n 
1 144 PHE n 
1 145 LEU n 
1 146 GLU n 
1 147 GLU n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 GLU n 
1 152 ASN n 
1 153 SER n 
1 154 ALA n 
1 155 TYR n 
1 156 GLU n 
1 157 GLN n 
1 158 LEU n 
1 159 LEU n 
1 160 SER n 
1 161 ARG n 
1 162 LEU n 
1 163 GLU n 
1 164 GLU n 
1 165 ILE n 
1 166 ALA n 
1 167 GLU n 
1 168 GLU n 
1 169 GLY n 
1 170 SER n 
1 171 GLU n 
1 172 THR n 
1 173 GLN n 
1 174 VAL n 
1 175 PRO n 
1 176 GLY n 
1 177 LEU n 
1 178 ASP n 
1 179 ILE n 
1 180 SER n 
1 181 ALA n 
1 182 LEU n 
1 183 LEU n 
1 184 PRO n 
1 185 SER n 
1 186 ASP n 
1 187 PHE n 
1 188 SER n 
1 189 ARG n 
1 190 TYR n 
1 191 PHE n 
1 192 GLN n 
1 193 TYR n 
1 194 GLU n 
1 195 GLY n 
1 196 SER n 
1 197 LEU n 
1 198 THR n 
1 199 THR n 
1 200 PRO n 
1 201 PRO n 
1 202 CYS n 
1 203 ALA n 
1 204 GLN n 
1 205 GLY n 
1 206 VAL n 
1 207 ILE n 
1 208 TRP n 
1 209 THR n 
1 210 VAL n 
1 211 PHE n 
1 212 ASN n 
1 213 GLN n 
1 214 THR n 
1 215 VAL n 
1 216 MET n 
1 217 LEU n 
1 218 SER n 
1 219 ALA n 
1 220 LYS n 
1 221 GLN n 
1 222 LEU n 
1 223 HIS n 
1 224 THR n 
1 225 LEU n 
1 226 SER n 
1 227 ASP n 
1 228 THR n 
1 229 LEU n 
1 230 TRP n 
1 231 GLY n 
1 232 PRO n 
1 233 GLY n 
1 234 ASP n 
1 235 SER n 
1 236 ARG n 
1 237 LEU n 
1 238 GLN n 
1 239 LEU n 
1 240 ASN n 
1 241 PHE n 
1 242 ARG n 
1 243 ALA n 
1 244 THR n 
1 245 GLN n 
1 246 PRO n 
1 247 LEU n 
1 248 ASN n 
1 249 GLY n 
1 250 ARG n 
1 251 VAL n 
1 252 ILE n 
1 253 GLU n 
1 254 ALA n 
1 255 SER n 
1 256 PHE n 
1 257 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'KOMAGATAELLA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CAH9_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q16790 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5FL6 A 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
2 1 5FL6 B 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
3 1 5FL6 C 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
4 1 5FL6 D 3 ? 257 ? Q16790 137 ? 391 ? 5 259 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5FL6 GLY A 1  ? UNP Q16790 ?   ?   'expression tag'      3  1  
1 5FL6 PRO A 2  ? UNP Q16790 ?   ?   'expression tag'      4  2  
1 5FL6 SER A 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 3  
2 5FL6 GLY B 1  ? UNP Q16790 ?   ?   'expression tag'      3  4  
2 5FL6 PRO B 2  ? UNP Q16790 ?   ?   'expression tag'      4  5  
2 5FL6 SER B 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 6  
3 5FL6 GLY C 1  ? UNP Q16790 ?   ?   'expression tag'      3  7  
3 5FL6 PRO C 2  ? UNP Q16790 ?   ?   'expression tag'      4  8  
3 5FL6 SER C 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 9  
4 5FL6 GLY D 1  ? UNP Q16790 ?   ?   'expression tag'      3  10 
4 5FL6 PRO D 2  ? UNP Q16790 ?   ?   'expression tag'      4  11 
4 5FL6 SER D 40 ? UNP Q16790 CYS 174 'engineered mutation' 42 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'                                                      ?                               
'C2 H4 O2'         60.052  
ALA 'L-peptide linking' y ALANINE                                                            ?                               
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                           ?                               
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                         ?                               
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                    ?                               
'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                           ?                               
'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                          ?                               
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                    ?                               
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                            ?                               
'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                                                           'GLYCERIN; PROPANE-1,2,3-TRIOL' 
'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                                                          ?                               
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                              ?                               
'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                         ?                               
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                            ?                               
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                             ?                               
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                         ?                               
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                      ?                               
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                            ?                               
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                             ?                               
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                          ?                               
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                         ?                               
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                           ?                               
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                             ?                               
'C5 H11 N O2'      117.146 
Y0R non-polymer         . '5-[1-(4-methylphenyl)-1,2,3-triazol-4-yl]thiophene-2-sulfonamide' ?                               
'C13 H12 N4 O2 S2' 320.390 
ZN  non-polymer         . 'ZINC ION'                                                         ?                               
'Zn 2'             65.409  
# 
_exptl.entry_id          5FL6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.43 
_exptl_crystal.density_percent_sol   64.14 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;1.0 M DI-AMMONIUM HYDROGEN PHOSPHATE, 0.1 M SODIUM ACETATE PH 4.5, PROTEIN 10 MG/ML 5-10 MM INHIBITOR (STOCK SOLUTION WAS 100 MM INHIBITOR DISSOLVED IN 100% DIMETHYL SULFOXIDE) VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 294K
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2015-02-02 
_diffrn_detector.details                MULTILAYER 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             1.10000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5FL6 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.11 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   108977 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.15 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.20 
_reflns.B_iso_Wilson_estimate        23.6 
_reflns.pdbx_redundancy              2.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.06 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.58 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        2.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5FL6 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     103629 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.00 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.17067 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16912 
_refine.ls_R_factor_R_free                       0.20004 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  5344 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.B_iso_mean                               23.692 
_refine.aniso_B[1][1]                            0.08 
_refine.aniso_B[2][2]                            0.08 
_refine.aniso_B[3][3]                            -0.26 
_refine.aniso_B[1][2]                            0.04 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'PDB ENTRY 3IAI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.122 
_refine.pdbx_overall_ESU_R_Free                  0.117 
_refine.overall_SU_ML                            0.097 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.539 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7710 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         120 
_refine_hist.number_atoms_solvent             1145 
_refine_hist.number_atoms_total               8975 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        48.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.019  ? 8064  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 7477  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.702  1.981  ? 11020 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.907  3.000  ? 17175 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.898  5.000  ? 1000  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.037 23.090 ? 356   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       11.847 15.000 ? 1145  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.726 15.000 ? 65    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.077  0.200  ? 1180  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 9185  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1888  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.346  2.192  ? 4014  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.345  2.191  ? 4011  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.218  3.280  ? 5008  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.910  2.427  ? 4050  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.950 
_refine_ls_shell.d_res_low                        2.001 
_refine_ls_shell.number_reflns_R_work             7646 
_refine_ls_shell.R_factor_R_work                  0.262 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.275 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             399 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  5FL6 
_struct.title                     
;Three dimensional structure of human carbonic anhydrase IX in complex with 5-(1-(4-Methylphenyl)-1H-1,2,3-triazol-4-yl)thiophene-2- sulfonamide
;
_struct.pdbx_descriptor           'CARBONIC ANHYDRASE IX (E.C.4.2.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5FL6 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'LYASE, CARBONIC ANHYDRASE IX, CARBONIC ANHYDRASE 9, CA IX, CA 9' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 2 ? 
M N N 3 ? 
N N N 4 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 5 ? 
S N N 6 ? 
T N N 6 ? 
U N N 6 ? 
V N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 14  ? SER A 19  ? PRO A 16  SER A 21  1 ? 6  
HELX_P HELX_P2  2  PRO A 20  ? GLY A 24  ? PRO A 22  GLY A 26  5 ? 5  
HELX_P HELX_P3  3  ARG A 33  ? ALA A 37  ? ARG A 35  ALA A 39  5 ? 5  
HELX_P HELX_P4  4  ARG A 127 ? LEU A 132 ? ARG A 129 LEU A 134 1 ? 6  
HELX_P HELX_P5  5  ASN A 152 ? SER A 160 ? ASN A 154 SER A 162 1 ? 9  
HELX_P HELX_P6  6  ARG A 161 ? ALA A 166 ? ARG A 163 ALA A 168 5 ? 6  
HELX_P HELX_P7  7  ILE A 179 ? LEU A 183 ? ILE A 181 LEU A 185 5 ? 5  
HELX_P HELX_P8  8  SER A 218 ? THR A 228 ? SER A 220 THR A 230 1 ? 11 
HELX_P HELX_P9  9  PRO B 14  ? SER B 19  ? PRO B 16  SER B 21  1 ? 6  
HELX_P HELX_P10 10 PRO B 20  ? GLY B 24  ? PRO B 22  GLY B 26  5 ? 5  
HELX_P HELX_P11 11 ARG B 33  ? ALA B 37  ? ARG B 35  ALA B 39  5 ? 5  
HELX_P HELX_P12 12 ARG B 127 ? LEU B 132 ? ARG B 129 LEU B 134 1 ? 6  
HELX_P HELX_P13 13 ASN B 152 ? SER B 160 ? ASN B 154 SER B 162 1 ? 9  
HELX_P HELX_P14 14 ARG B 161 ? ALA B 166 ? ARG B 163 ALA B 168 5 ? 6  
HELX_P HELX_P15 15 ILE B 179 ? LEU B 183 ? ILE B 181 LEU B 185 5 ? 5  
HELX_P HELX_P16 16 SER B 218 ? THR B 228 ? SER B 220 THR B 230 1 ? 11 
HELX_P HELX_P17 17 PRO C 14  ? SER C 19  ? PRO C 16  SER C 21  1 ? 6  
HELX_P HELX_P18 18 PRO C 20  ? GLY C 24  ? PRO C 22  GLY C 26  5 ? 5  
HELX_P HELX_P19 19 ARG C 33  ? ALA C 37  ? ARG C 35  ALA C 39  5 ? 5  
HELX_P HELX_P20 20 ARG C 127 ? LEU C 132 ? ARG C 129 LEU C 134 1 ? 6  
HELX_P HELX_P21 21 ASN C 152 ? SER C 160 ? ASN C 154 SER C 162 1 ? 9  
HELX_P HELX_P22 22 ARG C 161 ? ALA C 166 ? ARG C 163 ALA C 168 5 ? 6  
HELX_P HELX_P23 23 ILE C 179 ? LEU C 183 ? ILE C 181 LEU C 185 5 ? 5  
HELX_P HELX_P24 24 SER C 218 ? THR C 228 ? SER C 220 THR C 230 1 ? 11 
HELX_P HELX_P25 25 PRO D 14  ? SER D 19  ? PRO D 16  SER D 21  1 ? 6  
HELX_P HELX_P26 26 PRO D 20  ? GLY D 24  ? PRO D 22  GLY D 26  5 ? 5  
HELX_P HELX_P27 27 ARG D 33  ? ALA D 37  ? ARG D 35  ALA D 39  5 ? 5  
HELX_P HELX_P28 28 ARG D 127 ? LEU D 132 ? ARG D 129 LEU D 134 1 ? 6  
HELX_P HELX_P29 29 ASN D 152 ? SER D 160 ? ASN D 154 SER D 162 1 ? 9  
HELX_P HELX_P30 30 ARG D 161 ? ALA D 166 ? ARG D 163 ALA D 168 5 ? 6  
HELX_P HELX_P31 31 ILE D 179 ? LEU D 183 ? ILE D 181 LEU D 185 5 ? 5  
HELX_P HELX_P32 32 SER D 218 ? LEU D 229 ? SER D 220 LEU D 231 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 202 SG  ? ? A CYS 24   A CYS 204  1_555 ? ? ? ? ? ? ? 2.095 ? 
disulf2  disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 202 SG  ? ? B CYS 24   B CYS 204  1_555 ? ? ? ? ? ? ? 2.071 ? 
disulf3  disulf ? ? C CYS 22 SG ? ? ? 1_555 C CYS 202 SG  ? ? C CYS 24   C CYS 204  1_555 ? ? ? ? ? ? ? 2.087 ? 
disulf4  disulf ? ? D CYS 22 SG ? ? ? 1_555 D CYS 202 SG  ? ? D CYS 24   D CYS 204  1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc1  metalc ? ? E Y0R .  N2 ? ? ? 1_555 F ZN  .   ZN  ? ? A Y0R 268  A ZN  1260 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc2  metalc ? ? F ZN  .  ZN ? ? ? 1_555 A HIS 94  NE2 ? ? A ZN  1260 A HIS 96   1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc3  metalc ? ? F ZN  .  ZN ? ? ? 1_555 A HIS 117 ND1 ? ? A ZN  1260 A HIS 119  1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc4  metalc ? ? F ZN  .  ZN ? ? ? 1_555 A HIS 92  NE2 ? ? A ZN  1260 A HIS 94   1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc5  metalc ? ? H Y0R .  S1 ? ? ? 1_555 I ZN  .   ZN  ? ? B Y0R 269  B ZN  1260 1_555 ? ? ? ? ? ? ? 2.959 ? 
metalc6  metalc ? ? H Y0R .  N2 ? ? ? 1_555 I ZN  .   ZN  ? ? B Y0R 269  B ZN  1260 1_555 ? ? ? ? ? ? ? 1.842 ? 
metalc7  metalc ? ? I ZN  .  ZN ? ? ? 1_555 B HIS 92  NE2 ? ? B ZN  1260 B HIS 94   1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc8  metalc ? ? I ZN  .  ZN ? ? ? 1_555 B HIS 94  NE2 ? ? B ZN  1260 B HIS 96   1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc9  metalc ? ? I ZN  .  ZN ? ? ? 1_555 B HIS 117 ND1 ? ? B ZN  1260 B HIS 119  1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc10 metalc ? ? L Y0R .  N2 ? ? ? 1_555 M ZN  .   ZN  ? ? C Y0R 267  C ZN  1260 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc11 metalc ? ? L Y0R .  S1 ? ? ? 1_555 M ZN  .   ZN  ? ? C Y0R 267  C ZN  1260 1_555 ? ? ? ? ? ? ? 2.983 ? 
metalc12 metalc ? ? M ZN  .  ZN ? ? ? 1_555 C HIS 92  NE2 ? ? C ZN  1260 C HIS 94   1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc13 metalc ? ? M ZN  .  ZN ? ? ? 1_555 C HIS 117 ND1 ? ? C ZN  1260 C HIS 119  1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc14 metalc ? ? M ZN  .  ZN ? ? ? 1_555 C HIS 94  NE2 ? ? C ZN  1260 C HIS 96   1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc15 metalc ? ? O Y0R .  N2 ? ? ? 1_555 P ZN  .   ZN  ? ? D Y0R 266  D ZN  1260 1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc16 metalc ? ? O Y0R .  S1 ? ? ? 1_555 P ZN  .   ZN  ? ? D Y0R 266  D ZN  1260 1_555 ? ? ? ? ? ? ? 2.885 ? 
metalc17 metalc ? ? P ZN  .  ZN ? ? ? 1_555 D HIS 94  NE2 ? ? D ZN  1260 D HIS 96   1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc18 metalc ? ? P ZN  .  ZN ? ? ? 1_555 D HIS 117 ND1 ? ? D ZN  1260 D HIS 119  1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc19 metalc ? ? P ZN  .  ZN ? ? ? 1_555 D HIS 92  NE2 ? ? D ZN  1260 D HIS 94   1_555 ? ? ? ? ? ? ? 2.170 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 12  A . ? ASP 14  A PRO 13  A ? PRO 15  A 1 8.16  
2  SER 28  A . ? SER 30  A PRO 29  A ? PRO 31  A 1 -4.22 
3  LEU 56  A . ? LEU 58  A PRO 57  A ? PRO 59  A 1 6.52  
4  PRO 200 A . ? PRO 202 A PRO 201 A ? PRO 203 A 1 8.10  
5  ASP 12  B . ? ASP 14  B PRO 13  B ? PRO 15  B 1 9.29  
6  SER 28  B . ? SER 30  B PRO 29  B ? PRO 31  B 1 0.04  
7  LEU 56  B . ? LEU 58  B PRO 57  B ? PRO 59  B 1 3.60  
8  PRO 200 B . ? PRO 202 B PRO 201 B ? PRO 203 B 1 8.34  
9  ASP 12  C . ? ASP 14  C PRO 13  C ? PRO 15  C 1 4.00  
10 SER 28  C . ? SER 30  C PRO 29  C ? PRO 31  C 1 -0.77 
11 LEU 56  C . ? LEU 58  C PRO 57  C ? PRO 59  C 1 4.77  
12 PRO 200 C . ? PRO 202 C PRO 201 C ? PRO 203 C 1 10.72 
13 ASP 12  D . ? ASP 14  D PRO 13  D ? PRO 15  D 1 0.79  
14 SER 28  D . ? SER 30  D PRO 29  D ? PRO 31  D 1 -0.03 
15 LEU 56  D . ? LEU 58  D PRO 57  D ? PRO 59  D 1 -0.73 
16 PRO 200 D . ? PRO 202 D PRO 201 D ? PRO 203 D 1 6.87  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2  ? 
AB ? 6  ? 
AC ? 9  ? 
AD ? 10 ? 
AE ? 2  ? 
BA ? 2  ? 
BB ? 6  ? 
BC ? 9  ? 
BD ? 10 ? 
BE ? 2  ? 
CA ? 2  ? 
CB ? 6  ? 
CC ? 9  ? 
CD ? 10 ? 
CE ? 2  ? 
DA ? 2  ? 
DB ? 6  ? 
DC ? 9  ? 
DD ? 10 ? 
DE ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2  ? parallel      
AB 1 2  ? parallel      
AB 2 3  ? anti-parallel 
AB 3 4  ? anti-parallel 
AB 4 5  ? parallel      
AB 5 6  ? parallel      
AC 1 2  ? parallel      
AC 2 3  ? anti-parallel 
AC 3 4  ? anti-parallel 
AC 4 5  ? parallel      
AC 5 6  ? anti-parallel 
AC 6 7  ? anti-parallel 
AC 7 8  ? anti-parallel 
AC 8 9  ? parallel      
AD 1 2  ? parallel      
AD 2 3  ? anti-parallel 
AD 3 4  ? anti-parallel 
AD 4 5  ? parallel      
AD 5 6  ? anti-parallel 
AD 6 7  ? anti-parallel 
AD 7 8  ? anti-parallel 
AD 8 9  ? anti-parallel 
AD 9 10 ? anti-parallel 
AE 1 2  ? parallel      
BA 1 2  ? parallel      
BB 1 2  ? parallel      
BB 2 3  ? anti-parallel 
BB 3 4  ? anti-parallel 
BB 4 5  ? parallel      
BB 5 6  ? parallel      
BC 1 2  ? parallel      
BC 2 3  ? anti-parallel 
BC 3 4  ? anti-parallel 
BC 4 5  ? parallel      
BC 5 6  ? anti-parallel 
BC 6 7  ? anti-parallel 
BC 7 8  ? anti-parallel 
BC 8 9  ? parallel      
BD 1 2  ? parallel      
BD 2 3  ? anti-parallel 
BD 3 4  ? anti-parallel 
BD 4 5  ? parallel      
BD 5 6  ? anti-parallel 
BD 6 7  ? anti-parallel 
BD 7 8  ? anti-parallel 
BD 8 9  ? anti-parallel 
BD 9 10 ? anti-parallel 
BE 1 2  ? parallel      
CA 1 2  ? parallel      
CB 1 2  ? parallel      
CB 2 3  ? anti-parallel 
CB 3 4  ? anti-parallel 
CB 4 5  ? parallel      
CB 5 6  ? parallel      
CC 1 2  ? parallel      
CC 2 3  ? anti-parallel 
CC 3 4  ? anti-parallel 
CC 4 5  ? parallel      
CC 5 6  ? anti-parallel 
CC 6 7  ? anti-parallel 
CC 7 8  ? anti-parallel 
CC 8 9  ? parallel      
CD 1 2  ? parallel      
CD 2 3  ? anti-parallel 
CD 3 4  ? anti-parallel 
CD 4 5  ? parallel      
CD 5 6  ? anti-parallel 
CD 6 7  ? anti-parallel 
CD 7 8  ? anti-parallel 
CD 8 9  ? anti-parallel 
CD 9 10 ? anti-parallel 
CE 1 2  ? parallel      
DA 1 2  ? parallel      
DB 1 2  ? parallel      
DB 2 3  ? anti-parallel 
DB 3 4  ? anti-parallel 
DB 4 5  ? parallel      
DB 5 6  ? parallel      
DC 1 2  ? parallel      
DC 2 3  ? anti-parallel 
DC 3 4  ? anti-parallel 
DC 4 5  ? parallel      
DC 5 6  ? anti-parallel 
DC 6 7  ? anti-parallel 
DC 7 8  ? anti-parallel 
DC 8 9  ? parallel      
DD 1 2  ? parallel      
DD 2 3  ? anti-parallel 
DD 3 4  ? anti-parallel 
DD 4 5  ? parallel      
DD 5 6  ? anti-parallel 
DD 6 7  ? anti-parallel 
DD 7 8  ? anti-parallel 
DD 8 9  ? anti-parallel 
DD 9 10 ? anti-parallel 
DE 1 2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ASP A 31  ? ILE A 32  ? ASP A 33  ILE A 34  
AA 2  THR A 106 ? VAL A 107 ? THR A 108 VAL A 109 
AB 1  ALA A 38  ? PHE A 39  ? ALA A 40  PHE A 41  
AB 2  GLU A 253 ? ALA A 254 ? GLU A 255 ALA A 256 
AB 3  TYR A 190 ? GLY A 195 ? TYR A 192 GLY A 197 
AB 4  VAL A 206 ? PHE A 211 ? VAL A 208 PHE A 213 
AB 5  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
AB 6  VAL A 215 ? LEU A 217 ? VAL A 217 LEU A 219 
AC 1  ALA A 38  ? PHE A 39  ? ALA A 40  PHE A 41  
AC 2  GLU A 253 ? ALA A 254 ? GLU A 255 ALA A 256 
AC 3  TYR A 190 ? GLY A 195 ? TYR A 192 GLY A 197 
AC 4  VAL A 206 ? PHE A 211 ? VAL A 208 PHE A 213 
AC 5  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
AC 6  ALA A 114 ? SER A 122 ? ALA A 116 SER A 124 
AC 7  ARG A 84  ? TRP A 95  ? ARG A 86  TRP A 97  
AC 8  GLU A 77  ? GLY A 81  ? GLU A 79  GLY A 83  
AC 9  GLU A 47  ? LEU A 49  ? GLU A 49  LEU A 51  
AD 1  ALA A 38  ? PHE A 39  ? ALA A 40  PHE A 41  
AD 2  GLU A 253 ? ALA A 254 ? GLU A 255 ALA A 256 
AD 3  TYR A 190 ? GLY A 195 ? TYR A 192 GLY A 197 
AD 4  VAL A 206 ? PHE A 211 ? VAL A 208 PHE A 213 
AD 5  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
AD 6  ALA A 114 ? SER A 122 ? ALA A 116 SER A 124 
AD 7  ARG A 84  ? TRP A 95  ? ARG A 86  TRP A 97  
AD 8  VAL A 68  ? THR A 71  ? VAL A 70  THR A 73  
AD 9  LEU A 59  ? ASN A 63  ? LEU A 61  ASN A 65  
AD 10 GLU A 171 ? VAL A 174 ? GLU A 173 VAL A 176 
AE 1  VAL A 215 ? LEU A 217 ? VAL A 217 LEU A 219 
AE 2  LEU A 138 ? GLU A 147 ? LEU A 140 GLU A 149 
BA 1  ASP B 31  ? ILE B 32  ? ASP B 33  ILE B 34  
BA 2  THR B 106 ? VAL B 107 ? THR B 108 VAL B 109 
BB 1  ALA B 38  ? PHE B 39  ? ALA B 40  PHE B 41  
BB 2  GLU B 253 ? ALA B 254 ? GLU B 255 ALA B 256 
BB 3  TYR B 190 ? SER B 196 ? TYR B 192 SER B 198 
BB 4  GLN B 204 ? PHE B 211 ? GLN B 206 PHE B 213 
BB 5  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
BB 6  VAL B 215 ? LEU B 217 ? VAL B 217 LEU B 219 
BC 1  ALA B 38  ? PHE B 39  ? ALA B 40  PHE B 41  
BC 2  GLU B 253 ? ALA B 254 ? GLU B 255 ALA B 256 
BC 3  TYR B 190 ? SER B 196 ? TYR B 192 SER B 198 
BC 4  GLN B 204 ? PHE B 211 ? GLN B 206 PHE B 213 
BC 5  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
BC 6  ALA B 114 ? SER B 122 ? ALA B 116 SER B 124 
BC 7  ARG B 84  ? TRP B 95  ? ARG B 86  TRP B 97  
BC 8  GLU B 77  ? GLY B 81  ? GLU B 79  GLY B 83  
BC 9  GLU B 47  ? LEU B 49  ? GLU B 49  LEU B 51  
BD 1  ALA B 38  ? PHE B 39  ? ALA B 40  PHE B 41  
BD 2  GLU B 253 ? ALA B 254 ? GLU B 255 ALA B 256 
BD 3  TYR B 190 ? SER B 196 ? TYR B 192 SER B 198 
BD 4  GLN B 204 ? PHE B 211 ? GLN B 206 PHE B 213 
BD 5  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
BD 6  ALA B 114 ? SER B 122 ? ALA B 116 SER B 124 
BD 7  ARG B 84  ? TRP B 95  ? ARG B 86  TRP B 97  
BD 8  VAL B 68  ? THR B 71  ? VAL B 70  THR B 73  
BD 9  LEU B 59  ? ASN B 63  ? LEU B 61  ASN B 65  
BD 10 GLU B 171 ? VAL B 174 ? GLU B 173 VAL B 176 
BE 1  VAL B 215 ? LEU B 217 ? VAL B 217 LEU B 219 
BE 2  LEU B 138 ? GLU B 147 ? LEU B 140 GLU B 149 
CA 1  ASP C 31  ? ILE C 32  ? ASP C 33  ILE C 34  
CA 2  THR C 106 ? VAL C 107 ? THR C 108 VAL C 109 
CB 1  ALA C 38  ? PHE C 39  ? ALA C 40  PHE C 41  
CB 2  GLU C 253 ? ALA C 254 ? GLU C 255 ALA C 256 
CB 3  TYR C 190 ? SER C 196 ? TYR C 192 SER C 198 
CB 4  GLN C 204 ? PHE C 211 ? GLN C 206 PHE C 213 
CB 5  LEU C 138 ? GLU C 147 ? LEU C 140 GLU C 149 
CB 6  VAL C 215 ? LEU C 217 ? VAL C 217 LEU C 219 
CC 1  ALA C 38  ? PHE C 39  ? ALA C 40  PHE C 41  
CC 2  GLU C 253 ? ALA C 254 ? GLU C 255 ALA C 256 
CC 3  TYR C 190 ? SER C 196 ? TYR C 192 SER C 198 
CC 4  GLN C 204 ? PHE C 211 ? GLN C 206 PHE C 213 
CC 5  LEU C 138 ? GLU C 147 ? LEU C 140 GLU C 149 
CC 6  ALA C 114 ? SER C 122 ? ALA C 116 SER C 124 
CC 7  ARG C 84  ? TRP C 95  ? ARG C 86  TRP C 97  
CC 8  GLU C 77  ? GLY C 81  ? GLU C 79  GLY C 83  
CC 9  GLU C 47  ? LEU C 49  ? GLU C 49  LEU C 51  
CD 1  ALA C 38  ? PHE C 39  ? ALA C 40  PHE C 41  
CD 2  GLU C 253 ? ALA C 254 ? GLU C 255 ALA C 256 
CD 3  TYR C 190 ? SER C 196 ? TYR C 192 SER C 198 
CD 4  GLN C 204 ? PHE C 211 ? GLN C 206 PHE C 213 
CD 5  LEU C 138 ? GLU C 147 ? LEU C 140 GLU C 149 
CD 6  ALA C 114 ? SER C 122 ? ALA C 116 SER C 124 
CD 7  ARG C 84  ? TRP C 95  ? ARG C 86  TRP C 97  
CD 8  VAL C 68  ? THR C 71  ? VAL C 70  THR C 73  
CD 9  LEU C 59  ? ASN C 63  ? LEU C 61  ASN C 65  
CD 10 GLU C 171 ? VAL C 174 ? GLU C 173 VAL C 176 
CE 1  VAL C 215 ? LEU C 217 ? VAL C 217 LEU C 219 
CE 2  LEU C 138 ? GLU C 147 ? LEU C 140 GLU C 149 
DA 1  ASP D 31  ? ILE D 32  ? ASP D 33  ILE D 34  
DA 2  THR D 106 ? VAL D 107 ? THR D 108 VAL D 109 
DB 1  ALA D 38  ? PHE D 39  ? ALA D 40  PHE D 41  
DB 2  GLU D 253 ? ALA D 254 ? GLU D 255 ALA D 256 
DB 3  TYR D 190 ? SER D 196 ? TYR D 192 SER D 198 
DB 4  GLN D 204 ? PHE D 211 ? GLN D 206 PHE D 213 
DB 5  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
DB 6  VAL D 215 ? LEU D 217 ? VAL D 217 LEU D 219 
DC 1  ALA D 38  ? PHE D 39  ? ALA D 40  PHE D 41  
DC 2  GLU D 253 ? ALA D 254 ? GLU D 255 ALA D 256 
DC 3  TYR D 190 ? SER D 196 ? TYR D 192 SER D 198 
DC 4  GLN D 204 ? PHE D 211 ? GLN D 206 PHE D 213 
DC 5  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
DC 6  ALA D 114 ? SER D 122 ? ALA D 116 SER D 124 
DC 7  ARG D 84  ? TRP D 95  ? ARG D 86  TRP D 97  
DC 8  GLU D 77  ? GLY D 81  ? GLU D 79  GLY D 83  
DC 9  GLU D 47  ? LEU D 49  ? GLU D 49  LEU D 51  
DD 1  ALA D 38  ? PHE D 39  ? ALA D 40  PHE D 41  
DD 2  GLU D 253 ? ALA D 254 ? GLU D 255 ALA D 256 
DD 3  TYR D 190 ? SER D 196 ? TYR D 192 SER D 198 
DD 4  GLN D 204 ? PHE D 211 ? GLN D 206 PHE D 213 
DD 5  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
DD 6  ALA D 114 ? SER D 122 ? ALA D 116 SER D 124 
DD 7  ARG D 84  ? TRP D 95  ? ARG D 86  TRP D 97  
DD 8  VAL D 68  ? THR D 71  ? VAL D 70  THR D 73  
DD 9  LEU D 59  ? ASN D 63  ? LEU D 61  ASN D 65  
DD 10 GLU D 171 ? VAL D 174 ? GLU D 173 VAL D 176 
DE 1  VAL D 215 ? LEU D 217 ? VAL D 217 LEU D 219 
DE 2  LEU D 138 ? GLU D 147 ? LEU D 140 GLU D 149 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2  N ILE A 32  ? N ILE A 34  O THR A 106 ? O THR A 108 
AB 1 2  O ALA A 38  ? O ALA A 40  N ALA A 254 ? N ALA A 256 
AB 2 3  N GLU A 253 ? N GLU A 255 O GLN A 192 ? O GLN A 194 
AB 3 4  N GLY A 195 ? N GLY A 197 O VAL A 206 ? O VAL A 208 
AB 4 5  N ILE A 207 ? N ILE A 209 O LEU A 138 ? O LEU A 140 
AB 5 6  N GLU A 146 ? N GLU A 148 O VAL A 215 ? O VAL A 217 
AC 1 2  O ALA A 38  ? O ALA A 40  N ALA A 254 ? N ALA A 256 
AC 2 3  N GLU A 253 ? N GLU A 255 O GLN A 192 ? O GLN A 194 
AC 3 4  N GLY A 195 ? N GLY A 197 O VAL A 206 ? O VAL A 208 
AC 4 5  N ILE A 207 ? N ILE A 209 O LEU A 138 ? O LEU A 140 
AC 5 6  N LEU A 145 ? N LEU A 147 O ALA A 114 ? O ALA A 116 
AC 6 7  N LEU A 121 ? N LEU A 123 O ARG A 87  ? O ARG A 89  
AC 7 8  N TYR A 86  ? N TYR A 88  O MET A 78  ? O MET A 80  
AC 8 9  N ALA A 79  ? N ALA A 81  O GLU A 47  ? O GLU A 49  
AD 1 2  O ALA A 38  ? O ALA A 40  N ALA A 254 ? N ALA A 256 
AD 2 3  N GLU A 253 ? N GLU A 255 O GLN A 192 ? O GLN A 194 
AD 3 4  N GLY A 195 ? N GLY A 197 O VAL A 206 ? O VAL A 208 
AD 4 5  N ILE A 207 ? N ILE A 209 O LEU A 138 ? O LEU A 140 
AD 5 6  N LEU A 145 ? N LEU A 147 O ALA A 114 ? O ALA A 116 
AD 6 7  N LEU A 121 ? N LEU A 123 O ARG A 87  ? O ARG A 89  
AD 7 8  N LEU A 93  ? N LEU A 95  O VAL A 68  ? O VAL A 70  
AD 8 9  N THR A 71  ? N THR A 73  O ARG A 60  ? O ARG A 62  
AD 9 10 N LEU A 61  ? N LEU A 63  O THR A 172 ? O THR A 174 
AE 1 2  N VAL A 215 ? N VAL A 217 O PHE A 144 ? O PHE A 146 
BA 1 2  N ILE B 32  ? N ILE B 34  O THR B 106 ? O THR B 108 
BB 1 2  O ALA B 38  ? O ALA B 40  N ALA B 254 ? N ALA B 256 
BB 2 3  N GLU B 253 ? N GLU B 255 O GLN B 192 ? O GLN B 194 
BB 3 4  O GLY B 195 ? O GLY B 197 N GLY B 205 ? N GLY B 207 
BB 4 5  N ILE B 207 ? N ILE B 209 O LEU B 138 ? O LEU B 140 
BB 5 6  N GLU B 146 ? N GLU B 148 O VAL B 215 ? O VAL B 217 
BC 1 2  O ALA B 38  ? O ALA B 40  N ALA B 254 ? N ALA B 256 
BC 2 3  N GLU B 253 ? N GLU B 255 O GLN B 192 ? O GLN B 194 
BC 3 4  O GLY B 195 ? O GLY B 197 N GLY B 205 ? N GLY B 207 
BC 4 5  N ILE B 207 ? N ILE B 209 O LEU B 138 ? O LEU B 140 
BC 5 6  N LEU B 145 ? N LEU B 147 O ALA B 114 ? O ALA B 116 
BC 6 7  N LEU B 121 ? N LEU B 123 O ARG B 87  ? O ARG B 89  
BC 7 8  N TYR B 86  ? N TYR B 88  O MET B 78  ? O MET B 80  
BC 8 9  N ALA B 79  ? N ALA B 81  O GLU B 47  ? O GLU B 49  
BD 1 2  O ALA B 38  ? O ALA B 40  N ALA B 254 ? N ALA B 256 
BD 2 3  N GLU B 253 ? N GLU B 255 O GLN B 192 ? O GLN B 194 
BD 3 4  O GLY B 195 ? O GLY B 197 N GLY B 205 ? N GLY B 207 
BD 4 5  N ILE B 207 ? N ILE B 209 O LEU B 138 ? O LEU B 140 
BD 5 6  N LEU B 145 ? N LEU B 147 O ALA B 114 ? O ALA B 116 
BD 6 7  N LEU B 121 ? N LEU B 123 O ARG B 87  ? O ARG B 89  
BD 7 8  N LEU B 93  ? N LEU B 95  O VAL B 68  ? O VAL B 70  
BD 8 9  N THR B 71  ? N THR B 73  O ARG B 60  ? O ARG B 62  
BD 9 10 N LEU B 61  ? N LEU B 63  O THR B 172 ? O THR B 174 
BE 1 2  N VAL B 215 ? N VAL B 217 O PHE B 144 ? O PHE B 146 
CA 1 2  N ILE C 32  ? N ILE C 34  O THR C 106 ? O THR C 108 
CB 1 2  O ALA C 38  ? O ALA C 40  N ALA C 254 ? N ALA C 256 
CB 2 3  N GLU C 253 ? N GLU C 255 O GLN C 192 ? O GLN C 194 
CB 3 4  O GLY C 195 ? O GLY C 197 N GLY C 205 ? N GLY C 207 
CB 4 5  N ILE C 207 ? N ILE C 209 O LEU C 138 ? O LEU C 140 
CB 5 6  N GLU C 146 ? N GLU C 148 O VAL C 215 ? O VAL C 217 
CC 1 2  O ALA C 38  ? O ALA C 40  N ALA C 254 ? N ALA C 256 
CC 2 3  N GLU C 253 ? N GLU C 255 O GLN C 192 ? O GLN C 194 
CC 3 4  O GLY C 195 ? O GLY C 197 N GLY C 205 ? N GLY C 207 
CC 4 5  N ILE C 207 ? N ILE C 209 O LEU C 138 ? O LEU C 140 
CC 5 6  N LEU C 145 ? N LEU C 147 O ALA C 114 ? O ALA C 116 
CC 6 7  N LEU C 121 ? N LEU C 123 O ARG C 87  ? O ARG C 89  
CC 7 8  N TYR C 86  ? N TYR C 88  O MET C 78  ? O MET C 80  
CC 8 9  N ALA C 79  ? N ALA C 81  O GLU C 47  ? O GLU C 49  
CD 1 2  O ALA C 38  ? O ALA C 40  N ALA C 254 ? N ALA C 256 
CD 2 3  N GLU C 253 ? N GLU C 255 O GLN C 192 ? O GLN C 194 
CD 3 4  O GLY C 195 ? O GLY C 197 N GLY C 205 ? N GLY C 207 
CD 4 5  N ILE C 207 ? N ILE C 209 O LEU C 138 ? O LEU C 140 
CD 5 6  N LEU C 145 ? N LEU C 147 O ALA C 114 ? O ALA C 116 
CD 6 7  N LEU C 121 ? N LEU C 123 O ARG C 87  ? O ARG C 89  
CD 7 8  N LEU C 93  ? N LEU C 95  O VAL C 68  ? O VAL C 70  
CD 8 9  N THR C 71  ? N THR C 73  O ARG C 60  ? O ARG C 62  
CD 9 10 N LEU C 61  ? N LEU C 63  O THR C 172 ? O THR C 174 
CE 1 2  N VAL C 215 ? N VAL C 217 O PHE C 144 ? O PHE C 146 
DA 1 2  N ILE D 32  ? N ILE D 34  O THR D 106 ? O THR D 108 
DB 1 2  O ALA D 38  ? O ALA D 40  N ALA D 254 ? N ALA D 256 
DB 2 3  N GLU D 253 ? N GLU D 255 O GLN D 192 ? O GLN D 194 
DB 3 4  O GLY D 195 ? O GLY D 197 N GLY D 205 ? N GLY D 207 
DB 4 5  N ILE D 207 ? N ILE D 209 O LEU D 138 ? O LEU D 140 
DB 5 6  N GLU D 146 ? N GLU D 148 O VAL D 215 ? O VAL D 217 
DC 1 2  O ALA D 38  ? O ALA D 40  N ALA D 254 ? N ALA D 256 
DC 2 3  N GLU D 253 ? N GLU D 255 O GLN D 192 ? O GLN D 194 
DC 3 4  O GLY D 195 ? O GLY D 197 N GLY D 205 ? N GLY D 207 
DC 4 5  N ILE D 207 ? N ILE D 209 O LEU D 138 ? O LEU D 140 
DC 5 6  N LEU D 145 ? N LEU D 147 O ALA D 114 ? O ALA D 116 
DC 6 7  N LEU D 121 ? N LEU D 123 O ARG D 87  ? O ARG D 89  
DC 7 8  N TYR D 86  ? N TYR D 88  O MET D 78  ? O MET D 80  
DC 8 9  N ALA D 79  ? N ALA D 81  O GLU D 47  ? O GLU D 49  
DD 1 2  O ALA D 38  ? O ALA D 40  N ALA D 254 ? N ALA D 256 
DD 2 3  N GLU D 253 ? N GLU D 255 O GLN D 192 ? O GLN D 194 
DD 3 4  O GLY D 195 ? O GLY D 197 N GLY D 205 ? N GLY D 207 
DD 4 5  N ILE D 207 ? N ILE D 209 O LEU D 138 ? O LEU D 140 
DD 5 6  N LEU D 145 ? N LEU D 147 O ALA D 114 ? O ALA D 116 
DD 6 7  N LEU D 121 ? N LEU D 123 O ARG D 87  ? O ARG D 89  
DD 7 8  N LEU D 93  ? N LEU D 95  O VAL D 68  ? O VAL D 70  
DD 8 9  N THR D 71  ? N THR D 73  O ARG D 60  ? O ARG D 62  
DD 9 10 N LEU D 61  ? N LEU D 63  O THR D 172 ? O THR D 174 
DE 1 2  N VAL D 215 ? N VAL D 217 O PHE D 144 ? O PHE D 146 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1260'  
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE Y0R A 268'  
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 1261' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 1260'  
AC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE Y0R B 269'  
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL B 1261' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 1260'  
AC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE Y0R C 267'  
AC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL C 1261' 
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 1260'  
BC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE Y0R D 266'  
BC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL D 1261' 
BC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ACY D 1262' 
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACY B 1263' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  HIS A 92  ? HIS A 94   . ? 1_555 ? 
2   AC1 4  HIS A 94  ? HIS A 96   . ? 1_555 ? 
3   AC1 4  HIS A 117 ? HIS A 119  . ? 1_555 ? 
4   AC1 4  Y0R E .   ? Y0R A 268  . ? 1_555 ? 
5   AC2 11 GLN A 90  ? GLN A 92   . ? 1_555 ? 
6   AC2 11 HIS A 92  ? HIS A 94   . ? 1_555 ? 
7   AC2 11 HIS A 94  ? HIS A 96   . ? 1_555 ? 
8   AC2 11 HIS A 117 ? HIS A 119  . ? 1_555 ? 
9   AC2 11 LEU A 197 ? LEU A 199  . ? 1_555 ? 
10  AC2 11 THR A 198 ? THR A 200  . ? 1_555 ? 
11  AC2 11 THR A 199 ? THR A 201  . ? 1_555 ? 
12  AC2 11 TRP A 208 ? TRP A 210  . ? 1_555 ? 
13  AC2 11 ZN  F .   ? ZN  A 1260 . ? 1_555 ? 
14  AC2 11 GOL G .   ? GOL A 1261 . ? 1_555 ? 
15  AC2 11 HOH S .   ? HOH A 2364 . ? 1_555 ? 
16  AC3 9  ASN A 64  ? ASN A 66   . ? 1_555 ? 
17  AC3 9  HIS A 66  ? HIS A 68   . ? 1_555 ? 
18  AC3 9  SER A 67  ? SER A 69   . ? 1_555 ? 
19  AC3 9  GLN A 69  ? GLN A 71   . ? 1_555 ? 
20  AC3 9  GLN A 90  ? GLN A 92   . ? 1_555 ? 
21  AC3 9  HIS A 92  ? HIS A 94   . ? 1_555 ? 
22  AC3 9  THR A 199 ? THR A 201  . ? 1_555 ? 
23  AC3 9  Y0R E .   ? Y0R A 268  . ? 1_555 ? 
24  AC3 9  HOH S .   ? HOH A 2139 . ? 1_555 ? 
25  AC4 4  HIS B 92  ? HIS B 94   . ? 1_555 ? 
26  AC4 4  HIS B 94  ? HIS B 96   . ? 1_555 ? 
27  AC4 4  HIS B 117 ? HIS B 119  . ? 1_555 ? 
28  AC4 4  Y0R H .   ? Y0R B 269  . ? 1_555 ? 
29  AC5 11 GLN B 90  ? GLN B 92   . ? 1_555 ? 
30  AC5 11 HIS B 92  ? HIS B 94   . ? 1_555 ? 
31  AC5 11 HIS B 94  ? HIS B 96   . ? 1_555 ? 
32  AC5 11 HIS B 117 ? HIS B 119  . ? 1_555 ? 
33  AC5 11 VAL B 128 ? VAL B 130  . ? 1_555 ? 
34  AC5 11 LEU B 197 ? LEU B 199  . ? 1_555 ? 
35  AC5 11 THR B 198 ? THR B 200  . ? 1_555 ? 
36  AC5 11 THR B 199 ? THR B 201  . ? 1_555 ? 
37  AC5 11 TRP B 208 ? TRP B 210  . ? 1_555 ? 
38  AC5 11 ZN  I .   ? ZN  B 1260 . ? 1_555 ? 
39  AC5 11 GOL J .   ? GOL B 1261 . ? 1_555 ? 
40  AC6 9  ASN B 64  ? ASN B 66   . ? 1_555 ? 
41  AC6 9  HIS B 66  ? HIS B 68   . ? 1_555 ? 
42  AC6 9  SER B 67  ? SER B 69   . ? 1_555 ? 
43  AC6 9  GLN B 69  ? GLN B 71   . ? 1_555 ? 
44  AC6 9  GLN B 90  ? GLN B 92   . ? 1_555 ? 
45  AC6 9  HIS B 92  ? HIS B 94   . ? 1_555 ? 
46  AC6 9  Y0R H .   ? Y0R B 269  . ? 1_555 ? 
47  AC6 9  HOH T .   ? HOH B 2004 . ? 1_555 ? 
48  AC6 9  HOH T .   ? HOH B 2273 . ? 1_555 ? 
49  AC7 4  HIS C 92  ? HIS C 94   . ? 1_555 ? 
50  AC7 4  HIS C 94  ? HIS C 96   . ? 1_555 ? 
51  AC7 4  HIS C 117 ? HIS C 119  . ? 1_555 ? 
52  AC7 4  Y0R L .   ? Y0R C 267  . ? 1_555 ? 
53  AC8 14 HOH S .   ? HOH A 2277 . ? 9_444 ? 
54  AC8 14 GLN C 90  ? GLN C 92   . ? 1_555 ? 
55  AC8 14 HIS C 92  ? HIS C 94   . ? 1_555 ? 
56  AC8 14 HIS C 94  ? HIS C 96   . ? 1_555 ? 
57  AC8 14 HIS C 117 ? HIS C 119  . ? 1_555 ? 
58  AC8 14 VAL C 119 ? VAL C 121  . ? 1_555 ? 
59  AC8 14 VAL C 128 ? VAL C 130  . ? 1_555 ? 
60  AC8 14 LEU C 132 ? LEU C 134  . ? 1_555 ? 
61  AC8 14 LEU C 197 ? LEU C 199  . ? 1_555 ? 
62  AC8 14 THR C 198 ? THR C 200  . ? 1_555 ? 
63  AC8 14 THR C 199 ? THR C 201  . ? 1_555 ? 
64  AC8 14 TRP C 208 ? TRP C 210  . ? 1_555 ? 
65  AC8 14 ZN  M .   ? ZN  C 1260 . ? 1_555 ? 
66  AC8 14 HOH U .   ? HOH C 2118 . ? 1_555 ? 
67  AC9 10 ASN C 64  ? ASN C 66   . ? 1_555 ? 
68  AC9 10 HIS C 66  ? HIS C 68   . ? 1_555 ? 
69  AC9 10 SER C 67  ? SER C 69   . ? 1_555 ? 
70  AC9 10 GLN C 69  ? GLN C 71   . ? 1_555 ? 
71  AC9 10 GLN C 90  ? GLN C 92   . ? 1_555 ? 
72  AC9 10 HIS C 92  ? HIS C 94   . ? 1_555 ? 
73  AC9 10 THR C 199 ? THR C 201  . ? 1_555 ? 
74  AC9 10 HOH U .   ? HOH C 2003 . ? 1_555 ? 
75  AC9 10 HOH U .   ? HOH C 2187 . ? 1_555 ? 
76  AC9 10 HOH U .   ? HOH C 2231 . ? 1_555 ? 
77  BC1 4  HIS D 92  ? HIS D 94   . ? 1_555 ? 
78  BC1 4  HIS D 94  ? HIS D 96   . ? 1_555 ? 
79  BC1 4  HIS D 117 ? HIS D 119  . ? 1_555 ? 
80  BC1 4  Y0R O .   ? Y0R D 266  . ? 1_555 ? 
81  BC2 12 GLN D 90  ? GLN D 92   . ? 1_555 ? 
82  BC2 12 HIS D 92  ? HIS D 94   . ? 1_555 ? 
83  BC2 12 HIS D 94  ? HIS D 96   . ? 1_555 ? 
84  BC2 12 HIS D 117 ? HIS D 119  . ? 1_555 ? 
85  BC2 12 VAL D 119 ? VAL D 121  . ? 1_555 ? 
86  BC2 12 VAL D 128 ? VAL D 130  . ? 1_555 ? 
87  BC2 12 LEU D 197 ? LEU D 199  . ? 1_555 ? 
88  BC2 12 THR D 198 ? THR D 200  . ? 1_555 ? 
89  BC2 12 THR D 199 ? THR D 201  . ? 1_555 ? 
90  BC2 12 TRP D 208 ? TRP D 210  . ? 1_555 ? 
91  BC2 12 ZN  P .   ? ZN  D 1260 . ? 1_555 ? 
92  BC2 12 GOL Q .   ? GOL D 1261 . ? 1_555 ? 
93  BC3 8  ASN D 64  ? ASN D 66   . ? 1_555 ? 
94  BC3 8  HIS D 66  ? HIS D 68   . ? 1_555 ? 
95  BC3 8  SER D 67  ? SER D 69   . ? 1_555 ? 
96  BC3 8  GLN D 69  ? GLN D 71   . ? 1_555 ? 
97  BC3 8  GLN D 90  ? GLN D 92   . ? 1_555 ? 
98  BC3 8  HIS D 92  ? HIS D 94   . ? 1_555 ? 
99  BC3 8  Y0R O .   ? Y0R D 266  . ? 1_555 ? 
100 BC3 8  HOH V .   ? HOH D 2005 . ? 1_555 ? 
101 BC4 7  SER B 185 ? SER B 187  . ? 5_455 ? 
102 BC4 7  HOH T .   ? HOH B 2282 . ? 5_455 ? 
103 BC4 7  ARG D 33  ? ARG D 35   . ? 1_555 ? 
104 BC4 7  PRO D 246 ? PRO D 248  . ? 1_555 ? 
105 BC4 7  LEU D 247 ? LEU D 249  . ? 1_555 ? 
106 BC4 7  ASN D 248 ? ASN D 250  . ? 1_555 ? 
107 BC4 7  HOH V .   ? HOH D 2227 . ? 1_555 ? 
108 BC5 4  HOH T .   ? HOH B 2254 . ? 1_555 ? 
109 BC5 4  ARG D 25  ? ARG D 27   . ? 9_444 ? 
110 BC5 4  PHE D 26  ? PHE D 28   . ? 9_444 ? 
111 BC5 4  ASN D 248 ? ASN D 250  . ? 9_444 ? 
# 
_database_PDB_matrix.entry_id          5FL6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5FL6 
_atom_sites.fract_transf_matrix[1][1]   0.006527 
_atom_sites.fract_transf_matrix[1][2]   0.003768 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007536 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005854 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TRP A 1 7   ? -40.452 -8.074  4.164   1.00 37.76 ? 9    TRP A N   1 
ATOM   2    C  CA  . TRP A 1 7   ? -39.643 -9.266  3.752   1.00 35.77 ? 9    TRP A CA  1 
ATOM   3    C  C   . TRP A 1 7   ? -38.653 -9.700  4.847   1.00 35.29 ? 9    TRP A C   1 
ATOM   4    O  O   . TRP A 1 7   ? -38.244 -8.898  5.691   1.00 32.24 ? 9    TRP A O   1 
ATOM   5    C  CB  . TRP A 1 7   ? -38.894 -9.011  2.424   1.00 33.83 ? 9    TRP A CB  1 
ATOM   6    C  CG  . TRP A 1 7   ? -37.753 -8.036  2.559   1.00 31.62 ? 9    TRP A CG  1 
ATOM   7    C  CD1 . TRP A 1 7   ? -37.807 -6.667  2.404   1.00 30.00 ? 9    TRP A CD1 1 
ATOM   8    C  CD2 . TRP A 1 7   ? -36.399 -8.349  2.900   1.00 28.97 ? 9    TRP A CD2 1 
ATOM   9    N  NE1 . TRP A 1 7   ? -36.569 -6.120  2.629   1.00 30.21 ? 9    TRP A NE1 1 
ATOM   10   C  CE2 . TRP A 1 7   ? -35.684 -7.127  2.935   1.00 30.79 ? 9    TRP A CE2 1 
ATOM   11   C  CE3 . TRP A 1 7   ? -35.716 -9.544  3.180   1.00 29.09 ? 9    TRP A CE3 1 
ATOM   12   C  CZ2 . TRP A 1 7   ? -34.314 -7.072  3.236   1.00 29.27 ? 9    TRP A CZ2 1 
ATOM   13   C  CZ3 . TRP A 1 7   ? -34.351 -9.489  3.478   1.00 29.15 ? 9    TRP A CZ3 1 
ATOM   14   C  CH2 . TRP A 1 7   ? -33.670 -8.263  3.505   1.00 28.90 ? 9    TRP A CH2 1 
ATOM   15   N  N   . ARG A 1 8   ? -38.248 -10.965 4.780   1.00 37.82 ? 10   ARG A N   1 
ATOM   16   C  CA  . ARG A 1 8   ? -37.251 -11.537 5.696   1.00 42.75 ? 10   ARG A CA  1 
ATOM   17   C  C   . ARG A 1 8   ? -36.412 -12.636 5.016   1.00 39.25 ? 10   ARG A C   1 
ATOM   18   O  O   . ARG A 1 8   ? -36.780 -13.136 3.951   1.00 37.24 ? 10   ARG A O   1 
ATOM   19   C  CB  . ARG A 1 8   ? -37.954 -12.090 6.948   1.00 48.70 ? 10   ARG A CB  1 
ATOM   20   C  CG  . ARG A 1 8   ? -39.334 -12.689 6.678   1.00 55.46 ? 10   ARG A CG  1 
ATOM   21   C  CD  . ARG A 1 8   ? -39.811 -13.604 7.796   1.00 61.20 ? 10   ARG A CD  1 
ATOM   22   N  NE  . ARG A 1 8   ? -39.035 -14.850 7.846   1.00 68.49 ? 10   ARG A NE  1 
ATOM   23   C  CZ  . ARG A 1 8   ? -39.441 -16.005 8.387   1.00 73.70 ? 10   ARG A CZ  1 
ATOM   24   N  NH1 . ARG A 1 8   ? -40.652 -16.138 8.933   1.00 75.13 ? 10   ARG A NH1 1 
ATOM   25   N  NH2 . ARG A 1 8   ? -38.619 -17.055 8.373   1.00 74.12 ? 10   ARG A NH2 1 
ATOM   26   N  N   . TYR A 1 9   ? -35.279 -12.989 5.620   1.00 35.99 ? 11   TYR A N   1 
ATOM   27   C  CA  . TYR A 1 9   ? -34.562 -14.226 5.258   1.00 36.17 ? 11   TYR A CA  1 
ATOM   28   C  C   . TYR A 1 9   ? -35.206 -15.450 5.923   1.00 37.93 ? 11   TYR A C   1 
ATOM   29   O  O   . TYR A 1 9   ? -35.675 -15.365 7.052   1.00 38.93 ? 11   TYR A O   1 
ATOM   30   C  CB  . TYR A 1 9   ? -33.093 -14.160 5.676   1.00 34.19 ? 11   TYR A CB  1 
ATOM   31   C  CG  . TYR A 1 9   ? -32.291 -13.093 4.963   1.00 32.63 ? 11   TYR A CG  1 
ATOM   32   C  CD1 . TYR A 1 9   ? -31.858 -13.278 3.647   1.00 30.31 ? 11   TYR A CD1 1 
ATOM   33   C  CD2 . TYR A 1 9   ? -31.971 -11.898 5.600   1.00 31.33 ? 11   TYR A CD2 1 
ATOM   34   C  CE1 . TYR A 1 9   ? -31.121 -12.300 2.993   1.00 29.37 ? 11   TYR A CE1 1 
ATOM   35   C  CE2 . TYR A 1 9   ? -31.224 -10.925 4.952   1.00 30.63 ? 11   TYR A CE2 1 
ATOM   36   C  CZ  . TYR A 1 9   ? -30.801 -11.129 3.651   1.00 29.09 ? 11   TYR A CZ  1 
ATOM   37   O  OH  . TYR A 1 9   ? -30.051 -10.155 3.040   1.00 26.43 ? 11   TYR A OH  1 
ATOM   38   N  N   . GLY A 1 10  ? -35.226 -16.578 5.223   1.00 40.55 ? 12   GLY A N   1 
ATOM   39   C  CA  . GLY A 1 10  ? -35.706 -17.838 5.802   1.00 45.67 ? 12   GLY A CA  1 
ATOM   40   C  C   . GLY A 1 10  ? -37.158 -18.223 5.539   1.00 50.28 ? 12   GLY A C   1 
ATOM   41   O  O   . GLY A 1 10  ? -37.480 -19.411 5.591   1.00 55.79 ? 12   GLY A O   1 
ATOM   42   N  N   . GLY A 1 11  ? -38.038 -17.254 5.260   1.00 50.97 ? 13   GLY A N   1 
ATOM   43   C  CA  . GLY A 1 11  ? -39.457 -17.563 5.037   1.00 51.65 ? 13   GLY A CA  1 
ATOM   44   C  C   . GLY A 1 11  ? -40.303 -16.443 4.460   1.00 50.98 ? 13   GLY A C   1 
ATOM   45   O  O   . GLY A 1 11  ? -39.782 -15.446 3.956   1.00 47.97 ? 13   GLY A O   1 
ATOM   46   N  N   . ASP A 1 12  ? -41.622 -16.619 4.554   1.00 48.42 ? 14   ASP A N   1 
ATOM   47   C  CA  . ASP A 1 12  ? -42.592 -15.741 3.899   1.00 46.28 ? 14   ASP A CA  1 
ATOM   48   C  C   . ASP A 1 12  ? -42.529 -14.303 4.425   1.00 44.15 ? 14   ASP A C   1 
ATOM   49   O  O   . ASP A 1 12  ? -42.164 -14.100 5.582   1.00 47.72 ? 14   ASP A O   1 
ATOM   50   C  CB  . ASP A 1 12  ? -44.010 -16.303 4.084   1.00 50.62 ? 14   ASP A CB  1 
ATOM   51   C  CG  . ASP A 1 12  ? -44.242 -17.593 3.304   1.00 54.42 ? 14   ASP A CG  1 
ATOM   52   O  OD1 . ASP A 1 12  ? -43.516 -17.877 2.318   1.00 56.64 ? 14   ASP A OD1 1 
ATOM   53   O  OD2 . ASP A 1 12  ? -45.174 -18.329 3.682   1.00 61.28 ? 14   ASP A OD2 1 
ATOM   54   N  N   . PRO A 1 13  ? -42.912 -13.303 3.624   1.00 41.16 ? 15   PRO A N   1 
ATOM   55   C  CA  . PRO A 1 13  ? -43.565 -13.470 2.301   1.00 41.48 ? 15   PRO A CA  1 
ATOM   56   C  C   . PRO A 1 13  ? -42.606 -13.842 1.152   1.00 40.03 ? 15   PRO A C   1 
ATOM   57   O  O   . PRO A 1 13  ? -41.482 -13.354 1.143   1.00 35.95 ? 15   PRO A O   1 
ATOM   58   C  CB  . PRO A 1 13  ? -44.174 -12.084 2.039   1.00 40.94 ? 15   PRO A CB  1 
ATOM   59   C  CG  . PRO A 1 13  ? -43.319 -11.132 2.817   1.00 41.00 ? 15   PRO A CG  1 
ATOM   60   C  CD  . PRO A 1 13  ? -42.810 -11.883 4.021   1.00 39.43 ? 15   PRO A CD  1 
ATOM   61   N  N   . PRO A 1 14  ? -43.057 -14.680 0.183   1.00 40.21 ? 16   PRO A N   1 
ATOM   62   C  CA  . PRO A 1 14  ? -42.217 -14.907 -1.001  1.00 38.63 ? 16   PRO A CA  1 
ATOM   63   C  C   . PRO A 1 14  ? -41.789 -13.570 -1.613  1.00 35.69 ? 16   PRO A C   1 
ATOM   64   O  O   . PRO A 1 14  ? -42.637 -12.684 -1.830  1.00 34.67 ? 16   PRO A O   1 
ATOM   65   C  CB  . PRO A 1 14  ? -43.137 -15.681 -1.965  1.00 40.75 ? 16   PRO A CB  1 
ATOM   66   C  CG  . PRO A 1 14  ? -44.213 -16.261 -1.106  1.00 41.09 ? 16   PRO A CG  1 
ATOM   67   C  CD  . PRO A 1 14  ? -44.389 -15.303 0.034   1.00 40.38 ? 16   PRO A CD  1 
ATOM   68   N  N   . TRP A 1 15  ? -40.485 -13.422 -1.844  1.00 31.53 ? 17   TRP A N   1 
ATOM   69   C  CA  . TRP A 1 15  ? -39.902 -12.160 -2.347  1.00 30.39 ? 17   TRP A CA  1 
ATOM   70   C  C   . TRP A 1 15  ? -40.517 -11.640 -3.665  1.00 30.27 ? 17   TRP A C   1 
ATOM   71   O  O   . TRP A 1 15  ? -40.689 -10.422 -3.804  1.00 30.38 ? 17   TRP A O   1 
ATOM   72   C  CB  . TRP A 1 15  ? -38.368 -12.294 -2.477  1.00 29.63 ? 17   TRP A CB  1 
ATOM   73   C  CG  . TRP A 1 15  ? -37.636 -12.278 -1.174  1.00 28.57 ? 17   TRP A CG  1 
ATOM   74   C  CD1 . TRP A 1 15  ? -38.163 -12.444 0.087   1.00 28.99 ? 17   TRP A CD1 1 
ATOM   75   C  CD2 . TRP A 1 15  ? -36.231 -12.125 -0.998  1.00 28.50 ? 17   TRP A CD2 1 
ATOM   76   N  NE1 . TRP A 1 15  ? -37.174 -12.389 1.027   1.00 29.48 ? 17   TRP A NE1 1 
ATOM   77   C  CE2 . TRP A 1 15  ? -35.971 -12.195 0.392   1.00 28.85 ? 17   TRP A CE2 1 
ATOM   78   C  CE3 . TRP A 1 15  ? -35.161 -11.926 -1.878  1.00 27.81 ? 17   TRP A CE3 1 
ATOM   79   C  CZ2 . TRP A 1 15  ? -34.676 -12.069 0.924   1.00 27.36 ? 17   TRP A CZ2 1 
ATOM   80   C  CZ3 . TRP A 1 15  ? -33.870 -11.799 -1.345  1.00 26.72 ? 17   TRP A CZ3 1 
ATOM   81   C  CH2 . TRP A 1 15  ? -33.644 -11.874 0.040   1.00 26.92 ? 17   TRP A CH2 1 
ATOM   82   N  N   . PRO A 1 16  ? -40.870 -12.546 -4.623  1.00 31.40 ? 18   PRO A N   1 
ATOM   83   C  CA  . PRO A 1 16  ? -41.587 -12.102 -5.852  1.00 31.45 ? 18   PRO A CA  1 
ATOM   84   C  C   . PRO A 1 16  ? -42.955 -11.449 -5.597  1.00 32.55 ? 18   PRO A C   1 
ATOM   85   O  O   . PRO A 1 16  ? -43.373 -10.615 -6.398  1.00 31.39 ? 18   PRO A O   1 
ATOM   86   C  CB  . PRO A 1 16  ? -41.748 -13.404 -6.667  1.00 30.98 ? 18   PRO A CB  1 
ATOM   87   C  CG  . PRO A 1 16  ? -40.587 -14.222 -6.241  1.00 31.73 ? 18   PRO A CG  1 
ATOM   88   C  CD  . PRO A 1 16  ? -40.463 -13.959 -4.747  1.00 31.26 ? 18   PRO A CD  1 
ATOM   89   N  N   . ARG A 1 17  ? -43.634 -11.824 -4.500  1.00 32.68 ? 19   ARG A N   1 
ATOM   90   C  CA  . ARG A 1 17  ? -44.862 -11.125 -4.066  1.00 34.47 ? 19   ARG A CA  1 
ATOM   91   C  C   . ARG A 1 17  ? -44.510 -9.727  -3.558  1.00 34.31 ? 19   ARG A C   1 
ATOM   92   O  O   . ARG A 1 17  ? -45.264 -8.786  -3.779  1.00 36.53 ? 19   ARG A O   1 
ATOM   93   C  CB  . ARG A 1 17  ? -45.639 -11.920 -2.983  1.00 33.49 ? 19   ARG A CB  1 
ATOM   94   N  N   . VAL A 1 18  ? -43.366 -9.601  -2.883  1.00 33.42 ? 20   VAL A N   1 
ATOM   95   C  CA  . VAL A 1 18  ? -42.886 -8.303  -2.375  1.00 33.83 ? 20   VAL A CA  1 
ATOM   96   C  C   . VAL A 1 18  ? -42.473 -7.411  -3.553  1.00 32.30 ? 20   VAL A C   1 
ATOM   97   O  O   . VAL A 1 18  ? -42.849 -6.251  -3.617  1.00 32.00 ? 20   VAL A O   1 
ATOM   98   C  CB  . VAL A 1 18  ? -41.703 -8.446  -1.364  1.00 34.26 ? 20   VAL A CB  1 
ATOM   99   C  CG1 . VAL A 1 18  ? -41.246 -7.072  -0.876  1.00 34.61 ? 20   VAL A CG1 1 
ATOM   100  C  CG2 . VAL A 1 18  ? -42.090 -9.335  -0.177  1.00 34.91 ? 20   VAL A CG2 1 
ATOM   101  N  N   . SER A 1 19  ? -41.710 -7.972  -4.488  1.00 30.38 ? 21   SER A N   1 
ATOM   102  C  CA  . SER A 1 19  ? -41.290 -7.242  -5.665  1.00 28.54 ? 21   SER A CA  1 
ATOM   103  C  C   . SER A 1 19  ? -41.129 -8.213  -6.833  1.00 26.28 ? 21   SER A C   1 
ATOM   104  O  O   . SER A 1 19  ? -40.323 -9.129  -6.741  1.00 24.14 ? 21   SER A O   1 
ATOM   105  C  CB  . SER A 1 19  ? -39.968 -6.566  -5.347  1.00 29.10 ? 21   SER A CB  1 
ATOM   106  O  OG  . SER A 1 19  ? -39.372 -6.084  -6.533  1.00 32.81 ? 21   SER A OG  1 
ATOM   107  N  N   . PRO A 1 20  ? -41.887 -8.021  -7.941  1.00 28.36 ? 22   PRO A N   1 
ATOM   108  C  CA  . PRO A 1 20  ? -41.715 -8.897  -9.118  1.00 26.80 ? 22   PRO A CA  1 
ATOM   109  C  C   . PRO A 1 20  ? -40.256 -9.026  -9.601  1.00 25.54 ? 22   PRO A C   1 
ATOM   110  O  O   . PRO A 1 20  ? -39.857 -10.089 -10.087 1.00 24.04 ? 22   PRO A O   1 
ATOM   111  C  CB  . PRO A 1 20  ? -42.563 -8.211  -10.194 1.00 28.71 ? 22   PRO A CB  1 
ATOM   112  C  CG  . PRO A 1 20  ? -43.591 -7.439  -9.446  1.00 30.00 ? 22   PRO A CG  1 
ATOM   113  C  CD  . PRO A 1 20  ? -42.915 -6.983  -8.187  1.00 29.54 ? 22   PRO A CD  1 
ATOM   114  N  N   . ALA A 1 21  ? -39.465 -7.962  -9.457  1.00 24.25 ? 23   ALA A N   1 
ATOM   115  C  CA  . ALA A 1 21  ? -38.053 -7.982  -9.887  1.00 23.11 ? 23   ALA A CA  1 
ATOM   116  C  C   . ALA A 1 21  ? -37.230 -9.067  -9.192  1.00 21.97 ? 23   ALA A C   1 
ATOM   117  O  O   . ALA A 1 21  ? -36.264 -9.499  -9.756  1.00 20.29 ? 23   ALA A O   1 
ATOM   118  C  CB  . ALA A 1 21  ? -37.393 -6.610  -9.712  1.00 23.12 ? 23   ALA A CB  1 
ATOM   119  N  N   . CYS A 1 22  ? -37.641 -9.536  -8.000  1.00 21.37 ? 24   CYS A N   1 
ATOM   120  C  CA  . CYS A 1 22  ? -36.985 -10.689 -7.370  1.00 20.52 ? 24   CYS A CA  1 
ATOM   121  C  C   . CYS A 1 22  ? -37.115 -12.010 -8.131  1.00 20.08 ? 24   CYS A C   1 
ATOM   122  O  O   . CYS A 1 22  ? -36.460 -12.992 -7.773  1.00 18.03 ? 24   CYS A O   1 
ATOM   123  C  CB  . CYS A 1 22  ? -37.430 -10.847 -5.921  1.00 21.07 ? 24   CYS A CB  1 
ATOM   124  S  SG  . CYS A 1 22  ? -37.040 -9.415  -4.892  1.00 22.06 ? 24   CYS A SG  1 
ATOM   125  N  N   . ALA A 1 23  ? -37.935 -12.036 -9.186  1.00 19.53 ? 25   ALA A N   1 
ATOM   126  C  CA  . ALA A 1 23  ? -38.001 -13.207 -10.053 1.00 19.89 ? 25   ALA A CA  1 
ATOM   127  C  C   . ALA A 1 23  ? -37.436 -12.936 -11.445 1.00 19.16 ? 25   ALA A C   1 
ATOM   128  O  O   . ALA A 1 23  ? -37.744 -13.662 -12.388 1.00 19.24 ? 25   ALA A O   1 
ATOM   129  C  CB  . ALA A 1 23  ? -39.433 -13.699 -10.146 1.00 20.13 ? 25   ALA A CB  1 
ATOM   130  N  N   . GLY A 1 24  ? -36.588 -11.923 -11.577 1.00 17.39 ? 26   GLY A N   1 
ATOM   131  C  CA  . GLY A 1 24  ? -35.924 -11.679 -12.844 1.00 15.56 ? 26   GLY A CA  1 
ATOM   132  C  C   . GLY A 1 24  ? -34.947 -12.781 -13.169 1.00 15.23 ? 26   GLY A C   1 
ATOM   133  O  O   . GLY A 1 24  ? -34.519 -13.540 -12.299 1.00 14.28 ? 26   GLY A O   1 
ATOM   134  N  N   . ARG A 1 25  ? -34.596 -12.871 -14.451 1.00 14.54 ? 27   ARG A N   1 
ATOM   135  C  CA  . ARG A 1 25  ? -33.666 -13.871 -14.926 1.00 14.72 ? 27   ARG A CA  1 
ATOM   136  C  C   . ARG A 1 25  ? -32.208 -13.610 -14.473 1.00 14.13 ? 27   ARG A C   1 
ATOM   137  O  O   . ARG A 1 25  ? -31.411 -14.532 -14.439 1.00 14.57 ? 27   ARG A O   1 
ATOM   138  C  CB  . ARG A 1 25  ? -33.747 -13.969 -16.475 1.00 13.87 ? 27   ARG A CB  1 
ATOM   139  C  CG  . ARG A 1 25  ? -33.018 -15.158 -17.079 1.00 13.36 ? 27   ARG A CG  1 
ATOM   140  C  CD  . ARG A 1 25  ? -33.191 -15.282 -18.601 1.00 13.42 ? 27   ARG A CD  1 
ATOM   141  N  NE  . ARG A 1 25  ? -32.205 -16.229 -19.107 1.00 12.58 ? 27   ARG A NE  1 
ATOM   142  C  CZ  . ARG A 1 25  ? -32.289 -17.559 -19.020 1.00 12.13 ? 27   ARG A CZ  1 
ATOM   143  N  NH1 . ARG A 1 25  ? -33.362 -18.174 -18.512 1.00 12.97 ? 27   ARG A NH1 1 
ATOM   144  N  NH2 . ARG A 1 25  ? -31.297 -18.296 -19.458 1.00 11.48 ? 27   ARG A NH2 1 
ATOM   145  N  N   . PHE A 1 26  ? -31.874 -12.365 -14.141 1.00 15.47 ? 28   PHE A N   1 
ATOM   146  C  CA  . PHE A 1 26  ? -30.472 -11.913 -13.967 1.00 14.54 ? 28   PHE A CA  1 
ATOM   147  C  C   . PHE A 1 26  ? -30.214 -11.318 -12.582 1.00 15.11 ? 28   PHE A C   1 
ATOM   148  O  O   . PHE A 1 26  ? -29.933 -10.110 -12.405 1.00 14.75 ? 28   PHE A O   1 
ATOM   149  C  CB  . PHE A 1 26  ? -30.145 -10.938 -15.073 1.00 14.21 ? 28   PHE A CB  1 
ATOM   150  C  CG  . PHE A 1 26  ? -30.366 -11.505 -16.443 1.00 14.20 ? 28   PHE A CG  1 
ATOM   151  C  CD1 . PHE A 1 26  ? -29.619 -12.605 -16.878 1.00 13.97 ? 28   PHE A CD1 1 
ATOM   152  C  CD2 . PHE A 1 26  ? -31.325 -10.978 -17.293 1.00 14.52 ? 28   PHE A CD2 1 
ATOM   153  C  CE1 . PHE A 1 26  ? -29.841 -13.151 -18.122 1.00 14.76 ? 28   PHE A CE1 1 
ATOM   154  C  CE2 . PHE A 1 26  ? -31.526 -11.518 -18.564 1.00 14.63 ? 28   PHE A CE2 1 
ATOM   155  C  CZ  . PHE A 1 26  ? -30.784 -12.601 -18.982 1.00 14.00 ? 28   PHE A CZ  1 
ATOM   156  N  N   . GLN A 1 27  ? -30.284 -12.210 -11.598 1.00 15.26 ? 29   GLN A N   1 
ATOM   157  C  CA  . GLN A 1 27  ? -30.203 -11.857 -10.190 1.00 14.68 ? 29   GLN A CA  1 
ATOM   158  C  C   . GLN A 1 27  ? -28.825 -12.090 -9.590  1.00 14.21 ? 29   GLN A C   1 
ATOM   159  O  O   . GLN A 1 27  ? -27.956 -12.757 -10.173 1.00 14.44 ? 29   GLN A O   1 
ATOM   160  C  CB  . GLN A 1 27  ? -31.242 -12.628 -9.382  1.00 15.20 ? 29   GLN A CB  1 
ATOM   161  C  CG  . GLN A 1 27  ? -32.694 -12.339 -9.752  1.00 16.08 ? 29   GLN A CG  1 
ATOM   162  C  CD  . GLN A 1 27  ? -33.222 -11.055 -9.150  1.00 16.43 ? 29   GLN A CD  1 
ATOM   163  O  OE1 . GLN A 1 27  ? -33.536 -10.979 -7.951  1.00 16.92 ? 29   GLN A OE1 1 
ATOM   164  N  NE2 . GLN A 1 27  ? -33.318 -10.033 -9.975  1.00 17.83 ? 29   GLN A NE2 1 
ATOM   165  N  N   . SER A 1 28  ? -28.644 -11.505 -8.410  1.00 12.76 ? 30   SER A N   1 
ATOM   166  C  CA  . SER A 1 28  ? -27.433 -11.663 -7.607  1.00 12.51 ? 30   SER A CA  1 
ATOM   167  C  C   . SER A 1 28  ? -27.847 -12.220 -6.253  1.00 12.43 ? 30   SER A C   1 
ATOM   168  O  O   . SER A 1 28  ? -29.033 -12.096 -5.876  1.00 12.14 ? 30   SER A O   1 
ATOM   169  C  CB  . SER A 1 28  ? -26.776 -10.300 -7.422  1.00 12.23 ? 30   SER A CB  1 
ATOM   170  O  OG  . SER A 1 28  ? -26.415 -9.724  -8.675  1.00 11.95 ? 30   SER A OG  1 
ATOM   171  N  N   . PRO A 1 29  ? -26.930 -12.805 -5.488  1.00 12.47 ? 31   PRO A N   1 
ATOM   172  C  CA  . PRO A 1 29  ? -25.554 -13.052 -5.847  1.00 12.98 ? 31   PRO A CA  1 
ATOM   173  C  C   . PRO A 1 29  ? -25.407 -14.260 -6.733  1.00 12.78 ? 31   PRO A C   1 
ATOM   174  O  O   . PRO A 1 29  ? -26.399 -14.937 -7.052  1.00 13.03 ? 31   PRO A O   1 
ATOM   175  C  CB  . PRO A 1 29  ? -24.885 -13.300 -4.466  1.00 13.44 ? 31   PRO A CB  1 
ATOM   176  C  CG  . PRO A 1 29  ? -25.963 -14.034 -3.713  1.00 13.20 ? 31   PRO A CG  1 
ATOM   177  C  CD  . PRO A 1 29  ? -27.264 -13.391 -4.175  1.00 13.47 ? 31   PRO A CD  1 
ATOM   178  N  N   . VAL A 1 30  ? -24.172 -14.530 -7.138  1.00 12.57 ? 32   VAL A N   1 
ATOM   179  C  CA  . VAL A 1 30  ? -23.881 -15.639 -8.029  1.00 12.82 ? 32   VAL A CA  1 
ATOM   180  C  C   . VAL A 1 30  ? -22.672 -16.405 -7.526  1.00 13.36 ? 32   VAL A C   1 
ATOM   181  O  O   . VAL A 1 30  ? -21.914 -15.928 -6.648  1.00 12.97 ? 32   VAL A O   1 
ATOM   182  C  CB  . VAL A 1 30  ? -23.650 -15.164 -9.492  1.00 12.91 ? 32   VAL A CB  1 
ATOM   183  C  CG1 . VAL A 1 30  ? -24.867 -14.436 -10.033 1.00 12.73 ? 32   VAL A CG1 1 
ATOM   184  C  CG2 . VAL A 1 30  ? -22.388 -14.308 -9.610  1.00 12.63 ? 32   VAL A CG2 1 
ATOM   185  N  N   . ASP A 1 31  ? -22.475 -17.585 -8.110  1.00 13.83 ? 33   ASP A N   1 
ATOM   186  C  CA  . ASP A 1 31  ? -21.278 -18.386 -7.866  1.00 14.44 ? 33   ASP A CA  1 
ATOM   187  C  C   . ASP A 1 31  ? -20.249 -18.025 -8.921  1.00 14.08 ? 33   ASP A C   1 
ATOM   188  O  O   . ASP A 1 31  ? -20.501 -18.164 -10.118 1.00 13.31 ? 33   ASP A O   1 
ATOM   189  C  CB  . ASP A 1 31  ? -21.593 -19.891 -7.924  1.00 15.08 ? 33   ASP A CB  1 
ATOM   190  C  CG  . ASP A 1 31  ? -20.356 -20.752 -7.672  1.00 16.30 ? 33   ASP A CG  1 
ATOM   191  O  OD1 . ASP A 1 31  ? -19.588 -20.507 -6.697  1.00 15.04 ? 33   ASP A OD1 1 
ATOM   192  O  OD2 . ASP A 1 31  ? -20.134 -21.670 -8.477  1.00 18.40 ? 33   ASP A OD2 1 
ATOM   193  N  N   . ILE A 1 32  ? -19.095 -17.526 -8.493  1.00 14.47 ? 34   ILE A N   1 
ATOM   194  C  CA  . ILE A 1 32  ? -18.057 -17.132 -9.434  1.00 14.42 ? 34   ILE A CA  1 
ATOM   195  C  C   . ILE A 1 32  ? -17.163 -18.351 -9.722  1.00 15.77 ? 34   ILE A C   1 
ATOM   196  O  O   . ILE A 1 32  ? -16.582 -18.925 -8.802  1.00 15.08 ? 34   ILE A O   1 
ATOM   197  C  CB  . ILE A 1 32  ? -17.206 -15.973 -8.867  1.00 14.21 ? 34   ILE A CB  1 
ATOM   198  C  CG1 . ILE A 1 32  ? -18.066 -14.735 -8.577  1.00 14.02 ? 34   ILE A CG1 1 
ATOM   199  C  CG2 . ILE A 1 32  ? -16.078 -15.614 -9.824  1.00 13.92 ? 34   ILE A CG2 1 
ATOM   200  C  CD1 . ILE A 1 32  ? -17.391 -13.740 -7.641  1.00 14.20 ? 34   ILE A CD1 1 
ATOM   201  N  N   . ARG A 1 33  ? -17.056 -18.725 -11.003 1.00 16.48 ? 35   ARG A N   1 
ATOM   202  C  CA  . ARG A 1 33  ? -16.197 -19.797 -11.448 1.00 17.33 ? 35   ARG A CA  1 
ATOM   203  C  C   . ARG A 1 33  ? -15.086 -19.140 -12.271 1.00 16.30 ? 35   ARG A C   1 
ATOM   204  O  O   . ARG A 1 33  ? -15.297 -18.804 -13.450 1.00 15.51 ? 35   ARG A O   1 
ATOM   205  C  CB  . ARG A 1 33  ? -17.010 -20.806 -12.268 1.00 20.38 ? 35   ARG A CB  1 
ATOM   206  C  CG  . ARG A 1 33  ? -18.163 -21.374 -11.450 1.00 24.28 ? 35   ARG A CG  1 
ATOM   207  C  CD  . ARG A 1 33  ? -18.756 -22.605 -12.082 1.00 29.25 ? 35   ARG A CD  1 
ATOM   208  N  NE  . ARG A 1 33  ? -17.735 -23.639 -12.288 1.00 34.59 ? 35   ARG A NE  1 
ATOM   209  C  CZ  . ARG A 1 33  ? -17.858 -24.684 -13.114 1.00 40.44 ? 35   ARG A CZ  1 
ATOM   210  N  NH1 . ARG A 1 33  ? -18.971 -24.884 -13.831 1.00 39.71 ? 35   ARG A NH1 1 
ATOM   211  N  NH2 . ARG A 1 33  ? -16.850 -25.549 -13.227 1.00 46.39 ? 35   ARG A NH2 1 
ATOM   212  N  N   . PRO A 1 34  ? -13.916 -18.923 -11.652 1.00 15.90 ? 36   PRO A N   1 
ATOM   213  C  CA  . PRO A 1 34  ? -12.837 -18.162 -12.291 1.00 16.95 ? 36   PRO A CA  1 
ATOM   214  C  C   . PRO A 1 34  ? -12.410 -18.700 -13.641 1.00 18.48 ? 36   PRO A C   1 
ATOM   215  O  O   . PRO A 1 34  ? -12.055 -17.889 -14.524 1.00 18.25 ? 36   PRO A O   1 
ATOM   216  C  CB  . PRO A 1 34  ? -11.704 -18.240 -11.274 1.00 16.77 ? 36   PRO A CB  1 
ATOM   217  C  CG  . PRO A 1 34  ? -12.410 -18.371 -9.984  1.00 16.69 ? 36   PRO A CG  1 
ATOM   218  C  CD  . PRO A 1 34  ? -13.534 -19.310 -10.287 1.00 16.93 ? 36   PRO A CD  1 
ATOM   219  N  N   . GLN A 1 35  ? -12.487 -20.025 -13.855 1.00 18.71 ? 37   GLN A N   1 
ATOM   220  C  CA  . GLN A 1 35  ? -12.143 -20.551 -15.179 1.00 20.95 ? 37   GLN A CA  1 
ATOM   221  C  C   . GLN A 1 35  ? -13.125 -20.161 -16.269 1.00 20.80 ? 37   GLN A C   1 
ATOM   222  O  O   . GLN A 1 35  ? -12.743 -20.118 -17.421 1.00 21.37 ? 37   GLN A O   1 
ATOM   223  C  CB  . GLN A 1 35  ? -12.019 -22.062 -15.177 1.00 23.46 ? 37   GLN A CB  1 
ATOM   224  C  CG  . GLN A 1 35  ? -10.843 -22.537 -14.374 1.00 25.34 ? 37   GLN A CG  1 
ATOM   225  C  CD  . GLN A 1 35  ? -10.447 -23.952 -14.732 1.00 29.25 ? 37   GLN A CD  1 
ATOM   226  O  OE1 . GLN A 1 35  ? -10.365 -24.803 -13.862 1.00 32.60 ? 37   GLN A OE1 1 
ATOM   227  N  NE2 . GLN A 1 35  ? -10.199 -24.208 -16.024 1.00 29.55 ? 37   GLN A NE2 1 
ATOM   228  N  N   . LEU A 1 36  ? -14.374 -19.900 -15.918 1.00 18.90 ? 38   LEU A N   1 
ATOM   229  C  CA  . LEU A 1 36  ? -15.360 -19.461 -16.876 1.00 19.28 ? 38   LEU A CA  1 
ATOM   230  C  C   . LEU A 1 36  ? -15.464 -17.935 -16.997 1.00 17.90 ? 38   LEU A C   1 
ATOM   231  O  O   . LEU A 1 36  ? -16.276 -17.452 -17.788 1.00 17.51 ? 38   LEU A O   1 
ATOM   232  C  CB  . LEU A 1 36  ? -16.722 -20.065 -16.522 1.00 21.02 ? 38   LEU A CB  1 
ATOM   233  C  CG  . LEU A 1 36  ? -16.774 -21.606 -16.383 1.00 23.40 ? 38   LEU A CG  1 
ATOM   234  C  CD1 . LEU A 1 36  ? -18.225 -22.100 -16.437 1.00 23.79 ? 38   LEU A CD1 1 
ATOM   235  C  CD2 . LEU A 1 36  ? -15.950 -22.320 -17.445 1.00 24.37 ? 38   LEU A CD2 1 
ATOM   236  N  N   . ALA A 1 37  ? -14.666 -17.179 -16.235 1.00 16.37 ? 39   ALA A N   1 
ATOM   237  C  CA  . ALA A 1 37  ? -14.696 -15.711 -16.299 1.00 15.95 ? 39   ALA A CA  1 
ATOM   238  C  C   . ALA A 1 37  ? -13.941 -15.242 -17.521 1.00 15.52 ? 39   ALA A C   1 
ATOM   239  O  O   . ALA A 1 37  ? -12.996 -15.883 -17.930 1.00 16.42 ? 39   ALA A O   1 
ATOM   240  C  CB  . ALA A 1 37  ? -14.117 -15.073 -15.039 1.00 16.16 ? 39   ALA A CB  1 
ATOM   241  N  N   . ALA A 1 38  ? -14.377 -14.149 -18.125 1.00 14.39 ? 40   ALA A N   1 
ATOM   242  C  CA  . ALA A 1 38  ? -13.728 -13.624 -19.324 1.00 13.89 ? 40   ALA A CA  1 
ATOM   243  C  C   . ALA A 1 38  ? -12.717 -12.566 -18.943 1.00 13.63 ? 40   ALA A C   1 
ATOM   244  O  O   . ALA A 1 38  ? -13.106 -11.537 -18.395 1.00 12.90 ? 40   ALA A O   1 
ATOM   245  C  CB  . ALA A 1 38  ? -14.757 -13.032 -20.273 1.00 13.84 ? 40   ALA A CB  1 
ATOM   246  N  N   . PHE A 1 39  ? -11.442 -12.774 -19.306 1.00 13.38 ? 41   PHE A N   1 
ATOM   247  C  CA  . PHE A 1 39  ? -10.429 -11.741 -19.105 1.00 14.03 ? 41   PHE A CA  1 
ATOM   248  C  C   . PHE A 1 39  ? -10.758 -10.553 -19.959 1.00 14.28 ? 41   PHE A C   1 
ATOM   249  O  O   . PHE A 1 39  ? -10.877 -10.676 -21.167 1.00 13.52 ? 41   PHE A O   1 
ATOM   250  C  CB  . PHE A 1 39  ? -9.019  -12.244 -19.418 1.00 14.29 ? 41   PHE A CB  1 
ATOM   251  C  CG  . PHE A 1 39  ? -7.960  -11.184 -19.376 1.00 14.18 ? 41   PHE A CG  1 
ATOM   252  C  CD1 . PHE A 1 39  ? -7.893  -10.269 -18.330 1.00 14.67 ? 41   PHE A CD1 1 
ATOM   253  C  CD2 . PHE A 1 39  ? -7.004  -11.102 -20.386 1.00 14.65 ? 41   PHE A CD2 1 
ATOM   254  C  CE1 . PHE A 1 39  ? -6.910  -9.288  -18.299 1.00 14.95 ? 41   PHE A CE1 1 
ATOM   255  C  CE2 . PHE A 1 39  ? -5.993  -10.133 -20.354 1.00 14.98 ? 41   PHE A CE2 1 
ATOM   256  C  CZ  . PHE A 1 39  ? -5.934  -9.230  -19.306 1.00 14.82 ? 41   PHE A CZ  1 
ATOM   257  N  N   . SER A 1 40  ? -10.894 -9.403  -19.314 1.00 15.13 ? 42   SER A N   1 
ATOM   258  C  CA  . SER A 1 40  ? -11.227 -8.168  -19.980 1.00 16.81 ? 42   SER A CA  1 
ATOM   259  C  C   . SER A 1 40  ? -10.235 -7.071  -19.545 1.00 16.11 ? 42   SER A C   1 
ATOM   260  O  O   . SER A 1 40  ? -10.402 -6.487  -18.473 1.00 15.47 ? 42   SER A O   1 
ATOM   261  C  CB  . SER A 1 40  ? -12.674 -7.823  -19.612 1.00 19.89 ? 42   SER A CB  1 
ATOM   262  O  OG  . SER A 1 40  ? -13.470 -9.024  -19.577 1.00 24.08 ? 42   SER A OG  1 
ATOM   263  N  N   . PRO A 1 41  ? -9.191  -6.805  -20.357 1.00 15.71 ? 43   PRO A N   1 
ATOM   264  C  CA  . PRO A 1 41  ? -8.185  -5.793  -19.977 1.00 15.46 ? 43   PRO A CA  1 
ATOM   265  C  C   . PRO A 1 41  ? -8.659  -4.354  -19.958 1.00 15.42 ? 43   PRO A C   1 
ATOM   266  O  O   . PRO A 1 41  ? -7.893  -3.495  -19.521 1.00 14.46 ? 43   PRO A O   1 
ATOM   267  C  CB  . PRO A 1 41  ? -7.056  -5.953  -21.029 1.00 15.85 ? 43   PRO A CB  1 
ATOM   268  C  CG  . PRO A 1 41  ? -7.658  -6.724  -22.132 1.00 16.24 ? 43   PRO A CG  1 
ATOM   269  C  CD  . PRO A 1 41  ? -8.792  -7.544  -21.574 1.00 15.94 ? 43   PRO A CD  1 
ATOM   270  N  N   . ALA A 1 42  ? -9.879  -4.068  -20.421 1.00 14.38 ? 44   ALA A N   1 
ATOM   271  C  CA  . ALA A 1 42  ? -10.455 -2.720  -20.193 1.00 14.93 ? 44   ALA A CA  1 
ATOM   272  C  C   . ALA A 1 42  ? -10.819 -2.445  -18.723 1.00 14.44 ? 44   ALA A C   1 
ATOM   273  O  O   . ALA A 1 42  ? -11.095 -1.315  -18.371 1.00 14.53 ? 44   ALA A O   1 
ATOM   274  C  CB  . ALA A 1 42  ? -11.665 -2.465  -21.092 1.00 14.74 ? 44   ALA A CB  1 
ATOM   275  N  N   . LEU A 1 43  ? -10.842 -3.483  -17.885 1.00 13.88 ? 45   LEU A N   1 
ATOM   276  C  CA  . LEU A 1 43  ? -11.139 -3.350  -16.473 1.00 13.97 ? 45   LEU A CA  1 
ATOM   277  C  C   . LEU A 1 43  ? -9.885  -2.890  -15.723 1.00 14.22 ? 45   LEU A C   1 
ATOM   278  O  O   . LEU A 1 43  ? -8.980  -3.708  -15.387 1.00 12.75 ? 45   LEU A O   1 
ATOM   279  C  CB  . LEU A 1 43  ? -11.659 -4.683  -15.904 1.00 14.18 ? 45   LEU A CB  1 
ATOM   280  C  CG  . LEU A 1 43  ? -13.007 -5.170  -16.450 1.00 14.98 ? 45   LEU A CG  1 
ATOM   281  C  CD1 . LEU A 1 43  ? -13.345 -6.519  -15.830 1.00 15.23 ? 45   LEU A CD1 1 
ATOM   282  C  CD2 . LEU A 1 43  ? -14.122 -4.173  -16.190 1.00 15.72 ? 45   LEU A CD2 1 
ATOM   283  N  N   . ARG A 1 44  ? -9.846  -1.586  -15.467 1.00 13.98 ? 46   ARG A N   1 
ATOM   284  C  CA  . ARG A 1 44  ? -8.722  -0.937  -14.823 1.00 15.67 ? 46   ARG A CA  1 
ATOM   285  C  C   . ARG A 1 44  ? -8.907  -0.870  -13.311 1.00 14.38 ? 46   ARG A C   1 
ATOM   286  O  O   . ARG A 1 44  ? -10.004 -1.171  -12.796 1.00 13.35 ? 46   ARG A O   1 
ATOM   287  C  CB  . ARG A 1 44  ? -8.523  0.480   -15.387 1.00 17.81 ? 46   ARG A CB  1 
ATOM   288  C  CG  . ARG A 1 44  ? -8.489  0.545   -16.916 1.00 20.07 ? 46   ARG A CG  1 
ATOM   289  C  CD  . ARG A 1 44  ? -7.547  -0.463  -17.536 1.00 21.77 ? 46   ARG A CD  1 
ATOM   290  N  NE  . ARG A 1 44  ? -6.229  -0.289  -16.950 1.00 25.27 ? 46   ARG A NE  1 
ATOM   291  C  CZ  . ARG A 1 44  ? -5.258  -1.196  -16.913 1.00 30.31 ? 46   ARG A CZ  1 
ATOM   292  N  NH1 . ARG A 1 44  ? -5.416  -2.408  -17.439 1.00 35.42 ? 46   ARG A NH1 1 
ATOM   293  N  NH2 . ARG A 1 44  ? -4.110  -0.879  -16.326 1.00 31.49 ? 46   ARG A NH2 1 
ATOM   294  N  N   . PRO A 1 45  ? -7.837  -0.469  -12.600 1.00 14.14 ? 47   PRO A N   1 
ATOM   295  C  CA  . PRO A 1 45  ? -7.990  -0.409  -11.148 1.00 14.38 ? 47   PRO A CA  1 
ATOM   296  C  C   . PRO A 1 45  ? -9.090  0.558   -10.709 1.00 14.35 ? 47   PRO A C   1 
ATOM   297  O  O   . PRO A 1 45  ? -9.270  1.623   -11.301 1.00 14.30 ? 47   PRO A O   1 
ATOM   298  C  CB  . PRO A 1 45  ? -6.591  -0.003  -10.659 1.00 14.55 ? 47   PRO A CB  1 
ATOM   299  C  CG  . PRO A 1 45  ? -5.672  -0.497  -11.740 1.00 14.66 ? 47   PRO A CG  1 
ATOM   300  C  CD  . PRO A 1 45  ? -6.437  -0.209  -13.008 1.00 14.21 ? 47   PRO A CD  1 
ATOM   301  N  N   . LEU A 1 46  ? -9.876  0.143   -9.730  1.00 14.84 ? 48   LEU A N   1 
ATOM   302  C  CA  . LEU A 1 46  ? -10.917 1.011   -9.176  1.00 16.62 ? 48   LEU A CA  1 
ATOM   303  C  C   . LEU A 1 46  ? -10.276 2.246   -8.517  1.00 15.87 ? 48   LEU A C   1 
ATOM   304  O  O   . LEU A 1 46  ? -9.186  2.133   -7.986  1.00 15.12 ? 48   LEU A O   1 
ATOM   305  C  CB  . LEU A 1 46  ? -11.776 0.228   -8.178  1.00 17.96 ? 48   LEU A CB  1 
ATOM   306  C  CG  . LEU A 1 46  ? -13.043 -0.346  -8.846  1.00 21.00 ? 48   LEU A CG  1 
ATOM   307  C  CD1 . LEU A 1 46  ? -12.780 -1.151  -10.101 1.00 20.88 ? 48   LEU A CD1 1 
ATOM   308  C  CD2 . LEU A 1 46  ? -13.840 -1.163  -7.840  1.00 23.39 ? 48   LEU A CD2 1 
ATOM   309  N  N   . GLU A 1 47  ? -10.953 3.395   -8.580  1.00 14.91 ? 49   GLU A N   1 
ATOM   310  C  CA  . GLU A 1 47  ? -10.461 4.658   -8.011  1.00 15.15 ? 49   GLU A CA  1 
ATOM   311  C  C   . GLU A 1 47  ? -11.484 5.197   -7.018  1.00 15.46 ? 49   GLU A C   1 
ATOM   312  O  O   . GLU A 1 47  ? -12.661 5.310   -7.349  1.00 15.10 ? 49   GLU A O   1 
ATOM   313  C  CB  . GLU A 1 47  ? -10.212 5.709   -9.097  1.00 15.68 ? 49   GLU A CB  1 
ATOM   314  C  CG  . GLU A 1 47  ? -9.178  5.303   -10.141 1.00 16.20 ? 49   GLU A CG  1 
ATOM   315  C  CD  . GLU A 1 47  ? -7.782  5.147   -9.553  1.00 16.81 ? 49   GLU A CD  1 
ATOM   316  O  OE1 . GLU A 1 47  ? -7.539  5.677   -8.446  1.00 17.15 ? 49   GLU A OE1 1 
ATOM   317  O  OE2 . GLU A 1 47  ? -6.925  4.500   -10.192 1.00 17.70 ? 49   GLU A OE2 1 
ATOM   318  N  N   . LEU A 1 48  ? -11.025 5.492   -5.810  1.00 15.26 ? 50   LEU A N   1 
ATOM   319  C  CA  . LEU A 1 48  ? -11.866 6.027   -4.730  1.00 16.42 ? 50   LEU A CA  1 
ATOM   320  C  C   . LEU A 1 48  ? -11.366 7.405   -4.342  1.00 16.90 ? 50   LEU A C   1 
ATOM   321  O  O   . LEU A 1 48  ? -10.182 7.633   -4.285  1.00 18.05 ? 50   LEU A O   1 
ATOM   322  C  CB  . LEU A 1 48  ? -11.795 5.146   -3.507  1.00 17.22 ? 50   LEU A CB  1 
ATOM   323  C  CG  . LEU A 1 48  ? -12.277 3.710   -3.568  1.00 18.15 ? 50   LEU A CG  1 
ATOM   324  C  CD1 . LEU A 1 48  ? -12.347 3.091   -2.175  1.00 18.81 ? 50   LEU A CD1 1 
ATOM   325  C  CD2 . LEU A 1 48  ? -13.627 3.639   -4.226  1.00 19.27 ? 50   LEU A CD2 1 
ATOM   326  N  N   . LEU A 1 49  ? -12.260 8.337   -4.073  1.00 17.89 ? 51   LEU A N   1 
ATOM   327  C  CA  . LEU A 1 49  ? -11.842 9.678   -3.681  1.00 18.83 ? 51   LEU A CA  1 
ATOM   328  C  C   . LEU A 1 49  ? -12.763 10.094  -2.542  1.00 16.87 ? 51   LEU A C   1 
ATOM   329  O  O   . LEU A 1 49  ? -13.970 9.793   -2.574  1.00 15.80 ? 51   LEU A O   1 
ATOM   330  C  CB  . LEU A 1 49  ? -11.922 10.574  -4.922  1.00 22.52 ? 51   LEU A CB  1 
ATOM   331  C  CG  . LEU A 1 49  ? -11.586 12.061  -4.972  1.00 27.40 ? 51   LEU A CG  1 
ATOM   332  C  CD1 . LEU A 1 49  ? -10.219 12.368  -4.383  1.00 30.82 ? 51   LEU A CD1 1 
ATOM   333  C  CD2 . LEU A 1 49  ? -11.637 12.497  -6.431  1.00 29.74 ? 51   LEU A CD2 1 
ATOM   334  N  N   . GLY A 1 50  ? -12.172 10.715  -1.517  1.00 15.39 ? 52   GLY A N   1 
ATOM   335  C  CA  . GLY A 1 50  ? -12.886 11.190  -0.342  1.00 14.93 ? 52   GLY A CA  1 
ATOM   336  C  C   . GLY A 1 50  ? -13.271 10.139  0.691   1.00 14.39 ? 52   GLY A C   1 
ATOM   337  O  O   . GLY A 1 50  ? -14.094 10.424  1.556   1.00 14.47 ? 52   GLY A O   1 
ATOM   338  N  N   . PHE A 1 51  ? -12.721 8.925   0.625   1.00 13.63 ? 53   PHE A N   1 
ATOM   339  C  CA  . PHE A 1 51  ? -13.110 7.877   1.596   1.00 13.61 ? 53   PHE A CA  1 
ATOM   340  C  C   . PHE A 1 51  ? -12.437 8.026   2.965   1.00 14.09 ? 53   PHE A C   1 
ATOM   341  O  O   . PHE A 1 51  ? -12.854 7.377   3.943   1.00 13.45 ? 53   PHE A O   1 
ATOM   342  C  CB  . PHE A 1 51  ? -12.837 6.477   1.048   1.00 13.43 ? 53   PHE A CB  1 
ATOM   343  C  CG  . PHE A 1 51  ? -13.914 5.960   0.116   1.00 13.22 ? 53   PHE A CG  1 
ATOM   344  C  CD1 . PHE A 1 51  ? -14.240 6.638   -1.048  1.00 13.24 ? 53   PHE A CD1 1 
ATOM   345  C  CD2 . PHE A 1 51  ? -14.583 4.781   0.399   1.00 13.77 ? 53   PHE A CD2 1 
ATOM   346  C  CE1 . PHE A 1 51  ? -15.235 6.169   -1.897  1.00 13.13 ? 53   PHE A CE1 1 
ATOM   347  C  CE2 . PHE A 1 51  ? -15.562 4.286   -0.458  1.00 13.69 ? 53   PHE A CE2 1 
ATOM   348  C  CZ  . PHE A 1 51  ? -15.892 4.989   -1.605  1.00 13.08 ? 53   PHE A CZ  1 
ATOM   349  N  N   . GLN A 1 52  ? -11.396 8.854   3.039   1.00 14.43 ? 54   GLN A N   1 
ATOM   350  C  CA  . GLN A 1 52  ? -10.678 9.084   4.298   1.00 15.76 ? 54   GLN A CA  1 
ATOM   351  C  C   . GLN A 1 52  ? -11.380 10.224  5.040   1.00 15.23 ? 54   GLN A C   1 
ATOM   352  O  O   . GLN A 1 52  ? -11.076 11.403  4.816   1.00 15.16 ? 54   GLN A O   1 
ATOM   353  C  CB  . GLN A 1 52  ? -9.211  9.421   4.023   1.00 17.23 ? 54   GLN A CB  1 
ATOM   354  C  CG  . GLN A 1 52  ? -8.426  8.261   3.411   1.00 19.80 ? 54   GLN A CG  1 
ATOM   355  C  CD  . GLN A 1 52  ? -6.999  8.675   3.071   1.00 22.95 ? 54   GLN A CD  1 
ATOM   356  O  OE1 . GLN A 1 52  ? -6.756  9.336   2.071   1.00 25.86 ? 54   GLN A OE1 1 
ATOM   357  N  NE2 . GLN A 1 52  ? -6.065  8.322   3.926   1.00 25.90 ? 54   GLN A NE2 1 
ATOM   358  N  N   . LEU A 1 53  ? -12.313 9.863   5.915   1.00 14.84 ? 55   LEU A N   1 
ATOM   359  C  CA  . LEU A 1 53  ? -13.181 10.840  6.586   1.00 15.11 ? 55   LEU A CA  1 
ATOM   360  C  C   . LEU A 1 53  ? -12.573 11.374  7.863   1.00 14.92 ? 55   LEU A C   1 
ATOM   361  O  O   . LEU A 1 53  ? -11.887 10.629  8.573   1.00 12.99 ? 55   LEU A O   1 
ATOM   362  C  CB  . LEU A 1 53  ? -14.538 10.206  6.950   1.00 15.53 ? 55   LEU A CB  1 
ATOM   363  C  CG  . LEU A 1 53  ? -15.332 9.633   5.772   1.00 16.32 ? 55   LEU A CG  1 
ATOM   364  C  CD1 . LEU A 1 53  ? -16.567 8.919   6.283   1.00 17.20 ? 55   LEU A CD1 1 
ATOM   365  C  CD2 . LEU A 1 53  ? -15.699 10.713  4.777   1.00 16.73 ? 55   LEU A CD2 1 
ATOM   366  N  N   . PRO A 1 54  ? -12.878 12.652  8.194   1.00 15.31 ? 56   PRO A N   1 
ATOM   367  C  CA  . PRO A 1 54  ? -12.591 13.119  9.535   1.00 15.50 ? 56   PRO A CA  1 
ATOM   368  C  C   . PRO A 1 54  ? -13.565 12.469  10.528  1.00 15.61 ? 56   PRO A C   1 
ATOM   369  O  O   . PRO A 1 54  ? -14.599 11.939  10.110  1.00 15.86 ? 56   PRO A O   1 
ATOM   370  C  CB  . PRO A 1 54  ? -12.828 14.630  9.438   1.00 15.92 ? 56   PRO A CB  1 
ATOM   371  C  CG  . PRO A 1 54  ? -13.863 14.797  8.385   1.00 15.75 ? 56   PRO A CG  1 
ATOM   372  C  CD  . PRO A 1 54  ? -13.633 13.665  7.412   1.00 16.30 ? 56   PRO A CD  1 
ATOM   373  N  N   . PRO A 1 55  ? -13.234 12.506  11.825  1.00 15.72 ? 57   PRO A N   1 
ATOM   374  C  CA  . PRO A 1 55  ? -14.054 11.892  12.855  1.00 16.05 ? 57   PRO A CA  1 
ATOM   375  C  C   . PRO A 1 55  ? -15.438 12.562  12.990  1.00 16.40 ? 57   PRO A C   1 
ATOM   376  O  O   . PRO A 1 55  ? -16.428 11.856  13.183  1.00 16.14 ? 57   PRO A O   1 
ATOM   377  C  CB  . PRO A 1 55  ? -13.207 12.045  14.125  1.00 16.02 ? 57   PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 55  ? -12.340 13.215  13.853  1.00 16.61 ? 57   PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 55  ? -12.024 13.136  12.393  1.00 16.14 ? 57   PRO A CD  1 
ATOM   380  N  N   . LEU A 1 56  ? -15.499 13.876  12.803  1.00 16.64 ? 58   LEU A N   1 
ATOM   381  C  CA  . LEU A 1 56  ? -16.754 14.638  12.801  1.00 16.90 ? 58   LEU A CA  1 
ATOM   382  C  C   . LEU A 1 56  ? -16.994 15.219  11.435  1.00 16.97 ? 58   LEU A C   1 
ATOM   383  O  O   . LEU A 1 56  ? -16.060 15.735  10.849  1.00 18.74 ? 58   LEU A O   1 
ATOM   384  C  CB  . LEU A 1 56  ? -16.731 15.744  13.853  1.00 17.27 ? 58   LEU A CB  1 
ATOM   385  C  CG  . LEU A 1 56  ? -16.471 15.250  15.276  1.00 18.05 ? 58   LEU A CG  1 
ATOM   386  C  CD1 . LEU A 1 56  ? -16.558 16.382  16.297  1.00 19.50 ? 58   LEU A CD1 1 
ATOM   387  C  CD2 . LEU A 1 56  ? -17.430 14.136  15.645  1.00 18.36 ? 58   LEU A CD2 1 
ATOM   388  N  N   . PRO A 1 57  ? -18.220 15.140  10.892  1.00 17.34 ? 59   PRO A N   1 
ATOM   389  C  CA  . PRO A 1 57  ? -19.412 14.641  11.585  1.00 16.97 ? 59   PRO A CA  1 
ATOM   390  C  C   . PRO A 1 57  ? -19.459 13.119  11.679  1.00 16.50 ? 59   PRO A C   1 
ATOM   391  O  O   . PRO A 1 57  ? -18.851 12.412  10.872  1.00 15.09 ? 59   PRO A O   1 
ATOM   392  C  CB  . PRO A 1 57  ? -20.572 15.171  10.713  1.00 17.49 ? 59   PRO A CB  1 
ATOM   393  C  CG  . PRO A 1 57  ? -19.972 15.268  9.338   1.00 18.31 ? 59   PRO A CG  1 
ATOM   394  C  CD  . PRO A 1 57  ? -18.554 15.727  9.579   1.00 17.94 ? 59   PRO A CD  1 
ATOM   395  N  N   . GLU A 1 58  ? -20.170 12.632  12.683  1.00 15.59 ? 60   GLU A N   1 
ATOM   396  C  CA  . GLU A 1 58  ? -20.388 11.213  12.867  1.00 16.01 ? 60   GLU A CA  1 
ATOM   397  C  C   . GLU A 1 58  ? -21.319 10.634  11.797  1.00 14.97 ? 60   GLU A C   1 
ATOM   398  O  O   . GLU A 1 58  ? -22.055 11.365  11.141  1.00 13.95 ? 60   GLU A O   1 
ATOM   399  C  CB  . GLU A 1 58  ? -20.965 10.923  14.262  1.00 17.23 ? 60   GLU A CB  1 
ATOM   400  C  CG  . GLU A 1 58  ? -20.019 11.312  15.392  1.00 18.25 ? 60   GLU A CG  1 
ATOM   401  C  CD  . GLU A 1 58  ? -20.529 10.837  16.733  1.00 20.64 ? 60   GLU A CD  1 
ATOM   402  O  OE1 . GLU A 1 58  ? -21.515 11.429  17.234  1.00 23.12 ? 60   GLU A OE1 1 
ATOM   403  O  OE2 . GLU A 1 58  ? -19.985 9.857   17.261  1.00 23.26 ? 60   GLU A OE2 1 
ATOM   404  N  N   . LEU A 1 59  ? -21.255 9.315   11.664  1.00 14.11 ? 61   LEU A N   1 
ATOM   405  C  CA  . LEU A 1 59  ? -22.055 8.541   10.723  1.00 15.07 ? 61   LEU A CA  1 
ATOM   406  C  C   . LEU A 1 59  ? -23.048 7.689   11.482  1.00 15.33 ? 61   LEU A C   1 
ATOM   407  O  O   . LEU A 1 59  ? -22.763 7.272   12.625  1.00 15.83 ? 61   LEU A O   1 
ATOM   408  C  CB  . LEU A 1 59  ? -21.149 7.560   9.958   1.00 16.05 ? 61   LEU A CB  1 
ATOM   409  C  CG  . LEU A 1 59  ? -20.368 8.053   8.753   1.00 17.73 ? 61   LEU A CG  1 
ATOM   410  C  CD1 . LEU A 1 59  ? -19.924 9.483   8.875   1.00 18.59 ? 61   LEU A CD1 1 
ATOM   411  C  CD2 . LEU A 1 59  ? -19.204 7.117   8.429   1.00 18.28 ? 61   LEU A CD2 1 
ATOM   412  N  N   . ARG A 1 60  ? -24.164 7.351   10.834  1.00 14.86 ? 62   ARG A N   1 
ATOM   413  C  CA  . ARG A 1 60  ? -25.168 6.520   11.477  1.00 15.24 ? 62   ARG A CA  1 
ATOM   414  C  C   . ARG A 1 60  ? -24.984 5.062   11.126  1.00 14.62 ? 62   ARG A C   1 
ATOM   415  O  O   . ARG A 1 60  ? -24.862 4.703   9.940   1.00 14.48 ? 62   ARG A O   1 
ATOM   416  C  CB  . ARG A 1 60  ? -26.580 6.997   11.136  1.00 16.27 ? 62   ARG A CB  1 
ATOM   417  C  CG  . ARG A 1 60  ? -26.794 8.478   11.391  1.00 17.54 ? 62   ARG A CG  1 
ATOM   418  C  CD  . ARG A 1 60  ? -28.276 8.860   11.280  1.00 18.15 ? 62   ARG A CD  1 
ATOM   419  N  NE  . ARG A 1 60  ? -28.968 8.535   12.519  1.00 18.02 ? 62   ARG A NE  1 
ATOM   420  C  CZ  . ARG A 1 60  ? -28.878 9.243   13.646  1.00 17.42 ? 62   ARG A CZ  1 
ATOM   421  N  NH1 . ARG A 1 60  ? -28.145 10.344  13.712  1.00 18.08 ? 62   ARG A NH1 1 
ATOM   422  N  NH2 . ARG A 1 60  ? -29.537 8.847   14.715  1.00 17.34 ? 62   ARG A NH2 1 
ATOM   423  N  N   . LEU A 1 61  ? -24.963 4.234   12.169  1.00 14.02 ? 63   LEU A N   1 
ATOM   424  C  CA  . LEU A 1 61  ? -24.842 2.796   12.077  1.00 14.08 ? 63   LEU A CA  1 
ATOM   425  C  C   . LEU A 1 61  ? -26.102 2.186   12.622  1.00 15.20 ? 63   LEU A C   1 
ATOM   426  O  O   . LEU A 1 61  ? -26.482 2.468   13.761  1.00 15.51 ? 63   LEU A O   1 
ATOM   427  C  CB  . LEU A 1 61  ? -23.673 2.310   12.911  1.00 13.88 ? 63   LEU A CB  1 
ATOM   428  C  CG  . LEU A 1 61  ? -23.328 0.840   12.777  1.00 13.88 ? 63   LEU A CG  1 
ATOM   429  C  CD1 . LEU A 1 61  ? -22.700 0.587   11.418  1.00 14.13 ? 63   LEU A CD1 1 
ATOM   430  C  CD2 . LEU A 1 61  ? -22.363 0.449   13.874  1.00 14.62 ? 63   LEU A CD2 1 
ATOM   431  N  N   . ARG A 1 62  ? -26.744 1.344   11.827  1.00 15.74 ? 64   ARG A N   1 
ATOM   432  C  CA  . ARG A 1 62  ? -28.090 0.886   12.127  1.00 17.24 ? 64   ARG A CA  1 
ATOM   433  C  C   . ARG A 1 62  ? -28.220 -0.618  11.986  1.00 16.17 ? 64   ARG A C   1 
ATOM   434  O  O   . ARG A 1 62  ? -27.777 -1.192  10.994  1.00 13.96 ? 64   ARG A O   1 
ATOM   435  C  CB  . ARG A 1 62  ? -29.074 1.567   11.180  1.00 19.17 ? 64   ARG A CB  1 
ATOM   436  C  CG  . ARG A 1 62  ? -30.531 1.200   11.419  1.00 22.12 ? 64   ARG A CG  1 
ATOM   437  C  CD  . ARG A 1 62  ? -31.447 1.868   10.400  1.00 24.84 ? 64   ARG A CD  1 
ATOM   438  N  NE  . ARG A 1 62  ? -32.823 1.414   10.602  1.00 27.87 ? 64   ARG A NE  1 
ATOM   439  C  CZ  . ARG A 1 62  ? -33.617 1.817   11.596  1.00 30.55 ? 64   ARG A CZ  1 
ATOM   440  N  NH1 . ARG A 1 62  ? -33.214 2.730   12.498  1.00 31.88 ? 64   ARG A NH1 1 
ATOM   441  N  NH2 . ARG A 1 62  ? -34.844 1.313   11.690  1.00 32.68 ? 64   ARG A NH2 1 
ATOM   442  N  N   . ASN A 1 63  ? -28.858 -1.233  12.980  1.00 15.95 ? 65   ASN A N   1 
ATOM   443  C  CA  . ASN A 1 63  ? -29.316 -2.606  12.864  1.00 16.82 ? 65   ASN A CA  1 
ATOM   444  C  C   . ASN A 1 63  ? -30.697 -2.491  12.262  1.00 17.13 ? 65   ASN A C   1 
ATOM   445  O  O   . ASN A 1 63  ? -31.635 -2.055  12.945  1.00 18.35 ? 65   ASN A O   1 
ATOM   446  C  CB  . ASN A 1 63  ? -29.349 -3.289  14.235  1.00 17.15 ? 65   ASN A CB  1 
ATOM   447  C  CG  . ASN A 1 63  ? -30.028 -4.658  14.214  1.00 17.47 ? 65   ASN A CG  1 
ATOM   448  O  OD1 . ASN A 1 63  ? -30.674 -5.054  13.219  1.00 17.58 ? 65   ASN A OD1 1 
ATOM   449  N  ND2 . ASN A 1 63  ? -29.899 -5.390  15.334  1.00 17.37 ? 65   ASN A ND2 1 
ATOM   450  N  N   . ASN A 1 64  ? -30.846 -2.867  10.997  1.00 17.12 ? 66   ASN A N   1 
ATOM   451  C  CA  . ASN A 1 64  ? -32.160 -2.753  10.353  1.00 17.48 ? 66   ASN A CA  1 
ATOM   452  C  C   . ASN A 1 64  ? -32.971 -4.054  10.337  1.00 18.52 ? 66   ASN A C   1 
ATOM   453  O  O   . ASN A 1 64  ? -33.924 -4.163  9.585   1.00 19.25 ? 66   ASN A O   1 
ATOM   454  C  CB  . ASN A 1 64  ? -32.027 -2.195  8.951   1.00 17.08 ? 66   ASN A CB  1 
ATOM   455  C  CG  . ASN A 1 64  ? -31.197 -3.082  8.044   1.00 16.71 ? 66   ASN A CG  1 
ATOM   456  O  OD1 . ASN A 1 64  ? -31.146 -4.313  8.213   1.00 16.62 ? 66   ASN A OD1 1 
ATOM   457  N  ND2 . ASN A 1 64  ? -30.493 -2.451  7.108   1.00 16.45 ? 66   ASN A ND2 1 
ATOM   458  N  N   . GLY A 1 65  ? -32.569 -5.048  11.122  1.00 19.77 ? 67   GLY A N   1 
ATOM   459  C  CA  . GLY A 1 65  ? -33.273 -6.320  11.183  1.00 20.09 ? 67   GLY A CA  1 
ATOM   460  C  C   . GLY A 1 65  ? -32.728 -7.367  10.227  1.00 22.01 ? 67   GLY A C   1 
ATOM   461  O  O   . GLY A 1 65  ? -32.876 -8.563  10.495  1.00 22.73 ? 67   GLY A O   1 
ATOM   462  N  N   . HIS A 1 66  ? -32.132 -6.935  9.109   1.00 21.35 ? 68   HIS A N   1 
ATOM   463  C  CA  . HIS A 1 66  ? -31.531 -7.869  8.132   1.00 21.45 ? 68   HIS A CA  1 
ATOM   464  C  C   . HIS A 1 66  ? -30.035 -7.659  7.861   1.00 19.30 ? 68   HIS A C   1 
ATOM   465  O  O   . HIS A 1 66  ? -29.427 -8.481  7.190   1.00 18.62 ? 68   HIS A O   1 
ATOM   466  C  CB  . HIS A 1 66  ? -32.329 -7.883  6.810   1.00 23.31 ? 68   HIS A CB  1 
ATOM   467  C  CG  . HIS A 1 66  ? -32.620 -6.529  6.276   1.00 26.77 ? 68   HIS A CG  1 
ATOM   468  N  ND1 . HIS A 1 66  ? -33.758 -5.828  6.612   1.00 29.73 ? 68   HIS A ND1 1 
ATOM   469  C  CD2 . HIS A 1 66  ? -31.907 -5.721  5.462   1.00 29.11 ? 68   HIS A CD2 1 
ATOM   470  C  CE1 . HIS A 1 66  ? -33.736 -4.641  6.029   1.00 29.93 ? 68   HIS A CE1 1 
ATOM   471  N  NE2 . HIS A 1 66  ? -32.629 -4.555  5.314   1.00 31.18 ? 68   HIS A NE2 1 
ATOM   472  N  N   . SER A 1 67  ? -29.455 -6.590  8.393   1.00 17.07 ? 69   SER A N   1 
ATOM   473  C  CA  . SER A 1 67  ? -28.033 -6.339  8.298   1.00 16.96 ? 69   SER A CA  1 
ATOM   474  C  C   . SER A 1 67  ? -27.670 -5.257  9.288   1.00 15.79 ? 69   SER A C   1 
ATOM   475  O  O   . SER A 1 67  ? -28.546 -4.743  9.989   1.00 16.77 ? 69   SER A O   1 
ATOM   476  C  CB  . SER A 1 67  ? -27.622 -5.893  6.877   1.00 16.26 ? 69   SER A CB  1 
ATOM   477  O  OG  . SER A 1 67  ? -26.196 -5.906  6.742   1.00 16.26 ? 69   SER A OG  1 
ATOM   478  N  N   . VAL A 1 68  ? -26.379 -4.959  9.383   1.00 15.06 ? 70   VAL A N   1 
ATOM   479  C  CA  . VAL A 1 68  ? -25.909 -3.714  9.990   1.00 14.45 ? 70   VAL A CA  1 
ATOM   480  C  C   . VAL A 1 68  ? -25.439 -2.819  8.859   1.00 14.37 ? 70   VAL A C   1 
ATOM   481  O  O   . VAL A 1 68  ? -24.659 -3.259  8.012   1.00 13.79 ? 70   VAL A O   1 
ATOM   482  C  CB  . VAL A 1 68  ? -24.833 -3.898  11.097  1.00 14.92 ? 70   VAL A CB  1 
ATOM   483  C  CG1 . VAL A 1 68  ? -23.607 -4.693  10.641  1.00 14.71 ? 70   VAL A CG1 1 
ATOM   484  C  CG2 . VAL A 1 68  ? -24.439 -2.557  11.685  1.00 14.79 ? 70   VAL A CG2 1 
ATOM   485  N  N   . GLN A 1 69  ? -25.905 -1.572  8.855   1.00 13.98 ? 71   GLN A N   1 
ATOM   486  C  CA  . GLN A 1 69  ? -25.680 -0.647  7.751   1.00 14.12 ? 71   GLN A CA  1 
ATOM   487  C  C   . GLN A 1 69  ? -25.139 0.670   8.254   1.00 13.60 ? 71   GLN A C   1 
ATOM   488  O  O   . GLN A 1 69  ? -25.698 1.274   9.165   1.00 14.64 ? 71   GLN A O   1 
ATOM   489  C  CB  . GLN A 1 69  ? -26.964 -0.429  6.957   1.00 14.94 ? 71   GLN A CB  1 
ATOM   490  C  CG  . GLN A 1 69  ? -26.862 0.576   5.803   1.00 15.43 ? 71   GLN A CG  1 
ATOM   491  C  CD  . GLN A 1 69  ? -28.014 0.503   4.804   1.00 16.22 ? 71   GLN A CD  1 
ATOM   492  O  OE1 . GLN A 1 69  ? -28.482 1.521   4.301   1.00 18.66 ? 71   GLN A OE1 1 
ATOM   493  N  NE2 . GLN A 1 69  ? -28.438 -0.677  4.486   1.00 16.49 ? 71   GLN A NE2 1 
ATOM   494  N  N   . LEU A 1 70  ? -24.041 1.096   7.648   1.00 12.70 ? 72   LEU A N   1 
ATOM   495  C  CA  . LEU A 1 70  ? -23.439 2.369   7.897   1.00 12.55 ? 72   LEU A CA  1 
ATOM   496  C  C   . LEU A 1 70  ? -23.801 3.304   6.775   1.00 12.61 ? 72   LEU A C   1 
ATOM   497  O  O   . LEU A 1 70  ? -23.472 3.047   5.610   1.00 12.64 ? 72   LEU A O   1 
ATOM   498  C  CB  . LEU A 1 70  ? -21.919 2.225   7.961   1.00 12.55 ? 72   LEU A CB  1 
ATOM   499  C  CG  . LEU A 1 70  ? -21.122 3.476   8.322   1.00 12.54 ? 72   LEU A CG  1 
ATOM   500  C  CD1 . LEU A 1 70  ? -21.307 3.866   9.786   1.00 12.49 ? 72   LEU A CD1 1 
ATOM   501  C  CD2 . LEU A 1 70  ? -19.671 3.173   8.034   1.00 12.89 ? 72   LEU A CD2 1 
ATOM   502  N  N   . THR A 1 71  ? -24.389 4.435   7.129   1.00 12.35 ? 73   THR A N   1 
ATOM   503  C  CA  . THR A 1 71  ? -24.777 5.436   6.171   1.00 12.96 ? 73   THR A CA  1 
ATOM   504  C  C   . THR A 1 71  ? -23.568 6.299   5.898   1.00 13.02 ? 73   THR A C   1 
ATOM   505  O  O   . THR A 1 71  ? -22.931 6.809   6.823   1.00 13.02 ? 73   THR A O   1 
ATOM   506  C  CB  . THR A 1 71  ? -25.951 6.291   6.716   1.00 14.46 ? 73   THR A CB  1 
ATOM   507  O  OG1 . THR A 1 71  ? -27.094 5.448   6.906   1.00 14.02 ? 73   THR A OG1 1 
ATOM   508  C  CG2 . THR A 1 71  ? -26.316 7.426   5.728   1.00 14.90 ? 73   THR A CG2 1 
ATOM   509  N  N   . LEU A 1 72  ? -23.259 6.493   4.621   1.00 12.72 ? 74   LEU A N   1 
ATOM   510  C  CA  . LEU A 1 72  ? -22.071 7.234   4.239   1.00 13.66 ? 74   LEU A CA  1 
ATOM   511  C  C   . LEU A 1 72  ? -22.439 8.662   3.898   1.00 13.70 ? 74   LEU A C   1 
ATOM   512  O  O   . LEU A 1 72  ? -23.518 8.894   3.380   1.00 13.82 ? 74   LEU A O   1 
ATOM   513  C  CB  . LEU A 1 72  ? -21.374 6.531   3.063   1.00 13.17 ? 74   LEU A CB  1 
ATOM   514  C  CG  . LEU A 1 72  ? -20.839 5.139   3.459   1.00 13.16 ? 74   LEU A CG  1 
ATOM   515  C  CD1 . LEU A 1 72  ? -20.314 4.360   2.261   1.00 13.41 ? 74   LEU A CD1 1 
ATOM   516  C  CD2 . LEU A 1 72  ? -19.757 5.251   4.527   1.00 13.63 ? 74   LEU A CD2 1 
ATOM   517  N  N   . PRO A 1 73  ? -21.542 9.623   4.166   1.00 13.57 ? 75   PRO A N   1 
ATOM   518  C  CA  . PRO A 1 73  ? -21.857 11.028  3.921   1.00 14.31 ? 75   PRO A CA  1 
ATOM   519  C  C   . PRO A 1 73  ? -21.670 11.398  2.462   1.00 15.31 ? 75   PRO A C   1 
ATOM   520  O  O   . PRO A 1 73  ? -21.196 10.577  1.681   1.00 14.48 ? 75   PRO A O   1 
ATOM   521  C  CB  . PRO A 1 73  ? -20.860 11.772  4.824   1.00 14.02 ? 75   PRO A CB  1 
ATOM   522  C  CG  . PRO A 1 73  ? -19.659 10.879  4.805   1.00 14.18 ? 75   PRO A CG  1 
ATOM   523  C  CD  . PRO A 1 73  ? -20.202 9.471   4.764   1.00 14.47 ? 75   PRO A CD  1 
ATOM   524  N  N   . PRO A 1 74  ? -22.072 12.620  2.075   1.00 17.73 ? 76   PRO A N   1 
ATOM   525  C  CA  . PRO A 1 74  ? -21.763 13.073  0.731   1.00 18.40 ? 76   PRO A CA  1 
ATOM   526  C  C   . PRO A 1 74  ? -20.265 13.185  0.505   1.00 17.85 ? 76   PRO A C   1 
ATOM   527  O  O   . PRO A 1 74  ? -19.511 13.336  1.476   1.00 18.56 ? 76   PRO A O   1 
ATOM   528  C  CB  . PRO A 1 74  ? -22.401 14.478  0.681   1.00 18.84 ? 76   PRO A CB  1 
ATOM   529  C  CG  . PRO A 1 74  ? -23.451 14.467  1.748   1.00 19.06 ? 76   PRO A CG  1 
ATOM   530  C  CD  . PRO A 1 74  ? -22.856 13.633  2.826   1.00 18.92 ? 76   PRO A CD  1 
ATOM   531  N  N   . GLY A 1 75  ? -19.853 13.094  -0.760  1.00 16.85 ? 77   GLY A N   1 
ATOM   532  C  CA  . GLY A 1 75  ? -18.469 13.341  -1.168  1.00 16.51 ? 77   GLY A CA  1 
ATOM   533  C  C   . GLY A 1 75  ? -17.582 12.127  -1.329  1.00 15.80 ? 77   GLY A C   1 
ATOM   534  O  O   . GLY A 1 75  ? -16.370 12.278  -1.466  1.00 16.15 ? 77   GLY A O   1 
ATOM   535  N  N   . LEU A 1 76  ? -18.143 10.923  -1.279  1.00 14.67 ? 78   LEU A N   1 
ATOM   536  C  CA  . LEU A 1 76  ? -17.323 9.721   -1.481  1.00 15.09 ? 78   LEU A CA  1 
ATOM   537  C  C   . LEU A 1 76  ? -17.488 9.314   -2.928  1.00 15.68 ? 78   LEU A C   1 
ATOM   538  O  O   . LEU A 1 76  ? -18.546 8.815   -3.305  1.00 16.57 ? 78   LEU A O   1 
ATOM   539  C  CB  . LEU A 1 76  ? -17.719 8.586   -0.545  1.00 14.89 ? 78   LEU A CB  1 
ATOM   540  C  CG  . LEU A 1 76  ? -17.103 8.708   0.853   1.00 15.28 ? 78   LEU A CG  1 
ATOM   541  C  CD1 . LEU A 1 76  ? -17.686 9.860   1.650   1.00 16.52 ? 78   LEU A CD1 1 
ATOM   542  C  CD2 . LEU A 1 76  ? -17.296 7.421   1.619   1.00 15.70 ? 78   LEU A CD2 1 
ATOM   543  N  N   . GLU A 1 77  ? -16.456 9.538   -3.735  1.00 15.90 ? 79   GLU A N   1 
ATOM   544  C  CA  . GLU A 1 77  ? -16.541 9.283   -5.161  1.00 17.31 ? 79   GLU A CA  1 
ATOM   545  C  C   . GLU A 1 77  ? -15.817 7.989   -5.515  1.00 15.60 ? 79   GLU A C   1 
ATOM   546  O  O   . GLU A 1 77  ? -14.750 7.661   -4.972  1.00 14.36 ? 79   GLU A O   1 
ATOM   547  C  CB  . GLU A 1 77  ? -15.980 10.460  -5.949  1.00 20.87 ? 79   GLU A CB  1 
ATOM   548  C  CG  . GLU A 1 77  ? -16.604 11.806  -5.577  1.00 24.16 ? 79   GLU A CG  1 
ATOM   549  C  CD  . GLU A 1 77  ? -15.967 12.980  -6.309  1.00 27.57 ? 79   GLU A CD  1 
ATOM   550  O  OE1 . GLU A 1 77  ? -15.499 12.813  -7.450  1.00 34.27 ? 79   GLU A OE1 1 
ATOM   551  O  OE2 . GLU A 1 77  ? -15.947 14.089  -5.752  1.00 33.50 ? 79   GLU A OE2 1 
ATOM   552  N  N   . MET A 1 78  ? -16.420 7.244   -6.425  1.00 14.84 ? 80   MET A N   1 
ATOM   553  C  CA  . MET A 1 78  ? -15.868 5.984   -6.874  1.00 14.32 ? 80   MET A CA  1 
ATOM   554  C  C   . MET A 1 78  ? -16.025 5.918   -8.372  1.00 14.01 ? 80   MET A C   1 
ATOM   555  O  O   . MET A 1 78  ? -17.097 6.230   -8.892  1.00 13.76 ? 80   MET A O   1 
ATOM   556  C  CB  . MET A 1 78  ? -16.588 4.818   -6.215  1.00 14.42 ? 80   MET A CB  1 
ATOM   557  C  CG  . MET A 1 78  ? -16.009 3.439   -6.529  1.00 14.34 ? 80   MET A CG  1 
ATOM   558  S  SD  . MET A 1 78  ? -16.548 2.731   -8.095  1.00 15.11 ? 80   MET A SD  1 
ATOM   559  C  CE  . MET A 1 78  ? -18.251 2.294   -7.732  1.00 14.56 ? 80   MET A CE  1 
ATOM   560  N  N   . ALA A 1 79  ? -14.981 5.469   -9.062  1.00 13.35 ? 81   ALA A N   1 
ATOM   561  C  CA  . ALA A 1 79  ? -15.075 5.247   -10.512 1.00 13.45 ? 81   ALA A CA  1 
ATOM   562  C  C   . ALA A 1 79  ? -14.697 3.823   -10.887 1.00 12.98 ? 81   ALA A C   1 
ATOM   563  O  O   . ALA A 1 79  ? -13.663 3.313   -10.457 1.00 12.29 ? 81   ALA A O   1 
ATOM   564  C  CB  . ALA A 1 79  ? -14.193 6.244   -11.250 1.00 13.58 ? 81   ALA A CB  1 
ATOM   565  N  N   . LEU A 1 80  ? -15.528 3.193   -11.712 1.00 12.95 ? 82   LEU A N   1 
ATOM   566  C  CA  . LEU A 1 80  ? -15.226 1.884   -12.264 1.00 13.41 ? 82   LEU A CA  1 
ATOM   567  C  C   . LEU A 1 80  ? -14.278 1.971   -13.434 1.00 13.71 ? 82   LEU A C   1 
ATOM   568  O  O   . LEU A 1 80  ? -13.707 0.964   -13.839 1.00 15.33 ? 82   LEU A O   1 
ATOM   569  C  CB  . LEU A 1 80  ? -16.499 1.159   -12.712 1.00 12.89 ? 82   LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 80  ? -17.508 0.924   -11.598 1.00 12.87 ? 82   LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 80  ? -18.782 0.333   -12.199 1.00 12.92 ? 82   LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 80  ? -16.937 -0.022  -10.550 1.00 12.84 ? 82   LEU A CD2 1 
ATOM   573  N  N   . GLY A 1 81  ? -14.147 3.154   -13.991 1.00 13.48 ? 83   GLY A N   1 
ATOM   574  C  CA  . GLY A 1 81  ? -13.253 3.411   -15.085 1.00 13.97 ? 83   GLY A CA  1 
ATOM   575  C  C   . GLY A 1 81  ? -13.494 4.840   -15.515 1.00 13.95 ? 83   GLY A C   1 
ATOM   576  O  O   . GLY A 1 81  ? -14.386 5.515   -14.966 1.00 13.52 ? 83   GLY A O   1 
ATOM   577  N  N   . PRO A 1 82  ? -12.695 5.326   -16.472 1.00 15.03 ? 84   PRO A N   1 
ATOM   578  C  CA  . PRO A 1 82  ? -12.886 6.674   -17.012 1.00 15.21 ? 84   PRO A CA  1 
ATOM   579  C  C   . PRO A 1 82  ? -14.326 6.875   -17.510 1.00 15.22 ? 84   PRO A C   1 
ATOM   580  O  O   . PRO A 1 82  ? -14.832 6.088   -18.305 1.00 14.86 ? 84   PRO A O   1 
ATOM   581  C  CB  . PRO A 1 82  ? -11.885 6.729   -18.164 1.00 15.29 ? 84   PRO A CB  1 
ATOM   582  C  CG  . PRO A 1 82  ? -10.821 5.760   -17.769 1.00 15.04 ? 84   PRO A CG  1 
ATOM   583  C  CD  . PRO A 1 82  ? -11.542 4.643   -17.097 1.00 14.95 ? 84   PRO A CD  1 
ATOM   584  N  N   . GLY A 1 83  ? -14.986 7.884   -16.973 1.00 16.28 ? 85   GLY A N   1 
ATOM   585  C  CA  . GLY A 1 83  ? -16.365 8.178   -17.326 1.00 18.13 ? 85   GLY A CA  1 
ATOM   586  C  C   . GLY A 1 83  ? -17.439 7.308   -16.691 1.00 19.57 ? 85   GLY A C   1 
ATOM   587  O  O   . GLY A 1 83  ? -18.602 7.473   -17.042 1.00 22.50 ? 85   GLY A O   1 
ATOM   588  N  N   . ARG A 1 84  ? -17.078 6.405   -15.774 1.00 18.11 ? 86   ARG A N   1 
ATOM   589  C  CA  . ARG A 1 84  ? -18.034 5.511   -15.094 1.00 16.65 ? 86   ARG A CA  1 
ATOM   590  C  C   . ARG A 1 84  ? -18.036 5.905   -13.602 1.00 15.01 ? 86   ARG A C   1 
ATOM   591  O  O   . ARG A 1 84  ? -17.446 5.233   -12.774 1.00 13.66 ? 86   ARG A O   1 
ATOM   592  C  CB  . ARG A 1 84  ? -17.655 4.038   -15.310 1.00 17.62 ? 86   ARG A CB  1 
ATOM   593  C  CG  . ARG A 1 84  ? -17.599 3.574   -16.784 1.00 19.36 ? 86   ARG A CG  1 
ATOM   594  C  CD  . ARG A 1 84  ? -16.962 2.182   -16.896 1.00 21.25 ? 86   ARG A CD  1 
ATOM   595  N  NE  . ARG A 1 84  ? -17.820 1.143   -16.322 1.00 22.30 ? 86   ARG A NE  1 
ATOM   596  C  CZ  . ARG A 1 84  ? -17.437 -0.066  -15.911 1.00 25.15 ? 86   ARG A CZ  1 
ATOM   597  N  NH1 . ARG A 1 84  ? -16.176 -0.503  -16.010 1.00 25.96 ? 86   ARG A NH1 1 
ATOM   598  N  NH2 . ARG A 1 84  ? -18.352 -0.875  -15.385 1.00 26.88 ? 86   ARG A NH2 1 
ATOM   599  N  N   . GLU A 1 85  ? -18.714 7.011   -13.283 1.00 14.25 ? 87   GLU A N   1 
ATOM   600  C  CA  . GLU A 1 85  ? -18.567 7.674   -11.988 1.00 14.98 ? 87   GLU A CA  1 
ATOM   601  C  C   . GLU A 1 85  ? -19.764 7.487   -11.102 1.00 13.66 ? 87   GLU A C   1 
ATOM   602  O  O   . GLU A 1 85  ? -20.883 7.490   -11.581 1.00 12.88 ? 87   GLU A O   1 
ATOM   603  C  CB  . GLU A 1 85  ? -18.283 9.164   -12.206 1.00 17.14 ? 87   GLU A CB  1 
ATOM   604  C  CG  . GLU A 1 85  ? -16.983 9.369   -12.969 1.00 19.28 ? 87   GLU A CG  1 
ATOM   605  C  CD  . GLU A 1 85  ? -16.553 10.814  -13.075 1.00 22.50 ? 87   GLU A CD  1 
ATOM   606  O  OE1 . GLU A 1 85  ? -17.300 11.698  -12.646 1.00 25.64 ? 87   GLU A OE1 1 
ATOM   607  O  OE2 . GLU A 1 85  ? -15.448 11.083  -13.574 1.00 24.52 ? 87   GLU A OE2 1 
ATOM   608  N  N   . TYR A 1 86  ? -19.497 7.337   -9.806  1.00 13.09 ? 88   TYR A N   1 
ATOM   609  C  CA  . TYR A 1 86  ? -20.466 6.951   -8.795  1.00 12.65 ? 88   TYR A CA  1 
ATOM   610  C  C   . TYR A 1 86  ? -20.187 7.700   -7.485  1.00 13.32 ? 88   TYR A C   1 
ATOM   611  O  O   . TYR A 1 86  ? -19.082 8.176   -7.270  1.00 12.86 ? 88   TYR A O   1 
ATOM   612  C  CB  . TYR A 1 86  ? -20.411 5.421   -8.542  1.00 12.38 ? 88   TYR A CB  1 
ATOM   613  C  CG  . TYR A 1 86  ? -20.906 4.628   -9.700  1.00 11.90 ? 88   TYR A CG  1 
ATOM   614  C  CD1 . TYR A 1 86  ? -20.070 4.326   -10.758 1.00 11.74 ? 88   TYR A CD1 1 
ATOM   615  C  CD2 . TYR A 1 86  ? -22.244 4.193   -9.766  1.00 11.91 ? 88   TYR A CD2 1 
ATOM   616  C  CE1 . TYR A 1 86  ? -20.545 3.648   -11.876 1.00 11.84 ? 88   TYR A CE1 1 
ATOM   617  C  CE2 . TYR A 1 86  ? -22.727 3.501   -10.869 1.00 11.44 ? 88   TYR A CE2 1 
ATOM   618  C  CZ  . TYR A 1 86  ? -21.867 3.222   -11.925 1.00 11.93 ? 88   TYR A CZ  1 
ATOM   619  O  OH  . TYR A 1 86  ? -22.308 2.552   -13.046 1.00 11.84 ? 88   TYR A OH  1 
ATOM   620  N  N   . ARG A 1 87  ? -21.198 7.792   -6.626  1.00 14.30 ? 89   ARG A N   1 
ATOM   621  C  CA  . ARG A 1 87  ? -21.050 8.295   -5.261  1.00 15.62 ? 89   ARG A CA  1 
ATOM   622  C  C   . ARG A 1 87  ? -21.538 7.239   -4.269  1.00 13.99 ? 89   ARG A C   1 
ATOM   623  O  O   . ARG A 1 87  ? -22.573 6.614   -4.479  1.00 12.44 ? 89   ARG A O   1 
ATOM   624  C  CB  . ARG A 1 87  ? -21.827 9.599   -5.079  1.00 20.03 ? 89   ARG A CB  1 
ATOM   625  C  CG  . ARG A 1 87  ? -21.170 10.765  -5.804  1.00 25.54 ? 89   ARG A CG  1 
ATOM   626  C  CD  . ARG A 1 87  ? -22.093 11.983  -5.944  1.00 31.33 ? 89   ARG A CD  1 
ATOM   627  N  NE  . ARG A 1 87  ? -21.540 13.011  -6.861  1.00 34.14 ? 89   ARG A NE  1 
ATOM   628  C  CZ  . ARG A 1 87  ? -22.210 13.610  -7.866  1.00 36.61 ? 89   ARG A CZ  1 
ATOM   629  N  NH1 . ARG A 1 87  ? -23.500 13.342  -8.132  1.00 40.61 ? 89   ARG A NH1 1 
ATOM   630  N  NH2 . ARG A 1 87  ? -21.591 14.511  -8.624  1.00 38.48 ? 89   ARG A NH2 1 
ATOM   631  N  N   . ALA A 1 88  ? -20.785 7.031   -3.200  1.00 12.90 ? 90   ALA A N   1 
ATOM   632  C  CA  . ALA A 1 88  ? -21.142 6.002   -2.215  1.00 13.16 ? 90   ALA A CA  1 
ATOM   633  C  C   . ALA A 1 88  ? -22.321 6.469   -1.366  1.00 13.41 ? 90   ALA A C   1 
ATOM   634  O  O   . ALA A 1 88  ? -22.374 7.641   -0.972  1.00 13.74 ? 90   ALA A O   1 
ATOM   635  C  CB  . ALA A 1 88  ? -19.953 5.657   -1.325  1.00 13.03 ? 90   ALA A CB  1 
ATOM   636  N  N   . LEU A 1 89  ? -23.241 5.546   -1.103  1.00 13.54 ? 91   LEU A N   1 
ATOM   637  C  CA  . LEU A 1 89  ? -24.423 5.791   -0.268  1.00 14.00 ? 91   LEU A CA  1 
ATOM   638  C  C   . LEU A 1 89  ? -24.343 5.173   1.116   1.00 13.07 ? 91   LEU A C   1 
ATOM   639  O  O   . LEU A 1 89  ? -24.658 5.810   2.122   1.00 12.15 ? 91   LEU A O   1 
ATOM   640  C  CB  . LEU A 1 89  ? -25.662 5.246   -0.970  1.00 14.80 ? 91   LEU A CB  1 
ATOM   641  C  CG  . LEU A 1 89  ? -25.938 5.849   -2.345  1.00 15.91 ? 91   LEU A CG  1 
ATOM   642  C  CD1 . LEU A 1 89  ? -27.151 5.175   -2.935  1.00 17.19 ? 91   LEU A CD1 1 
ATOM   643  C  CD2 . LEU A 1 89  ? -26.119 7.355   -2.314  1.00 17.01 ? 91   LEU A CD2 1 
ATOM   644  N  N   . GLN A 1 90  ? -23.915 3.927   1.165   1.00 12.48 ? 92   GLN A N   1 
ATOM   645  C  CA  . GLN A 1 90  ? -23.984 3.145   2.399   1.00 11.85 ? 92   GLN A CA  1 
ATOM   646  C  C   . GLN A 1 90  ? -23.165 1.893   2.235   1.00 11.42 ? 92   GLN A C   1 
ATOM   647  O  O   . GLN A 1 90  ? -22.876 1.474   1.084   1.00 11.60 ? 92   GLN A O   1 
ATOM   648  C  CB  . GLN A 1 90  ? -25.433 2.755   2.720   1.00 11.93 ? 92   GLN A CB  1 
ATOM   649  C  CG  . GLN A 1 90  ? -26.167 2.045   1.576   1.00 11.94 ? 92   GLN A CG  1 
ATOM   650  C  CD  . GLN A 1 90  ? -26.359 0.543   1.760   1.00 12.46 ? 92   GLN A CD  1 
ATOM   651  O  OE1 . GLN A 1 90  ? -25.626 -0.121  2.485   1.00 12.10 ? 92   GLN A OE1 1 
ATOM   652  N  NE2 . GLN A 1 90  ? -27.364 -0.001  1.083   1.00 13.49 ? 92   GLN A NE2 1 
ATOM   653  N  N   . LEU A 1 91  ? -22.786 1.301   3.358   1.00 10.60 ? 93   LEU A N   1 
ATOM   654  C  CA  . LEU A 1 91  ? -22.235 -0.061  3.343   1.00 10.91 ? 93   LEU A CA  1 
ATOM   655  C  C   . LEU A 1 91  ? -22.890 -0.942  4.405   1.00 11.37 ? 93   LEU A C   1 
ATOM   656  O  O   . LEU A 1 91  ? -23.425 -0.447  5.396   1.00 10.91 ? 93   LEU A O   1 
ATOM   657  C  CB  . LEU A 1 91  ? -20.693 -0.043  3.466   1.00 10.96 ? 93   LEU A CB  1 
ATOM   658  C  CG  . LEU A 1 91  ? -20.072 0.486   4.765   1.00 10.94 ? 93   LEU A CG  1 
ATOM   659  C  CD1 . LEU A 1 91  ? -20.032 -0.576  5.868   1.00 11.15 ? 93   LEU A CD1 1 
ATOM   660  C  CD2 . LEU A 1 91  ? -18.654 1.018   4.510   1.00 10.96 ? 93   LEU A CD2 1 
ATOM   661  N  N   . HIS A 1 92  ? -22.876 -2.244  4.173   1.00 11.56 ? 94   HIS A N   1 
ATOM   662  C  CA  . HIS A 1 92  ? -23.480 -3.196  5.091   1.00 11.82 ? 94   HIS A CA  1 
ATOM   663  C  C   . HIS A 1 92  ? -22.813 -4.527  4.916   1.00 12.43 ? 94   HIS A C   1 
ATOM   664  O  O   . HIS A 1 92  ? -22.011 -4.725  3.979   1.00 12.07 ? 94   HIS A O   1 
ATOM   665  C  CB  . HIS A 1 92  ? -25.013 -3.318  4.851   1.00 12.18 ? 94   HIS A CB  1 
ATOM   666  C  CG  . HIS A 1 92  ? -25.354 -3.763  3.466   1.00 12.04 ? 94   HIS A CG  1 
ATOM   667  N  ND1 . HIS A 1 92  ? -25.463 -2.875  2.424   1.00 12.23 ? 94   HIS A ND1 1 
ATOM   668  C  CD2 . HIS A 1 92  ? -25.469 -4.996  2.921   1.00 12.42 ? 94   HIS A CD2 1 
ATOM   669  C  CE1 . HIS A 1 92  ? -25.699 -3.531  1.305   1.00 12.66 ? 94   HIS A CE1 1 
ATOM   670  N  NE2 . HIS A 1 92  ? -25.671 -4.819  1.571   1.00 12.46 ? 94   HIS A NE2 1 
ATOM   671  N  N   . LEU A 1 93  ? -23.150 -5.447  5.825   1.00 13.19 ? 95   LEU A N   1 
ATOM   672  C  CA  . LEU A 1 93  ? -22.520 -6.741  5.890   1.00 13.46 ? 95   LEU A CA  1 
ATOM   673  C  C   . LEU A 1 93  ? -23.505 -7.910  5.812   1.00 13.13 ? 95   LEU A C   1 
ATOM   674  O  O   . LEU A 1 93  ? -24.681 -7.804  6.139   1.00 12.86 ? 95   LEU A O   1 
ATOM   675  C  CB  . LEU A 1 93  ? -21.711 -6.848  7.211   1.00 14.14 ? 95   LEU A CB  1 
ATOM   676  C  CG  . LEU A 1 93  ? -20.696 -5.740  7.501   1.00 15.08 ? 95   LEU A CG  1 
ATOM   677  C  CD1 . LEU A 1 93  ? -20.071 -5.889  8.882   1.00 15.73 ? 95   LEU A CD1 1 
ATOM   678  C  CD2 . LEU A 1 93  ? -19.606 -5.738  6.461   1.00 15.95 ? 95   LEU A CD2 1 
ATOM   679  N  N   . HIS A 1 94  ? -22.970 -9.043  5.378   1.00 13.09 ? 96   HIS A N   1 
ATOM   680  C  CA  . HIS A 1 94  ? -23.669 -10.311 5.357   1.00 13.83 ? 96   HIS A CA  1 
ATOM   681  C  C   . HIS A 1 94  ? -22.759 -11.345 5.985   1.00 14.50 ? 96   HIS A C   1 
ATOM   682  O  O   . HIS A 1 94  ? -21.563 -11.372 5.695   1.00 14.74 ? 96   HIS A O   1 
ATOM   683  C  CB  . HIS A 1 94  ? -24.000 -10.750 3.935   1.00 13.67 ? 96   HIS A CB  1 
ATOM   684  C  CG  . HIS A 1 94  ? -24.825 -9.770  3.170   1.00 13.40 ? 96   HIS A CG  1 
ATOM   685  N  ND1 . HIS A 1 94  ? -26.197 -9.835  3.124   1.00 13.70 ? 96   HIS A ND1 1 
ATOM   686  C  CD2 . HIS A 1 94  ? -24.470 -8.719  2.393   1.00 13.48 ? 96   HIS A CD2 1 
ATOM   687  C  CE1 . HIS A 1 94  ? -26.656 -8.857  2.367   1.00 13.53 ? 96   HIS A CE1 1 
ATOM   688  N  NE2 . HIS A 1 94  ? -25.625 -8.171  1.909   1.00 12.91 ? 96   HIS A NE2 1 
ATOM   689  N  N   . TRP A 1 95  ? -23.333 -12.200 6.826   1.00 15.25 ? 97   TRP A N   1 
ATOM   690  C  CA  . TRP A 1 95  ? -22.553 -13.121 7.630   1.00 15.76 ? 97   TRP A CA  1 
ATOM   691  C  C   . TRP A 1 95  ? -23.343 -14.375 7.977   1.00 16.71 ? 97   TRP A C   1 
ATOM   692  O  O   . TRP A 1 95  ? -24.507 -14.502 7.640   1.00 16.85 ? 97   TRP A O   1 
ATOM   693  C  CB  . TRP A 1 95  ? -22.090 -12.419 8.889   1.00 15.27 ? 97   TRP A CB  1 
ATOM   694  C  CG  . TRP A 1 95  ? -23.212 -11.979 9.791   1.00 15.56 ? 97   TRP A CG  1 
ATOM   695  C  CD1 . TRP A 1 95  ? -23.847 -12.729 10.730  1.00 15.36 ? 97   TRP A CD1 1 
ATOM   696  C  CD2 . TRP A 1 95  ? -23.812 -10.681 9.837   1.00 15.36 ? 97   TRP A CD2 1 
ATOM   697  N  NE1 . TRP A 1 95  ? -24.810 -11.978 11.372  1.00 15.90 ? 97   TRP A NE1 1 
ATOM   698  C  CE2 . TRP A 1 95  ? -24.807 -10.716 10.843  1.00 15.54 ? 97   TRP A CE2 1 
ATOM   699  C  CE3 . TRP A 1 95  ? -23.600 -9.489  9.130   1.00 15.21 ? 97   TRP A CE3 1 
ATOM   700  C  CZ2 . TRP A 1 95  ? -25.587 -9.612  11.166  1.00 15.87 ? 97   TRP A CZ2 1 
ATOM   701  C  CZ3 . TRP A 1 95  ? -24.384 -8.375  9.447   1.00 15.33 ? 97   TRP A CZ3 1 
ATOM   702  C  CH2 . TRP A 1 95  ? -25.365 -8.445  10.464  1.00 15.70 ? 97   TRP A CH2 1 
ATOM   703  N  N   . GLY A 1 96  ? -22.662 -15.323 8.600   1.00 19.27 ? 98   GLY A N   1 
ATOM   704  C  CA  . GLY A 1 96  ? -23.251 -16.628 8.901   1.00 20.58 ? 98   GLY A CA  1 
ATOM   705  C  C   . GLY A 1 96  ? -23.560 -16.760 10.385  1.00 21.25 ? 98   GLY A C   1 
ATOM   706  O  O   . GLY A 1 96  ? -24.257 -15.936 10.954  1.00 20.64 ? 98   GLY A O   1 
ATOM   707  N  N   . ALA A 1 97  ? -23.044 -17.814 10.991  1.00 22.90 ? 99   ALA A N   1 
ATOM   708  C  CA  . ALA A 1 97  ? -23.335 -18.156 12.388  1.00 25.48 ? 99   ALA A CA  1 
ATOM   709  C  C   . ALA A 1 97  ? -22.199 -19.057 12.859  1.00 28.13 ? 99   ALA A C   1 
ATOM   710  O  O   . ALA A 1 97  ? -21.356 -19.457 12.042  1.00 28.50 ? 99   ALA A O   1 
ATOM   711  C  CB  . ALA A 1 97  ? -24.682 -18.866 12.493  1.00 24.47 ? 99   ALA A CB  1 
ATOM   712  N  N   . ALA A 1 98  ? -22.164 -19.368 14.154  1.00 29.33 ? 100  ALA A N   1 
ATOM   713  C  CA  . ALA A 1 98  ? -21.108 -20.216 14.724  1.00 30.91 ? 100  ALA A CA  1 
ATOM   714  C  C   . ALA A 1 98  ? -20.801 -21.400 13.808  1.00 31.53 ? 100  ALA A C   1 
ATOM   715  O  O   . ALA A 1 98  ? -21.682 -22.205 13.509  1.00 32.38 ? 100  ALA A O   1 
ATOM   716  C  CB  . ALA A 1 98  ? -21.506 -20.711 16.104  1.00 31.42 ? 100  ALA A CB  1 
ATOM   717  N  N   . GLY A 1 99  ? -19.570 -21.441 13.311  1.00 33.30 ? 101  GLY A N   1 
ATOM   718  C  CA  . GLY A 1 99  ? -19.109 -22.485 12.415  1.00 33.72 ? 101  GLY A CA  1 
ATOM   719  C  C   . GLY A 1 99  ? -19.805 -22.608 11.066  1.00 36.19 ? 101  GLY A C   1 
ATOM   720  O  O   . GLY A 1 99  ? -19.734 -23.677 10.458  1.00 38.50 ? 101  GLY A O   1 
ATOM   721  N  N   . ARG A 1 100 ? -20.479 -21.555 10.587  1.00 32.00 ? 102  ARG A N   1 
ATOM   722  C  CA  . ARG A 1 100 ? -21.180 -21.617 9.293   1.00 30.04 ? 102  ARG A CA  1 
ATOM   723  C  C   . ARG A 1 100 ? -20.920 -20.316 8.525   1.00 26.17 ? 102  ARG A C   1 
ATOM   724  O  O   . ARG A 1 100 ? -21.167 -19.248 9.052   1.00 24.96 ? 102  ARG A O   1 
ATOM   725  C  CB  . ARG A 1 100 ? -22.679 -21.809 9.476   1.00 31.46 ? 102  ARG A CB  1 
ATOM   726  C  CG  . ARG A 1 100 ? -23.070 -23.134 10.109  1.00 35.47 ? 102  ARG A CG  1 
ATOM   727  C  CD  . ARG A 1 100 ? -24.545 -23.166 10.485  1.00 37.04 ? 102  ARG A CD  1 
ATOM   728  N  NE  . ARG A 1 100 ? -25.396 -23.296 9.304   1.00 41.81 ? 102  ARG A NE  1 
ATOM   729  C  CZ  . ARG A 1 100 ? -26.734 -23.264 9.314   1.00 42.19 ? 102  ARG A CZ  1 
ATOM   730  N  NH1 . ARG A 1 100 ? -27.407 -23.103 10.449  1.00 43.10 ? 102  ARG A NH1 1 
ATOM   731  N  NH2 . ARG A 1 100 ? -27.407 -23.391 8.172   1.00 42.70 ? 102  ARG A NH2 1 
ATOM   732  N  N   . PRO A 1 101 ? -20.398 -20.408 7.293   1.00 23.10 ? 103  PRO A N   1 
ATOM   733  C  CA  . PRO A 1 101 ? -20.100 -19.179 6.557   1.00 20.55 ? 103  PRO A CA  1 
ATOM   734  C  C   . PRO A 1 101 ? -21.379 -18.488 6.035   1.00 18.99 ? 103  PRO A C   1 
ATOM   735  O  O   . PRO A 1 101 ? -22.421 -19.134 5.869   1.00 17.37 ? 103  PRO A O   1 
ATOM   736  C  CB  . PRO A 1 101 ? -19.225 -19.679 5.404   1.00 21.12 ? 103  PRO A CB  1 
ATOM   737  C  CG  . PRO A 1 101 ? -19.713 -21.058 5.152   1.00 21.79 ? 103  PRO A CG  1 
ATOM   738  C  CD  . PRO A 1 101 ? -20.033 -21.611 6.517   1.00 22.60 ? 103  PRO A CD  1 
ATOM   739  N  N   . GLY A 1 102 ? -21.299 -17.185 5.777   1.00 16.46 ? 104  GLY A N   1 
ATOM   740  C  CA  . GLY A 1 102 ? -22.458 -16.435 5.296   1.00 15.68 ? 104  GLY A CA  1 
ATOM   741  C  C   . GLY A 1 102 ? -22.214 -15.338 4.281   1.00 15.05 ? 104  GLY A C   1 
ATOM   742  O  O   . GLY A 1 102 ? -23.026 -14.427 4.182   1.00 14.32 ? 104  GLY A O   1 
ATOM   743  N  N   . SER A 1 103 ? -21.148 -15.453 3.478   1.00 16.04 ? 105  SER A N   1 
ATOM   744  C  CA  . SER A 1 103 ? -20.999 -14.589 2.274   1.00 15.35 ? 105  SER A CA  1 
ATOM   745  C  C   . SER A 1 103 ? -22.141 -14.830 1.301   1.00 15.74 ? 105  SER A C   1 
ATOM   746  O  O   . SER A 1 103 ? -22.775 -15.888 1.330   1.00 15.96 ? 105  SER A O   1 
ATOM   747  C  CB  . SER A 1 103 ? -19.657 -14.789 1.576   1.00 15.23 ? 105  SER A CB  1 
ATOM   748  O  OG  . SER A 1 103 ? -19.569 -16.026 0.886   1.00 14.68 ? 105  SER A OG  1 
ATOM   749  N  N   . GLU A 1 104 ? -22.422 -13.827 0.471   1.00 14.95 ? 106  GLU A N   1 
ATOM   750  C  CA  . GLU A 1 104 ? -23.470 -13.920 -0.536  1.00 15.53 ? 106  GLU A CA  1 
ATOM   751  C  C   . GLU A 1 104 ? -22.909 -14.546 -1.790  1.00 14.86 ? 106  GLU A C   1 
ATOM   752  O  O   . GLU A 1 104 ? -23.448 -15.520 -2.301  1.00 14.79 ? 106  GLU A O   1 
ATOM   753  C  CB  . GLU A 1 104 ? -24.040 -12.543 -0.872  1.00 15.82 ? 106  GLU A CB  1 
ATOM   754  C  CG  . GLU A 1 104 ? -24.783 -11.930 0.286   1.00 16.76 ? 106  GLU A CG  1 
ATOM   755  C  CD  . GLU A 1 104 ? -26.107 -11.305 -0.111  1.00 17.01 ? 106  GLU A CD  1 
ATOM   756  O  OE1 . GLU A 1 104 ? -26.104 -10.228 -0.744  1.00 16.83 ? 106  GLU A OE1 1 
ATOM   757  O  OE2 . GLU A 1 104 ? -27.134 -11.916 0.216   1.00 15.91 ? 106  GLU A OE2 1 
ATOM   758  N  N   . HIS A 1 105 ? -21.842 -13.963 -2.307  1.00 13.93 ? 107  HIS A N   1 
ATOM   759  C  CA  . HIS A 1 105 ? -21.152 -14.552 -3.443  1.00 13.91 ? 107  HIS A CA  1 
ATOM   760  C  C   . HIS A 1 105 ? -20.356 -15.759 -2.958  1.00 14.36 ? 107  HIS A C   1 
ATOM   761  O  O   . HIS A 1 105 ? -19.962 -15.819 -1.793  1.00 13.50 ? 107  HIS A O   1 
ATOM   762  C  CB  . HIS A 1 105 ? -20.249 -13.530 -4.124  1.00 13.39 ? 107  HIS A CB  1 
ATOM   763  C  CG  . HIS A 1 105 ? -21.017 -12.468 -4.833  1.00 13.05 ? 107  HIS A CG  1 
ATOM   764  N  ND1 . HIS A 1 105 ? -21.482 -11.344 -4.195  1.00 12.71 ? 107  HIS A ND1 1 
ATOM   765  C  CD2 . HIS A 1 105 ? -21.476 -12.394 -6.107  1.00 12.88 ? 107  HIS A CD2 1 
ATOM   766  C  CE1 . HIS A 1 105 ? -22.157 -10.601 -5.053  1.00 12.37 ? 107  HIS A CE1 1 
ATOM   767  N  NE2 . HIS A 1 105 ? -22.176 -11.218 -6.218  1.00 12.04 ? 107  HIS A NE2 1 
ATOM   768  N  N   . THR A 1 106 ? -20.176 -16.723 -3.858  1.00 14.52 ? 108  THR A N   1 
ATOM   769  C  CA  . THR A 1 106 ? -19.302 -17.856 -3.618  1.00 15.39 ? 108  THR A CA  1 
ATOM   770  C  C   . THR A 1 106 ? -18.317 -17.929 -4.752  1.00 16.58 ? 108  THR A C   1 
ATOM   771  O  O   . THR A 1 106 ? -18.558 -17.370 -5.837  1.00 17.03 ? 108  THR A O   1 
ATOM   772  C  CB  . THR A 1 106 ? -20.093 -19.184 -3.504  1.00 15.88 ? 108  THR A CB  1 
ATOM   773  O  OG1 . THR A 1 106 ? -20.901 -19.411 -4.671  1.00 15.54 ? 108  THR A OG1 1 
ATOM   774  C  CG2 . THR A 1 106 ? -21.004 -19.116 -2.313  1.00 16.03 ? 108  THR A CG2 1 
ATOM   775  N  N   . VAL A 1 107 ? -17.203 -18.609 -4.501  1.00 17.87 ? 109  VAL A N   1 
ATOM   776  C  CA  . VAL A 1 107 ? -16.197 -18.867 -5.520  1.00 19.06 ? 109  VAL A CA  1 
ATOM   777  C  C   . VAL A 1 107 ? -16.010 -20.387 -5.617  1.00 20.37 ? 109  VAL A C   1 
ATOM   778  O  O   . VAL A 1 107 ? -15.564 -21.024 -4.657  1.00 18.54 ? 109  VAL A O   1 
ATOM   779  C  CB  . VAL A 1 107 ? -14.863 -18.157 -5.194  1.00 19.22 ? 109  VAL A CB  1 
ATOM   780  C  CG1 . VAL A 1 107 ? -13.773 -18.538 -6.205  1.00 18.81 ? 109  VAL A CG1 1 
ATOM   781  C  CG2 . VAL A 1 107 ? -15.072 -16.645 -5.154  1.00 18.82 ? 109  VAL A CG2 1 
ATOM   782  N  N   . GLU A 1 108 ? -16.371 -20.948 -6.774  1.00 22.48 ? 110  GLU A N   1 
ATOM   783  C  CA  . GLU A 1 108 ? -16.377 -22.388 -7.013  1.00 24.14 ? 110  GLU A CA  1 
ATOM   784  C  C   . GLU A 1 108 ? -17.075 -23.141 -5.886  1.00 22.66 ? 110  GLU A C   1 
ATOM   785  O  O   . GLU A 1 108 ? -16.577 -24.139 -5.376  1.00 21.33 ? 110  GLU A O   1 
ATOM   786  C  CB  . GLU A 1 108 ? -14.956 -22.901 -7.238  1.00 27.41 ? 110  GLU A CB  1 
ATOM   787  C  CG  . GLU A 1 108 ? -14.338 -22.346 -8.514  1.00 31.66 ? 110  GLU A CG  1 
ATOM   788  C  CD  . GLU A 1 108 ? -12.902 -22.776 -8.751  1.00 36.62 ? 110  GLU A CD  1 
ATOM   789  O  OE1 . GLU A 1 108 ? -12.223 -23.260 -7.821  1.00 41.29 ? 110  GLU A OE1 1 
ATOM   790  O  OE2 . GLU A 1 108 ? -12.433 -22.600 -9.887  1.00 41.50 ? 110  GLU A OE2 1 
ATOM   791  N  N   . GLY A 1 109 ? -18.225 -22.622 -5.474  1.00 21.02 ? 111  GLY A N   1 
ATOM   792  C  CA  . GLY A 1 109 ? -19.009 -23.227 -4.430  1.00 20.47 ? 111  GLY A CA  1 
ATOM   793  C  C   . GLY A 1 109 ? -18.549 -22.882 -3.019  1.00 19.81 ? 111  GLY A C   1 
ATOM   794  O  O   . GLY A 1 109 ? -19.258 -23.199 -2.086  1.00 20.52 ? 111  GLY A O   1 
ATOM   795  N  N   . HIS A 1 110 ? -17.383 -22.255 -2.848  1.00 18.51 ? 112  HIS A N   1 
ATOM   796  C  CA  . HIS A 1 110 ? -16.888 -21.910 -1.524  1.00 18.26 ? 112  HIS A CA  1 
ATOM   797  C  C   . HIS A 1 110 ? -17.586 -20.670 -0.995  1.00 18.26 ? 112  HIS A C   1 
ATOM   798  O  O   . HIS A 1 110 ? -17.564 -19.635 -1.632  1.00 17.99 ? 112  HIS A O   1 
ATOM   799  C  CB  . HIS A 1 110 ? -15.387 -21.685 -1.543  1.00 18.54 ? 112  HIS A CB  1 
ATOM   800  C  CG  . HIS A 1 110 ? -14.820 -21.368 -0.203  1.00 19.51 ? 112  HIS A CG  1 
ATOM   801  N  ND1 . HIS A 1 110 ? -14.665 -22.318 0.779   1.00 20.54 ? 112  HIS A ND1 1 
ATOM   802  C  CD2 . HIS A 1 110 ? -14.419 -20.197 0.342   1.00 20.06 ? 112  HIS A CD2 1 
ATOM   803  C  CE1 . HIS A 1 110 ? -14.184 -21.752 1.869   1.00 20.57 ? 112  HIS A CE1 1 
ATOM   804  N  NE2 . HIS A 1 110 ? -14.034 -20.462 1.633   1.00 21.73 ? 112  HIS A NE2 1 
ATOM   805  N  N   . ARG A 1 111 ? -18.183 -20.777 0.182   1.00 17.90 ? 113  ARG A N   1 
ATOM   806  C  CA  . ARG A 1 111 ? -18.781 -19.634 0.847   1.00 17.95 ? 113  ARG A CA  1 
ATOM   807  C  C   . ARG A 1 111 ? -17.822 -19.180 1.917   1.00 17.91 ? 113  ARG A C   1 
ATOM   808  O  O   . ARG A 1 111 ? -17.313 -20.005 2.675   1.00 17.50 ? 113  ARG A O   1 
ATOM   809  C  CB  . ARG A 1 111 ? -20.111 -20.002 1.469   1.00 18.70 ? 113  ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 111 ? -20.935 -18.801 1.887   1.00 18.30 ? 113  ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 111 ? -22.257 -19.222 2.523   1.00 19.26 ? 113  ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 111 ? -23.083 -19.994 1.595   1.00 18.79 ? 113  ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 111 ? -23.750 -19.487 0.570   1.00 19.31 ? 113  ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 111 ? -23.748 -18.172 0.308   1.00 21.28 ? 113  ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 111 ? -24.437 -20.291 -0.212  1.00 18.85 ? 113  ARG A NH2 1 
ATOM   816  N  N   . PHE A 1 112 ? -17.597 -17.865 1.979   1.00 16.52 ? 114  PHE A N   1 
ATOM   817  C  CA  . PHE A 1 112 ? -16.616 -17.256 2.868   1.00 15.73 ? 114  PHE A CA  1 
ATOM   818  C  C   . PHE A 1 112 ? -17.340 -16.845 4.135   1.00 14.77 ? 114  PHE A C   1 
ATOM   819  O  O   . PHE A 1 112 ? -18.554 -16.724 4.127   1.00 14.69 ? 114  PHE A O   1 
ATOM   820  C  CB  . PHE A 1 112 ? -15.978 -16.027 2.208   1.00 15.44 ? 114  PHE A CB  1 
ATOM   821  C  CG  . PHE A 1 112 ? -15.230 -16.348 0.951   1.00 15.94 ? 114  PHE A CG  1 
ATOM   822  C  CD1 . PHE A 1 112 ? -15.914 -16.569 -0.244  1.00 15.30 ? 114  PHE A CD1 1 
ATOM   823  C  CD2 . PHE A 1 112 ? -13.862 -16.455 0.966   1.00 15.69 ? 114  PHE A CD2 1 
ATOM   824  C  CE1 . PHE A 1 112 ? -15.235 -16.886 -1.386  1.00 15.74 ? 114  PHE A CE1 1 
ATOM   825  C  CE2 . PHE A 1 112 ? -13.159 -16.756 -0.185  1.00 16.51 ? 114  PHE A CE2 1 
ATOM   826  C  CZ  . PHE A 1 112 ? -13.850 -16.977 -1.370  1.00 16.53 ? 114  PHE A CZ  1 
ATOM   827  N  N   . PRO A 1 113 ? -16.599 -16.608 5.231   1.00 14.46 ? 115  PRO A N   1 
ATOM   828  C  CA  . PRO A 1 113 ? -17.287 -16.297 6.491   1.00 14.19 ? 115  PRO A CA  1 
ATOM   829  C  C   . PRO A 1 113 ? -18.276 -15.132 6.395   1.00 14.14 ? 115  PRO A C   1 
ATOM   830  O  O   . PRO A 1 113 ? -19.418 -15.268 6.859   1.00 13.58 ? 115  PRO A O   1 
ATOM   831  C  CB  . PRO A 1 113 ? -16.119 -15.997 7.442   1.00 14.68 ? 115  PRO A CB  1 
ATOM   832  C  CG  . PRO A 1 113 ? -15.071 -16.969 6.958   1.00 14.58 ? 115  PRO A CG  1 
ATOM   833  C  CD  . PRO A 1 113 ? -15.152 -16.793 5.457   1.00 14.80 ? 115  PRO A CD  1 
ATOM   834  N  N   . ALA A 1 114 ? -17.876 -14.031 5.745   1.00 13.22 ? 116  ALA A N   1 
ATOM   835  C  CA  . ALA A 1 114 ? -18.741 -12.864 5.658   1.00 13.23 ? 116  ALA A CA  1 
ATOM   836  C  C   . ALA A 1 114 ? -18.433 -12.052 4.394   1.00 13.18 ? 116  ALA A C   1 
ATOM   837  O  O   . ALA A 1 114 ? -17.510 -12.393 3.665   1.00 13.43 ? 116  ALA A O   1 
ATOM   838  C  CB  . ALA A 1 114 ? -18.606 -12.014 6.920   1.00 13.48 ? 116  ALA A CB  1 
ATOM   839  N  N   . GLU A 1 115 ? -19.226 -11.010 4.139   1.00 12.35 ? 117  GLU A N   1 
ATOM   840  C  CA  . GLU A 1 115 ? -19.062 -10.174 2.962   1.00 11.69 ? 117  GLU A CA  1 
ATOM   841  C  C   . GLU A 1 115 ? -19.502 -8.740  3.249   1.00 11.30 ? 117  GLU A C   1 
ATOM   842  O  O   . GLU A 1 115 ? -20.515 -8.511  3.921   1.00 11.04 ? 117  GLU A O   1 
ATOM   843  C  CB  . GLU A 1 115 ? -19.882 -10.793 1.813   1.00 12.09 ? 117  GLU A CB  1 
ATOM   844  C  CG  . GLU A 1 115 ? -19.634 -10.207 0.433   1.00 12.38 ? 117  GLU A CG  1 
ATOM   845  C  CD  . GLU A 1 115 ? -20.305 -10.978 -0.708  1.00 13.11 ? 117  GLU A CD  1 
ATOM   846  O  OE1 . GLU A 1 115 ? -20.448 -12.234 -0.619  1.00 12.26 ? 117  GLU A OE1 1 
ATOM   847  O  OE2 . GLU A 1 115 ? -20.650 -10.316 -1.745  1.00 13.80 ? 117  GLU A OE2 1 
ATOM   848  N  N   . ILE A 1 116 ? -18.740 -7.780  2.725   1.00 10.75 ? 118  ILE A N   1 
ATOM   849  C  CA  . ILE A 1 116 ? -19.110 -6.374  2.786   1.00 10.84 ? 118  ILE A CA  1 
ATOM   850  C  C   . ILE A 1 116 ? -19.588 -5.913  1.414   1.00 10.93 ? 118  ILE A C   1 
ATOM   851  O  O   . ILE A 1 116 ? -19.004 -6.268  0.385   1.00 10.50 ? 118  ILE A O   1 
ATOM   852  C  CB  . ILE A 1 116 ? -17.963 -5.474  3.322   1.00 10.97 ? 118  ILE A CB  1 
ATOM   853  C  CG1 . ILE A 1 116 ? -18.396 -4.004  3.362   1.00 11.26 ? 118  ILE A CG1 1 
ATOM   854  C  CG2 . ILE A 1 116 ? -16.681 -5.590  2.492   1.00 10.89 ? 118  ILE A CG2 1 
ATOM   855  C  CD1 . ILE A 1 116 ? -17.417 -3.116  4.120   1.00 11.66 ? 118  ILE A CD1 1 
ATOM   856  N  N   . HIS A 1 117 ? -20.644 -5.105  1.424   1.00 10.93 ? 119  HIS A N   1 
ATOM   857  C  CA  . HIS A 1 117 ? -21.135 -4.410  0.238   1.00 11.24 ? 119  HIS A CA  1 
ATOM   858  C  C   . HIS A 1 117 ? -21.119 -2.922  0.437   1.00 11.08 ? 119  HIS A C   1 
ATOM   859  O  O   . HIS A 1 117 ? -21.662 -2.446  1.444   1.00 11.57 ? 119  HIS A O   1 
ATOM   860  C  CB  . HIS A 1 117 ? -22.560 -4.862  -0.056  1.00 11.06 ? 119  HIS A CB  1 
ATOM   861  C  CG  . HIS A 1 117 ? -22.646 -6.284  -0.462  1.00 11.24 ? 119  HIS A CG  1 
ATOM   862  N  ND1 . HIS A 1 117 ? -23.812 -7.000  -0.408  1.00 11.40 ? 119  HIS A ND1 1 
ATOM   863  C  CD2 . HIS A 1 117 ? -21.697 -7.147  -0.897  1.00 11.08 ? 119  HIS A CD2 1 
ATOM   864  C  CE1 . HIS A 1 117 ? -23.592 -8.239  -0.806  1.00 11.05 ? 119  HIS A CE1 1 
ATOM   865  N  NE2 . HIS A 1 117 ? -22.315 -8.351  -1.117  1.00 11.00 ? 119  HIS A NE2 1 
ATOM   866  N  N   . VAL A 1 118 ? -20.527 -2.191  -0.515  1.00 10.86 ? 120  VAL A N   1 
ATOM   867  C  CA  . VAL A 1 118 ? -20.530 -0.730  -0.527  1.00 10.50 ? 120  VAL A CA  1 
ATOM   868  C  C   . VAL A 1 118 ? -21.331 -0.315  -1.758  1.00 10.27 ? 120  VAL A C   1 
ATOM   869  O  O   . VAL A 1 118 ? -20.919 -0.576  -2.894  1.00 10.08 ? 120  VAL A O   1 
ATOM   870  C  CB  . VAL A 1 118 ? -19.101 -0.131  -0.578  1.00 10.72 ? 120  VAL A CB  1 
ATOM   871  C  CG1 . VAL A 1 118 ? -19.126 1.361   -0.333  1.00 10.50 ? 120  VAL A CG1 1 
ATOM   872  C  CG2 . VAL A 1 118 ? -18.186 -0.822  0.436   1.00 11.08 ? 120  VAL A CG2 1 
ATOM   873  N  N   . VAL A 1 119 ? -22.482 0.308   -1.520  1.00 10.02 ? 121  VAL A N   1 
ATOM   874  C  CA  . VAL A 1 119 ? -23.488 0.548   -2.526  1.00 10.32 ? 121  VAL A CA  1 
ATOM   875  C  C   . VAL A 1 119 ? -23.310 1.969   -2.969  1.00 10.47 ? 121  VAL A C   1 
ATOM   876  O  O   . VAL A 1 119 ? -23.224 2.859   -2.129  1.00 10.21 ? 121  VAL A O   1 
ATOM   877  C  CB  . VAL A 1 119 ? -24.918 0.389   -1.934  1.00 10.79 ? 121  VAL A CB  1 
ATOM   878  C  CG1 . VAL A 1 119 ? -25.981 0.634   -2.985  1.00 11.27 ? 121  VAL A CG1 1 
ATOM   879  C  CG2 . VAL A 1 119 ? -25.081 -0.973  -1.341  1.00 10.85 ? 121  VAL A CG2 1 
ATOM   880  N  N   . HIS A 1 120 ? -23.279 2.169   -4.293  1.00 10.74 ? 122  HIS A N   1 
ATOM   881  C  CA  . HIS A 1 120 ? -23.036 3.454   -4.914  1.00 10.66 ? 122  HIS A CA  1 
ATOM   882  C  C   . HIS A 1 120 ? -24.127 3.781   -5.922  1.00 11.49 ? 122  HIS A C   1 
ATOM   883  O  O   . HIS A 1 120 ? -24.751 2.884   -6.499  1.00 11.38 ? 122  HIS A O   1 
ATOM   884  C  CB  . HIS A 1 120 ? -21.701 3.475   -5.682  1.00 10.71 ? 122  HIS A CB  1 
ATOM   885  C  CG  . HIS A 1 120 ? -20.483 3.212   -4.846  1.00 10.43 ? 122  HIS A CG  1 
ATOM   886  N  ND1 . HIS A 1 120 ? -20.166 1.964   -4.350  1.00 10.21 ? 122  HIS A ND1 1 
ATOM   887  C  CD2 . HIS A 1 120 ? -19.475 4.036   -4.466  1.00 10.44 ? 122  HIS A CD2 1 
ATOM   888  C  CE1 . HIS A 1 120 ? -19.019 2.037   -3.700  1.00 10.39 ? 122  HIS A CE1 1 
ATOM   889  N  NE2 . HIS A 1 120 ? -18.586 3.285   -3.743  1.00 10.18 ? 122  HIS A NE2 1 
ATOM   890  N  N   . LEU A 1 121 ? -24.315 5.087   -6.145  1.00 11.69 ? 123  LEU A N   1 
ATOM   891  C  CA  . LEU A 1 121 ? -25.296 5.630   -7.072  1.00 11.97 ? 123  LEU A CA  1 
ATOM   892  C  C   . LEU A 1 121 ? -24.574 6.311   -8.206  1.00 11.80 ? 123  LEU A C   1 
ATOM   893  O  O   . LEU A 1 121 ? -23.655 7.117   -7.946  1.00 11.97 ? 123  LEU A O   1 
ATOM   894  C  CB  . LEU A 1 121 ? -26.162 6.671   -6.338  1.00 12.59 ? 123  LEU A CB  1 
ATOM   895  C  CG  . LEU A 1 121 ? -27.232 7.436   -7.119  1.00 12.52 ? 123  LEU A CG  1 
ATOM   896  C  CD1 . LEU A 1 121 ? -28.215 6.471   -7.750  1.00 12.76 ? 123  LEU A CD1 1 
ATOM   897  C  CD2 . LEU A 1 121 ? -27.933 8.462   -6.212  1.00 12.57 ? 123  LEU A CD2 1 
ATOM   898  N  N   . SER A 1 122 ? -24.972 6.011   -9.451  1.00 10.92 ? 124  SER A N   1 
ATOM   899  C  CA  . SER A 1 122 ? -24.397 6.701   -10.623 1.00 11.34 ? 124  SER A CA  1 
ATOM   900  C  C   . SER A 1 122 ? -24.588 8.212   -10.470 1.00 11.60 ? 124  SER A C   1 
ATOM   901  O  O   . SER A 1 122 ? -25.672 8.676   -10.084 1.00 10.40 ? 124  SER A O   1 
ATOM   902  C  CB  . SER A 1 122 ? -25.022 6.226   -11.952 1.00 11.17 ? 124  SER A CB  1 
ATOM   903  O  OG  . SER A 1 122 ? -24.839 7.173   -13.006 1.00 11.31 ? 124  SER A OG  1 
ATOM   904  N  N   . THR A 1 123 ? -23.552 8.981   -10.807 1.00 12.55 ? 125  THR A N   1 
ATOM   905  C  CA  . THR A 1 123 ? -23.664 10.446  -10.764 1.00 13.77 ? 125  THR A CA  1 
ATOM   906  C  C   . THR A 1 123 ? -24.674 11.000  -11.768 1.00 13.93 ? 125  THR A C   1 
ATOM   907  O  O   . THR A 1 123 ? -24.965 12.181  -11.730 1.00 13.63 ? 125  THR A O   1 
ATOM   908  C  CB  . THR A 1 123 ? -22.337 11.169  -11.051 1.00 14.38 ? 125  THR A CB  1 
ATOM   909  O  OG1 . THR A 1 123 ? -21.884 10.776  -12.341 1.00 15.07 ? 125  THR A OG1 1 
ATOM   910  C  CG2 . THR A 1 123 ? -21.283 10.842  -10.005 1.00 15.66 ? 125  THR A CG2 1 
ATOM   911  N  N   . ALA A 1 124 ? -25.193 10.175  -12.680 1.00 14.48 ? 126  ALA A N   1 
ATOM   912  C  CA  . ALA A 1 124 ? -26.264 10.612  -13.579 1.00 14.61 ? 126  ALA A CA  1 
ATOM   913  C  C   . ALA A 1 124 ? -27.635 10.705  -12.912 1.00 14.53 ? 126  ALA A C   1 
ATOM   914  O  O   . ALA A 1 124 ? -28.551 11.234  -13.514 1.00 14.22 ? 126  ALA A O   1 
ATOM   915  C  CB  . ALA A 1 124 ? -26.345 9.703   -14.785 1.00 14.55 ? 126  ALA A CB  1 
ATOM   916  N  N   . PHE A 1 125 ? -27.782 10.167  -11.696 1.00 14.87 ? 127  PHE A N   1 
ATOM   917  C  CA  . PHE A 1 125 ? -29.058 10.161  -10.978 1.00 15.43 ? 127  PHE A CA  1 
ATOM   918  C  C   . PHE A 1 125 ? -28.938 10.888  -9.647  1.00 16.10 ? 127  PHE A C   1 
ATOM   919  O  O   . PHE A 1 125 ? -27.925 10.750  -8.955  1.00 15.61 ? 127  PHE A O   1 
ATOM   920  C  CB  . PHE A 1 125 ? -29.536 8.727   -10.745 1.00 16.17 ? 127  PHE A CB  1 
ATOM   921  C  CG  . PHE A 1 125 ? -29.754 7.941   -12.013 1.00 16.17 ? 127  PHE A CG  1 
ATOM   922  C  CD1 . PHE A 1 125 ? -30.960 8.013   -12.691 1.00 15.84 ? 127  PHE A CD1 1 
ATOM   923  C  CD2 . PHE A 1 125 ? -28.764 7.095   -12.499 1.00 16.64 ? 127  PHE A CD2 1 
ATOM   924  C  CE1 . PHE A 1 125 ? -31.159 7.287   -13.845 1.00 16.00 ? 127  PHE A CE1 1 
ATOM   925  C  CE2 . PHE A 1 125 ? -28.955 6.371   -13.671 1.00 16.31 ? 127  PHE A CE2 1 
ATOM   926  C  CZ  . PHE A 1 125 ? -30.154 6.456   -14.336 1.00 15.92 ? 127  PHE A CZ  1 
ATOM   927  N  N   . ALA A 1 126 ? -29.963 11.685  -9.317  1.00 16.52 ? 128  ALA A N   1 
ATOM   928  C  CA  . ALA A 1 126 ? -30.014 12.424  -8.062  1.00 17.94 ? 128  ALA A CA  1 
ATOM   929  C  C   . ALA A 1 126 ? -30.394 11.540  -6.901  1.00 19.28 ? 128  ALA A C   1 
ATOM   930  O  O   . ALA A 1 126 ? -29.962 11.803  -5.794  1.00 20.68 ? 128  ALA A O   1 
ATOM   931  C  CB  . ALA A 1 126 ? -30.998 13.587  -8.146  1.00 18.42 ? 128  ALA A CB  1 
ATOM   932  N  N   . ARG A 1 127 ? -31.222 10.524  -7.133  1.00 20.41 ? 129  ARG A N   1 
ATOM   933  C  CA  . ARG A 1 127 ? -31.705 9.655   -6.067  1.00 23.25 ? 129  ARG A CA  1 
ATOM   934  C  C   . ARG A 1 127 ? -31.729 8.193   -6.480  1.00 21.54 ? 129  ARG A C   1 
ATOM   935  O  O   . ARG A 1 127 ? -31.948 7.878   -7.637  1.00 19.59 ? 129  ARG A O   1 
ATOM   936  C  CB  . ARG A 1 127 ? -33.144 10.012  -5.691  1.00 26.06 ? 129  ARG A CB  1 
ATOM   937  C  CG  . ARG A 1 127 ? -33.350 11.438  -5.206  1.00 31.43 ? 129  ARG A CG  1 
ATOM   938  C  CD  . ARG A 1 127 ? -34.663 11.567  -4.445  1.00 35.10 ? 129  ARG A CD  1 
ATOM   939  N  NE  . ARG A 1 127 ? -35.783 11.023  -5.217  1.00 37.80 ? 129  ARG A NE  1 
ATOM   940  C  CZ  . ARG A 1 127 ? -36.370 11.640  -6.238  1.00 42.24 ? 129  ARG A CZ  1 
ATOM   941  N  NH1 . ARG A 1 127 ? -35.967 12.851  -6.634  1.00 46.09 ? 129  ARG A NH1 1 
ATOM   942  N  NH2 . ARG A 1 127 ? -37.383 11.045  -6.865  1.00 44.23 ? 129  ARG A NH2 1 
ATOM   943  N  N   . VAL A 1 128 ? -31.604 7.319   -5.495  1.00 21.95 ? 130  VAL A N   1 
ATOM   944  C  CA  . VAL A 1 128 ? -31.642 5.869   -5.716  1.00 24.07 ? 130  VAL A CA  1 
ATOM   945  C  C   . VAL A 1 128 ? -32.878 5.421   -6.464  1.00 25.89 ? 130  VAL A C   1 
ATOM   946  O  O   . VAL A 1 128 ? -32.784 4.657   -7.427  1.00 24.30 ? 130  VAL A O   1 
ATOM   947  C  CB  . VAL A 1 128 ? -31.587 5.071   -4.402  1.00 24.81 ? 130  VAL A CB  1 
ATOM   948  C  CG1 . VAL A 1 128 ? -31.792 3.582   -4.666  1.00 25.53 ? 130  VAL A CG1 1 
ATOM   949  C  CG2 . VAL A 1 128 ? -30.256 5.269   -3.749  1.00 24.32 ? 130  VAL A CG2 1 
ATOM   950  N  N   . ASP A 1 129 ? -34.038 5.914   -6.045  1.00 27.06 ? 131  ASP A N   1 
ATOM   951  C  CA  . ASP A 1 129 ? -35.285 5.490   -6.679  1.00 26.86 ? 131  ASP A CA  1 
ATOM   952  C  C   . ASP A 1 129 ? -35.331 5.733   -8.181  1.00 25.10 ? 131  ASP A C   1 
ATOM   953  O  O   . ASP A 1 129 ? -35.897 4.941   -8.889  1.00 26.13 ? 131  ASP A O   1 
ATOM   954  C  CB  . ASP A 1 129 ? -36.514 6.072   -5.968  1.00 31.47 ? 131  ASP A CB  1 
ATOM   955  C  CG  . ASP A 1 129 ? -36.349 7.515   -5.613  1.00 33.99 ? 131  ASP A CG  1 
ATOM   956  O  OD1 . ASP A 1 129 ? -35.587 7.830   -4.644  1.00 34.83 ? 131  ASP A OD1 1 
ATOM   957  O  OD2 . ASP A 1 129 ? -36.954 8.315   -6.336  1.00 37.47 ? 131  ASP A OD2 1 
ATOM   958  N  N   . GLU A 1 130 ? -34.682 6.780   -8.674  1.00 22.83 ? 132  GLU A N   1 
ATOM   959  C  CA  . GLU A 1 130 ? -34.577 7.001   -10.117 1.00 23.34 ? 132  GLU A CA  1 
ATOM   960  C  C   . GLU A 1 130 ? -33.607 6.019   -10.832 1.00 20.73 ? 132  GLU A C   1 
ATOM   961  O  O   . GLU A 1 130 ? -33.756 5.756   -12.024 1.00 19.10 ? 132  GLU A O   1 
ATOM   962  C  CB  . GLU A 1 130 ? -34.107 8.423   -10.397 1.00 27.60 ? 132  GLU A CB  1 
ATOM   963  C  CG  . GLU A 1 130 ? -34.930 9.513   -9.717  1.00 30.55 ? 132  GLU A CG  1 
ATOM   964  C  CD  . GLU A 1 130 ? -34.240 10.862  -9.733  1.00 35.52 ? 132  GLU A CD  1 
ATOM   965  O  OE1 . GLU A 1 130 ? -33.018 10.957  -10.055 1.00 36.12 ? 132  GLU A OE1 1 
ATOM   966  O  OE2 . GLU A 1 130 ? -34.954 11.844  -9.414  1.00 42.28 ? 132  GLU A OE2 1 
ATOM   967  N  N   . ALA A 1 131 ? -32.608 5.516   -10.105 1.00 19.44 ? 133  ALA A N   1 
ATOM   968  C  CA  . ALA A 1 131 ? -31.594 4.598   -10.628 1.00 18.23 ? 133  ALA A CA  1 
ATOM   969  C  C   . ALA A 1 131 ? -32.012 3.132   -10.643 1.00 17.56 ? 133  ALA A C   1 
ATOM   970  O  O   . ALA A 1 131 ? -31.448 2.347   -11.413 1.00 16.11 ? 133  ALA A O   1 
ATOM   971  C  CB  . ALA A 1 131 ? -30.315 4.744   -9.824  1.00 18.25 ? 133  ALA A CB  1 
ATOM   972  N  N   . LEU A 1 132 ? -32.992 2.756   -9.820  1.00 17.26 ? 134  LEU A N   1 
ATOM   973  C  CA  . LEU A 1 132 ? -33.416 1.365   -9.729  1.00 17.92 ? 134  LEU A CA  1 
ATOM   974  C  C   . LEU A 1 132 ? -33.847 0.841   -11.083 1.00 17.24 ? 134  LEU A C   1 
ATOM   975  O  O   . LEU A 1 132 ? -34.614 1.503   -11.811 1.00 17.41 ? 134  LEU A O   1 
ATOM   976  C  CB  . LEU A 1 132 ? -34.569 1.202   -8.732  1.00 20.11 ? 134  LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 132 ? -34.199 1.397   -7.259  1.00 20.68 ? 134  LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 132 ? -35.450 1.663   -6.415  1.00 21.99 ? 134  LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 132 ? -33.454 0.191   -6.726  1.00 20.79 ? 134  LEU A CD2 1 
ATOM   980  N  N   . GLY A 1 133 ? -33.307 -0.312  -11.455 1.00 16.47 ? 135  GLY A N   1 
ATOM   981  C  CA  . GLY A 1 133 ? -33.599 -0.906  -12.749 1.00 16.68 ? 135  GLY A CA  1 
ATOM   982  C  C   . GLY A 1 133 ? -33.000 -0.258  -13.998 1.00 17.38 ? 135  GLY A C   1 
ATOM   983  O  O   . GLY A 1 133 ? -33.219 -0.765  -15.097 1.00 17.99 ? 135  GLY A O   1 
ATOM   984  N  N   . ARG A 1 134 ? -32.237 0.827   -13.858 1.00 16.94 ? 136  ARG A N   1 
ATOM   985  C  CA  . ARG A 1 134 ? -31.610 1.484   -15.009 1.00 17.41 ? 136  ARG A CA  1 
ATOM   986  C  C   . ARG A 1 134 ? -30.196 0.909   -15.219 1.00 16.72 ? 136  ARG A C   1 
ATOM   987  O  O   . ARG A 1 134 ? -29.530 0.572   -14.256 1.00 16.94 ? 136  ARG A O   1 
ATOM   988  C  CB  . ARG A 1 134 ? -31.572 2.998   -14.800 1.00 18.99 ? 136  ARG A CB  1 
ATOM   989  C  CG  . ARG A 1 134 ? -32.818 3.735   -15.285 1.00 22.21 ? 136  ARG A CG  1 
ATOM   990  C  CD  . ARG A 1 134 ? -34.122 3.271   -14.655 1.00 25.37 ? 136  ARG A CD  1 
ATOM   991  N  NE  . ARG A 1 134 ? -35.231 3.832   -15.410 1.00 28.58 ? 136  ARG A NE  1 
ATOM   992  C  CZ  . ARG A 1 134 ? -35.656 5.091   -15.317 1.00 31.42 ? 136  ARG A CZ  1 
ATOM   993  N  NH1 . ARG A 1 134 ? -35.099 5.949   -14.462 1.00 33.57 ? 136  ARG A NH1 1 
ATOM   994  N  NH2 . ARG A 1 134 ? -36.648 5.504   -16.095 1.00 31.66 ? 136  ARG A NH2 1 
ATOM   995  N  N   . PRO A 1 135 ? -29.733 0.792   -16.471 1.00 16.59 ? 137  PRO A N   1 
ATOM   996  C  CA  . PRO A 1 135 ? -28.413 0.163   -16.705 1.00 16.86 ? 137  PRO A CA  1 
ATOM   997  C  C   . PRO A 1 135 ? -27.267 0.896   -15.997 1.00 15.34 ? 137  PRO A C   1 
ATOM   998  O  O   . PRO A 1 135 ? -27.073 2.081   -16.221 1.00 15.08 ? 137  PRO A O   1 
ATOM   999  C  CB  . PRO A 1 135 ? -28.229 0.214   -18.228 1.00 17.17 ? 137  PRO A CB  1 
ATOM   1000 C  CG  . PRO A 1 135 ? -29.458 0.832   -18.786 1.00 17.49 ? 137  PRO A CG  1 
ATOM   1001 C  CD  . PRO A 1 135 ? -30.456 1.103   -17.715 1.00 17.09 ? 137  PRO A CD  1 
ATOM   1002 N  N   . GLY A 1 136 ? -26.571 0.207   -15.105 1.00 14.44 ? 138  GLY A N   1 
ATOM   1003 C  CA  . GLY A 1 136 ? -25.450 0.835   -14.371 1.00 14.82 ? 138  GLY A CA  1 
ATOM   1004 C  C   . GLY A 1 136 ? -25.830 1.958   -13.418 1.00 14.09 ? 138  GLY A C   1 
ATOM   1005 O  O   . GLY A 1 136 ? -24.962 2.730   -12.964 1.00 14.36 ? 138  GLY A O   1 
ATOM   1006 N  N   . GLY A 1 137 ? -27.114 2.049   -13.088 1.00 12.98 ? 139  GLY A N   1 
ATOM   1007 C  CA  . GLY A 1 137 ? -27.590 3.103   -12.199 1.00 13.16 ? 139  GLY A CA  1 
ATOM   1008 C  C   . GLY A 1 137 ? -27.056 2.975   -10.779 1.00 13.01 ? 139  GLY A C   1 
ATOM   1009 O  O   . GLY A 1 137 ? -26.824 3.990   -10.122 1.00 12.05 ? 139  GLY A O   1 
ATOM   1010 N  N   . LEU A 1 138 ? -26.940 1.727   -10.305 1.00 12.17 ? 140  LEU A N   1 
ATOM   1011 C  CA  . LEU A 1 138 ? -26.276 1.396   -9.061  1.00 12.51 ? 140  LEU A CA  1 
ATOM   1012 C  C   . LEU A 1 138 ? -25.045 0.503   -9.301  1.00 11.89 ? 140  LEU A C   1 
ATOM   1013 O  O   . LEU A 1 138 ? -25.000 -0.304  -10.246 1.00 11.27 ? 140  LEU A O   1 
ATOM   1014 C  CB  . LEU A 1 138 ? -27.248 0.660   -8.142  1.00 13.37 ? 140  LEU A CB  1 
ATOM   1015 C  CG  . LEU A 1 138 ? -28.530 1.438   -7.802  1.00 13.97 ? 140  LEU A CG  1 
ATOM   1016 C  CD1 . LEU A 1 138 ? -29.517 0.559   -7.065  1.00 14.22 ? 140  LEU A CD1 1 
ATOM   1017 C  CD2 . LEU A 1 138 ? -28.183 2.659   -6.978  1.00 14.60 ? 140  LEU A CD2 1 
ATOM   1018 N  N   . ALA A 1 139 ? -24.051 0.655   -8.434  1.00 11.52 ? 141  ALA A N   1 
ATOM   1019 C  CA  . ALA A 1 139 ? -22.874 -0.205  -8.437  1.00 11.15 ? 141  ALA A CA  1 
ATOM   1020 C  C   . ALA A 1 139 ? -22.523 -0.612  -7.026  1.00 10.89 ? 141  ALA A C   1 
ATOM   1021 O  O   . ALA A 1 139 ? -22.491 0.237   -6.118  1.00 10.30 ? 141  ALA A O   1 
ATOM   1022 C  CB  . ALA A 1 139 ? -21.703 0.499   -9.092  1.00 10.70 ? 141  ALA A CB  1 
ATOM   1023 N  N   . VAL A 1 140 ? -22.253 -1.907  -6.834  1.00 10.80 ? 142  VAL A N   1 
ATOM   1024 C  CA  . VAL A 1 140 ? -21.849 -2.407  -5.522  1.00 11.17 ? 142  VAL A CA  1 
ATOM   1025 C  C   . VAL A 1 140 ? -20.409 -2.910  -5.587  1.00 11.48 ? 142  VAL A C   1 
ATOM   1026 O  O   . VAL A 1 140 ? -20.046 -3.617  -6.537  1.00 12.09 ? 142  VAL A O   1 
ATOM   1027 C  CB  . VAL A 1 140 ? -22.791 -3.496  -5.004  1.00 11.53 ? 142  VAL A CB  1 
ATOM   1028 C  CG1 . VAL A 1 140 ? -22.382 -3.944  -3.591  1.00 11.44 ? 142  VAL A CG1 1 
ATOM   1029 C  CG2 . VAL A 1 140 ? -24.226 -2.977  -5.012  1.00 11.70 ? 142  VAL A CG2 1 
ATOM   1030 N  N   . LEU A 1 141 ? -19.586 -2.493  -4.627  1.00 11.19 ? 143  LEU A N   1 
ATOM   1031 C  CA  . LEU A 1 141 ? -18.280 -3.119  -4.385  1.00 11.51 ? 143  LEU A CA  1 
ATOM   1032 C  C   . LEU A 1 141 ? -18.425 -4.155  -3.291  1.00 11.64 ? 143  LEU A C   1 
ATOM   1033 O  O   . LEU A 1 141 ? -18.933 -3.852  -2.218  1.00 11.78 ? 143  LEU A O   1 
ATOM   1034 C  CB  . LEU A 1 141 ? -17.240 -2.114  -3.955  1.00 11.72 ? 143  LEU A CB  1 
ATOM   1035 C  CG  . LEU A 1 141 ? -17.018 -0.905  -4.838  1.00 12.42 ? 143  LEU A CG  1 
ATOM   1036 C  CD1 . LEU A 1 141 ? -15.807 -0.148  -4.326  1.00 12.85 ? 143  LEU A CD1 1 
ATOM   1037 C  CD2 . LEU A 1 141 ? -16.822 -1.295  -6.278  1.00 12.62 ? 143  LEU A CD2 1 
ATOM   1038 N  N   . ALA A 1 142 ? -17.934 -5.360  -3.560  1.00 11.42 ? 144  ALA A N   1 
ATOM   1039 C  CA  . ALA A 1 142 ? -18.099 -6.487  -2.689  1.00 11.47 ? 144  ALA A CA  1 
ATOM   1040 C  C   . ALA A 1 142 ? -16.745 -7.115  -2.373  1.00 11.90 ? 144  ALA A C   1 
ATOM   1041 O  O   . ALA A 1 142 ? -15.952 -7.352  -3.305  1.00 11.78 ? 144  ALA A O   1 
ATOM   1042 C  CB  . ALA A 1 142 ? -19.005 -7.507  -3.349  1.00 11.47 ? 144  ALA A CB  1 
ATOM   1043 N  N   . ALA A 1 143 ? -16.485 -7.387  -1.086  1.00 11.19 ? 145  ALA A N   1 
ATOM   1044 C  CA  . ALA A 1 143 ? -15.278 -8.094  -0.663  1.00 11.32 ? 145  ALA A CA  1 
ATOM   1045 C  C   . ALA A 1 143 ? -15.618 -9.146  0.370   1.00 11.94 ? 145  ALA A C   1 
ATOM   1046 O  O   . ALA A 1 143 ? -16.500 -8.941  1.212   1.00 11.80 ? 145  ALA A O   1 
ATOM   1047 C  CB  . ALA A 1 143 ? -14.236 -7.129  -0.106  1.00 11.64 ? 145  ALA A CB  1 
ATOM   1048 N  N   . PHE A 1 144 ? -14.917 -10.274 0.298   1.00 11.93 ? 146  PHE A N   1 
ATOM   1049 C  CA  . PHE A 1 144 ? -15.090 -11.334 1.269   1.00 12.58 ? 146  PHE A CA  1 
ATOM   1050 C  C   . PHE A 1 144 ? -14.299 -11.007 2.520   1.00 12.69 ? 146  PHE A C   1 
ATOM   1051 O  O   . PHE A 1 144 ? -13.214 -10.446 2.430   1.00 12.09 ? 146  PHE A O   1 
ATOM   1052 C  CB  . PHE A 1 144 ? -14.644 -12.668 0.709   1.00 12.53 ? 146  PHE A CB  1 
ATOM   1053 C  CG  . PHE A 1 144 ? -15.398 -13.084 -0.522  1.00 12.63 ? 146  PHE A CG  1 
ATOM   1054 C  CD1 . PHE A 1 144 ? -16.759 -13.297 -0.469  1.00 12.89 ? 146  PHE A CD1 1 
ATOM   1055 C  CD2 . PHE A 1 144 ? -14.737 -13.266 -1.730  1.00 13.16 ? 146  PHE A CD2 1 
ATOM   1056 C  CE1 . PHE A 1 144 ? -17.459 -13.687 -1.608  1.00 13.08 ? 146  PHE A CE1 1 
ATOM   1057 C  CE2 . PHE A 1 144 ? -15.424 -13.633 -2.879  1.00 13.40 ? 146  PHE A CE2 1 
ATOM   1058 C  CZ  . PHE A 1 144 ? -16.792 -13.845 -2.817  1.00 13.21 ? 146  PHE A CZ  1 
ATOM   1059 N  N   . LEU A 1 145 ? -14.866 -11.371 3.668   1.00 13.39 ? 147  LEU A N   1 
ATOM   1060 C  CA  . LEU A 1 145 ? -14.195 -11.272 4.954   1.00 13.86 ? 147  LEU A CA  1 
ATOM   1061 C  C   . LEU A 1 145 ? -13.795 -12.690 5.398   1.00 14.39 ? 147  LEU A C   1 
ATOM   1062 O  O   . LEU A 1 145 ? -14.626 -13.597 5.415   1.00 14.51 ? 147  LEU A O   1 
ATOM   1063 C  CB  . LEU A 1 145 ? -15.083 -10.636 6.010   1.00 14.12 ? 147  LEU A CB  1 
ATOM   1064 C  CG  . LEU A 1 145 ? -15.825 -9.336  5.687   1.00 15.26 ? 147  LEU A CG  1 
ATOM   1065 C  CD1 . LEU A 1 145 ? -16.397 -8.762  6.972   1.00 15.33 ? 147  LEU A CD1 1 
ATOM   1066 C  CD2 . LEU A 1 145 ? -15.004 -8.312  4.954   1.00 15.72 ? 147  LEU A CD2 1 
ATOM   1067 N  N   . GLU A 1 146 ? -12.511 -12.855 5.717   1.00 15.44 ? 148  GLU A N   1 
ATOM   1068 C  CA  . GLU A 1 146 ? -11.935 -14.105 6.209   1.00 15.84 ? 148  GLU A CA  1 
ATOM   1069 C  C   . GLU A 1 146 ? -11.225 -13.902 7.533   1.00 15.93 ? 148  GLU A C   1 
ATOM   1070 O  O   . GLU A 1 146 ? -10.923 -12.774 7.917   1.00 14.53 ? 148  GLU A O   1 
ATOM   1071 C  CB  . GLU A 1 146 ? -10.913 -14.622 5.207   1.00 16.88 ? 148  GLU A CB  1 
ATOM   1072 C  CG  . GLU A 1 146 ? -11.540 -15.114 3.920   1.00 17.95 ? 148  GLU A CG  1 
ATOM   1073 C  CD  . GLU A 1 146 ? -10.523 -15.815 3.044   1.00 18.67 ? 148  GLU A CD  1 
ATOM   1074 O  OE1 . GLU A 1 146 ? -9.489  -15.194 2.702   1.00 18.40 ? 148  GLU A OE1 1 
ATOM   1075 O  OE2 . GLU A 1 146 ? -10.770 -17.004 2.740   1.00 20.67 ? 148  GLU A OE2 1 
ATOM   1076 N  N   . GLU A 1 147 ? -10.915 -15.011 8.199   1.00 15.93 ? 149  GLU A N   1 
ATOM   1077 C  CA  . GLU A 1 147 ? -10.207 -14.948 9.459   1.00 17.85 ? 149  GLU A CA  1 
ATOM   1078 C  C   . GLU A 1 147 ? -8.716  -14.753 9.230   1.00 18.26 ? 149  GLU A C   1 
ATOM   1079 O  O   . GLU A 1 147 ? -8.072  -15.561 8.560   1.00 20.05 ? 149  GLU A O   1 
ATOM   1080 C  CB  . GLU A 1 147 ? -10.403 -16.212 10.303  1.00 18.71 ? 149  GLU A CB  1 
ATOM   1081 C  CG  . GLU A 1 147 ? -9.669  -16.108 11.647  1.00 21.08 ? 149  GLU A CG  1 
ATOM   1082 C  CD  . GLU A 1 147 ? -9.526  -17.410 12.421  1.00 22.53 ? 149  GLU A CD  1 
ATOM   1083 O  OE1 . GLU A 1 147 ? -10.116 -18.410 12.009  1.00 26.43 ? 149  GLU A OE1 1 
ATOM   1084 O  OE2 . GLU A 1 147 ? -8.834  -17.413 13.465  1.00 23.37 ? 149  GLU A OE2 1 
ATOM   1085 N  N   . GLY A 1 148 ? -8.169  -13.733 9.865   1.00 17.78 ? 150  GLY A N   1 
ATOM   1086 C  CA  . GLY A 1 148 ? -6.728  -13.532 9.972   1.00 18.57 ? 150  GLY A CA  1 
ATOM   1087 C  C   . GLY A 1 148 ? -6.330  -13.474 11.424  1.00 17.81 ? 150  GLY A C   1 
ATOM   1088 O  O   . GLY A 1 148 ? -7.196  -13.532 12.300  1.00 19.07 ? 150  GLY A O   1 
ATOM   1089 N  N   . PRO A 1 149 ? -5.027  -13.356 11.696  1.00 19.39 ? 151  PRO A N   1 
ATOM   1090 C  CA  . PRO A 1 149 ? -4.513  -13.402 13.085  1.00 19.12 ? 151  PRO A CA  1 
ATOM   1091 C  C   . PRO A 1 149 ? -4.662  -12.136 13.904  1.00 19.43 ? 151  PRO A C   1 
ATOM   1092 O  O   . PRO A 1 149 ? -4.639  -12.212 15.136  1.00 18.21 ? 151  PRO A O   1 
ATOM   1093 C  CB  . PRO A 1 149 ? -3.025  -13.735 12.900  1.00 19.39 ? 151  PRO A CB  1 
ATOM   1094 C  CG  . PRO A 1 149 ? -2.698  -13.248 11.536  1.00 19.74 ? 151  PRO A CG  1 
ATOM   1095 C  CD  . PRO A 1 149 ? -3.938  -13.315 10.705  1.00 19.48 ? 151  PRO A CD  1 
ATOM   1096 N  N   . GLU A 1 150 ? -4.817  -10.991 13.241  1.00 19.27 ? 152  GLU A N   1 
ATOM   1097 C  CA  . GLU A 1 150 ? -4.833  -9.703  13.917  1.00 19.64 ? 152  GLU A CA  1 
ATOM   1098 C  C   . GLU A 1 150 ? -6.235  -9.139  13.982  1.00 18.48 ? 152  GLU A C   1 
ATOM   1099 O  O   . GLU A 1 150 ? -7.044  -9.359  13.103  1.00 18.51 ? 152  GLU A O   1 
ATOM   1100 C  CB  . GLU A 1 150 ? -3.965  -8.682  13.179  1.00 21.56 ? 152  GLU A CB  1 
ATOM   1101 C  CG  . GLU A 1 150 ? -2.492  -9.008  13.063  1.00 24.72 ? 152  GLU A CG  1 
ATOM   1102 C  CD  . GLU A 1 150 ? -1.829  -9.239  14.394  1.00 26.63 ? 152  GLU A CD  1 
ATOM   1103 O  OE1 . GLU A 1 150 ? -2.071  -8.423  15.298  1.00 30.82 ? 152  GLU A OE1 1 
ATOM   1104 O  OE2 . GLU A 1 150 ? -1.079  -10.228 14.537  1.00 25.42 ? 152  GLU A OE2 1 
ATOM   1105 N  N   . GLU A 1 151 ? -6.499  -8.376  15.025  1.00 18.52 ? 153  GLU A N   1 
ATOM   1106 C  CA  . GLU A 1 151 ? -7.688  -7.539  15.086  1.00 19.26 ? 153  GLU A CA  1 
ATOM   1107 C  C   . GLU A 1 151 ? -7.613  -6.514  13.956  1.00 17.42 ? 153  GLU A C   1 
ATOM   1108 O  O   . GLU A 1 151 ? -6.613  -5.830  13.835  1.00 16.77 ? 153  GLU A O   1 
ATOM   1109 C  CB  . GLU A 1 151 ? -7.735  -6.810  16.427  1.00 21.17 ? 153  GLU A CB  1 
ATOM   1110 C  CG  . GLU A 1 151 ? -8.988  -5.970  16.605  1.00 23.92 ? 153  GLU A CG  1 
ATOM   1111 C  CD  . GLU A 1 151 ? -9.239  -5.609  18.062  1.00 26.27 ? 153  GLU A CD  1 
ATOM   1112 O  OE1 . GLU A 1 151 ? -9.652  -6.513  18.838  1.00 29.04 ? 153  GLU A OE1 1 
ATOM   1113 O  OE2 . GLU A 1 151 ? -9.012  -4.444  18.417  1.00 26.64 ? 153  GLU A OE2 1 
ATOM   1114 N  N   . ASN A 1 152 ? -8.641  -6.454  13.110  1.00 16.03 ? 154  ASN A N   1 
ATOM   1115 C  CA  . ASN A 1 152 ? -8.732  -5.441  12.082  1.00 14.66 ? 154  ASN A CA  1 
ATOM   1116 C  C   . ASN A 1 152 ? -9.204  -4.147  12.703  1.00 14.98 ? 154  ASN A C   1 
ATOM   1117 O  O   . ASN A 1 152 ? -10.363 -4.063  13.137  1.00 15.63 ? 154  ASN A O   1 
ATOM   1118 C  CB  . ASN A 1 152 ? -9.696  -5.885  10.973  1.00 14.33 ? 154  ASN A CB  1 
ATOM   1119 C  CG  . ASN A 1 152 ? -9.658  -4.963  9.776   1.00 13.64 ? 154  ASN A CG  1 
ATOM   1120 O  OD1 . ASN A 1 152 ? -9.901  -3.760  9.902   1.00 13.89 ? 154  ASN A OD1 1 
ATOM   1121 N  ND2 . ASN A 1 152 ? -9.371  -5.512  8.613   1.00 12.85 ? 154  ASN A ND2 1 
ATOM   1122 N  N   . SER A 1 153 ? -8.331  -3.138  12.767  1.00 15.15 ? 155  SER A N   1 
ATOM   1123 C  CA  . SER A 1 153 ? -8.670  -1.902  13.494  1.00 15.44 ? 155  SER A CA  1 
ATOM   1124 C  C   . SER A 1 153 ? -9.792  -1.052  12.857  1.00 14.77 ? 155  SER A C   1 
ATOM   1125 O  O   . SER A 1 153 ? -10.570 -0.416  13.569  1.00 14.22 ? 155  SER A O   1 
ATOM   1126 C  CB  . SER A 1 153 ? -7.423  -1.046  13.764  1.00 16.48 ? 155  SER A CB  1 
ATOM   1127 O  OG  . SER A 1 153 ? -6.960  -0.453  12.597  1.00 19.23 ? 155  SER A OG  1 
ATOM   1128 N  N   . ALA A 1 154 ? -9.895  -1.047  11.531  1.00 13.89 ? 156  ALA A N   1 
ATOM   1129 C  CA  . ALA A 1 154 ? -10.989 -0.334  10.904  1.00 13.73 ? 156  ALA A CA  1 
ATOM   1130 C  C   . ALA A 1 154 ? -12.312 -1.018  11.225  1.00 13.35 ? 156  ALA A C   1 
ATOM   1131 O  O   . ALA A 1 154 ? -13.254 -0.360  11.639  1.00 12.66 ? 156  ALA A O   1 
ATOM   1132 C  CB  . ALA A 1 154 ? -10.779 -0.212  9.420   1.00 13.90 ? 156  ALA A CB  1 
ATOM   1133 N  N   . TYR A 1 155 ? -12.386 -2.330  11.060  1.00 13.65 ? 157  TYR A N   1 
ATOM   1134 C  CA  . TYR A 1 155 ? -13.613 -3.048  11.435  1.00 14.04 ? 157  TYR A CA  1 
ATOM   1135 C  C   . TYR A 1 155 ? -13.989 -2.947  12.906  1.00 14.81 ? 157  TYR A C   1 
ATOM   1136 O  O   . TYR A 1 155 ? -15.200 -2.920  13.237  1.00 14.79 ? 157  TYR A O   1 
ATOM   1137 C  CB  . TYR A 1 155 ? -13.579 -4.511  11.017  1.00 13.74 ? 157  TYR A CB  1 
ATOM   1138 C  CG  . TYR A 1 155 ? -13.966 -4.684  9.574   1.00 13.15 ? 157  TYR A CG  1 
ATOM   1139 C  CD1 . TYR A 1 155 ? -13.029 -4.533  8.569   1.00 13.10 ? 157  TYR A CD1 1 
ATOM   1140 C  CD2 . TYR A 1 155 ? -15.279 -4.933  9.222   1.00 13.09 ? 157  TYR A CD2 1 
ATOM   1141 C  CE1 . TYR A 1 155 ? -13.387 -4.658  7.236   1.00 13.70 ? 157  TYR A CE1 1 
ATOM   1142 C  CE2 . TYR A 1 155 ? -15.660 -5.043  7.894   1.00 13.03 ? 157  TYR A CE2 1 
ATOM   1143 C  CZ  . TYR A 1 155 ? -14.707 -4.920  6.911   1.00 12.97 ? 157  TYR A CZ  1 
ATOM   1144 O  OH  . TYR A 1 155 ? -15.060 -5.037  5.612   1.00 13.21 ? 157  TYR A OH  1 
ATOM   1145 N  N   . GLU A 1 156 ? -12.987 -2.882  13.778  1.00 15.60 ? 158  GLU A N   1 
ATOM   1146 C  CA  . GLU A 1 156 ? -13.229 -2.773  15.223  1.00 17.04 ? 158  GLU A CA  1 
ATOM   1147 C  C   . GLU A 1 156 ? -14.042 -1.547  15.580  1.00 16.67 ? 158  GLU A C   1 
ATOM   1148 O  O   . GLU A 1 156 ? -14.824 -1.577  16.531  1.00 16.50 ? 158  GLU A O   1 
ATOM   1149 C  CB  . GLU A 1 156 ? -11.924 -2.781  16.024  1.00 18.15 ? 158  GLU A CB  1 
ATOM   1150 C  CG  . GLU A 1 156 ? -12.083 -2.957  17.532  1.00 19.62 ? 158  GLU A CG  1 
ATOM   1151 C  CD  . GLU A 1 156 ? -12.751 -4.258  17.949  1.00 21.77 ? 158  GLU A CD  1 
ATOM   1152 O  OE1 . GLU A 1 156 ? -12.822 -5.243  17.171  1.00 21.03 ? 158  GLU A OE1 1 
ATOM   1153 O  OE2 . GLU A 1 156 ? -13.220 -4.294  19.105  1.00 25.45 ? 158  GLU A OE2 1 
ATOM   1154 N  N   . GLN A 1 157 ? -13.891 -0.488  14.803  1.00 17.24 ? 159  GLN A N   1 
ATOM   1155 C  CA  . GLN A 1 157 ? -14.653 0.727   15.031  1.00 18.21 ? 159  GLN A CA  1 
ATOM   1156 C  C   . GLN A 1 157 ? -16.166 0.524   14.876  1.00 18.44 ? 159  GLN A C   1 
ATOM   1157 O  O   . GLN A 1 157 ? -16.949 1.184   15.561  1.00 20.15 ? 159  GLN A O   1 
ATOM   1158 C  CB  . GLN A 1 157 ? -14.183 1.805   14.101  1.00 20.27 ? 159  GLN A CB  1 
ATOM   1159 C  CG  . GLN A 1 157 ? -12.709 2.080   14.270  1.00 22.08 ? 159  GLN A CG  1 
ATOM   1160 C  CD  . GLN A 1 157 ? -12.287 3.405   13.712  1.00 25.07 ? 159  GLN A CD  1 
ATOM   1161 O  OE1 . GLN A 1 157 ? -11.185 3.540   13.153  1.00 26.28 ? 159  GLN A OE1 1 
ATOM   1162 N  NE2 . GLN A 1 157 ? -13.132 4.404   13.878  1.00 26.80 ? 159  GLN A NE2 1 
ATOM   1163 N  N   . LEU A 1 158 ? -16.564 -0.387  13.989  1.00 16.14 ? 160  LEU A N   1 
ATOM   1164 C  CA  . LEU A 1 158 ? -17.952 -0.742  13.811  1.00 16.79 ? 160  LEU A CA  1 
ATOM   1165 C  C   . LEU A 1 158 ? -18.347 -1.853  14.755  1.00 16.67 ? 160  LEU A C   1 
ATOM   1166 O  O   . LEU A 1 158 ? -19.402 -1.774  15.409  1.00 16.40 ? 160  LEU A O   1 
ATOM   1167 C  CB  . LEU A 1 158 ? -18.226 -1.175  12.366  1.00 16.69 ? 160  LEU A CB  1 
ATOM   1168 C  CG  . LEU A 1 158 ? -17.787 -0.145  11.311  1.00 17.45 ? 160  LEU A CG  1 
ATOM   1169 C  CD1 . LEU A 1 158 ? -18.221 -0.589  9.930   1.00 17.73 ? 160  LEU A CD1 1 
ATOM   1170 C  CD2 . LEU A 1 158 ? -18.347 1.239   11.622  1.00 17.76 ? 160  LEU A CD2 1 
ATOM   1171 N  N   . LEU A 1 159 ? -17.518 -2.892  14.822  1.00 16.40 ? 161  LEU A N   1 
ATOM   1172 C  CA  . LEU A 1 159 ? -17.881 -4.097  15.541  1.00 16.95 ? 161  LEU A CA  1 
ATOM   1173 C  C   . LEU A 1 159 ? -17.980 -3.875  17.053  1.00 17.22 ? 161  LEU A C   1 
ATOM   1174 O  O   . LEU A 1 159 ? -18.797 -4.513  17.703  1.00 17.11 ? 161  LEU A O   1 
ATOM   1175 C  CB  . LEU A 1 159 ? -16.901 -5.220  15.250  1.00 17.50 ? 161  LEU A CB  1 
ATOM   1176 C  CG  . LEU A 1 159 ? -16.881 -5.714  13.790  1.00 18.22 ? 161  LEU A CG  1 
ATOM   1177 C  CD1 . LEU A 1 159 ? -15.800 -6.777  13.648  1.00 18.67 ? 161  LEU A CD1 1 
ATOM   1178 C  CD2 . LEU A 1 159 ? -18.220 -6.270  13.363  1.00 18.54 ? 161  LEU A CD2 1 
ATOM   1179 N  N   . SER A 1 160 ? -17.162 -2.964  17.585  1.00 17.20 ? 162  SER A N   1 
ATOM   1180 C  CA  . SER A 1 160 ? -17.188 -2.592  19.002  1.00 17.93 ? 162  SER A CA  1 
ATOM   1181 C  C   . SER A 1 160 ? -18.477 -1.873  19.402  1.00 19.35 ? 162  SER A C   1 
ATOM   1182 O  O   . SER A 1 160 ? -18.712 -1.695  20.585  1.00 19.01 ? 162  SER A O   1 
ATOM   1183 C  CB  . SER A 1 160 ? -15.992 -1.701  19.369  1.00 17.65 ? 162  SER A CB  1 
ATOM   1184 O  OG  . SER A 1 160 ? -16.045 -0.435  18.704  1.00 17.93 ? 162  SER A OG  1 
ATOM   1185 N  N   . ARG A 1 161 ? -19.304 -1.491  18.430  1.00 19.36 ? 163  ARG A N   1 
ATOM   1186 C  CA  . ARG A 1 161 ? -20.529 -0.749  18.673  1.00 20.46 ? 163  ARG A CA  1 
ATOM   1187 C  C   . ARG A 1 161 ? -21.769 -1.585  18.430  1.00 20.31 ? 163  ARG A C   1 
ATOM   1188 O  O   . ARG A 1 161 ? -22.878 -1.058  18.587  1.00 20.92 ? 163  ARG A O   1 
ATOM   1189 C  CB  . ARG A 1 161 ? -20.586 0.491   17.761  1.00 22.04 ? 163  ARG A CB  1 
ATOM   1190 C  CG  . ARG A 1 161 ? -19.331 1.336   17.725  1.00 23.84 ? 163  ARG A CG  1 
ATOM   1191 C  CD  . ARG A 1 161 ? -18.966 1.947   19.066  1.00 25.67 ? 163  ARG A CD  1 
ATOM   1192 N  NE  . ARG A 1 161 ? -19.988 2.909   19.437  1.00 29.74 ? 163  ARG A NE  1 
ATOM   1193 C  CZ  . ARG A 1 161 ? -19.968 4.227   19.201  1.00 30.59 ? 163  ARG A CZ  1 
ATOM   1194 N  NH1 . ARG A 1 161 ? -18.942 4.838   18.602  1.00 31.71 ? 163  ARG A NH1 1 
ATOM   1195 N  NH2 . ARG A 1 161 ? -21.020 4.945   19.574  1.00 32.02 ? 163  ARG A NH2 1 
ATOM   1196 N  N   . LEU A 1 162 ? -21.623 -2.866  18.063  1.00 18.79 ? 164  LEU A N   1 
ATOM   1197 C  CA  . LEU A 1 162 ? -22.792 -3.689  17.775  1.00 19.74 ? 164  LEU A CA  1 
ATOM   1198 C  C   . LEU A 1 162 ? -23.647 -3.960  19.011  1.00 21.25 ? 164  LEU A C   1 
ATOM   1199 O  O   . LEU A 1 162 ? -24.847 -4.124  18.878  1.00 19.02 ? 164  LEU A O   1 
ATOM   1200 C  CB  . LEU A 1 162 ? -22.423 -5.022  17.121  1.00 19.24 ? 164  LEU A CB  1 
ATOM   1201 C  CG  . LEU A 1 162 ? -21.783 -4.954  15.730  1.00 18.73 ? 164  LEU A CG  1 
ATOM   1202 C  CD1 . LEU A 1 162 ? -21.763 -6.354  15.150  1.00 19.39 ? 164  LEU A CD1 1 
ATOM   1203 C  CD2 . LEU A 1 162 ? -22.492 -4.003  14.775  1.00 18.69 ? 164  LEU A CD2 1 
ATOM   1204 N  N   . GLU A 1 163 ? -23.031 -3.997  20.196  1.00 24.08 ? 165  GLU A N   1 
ATOM   1205 C  CA  . GLU A 1 163 ? -23.767 -4.224  21.443  1.00 28.15 ? 165  GLU A CA  1 
ATOM   1206 C  C   . GLU A 1 163 ? -24.790 -3.102  21.701  1.00 27.14 ? 165  GLU A C   1 
ATOM   1207 O  O   . GLU A 1 163 ? -25.916 -3.388  22.096  1.00 27.95 ? 165  GLU A O   1 
ATOM   1208 C  CB  . GLU A 1 163 ? -22.813 -4.371  22.639  1.00 34.21 ? 165  GLU A CB  1 
ATOM   1209 C  CG  . GLU A 1 163 ? -23.472 -5.026  23.841  1.00 41.77 ? 165  GLU A CG  1 
ATOM   1210 C  CD  . GLU A 1 163 ? -22.540 -5.163  25.041  1.00 50.70 ? 165  GLU A CD  1 
ATOM   1211 O  OE1 . GLU A 1 163 ? -21.290 -5.145  24.867  1.00 56.74 ? 165  GLU A OE1 1 
ATOM   1212 O  OE2 . GLU A 1 163 ? -23.070 -5.285  26.171  1.00 55.68 ? 165  GLU A OE2 1 
ATOM   1213 N  N   . GLU A 1 164 ? -24.404 -1.860  21.417  1.00 26.25 ? 166  GLU A N   1 
ATOM   1214 C  CA  . GLU A 1 164 ? -25.319 -0.709  21.455  1.00 27.15 ? 166  GLU A CA  1 
ATOM   1215 C  C   . GLU A 1 164 ? -26.526 -0.822  20.528  1.00 24.28 ? 166  GLU A C   1 
ATOM   1216 O  O   . GLU A 1 164 ? -27.509 -0.128  20.755  1.00 22.84 ? 166  GLU A O   1 
ATOM   1217 C  CB  . GLU A 1 164 ? -24.600 0.592   21.050  1.00 29.49 ? 166  GLU A CB  1 
ATOM   1218 C  CG  . GLU A 1 164 ? -23.584 1.093   22.047  1.00 33.40 ? 166  GLU A CG  1 
ATOM   1219 C  CD  . GLU A 1 164 ? -22.582 2.038   21.411  1.00 36.06 ? 166  GLU A CD  1 
ATOM   1220 O  OE1 . GLU A 1 164 ? -22.990 2.968   20.671  1.00 35.18 ? 166  GLU A OE1 1 
ATOM   1221 O  OE2 . GLU A 1 164 ? -21.369 1.829   21.633  1.00 41.65 ? 166  GLU A OE2 1 
ATOM   1222 N  N   . ILE A 1 165 ? -26.416 -1.588  19.437  1.00 21.61 ? 167  ILE A N   1 
ATOM   1223 C  CA  . ILE A 1 165 ? -27.520 -1.736  18.474  1.00 20.21 ? 167  ILE A CA  1 
ATOM   1224 C  C   . ILE A 1 165 ? -28.011 -3.188  18.325  1.00 19.90 ? 167  ILE A C   1 
ATOM   1225 O  O   . ILE A 1 165 ? -28.475 -3.603  17.253  1.00 18.07 ? 167  ILE A O   1 
ATOM   1226 C  CB  . ILE A 1 165 ? -27.167 -1.138  17.083  1.00 19.51 ? 167  ILE A CB  1 
ATOM   1227 C  CG1 . ILE A 1 165 ? -25.906 -1.781  16.474  1.00 18.68 ? 167  ILE A CG1 1 
ATOM   1228 C  CG2 . ILE A 1 165 ? -27.018 0.365   17.181  1.00 19.42 ? 167  ILE A CG2 1 
ATOM   1229 C  CD1 . ILE A 1 165 ? -25.652 -1.368  15.028  1.00 18.63 ? 167  ILE A CD1 1 
ATOM   1230 N  N   . ALA A 1 166 ? -27.923 -3.950  19.409  1.00 19.94 ? 168  ALA A N   1 
ATOM   1231 C  CA  . ALA A 1 166 ? -28.318 -5.358  19.388  1.00 21.44 ? 168  ALA A CA  1 
ATOM   1232 C  C   . ALA A 1 166 ? -29.780 -5.542  18.980  1.00 22.22 ? 168  ALA A C   1 
ATOM   1233 O  O   . ALA A 1 166 ? -30.121 -6.479  18.262  1.00 22.46 ? 168  ALA A O   1 
ATOM   1234 C  CB  . ALA A 1 166 ? -28.073 -5.991  20.749  1.00 21.86 ? 168  ALA A CB  1 
ATOM   1235 N  N   . GLU A 1 167 ? -30.634 -4.626  19.422  1.00 23.17 ? 169  GLU A N   1 
ATOM   1236 C  CA  . GLU A 1 167 ? -32.064 -4.720  19.169  1.00 25.13 ? 169  GLU A CA  1 
ATOM   1237 C  C   . GLU A 1 167 ? -32.391 -4.339  17.718  1.00 23.21 ? 169  GLU A C   1 
ATOM   1238 O  O   . GLU A 1 167 ? -31.893 -3.341  17.202  1.00 21.44 ? 169  GLU A O   1 
ATOM   1239 C  CB  . GLU A 1 167 ? -32.790 -3.790  20.147  1.00 29.95 ? 169  GLU A CB  1 
ATOM   1240 C  CG  . GLU A 1 167 ? -34.302 -3.880  20.145  1.00 36.21 ? 169  GLU A CG  1 
ATOM   1241 C  CD  . GLU A 1 167 ? -34.966 -2.737  20.916  1.00 40.58 ? 169  GLU A CD  1 
ATOM   1242 O  OE1 . GLU A 1 167 ? -34.376 -2.197  21.884  1.00 43.09 ? 169  GLU A OE1 1 
ATOM   1243 O  OE2 . GLU A 1 167 ? -36.094 -2.374  20.539  1.00 44.20 ? 169  GLU A OE2 1 
ATOM   1244 N  N   . GLU A 1 168 ? -33.240 -5.138  17.076  1.00 22.81 ? 170  GLU A N   1 
ATOM   1245 C  CA  . GLU A 1 168 ? -33.791 -4.821  15.770  1.00 23.89 ? 170  GLU A CA  1 
ATOM   1246 C  C   . GLU A 1 168 ? -34.261 -3.369  15.733  1.00 22.53 ? 170  GLU A C   1 
ATOM   1247 O  O   . GLU A 1 168 ? -34.912 -2.888  16.664  1.00 20.13 ? 170  GLU A O   1 
ATOM   1248 C  CB  . GLU A 1 168 ? -34.954 -5.761  15.405  1.00 26.74 ? 170  GLU A CB  1 
ATOM   1249 C  CG  . GLU A 1 168 ? -35.666 -5.340  14.122  1.00 30.71 ? 170  GLU A CG  1 
ATOM   1250 C  CD  . GLU A 1 168 ? -36.801 -6.251  13.699  1.00 35.02 ? 170  GLU A CD  1 
ATOM   1251 O  OE1 . GLU A 1 168 ? -37.405 -6.921  14.560  1.00 39.88 ? 170  GLU A OE1 1 
ATOM   1252 O  OE2 . GLU A 1 168 ? -37.090 -6.271  12.485  1.00 39.81 ? 170  GLU A OE2 1 
ATOM   1253 N  N   . GLY A 1 169 ? -33.904 -2.675  14.660  1.00 20.70 ? 171  GLY A N   1 
ATOM   1254 C  CA  . GLY A 1 169 ? -34.315 -1.295  14.465  1.00 21.15 ? 171  GLY A CA  1 
ATOM   1255 C  C   . GLY A 1 169 ? -33.607 -0.232  15.280  1.00 21.08 ? 171  GLY A C   1 
ATOM   1256 O  O   . GLY A 1 169 ? -34.079 0.890   15.309  1.00 23.69 ? 171  GLY A O   1 
ATOM   1257 N  N   . SER A 1 170 ? -32.496 -0.559  15.942  1.00 20.29 ? 172  SER A N   1 
ATOM   1258 C  CA  . SER A 1 170 ? -31.755 0.424   16.727  1.00 20.36 ? 172  SER A CA  1 
ATOM   1259 C  C   . SER A 1 170 ? -30.598 1.014   15.920  1.00 19.98 ? 172  SER A C   1 
ATOM   1260 O  O   . SER A 1 170 ? -30.143 0.444   14.923  1.00 18.01 ? 172  SER A O   1 
ATOM   1261 C  CB  . SER A 1 170 ? -31.244 -0.163  18.037  1.00 21.75 ? 172  SER A CB  1 
ATOM   1262 O  OG  . SER A 1 170 ? -30.498 -1.335  17.820  1.00 24.00 ? 172  SER A OG  1 
ATOM   1263 N  N   . GLU A 1 171 ? -30.141 2.171   16.360  1.00 18.61 ? 173  GLU A N   1 
ATOM   1264 C  CA  . GLU A 1 171 ? -29.011 2.811   15.704  1.00 20.12 ? 173  GLU A CA  1 
ATOM   1265 C  C   . GLU A 1 171 ? -28.142 3.570   16.692  1.00 19.19 ? 173  GLU A C   1 
ATOM   1266 O  O   . GLU A 1 171 ? -28.533 3.807   17.854  1.00 16.43 ? 173  GLU A O   1 
ATOM   1267 C  CB  . GLU A 1 171 ? -29.466 3.675   14.514  1.00 20.52 ? 173  GLU A CB  1 
ATOM   1268 C  CG  . GLU A 1 171 ? -30.409 4.802   14.843  1.00 21.41 ? 173  GLU A CG  1 
ATOM   1269 C  CD  . GLU A 1 171 ? -30.928 5.515   13.608  1.00 22.34 ? 173  GLU A CD  1 
ATOM   1270 O  OE1 . GLU A 1 171 ? -31.579 4.898   12.762  1.00 27.25 ? 173  GLU A OE1 1 
ATOM   1271 O  OE2 . GLU A 1 171 ? -30.716 6.717   13.475  1.00 24.42 ? 173  GLU A OE2 1 
ATOM   1272 N  N   . THR A 1 172 ? -26.929 3.863   16.235  1.00 16.97 ? 174  THR A N   1 
ATOM   1273 C  CA  . THR A 1 172 ? -25.989 4.654   16.987  1.00 17.63 ? 174  THR A CA  1 
ATOM   1274 C  C   . THR A 1 172 ? -25.157 5.475   16.033  1.00 18.40 ? 174  THR A C   1 
ATOM   1275 O  O   . THR A 1 172 ? -25.192 5.260   14.820  1.00 18.30 ? 174  THR A O   1 
ATOM   1276 C  CB  . THR A 1 172 ? -25.119 3.760   17.877  1.00 18.16 ? 174  THR A CB  1 
ATOM   1277 O  OG1 . THR A 1 172 ? -24.477 4.561   18.849  1.00 18.41 ? 174  THR A OG1 1 
ATOM   1278 C  CG2 . THR A 1 172 ? -24.074 2.941   17.054  1.00 18.05 ? 174  THR A CG2 1 
ATOM   1279 N  N   . GLN A 1 173 ? -24.444 6.446   16.581  1.00 18.69 ? 175  GLN A N   1 
ATOM   1280 C  CA  . GLN A 1 173 ? -23.569 7.279   15.799  1.00 19.11 ? 175  GLN A CA  1 
ATOM   1281 C  C   . GLN A 1 173 ? -22.139 6.811   16.044  1.00 19.13 ? 175  GLN A C   1 
ATOM   1282 O  O   . GLN A 1 173 ? -21.774 6.443   17.176  1.00 19.11 ? 175  GLN A O   1 
ATOM   1283 C  CB  . GLN A 1 173 ? -23.755 8.751   16.164  1.00 19.95 ? 175  GLN A CB  1 
ATOM   1284 C  CG  . GLN A 1 173 ? -25.071 9.364   15.700  1.00 20.49 ? 175  GLN A CG  1 
ATOM   1285 C  CD  . GLN A 1 173 ? -25.073 10.881  15.849  1.00 21.22 ? 175  GLN A CD  1 
ATOM   1286 O  OE1 . GLN A 1 173 ? -25.069 11.415  16.958  1.00 22.53 ? 175  GLN A OE1 1 
ATOM   1287 N  NE2 . GLN A 1 173 ? -25.049 11.576  14.733  1.00 21.86 ? 175  GLN A NE2 1 
ATOM   1288 N  N   . VAL A 1 174 ? -21.343 6.785   14.978  1.00 18.40 ? 176  VAL A N   1 
ATOM   1289 C  CA  . VAL A 1 174 ? -19.920 6.431   15.068  1.00 17.96 ? 176  VAL A CA  1 
ATOM   1290 C  C   . VAL A 1 174 ? -19.058 7.504   14.391  1.00 16.82 ? 176  VAL A C   1 
ATOM   1291 O  O   . VAL A 1 174 ? -19.467 8.089   13.402  1.00 16.05 ? 176  VAL A O   1 
ATOM   1292 C  CB  . VAL A 1 174 ? -19.591 5.030   14.477  1.00 18.38 ? 176  VAL A CB  1 
ATOM   1293 C  CG1 . VAL A 1 174 ? -20.448 3.959   15.127  1.00 19.91 ? 176  VAL A CG1 1 
ATOM   1294 C  CG2 . VAL A 1 174 ? -19.758 4.990   12.978  1.00 18.46 ? 176  VAL A CG2 1 
ATOM   1295 N  N   . PRO A 1 175 ? -17.851 7.753   14.928  1.00 16.37 ? 177  PRO A N   1 
ATOM   1296 C  CA  . PRO A 1 175 ? -16.966 8.700   14.255  1.00 15.92 ? 177  PRO A CA  1 
ATOM   1297 C  C   . PRO A 1 175 ? -16.617 8.262   12.833  1.00 14.53 ? 177  PRO A C   1 
ATOM   1298 O  O   . PRO A 1 175 ? -16.550 7.075   12.543  1.00 13.91 ? 177  PRO A O   1 
ATOM   1299 C  CB  . PRO A 1 175 ? -15.709 8.704   15.123  1.00 16.47 ? 177  PRO A CB  1 
ATOM   1300 C  CG  . PRO A 1 175 ? -16.173 8.232   16.467  1.00 17.61 ? 177  PRO A CG  1 
ATOM   1301 C  CD  . PRO A 1 175 ? -17.261 7.235   16.175  1.00 17.03 ? 177  PRO A CD  1 
ATOM   1302 N  N   . GLY A 1 176 ? -16.428 9.224   11.954  1.00 13.87 ? 178  GLY A N   1 
ATOM   1303 C  CA  . GLY A 1 176 ? -15.923 8.933   10.605  1.00 14.27 ? 178  GLY A CA  1 
ATOM   1304 C  C   . GLY A 1 176 ? -14.578 8.247   10.721  1.00 13.95 ? 178  GLY A C   1 
ATOM   1305 O  O   . GLY A 1 176 ? -13.872 8.375   11.742  1.00 13.83 ? 178  GLY A O   1 
ATOM   1306 N  N   . LEU A 1 177 ? -14.260 7.462   9.701   1.00 13.84 ? 179  LEU A N   1 
ATOM   1307 C  CA  . LEU A 1 177 ? -13.025 6.689   9.649   1.00 14.05 ? 179  LEU A CA  1 
ATOM   1308 C  C   . LEU A 1 177 ? -12.625 6.579   8.193   1.00 13.35 ? 179  LEU A C   1 
ATOM   1309 O  O   . LEU A 1 177 ? -13.329 7.085   7.317   1.00 12.38 ? 179  LEU A O   1 
ATOM   1310 C  CB  . LEU A 1 177 ? -13.225 5.300   10.276  1.00 14.62 ? 179  LEU A CB  1 
ATOM   1311 C  CG  . LEU A 1 177 ? -14.180 4.334   9.550   1.00 15.05 ? 179  LEU A CG  1 
ATOM   1312 C  CD1 . LEU A 1 177 ? -13.686 2.894   9.626   1.00 15.85 ? 179  LEU A CD1 1 
ATOM   1313 C  CD2 . LEU A 1 177 ? -15.606 4.423   10.075  1.00 15.22 ? 179  LEU A CD2 1 
ATOM   1314 N  N   . ASP A 1 178 ? -11.491 5.927   7.937   1.00 13.57 ? 180  ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 178 ? -11.088 5.627   6.550   1.00 13.45 ? 180  ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 178 ? -11.924 4.457   6.062   1.00 12.57 ? 180  ASP A C   1 
ATOM   1317 O  O   . ASP A 1 178 ? -11.635 3.294   6.352   1.00 12.07 ? 180  ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 178 ? -9.605  5.291   6.455   1.00 14.45 ? 180  ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 178 ? -9.153  5.031   5.009   1.00 15.84 ? 180  ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 178 ? -9.969  5.101   4.056   1.00 15.24 ? 180  ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 178 ? -7.947  4.805   4.841   1.00 16.86 ? 180  ASP A OD2 1 
ATOM   1322 N  N   . ILE A 1 179 ? -12.963 4.789   5.309   1.00 12.57 ? 181  ILE A N   1 
ATOM   1323 C  CA  . ILE A 1 179 ? -13.910 3.808   4.794   1.00 12.52 ? 181  ILE A CA  1 
ATOM   1324 C  C   . ILE A 1 179 ? -13.200 2.828   3.828   1.00 12.42 ? 181  ILE A C   1 
ATOM   1325 O  O   . ILE A 1 179 ? -13.578 1.648   3.769   1.00 12.44 ? 181  ILE A O   1 
ATOM   1326 C  CB  . ILE A 1 179 ? -15.123 4.499   4.097   1.00 12.47 ? 181  ILE A CB  1 
ATOM   1327 C  CG1 . ILE A 1 179 ? -15.887 5.407   5.070   1.00 12.52 ? 181  ILE A CG1 1 
ATOM   1328 C  CG2 . ILE A 1 179 ? -16.104 3.474   3.502   1.00 12.63 ? 181  ILE A CG2 1 
ATOM   1329 C  CD1 . ILE A 1 179 ? -16.425 4.712   6.292   1.00 12.68 ? 181  ILE A CD1 1 
ATOM   1330 N  N   . SER A 1 180 ? -12.173 3.297   3.113   1.00 12.30 ? 182  SER A N   1 
ATOM   1331 C  CA  . SER A 1 180 ? -11.385 2.425   2.196   1.00 12.90 ? 182  SER A CA  1 
ATOM   1332 C  C   . SER A 1 180 ? -10.630 1.338   2.953   1.00 12.51 ? 182  SER A C   1 
ATOM   1333 O  O   . SER A 1 180 ? -10.367 0.290   2.415   1.00 12.37 ? 182  SER A O   1 
ATOM   1334 C  CB  . SER A 1 180 ? -10.446 3.243   1.283   1.00 12.79 ? 182  SER A CB  1 
ATOM   1335 O  OG  . SER A 1 180 ? -9.275  3.640   1.952   1.00 13.54 ? 182  SER A OG  1 
ATOM   1336 N  N   . ALA A 1 181 ? -10.362 1.561   4.241   1.00 13.00 ? 183  ALA A N   1 
ATOM   1337 C  CA  . ALA A 1 181 ? -9.731  0.553   5.079   1.00 12.69 ? 183  ALA A CA  1 
ATOM   1338 C  C   . ALA A 1 181 ? -10.644 -0.611  5.415   1.00 13.06 ? 183  ALA A C   1 
ATOM   1339 O  O   . ALA A 1 181 ? -10.190 -1.578  5.998   1.00 13.56 ? 183  ALA A O   1 
ATOM   1340 C  CB  . ALA A 1 181 ? -9.164  1.199   6.346   1.00 13.03 ? 183  ALA A CB  1 
ATOM   1341 N  N   . LEU A 1 182 ? -11.939 -0.537  5.077   1.00 13.39 ? 184  LEU A N   1 
ATOM   1342 C  CA  . LEU A 1 182 ? -12.832 -1.699  5.187   1.00 13.27 ? 184  LEU A CA  1 
ATOM   1343 C  C   . LEU A 1 182 ? -12.772 -2.610  3.962   1.00 13.83 ? 184  LEU A C   1 
ATOM   1344 O  O   . LEU A 1 182 ? -13.407 -3.680  3.953   1.00 14.13 ? 184  LEU A O   1 
ATOM   1345 C  CB  . LEU A 1 182 ? -14.279 -1.264  5.424   1.00 13.14 ? 184  LEU A CB  1 
ATOM   1346 C  CG  . LEU A 1 182 ? -14.453 -0.358  6.654   1.00 13.07 ? 184  LEU A CG  1 
ATOM   1347 C  CD1 . LEU A 1 182 ? -15.816 0.325   6.628   1.00 13.45 ? 184  LEU A CD1 1 
ATOM   1348 C  CD2 . LEU A 1 182 ? -14.234 -1.093  7.976   1.00 13.40 ? 184  LEU A CD2 1 
ATOM   1349 N  N   . LEU A 1 183 ? -12.022 -2.204  2.933   1.00 14.15 ? 185  LEU A N   1 
ATOM   1350 C  CA  . LEU A 1 183 ? -11.941 -2.968  1.686   1.00 14.58 ? 185  LEU A CA  1 
ATOM   1351 C  C   . LEU A 1 183 ? -10.504 -3.448  1.502   1.00 15.11 ? 185  LEU A C   1 
ATOM   1352 O  O   . LEU A 1 183 ? -9.610  -2.944  2.159   1.00 14.31 ? 185  LEU A O   1 
ATOM   1353 C  CB  . LEU A 1 183 ? -12.380 -2.082  0.519   1.00 14.91 ? 185  LEU A CB  1 
ATOM   1354 C  CG  . LEU A 1 183 ? -13.849 -1.634  0.513   1.00 15.24 ? 185  LEU A CG  1 
ATOM   1355 C  CD1 . LEU A 1 183 ? -14.055 -0.588  -0.568  1.00 16.26 ? 185  LEU A CD1 1 
ATOM   1356 C  CD2 . LEU A 1 183 ? -14.792 -2.797  0.272   1.00 15.70 ? 185  LEU A CD2 1 
ATOM   1357 N  N   . PRO A 1 184 ? -10.267 -4.413  0.590   1.00 15.94 ? 186  PRO A N   1 
ATOM   1358 C  CA  . PRO A 1 184 ? -8.891  -4.841  0.246   1.00 16.04 ? 186  PRO A CA  1 
ATOM   1359 C  C   . PRO A 1 184 ? -8.020  -3.710  -0.267  1.00 15.87 ? 186  PRO A C   1 
ATOM   1360 O  O   . PRO A 1 184 ? -8.548  -2.746  -0.827  1.00 15.32 ? 186  PRO A O   1 
ATOM   1361 C  CB  . PRO A 1 184 ? -9.129  -5.842  -0.905  1.00 16.93 ? 186  PRO A CB  1 
ATOM   1362 C  CG  . PRO A 1 184 ? -10.503 -6.338  -0.705  1.00 16.98 ? 186  PRO A CG  1 
ATOM   1363 C  CD  . PRO A 1 184 ? -11.281 -5.183  -0.161  1.00 16.37 ? 186  PRO A CD  1 
ATOM   1364 N  N   . SER A 1 185 ? -6.711  -3.801  -0.078  1.00 16.04 ? 187  SER A N   1 
ATOM   1365 C  CA  . SER A 1 185 ? -5.810  -2.804  -0.656  1.00 16.75 ? 187  SER A CA  1 
ATOM   1366 C  C   . SER A 1 185 ? -5.626  -3.046  -2.166  1.00 15.19 ? 187  SER A C   1 
ATOM   1367 O  O   . SER A 1 185 ? -5.321  -2.127  -2.896  1.00 14.35 ? 187  SER A O   1 
ATOM   1368 C  CB  . SER A 1 185 ? -4.467  -2.770  0.070   1.00 18.81 ? 187  SER A CB  1 
ATOM   1369 O  OG  . SER A 1 185 ? -3.874  -4.037  -0.011  1.00 21.49 ? 187  SER A OG  1 
ATOM   1370 N  N   . ASP A 1 186 ? -5.885  -4.255  -2.648  1.00 15.05 ? 188  ASP A N   1 
ATOM   1371 C  CA  . ASP A 1 186 ? -5.757  -4.530  -4.081  1.00 15.43 ? 188  ASP A CA  1 
ATOM   1372 C  C   . ASP A 1 186 ? -7.039  -4.149  -4.835  1.00 15.16 ? 188  ASP A C   1 
ATOM   1373 O  O   . ASP A 1 186 ? -8.014  -4.925  -4.846  1.00 15.07 ? 188  ASP A O   1 
ATOM   1374 C  CB  . ASP A 1 186 ? -5.411  -6.016  -4.291  1.00 16.15 ? 188  ASP A CB  1 
ATOM   1375 C  CG  . ASP A 1 186 ? -5.150  -6.370  -5.779  1.00 17.93 ? 188  ASP A CG  1 
ATOM   1376 O  OD1 . ASP A 1 186 ? -5.419  -5.524  -6.677  1.00 17.87 ? 188  ASP A OD1 1 
ATOM   1377 O  OD2 . ASP A 1 186 ? -4.658  -7.500  -6.025  1.00 18.13 ? 188  ASP A OD2 1 
ATOM   1378 N  N   . PHE A 1 187 ? -7.028  -2.987  -5.486  1.00 15.42 ? 189  PHE A N   1 
ATOM   1379 C  CA  . PHE A 1 187 ? -8.163  -2.538  -6.327  1.00 17.55 ? 189  PHE A CA  1 
ATOM   1380 C  C   . PHE A 1 187 ? -8.020  -2.887  -7.829  1.00 15.33 ? 189  PHE A C   1 
ATOM   1381 O  O   . PHE A 1 187 ? -8.839  -2.461  -8.633  1.00 14.29 ? 189  PHE A O   1 
ATOM   1382 C  CB  . PHE A 1 187 ? -8.368  -1.011  -6.188  1.00 20.65 ? 189  PHE A CB  1 
ATOM   1383 C  CG  . PHE A 1 187 ? -8.885  -0.567  -4.837  1.00 25.67 ? 189  PHE A CG  1 
ATOM   1384 C  CD1 . PHE A 1 187 ? -9.837  -1.300  -4.138  1.00 29.03 ? 189  PHE A CD1 1 
ATOM   1385 C  CD2 . PHE A 1 187 ? -8.398  0.606   -4.254  1.00 32.27 ? 189  PHE A CD2 1 
ATOM   1386 C  CE1 . PHE A 1 187 ? -10.306 -0.874  -2.892  1.00 30.48 ? 189  PHE A CE1 1 
ATOM   1387 C  CE2 . PHE A 1 187 ? -8.847  1.029   -3.001  1.00 33.74 ? 189  PHE A CE2 1 
ATOM   1388 C  CZ  . PHE A 1 187 ? -9.806  0.285   -2.326  1.00 32.17 ? 189  PHE A CZ  1 
ATOM   1389 N  N   . SER A 1 188 ? -7.000  -3.671  -8.181  1.00 14.04 ? 190  SER A N   1 
ATOM   1390 C  CA  . SER A 1 188 ? -6.703  -4.035  -9.558  1.00 13.89 ? 190  SER A CA  1 
ATOM   1391 C  C   . SER A 1 188 ? -7.310  -5.347  -10.006 1.00 12.87 ? 190  SER A C   1 
ATOM   1392 O  O   . SER A 1 188 ? -7.576  -5.530  -11.200 1.00 12.80 ? 190  SER A O   1 
ATOM   1393 C  CB  . SER A 1 188 ? -5.185  -4.150  -9.731  1.00 15.06 ? 190  SER A CB  1 
ATOM   1394 O  OG  . SER A 1 188 ? -4.665  -2.852  -9.540  1.00 17.90 ? 190  SER A OG  1 
ATOM   1395 N  N   . ARG A 1 189 ? -7.455  -6.286  -9.072  1.00 12.07 ? 191  ARG A N   1 
ATOM   1396 C  CA  . ARG A 1 189 ? -7.865  -7.641  -9.398  1.00 12.11 ? 191  ARG A CA  1 
ATOM   1397 C  C   . ARG A 1 189 ? -9.256  -7.925  -8.878  1.00 11.62 ? 191  ARG A C   1 
ATOM   1398 O  O   . ARG A 1 189 ? -9.476  -7.978  -7.664  1.00 11.57 ? 191  ARG A O   1 
ATOM   1399 C  CB  . ARG A 1 189 ? -6.842  -8.627  -8.831  1.00 12.45 ? 191  ARG A CB  1 
ATOM   1400 C  CG  . ARG A 1 189 ? -5.437  -8.332  -9.359  1.00 13.11 ? 191  ARG A CG  1 
ATOM   1401 C  CD  . ARG A 1 189 ? -4.405  -9.285  -8.807  1.00 13.54 ? 191  ARG A CD  1 
ATOM   1402 N  NE  . ARG A 1 189 ? -4.473  -10.602 -9.434  1.00 14.65 ? 191  ARG A NE  1 
ATOM   1403 C  CZ  . ARG A 1 189 ? -3.943  -10.941 -10.618 1.00 14.57 ? 191  ARG A CZ  1 
ATOM   1404 N  NH1 . ARG A 1 189 ? -3.321  -10.062 -11.378 1.00 14.50 ? 191  ARG A NH1 1 
ATOM   1405 N  NH2 . ARG A 1 189 ? -4.041  -12.197 -11.042 1.00 15.09 ? 191  ARG A NH2 1 
ATOM   1406 N  N   . TYR A 1 190 ? -10.199 -8.101  -9.799  1.00 10.64 ? 192  TYR A N   1 
ATOM   1407 C  CA  . TYR A 1 190 ? -11.593 -8.268  -9.419  1.00 10.22 ? 192  TYR A CA  1 
ATOM   1408 C  C   . TYR A 1 190 ? -12.387 -8.913  -10.532 1.00 10.16 ? 192  TYR A C   1 
ATOM   1409 O  O   . TYR A 1 190 ? -11.936 -8.931  -11.683 1.00 9.53  ? 192  TYR A O   1 
ATOM   1410 C  CB  . TYR A 1 190 ? -12.220 -6.922  -9.065  1.00 10.21 ? 192  TYR A CB  1 
ATOM   1411 C  CG  . TYR A 1 190 ? -12.108 -5.854  -10.132 1.00 10.28 ? 192  TYR A CG  1 
ATOM   1412 C  CD1 . TYR A 1 190 ? -13.044 -5.782  -11.155 1.00 10.32 ? 192  TYR A CD1 1 
ATOM   1413 C  CD2 . TYR A 1 190 ? -11.069 -4.900  -10.125 1.00 10.50 ? 192  TYR A CD2 1 
ATOM   1414 C  CE1 . TYR A 1 190 ? -12.964 -4.804  -12.146 1.00 10.52 ? 192  TYR A CE1 1 
ATOM   1415 C  CE2 . TYR A 1 190 ? -10.983 -3.916  -11.121 1.00 10.45 ? 192  TYR A CE2 1 
ATOM   1416 C  CZ  . TYR A 1 190 ? -11.937 -3.871  -12.132 1.00 10.68 ? 192  TYR A CZ  1 
ATOM   1417 O  OH  . TYR A 1 190 ? -11.904 -2.898  -13.135 1.00 11.01 ? 192  TYR A OH  1 
ATOM   1418 N  N   . PHE A 1 191 ? -13.559 -9.417  -10.147 1.00 10.26 ? 193  PHE A N   1 
ATOM   1419 C  CA  . PHE A 1 191 ? -14.551 -9.906  -11.052 1.00 10.77 ? 193  PHE A CA  1 
ATOM   1420 C  C   . PHE A 1 191 ? -15.644 -8.844  -11.166 1.00 11.14 ? 193  PHE A C   1 
ATOM   1421 O  O   . PHE A 1 191 ? -15.881 -8.064  -10.222 1.00 10.72 ? 193  PHE A O   1 
ATOM   1422 C  CB  . PHE A 1 191 ? -15.139 -11.208 -10.537 1.00 11.41 ? 193  PHE A CB  1 
ATOM   1423 C  CG  . PHE A 1 191 ? -14.132 -12.267 -10.313 1.00 11.83 ? 193  PHE A CG  1 
ATOM   1424 C  CD1 . PHE A 1 191 ? -13.687 -13.045 -11.367 1.00 12.84 ? 193  PHE A CD1 1 
ATOM   1425 C  CD2 . PHE A 1 191 ? -13.616 -12.497 -9.046  1.00 12.64 ? 193  PHE A CD2 1 
ATOM   1426 C  CE1 . PHE A 1 191 ? -12.710 -14.026 -11.159 1.00 13.07 ? 193  PHE A CE1 1 
ATOM   1427 C  CE2 . PHE A 1 191 ? -12.659 -13.483 -8.824  1.00 12.89 ? 193  PHE A CE2 1 
ATOM   1428 C  CZ  . PHE A 1 191 ? -12.206 -14.246 -9.877  1.00 12.88 ? 193  PHE A CZ  1 
ATOM   1429 N  N   . GLN A 1 192 ? -16.285 -8.775  -12.337 1.00 10.73 ? 194  GLN A N   1 
ATOM   1430 C  CA  . GLN A 1 192 ? -17.368 -7.833  -12.522 1.00 10.63 ? 194  GLN A CA  1 
ATOM   1431 C  C   . GLN A 1 192 ? -18.450 -8.458  -13.398 1.00 11.39 ? 194  GLN A C   1 
ATOM   1432 O  O   . GLN A 1 192 ? -18.144 -9.137  -14.399 1.00 11.78 ? 194  GLN A O   1 
ATOM   1433 C  CB  . GLN A 1 192 ? -16.831 -6.546  -13.130 1.00 10.56 ? 194  GLN A CB  1 
ATOM   1434 C  CG  . GLN A 1 192 ? -17.836 -5.411  -13.178 1.00 10.22 ? 194  GLN A CG  1 
ATOM   1435 C  CD  . GLN A 1 192 ? -17.194 -4.115  -13.573 1.00 10.45 ? 194  GLN A CD  1 
ATOM   1436 O  OE1 . GLN A 1 192 ? -17.171 -3.754  -14.729 1.00 10.24 ? 194  GLN A OE1 1 
ATOM   1437 N  NE2 . GLN A 1 192 ? -16.605 -3.437  -12.611 1.00 10.43 ? 194  GLN A NE2 1 
ATOM   1438 N  N   . TYR A 1 193 ? -19.700 -8.241  -13.002 1.00 11.55 ? 195  TYR A N   1 
ATOM   1439 C  CA  . TYR A 1 193 ? -20.852 -8.715  -13.761 1.00 11.77 ? 195  TYR A CA  1 
ATOM   1440 C  C   . TYR A 1 193 ? -22.070 -7.823  -13.486 1.00 11.95 ? 195  TYR A C   1 
ATOM   1441 O  O   . TYR A 1 193 ? -22.084 -7.032  -12.534 1.00 11.45 ? 195  TYR A O   1 
ATOM   1442 C  CB  . TYR A 1 193 ? -21.150 -10.189 -13.429 1.00 11.38 ? 195  TYR A CB  1 
ATOM   1443 C  CG  . TYR A 1 193 ? -21.794 -10.409 -12.091 1.00 10.88 ? 195  TYR A CG  1 
ATOM   1444 C  CD1 . TYR A 1 193 ? -21.056 -10.381 -10.918 1.00 11.14 ? 195  TYR A CD1 1 
ATOM   1445 C  CD2 . TYR A 1 193 ? -23.156 -10.617 -11.996 1.00 11.28 ? 195  TYR A CD2 1 
ATOM   1446 C  CE1 . TYR A 1 193 ? -21.651 -10.579 -9.678  1.00 11.22 ? 195  TYR A CE1 1 
ATOM   1447 C  CE2 . TYR A 1 193 ? -23.767 -10.812 -10.766 1.00 11.25 ? 195  TYR A CE2 1 
ATOM   1448 C  CZ  . TYR A 1 193 ? -23.022 -10.791 -9.619  1.00 11.17 ? 195  TYR A CZ  1 
ATOM   1449 O  OH  . TYR A 1 193 ? -23.673 -10.948 -8.432  1.00 11.75 ? 195  TYR A OH  1 
ATOM   1450 N  N   . GLU A 1 194 ? -23.089 -7.972  -14.328 1.00 12.44 ? 196  GLU A N   1 
ATOM   1451 C  CA  . GLU A 1 194 ? -24.325 -7.260  -14.145 1.00 13.42 ? 196  GLU A CA  1 
ATOM   1452 C  C   . GLU A 1 194 ? -25.383 -8.149  -13.512 1.00 12.49 ? 196  GLU A C   1 
ATOM   1453 O  O   . GLU A 1 194 ? -25.625 -9.274  -13.956 1.00 11.83 ? 196  GLU A O   1 
ATOM   1454 C  CB  . GLU A 1 194 ? -24.842 -6.682  -15.452 1.00 15.76 ? 196  GLU A CB  1 
ATOM   1455 C  CG  . GLU A 1 194 ? -25.886 -5.601  -15.217 1.00 19.12 ? 196  GLU A CG  1 
ATOM   1456 C  CD  . GLU A 1 194 ? -26.243 -4.804  -16.460 1.00 23.63 ? 196  GLU A CD  1 
ATOM   1457 O  OE1 . GLU A 1 194 ? -25.369 -4.591  -17.342 1.00 25.88 ? 196  GLU A OE1 1 
ATOM   1458 O  OE2 . GLU A 1 194 ? -27.408 -4.364  -16.536 1.00 26.21 ? 196  GLU A OE2 1 
ATOM   1459 N  N   . GLY A 1 195 ? -26.026 -7.621  -12.485 1.00 11.32 ? 197  GLY A N   1 
ATOM   1460 C  CA  . GLY A 1 195 ? -27.022 -8.380  -11.763 1.00 11.33 ? 197  GLY A CA  1 
ATOM   1461 C  C   . GLY A 1 195 ? -28.024 -7.467  -11.087 1.00 11.23 ? 197  GLY A C   1 
ATOM   1462 O  O   . GLY A 1 195 ? -28.437 -6.461  -11.650 1.00 10.84 ? 197  GLY A O   1 
ATOM   1463 N  N   . SER A 1 196 ? -28.352 -7.809  -9.849  1.00 11.72 ? 198  SER A N   1 
ATOM   1464 C  CA  . SER A 1 196 ? -29.490 -7.215  -9.146  1.00 12.24 ? 198  SER A CA  1 
ATOM   1465 C  C   . SER A 1 196 ? -29.120 -6.893  -7.744  1.00 12.32 ? 198  SER A C   1 
ATOM   1466 O  O   . SER A 1 196 ? -28.132 -7.378  -7.257  1.00 11.46 ? 198  SER A O   1 
ATOM   1467 C  CB  . SER A 1 196 ? -30.663 -8.221  -9.087  1.00 12.15 ? 198  SER A CB  1 
ATOM   1468 O  OG  . SER A 1 196 ? -30.469 -9.217  -8.076  1.00 12.16 ? 198  SER A OG  1 
ATOM   1469 N  N   . LEU A 1 197 ? -29.982 -6.120  -7.082  1.00 14.19 ? 199  LEU A N   1 
ATOM   1470 C  CA  . LEU A 1 197 ? -29.960 -6.037  -5.633  1.00 15.30 ? 199  LEU A CA  1 
ATOM   1471 C  C   . LEU A 1 197 ? -30.337 -7.416  -5.083  1.00 16.20 ? 199  LEU A C   1 
ATOM   1472 O  O   . LEU A 1 197 ? -31.102 -8.166  -5.719  1.00 15.09 ? 199  LEU A O   1 
ATOM   1473 C  CB  . LEU A 1 197 ? -30.942 -4.970  -5.120  1.00 15.99 ? 199  LEU A CB  1 
ATOM   1474 C  CG  . LEU A 1 197 ? -30.770 -3.558  -5.673  1.00 17.23 ? 199  LEU A CG  1 
ATOM   1475 C  CD1 . LEU A 1 197 ? -31.896 -2.679  -5.167  1.00 17.87 ? 199  LEU A CD1 1 
ATOM   1476 C  CD2 . LEU A 1 197 ? -29.409 -2.996  -5.274  1.00 17.74 ? 199  LEU A CD2 1 
ATOM   1477 N  N   . THR A 1 198 ? -29.748 -7.761  -3.934  1.00 18.50 ? 200  THR A N   1 
ATOM   1478 C  CA  . THR A 1 198 ? -29.873 -9.101  -3.355  1.00 19.36 ? 200  THR A CA  1 
ATOM   1479 C  C   . THR A 1 198 ? -30.971 -9.213  -2.311  1.00 20.91 ? 200  THR A C   1 
ATOM   1480 O  O   . THR A 1 198 ? -31.114 -10.273 -1.677  1.00 20.15 ? 200  THR A O   1 
ATOM   1481 C  CB  . THR A 1 198 ? -28.565 -9.587  -2.711  1.00 19.43 ? 200  THR A CB  1 
ATOM   1482 O  OG1 . THR A 1 198 ? -28.282 -8.843  -1.506  1.00 19.34 ? 200  THR A OG1 1 
ATOM   1483 C  CG2 . THR A 1 198 ? -27.412 -9.493  -3.706  1.00 19.35 ? 200  THR A CG2 1 
ATOM   1484 N  N   . THR A 1 199 ? -31.708 -8.119  -2.111  1.00 20.49 ? 201  THR A N   1 
ATOM   1485 C  CA  . THR A 1 199 ? -32.890 -8.109  -1.292  1.00 21.38 ? 201  THR A CA  1 
ATOM   1486 C  C   . THR A 1 199 ? -33.920 -7.336  -2.081  1.00 22.07 ? 201  THR A C   1 
ATOM   1487 O  O   . THR A 1 199 ? -33.542 -6.614  -3.011  1.00 21.07 ? 201  THR A O   1 
ATOM   1488 C  CB  . THR A 1 199 ? -32.674 -7.413  0.081   1.00 21.85 ? 201  THR A CB  1 
ATOM   1489 O  OG1 . THR A 1 199 ? -32.659 -5.992  -0.067  1.00 23.26 ? 201  THR A OG1 1 
ATOM   1490 C  CG2 . THR A 1 199 ? -31.369 -7.884  0.769   1.00 22.43 ? 201  THR A CG2 1 
ATOM   1491 N  N   . PRO A 1 200 ? -35.217 -7.461  -1.718  1.00 22.39 ? 202  PRO A N   1 
ATOM   1492 C  CA  . PRO A 1 200 ? -36.233 -6.664  -2.381  1.00 23.12 ? 202  PRO A CA  1 
ATOM   1493 C  C   . PRO A 1 200 ? -35.853 -5.205  -2.299  1.00 23.92 ? 202  PRO A C   1 
ATOM   1494 O  O   . PRO A 1 200 ? -35.298 -4.795  -1.273  1.00 26.22 ? 202  PRO A O   1 
ATOM   1495 C  CB  . PRO A 1 200 ? -37.492 -6.957  -1.573  1.00 23.38 ? 202  PRO A CB  1 
ATOM   1496 C  CG  . PRO A 1 200 ? -37.277 -8.330  -1.092  1.00 23.86 ? 202  PRO A CG  1 
ATOM   1497 C  CD  . PRO A 1 200 ? -35.821 -8.361  -0.724  1.00 23.40 ? 202  PRO A CD  1 
ATOM   1498 N  N   . PRO A 1 201 ? -36.091 -4.423  -3.350  1.00 24.80 ? 203  PRO A N   1 
ATOM   1499 C  CA  . PRO A 1 201 ? -36.852 -4.823  -4.537  1.00 23.81 ? 203  PRO A CA  1 
ATOM   1500 C  C   . PRO A 1 201 ? -36.104 -5.644  -5.633  1.00 21.62 ? 203  PRO A C   1 
ATOM   1501 O  O   . PRO A 1 201 ? -36.669 -5.872  -6.683  1.00 21.48 ? 203  PRO A O   1 
ATOM   1502 C  CB  . PRO A 1 201 ? -37.317 -3.473  -5.089  1.00 24.09 ? 203  PRO A CB  1 
ATOM   1503 C  CG  . PRO A 1 201 ? -36.204 -2.546  -4.734  1.00 24.77 ? 203  PRO A CG  1 
ATOM   1504 C  CD  . PRO A 1 201 ? -35.507 -3.084  -3.505  1.00 24.23 ? 203  PRO A CD  1 
ATOM   1505 N  N   . CYS A 1 202 ? -34.879 -6.104  -5.388  1.00 20.10 ? 204  CYS A N   1 
ATOM   1506 C  CA  . CYS A 1 202 ? -34.119 -6.917  -6.360  1.00 18.26 ? 204  CYS A CA  1 
ATOM   1507 C  C   . CYS A 1 202 ? -34.030 -6.340  -7.777  1.00 16.89 ? 204  CYS A C   1 
ATOM   1508 O  O   . CYS A 1 202 ? -34.007 -7.092  -8.762  1.00 16.70 ? 204  CYS A O   1 
ATOM   1509 C  CB  . CYS A 1 202 ? -34.681 -8.333  -6.457  1.00 19.00 ? 204  CYS A CB  1 
ATOM   1510 S  SG  . CYS A 1 202 ? -34.954 -9.224  -4.909  1.00 19.83 ? 204  CYS A SG  1 
ATOM   1511 N  N   . ALA A 1 203 ? -33.956 -5.015  -7.889  1.00 16.18 ? 205  ALA A N   1 
ATOM   1512 C  CA  . ALA A 1 203 ? -33.906 -4.374  -9.190  1.00 15.88 ? 205  ALA A CA  1 
ATOM   1513 C  C   . ALA A 1 203 ? -32.640 -4.778  -9.910  1.00 15.55 ? 205  ALA A C   1 
ATOM   1514 O  O   . ALA A 1 203 ? -31.604 -4.935  -9.283  1.00 14.53 ? 205  ALA A O   1 
ATOM   1515 C  CB  . ALA A 1 203 ? -33.987 -2.883  -9.047  1.00 16.31 ? 205  ALA A CB  1 
ATOM   1516 N  N   . GLN A 1 204 ? -32.753 -4.987  -11.214 1.00 15.38 ? 206  GLN A N   1 
ATOM   1517 C  CA  . GLN A 1 204 ? -31.624 -5.397  -12.057 1.00 15.65 ? 206  GLN A CA  1 
ATOM   1518 C  C   . GLN A 1 204 ? -30.880 -4.155  -12.576 1.00 14.23 ? 206  GLN A C   1 
ATOM   1519 O  O   . GLN A 1 204 ? -31.173 -3.036  -12.157 1.00 14.04 ? 206  GLN A O   1 
ATOM   1520 C  CB  . GLN A 1 204 ? -32.130 -6.353  -13.171 1.00 16.30 ? 206  GLN A CB  1 
ATOM   1521 C  CG  . GLN A 1 204 ? -32.575 -7.684  -12.560 1.00 16.79 ? 206  GLN A CG  1 
ATOM   1522 C  CD  . GLN A 1 204 ? -33.005 -8.766  -13.552 1.00 17.36 ? 206  GLN A CD  1 
ATOM   1523 O  OE1 . GLN A 1 204 ? -33.232 -9.930  -13.164 1.00 16.03 ? 206  GLN A OE1 1 
ATOM   1524 N  NE2 . GLN A 1 204 ? -33.093 -8.405  -14.831 1.00 17.93 ? 206  GLN A NE2 1 
ATOM   1525 N  N   . GLY A 1 205 ? -29.886 -4.360  -13.427 1.00 13.67 ? 207  GLY A N   1 
ATOM   1526 C  CA  . GLY A 1 205 ? -29.014 -3.301  -13.884 1.00 12.98 ? 207  GLY A CA  1 
ATOM   1527 C  C   . GLY A 1 205 ? -27.910 -2.878  -12.920 1.00 12.67 ? 207  GLY A C   1 
ATOM   1528 O  O   . GLY A 1 205 ? -27.274 -1.848  -13.126 1.00 13.60 ? 207  GLY A O   1 
ATOM   1529 N  N   . VAL A 1 206 ? -27.676 -3.656  -11.880 1.00 11.83 ? 208  VAL A N   1 
ATOM   1530 C  CA  . VAL A 1 206 ? -26.648 -3.335  -10.879 1.00 11.83 ? 208  VAL A CA  1 
ATOM   1531 C  C   . VAL A 1 206 ? -25.294 -3.885  -11.366 1.00 11.78 ? 208  VAL A C   1 
ATOM   1532 O  O   . VAL A 1 206 ? -25.192 -5.044  -11.718 1.00 11.24 ? 208  VAL A O   1 
ATOM   1533 C  CB  . VAL A 1 206 ? -27.014 -3.909  -9.501  1.00 11.50 ? 208  VAL A CB  1 
ATOM   1534 C  CG1 . VAL A 1 206 ? -25.964 -3.562  -8.447  1.00 11.93 ? 208  VAL A CG1 1 
ATOM   1535 C  CG2 . VAL A 1 206 ? -28.398 -3.417  -9.082  1.00 11.99 ? 208  VAL A CG2 1 
ATOM   1536 N  N   . ILE A 1 207 ? -24.260 -3.043  -11.367 1.00 11.57 ? 209  ILE A N   1 
ATOM   1537 C  CA  . ILE A 1 207 ? -22.897 -3.514  -11.657 1.00 11.89 ? 209  ILE A CA  1 
ATOM   1538 C  C   . ILE A 1 207 ? -22.246 -3.987  -10.365 1.00 11.20 ? 209  ILE A C   1 
ATOM   1539 O  O   . ILE A 1 207 ? -22.014 -3.190  -9.440  1.00 11.53 ? 209  ILE A O   1 
ATOM   1540 C  CB  . ILE A 1 207 ? -22.019 -2.420  -12.283 1.00 12.57 ? 209  ILE A CB  1 
ATOM   1541 C  CG1 . ILE A 1 207 ? -22.747 -1.700  -13.432 1.00 13.72 ? 209  ILE A CG1 1 
ATOM   1542 C  CG2 . ILE A 1 207 ? -20.676 -2.984  -12.754 1.00 12.64 ? 209  ILE A CG2 1 
ATOM   1543 C  CD1 . ILE A 1 207 ? -23.135 -2.570  -14.584 1.00 14.48 ? 209  ILE A CD1 1 
ATOM   1544 N  N   . TRP A 1 208 ? -21.953 -5.277  -10.297 1.00 10.62 ? 210  TRP A N   1 
ATOM   1545 C  CA  . TRP A 1 208 ? -21.288 -5.881  -9.134  1.00 10.28 ? 210  TRP A CA  1 
ATOM   1546 C  C   . TRP A 1 208 ? -19.792 -6.031  -9.427  1.00 10.41 ? 210  TRP A C   1 
ATOM   1547 O  O   . TRP A 1 208 ? -19.412 -6.549  -10.470 1.00 9.61  ? 210  TRP A O   1 
ATOM   1548 C  CB  . TRP A 1 208 ? -21.870 -7.255  -8.838  1.00 10.66 ? 210  TRP A CB  1 
ATOM   1549 C  CG  . TRP A 1 208 ? -23.176 -7.173  -8.173  1.00 10.65 ? 210  TRP A CG  1 
ATOM   1550 C  CD1 . TRP A 1 208 ? -24.404 -7.133  -8.761  1.00 10.54 ? 210  TRP A CD1 1 
ATOM   1551 C  CD2 . TRP A 1 208 ? -23.386 -7.100  -6.778  1.00 10.67 ? 210  TRP A CD2 1 
ATOM   1552 N  NE1 . TRP A 1 208 ? -25.377 -7.013  -7.798  1.00 10.87 ? 210  TRP A NE1 1 
ATOM   1553 C  CE2 . TRP A 1 208 ? -24.774 -6.994  -6.568  1.00 10.51 ? 210  TRP A CE2 1 
ATOM   1554 C  CE3 . TRP A 1 208 ? -22.527 -7.093  -5.667  1.00 10.86 ? 210  TRP A CE3 1 
ATOM   1555 C  CZ2 . TRP A 1 208 ? -25.326 -6.906  -5.304  1.00 10.85 ? 210  TRP A CZ2 1 
ATOM   1556 C  CZ3 . TRP A 1 208 ? -23.076 -7.018  -4.408  1.00 10.74 ? 210  TRP A CZ3 1 
ATOM   1557 C  CH2 . TRP A 1 208 ? -24.463 -6.937  -4.229  1.00 11.03 ? 210  TRP A CH2 1 
ATOM   1558 N  N   . THR A 1 209 ? -18.962 -5.561  -8.500  1.00 10.21 ? 211  THR A N   1 
ATOM   1559 C  CA  . THR A 1 209 ? -17.520 -5.749  -8.564  1.00 10.03 ? 211  THR A CA  1 
ATOM   1560 C  C   . THR A 1 209 ? -17.129 -6.514  -7.299  1.00 10.68 ? 211  THR A C   1 
ATOM   1561 O  O   . THR A 1 209 ? -17.403 -6.046  -6.184  1.00 10.30 ? 211  THR A O   1 
ATOM   1562 C  CB  . THR A 1 209 ? -16.779 -4.422  -8.628  1.00 9.88  ? 211  THR A CB  1 
ATOM   1563 O  OG1 . THR A 1 209 ? -17.172 -3.710  -9.801  1.00 9.59  ? 211  THR A OG1 1 
ATOM   1564 C  CG2 . THR A 1 209 ? -15.253 -4.652  -8.685  1.00 10.02 ? 211  THR A CG2 1 
ATOM   1565 N  N   . VAL A 1 210 ? -16.493 -7.674  -7.490  1.00 10.45 ? 212  VAL A N   1 
ATOM   1566 C  CA  . VAL A 1 210 ? -16.144 -8.570  -6.405  1.00 10.87 ? 212  VAL A CA  1 
ATOM   1567 C  C   . VAL A 1 210 ? -14.628 -8.688  -6.427  1.00 11.18 ? 212  VAL A C   1 
ATOM   1568 O  O   . VAL A 1 210 ? -14.035 -9.171  -7.419  1.00 10.08 ? 212  VAL A O   1 
ATOM   1569 C  CB  . VAL A 1 210 ? -16.772 -9.959  -6.563  1.00 10.75 ? 212  VAL A CB  1 
ATOM   1570 C  CG1 . VAL A 1 210 ? -16.359 -10.867 -5.402  1.00 11.06 ? 212  VAL A CG1 1 
ATOM   1571 C  CG2 . VAL A 1 210 ? -18.296 -9.859  -6.681  1.00 10.84 ? 212  VAL A CG2 1 
ATOM   1572 N  N   . PHE A 1 211 ? -13.999 -8.193  -5.357  1.00 11.46 ? 213  PHE A N   1 
ATOM   1573 C  CA  . PHE A 1 211 ? -12.522 -8.226  -5.252  1.00 12.54 ? 213  PHE A CA  1 
ATOM   1574 C  C   . PHE A 1 211 ? -11.963 -9.652  -5.144  1.00 12.17 ? 213  PHE A C   1 
ATOM   1575 O  O   . PHE A 1 211 ? -12.569 -10.508 -4.483  1.00 11.10 ? 213  PHE A O   1 
ATOM   1576 C  CB  . PHE A 1 211 ? -12.042 -7.374  -4.068  1.00 13.62 ? 213  PHE A CB  1 
ATOM   1577 C  CG  . PHE A 1 211 ? -12.305 -5.924  -4.258  1.00 16.18 ? 213  PHE A CG  1 
ATOM   1578 C  CD1 . PHE A 1 211 ? -11.695 -5.228  -5.302  1.00 19.51 ? 213  PHE A CD1 1 
ATOM   1579 C  CD2 . PHE A 1 211 ? -13.251 -5.256  -3.480  1.00 17.53 ? 213  PHE A CD2 1 
ATOM   1580 C  CE1 . PHE A 1 211 ? -11.992 -3.878  -5.522  1.00 21.02 ? 213  PHE A CE1 1 
ATOM   1581 C  CE2 . PHE A 1 211 ? -13.509 -3.906  -3.664  1.00 18.57 ? 213  PHE A CE2 1 
ATOM   1582 C  CZ  . PHE A 1 211 ? -12.890 -3.214  -4.676  1.00 20.39 ? 213  PHE A CZ  1 
ATOM   1583 N  N   . ASN A 1 212 ? -10.815 -9.869  -5.804  1.00 13.01 ? 214  ASN A N   1 
ATOM   1584 C  CA  . ASN A 1 212 ? -9.959  -11.097 -5.683  1.00 14.73 ? 214  ASN A CA  1 
ATOM   1585 C  C   . ASN A 1 212 ? -9.457  -11.182 -4.235  1.00 13.53 ? 214  ASN A C   1 
ATOM   1586 O  O   . ASN A 1 212 ? -9.587  -12.204 -3.570  1.00 13.15 ? 214  ASN A O   1 
ATOM   1587 C  CB  . ASN A 1 212 ? -8.745  -10.972 -6.701  1.00 16.29 ? 214  ASN A CB  1 
ATOM   1588 C  CG  . ASN A 1 212 ? -7.879  -12.257 -6.874  1.00 20.22 ? 214  ASN A CG  1 
ATOM   1589 O  OD1 . ASN A 1 212 ? -6.721  -12.288 -7.508  1.00 17.34 ? 214  ASN A OD1 1 
ATOM   1590 N  ND2 . ASN A 1 212 ? -8.435  -13.316 -6.408  1.00 23.35 ? 214  ASN A ND2 1 
ATOM   1591 N  N   . GLN A 1 213 ? -8.857  -10.106 -3.758  1.00 13.98 ? 215  GLN A N   1 
ATOM   1592 C  CA  . GLN A 1 213 ? -8.243  -10.120 -2.421  1.00 15.03 ? 215  GLN A CA  1 
ATOM   1593 C  C   . GLN A 1 213 ? -9.311  -10.026 -1.347  1.00 15.23 ? 215  GLN A C   1 
ATOM   1594 O  O   . GLN A 1 213 ? -10.320 -9.334  -1.531  1.00 15.87 ? 215  GLN A O   1 
ATOM   1595 C  CB  . GLN A 1 213 ? -7.240  -8.985  -2.274  1.00 15.82 ? 215  GLN A CB  1 
ATOM   1596 C  CG  . GLN A 1 213 ? -6.440  -9.061  -0.993  1.00 16.56 ? 215  GLN A CG  1 
ATOM   1597 C  CD  . GLN A 1 213 ? -5.585  -7.858  -0.762  1.00 18.42 ? 215  GLN A CD  1 
ATOM   1598 O  OE1 . GLN A 1 213 ? -5.881  -6.769  -1.215  1.00 18.11 ? 215  GLN A OE1 1 
ATOM   1599 N  NE2 . GLN A 1 213 ? -4.524  -8.044  0.023   1.00 21.63 ? 215  GLN A NE2 1 
ATOM   1600 N  N   . THR A 1 214 ? -9.103  -10.729 -0.239  1.00 14.98 ? 216  THR A N   1 
ATOM   1601 C  CA  . THR A 1 214 ? -10.053 -10.729 0.849   1.00 15.12 ? 216  THR A CA  1 
ATOM   1602 C  C   . THR A 1 214 ? -9.593  -9.817  1.980   1.00 15.28 ? 216  THR A C   1 
ATOM   1603 O  O   . THR A 1 214 ? -8.434  -9.384  2.023   1.00 15.65 ? 216  THR A O   1 
ATOM   1604 C  CB  . THR A 1 214 ? -10.296 -12.153 1.388   1.00 15.87 ? 216  THR A CB  1 
ATOM   1605 O  OG1 . THR A 1 214 ? -9.116  -12.642 2.053   1.00 15.55 ? 216  THR A OG1 1 
ATOM   1606 C  CG2 . THR A 1 214 ? -10.679 -13.091 0.251   1.00 16.46 ? 216  THR A CG2 1 
ATOM   1607 N  N   . VAL A 1 215 ? -10.517 -9.536  2.893   1.00 15.32 ? 217  VAL A N   1 
ATOM   1608 C  CA  . VAL A 1 215 ? -10.245 -8.690  4.052   1.00 15.68 ? 217  VAL A CA  1 
ATOM   1609 C  C   . VAL A 1 215 ? -10.152 -9.613  5.270   1.00 15.21 ? 217  VAL A C   1 
ATOM   1610 O  O   . VAL A 1 215 ? -10.918 -10.553 5.372   1.00 14.46 ? 217  VAL A O   1 
ATOM   1611 C  CB  . VAL A 1 215 ? -11.372 -7.667  4.243   1.00 17.50 ? 217  VAL A CB  1 
ATOM   1612 C  CG1 . VAL A 1 215 ? -11.231 -6.936  5.569   1.00 18.11 ? 217  VAL A CG1 1 
ATOM   1613 C  CG2 . VAL A 1 215 ? -11.380 -6.677  3.081   1.00 18.56 ? 217  VAL A CG2 1 
ATOM   1614 N  N   . MET A 1 216 ? -9.238  -9.308  6.186   1.00 15.63 ? 218  MET A N   1 
ATOM   1615 C  CA  . MET A 1 216 ? -8.928  -10.160 7.336   1.00 16.39 ? 218  MET A CA  1 
ATOM   1616 C  C   . MET A 1 216 ? -9.524  -9.585  8.623   1.00 14.55 ? 218  MET A C   1 
ATOM   1617 O  O   . MET A 1 216 ? -9.210  -8.466  9.004   1.00 12.48 ? 218  MET A O   1 
ATOM   1618 C  CB  . MET A 1 216 ? -7.416  -10.255 7.500   1.00 19.15 ? 218  MET A CB  1 
ATOM   1619 C  CG  . MET A 1 216 ? -6.693  -10.749 6.258   1.00 22.73 ? 218  MET A CG  1 
ATOM   1620 S  SD  . MET A 1 216 ? -7.159  -12.448 5.918   1.00 28.76 ? 218  MET A SD  1 
ATOM   1621 C  CE  . MET A 1 216 ? -5.972  -13.194 6.965   1.00 30.01 ? 218  MET A CE  1 
ATOM   1622 N  N   . LEU A 1 217 ? -10.378 -10.369 9.272   1.00 14.32 ? 219  LEU A N   1 
ATOM   1623 C  CA  . LEU A 1 217 ? -10.874 -10.069 10.627  1.00 14.18 ? 219  LEU A CA  1 
ATOM   1624 C  C   . LEU A 1 217 ? -10.369 -11.130 11.596  1.00 13.84 ? 219  LEU A C   1 
ATOM   1625 O  O   . LEU A 1 217 ? -10.099 -12.249 11.187  1.00 13.68 ? 219  LEU A O   1 
ATOM   1626 C  CB  . LEU A 1 217 ? -12.413 -10.089 10.621  1.00 14.45 ? 219  LEU A CB  1 
ATOM   1627 C  CG  . LEU A 1 217 ? -13.109 -8.779  10.218  1.00 14.77 ? 219  LEU A CG  1 
ATOM   1628 C  CD1 . LEU A 1 217 ? -12.744 -8.387  8.792   1.00 15.16 ? 219  LEU A CD1 1 
ATOM   1629 C  CD2 . LEU A 1 217 ? -14.612 -8.932  10.409  1.00 14.52 ? 219  LEU A CD2 1 
ATOM   1630 N  N   . SER A 1 218 ? -10.255 -10.808 12.880  1.00 14.17 ? 220  SER A N   1 
ATOM   1631 C  CA  . SER A 1 218 ? -9.963  -11.859 13.875  1.00 14.16 ? 220  SER A CA  1 
ATOM   1632 C  C   . SER A 1 218 ? -11.166 -12.788 14.076  1.00 14.67 ? 220  SER A C   1 
ATOM   1633 O  O   . SER A 1 218 ? -12.318 -12.432 13.789  1.00 13.93 ? 220  SER A O   1 
ATOM   1634 C  CB  . SER A 1 218 ? -9.516  -11.268 15.210  1.00 13.94 ? 220  SER A CB  1 
ATOM   1635 O  OG  . SER A 1 218 ? -10.566 -10.549 15.836  1.00 13.99 ? 220  SER A OG  1 
ATOM   1636 N  N   . ALA A 1 219 ? -10.882 -13.984 14.579  1.00 15.73 ? 221  ALA A N   1 
ATOM   1637 C  CA  . ALA A 1 219 ? -11.917 -14.920 15.016  1.00 16.30 ? 221  ALA A CA  1 
ATOM   1638 C  C   . ALA A 1 219 ? -12.907 -14.204 15.951  1.00 17.03 ? 221  ALA A C   1 
ATOM   1639 O  O   . ALA A 1 219 ? -14.108 -14.367 15.817  1.00 17.82 ? 221  ALA A O   1 
ATOM   1640 C  CB  . ALA A 1 219 ? -11.291 -16.121 15.734  1.00 15.92 ? 221  ALA A CB  1 
ATOM   1641 N  N   . LYS A 1 220 ? -12.385 -13.387 16.861  1.00 17.70 ? 222  LYS A N   1 
ATOM   1642 C  CA  . LYS A 1 220 ? -13.214 -12.708 17.840  1.00 19.95 ? 222  LYS A CA  1 
ATOM   1643 C  C   . LYS A 1 220 ? -14.160 -11.749 17.132  1.00 17.75 ? 222  LYS A C   1 
ATOM   1644 O  O   . LYS A 1 220 ? -15.328 -11.671 17.468  1.00 17.49 ? 222  LYS A O   1 
ATOM   1645 C  CB  . LYS A 1 220 ? -12.339 -11.955 18.853  1.00 22.35 ? 222  LYS A CB  1 
ATOM   1646 C  CG  . LYS A 1 220 ? -13.103 -11.304 19.995  1.00 26.57 ? 222  LYS A CG  1 
ATOM   1647 C  CD  . LYS A 1 220 ? -12.153 -10.606 20.949  1.00 30.78 ? 222  LYS A CD  1 
ATOM   1648 C  CE  . LYS A 1 220 ? -12.874 -9.558  21.789  1.00 36.04 ? 222  LYS A CE  1 
ATOM   1649 N  NZ  . LYS A 1 220 ? -12.041 -9.081  22.932  1.00 39.40 ? 222  LYS A NZ  1 
ATOM   1650 N  N   . GLN A 1 221 ? -13.631 -11.018 16.166  1.00 16.75 ? 223  GLN A N   1 
ATOM   1651 C  CA  . GLN A 1 221 ? -14.421 -10.084 15.378  1.00 16.50 ? 223  GLN A CA  1 
ATOM   1652 C  C   . GLN A 1 221 ? -15.519 -10.777 14.595  1.00 15.88 ? 223  GLN A C   1 
ATOM   1653 O  O   . GLN A 1 221 ? -16.669 -10.328 14.616  1.00 16.52 ? 223  GLN A O   1 
ATOM   1654 C  CB  . GLN A 1 221 ? -13.518 -9.275  14.462  1.00 15.81 ? 223  GLN A CB  1 
ATOM   1655 C  CG  . GLN A 1 221 ? -12.743 -8.249  15.237  1.00 15.60 ? 223  GLN A CG  1 
ATOM   1656 C  CD  . GLN A 1 221 ? -11.788 -7.458  14.378  1.00 16.13 ? 223  GLN A CD  1 
ATOM   1657 O  OE1 . GLN A 1 221 ? -11.003 -8.020  13.604  1.00 15.98 ? 223  GLN A OE1 1 
ATOM   1658 N  NE2 . GLN A 1 221 ? -11.833 -6.142  14.518  1.00 16.57 ? 223  GLN A NE2 1 
ATOM   1659 N  N   . LEU A 1 222 ? -15.188 -11.877 13.932  1.00 16.40 ? 224  LEU A N   1 
ATOM   1660 C  CA  . LEU A 1 222 ? -16.199 -12.630 13.192  1.00 16.92 ? 224  LEU A CA  1 
ATOM   1661 C  C   . LEU A 1 222 ? -17.304 -13.155 14.114  1.00 18.37 ? 224  LEU A C   1 
ATOM   1662 O  O   . LEU A 1 222 ? -18.486 -13.111 13.752  1.00 17.58 ? 224  LEU A O   1 
ATOM   1663 C  CB  . LEU A 1 222 ? -15.562 -13.760 12.378  1.00 16.77 ? 224  LEU A CB  1 
ATOM   1664 C  CG  . LEU A 1 222 ? -14.699 -13.280 11.201  1.00 16.56 ? 224  LEU A CG  1 
ATOM   1665 C  CD1 . LEU A 1 222 ? -13.802 -14.402 10.720  1.00 16.74 ? 224  LEU A CD1 1 
ATOM   1666 C  CD2 . LEU A 1 222 ? -15.545 -12.750 10.049  1.00 15.93 ? 224  LEU A CD2 1 
ATOM   1667 N  N   . HIS A 1 223 ? -16.926 -13.614 15.309  1.00 19.97 ? 225  HIS A N   1 
ATOM   1668 C  CA  . HIS A 1 223 ? -17.914 -14.053 16.304  1.00 22.76 ? 225  HIS A CA  1 
ATOM   1669 C  C   . HIS A 1 223 ? -18.805 -12.874 16.765  1.00 21.29 ? 225  HIS A C   1 
ATOM   1670 O  O   . HIS A 1 223 ? -20.026 -13.017 16.818  1.00 21.02 ? 225  HIS A O   1 
ATOM   1671 C  CB  . HIS A 1 223 ? -17.247 -14.751 17.498  1.00 25.79 ? 225  HIS A CB  1 
ATOM   1672 C  CG  . HIS A 1 223 ? -18.210 -15.217 18.544  1.00 30.11 ? 225  HIS A CG  1 
ATOM   1673 N  ND1 . HIS A 1 223 ? -18.437 -14.515 19.715  1.00 35.21 ? 225  HIS A ND1 1 
ATOM   1674 C  CD2 . HIS A 1 223 ? -19.000 -16.315 18.608  1.00 33.28 ? 225  HIS A CD2 1 
ATOM   1675 C  CE1 . HIS A 1 223 ? -19.335 -15.152 20.446  1.00 33.26 ? 225  HIS A CE1 1 
ATOM   1676 N  NE2 . HIS A 1 223 ? -19.691 -16.249 19.800  1.00 34.27 ? 225  HIS A NE2 1 
ATOM   1677 N  N   . THR A 1 224 ? -18.204 -11.721 17.030  1.00 19.43 ? 226  THR A N   1 
ATOM   1678 C  CA  . THR A 1 224 ? -18.963 -10.504 17.396  1.00 19.52 ? 226  THR A CA  1 
ATOM   1679 C  C   . THR A 1 224 ? -20.000 -10.136 16.330  1.00 19.13 ? 226  THR A C   1 
ATOM   1680 O  O   . THR A 1 224 ? -21.155 -9.834  16.644  1.00 19.88 ? 226  THR A O   1 
ATOM   1681 C  CB  . THR A 1 224 ? -18.011 -9.323  17.665  1.00 19.28 ? 226  THR A CB  1 
ATOM   1682 O  OG1 . THR A 1 224 ? -17.214 -9.620  18.802  1.00 18.19 ? 226  THR A OG1 1 
ATOM   1683 C  CG2 . THR A 1 224 ? -18.762 -8.010  17.940  1.00 19.76 ? 226  THR A CG2 1 
ATOM   1684 N  N   . LEU A 1 225 ? -19.594 -10.187 15.071  1.00 18.04 ? 227  LEU A N   1 
ATOM   1685 C  CA  . LEU A 1 225 ? -20.493 -9.867  13.981  1.00 17.60 ? 227  LEU A CA  1 
ATOM   1686 C  C   . LEU A 1 225 ? -21.721 -10.761 13.966  1.00 18.54 ? 227  LEU A C   1 
ATOM   1687 O  O   . LEU A 1 225 ? -22.828 -10.274 13.794  1.00 18.36 ? 227  LEU A O   1 
ATOM   1688 C  CB  . LEU A 1 225 ? -19.774 -10.005 12.630  1.00 17.05 ? 227  LEU A CB  1 
ATOM   1689 C  CG  . LEU A 1 225 ? -20.578 -9.641  11.375  1.00 16.43 ? 227  LEU A CG  1 
ATOM   1690 C  CD1 . LEU A 1 225 ? -21.207 -8.259  11.505  1.00 16.09 ? 227  LEU A CD1 1 
ATOM   1691 C  CD2 . LEU A 1 225 ? -19.679 -9.689  10.158  1.00 16.25 ? 227  LEU A CD2 1 
ATOM   1692 N  N   . SER A 1 226 ? -21.501 -12.062 14.138  1.00 18.58 ? 228  SER A N   1 
ATOM   1693 C  CA  . SER A 1 226 ? -22.556 -13.045 13.995  1.00 21.14 ? 228  SER A CA  1 
ATOM   1694 C  C   . SER A 1 226 ? -23.339 -13.337 15.281  1.00 21.98 ? 228  SER A C   1 
ATOM   1695 O  O   . SER A 1 226 ? -24.414 -13.919 15.191  1.00 24.39 ? 228  SER A O   1 
ATOM   1696 C  CB  . SER A 1 226 ? -21.999 -14.352 13.407  1.00 21.53 ? 228  SER A CB  1 
ATOM   1697 O  OG  . SER A 1 226 ? -21.109 -14.991 14.290  1.00 22.57 ? 228  SER A OG  1 
ATOM   1698 N  N   . ASP A 1 227 ? -22.852 -12.910 16.447  1.00 23.03 ? 229  ASP A N   1 
ATOM   1699 C  CA  . ASP A 1 227 ? -23.457 -13.295 17.731  1.00 25.53 ? 229  ASP A CA  1 
ATOM   1700 C  C   . ASP A 1 227 ? -24.079 -12.137 18.517  1.00 25.09 ? 229  ASP A C   1 
ATOM   1701 O  O   . ASP A 1 227 ? -24.623 -12.350 19.607  1.00 24.46 ? 229  ASP A O   1 
ATOM   1702 C  CB  . ASP A 1 227 ? -22.400 -13.983 18.600  1.00 29.87 ? 229  ASP A CB  1 
ATOM   1703 C  CG  . ASP A 1 227 ? -22.991 -14.631 19.866  1.00 34.84 ? 229  ASP A CG  1 
ATOM   1704 O  OD1 . ASP A 1 227 ? -23.862 -15.530 19.742  1.00 40.04 ? 229  ASP A OD1 1 
ATOM   1705 O  OD2 . ASP A 1 227 ? -22.584 -14.224 20.983  1.00 39.56 ? 229  ASP A OD2 1 
ATOM   1706 N  N   . THR A 1 228 ? -24.017 -10.917 17.994  1.00 23.28 ? 230  THR A N   1 
ATOM   1707 C  CA  . THR A 1 228 ? -24.419 -9.756  18.777  1.00 22.62 ? 230  THR A CA  1 
ATOM   1708 C  C   . THR A 1 228 ? -25.803 -9.235  18.419  1.00 22.20 ? 230  THR A C   1 
ATOM   1709 O  O   . THR A 1 228 ? -26.511 -8.751  19.303  1.00 20.86 ? 230  THR A O   1 
ATOM   1710 C  CB  . THR A 1 228 ? -23.374 -8.634  18.664  1.00 23.24 ? 230  THR A CB  1 
ATOM   1711 O  OG1 . THR A 1 228 ? -22.083 -9.157  18.998  1.00 22.54 ? 230  THR A OG1 1 
ATOM   1712 C  CG2 . THR A 1 228 ? -23.695 -7.497  19.609  1.00 24.09 ? 230  THR A CG2 1 
ATOM   1713 N  N   . LEU A 1 229 ? -26.194 -9.312  17.145  1.00 20.17 ? 231  LEU A N   1 
ATOM   1714 C  CA  . LEU A 1 229 ? -27.380 -8.596  16.690  1.00 20.63 ? 231  LEU A CA  1 
ATOM   1715 C  C   . LEU A 1 229 ? -28.596 -9.523  16.637  1.00 20.73 ? 231  LEU A C   1 
ATOM   1716 O  O   . LEU A 1 229 ? -28.463 -10.732 16.375  1.00 20.19 ? 231  LEU A O   1 
ATOM   1717 C  CB  . LEU A 1 229 ? -27.143 -7.964  15.311  1.00 20.65 ? 231  LEU A CB  1 
ATOM   1718 C  CG  . LEU A 1 229 ? -25.978 -6.978  15.162  1.00 20.41 ? 231  LEU A CG  1 
ATOM   1719 C  CD1 . LEU A 1 229 ? -25.792 -6.607  13.697  1.00 20.34 ? 231  LEU A CD1 1 
ATOM   1720 C  CD2 . LEU A 1 229 ? -26.166 -5.717  15.992  1.00 19.80 ? 231  LEU A CD2 1 
ATOM   1721 N  N   . TRP A 1 230 ? -29.764 -8.937  16.883  1.00 21.27 ? 232  TRP A N   1 
ATOM   1722 C  CA  . TRP A 1 230 ? -31.057 -9.631  16.858  1.00 23.24 ? 232  TRP A CA  1 
ATOM   1723 C  C   . TRP A 1 230 ? -31.921 -9.058  15.741  1.00 23.11 ? 232  TRP A C   1 
ATOM   1724 O  O   . TRP A 1 230 ? -31.811 -7.883  15.401  1.00 21.14 ? 232  TRP A O   1 
ATOM   1725 C  CB  . TRP A 1 230 ? -31.726 -9.533  18.258  1.00 25.43 ? 232  TRP A CB  1 
ATOM   1726 C  CG  . TRP A 1 230 ? -30.900 -10.326 19.231  1.00 28.64 ? 232  TRP A CG  1 
ATOM   1727 C  CD1 . TRP A 1 230 ? -29.662 -9.994  19.711  1.00 30.94 ? 232  TRP A CD1 1 
ATOM   1728 C  CD2 . TRP A 1 230 ? -31.164 -11.648 19.704  1.00 30.37 ? 232  TRP A CD2 1 
ATOM   1729 N  NE1 . TRP A 1 230 ? -29.164 -11.002 20.499  1.00 32.60 ? 232  TRP A NE1 1 
ATOM   1730 C  CE2 . TRP A 1 230 ? -30.068 -12.026 20.527  1.00 32.08 ? 232  TRP A CE2 1 
ATOM   1731 C  CE3 . TRP A 1 230 ? -32.232 -12.530 19.561  1.00 30.07 ? 232  TRP A CE3 1 
ATOM   1732 C  CZ2 . TRP A 1 230 ? -30.014 -13.259 21.199  1.00 34.20 ? 232  TRP A CZ2 1 
ATOM   1733 C  CZ3 . TRP A 1 230 ? -32.174 -13.767 20.231  1.00 32.57 ? 232  TRP A CZ3 1 
ATOM   1734 C  CH2 . TRP A 1 230 ? -31.068 -14.116 21.031  1.00 32.55 ? 232  TRP A CH2 1 
ATOM   1735 N  N   . GLY A 1 231 ? -32.733 -9.913  15.131  1.00 25.14 ? 233  GLY A N   1 
ATOM   1736 C  CA  . GLY A 1 231 ? -33.518 -9.549  13.963  1.00 29.20 ? 233  GLY A CA  1 
ATOM   1737 C  C   . GLY A 1 231 ? -35.009 -9.669  14.226  1.00 34.12 ? 233  GLY A C   1 
ATOM   1738 O  O   . GLY A 1 231 ? -35.448 -9.479  15.370  1.00 36.57 ? 233  GLY A O   1 
ATOM   1739 N  N   . PRO A 1 232 ? -35.802 -10.002 13.184  1.00 36.67 ? 234  PRO A N   1 
ATOM   1740 C  CA  . PRO A 1 232 ? -37.258 -10.110 13.379  1.00 39.95 ? 234  PRO A CA  1 
ATOM   1741 C  C   . PRO A 1 232 ? -37.635 -11.200 14.390  1.00 43.17 ? 234  PRO A C   1 
ATOM   1742 O  O   . PRO A 1 232 ? -36.942 -12.220 14.483  1.00 42.42 ? 234  PRO A O   1 
ATOM   1743 C  CB  . PRO A 1 232 ? -37.782 -10.463 11.972  1.00 38.06 ? 234  PRO A CB  1 
ATOM   1744 C  CG  . PRO A 1 232 ? -36.681 -10.101 11.034  1.00 36.76 ? 234  PRO A CG  1 
ATOM   1745 C  CD  . PRO A 1 232 ? -35.423 -10.352 11.807  1.00 35.49 ? 234  PRO A CD  1 
ATOM   1746 N  N   . GLY A 1 233 ? -38.717 -10.964 15.136  1.00 47.82 ? 235  GLY A N   1 
ATOM   1747 C  CA  . GLY A 1 233 ? -39.163 -11.870 16.203  1.00 50.05 ? 235  GLY A CA  1 
ATOM   1748 C  C   . GLY A 1 233 ? -38.196 -11.824 17.369  1.00 50.45 ? 235  GLY A C   1 
ATOM   1749 O  O   . GLY A 1 233 ? -37.674 -10.761 17.695  1.00 52.09 ? 235  GLY A O   1 
ATOM   1750 N  N   . ASP A 1 234 ? -37.941 -12.971 17.991  1.00 48.51 ? 236  ASP A N   1 
ATOM   1751 C  CA  . ASP A 1 234 ? -36.871 -13.072 18.982  1.00 47.93 ? 236  ASP A CA  1 
ATOM   1752 C  C   . ASP A 1 234 ? -35.686 -13.850 18.380  1.00 45.58 ? 236  ASP A C   1 
ATOM   1753 O  O   . ASP A 1 234 ? -35.045 -14.629 19.072  1.00 45.95 ? 236  ASP A O   1 
ATOM   1754 C  CB  . ASP A 1 234 ? -37.397 -13.717 20.274  1.00 46.00 ? 236  ASP A CB  1 
ATOM   1755 N  N   . SER A 1 235 ? -35.390 -13.619 17.094  1.00 41.65 ? 237  SER A N   1 
ATOM   1756 C  CA  . SER A 1 235 ? -34.375 -14.403 16.363  1.00 39.52 ? 237  SER A CA  1 
ATOM   1757 C  C   . SER A 1 235 ? -33.047 -13.682 16.317  1.00 33.47 ? 237  SER A C   1 
ATOM   1758 O  O   . SER A 1 235 ? -33.005 -12.479 16.132  1.00 31.47 ? 237  SER A O   1 
ATOM   1759 C  CB  . SER A 1 235 ? -34.799 -14.635 14.920  1.00 42.23 ? 237  SER A CB  1 
ATOM   1760 O  OG  . SER A 1 235 ? -35.981 -15.393 14.869  1.00 48.98 ? 237  SER A OG  1 
ATOM   1761 N  N   . ARG A 1 236 ? -31.966 -14.425 16.480  1.00 31.76 ? 238  ARG A N   1 
ATOM   1762 C  CA  . ARG A 1 236 ? -30.641 -13.892 16.181  1.00 31.36 ? 238  ARG A CA  1 
ATOM   1763 C  C   . ARG A 1 236 ? -30.548 -13.456 14.719  1.00 27.28 ? 238  ARG A C   1 
ATOM   1764 O  O   . ARG A 1 236 ? -31.093 -14.105 13.837  1.00 24.88 ? 238  ARG A O   1 
ATOM   1765 C  CB  . ARG A 1 236 ? -29.572 -14.933 16.469  1.00 33.56 ? 238  ARG A CB  1 
ATOM   1766 C  CG  . ARG A 1 236 ? -29.320 -15.118 17.939  1.00 35.69 ? 238  ARG A CG  1 
ATOM   1767 C  CD  . ARG A 1 236 ? -28.224 -16.138 18.157  1.00 37.93 ? 238  ARG A CD  1 
ATOM   1768 N  NE  . ARG A 1 236 ? -27.843 -16.185 19.558  1.00 39.61 ? 238  ARG A NE  1 
ATOM   1769 C  CZ  . ARG A 1 236 ? -27.091 -15.275 20.171  1.00 41.69 ? 238  ARG A CZ  1 
ATOM   1770 N  NH1 . ARG A 1 236 ? -26.617 -14.215 19.516  1.00 42.17 ? 238  ARG A NH1 1 
ATOM   1771 N  NH2 . ARG A 1 236 ? -26.816 -15.424 21.463  1.00 41.22 ? 238  ARG A NH2 1 
ATOM   1772 N  N   . LEU A 1 237 ? -29.882 -12.332 14.480  1.00 25.53 ? 239  LEU A N   1 
ATOM   1773 C  CA  . LEU A 1 237 ? -29.657 -11.842 13.116  1.00 24.01 ? 239  LEU A CA  1 
ATOM   1774 C  C   . LEU A 1 237 ? -28.387 -12.531 12.618  1.00 22.20 ? 239  LEU A C   1 
ATOM   1775 O  O   . LEU A 1 237 ? -27.268 -12.134 12.950  1.00 21.37 ? 239  LEU A O   1 
ATOM   1776 C  CB  . LEU A 1 237 ? -29.564 -10.321 13.106  1.00 24.22 ? 239  LEU A CB  1 
ATOM   1777 C  CG  . LEU A 1 237 ? -29.255 -9.574  11.805  1.00 25.31 ? 239  LEU A CG  1 
ATOM   1778 C  CD1 . LEU A 1 237 ? -29.774 -10.245 10.553  1.00 25.24 ? 239  LEU A CD1 1 
ATOM   1779 C  CD2 . LEU A 1 237 ? -29.698 -8.117  11.921  1.00 24.51 ? 239  LEU A CD2 1 
ATOM   1780 N  N   . GLN A 1 238 ? -28.604 -13.621 11.896  1.00 20.83 ? 240  GLN A N   1 
ATOM   1781 C  CA  . GLN A 1 238 ? -27.546 -14.504 11.400  1.00 21.75 ? 240  GLN A CA  1 
ATOM   1782 C  C   . GLN A 1 238 ? -27.936 -15.067 10.045  1.00 19.60 ? 240  GLN A C   1 
ATOM   1783 O  O   . GLN A 1 238 ? -29.107 -15.069 9.680   1.00 19.47 ? 240  GLN A O   1 
ATOM   1784 C  CB  . GLN A 1 238 ? -27.358 -15.694 12.341  1.00 22.71 ? 240  GLN A CB  1 
ATOM   1785 C  CG  . GLN A 1 238 ? -26.980 -15.331 13.746  1.00 24.40 ? 240  GLN A CG  1 
ATOM   1786 C  CD  . GLN A 1 238 ? -26.712 -16.555 14.617  1.00 25.26 ? 240  GLN A CD  1 
ATOM   1787 O  OE1 . GLN A 1 238 ? -27.416 -17.561 14.545  1.00 27.36 ? 240  GLN A OE1 1 
ATOM   1788 N  NE2 . GLN A 1 238 ? -25.685 -16.473 15.429  1.00 24.28 ? 240  GLN A NE2 1 
ATOM   1789 N  N   . LEU A 1 239 ? -26.956 -15.586 9.319   1.00 20.08 ? 241  LEU A N   1 
ATOM   1790 C  CA  . LEU A 1 239 ? -27.205 -16.264 8.042   1.00 20.64 ? 241  LEU A CA  1 
ATOM   1791 C  C   . LEU A 1 239 ? -28.051 -15.369 7.116   1.00 19.82 ? 241  LEU A C   1 
ATOM   1792 O  O   . LEU A 1 239 ? -28.965 -15.830 6.439   1.00 19.87 ? 241  LEU A O   1 
ATOM   1793 C  CB  . LEU A 1 239 ? -27.876 -17.641 8.291   1.00 21.96 ? 241  LEU A CB  1 
ATOM   1794 C  CG  . LEU A 1 239 ? -27.078 -18.621 9.162   1.00 22.96 ? 241  LEU A CG  1 
ATOM   1795 C  CD1 . LEU A 1 239 ? -28.009 -19.706 9.696   1.00 24.75 ? 241  LEU A CD1 1 
ATOM   1796 C  CD2 . LEU A 1 239 ? -25.937 -19.241 8.365   1.00 23.59 ? 241  LEU A CD2 1 
ATOM   1797 N  N   . ASN A 1 240 ? -27.716 -14.080 7.103   1.00 19.72 ? 242  ASN A N   1 
ATOM   1798 C  CA  . ASN A 1 240 ? -28.454 -13.065 6.382   1.00 18.59 ? 242  ASN A CA  1 
ATOM   1799 C  C   . ASN A 1 240 ? -27.907 -12.896 4.956   1.00 19.31 ? 242  ASN A C   1 
ATOM   1800 O  O   . ASN A 1 240 ? -27.387 -11.838 4.572   1.00 18.37 ? 242  ASN A O   1 
ATOM   1801 C  CB  . ASN A 1 240 ? -28.473 -11.745 7.167   1.00 18.49 ? 242  ASN A CB  1 
ATOM   1802 C  CG  . ASN A 1 240 ? -27.091 -11.134 7.396   1.00 18.37 ? 242  ASN A CG  1 
ATOM   1803 O  OD1 . ASN A 1 240 ? -26.074 -11.829 7.565   1.00 18.08 ? 242  ASN A OD1 1 
ATOM   1804 N  ND2 . ASN A 1 240 ? -27.054 -9.804  7.412   1.00 17.57 ? 242  ASN A ND2 1 
ATOM   1805 N  N   . PHE A 1 241 ? -28.033 -13.971 4.184   1.00 19.39 ? 243  PHE A N   1 
ATOM   1806 C  CA  . PHE A 1 241 ? -27.591 -14.004 2.800   1.00 19.24 ? 243  PHE A CA  1 
ATOM   1807 C  C   . PHE A 1 241 ? -28.617 -14.692 1.922   1.00 19.43 ? 243  PHE A C   1 
ATOM   1808 O  O   . PHE A 1 241 ? -29.301 -15.626 2.359   1.00 19.08 ? 243  PHE A O   1 
ATOM   1809 C  CB  . PHE A 1 241 ? -26.224 -14.688 2.673   1.00 19.13 ? 243  PHE A CB  1 
ATOM   1810 C  CG  . PHE A 1 241 ? -26.204 -16.140 3.074   1.00 19.40 ? 243  PHE A CG  1 
ATOM   1811 C  CD1 . PHE A 1 241 ? -26.510 -17.136 2.147   1.00 20.27 ? 243  PHE A CD1 1 
ATOM   1812 C  CD2 . PHE A 1 241 ? -25.841 -16.515 4.354   1.00 19.93 ? 243  PHE A CD2 1 
ATOM   1813 C  CE1 . PHE A 1 241 ? -26.458 -18.485 2.499   1.00 21.08 ? 243  PHE A CE1 1 
ATOM   1814 C  CE2 . PHE A 1 241 ? -25.787 -17.858 4.717   1.00 21.13 ? 243  PHE A CE2 1 
ATOM   1815 C  CZ  . PHE A 1 241 ? -26.102 -18.850 3.786   1.00 21.00 ? 243  PHE A CZ  1 
ATOM   1816 N  N   . ARG A 1 242 ? -28.699 -14.244 0.674   1.00 19.07 ? 244  ARG A N   1 
ATOM   1817 C  CA  . ARG A 1 242 ? -29.568 -14.861 -0.317  1.00 18.84 ? 244  ARG A CA  1 
ATOM   1818 C  C   . ARG A 1 242 ? -28.845 -16.009 -0.982  1.00 19.47 ? 244  ARG A C   1 
ATOM   1819 O  O   . ARG A 1 242 ? -27.635 -15.952 -1.187  1.00 20.41 ? 244  ARG A O   1 
ATOM   1820 C  CB  . ARG A 1 242 ? -29.942 -13.844 -1.382  1.00 18.06 ? 244  ARG A CB  1 
ATOM   1821 C  CG  . ARG A 1 242 ? -31.080 -14.290 -2.295  1.00 18.00 ? 244  ARG A CG  1 
ATOM   1822 C  CD  . ARG A 1 242 ? -31.186 -13.339 -3.469  1.00 18.04 ? 244  ARG A CD  1 
ATOM   1823 N  NE  . ARG A 1 242 ? -32.442 -13.436 -4.193  1.00 17.43 ? 244  ARG A NE  1 
ATOM   1824 C  CZ  . ARG A 1 242 ? -32.763 -12.678 -5.241  1.00 19.00 ? 244  ARG A CZ  1 
ATOM   1825 N  NH1 . ARG A 1 242 ? -31.915 -11.747 -5.707  1.00 17.34 ? 244  ARG A NH1 1 
ATOM   1826 N  NH2 . ARG A 1 242 ? -33.955 -12.834 -5.837  1.00 20.12 ? 244  ARG A NH2 1 
ATOM   1827 N  N   . ALA A 1 243 ? -29.589 -17.031 -1.375  1.00 19.89 ? 245  ALA A N   1 
ATOM   1828 C  CA  . ALA A 1 243 ? -28.991 -18.180 -2.050  1.00 20.62 ? 245  ALA A CA  1 
ATOM   1829 C  C   . ALA A 1 243 ? -28.426 -17.714 -3.392  1.00 19.95 ? 245  ALA A C   1 
ATOM   1830 O  O   . ALA A 1 243 ? -28.927 -16.729 -3.956  1.00 19.80 ? 245  ALA A O   1 
ATOM   1831 C  CB  . ALA A 1 243 ? -30.034 -19.271 -2.261  1.00 21.16 ? 245  ALA A CB  1 
ATOM   1832 N  N   . THR A 1 244 ? -27.402 -18.397 -3.912  1.00 19.40 ? 246  THR A N   1 
ATOM   1833 C  CA  . THR A 1 244 ? -26.838 -17.979 -5.195  1.00 20.41 ? 246  THR A CA  1 
ATOM   1834 C  C   . THR A 1 244 ? -27.848 -18.224 -6.304  1.00 18.47 ? 246  THR A C   1 
ATOM   1835 O  O   . THR A 1 244 ? -28.644 -19.150 -6.244  1.00 19.78 ? 246  THR A O   1 
ATOM   1836 C  CB  . THR A 1 244 ? -25.492 -18.645 -5.548  1.00 21.94 ? 246  THR A CB  1 
ATOM   1837 O  OG1 . THR A 1 244 ? -25.590 -20.037 -5.313  1.00 25.20 ? 246  THR A OG1 1 
ATOM   1838 C  CG2 . THR A 1 244 ? -24.328 -18.056 -4.685  1.00 24.27 ? 246  THR A CG2 1 
ATOM   1839 N  N   . GLN A 1 245 ? -27.807 -17.347 -7.290  1.00 17.14 ? 247  GLN A N   1 
ATOM   1840 C  CA  . GLN A 1 245 ? -28.710 -17.308 -8.409  1.00 16.88 ? 247  GLN A CA  1 
ATOM   1841 C  C   . GLN A 1 245 ? -27.943 -17.710 -9.651  1.00 16.99 ? 247  GLN A C   1 
ATOM   1842 O  O   . GLN A 1 245 ? -26.745 -17.404 -9.768  1.00 16.19 ? 247  GLN A O   1 
ATOM   1843 C  CB  . GLN A 1 245 ? -29.245 -15.879 -8.586  1.00 16.86 ? 247  GLN A CB  1 
ATOM   1844 C  CG  . GLN A 1 245 ? -29.858 -15.291 -7.311  1.00 17.14 ? 247  GLN A CG  1 
ATOM   1845 C  CD  . GLN A 1 245 ? -31.180 -15.955 -6.971  1.00 17.96 ? 247  GLN A CD  1 
ATOM   1846 O  OE1 . GLN A 1 245 ? -32.098 -15.940 -7.787  1.00 18.75 ? 247  GLN A OE1 1 
ATOM   1847 N  NE2 . GLN A 1 245 ? -31.278 -16.557 -5.796  1.00 17.79 ? 247  GLN A NE2 1 
ATOM   1848 N  N   . PRO A 1 246 ? -28.611 -18.411 -10.593 1.00 16.91 ? 248  PRO A N   1 
ATOM   1849 C  CA  . PRO A 1 246 ? -27.873 -18.870 -11.787 1.00 16.70 ? 248  PRO A CA  1 
ATOM   1850 C  C   . PRO A 1 246 ? -27.414 -17.704 -12.642 1.00 15.91 ? 248  PRO A C   1 
ATOM   1851 O  O   . PRO A 1 246 ? -28.094 -16.667 -12.693 1.00 17.26 ? 248  PRO A O   1 
ATOM   1852 C  CB  . PRO A 1 246 ? -28.920 -19.698 -12.563 1.00 17.24 ? 248  PRO A CB  1 
ATOM   1853 C  CG  . PRO A 1 246 ? -30.251 -19.300 -11.989 1.00 18.04 ? 248  PRO A CG  1 
ATOM   1854 C  CD  . PRO A 1 246 ? -29.992 -18.926 -10.554 1.00 17.23 ? 248  PRO A CD  1 
ATOM   1855 N  N   . LEU A 1 247 ? -26.285 -17.861 -13.312 1.00 14.41 ? 249  LEU A N   1 
ATOM   1856 C  CA  . LEU A 1 247 ? -25.812 -16.859 -14.250 1.00 14.65 ? 249  LEU A CA  1 
ATOM   1857 C  C   . LEU A 1 247 ? -26.757 -16.724 -15.432 1.00 14.56 ? 249  LEU A C   1 
ATOM   1858 O  O   . LEU A 1 247 ? -26.977 -15.617 -15.925 1.00 13.89 ? 249  LEU A O   1 
ATOM   1859 C  CB  . LEU A 1 247 ? -24.401 -17.180 -14.739 1.00 14.94 ? 249  LEU A CB  1 
ATOM   1860 C  CG  . LEU A 1 247 ? -23.279 -16.746 -13.790 1.00 14.67 ? 249  LEU A CG  1 
ATOM   1861 C  CD1 . LEU A 1 247 ? -21.952 -17.244 -14.354 1.00 15.09 ? 249  LEU A CD1 1 
ATOM   1862 C  CD2 . LEU A 1 247 ? -23.265 -15.235 -13.593 1.00 14.79 ? 249  LEU A CD2 1 
ATOM   1863 N  N   . ASN A 1 248 ? -27.368 -17.835 -15.840 1.00 14.35 ? 250  ASN A N   1 
ATOM   1864 C  CA  . ASN A 1 248 ? -28.381 -17.818 -16.907 1.00 14.51 ? 250  ASN A CA  1 
ATOM   1865 C  C   . ASN A 1 248 ? -27.850 -17.192 -18.192 1.00 14.65 ? 250  ASN A C   1 
ATOM   1866 O  O   . ASN A 1 248 ? -28.576 -16.520 -18.915 1.00 15.71 ? 250  ASN A O   1 
ATOM   1867 C  CB  . ASN A 1 248 ? -29.663 -17.101 -16.437 1.00 14.30 ? 250  ASN A CB  1 
ATOM   1868 C  CG  . ASN A 1 248 ? -30.597 -18.021 -15.669 1.00 14.93 ? 250  ASN A CG  1 
ATOM   1869 O  OD1 . ASN A 1 248 ? -30.498 -19.239 -15.771 1.00 15.17 ? 250  ASN A OD1 1 
ATOM   1870 N  ND2 . ASN A 1 248 ? -31.512 -17.436 -14.895 1.00 14.51 ? 250  ASN A ND2 1 
ATOM   1871 N  N   . GLY A 1 249 ? -26.580 -17.442 -18.469 1.00 14.64 ? 251  GLY A N   1 
ATOM   1872 C  CA  . GLY A 1 249 ? -25.948 -17.002 -19.713 1.00 15.41 ? 251  GLY A CA  1 
ATOM   1873 C  C   . GLY A 1 249 ? -25.083 -15.762 -19.604 1.00 15.07 ? 251  GLY A C   1 
ATOM   1874 O  O   . GLY A 1 249 ? -24.339 -15.446 -20.544 1.00 15.45 ? 251  GLY A O   1 
ATOM   1875 N  N   . ARG A 1 250 ? -25.173 -15.034 -18.489 1.00 14.09 ? 252  ARG A N   1 
ATOM   1876 C  CA  . ARG A 1 250 ? -24.253 -13.942 -18.244 1.00 13.38 ? 252  ARG A CA  1 
ATOM   1877 C  C   . ARG A 1 250 ? -22.842 -14.498 -18.132 1.00 13.95 ? 252  ARG A C   1 
ATOM   1878 O  O   . ARG A 1 250 ? -22.640 -15.629 -17.662 1.00 14.73 ? 252  ARG A O   1 
ATOM   1879 C  CB  . ARG A 1 250 ? -24.587 -13.215 -16.945 1.00 13.20 ? 252  ARG A CB  1 
ATOM   1880 C  CG  . ARG A 1 250 ? -25.898 -12.431 -16.976 1.00 12.82 ? 252  ARG A CG  1 
ATOM   1881 C  CD  . ARG A 1 250 ? -26.252 -11.955 -15.576 1.00 11.95 ? 252  ARG A CD  1 
ATOM   1882 N  NE  . ARG A 1 250 ? -26.714 -13.028 -14.723 1.00 11.81 ? 252  ARG A NE  1 
ATOM   1883 C  CZ  . ARG A 1 250 ? -27.009 -12.886 -13.426 1.00 11.89 ? 252  ARG A CZ  1 
ATOM   1884 N  NH1 . ARG A 1 250 ? -26.865 -11.713 -12.824 1.00 11.89 ? 252  ARG A NH1 1 
ATOM   1885 N  NH2 . ARG A 1 250 ? -27.454 -13.910 -12.735 1.00 11.71 ? 252  ARG A NH2 1 
ATOM   1886 N  N   . VAL A 1 251 ? -21.880 -13.703 -18.535 1.00 13.21 ? 253  VAL A N   1 
ATOM   1887 C  CA  . VAL A 1 251 ? -20.474 -14.085 -18.454 1.00 14.68 ? 253  VAL A CA  1 
ATOM   1888 C  C   . VAL A 1 251 ? -19.836 -13.116 -17.472 1.00 14.15 ? 253  VAL A C   1 
ATOM   1889 O  O   . VAL A 1 251 ? -19.917 -11.909 -17.675 1.00 16.23 ? 253  VAL A O   1 
ATOM   1890 C  CB  . VAL A 1 251 ? -19.758 -13.952 -19.816 1.00 15.48 ? 253  VAL A CB  1 
ATOM   1891 C  CG1 . VAL A 1 251 ? -18.259 -14.280 -19.697 1.00 16.66 ? 253  VAL A CG1 1 
ATOM   1892 C  CG2 . VAL A 1 251 ? -20.426 -14.860 -20.847 1.00 16.88 ? 253  VAL A CG2 1 
ATOM   1893 N  N   . ILE A 1 252 ? -19.203 -13.629 -16.433 1.00 12.67 ? 254  ILE A N   1 
ATOM   1894 C  CA  . ILE A 1 252 ? -18.516 -12.770 -15.486 1.00 12.97 ? 254  ILE A CA  1 
ATOM   1895 C  C   . ILE A 1 252 ? -17.188 -12.353 -16.093 1.00 13.16 ? 254  ILE A C   1 
ATOM   1896 O  O   . ILE A 1 252 ? -16.521 -13.165 -16.672 1.00 13.03 ? 254  ILE A O   1 
ATOM   1897 C  CB  . ILE A 1 252 ? -18.266 -13.505 -14.162 1.00 13.34 ? 254  ILE A CB  1 
ATOM   1898 C  CG1 . ILE A 1 252 ? -19.602 -13.953 -13.554 1.00 13.09 ? 254  ILE A CG1 1 
ATOM   1899 C  CG2 . ILE A 1 252 ? -17.474 -12.628 -13.187 1.00 13.37 ? 254  ILE A CG2 1 
ATOM   1900 C  CD1 . ILE A 1 252 ? -19.438 -14.825 -12.330 1.00 13.46 ? 254  ILE A CD1 1 
ATOM   1901 N  N   . GLU A 1 253 ? -16.825 -11.089 -15.975 1.00 13.54 ? 255  GLU A N   1 
ATOM   1902 C  CA  . GLU A 1 253 ? -15.546 -10.598 -16.460 1.00 14.26 ? 255  GLU A CA  1 
ATOM   1903 C  C   . GLU A 1 253 ? -14.563 -10.535 -15.291 1.00 14.10 ? 255  GLU A C   1 
ATOM   1904 O  O   . GLU A 1 253 ? -14.960 -10.358 -14.129 1.00 13.16 ? 255  GLU A O   1 
ATOM   1905 C  CB  . GLU A 1 253 ? -15.699 -9.225  -17.095 1.00 15.89 ? 255  GLU A CB  1 
ATOM   1906 C  CG  . GLU A 1 253 ? -16.507 -9.245  -18.388 1.00 18.16 ? 255  GLU A CG  1 
ATOM   1907 C  CD  . GLU A 1 253 ? -16.496 -7.898  -19.114 1.00 21.25 ? 255  GLU A CD  1 
ATOM   1908 O  OE1 . GLU A 1 253 ? -16.754 -6.868  -18.493 1.00 25.32 ? 255  GLU A OE1 1 
ATOM   1909 O  OE2 . GLU A 1 253 ? -16.184 -7.843  -20.307 1.00 24.72 ? 255  GLU A OE2 1 
ATOM   1910 N  N   . ALA A 1 254 ? -13.286 -10.718 -15.616 1.00 13.45 ? 256  ALA A N   1 
ATOM   1911 C  CA  . ALA A 1 254 ? -12.190 -10.647 -14.646 1.00 13.02 ? 256  ALA A CA  1 
ATOM   1912 C  C   . ALA A 1 254 ? -11.217 -9.632  -15.178 1.00 12.99 ? 256  ALA A C   1 
ATOM   1913 O  O   . ALA A 1 254 ? -11.022 -9.523  -16.410 1.00 13.14 ? 256  ALA A O   1 
ATOM   1914 C  CB  . ALA A 1 254 ? -11.508 -11.996 -14.511 1.00 13.25 ? 256  ALA A CB  1 
ATOM   1915 N  N   . SER A 1 255 ? -10.583 -8.899  -14.277 1.00 12.71 ? 257  SER A N   1 
ATOM   1916 C  CA  . SER A 1 255 ? -9.627  -7.864  -14.674 1.00 12.64 ? 257  SER A CA  1 
ATOM   1917 C  C   . SER A 1 255 ? -8.207  -8.424  -14.867 1.00 12.92 ? 257  SER A C   1 
ATOM   1918 O  O   . SER A 1 255 ? -7.283  -7.664  -15.066 1.00 12.41 ? 257  SER A O   1 
ATOM   1919 C  CB  . SER A 1 255 ? -9.593  -6.748  -13.635 1.00 12.85 ? 257  SER A CB  1 
ATOM   1920 O  OG  . SER A 1 255 ? -9.173  -7.249  -12.362 1.00 12.80 ? 257  SER A OG  1 
ATOM   1921 N  N   . PHE A 1 256 ? -8.048  -9.738  -14.830 1.00 13.48 ? 258  PHE A N   1 
ATOM   1922 C  CA  . PHE A 1 256 ? -6.729  -10.378 -14.888 1.00 14.52 ? 258  PHE A CA  1 
ATOM   1923 C  C   . PHE A 1 256 ? -6.934  -11.708 -15.603 1.00 15.78 ? 258  PHE A C   1 
ATOM   1924 O  O   . PHE A 1 256 ? -8.034  -12.274 -15.560 1.00 15.69 ? 258  PHE A O   1 
ATOM   1925 C  CB  . PHE A 1 256 ? -6.192  -10.581 -13.457 1.00 14.71 ? 258  PHE A CB  1 
ATOM   1926 C  CG  . PHE A 1 256 ? -7.164  -11.304 -12.536 1.00 14.40 ? 258  PHE A CG  1 
ATOM   1927 C  CD1 . PHE A 1 256 ? -8.123  -10.590 -11.800 1.00 13.70 ? 258  PHE A CD1 1 
ATOM   1928 C  CD2 . PHE A 1 256 ? -7.162  -12.690 -12.456 1.00 14.41 ? 258  PHE A CD2 1 
ATOM   1929 C  CE1 . PHE A 1 256 ? -9.034  -11.256 -10.978 1.00 13.92 ? 258  PHE A CE1 1 
ATOM   1930 C  CE2 . PHE A 1 256 ? -8.057  -13.372 -11.622 1.00 14.42 ? 258  PHE A CE2 1 
ATOM   1931 C  CZ  . PHE A 1 256 ? -9.001  -12.648 -10.883 1.00 14.30 ? 258  PHE A CZ  1 
ATOM   1932 N  N   . PRO A 1 257 ? -5.907  -12.196 -16.314 1.00 17.63 ? 259  PRO A N   1 
ATOM   1933 C  CA  . PRO A 1 257 ? -6.041  -13.481 -17.032 1.00 18.57 ? 259  PRO A CA  1 
ATOM   1934 C  C   . PRO A 1 257 ? -5.995  -14.699 -16.113 1.00 20.33 ? 259  PRO A C   1 
ATOM   1935 O  O   . PRO A 1 257 ? -6.483  -15.787 -16.443 1.00 23.01 ? 259  PRO A O   1 
ATOM   1936 C  CB  . PRO A 1 257 ? -4.831  -13.494 -17.966 1.00 18.46 ? 259  PRO A CB  1 
ATOM   1937 C  CG  . PRO A 1 257 ? -3.848  -12.550 -17.373 1.00 17.65 ? 259  PRO A CG  1 
ATOM   1938 C  CD  . PRO A 1 257 ? -4.596  -11.558 -16.541 1.00 17.70 ? 259  PRO A CD  1 
ATOM   1939 O  OXT . PRO A 1 257 ? -5.472  -14.628 -14.999 1.00 20.04 ? 259  PRO A OXT 1 
ATOM   1940 N  N   . TRP B 1 7   ? -27.462 24.907  -34.843 1.00 32.44 ? 9    TRP B N   1 
ATOM   1941 C  CA  . TRP B 1 7   ? -25.990 24.634  -35.002 1.00 31.18 ? 9    TRP B CA  1 
ATOM   1942 C  C   . TRP B 1 7   ? -25.705 24.181  -36.434 1.00 29.87 ? 9    TRP B C   1 
ATOM   1943 O  O   . TRP B 1 7   ? -26.619 23.737  -37.131 1.00 31.32 ? 9    TRP B O   1 
ATOM   1944 C  CB  . TRP B 1 7   ? -25.531 23.541  -34.015 1.00 29.66 ? 9    TRP B CB  1 
ATOM   1945 C  CG  . TRP B 1 7   ? -26.282 22.236  -34.222 1.00 27.08 ? 9    TRP B CG  1 
ATOM   1946 C  CD1 . TRP B 1 7   ? -27.470 21.883  -33.666 1.00 25.98 ? 9    TRP B CD1 1 
ATOM   1947 C  CD2 . TRP B 1 7   ? -25.906 21.155  -35.089 1.00 26.00 ? 9    TRP B CD2 1 
ATOM   1948 N  NE1 . TRP B 1 7   ? -27.860 20.641  -34.118 1.00 26.01 ? 9    TRP B NE1 1 
ATOM   1949 C  CE2 . TRP B 1 7   ? -26.917 20.170  -34.992 1.00 26.11 ? 9    TRP B CE2 1 
ATOM   1950 C  CE3 . TRP B 1 7   ? -24.813 20.922  -35.933 1.00 26.14 ? 9    TRP B CE3 1 
ATOM   1951 C  CZ2 . TRP B 1 7   ? -26.862 18.963  -35.702 1.00 25.72 ? 9    TRP B CZ2 1 
ATOM   1952 C  CZ3 . TRP B 1 7   ? -24.757 19.715  -36.639 1.00 26.66 ? 9    TRP B CZ3 1 
ATOM   1953 C  CH2 . TRP B 1 7   ? -25.785 18.758  -36.520 1.00 26.49 ? 9    TRP B CH2 1 
ATOM   1954 N  N   . ARG B 1 8   ? -24.444 24.241  -36.854 1.00 30.15 ? 10   ARG B N   1 
ATOM   1955 C  CA  . ARG B 1 8   ? -24.047 23.770  -38.192 1.00 31.13 ? 10   ARG B CA  1 
ATOM   1956 C  C   . ARG B 1 8   ? -22.713 23.045  -38.189 1.00 33.23 ? 10   ARG B C   1 
ATOM   1957 O  O   . ARG B 1 8   ? -21.907 23.178  -37.257 1.00 35.47 ? 10   ARG B O   1 
ATOM   1958 C  CB  . ARG B 1 8   ? -23.971 24.948  -39.195 1.00 31.25 ? 10   ARG B CB  1 
ATOM   1959 N  N   . TYR B 1 9   ? -22.481 22.293  -39.258 1.00 33.68 ? 11   TYR B N   1 
ATOM   1960 C  CA  . TYR B 1 9   ? -21.163 21.742  -39.540 1.00 35.75 ? 11   TYR B CA  1 
ATOM   1961 C  C   . TYR B 1 9   ? -20.277 22.845  -40.121 1.00 42.16 ? 11   TYR B C   1 
ATOM   1962 O  O   . TYR B 1 9   ? -20.675 23.516  -41.081 1.00 43.47 ? 11   TYR B O   1 
ATOM   1963 C  CB  . TYR B 1 9   ? -21.258 20.571  -40.515 1.00 32.99 ? 11   TYR B CB  1 
ATOM   1964 C  CG  . TYR B 1 9   ? -21.872 19.331  -39.885 1.00 31.06 ? 11   TYR B CG  1 
ATOM   1965 C  CD1 . TYR B 1 9   ? -21.151 18.575  -38.957 1.00 30.61 ? 11   TYR B CD1 1 
ATOM   1966 C  CD2 . TYR B 1 9   ? -23.165 18.916  -40.207 1.00 28.91 ? 11   TYR B CD2 1 
ATOM   1967 C  CE1 . TYR B 1 9   ? -21.701 17.443  -38.364 1.00 29.42 ? 11   TYR B CE1 1 
ATOM   1968 C  CE2 . TYR B 1 9   ? -23.720 17.783  -39.617 1.00 28.47 ? 11   TYR B CE2 1 
ATOM   1969 C  CZ  . TYR B 1 9   ? -22.982 17.045  -38.705 1.00 27.79 ? 11   TYR B CZ  1 
ATOM   1970 O  OH  . TYR B 1 9   ? -23.522 15.918  -38.122 1.00 26.16 ? 11   TYR B OH  1 
ATOM   1971 N  N   . GLY B 1 10  ? -19.093 23.031  -39.526 1.00 47.17 ? 12   GLY B N   1 
ATOM   1972 C  CA  . GLY B 1 10  ? -18.113 24.033  -39.983 1.00 49.34 ? 12   GLY B CA  1 
ATOM   1973 C  C   . GLY B 1 10  ? -18.299 25.471  -39.498 1.00 50.82 ? 12   GLY B C   1 
ATOM   1974 O  O   . GLY B 1 10  ? -17.622 26.364  -40.002 1.00 52.14 ? 12   GLY B O   1 
ATOM   1975 N  N   . GLY B 1 11  ? -19.179 25.703  -38.515 1.00 51.54 ? 13   GLY B N   1 
ATOM   1976 C  CA  . GLY B 1 11  ? -19.456 27.052  -38.007 1.00 53.33 ? 13   GLY B CA  1 
ATOM   1977 C  C   . GLY B 1 11  ? -18.387 27.568  -37.054 1.00 56.57 ? 13   GLY B C   1 
ATOM   1978 O  O   . GLY B 1 11  ? -17.492 26.822  -36.622 1.00 56.14 ? 13   GLY B O   1 
ATOM   1979 N  N   . ASP B 1 12  ? -18.478 28.859  -36.744 1.00 56.82 ? 14   ASP B N   1 
ATOM   1980 C  CA  . ASP B 1 12  ? -17.567 29.524  -35.800 1.00 56.76 ? 14   ASP B CA  1 
ATOM   1981 C  C   . ASP B 1 12  ? -18.360 30.673  -35.118 1.00 58.03 ? 14   ASP B C   1 
ATOM   1982 O  O   . ASP B 1 12  ? -18.840 31.564  -35.818 1.00 55.37 ? 14   ASP B O   1 
ATOM   1983 C  CB  . ASP B 1 12  ? -16.319 30.045  -36.534 1.00 55.38 ? 14   ASP B CB  1 
ATOM   1984 C  CG  . ASP B 1 12  ? -15.031 29.867  -35.729 1.00 54.86 ? 14   ASP B CG  1 
ATOM   1985 O  OD1 . ASP B 1 12  ? -14.992 30.237  -34.533 1.00 53.01 ? 14   ASP B OD1 1 
ATOM   1986 O  OD2 . ASP B 1 12  ? -14.044 29.362  -36.302 1.00 49.41 ? 14   ASP B OD2 1 
ATOM   1987 N  N   . PRO B 1 13  ? -18.521 30.677  -33.784 1.00 59.48 ? 15   PRO B N   1 
ATOM   1988 C  CA  . PRO B 1 13  ? -17.836 29.765  -32.850 1.00 58.07 ? 15   PRO B CA  1 
ATOM   1989 C  C   . PRO B 1 13  ? -18.233 28.278  -32.984 1.00 52.96 ? 15   PRO B C   1 
ATOM   1990 O  O   . PRO B 1 13  ? -19.317 27.961  -33.505 1.00 52.55 ? 15   PRO B O   1 
ATOM   1991 C  CB  . PRO B 1 13  ? -18.186 30.332  -31.453 1.00 58.14 ? 15   PRO B CB  1 
ATOM   1992 C  CG  . PRO B 1 13  ? -19.248 31.358  -31.663 1.00 58.95 ? 15   PRO B CG  1 
ATOM   1993 C  CD  . PRO B 1 13  ? -19.215 31.786  -33.095 1.00 59.75 ? 15   PRO B CD  1 
ATOM   1994 N  N   . PRO B 1 14  ? -17.340 27.372  -32.547 1.00 48.12 ? 16   PRO B N   1 
ATOM   1995 C  CA  . PRO B 1 14  ? -17.666 25.946  -32.589 1.00 45.21 ? 16   PRO B CA  1 
ATOM   1996 C  C   . PRO B 1 14  ? -18.761 25.562  -31.568 1.00 37.62 ? 16   PRO B C   1 
ATOM   1997 O  O   . PRO B 1 14  ? -19.292 26.421  -30.839 1.00 33.70 ? 16   PRO B O   1 
ATOM   1998 C  CB  . PRO B 1 14  ? -16.318 25.267  -32.286 1.00 47.02 ? 16   PRO B CB  1 
ATOM   1999 C  CG  . PRO B 1 14  ? -15.573 26.263  -31.459 1.00 49.09 ? 16   PRO B CG  1 
ATOM   2000 C  CD  . PRO B 1 14  ? -16.030 27.625  -31.908 1.00 49.11 ? 16   PRO B CD  1 
ATOM   2001 N  N   . TRP B 1 15  ? -19.093 24.281  -31.539 1.00 31.44 ? 17   TRP B N   1 
ATOM   2002 C  CA  . TRP B 1 15  ? -20.251 23.791  -30.785 1.00 31.38 ? 17   TRP B CA  1 
ATOM   2003 C  C   . TRP B 1 15  ? -20.235 24.043  -29.272 1.00 30.77 ? 17   TRP B C   1 
ATOM   2004 O  O   . TRP B 1 15  ? -21.285 24.335  -28.713 1.00 31.86 ? 17   TRP B O   1 
ATOM   2005 C  CB  . TRP B 1 15  ? -20.467 22.304  -31.058 1.00 30.19 ? 17   TRP B CB  1 
ATOM   2006 C  CG  . TRP B 1 15  ? -20.859 21.988  -32.467 1.00 30.36 ? 17   TRP B CG  1 
ATOM   2007 C  CD1 . TRP B 1 15  ? -21.292 22.860  -33.440 1.00 30.81 ? 17   TRP B CD1 1 
ATOM   2008 C  CD2 . TRP B 1 15  ? -20.887 20.691  -33.053 1.00 29.77 ? 17   TRP B CD2 1 
ATOM   2009 N  NE1 . TRP B 1 15  ? -21.579 22.169  -34.593 1.00 31.09 ? 17   TRP B NE1 1 
ATOM   2010 C  CE2 . TRP B 1 15  ? -21.344 20.836  -34.377 1.00 31.08 ? 17   TRP B CE2 1 
ATOM   2011 C  CE3 . TRP B 1 15  ? -20.577 19.411  -32.580 1.00 27.93 ? 17   TRP B CE3 1 
ATOM   2012 C  CZ2 . TRP B 1 15  ? -21.490 19.744  -35.233 1.00 30.33 ? 17   TRP B CZ2 1 
ATOM   2013 C  CZ3 . TRP B 1 15  ? -20.718 18.345  -33.425 1.00 27.84 ? 17   TRP B CZ3 1 
ATOM   2014 C  CH2 . TRP B 1 15  ? -21.167 18.508  -34.734 1.00 28.65 ? 17   TRP B CH2 1 
ATOM   2015 N  N   . PRO B 1 16  ? -19.059 23.959  -28.618 1.00 29.40 ? 18   PRO B N   1 
ATOM   2016 C  CA  . PRO B 1 16  ? -19.055 24.202  -27.169 1.00 32.17 ? 18   PRO B CA  1 
ATOM   2017 C  C   . PRO B 1 16  ? -19.651 25.535  -26.695 1.00 34.91 ? 18   PRO B C   1 
ATOM   2018 O  O   . PRO B 1 16  ? -20.182 25.582  -25.583 1.00 31.64 ? 18   PRO B O   1 
ATOM   2019 C  CB  . PRO B 1 16  ? -17.574 24.093  -26.804 1.00 30.88 ? 18   PRO B CB  1 
ATOM   2020 C  CG  . PRO B 1 16  ? -17.046 23.089  -27.789 1.00 30.89 ? 18   PRO B CG  1 
ATOM   2021 C  CD  . PRO B 1 16  ? -17.744 23.468  -29.076 1.00 30.32 ? 18   PRO B CD  1 
ATOM   2022 N  N   . ARG B 1 17  ? -19.593 26.588  -27.521 1.00 37.06 ? 19   ARG B N   1 
ATOM   2023 C  CA  . ARG B 1 17  ? -20.134 27.891  -27.115 1.00 43.34 ? 19   ARG B CA  1 
ATOM   2024 C  C   . ARG B 1 17  ? -21.650 27.830  -26.876 1.00 44.06 ? 19   ARG B C   1 
ATOM   2025 O  O   . ARG B 1 17  ? -22.128 28.300  -25.842 1.00 47.78 ? 19   ARG B O   1 
ATOM   2026 C  CB  . ARG B 1 17  ? -19.790 29.028  -28.101 1.00 46.14 ? 19   ARG B CB  1 
ATOM   2027 C  CG  . ARG B 1 17  ? -20.502 30.322  -27.695 1.00 52.16 ? 19   ARG B CG  1 
ATOM   2028 C  CD  . ARG B 1 17  ? -19.974 31.602  -28.305 1.00 54.33 ? 19   ARG B CD  1 
ATOM   2029 N  NE  . ARG B 1 17  ? -20.525 32.790  -27.632 1.00 54.57 ? 19   ARG B NE  1 
ATOM   2030 C  CZ  . ARG B 1 17  ? -20.142 33.253  -26.435 1.00 55.76 ? 19   ARG B CZ  1 
ATOM   2031 N  NH1 . ARG B 1 17  ? -19.204 32.633  -25.717 1.00 56.25 ? 19   ARG B NH1 1 
ATOM   2032 N  NH2 . ARG B 1 17  ? -20.709 34.356  -25.939 1.00 57.03 ? 19   ARG B NH2 1 
ATOM   2033 N  N   . VAL B 1 18  ? -22.381 27.279  -27.836 1.00 43.25 ? 20   VAL B N   1 
ATOM   2034 C  CA  . VAL B 1 18  ? -23.830 27.062  -27.705 1.00 46.85 ? 20   VAL B CA  1 
ATOM   2035 C  C   . VAL B 1 18  ? -24.190 25.808  -26.870 1.00 45.84 ? 20   VAL B C   1 
ATOM   2036 O  O   . VAL B 1 18  ? -25.196 25.818  -26.142 1.00 44.46 ? 20   VAL B O   1 
ATOM   2037 C  CB  . VAL B 1 18  ? -24.532 27.024  -29.101 1.00 52.00 ? 20   VAL B CB  1 
ATOM   2038 C  CG1 . VAL B 1 18  ? -24.152 25.786  -29.927 1.00 55.15 ? 20   VAL B CG1 1 
ATOM   2039 C  CG2 . VAL B 1 18  ? -26.049 27.119  -28.954 1.00 53.40 ? 20   VAL B CG2 1 
ATOM   2040 N  N   . SER B 1 19  ? -23.372 24.749  -26.964 1.00 40.17 ? 21   SER B N   1 
ATOM   2041 C  CA  . SER B 1 19  ? -23.637 23.477  -26.274 1.00 35.53 ? 21   SER B CA  1 
ATOM   2042 C  C   . SER B 1 19  ? -22.409 23.025  -25.487 1.00 29.71 ? 21   SER B C   1 
ATOM   2043 O  O   . SER B 1 19  ? -21.612 22.254  -25.988 1.00 25.66 ? 21   SER B O   1 
ATOM   2044 C  CB  . SER B 1 19  ? -24.030 22.422  -27.296 1.00 37.15 ? 21   SER B CB  1 
ATOM   2045 O  OG  . SER B 1 19  ? -25.080 22.920  -28.094 1.00 40.94 ? 21   SER B OG  1 
ATOM   2046 N  N   . PRO B 1 20  ? -22.258 23.508  -24.242 1.00 27.50 ? 22   PRO B N   1 
ATOM   2047 C  CA  . PRO B 1 20  ? -21.085 23.199  -23.411 1.00 25.54 ? 22   PRO B CA  1 
ATOM   2048 C  C   . PRO B 1 20  ? -20.778 21.704  -23.239 1.00 21.67 ? 22   PRO B C   1 
ATOM   2049 O  O   . PRO B 1 20  ? -19.621 21.348  -23.036 1.00 21.04 ? 22   PRO B O   1 
ATOM   2050 C  CB  . PRO B 1 20  ? -21.445 23.816  -22.051 1.00 27.76 ? 22   PRO B CB  1 
ATOM   2051 C  CG  . PRO B 1 20  ? -22.394 24.915  -22.396 1.00 29.74 ? 22   PRO B CG  1 
ATOM   2052 C  CD  . PRO B 1 20  ? -23.211 24.389  -23.533 1.00 28.86 ? 22   PRO B CD  1 
ATOM   2053 N  N   . ALA B 1 21  ? -21.801 20.854  -23.294 1.00 18.78 ? 23   ALA B N   1 
ATOM   2054 C  CA  . ALA B 1 21  ? -21.617 19.398  -23.208 1.00 18.15 ? 23   ALA B CA  1 
ATOM   2055 C  C   . ALA B 1 21  ? -20.717 18.844  -24.331 1.00 16.58 ? 23   ALA B C   1 
ATOM   2056 O  O   . ALA B 1 21  ? -20.106 17.786  -24.169 1.00 15.58 ? 23   ALA B O   1 
ATOM   2057 C  CB  . ALA B 1 21  ? -22.966 18.696  -23.226 1.00 17.97 ? 23   ALA B CB  1 
ATOM   2058 N  N   . CYS B 1 22  ? -20.636 19.574  -25.444 1.00 16.37 ? 24   CYS B N   1 
ATOM   2059 C  CA  . CYS B 1 22  ? -19.763 19.215  -26.544 1.00 16.60 ? 24   CYS B CA  1 
ATOM   2060 C  C   . CYS B 1 22  ? -18.302 19.302  -26.196 1.00 16.49 ? 24   CYS B C   1 
ATOM   2061 O  O   . CYS B 1 22  ? -17.491 18.713  -26.914 1.00 16.87 ? 24   CYS B O   1 
ATOM   2062 C  CB  . CYS B 1 22  ? -20.097 20.027  -27.804 1.00 16.79 ? 24   CYS B CB  1 
ATOM   2063 S  SG  . CYS B 1 22  ? -21.790 19.802  -28.400 1.00 18.32 ? 24   CYS B SG  1 
ATOM   2064 N  N   . ALA B 1 23  ? -17.966 19.987  -25.092 1.00 15.89 ? 25   ALA B N   1 
ATOM   2065 C  CA  . ALA B 1 23  ? -16.612 19.982  -24.557 1.00 16.62 ? 25   ALA B CA  1 
ATOM   2066 C  C   . ALA B 1 23  ? -16.455 19.026  -23.380 1.00 16.05 ? 25   ALA B C   1 
ATOM   2067 O  O   . ALA B 1 23  ? -15.489 19.141  -22.641 1.00 16.12 ? 25   ALA B O   1 
ATOM   2068 C  CB  . ALA B 1 23  ? -16.186 21.397  -24.147 1.00 16.85 ? 25   ALA B CB  1 
ATOM   2069 N  N   . GLY B 1 24  ? -17.359 18.064  -23.215 1.00 15.11 ? 26   GLY B N   1 
ATOM   2070 C  CA  . GLY B 1 24  ? -17.159 17.006  -22.219 1.00 15.14 ? 26   GLY B CA  1 
ATOM   2071 C  C   . GLY B 1 24  ? -15.931 16.143  -22.522 1.00 14.74 ? 26   GLY B C   1 
ATOM   2072 O  O   . GLY B 1 24  ? -15.400 16.155  -23.642 1.00 14.01 ? 26   GLY B O   1 
ATOM   2073 N  N   . ARG B 1 25  ? -15.497 15.393  -21.524 1.00 14.73 ? 27   ARG B N   1 
ATOM   2074 C  CA  . ARG B 1 25  ? -14.314 14.544  -21.639 1.00 14.93 ? 27   ARG B CA  1 
ATOM   2075 C  C   . ARG B 1 25  ? -14.502 13.274  -22.476 1.00 13.96 ? 27   ARG B C   1 
ATOM   2076 O  O   . ARG B 1 25  ? -13.520 12.727  -22.957 1.00 14.06 ? 27   ARG B O   1 
ATOM   2077 C  CB  . ARG B 1 25  ? -13.844 14.107  -20.252 1.00 16.87 ? 27   ARG B CB  1 
ATOM   2078 C  CG  . ARG B 1 25  ? -13.354 15.231  -19.339 1.00 19.35 ? 27   ARG B CG  1 
ATOM   2079 C  CD  . ARG B 1 25  ? -13.119 14.711  -17.926 1.00 20.99 ? 27   ARG B CD  1 
ATOM   2080 N  NE  . ARG B 1 25  ? -14.364 14.260  -17.279 1.00 22.13 ? 27   ARG B NE  1 
ATOM   2081 C  CZ  . ARG B 1 25  ? -14.436 13.458  -16.210 1.00 24.51 ? 27   ARG B CZ  1 
ATOM   2082 N  NH1 . ARG B 1 25  ? -13.338 13.011  -15.613 1.00 26.35 ? 27   ARG B NH1 1 
ATOM   2083 N  NH2 . ARG B 1 25  ? -15.621 13.091  -15.730 1.00 24.57 ? 27   ARG B NH2 1 
ATOM   2084 N  N   . PHE B 1 26  ? -15.741 12.804  -22.635 1.00 12.99 ? 28   PHE B N   1 
ATOM   2085 C  CA  . PHE B 1 26  ? -16.003 11.486  -23.221 1.00 12.87 ? 28   PHE B CA  1 
ATOM   2086 C  C   . PHE B 1 26  ? -16.952 11.539  -24.398 1.00 12.75 ? 28   PHE B C   1 
ATOM   2087 O  O   . PHE B 1 26  ? -18.101 11.011  -24.359 1.00 12.79 ? 28   PHE B O   1 
ATOM   2088 C  CB  . PHE B 1 26  ? -16.471 10.523  -22.137 1.00 12.79 ? 28   PHE B CB  1 
ATOM   2089 C  CG  . PHE B 1 26  ? -15.546 10.471  -20.965 1.00 13.35 ? 28   PHE B CG  1 
ATOM   2090 C  CD1 . PHE B 1 26  ? -14.241 10.027  -21.120 1.00 13.41 ? 28   PHE B CD1 1 
ATOM   2091 C  CD2 . PHE B 1 26  ? -15.956 10.910  -19.700 1.00 13.24 ? 28   PHE B CD2 1 
ATOM   2092 C  CE1 . PHE B 1 26  ? -13.367 9.993   -20.041 1.00 13.44 ? 28   PHE B CE1 1 
ATOM   2093 C  CE2 . PHE B 1 26  ? -15.080 10.878  -18.621 1.00 13.57 ? 28   PHE B CE2 1 
ATOM   2094 C  CZ  . PHE B 1 26  ? -13.782 10.411  -18.785 1.00 13.49 ? 28   PHE B CZ  1 
ATOM   2095 N  N   . GLN B 1 27  ? -16.433 12.149  -25.460 1.00 12.22 ? 29   GLN B N   1 
ATOM   2096 C  CA  . GLN B 1 27  ? -17.180 12.419  -26.664 1.00 12.56 ? 29   GLN B CA  1 
ATOM   2097 C  C   . GLN B 1 27  ? -16.953 11.395  -27.778 1.00 12.20 ? 29   GLN B C   1 
ATOM   2098 O  O   . GLN B 1 27  ? -16.037 10.565  -27.734 1.00 11.35 ? 29   GLN B O   1 
ATOM   2099 C  CB  . GLN B 1 27  ? -16.843 13.831  -27.175 1.00 13.24 ? 29   GLN B CB  1 
ATOM   2100 C  CG  . GLN B 1 27  ? -17.223 14.959  -26.209 1.00 14.05 ? 29   GLN B CG  1 
ATOM   2101 C  CD  . GLN B 1 27  ? -18.705 15.268  -26.244 1.00 14.90 ? 29   GLN B CD  1 
ATOM   2102 O  OE1 . GLN B 1 27  ? -19.205 15.807  -27.240 1.00 14.95 ? 29   GLN B OE1 1 
ATOM   2103 N  NE2 . GLN B 1 27  ? -19.418 14.931  -25.166 1.00 15.36 ? 29   GLN B NE2 1 
ATOM   2104 N  N   . SER B 1 28  ? -17.797 11.512  -28.797 1.00 12.23 ? 30   SER B N   1 
ATOM   2105 C  CA  . SER B 1 28  ? -17.733 10.703  -30.009 1.00 11.80 ? 30   SER B CA  1 
ATOM   2106 C  C   . SER B 1 28  ? -17.767 11.627  -31.239 1.00 12.11 ? 30   SER B C   1 
ATOM   2107 O  O   . SER B 1 28  ? -18.277 12.731  -31.141 1.00 12.48 ? 30   SER B O   1 
ATOM   2108 C  CB  . SER B 1 28  ? -18.937 9.779   -30.029 1.00 11.88 ? 30   SER B CB  1 
ATOM   2109 O  OG  . SER B 1 28  ? -18.886 8.835   -28.972 1.00 11.56 ? 30   SER B OG  1 
ATOM   2110 N  N   . PRO B 1 29  ? -17.266 11.198  -32.400 1.00 12.15 ? 31   PRO B N   1 
ATOM   2111 C  CA  . PRO B 1 29  ? -16.668 9.890   -32.625 1.00 12.23 ? 31   PRO B CA  1 
ATOM   2112 C  C   . PRO B 1 29  ? -15.191 9.838   -32.233 1.00 12.33 ? 31   PRO B C   1 
ATOM   2113 O  O   . PRO B 1 29  ? -14.609 10.847  -31.799 1.00 12.44 ? 31   PRO B O   1 
ATOM   2114 C  CB  . PRO B 1 29  ? -16.817 9.723   -34.157 1.00 12.20 ? 31   PRO B CB  1 
ATOM   2115 C  CG  . PRO B 1 29  ? -16.598 11.134  -34.659 1.00 11.89 ? 31   PRO B CG  1 
ATOM   2116 C  CD  . PRO B 1 29  ? -17.325 11.992  -33.646 1.00 12.28 ? 31   PRO B CD  1 
ATOM   2117 N  N   . VAL B 1 30  ? -14.591 8.666   -32.408 1.00 12.07 ? 32   VAL B N   1 
ATOM   2118 C  CA  . VAL B 1 30  ? -13.170 8.425   -32.071 1.00 12.28 ? 32   VAL B CA  1 
ATOM   2119 C  C   . VAL B 1 30  ? -12.468 7.658   -33.200 1.00 12.48 ? 32   VAL B C   1 
ATOM   2120 O  O   . VAL B 1 30  ? -13.120 7.089   -34.088 1.00 12.08 ? 32   VAL B O   1 
ATOM   2121 C  CB  . VAL B 1 30  ? -13.015 7.646   -30.746 1.00 12.09 ? 32   VAL B CB  1 
ATOM   2122 C  CG1 . VAL B 1 30  ? -13.656 8.417   -29.622 1.00 12.12 ? 32   VAL B CG1 1 
ATOM   2123 C  CG2 . VAL B 1 30  ? -13.645 6.253   -30.824 1.00 12.14 ? 32   VAL B CG2 1 
ATOM   2124 N  N   . ASP B 1 31  ? -11.139 7.664   -33.158 1.00 12.49 ? 33   ASP B N   1 
ATOM   2125 C  CA  . ASP B 1 31  ? -10.327 6.839   -34.021 1.00 12.66 ? 33   ASP B CA  1 
ATOM   2126 C  C   . ASP B 1 31  ? -10.150 5.493   -33.356 1.00 12.56 ? 33   ASP B C   1 
ATOM   2127 O  O   . ASP B 1 31  ? -9.779  5.421   -32.178 1.00 12.98 ? 33   ASP B O   1 
ATOM   2128 C  CB  . ASP B 1 31  ? -8.960  7.477   -34.262 1.00 13.25 ? 33   ASP B CB  1 
ATOM   2129 C  CG  . ASP B 1 31  ? -8.143  6.729   -35.298 1.00 13.80 ? 33   ASP B CG  1 
ATOM   2130 O  OD1 . ASP B 1 31  ? -8.701  6.414   -36.387 1.00 13.31 ? 33   ASP B OD1 1 
ATOM   2131 O  OD2 . ASP B 1 31  ? -6.941  6.477   -35.029 1.00 13.71 ? 33   ASP B OD2 1 
ATOM   2132 N  N   . ILE B 1 32  ? -10.480 4.431   -34.088 1.00 12.68 ? 34   ILE B N   1 
ATOM   2133 C  CA  . ILE B 1 32  ? -10.384 3.070   -33.594 1.00 13.07 ? 34   ILE B CA  1 
ATOM   2134 C  C   . ILE B 1 32  ? -8.987  2.551   -33.999 1.00 13.34 ? 34   ILE B C   1 
ATOM   2135 O  O   . ILE B 1 32  ? -8.636  2.567   -35.184 1.00 13.42 ? 34   ILE B O   1 
ATOM   2136 C  CB  . ILE B 1 32  ? -11.489 2.157   -34.186 1.00 13.26 ? 34   ILE B CB  1 
ATOM   2137 C  CG1 . ILE B 1 32  ? -12.872 2.671   -33.802 1.00 13.58 ? 34   ILE B CG1 1 
ATOM   2138 C  CG2 . ILE B 1 32  ? -11.291 0.702   -33.717 1.00 13.46 ? 34   ILE B CG2 1 
ATOM   2139 C  CD1 . ILE B 1 32  ? -14.026 2.063   -34.581 1.00 13.79 ? 34   ILE B CD1 1 
ATOM   2140 N  N   . ARG B 1 33  ? -8.214  2.115   -33.012 1.00 12.90 ? 35   ARG B N   1 
ATOM   2141 C  CA  . ARG B 1 33  ? -6.890  1.543   -33.204 1.00 13.36 ? 35   ARG B CA  1 
ATOM   2142 C  C   . ARG B 1 33  ? -6.963  0.101   -32.751 1.00 12.79 ? 35   ARG B C   1 
ATOM   2143 O  O   . ARG B 1 33  ? -6.901  -0.172  -31.567 1.00 13.10 ? 35   ARG B O   1 
ATOM   2144 C  CB  . ARG B 1 33  ? -5.875  2.379   -32.416 1.00 14.32 ? 35   ARG B CB  1 
ATOM   2145 C  CG  . ARG B 1 33  ? -5.664  3.700   -33.122 1.00 14.80 ? 35   ARG B CG  1 
ATOM   2146 C  CD  . ARG B 1 33  ? -5.075  4.797   -32.268 1.00 16.73 ? 35   ARG B CD  1 
ATOM   2147 N  NE  . ARG B 1 33  ? -5.301  6.087   -32.914 1.00 18.26 ? 35   ARG B NE  1 
ATOM   2148 C  CZ  . ARG B 1 33  ? -4.807  7.254   -32.511 1.00 20.29 ? 35   ARG B CZ  1 
ATOM   2149 N  NH1 . ARG B 1 33  ? -4.005  7.331   -31.433 1.00 20.18 ? 35   ARG B NH1 1 
ATOM   2150 N  NH2 . ARG B 1 33  ? -5.112  8.356   -33.205 1.00 19.88 ? 35   ARG B NH2 1 
ATOM   2151 N  N   . PRO B 1 34  ? -7.178  -0.836  -33.691 1.00 12.91 ? 36   PRO B N   1 
ATOM   2152 C  CA  . PRO B 1 34  ? -7.487  -2.198  -33.259 1.00 13.20 ? 36   PRO B CA  1 
ATOM   2153 C  C   . PRO B 1 34  ? -6.416  -2.900  -32.453 1.00 12.69 ? 36   PRO B C   1 
ATOM   2154 O  O   . PRO B 1 34  ? -6.756  -3.729  -31.588 1.00 11.67 ? 36   PRO B O   1 
ATOM   2155 C  CB  . PRO B 1 34  ? -7.735  -2.945  -34.594 1.00 13.83 ? 36   PRO B CB  1 
ATOM   2156 C  CG  . PRO B 1 34  ? -8.162  -1.887  -35.533 1.00 13.37 ? 36   PRO B CG  1 
ATOM   2157 C  CD  . PRO B 1 34  ? -7.349  -0.686  -35.143 1.00 13.05 ? 36   PRO B CD  1 
ATOM   2158 N  N   . GLN B 1 35  ? -5.137  -2.563  -32.670 1.00 12.64 ? 37   GLN B N   1 
ATOM   2159 C  CA  . GLN B 1 35  ? -4.063  -3.156  -31.829 1.00 13.84 ? 37   GLN B CA  1 
ATOM   2160 C  C   . GLN B 1 35  ? -4.131  -2.739  -30.368 1.00 13.61 ? 37   GLN B C   1 
ATOM   2161 O  O   . GLN B 1 35  ? -3.558  -3.415  -29.518 1.00 13.17 ? 37   GLN B O   1 
ATOM   2162 C  CB  . GLN B 1 35  ? -2.678  -2.814  -32.366 1.00 14.98 ? 37   GLN B CB  1 
ATOM   2163 C  CG  . GLN B 1 35  ? -2.477  -3.401  -33.751 1.00 17.29 ? 37   GLN B CG  1 
ATOM   2164 C  CD  . GLN B 1 35  ? -1.101  -3.155  -34.353 1.00 17.98 ? 37   GLN B CD  1 
ATOM   2165 O  OE1 . GLN B 1 35  ? -0.914  -3.361  -35.573 1.00 22.15 ? 37   GLN B OE1 1 
ATOM   2166 N  NE2 . GLN B 1 35  ? -0.161  -2.664  -33.540 1.00 17.67 ? 37   GLN B NE2 1 
ATOM   2167 N  N   . LEU B 1 36  ? -4.816  -1.618  -30.106 1.00 13.53 ? 38   LEU B N   1 
ATOM   2168 C  CA  . LEU B 1 36  ? -5.047  -1.120  -28.766 1.00 14.08 ? 38   LEU B CA  1 
ATOM   2169 C  C   . LEU B 1 36  ? -6.410  -1.447  -28.196 1.00 13.60 ? 38   LEU B C   1 
ATOM   2170 O  O   . LEU B 1 36  ? -6.666  -1.107  -27.052 1.00 13.66 ? 38   LEU B O   1 
ATOM   2171 C  CB  . LEU B 1 36  ? -4.842  0.406   -28.735 1.00 14.88 ? 38   LEU B CB  1 
ATOM   2172 C  CG  . LEU B 1 36  ? -3.437  0.812   -29.210 1.00 15.41 ? 38   LEU B CG  1 
ATOM   2173 C  CD1 . LEU B 1 36  ? -3.191  2.305   -29.181 1.00 15.26 ? 38   LEU B CD1 1 
ATOM   2174 C  CD2 . LEU B 1 36  ? -2.396  0.078   -28.395 1.00 16.22 ? 38   LEU B CD2 1 
ATOM   2175 N  N   . ALA B 1 37  ? -7.266  -2.131  -28.949 1.00 12.59 ? 39   ALA B N   1 
ATOM   2176 C  CA  . ALA B 1 37  ? -8.580  -2.501  -28.443 1.00 12.54 ? 39   ALA B CA  1 
ATOM   2177 C  C   . ALA B 1 37  ? -8.433  -3.652  -27.469 1.00 12.79 ? 39   ALA B C   1 
ATOM   2178 O  O   . ALA B 1 37  ? -7.559  -4.497  -27.634 1.00 13.87 ? 39   ALA B O   1 
ATOM   2179 C  CB  . ALA B 1 37  ? -9.511  -2.893  -29.582 1.00 12.49 ? 39   ALA B CB  1 
ATOM   2180 N  N   . ALA B 1 38  ? -9.259  -3.665  -26.439 1.00 12.35 ? 40   ALA B N   1 
ATOM   2181 C  CA  . ALA B 1 38  ? -9.275  -4.737  -25.460 1.00 12.51 ? 40   ALA B CA  1 
ATOM   2182 C  C   . ALA B 1 38  ? -10.262 -5.829  -25.893 1.00 12.78 ? 40   ALA B C   1 
ATOM   2183 O  O   . ALA B 1 38  ? -11.457 -5.599  -25.893 1.00 12.80 ? 40   ALA B O   1 
ATOM   2184 C  CB  . ALA B 1 38  ? -9.679  -4.192  -24.104 1.00 12.64 ? 40   ALA B CB  1 
ATOM   2185 N  N   . PHE B 1 39  ? -9.759  -7.009  -26.220 1.00 13.11 ? 41   PHE B N   1 
ATOM   2186 C  CA  . PHE B 1 39  ? -10.605 -8.171  -26.508 1.00 14.01 ? 41   PHE B CA  1 
ATOM   2187 C  C   . PHE B 1 39  ? -11.362 -8.569  -25.246 1.00 14.35 ? 41   PHE B C   1 
ATOM   2188 O  O   . PHE B 1 39  ? -10.718 -8.839  -24.244 1.00 14.98 ? 41   PHE B O   1 
ATOM   2189 C  CB  . PHE B 1 39  ? -9.714  -9.307  -27.017 1.00 14.02 ? 41   PHE B CB  1 
ATOM   2190 C  CG  . PHE B 1 39  ? -10.404 -10.642 -27.168 1.00 14.51 ? 41   PHE B CG  1 
ATOM   2191 C  CD1 . PHE B 1 39  ? -11.658 -10.745 -27.787 1.00 15.04 ? 41   PHE B CD1 1 
ATOM   2192 C  CD2 . PHE B 1 39  ? -9.792  -11.799 -26.700 1.00 14.60 ? 41   PHE B CD2 1 
ATOM   2193 C  CE1 . PHE B 1 39  ? -12.285 -11.984 -27.918 1.00 15.37 ? 41   PHE B CE1 1 
ATOM   2194 C  CE2 . PHE B 1 39  ? -10.409 -13.028 -26.836 1.00 15.42 ? 41   PHE B CE2 1 
ATOM   2195 C  CZ  . PHE B 1 39  ? -11.652 -13.128 -27.463 1.00 14.96 ? 41   PHE B CZ  1 
ATOM   2196 N  N   . SER B 1 40  ? -12.696 -8.529  -25.229 1.00 15.28 ? 42   SER B N   1 
ATOM   2197 C  CA  . SER B 1 40  ? -13.420 -9.193  -24.116 1.00 17.34 ? 42   SER B CA  1 
ATOM   2198 C  C   . SER B 1 40  ? -14.350 -10.200 -24.666 1.00 16.77 ? 42   SER B C   1 
ATOM   2199 O  O   . SER B 1 40  ? -15.327 -9.828  -25.335 1.00 15.47 ? 42   SER B O   1 
ATOM   2200 C  CB  . SER B 1 40  ? -14.256 -8.327  -23.175 1.00 21.21 ? 42   SER B CB  1 
ATOM   2201 O  OG  . SER B 1 40  ? -14.936 -9.230  -22.200 1.00 22.31 ? 42   SER B OG  1 
ATOM   2202 N  N   . PRO B 1 41  ? -14.061 -11.474 -24.385 1.00 16.52 ? 43   PRO B N   1 
ATOM   2203 C  CA  . PRO B 1 41  ? -14.952 -12.494 -24.860 1.00 16.63 ? 43   PRO B CA  1 
ATOM   2204 C  C   . PRO B 1 41  ? -16.319 -12.493 -24.198 1.00 15.80 ? 43   PRO B C   1 
ATOM   2205 O  O   . PRO B 1 41  ? -17.165 -13.230 -24.638 1.00 15.72 ? 43   PRO B O   1 
ATOM   2206 C  CB  . PRO B 1 41  ? -14.195 -13.801 -24.604 1.00 17.05 ? 43   PRO B CB  1 
ATOM   2207 C  CG  . PRO B 1 41  ? -13.062 -13.466 -23.739 1.00 16.71 ? 43   PRO B CG  1 
ATOM   2208 C  CD  . PRO B 1 41  ? -12.773 -12.032 -23.926 1.00 17.27 ? 43   PRO B CD  1 
ATOM   2209 N  N   . ALA B 1 42  ? -16.558 -11.681 -23.179 1.00 15.36 ? 44   ALA B N   1 
ATOM   2210 C  CA  . ALA B 1 42  ? -17.927 -11.482 -22.720 1.00 16.49 ? 44   ALA B CA  1 
ATOM   2211 C  C   . ALA B 1 42  ? -18.843 -10.787 -23.742 1.00 16.38 ? 44   ALA B C   1 
ATOM   2212 O  O   . ALA B 1 42  ? -20.050 -10.847 -23.581 1.00 16.34 ? 44   ALA B O   1 
ATOM   2213 C  CB  . ALA B 1 42  ? -17.963 -10.717 -21.413 1.00 16.98 ? 44   ALA B CB  1 
ATOM   2214 N  N   . LEU B 1 43  ? -18.289 -10.127 -24.757 1.00 15.87 ? 45   LEU B N   1 
ATOM   2215 C  CA  . LEU B 1 43  ? -19.094 -9.458  -25.775 1.00 16.72 ? 45   LEU B CA  1 
ATOM   2216 C  C   . LEU B 1 43  ? -19.727 -10.497 -26.717 1.00 17.31 ? 45   LEU B C   1 
ATOM   2217 O  O   . LEU B 1 43  ? -19.031 -11.103 -27.529 1.00 17.50 ? 45   LEU B O   1 
ATOM   2218 C  CB  . LEU B 1 43  ? -18.237 -8.469  -26.563 1.00 17.19 ? 45   LEU B CB  1 
ATOM   2219 C  CG  . LEU B 1 43  ? -17.711 -7.289  -25.749 1.00 17.93 ? 45   LEU B CG  1 
ATOM   2220 C  CD1 . LEU B 1 43  ? -16.803 -6.458  -26.621 1.00 18.15 ? 45   LEU B CD1 1 
ATOM   2221 C  CD2 . LEU B 1 43  ? -18.863 -6.432  -25.206 1.00 17.71 ? 45   LEU B CD2 1 
ATOM   2222 N  N   . ARG B 1 44  ? -21.039 -10.695 -26.596 1.00 17.90 ? 46   ARG B N   1 
ATOM   2223 C  CA  . ARG B 1 44  ? -21.749 -11.707 -27.383 1.00 18.13 ? 46   ARG B CA  1 
ATOM   2224 C  C   . ARG B 1 44  ? -22.242 -11.129 -28.726 1.00 16.53 ? 46   ARG B C   1 
ATOM   2225 O  O   . ARG B 1 44  ? -22.255 -9.902  -28.911 1.00 15.43 ? 46   ARG B O   1 
ATOM   2226 C  CB  . ARG B 1 44  ? -22.886 -12.341 -26.548 1.00 21.56 ? 46   ARG B CB  1 
ATOM   2227 C  CG  . ARG B 1 44  ? -24.133 -11.495 -26.365 1.00 25.75 ? 46   ARG B CG  1 
ATOM   2228 C  CD  . ARG B 1 44  ? -25.346 -12.256 -25.790 1.00 29.46 ? 46   ARG B CD  1 
ATOM   2229 N  NE  . ARG B 1 44  ? -26.586 -11.440 -25.856 1.00 32.29 ? 46   ARG B NE  1 
ATOM   2230 C  CZ  . ARG B 1 44  ? -27.763 -11.798 -25.345 1.00 36.78 ? 46   ARG B CZ  1 
ATOM   2231 N  NH1 . ARG B 1 44  ? -27.897 -12.962 -24.695 1.00 42.38 ? 46   ARG B NH1 1 
ATOM   2232 N  NH2 . ARG B 1 44  ? -28.828 -11.005 -25.486 1.00 40.58 ? 46   ARG B NH2 1 
ATOM   2233 N  N   . PRO B 1 45  ? -22.638 -12.009 -29.671 1.00 14.62 ? 47   PRO B N   1 
ATOM   2234 C  CA  . PRO B 1 45  ? -23.184 -11.509 -30.920 1.00 14.40 ? 47   PRO B CA  1 
ATOM   2235 C  C   . PRO B 1 45  ? -24.427 -10.632 -30.665 1.00 13.09 ? 47   PRO B C   1 
ATOM   2236 O  O   . PRO B 1 45  ? -25.219 -10.909 -29.760 1.00 12.45 ? 47   PRO B O   1 
ATOM   2237 C  CB  . PRO B 1 45  ? -23.532 -12.787 -31.694 1.00 14.87 ? 47   PRO B CB  1 
ATOM   2238 C  CG  . PRO B 1 45  ? -22.627 -13.829 -31.116 1.00 14.95 ? 47   PRO B CG  1 
ATOM   2239 C  CD  . PRO B 1 45  ? -22.575 -13.481 -29.663 1.00 15.32 ? 47   PRO B CD  1 
ATOM   2240 N  N   . LEU B 1 46  ? -24.527 -9.557  -31.424 1.00 12.89 ? 48   LEU B N   1 
ATOM   2241 C  CA  . LEU B 1 46  ? -25.661 -8.651  -31.332 1.00 13.56 ? 48   LEU B CA  1 
ATOM   2242 C  C   . LEU B 1 46  ? -26.903 -9.421  -31.749 1.00 13.77 ? 48   LEU B C   1 
ATOM   2243 O  O   . LEU B 1 46  ? -26.840 -10.262 -32.647 1.00 13.79 ? 48   LEU B O   1 
ATOM   2244 C  CB  . LEU B 1 46  ? -25.482 -7.466  -32.261 1.00 13.61 ? 48   LEU B CB  1 
ATOM   2245 C  CG  . LEU B 1 46  ? -24.213 -6.649  -32.064 1.00 13.89 ? 48   LEU B CG  1 
ATOM   2246 C  CD1 . LEU B 1 46  ? -24.091 -5.587  -33.134 1.00 13.80 ? 48   LEU B CD1 1 
ATOM   2247 C  CD2 . LEU B 1 46  ? -24.180 -6.042  -30.673 1.00 14.56 ? 48   LEU B CD2 1 
ATOM   2248 N  N   . GLU B 1 47  ? -28.009 -9.142  -31.082 1.00 14.10 ? 49   GLU B N   1 
ATOM   2249 C  CA  . GLU B 1 47  ? -29.308 -9.721  -31.452 1.00 14.04 ? 49   GLU B CA  1 
ATOM   2250 C  C   . GLU B 1 47  ? -30.244 -8.601  -31.910 1.00 14.29 ? 49   GLU B C   1 
ATOM   2251 O  O   . GLU B 1 47  ? -30.447 -7.628  -31.181 1.00 13.70 ? 49   GLU B O   1 
ATOM   2252 C  CB  . GLU B 1 47  ? -29.850 -10.484 -30.274 1.00 14.71 ? 49   GLU B CB  1 
ATOM   2253 C  CG  . GLU B 1 47  ? -28.915 -11.614 -29.847 1.00 15.12 ? 49   GLU B CG  1 
ATOM   2254 C  CD  . GLU B 1 47  ? -29.445 -12.432 -28.695 1.00 16.38 ? 49   GLU B CD  1 
ATOM   2255 O  OE1 . GLU B 1 47  ? -30.564 -12.150 -28.177 1.00 17.09 ? 49   GLU B OE1 1 
ATOM   2256 O  OE2 . GLU B 1 47  ? -28.737 -13.375 -28.280 1.00 17.42 ? 49   GLU B OE2 1 
ATOM   2257 N  N   . LEU B 1 48  ? -30.735 -8.708  -33.147 1.00 13.62 ? 50   LEU B N   1 
ATOM   2258 C  CA  . LEU B 1 48  ? -31.647 -7.741  -33.732 1.00 14.19 ? 50   LEU B CA  1 
ATOM   2259 C  C   . LEU B 1 48  ? -32.898 -8.467  -34.257 1.00 14.36 ? 50   LEU B C   1 
ATOM   2260 O  O   . LEU B 1 48  ? -32.810 -9.150  -35.265 1.00 14.32 ? 50   LEU B O   1 
ATOM   2261 C  CB  . LEU B 1 48  ? -30.970 -6.998  -34.895 1.00 13.90 ? 50   LEU B CB  1 
ATOM   2262 C  CG  . LEU B 1 48  ? -29.967 -5.875  -34.567 1.00 14.08 ? 50   LEU B CG  1 
ATOM   2263 C  CD1 . LEU B 1 48  ? -28.682 -6.394  -33.902 1.00 13.69 ? 50   LEU B CD1 1 
ATOM   2264 C  CD2 . LEU B 1 48  ? -29.612 -5.142  -35.845 1.00 14.20 ? 50   LEU B CD2 1 
ATOM   2265 N  N   . LEU B 1 49  ? -34.036 -8.303  -33.575 1.00 14.66 ? 51   LEU B N   1 
ATOM   2266 C  CA  . LEU B 1 49  ? -35.307 -8.913  -33.984 1.00 16.02 ? 51   LEU B CA  1 
ATOM   2267 C  C   . LEU B 1 49  ? -36.326 -7.861  -34.327 1.00 16.57 ? 51   LEU B C   1 
ATOM   2268 O  O   . LEU B 1 49  ? -36.296 -6.764  -33.774 1.00 17.41 ? 51   LEU B O   1 
ATOM   2269 C  CB  . LEU B 1 49  ? -35.865 -9.825  -32.880 1.00 16.14 ? 51   LEU B CB  1 
ATOM   2270 C  CG  . LEU B 1 49  ? -34.884 -10.870 -32.330 1.00 16.02 ? 51   LEU B CG  1 
ATOM   2271 C  CD1 . LEU B 1 49  ? -35.555 -11.753 -31.298 1.00 16.34 ? 51   LEU B CD1 1 
ATOM   2272 C  CD2 . LEU B 1 49  ? -34.304 -11.696 -33.456 1.00 16.10 ? 51   LEU B CD2 1 
ATOM   2273 N  N   . GLY B 1 50  ? -37.245 -8.217  -35.227 1.00 16.66 ? 52   GLY B N   1 
ATOM   2274 C  CA  . GLY B 1 50  ? -38.281 -7.311  -35.710 1.00 15.78 ? 52   GLY B CA  1 
ATOM   2275 C  C   . GLY B 1 50  ? -37.818 -6.342  -36.787 1.00 15.61 ? 52   GLY B C   1 
ATOM   2276 O  O   . GLY B 1 50  ? -38.571 -5.443  -37.140 1.00 15.68 ? 52   GLY B O   1 
ATOM   2277 N  N   . PHE B 1 51  ? -36.607 -6.521  -37.331 1.00 15.43 ? 53   PHE B N   1 
ATOM   2278 C  CA  . PHE B 1 51  ? -36.036 -5.560  -38.295 1.00 15.52 ? 53   PHE B CA  1 
ATOM   2279 C  C   . PHE B 1 51  ? -36.508 -5.758  -39.738 1.00 16.18 ? 53   PHE B C   1 
ATOM   2280 O  O   . PHE B 1 51  ? -36.346 -4.856  -40.589 1.00 15.40 ? 53   PHE B O   1 
ATOM   2281 C  CB  . PHE B 1 51  ? -34.492 -5.582  -38.256 1.00 15.68 ? 53   PHE B CB  1 
ATOM   2282 C  CG  . PHE B 1 51  ? -33.907 -4.813  -37.099 1.00 16.34 ? 53   PHE B CG  1 
ATOM   2283 C  CD1 . PHE B 1 51  ? -34.171 -5.197  -35.787 1.00 16.28 ? 53   PHE B CD1 1 
ATOM   2284 C  CD2 . PHE B 1 51  ? -33.103 -3.700  -37.320 1.00 16.45 ? 53   PHE B CD2 1 
ATOM   2285 C  CE1 . PHE B 1 51  ? -33.647 -4.485  -34.718 1.00 16.40 ? 53   PHE B CE1 1 
ATOM   2286 C  CE2 . PHE B 1 51  ? -32.571 -2.982  -36.245 1.00 16.20 ? 53   PHE B CE2 1 
ATOM   2287 C  CZ  . PHE B 1 51  ? -32.847 -3.376  -34.953 1.00 16.10 ? 53   PHE B CZ  1 
ATOM   2288 N  N   . GLN B 1 52  ? -37.089 -6.913  -40.019 1.00 17.36 ? 54   GLN B N   1 
ATOM   2289 C  CA  . GLN B 1 52  ? -37.501 -7.254  -41.392 1.00 19.87 ? 54   GLN B CA  1 
ATOM   2290 C  C   . GLN B 1 52  ? -38.909 -6.716  -41.631 1.00 20.06 ? 54   GLN B C   1 
ATOM   2291 O  O   . GLN B 1 52  ? -39.887 -7.441  -41.504 1.00 21.38 ? 54   GLN B O   1 
ATOM   2292 C  CB  . GLN B 1 52  ? -37.463 -8.771  -41.597 1.00 21.26 ? 54   GLN B CB  1 
ATOM   2293 C  CG  . GLN B 1 52  ? -36.133 -9.421  -41.241 1.00 23.41 ? 54   GLN B CG  1 
ATOM   2294 C  CD  . GLN B 1 52  ? -36.212 -10.939 -41.303 1.00 24.76 ? 54   GLN B CD  1 
ATOM   2295 O  OE1 . GLN B 1 52  ? -35.890 -11.530 -42.318 1.00 24.93 ? 54   GLN B OE1 1 
ATOM   2296 N  NE2 . GLN B 1 52  ? -36.675 -11.566 -40.224 1.00 26.10 ? 54   GLN B NE2 1 
ATOM   2297 N  N   . LEU B 1 53  ? -39.001 -5.438  -41.958 1.00 19.81 ? 55   LEU B N   1 
ATOM   2298 C  CA  . LEU B 1 53  ? -40.287 -4.748  -42.022 1.00 20.80 ? 55   LEU B CA  1 
ATOM   2299 C  C   . LEU B 1 53  ? -41.032 -5.100  -43.306 1.00 22.25 ? 55   LEU B C   1 
ATOM   2300 O  O   . LEU B 1 53  ? -40.417 -5.183  -44.368 1.00 21.82 ? 55   LEU B O   1 
ATOM   2301 C  CB  . LEU B 1 53  ? -40.099 -3.229  -41.946 1.00 20.87 ? 55   LEU B CB  1 
ATOM   2302 C  CG  . LEU B 1 53  ? -39.453 -2.701  -40.649 1.00 20.23 ? 55   LEU B CG  1 
ATOM   2303 C  CD1 . LEU B 1 53  ? -39.311 -1.185  -40.705 1.00 19.69 ? 55   LEU B CD1 1 
ATOM   2304 C  CD2 . LEU B 1 53  ? -40.262 -3.153  -39.447 1.00 19.77 ? 55   LEU B CD2 1 
ATOM   2305 N  N   . PRO B 1 54  ? -42.357 -5.285  -43.213 1.00 24.44 ? 56   PRO B N   1 
ATOM   2306 C  CA  . PRO B 1 54  ? -43.137 -5.472  -44.456 1.00 24.70 ? 56   PRO B CA  1 
ATOM   2307 C  C   . PRO B 1 54  ? -43.278 -4.165  -45.261 1.00 24.95 ? 56   PRO B C   1 
ATOM   2308 O  O   . PRO B 1 54  ? -42.983 -3.084  -44.723 1.00 22.13 ? 56   PRO B O   1 
ATOM   2309 C  CB  . PRO B 1 54  ? -44.496 -5.957  -43.946 1.00 25.13 ? 56   PRO B CB  1 
ATOM   2310 C  CG  . PRO B 1 54  ? -44.610 -5.437  -42.547 1.00 25.55 ? 56   PRO B CG  1 
ATOM   2311 C  CD  . PRO B 1 54  ? -43.222 -5.166  -42.019 1.00 25.01 ? 56   PRO B CD  1 
ATOM   2312 N  N   . PRO B 1 55  ? -43.727 -4.258  -46.538 1.00 25.86 ? 57   PRO B N   1 
ATOM   2313 C  CA  . PRO B 1 55  ? -43.877 -3.062  -47.384 1.00 26.30 ? 57   PRO B CA  1 
ATOM   2314 C  C   . PRO B 1 55  ? -44.807 -1.976  -46.842 1.00 25.16 ? 57   PRO B C   1 
ATOM   2315 O  O   . PRO B 1 55  ? -44.597 -0.804  -47.144 1.00 25.51 ? 57   PRO B O   1 
ATOM   2316 C  CB  . PRO B 1 55  ? -44.406 -3.630  -48.714 1.00 27.38 ? 57   PRO B CB  1 
ATOM   2317 C  CG  . PRO B 1 55  ? -43.841 -5.011  -48.766 1.00 27.90 ? 57   PRO B CG  1 
ATOM   2318 C  CD  . PRO B 1 55  ? -43.899 -5.498  -47.333 1.00 27.44 ? 57   PRO B CD  1 
ATOM   2319 N  N   . LEU B 1 56  ? -45.798 -2.346  -46.043 1.00 25.81 ? 58   LEU B N   1 
ATOM   2320 C  CA  . LEU B 1 56  ? -46.682 -1.387  -45.394 1.00 27.11 ? 58   LEU B CA  1 
ATOM   2321 C  C   . LEU B 1 56  ? -46.745 -1.716  -43.916 1.00 27.77 ? 58   LEU B C   1 
ATOM   2322 O  O   . LEU B 1 56  ? -46.738 -2.886  -43.585 1.00 29.89 ? 58   LEU B O   1 
ATOM   2323 C  CB  . LEU B 1 56  ? -48.086 -1.468  -46.007 1.00 28.62 ? 58   LEU B CB  1 
ATOM   2324 C  CG  . LEU B 1 56  ? -48.214 -1.035  -47.467 1.00 29.16 ? 58   LEU B CG  1 
ATOM   2325 C  CD1 . LEU B 1 56  ? -49.586 -1.442  -47.987 1.00 31.54 ? 58   LEU B CD1 1 
ATOM   2326 C  CD2 . LEU B 1 56  ? -48.025 0.475   -47.617 1.00 29.81 ? 58   LEU B CD2 1 
ATOM   2327 N  N   . PRO B 1 57  ? -46.839 -0.731  -43.016 1.00 27.59 ? 59   PRO B N   1 
ATOM   2328 C  CA  . PRO B 1 57  ? -46.964 0.690   -43.343 1.00 27.63 ? 59   PRO B CA  1 
ATOM   2329 C  C   . PRO B 1 57  ? -45.675 1.300   -43.879 1.00 28.67 ? 59   PRO B C   1 
ATOM   2330 O  O   . PRO B 1 57  ? -44.604 0.718   -43.758 1.00 27.45 ? 59   PRO B O   1 
ATOM   2331 C  CB  . PRO B 1 57  ? -47.328 1.324   -42.005 1.00 26.87 ? 59   PRO B CB  1 
ATOM   2332 C  CG  . PRO B 1 57  ? -46.817 0.377   -40.985 1.00 26.90 ? 59   PRO B CG  1 
ATOM   2333 C  CD  . PRO B 1 57  ? -47.033 -0.974  -41.583 1.00 27.23 ? 59   PRO B CD  1 
ATOM   2334 N  N   . GLU B 1 58  ? -45.817 2.456   -44.503 1.00 28.24 ? 60   GLU B N   1 
ATOM   2335 C  CA  . GLU B 1 58  ? -44.700 3.204   -45.015 1.00 28.43 ? 60   GLU B CA  1 
ATOM   2336 C  C   . GLU B 1 58  ? -43.955 3.878   -43.864 1.00 25.89 ? 60   GLU B C   1 
ATOM   2337 O  O   . GLU B 1 58  ? -44.479 3.988   -42.763 1.00 25.70 ? 60   GLU B O   1 
ATOM   2338 C  CB  . GLU B 1 58  ? -45.182 4.252   -46.018 1.00 30.53 ? 60   GLU B CB  1 
ATOM   2339 C  CG  . GLU B 1 58  ? -45.785 3.669   -47.284 1.00 33.19 ? 60   GLU B CG  1 
ATOM   2340 C  CD  . GLU B 1 58  ? -46.122 4.753   -48.295 1.00 35.69 ? 60   GLU B CD  1 
ATOM   2341 O  OE1 . GLU B 1 58  ? -46.810 5.744   -47.934 1.00 37.11 ? 60   GLU B OE1 1 
ATOM   2342 O  OE2 . GLU B 1 58  ? -45.684 4.615   -49.443 1.00 39.46 ? 60   GLU B OE2 1 
ATOM   2343 N  N   . LEU B 1 59  ? -42.733 4.319   -44.148 1.00 24.98 ? 61   LEU B N   1 
ATOM   2344 C  CA  . LEU B 1 59  ? -41.849 4.926   -43.155 1.00 24.99 ? 61   LEU B CA  1 
ATOM   2345 C  C   . LEU B 1 59  ? -41.489 6.355   -43.580 1.00 23.12 ? 61   LEU B C   1 
ATOM   2346 O  O   . LEU B 1 59  ? -41.252 6.613   -44.758 1.00 20.53 ? 61   LEU B O   1 
ATOM   2347 C  CB  . LEU B 1 59  ? -40.560 4.105   -43.026 1.00 25.78 ? 61   LEU B CB  1 
ATOM   2348 C  CG  . LEU B 1 59  ? -40.524 2.666   -42.501 1.00 27.60 ? 61   LEU B CG  1 
ATOM   2349 C  CD1 . LEU B 1 59  ? -40.931 2.654   -41.064 1.00 30.86 ? 61   LEU B CD1 1 
ATOM   2350 C  CD2 . LEU B 1 59  ? -41.435 1.704   -43.226 1.00 28.67 ? 61   LEU B CD2 1 
ATOM   2351 N  N   . ARG B 1 60  ? -41.439 7.261   -42.609 1.00 22.39 ? 62   ARG B N   1 
ATOM   2352 C  CA  . ARG B 1 60  ? -41.064 8.648   -42.846 1.00 23.93 ? 62   ARG B CA  1 
ATOM   2353 C  C   . ARG B 1 60  ? -39.558 8.777   -43.101 1.00 23.30 ? 62   ARG B C   1 
ATOM   2354 O  O   . ARG B 1 60  ? -38.743 8.327   -42.282 1.00 21.16 ? 62   ARG B O   1 
ATOM   2355 C  CB  . ARG B 1 60  ? -41.460 9.506   -41.648 1.00 26.02 ? 62   ARG B CB  1 
ATOM   2356 C  CG  . ARG B 1 60  ? -41.170 10.990  -41.788 1.00 28.81 ? 62   ARG B CG  1 
ATOM   2357 C  CD  . ARG B 1 60  ? -41.379 11.675  -40.454 1.00 32.68 ? 62   ARG B CD  1 
ATOM   2358 N  NE  . ARG B 1 60  ? -41.504 13.130  -40.576 1.00 38.08 ? 62   ARG B NE  1 
ATOM   2359 C  CZ  . ARG B 1 60  ? -41.543 13.979  -39.539 1.00 41.12 ? 62   ARG B CZ  1 
ATOM   2360 N  NH1 . ARG B 1 60  ? -41.434 13.540  -38.282 1.00 41.00 ? 62   ARG B NH1 1 
ATOM   2361 N  NH2 . ARG B 1 60  ? -41.663 15.292  -39.759 1.00 41.28 ? 62   ARG B NH2 1 
ATOM   2362 N  N   . LEU B 1 61  ? -39.209 9.380   -44.238 1.00 22.86 ? 63   LEU B N   1 
ATOM   2363 C  CA  . LEU B 1 61  ? -37.826 9.704   -44.591 1.00 22.85 ? 63   LEU B CA  1 
ATOM   2364 C  C   . LEU B 1 61  ? -37.702 11.216  -44.737 1.00 25.05 ? 63   LEU B C   1 
ATOM   2365 O  O   . LEU B 1 61  ? -38.411 11.804  -45.568 1.00 24.14 ? 63   LEU B O   1 
ATOM   2366 C  CB  . LEU B 1 61  ? -37.458 9.024   -45.905 1.00 22.82 ? 63   LEU B CB  1 
ATOM   2367 C  CG  . LEU B 1 61  ? -35.995 9.125   -46.315 1.00 21.95 ? 63   LEU B CG  1 
ATOM   2368 C  CD1 . LEU B 1 61  ? -35.122 8.281   -45.386 1.00 21.84 ? 63   LEU B CD1 1 
ATOM   2369 C  CD2 . LEU B 1 61  ? -35.824 8.668   -47.751 1.00 21.71 ? 63   LEU B CD2 1 
ATOM   2370 N  N   . ARG B 1 62  ? -36.800 11.839  -43.973 1.00 24.94 ? 64   ARG B N   1 
ATOM   2371 C  CA  . ARG B 1 62  ? -36.746 13.296  -43.860 1.00 26.72 ? 64   ARG B CA  1 
ATOM   2372 C  C   . ARG B 1 62  ? -35.327 13.866  -44.059 1.00 26.20 ? 64   ARG B C   1 
ATOM   2373 O  O   . ARG B 1 62  ? -34.368 13.363  -43.488 1.00 23.91 ? 64   ARG B O   1 
ATOM   2374 C  CB  . ARG B 1 62  ? -37.276 13.690  -42.494 1.00 30.47 ? 64   ARG B CB  1 
ATOM   2375 C  CG  . ARG B 1 62  ? -37.326 15.182  -42.209 1.00 36.79 ? 64   ARG B CG  1 
ATOM   2376 C  CD  . ARG B 1 62  ? -38.035 15.483  -40.880 1.00 42.08 ? 64   ARG B CD  1 
ATOM   2377 N  NE  . ARG B 1 62  ? -38.781 16.743  -40.957 1.00 50.37 ? 64   ARG B NE  1 
ATOM   2378 C  CZ  . ARG B 1 62  ? -38.265 17.973  -40.825 1.00 56.89 ? 64   ARG B CZ  1 
ATOM   2379 N  NH1 . ARG B 1 62  ? -36.969 18.168  -40.588 1.00 59.17 ? 64   ARG B NH1 1 
ATOM   2380 N  NH2 . ARG B 1 62  ? -39.063 19.036  -40.937 1.00 58.94 ? 64   ARG B NH2 1 
ATOM   2381 N  N   . ASN B 1 63  ? -35.213 14.912  -44.877 1.00 24.35 ? 65   ASN B N   1 
ATOM   2382 C  CA  . ASN B 1 63  ? -34.024 15.767  -44.927 1.00 23.45 ? 65   ASN B CA  1 
ATOM   2383 C  C   . ASN B 1 63  ? -34.194 16.780  -43.829 1.00 23.76 ? 65   ASN B C   1 
ATOM   2384 O  O   . ASN B 1 63  ? -35.010 17.689  -43.952 1.00 25.91 ? 65   ASN B O   1 
ATOM   2385 C  CB  . ASN B 1 63  ? -33.898 16.462  -46.287 1.00 23.87 ? 65   ASN B CB  1 
ATOM   2386 C  CG  . ASN B 1 63  ? -32.714 17.423  -46.372 1.00 24.72 ? 65   ASN B CG  1 
ATOM   2387 O  OD1 . ASN B 1 63  ? -32.148 17.829  -45.364 1.00 25.95 ? 65   ASN B OD1 1 
ATOM   2388 N  ND2 . ASN B 1 63  ? -32.353 17.809  -47.595 1.00 23.89 ? 65   ASN B ND2 1 
ATOM   2389 N  N   . ASN B 1 64  ? -33.439 16.624  -42.748 1.00 22.43 ? 66   ASN B N   1 
ATOM   2390 C  CA  . ASN B 1 64  ? -33.530 17.556  -41.625 1.00 22.70 ? 66   ASN B CA  1 
ATOM   2391 C  C   . ASN B 1 64  ? -32.466 18.643  -41.693 1.00 22.86 ? 66   ASN B C   1 
ATOM   2392 O  O   . ASN B 1 64  ? -32.324 19.433  -40.756 1.00 23.82 ? 66   ASN B O   1 
ATOM   2393 C  CB  . ASN B 1 64  ? -33.502 16.823  -40.266 1.00 22.05 ? 66   ASN B CB  1 
ATOM   2394 C  CG  . ASN B 1 64  ? -32.225 16.018  -40.046 1.00 21.96 ? 66   ASN B CG  1 
ATOM   2395 O  OD1 . ASN B 1 64  ? -31.140 16.413  -40.462 1.00 20.35 ? 66   ASN B OD1 1 
ATOM   2396 N  ND2 . ASN B 1 64  ? -32.361 14.868  -39.382 1.00 22.74 ? 66   ASN B ND2 1 
ATOM   2397 N  N   . GLY B 1 65  ? -31.694 18.671  -42.771 1.00 22.87 ? 67   GLY B N   1 
ATOM   2398 C  CA  . GLY B 1 65  ? -30.653 19.670  -42.922 1.00 24.91 ? 67   GLY B CA  1 
ATOM   2399 C  C   . GLY B 1 65  ? -29.275 19.275  -42.431 1.00 24.81 ? 67   GLY B C   1 
ATOM   2400 O  O   . GLY B 1 65  ? -28.306 19.866  -42.867 1.00 24.35 ? 67   GLY B O   1 
ATOM   2401 N  N   . HIS B 1 66  ? -29.203 18.281  -41.543 1.00 24.78 ? 68   HIS B N   1 
ATOM   2402 C  CA  . HIS B 1 66  ? -27.955 17.718  -41.041 1.00 26.24 ? 68   HIS B CA  1 
ATOM   2403 C  C   . HIS B 1 66  ? -27.691 16.270  -41.488 1.00 24.37 ? 68   HIS B C   1 
ATOM   2404 O  O   . HIS B 1 66  ? -26.570 15.796  -41.376 1.00 22.85 ? 68   HIS B O   1 
ATOM   2405 C  CB  . HIS B 1 66  ? -28.002 17.742  -39.521 1.00 29.09 ? 68   HIS B CB  1 
ATOM   2406 C  CG  . HIS B 1 66  ? -28.169 19.113  -38.965 1.00 34.37 ? 68   HIS B CG  1 
ATOM   2407 N  ND1 . HIS B 1 66  ? -29.258 19.481  -38.208 1.00 37.87 ? 68   HIS B ND1 1 
ATOM   2408 C  CD2 . HIS B 1 66  ? -27.405 20.226  -39.097 1.00 37.39 ? 68   HIS B CD2 1 
ATOM   2409 C  CE1 . HIS B 1 66  ? -29.141 20.753  -37.862 1.00 40.43 ? 68   HIS B CE1 1 
ATOM   2410 N  NE2 . HIS B 1 66  ? -28.028 21.230  -38.391 1.00 39.60 ? 68   HIS B NE2 1 
ATOM   2411 N  N   . SER B 1 67  ? -28.737 15.564  -41.915 1.00 22.31 ? 69   SER B N   1 
ATOM   2412 C  CA  . SER B 1 67  ? -28.638 14.208  -42.435 1.00 20.21 ? 69   SER B CA  1 
ATOM   2413 C  C   . SER B 1 67  ? -29.941 13.883  -43.157 1.00 20.89 ? 69   SER B C   1 
ATOM   2414 O  O   . SER B 1 67  ? -30.854 14.731  -43.228 1.00 21.46 ? 69   SER B O   1 
ATOM   2415 C  CB  . SER B 1 67  ? -28.427 13.199  -41.284 1.00 18.69 ? 69   SER B CB  1 
ATOM   2416 O  OG  . SER B 1 67  ? -28.172 11.909  -41.787 1.00 16.66 ? 69   SER B OG  1 
ATOM   2417 N  N   . VAL B 1 68  ? -30.020 12.667  -43.696 1.00 19.69 ? 70   VAL B N   1 
ATOM   2418 C  CA  . VAL B 1 68  ? -31.308 12.058  -44.046 1.00 19.51 ? 70   VAL B CA  1 
ATOM   2419 C  C   . VAL B 1 68  ? -31.640 11.051  -42.954 1.00 19.01 ? 70   VAL B C   1 
ATOM   2420 O  O   . VAL B 1 68  ? -30.786 10.252  -42.581 1.00 18.83 ? 70   VAL B O   1 
ATOM   2421 C  CB  . VAL B 1 68  ? -31.337 11.448  -45.465 1.00 19.23 ? 70   VAL B CB  1 
ATOM   2422 C  CG1 . VAL B 1 68  ? -30.146 10.548  -45.763 1.00 19.37 ? 70   VAL B CG1 1 
ATOM   2423 C  CG2 . VAL B 1 68  ? -32.647 10.729  -45.697 1.00 20.37 ? 70   VAL B CG2 1 
ATOM   2424 N  N   . GLN B 1 69  ? -32.851 11.135  -42.411 1.00 18.48 ? 71   GLN B N   1 
ATOM   2425 C  CA  . GLN B 1 69  ? -33.257 10.316  -41.257 1.00 18.71 ? 71   GLN B CA  1 
ATOM   2426 C  C   . GLN B 1 69  ? -34.544 9.558   -41.562 1.00 18.65 ? 71   GLN B C   1 
ATOM   2427 O  O   . GLN B 1 69  ? -35.554 10.155  -41.994 1.00 19.09 ? 71   GLN B O   1 
ATOM   2428 C  CB  . GLN B 1 69  ? -33.421 11.162  -40.001 1.00 18.74 ? 71   GLN B CB  1 
ATOM   2429 C  CG  . GLN B 1 69  ? -33.781 10.367  -38.744 1.00 19.29 ? 71   GLN B CG  1 
ATOM   2430 C  CD  . GLN B 1 69  ? -33.730 11.189  -37.492 1.00 20.09 ? 71   GLN B CD  1 
ATOM   2431 O  OE1 . GLN B 1 69  ? -34.621 11.117  -36.638 1.00 21.59 ? 71   GLN B OE1 1 
ATOM   2432 N  NE2 . GLN B 1 69  ? -32.684 11.965  -37.357 1.00 19.99 ? 71   GLN B NE2 1 
ATOM   2433 N  N   . LEU B 1 70  ? -34.473 8.249   -41.341 1.00 18.65 ? 72   LEU B N   1 
ATOM   2434 C  CA  . LEU B 1 70  ? -35.593 7.332   -41.448 1.00 18.27 ? 72   LEU B CA  1 
ATOM   2435 C  C   . LEU B 1 70  ? -36.162 7.042   -40.078 1.00 19.05 ? 72   LEU B C   1 
ATOM   2436 O  O   . LEU B 1 70  ? -35.436 6.550   -39.186 1.00 18.58 ? 72   LEU B O   1 
ATOM   2437 C  CB  . LEU B 1 70  ? -35.111 6.030   -42.068 1.00 18.21 ? 72   LEU B CB  1 
ATOM   2438 C  CG  . LEU B 1 70  ? -36.171 4.973   -42.373 1.00 18.80 ? 72   LEU B CG  1 
ATOM   2439 C  CD1 . LEU B 1 70  ? -37.039 5.411   -43.539 1.00 18.53 ? 72   LEU B CD1 1 
ATOM   2440 C  CD2 . LEU B 1 70  ? -35.544 3.624   -42.660 1.00 18.56 ? 72   LEU B CD2 1 
ATOM   2441 N  N   . THR B 1 71  ? -37.453 7.317   -39.898 1.00 17.85 ? 73   THR B N   1 
ATOM   2442 C  CA  . THR B 1 71  ? -38.133 7.002   -38.638 1.00 18.25 ? 73   THR B CA  1 
ATOM   2443 C  C   . THR B 1 71  ? -38.478 5.520   -38.628 1.00 17.70 ? 73   THR B C   1 
ATOM   2444 O  O   . THR B 1 71  ? -39.017 5.002   -39.598 1.00 16.96 ? 73   THR B O   1 
ATOM   2445 C  CB  . THR B 1 71  ? -39.413 7.851   -38.441 1.00 18.92 ? 73   THR B CB  1 
ATOM   2446 O  OG1 . THR B 1 71  ? -39.052 9.234   -38.473 1.00 19.90 ? 73   THR B OG1 1 
ATOM   2447 C  CG2 . THR B 1 71  ? -40.096 7.539   -37.098 1.00 19.27 ? 73   THR B CG2 1 
ATOM   2448 N  N   . LEU B 1 72  ? -38.159 4.840   -37.538 1.00 16.88 ? 74   LEU B N   1 
ATOM   2449 C  CA  . LEU B 1 72  ? -38.453 3.423   -37.435 1.00 17.62 ? 74   LEU B CA  1 
ATOM   2450 C  C   . LEU B 1 72  ? -39.657 3.211   -36.560 1.00 16.88 ? 74   LEU B C   1 
ATOM   2451 O  O   . LEU B 1 72  ? -39.856 3.956   -35.616 1.00 16.69 ? 74   LEU B O   1 
ATOM   2452 C  CB  . LEU B 1 72  ? -37.254 2.653   -36.890 1.00 17.35 ? 74   LEU B CB  1 
ATOM   2453 C  CG  . LEU B 1 72  ? -36.010 2.750   -37.762 1.00 17.81 ? 74   LEU B CG  1 
ATOM   2454 C  CD1 . LEU B 1 72  ? -34.793 2.245   -36.994 1.00 18.21 ? 74   LEU B CD1 1 
ATOM   2455 C  CD2 . LEU B 1 72  ? -36.205 2.016   -39.087 1.00 17.68 ? 74   LEU B CD2 1 
ATOM   2456 N  N   . PRO B 1 73  ? -40.472 2.192   -36.882 1.00 18.05 ? 75   PRO B N   1 
ATOM   2457 C  CA  . PRO B 1 73  ? -41.656 1.884   -36.102 1.00 18.77 ? 75   PRO B CA  1 
ATOM   2458 C  C   . PRO B 1 73  ? -41.318 1.136   -34.821 1.00 19.64 ? 75   PRO B C   1 
ATOM   2459 O  O   . PRO B 1 73  ? -40.179 0.705   -34.645 1.00 19.98 ? 75   PRO B O   1 
ATOM   2460 C  CB  . PRO B 1 73  ? -42.454 0.980   -37.041 1.00 18.79 ? 75   PRO B CB  1 
ATOM   2461 C  CG  . PRO B 1 73  ? -41.394 0.205   -37.745 1.00 19.33 ? 75   PRO B CG  1 
ATOM   2462 C  CD  . PRO B 1 73  ? -40.246 1.177   -37.925 1.00 18.74 ? 75   PRO B CD  1 
ATOM   2463 N  N   . PRO B 1 74  ? -42.315 0.954   -33.936 1.00 20.36 ? 76   PRO B N   1 
ATOM   2464 C  CA  . PRO B 1 74  ? -42.129 0.083   -32.777 1.00 20.10 ? 76   PRO B CA  1 
ATOM   2465 C  C   . PRO B 1 74  ? -41.859 -1.358  -33.174 1.00 19.39 ? 76   PRO B C   1 
ATOM   2466 O  O   . PRO B 1 74  ? -42.226 -1.764  -34.276 1.00 19.64 ? 76   PRO B O   1 
ATOM   2467 C  CB  . PRO B 1 74  ? -43.466 0.179   -32.038 1.00 20.35 ? 76   PRO B CB  1 
ATOM   2468 C  CG  . PRO B 1 74  ? -44.095 1.429   -32.535 1.00 20.20 ? 76   PRO B CG  1 
ATOM   2469 C  CD  . PRO B 1 74  ? -43.667 1.547   -33.957 1.00 20.30 ? 76   PRO B CD  1 
ATOM   2470 N  N   . GLY B 1 75  ? -41.214 -2.107  -32.281 1.00 18.22 ? 77   GLY B N   1 
ATOM   2471 C  CA  . GLY B 1 75  ? -40.977 -3.530  -32.471 1.00 17.87 ? 77   GLY B CA  1 
ATOM   2472 C  C   . GLY B 1 75  ? -39.592 -3.962  -32.948 1.00 16.82 ? 77   GLY B C   1 
ATOM   2473 O  O   . GLY B 1 75  ? -39.352 -5.174  -33.095 1.00 17.48 ? 77   GLY B O   1 
ATOM   2474 N  N   . LEU B 1 76  ? -38.686 -3.017  -33.198 1.00 15.68 ? 78   LEU B N   1 
ATOM   2475 C  CA  . LEU B 1 76  ? -37.302 -3.368  -33.575 1.00 15.68 ? 78   LEU B CA  1 
ATOM   2476 C  C   . LEU B 1 76  ? -36.513 -3.497  -32.272 1.00 15.65 ? 78   LEU B C   1 
ATOM   2477 O  O   . LEU B 1 76  ? -36.103 -2.472  -31.683 1.00 14.93 ? 78   LEU B O   1 
ATOM   2478 C  CB  . LEU B 1 76  ? -36.661 -2.347  -34.535 1.00 16.03 ? 78   LEU B CB  1 
ATOM   2479 C  CG  . LEU B 1 76  ? -37.101 -2.479  -36.008 1.00 17.19 ? 78   LEU B CG  1 
ATOM   2480 C  CD1 . LEU B 1 76  ? -38.553 -2.078  -36.194 1.00 18.33 ? 78   LEU B CD1 1 
ATOM   2481 C  CD2 . LEU B 1 76  ? -36.246 -1.662  -36.960 1.00 17.82 ? 78   LEU B CD2 1 
ATOM   2482 N  N   . GLU B 1 77  ? -36.334 -4.743  -31.817 1.00 14.56 ? 79   GLU B N   1 
ATOM   2483 C  CA  . GLU B 1 77  ? -35.716 -5.020  -30.531 1.00 14.95 ? 79   GLU B CA  1 
ATOM   2484 C  C   . GLU B 1 77  ? -34.251 -5.413  -30.754 1.00 14.32 ? 79   GLU B C   1 
ATOM   2485 O  O   . GLU B 1 77  ? -33.916 -6.162  -31.664 1.00 13.19 ? 79   GLU B O   1 
ATOM   2486 C  CB  . GLU B 1 77  ? -36.498 -6.093  -29.777 1.00 15.97 ? 79   GLU B CB  1 
ATOM   2487 C  CG  . GLU B 1 77  ? -37.959 -5.689  -29.591 1.00 17.89 ? 79   GLU B CG  1 
ATOM   2488 C  CD  . GLU B 1 77  ? -38.803 -6.736  -28.905 1.00 20.67 ? 79   GLU B CD  1 
ATOM   2489 O  OE1 . GLU B 1 77  ? -38.292 -7.809  -28.571 1.00 25.16 ? 79   GLU B OE1 1 
ATOM   2490 O  OE2 . GLU B 1 77  ? -40.011 -6.502  -28.735 1.00 23.45 ? 79   GLU B OE2 1 
ATOM   2491 N  N   . MET B 1 78  ? -33.378 -4.877  -29.914 1.00 14.48 ? 80   MET B N   1 
ATOM   2492 C  CA  . MET B 1 78  ? -31.927 -5.123  -30.044 1.00 14.18 ? 80   MET B CA  1 
ATOM   2493 C  C   . MET B 1 78  ? -31.361 -5.410  -28.653 1.00 14.03 ? 80   MET B C   1 
ATOM   2494 O  O   . MET B 1 78  ? -31.791 -4.785  -27.700 1.00 13.90 ? 80   MET B O   1 
ATOM   2495 C  CB  . MET B 1 78  ? -31.268 -3.905  -30.683 1.00 13.89 ? 80   MET B CB  1 
ATOM   2496 C  CG  . MET B 1 78  ? -29.777 -4.041  -30.992 1.00 14.40 ? 80   MET B CG  1 
ATOM   2497 S  SD  . MET B 1 78  ? -28.753 -3.635  -29.563 1.00 15.12 ? 80   MET B SD  1 
ATOM   2498 C  CE  . MET B 1 78  ? -28.742 -1.840  -29.660 1.00 15.13 ? 80   MET B CE  1 
ATOM   2499 N  N   . ALA B 1 79  ? -30.433 -6.368  -28.539 1.00 13.67 ? 81   ALA B N   1 
ATOM   2500 C  CA  . ALA B 1 79  ? -29.777 -6.647  -27.254 1.00 13.49 ? 81   ALA B CA  1 
ATOM   2501 C  C   . ALA B 1 79  ? -28.276 -6.553  -27.407 1.00 13.76 ? 81   ALA B C   1 
ATOM   2502 O  O   . ALA B 1 79  ? -27.712 -7.100  -28.364 1.00 13.44 ? 81   ALA B O   1 
ATOM   2503 C  CB  . ALA B 1 79  ? -30.157 -8.008  -26.706 1.00 13.42 ? 81   ALA B CB  1 
ATOM   2504 N  N   . LEU B 1 80  ? -27.642 -5.824  -26.486 1.00 13.71 ? 82   LEU B N   1 
ATOM   2505 C  CA  . LEU B 1 80  ? -26.181 -5.788  -26.396 1.00 14.30 ? 82   LEU B CA  1 
ATOM   2506 C  C   . LEU B 1 80  ? -25.649 -6.916  -25.506 1.00 14.65 ? 82   LEU B C   1 
ATOM   2507 O  O   . LEU B 1 80  ? -24.479 -7.223  -25.521 1.00 14.55 ? 82   LEU B O   1 
ATOM   2508 C  CB  . LEU B 1 80  ? -25.717 -4.439  -25.849 1.00 14.62 ? 82   LEU B CB  1 
ATOM   2509 C  CG  . LEU B 1 80  ? -26.017 -3.202  -26.737 1.00 15.19 ? 82   LEU B CG  1 
ATOM   2510 C  CD1 . LEU B 1 80  ? -25.489 -1.964  -26.036 1.00 15.87 ? 82   LEU B CD1 1 
ATOM   2511 C  CD2 . LEU B 1 80  ? -25.419 -3.274  -28.125 1.00 15.50 ? 82   LEU B CD2 1 
ATOM   2512 N  N   . GLY B 1 81  ? -26.515 -7.495  -24.696 1.00 14.89 ? 83   GLY B N   1 
ATOM   2513 C  CA  . GLY B 1 81  ? -26.137 -8.598  -23.864 1.00 15.09 ? 83   GLY B CA  1 
ATOM   2514 C  C   . GLY B 1 81  ? -27.350 -9.106  -23.143 1.00 15.60 ? 83   GLY B C   1 
ATOM   2515 O  O   . GLY B 1 81  ? -28.450 -8.575  -23.334 1.00 15.12 ? 83   GLY B O   1 
ATOM   2516 N  N   . PRO B 1 82  ? -27.165 -10.146 -22.314 1.00 17.60 ? 84   PRO B N   1 
ATOM   2517 C  CA  . PRO B 1 82  ? -28.342 -10.799 -21.719 1.00 18.15 ? 84   PRO B CA  1 
ATOM   2518 C  C   . PRO B 1 82  ? -29.126 -9.807  -20.877 1.00 18.75 ? 84   PRO B C   1 
ATOM   2519 O  O   . PRO B 1 82  ? -28.555 -9.140  -20.023 1.00 19.76 ? 84   PRO B O   1 
ATOM   2520 C  CB  . PRO B 1 82  ? -27.741 -11.932 -20.869 1.00 18.29 ? 84   PRO B CB  1 
ATOM   2521 C  CG  . PRO B 1 82  ? -26.368 -12.126 -21.424 1.00 18.15 ? 84   PRO B CG  1 
ATOM   2522 C  CD  . PRO B 1 82  ? -25.905 -10.799 -21.915 1.00 17.34 ? 84   PRO B CD  1 
ATOM   2523 N  N   . GLY B 1 83  ? -30.403 -9.641  -21.190 1.00 19.49 ? 85   GLY B N   1 
ATOM   2524 C  CA  . GLY B 1 83  ? -31.233 -8.653  -20.503 1.00 20.54 ? 85   GLY B CA  1 
ATOM   2525 C  C   . GLY B 1 83  ? -30.963 -7.170  -20.775 1.00 21.21 ? 85   GLY B C   1 
ATOM   2526 O  O   . GLY B 1 83  ? -31.626 -6.321  -20.179 1.00 26.16 ? 85   GLY B O   1 
ATOM   2527 N  N   . ARG B 1 84  ? -30.036 -6.840  -21.671 1.00 17.81 ? 86   ARG B N   1 
ATOM   2528 C  CA  . ARG B 1 84  ? -29.650 -5.465  -21.906 1.00 17.11 ? 86   ARG B CA  1 
ATOM   2529 C  C   . ARG B 1 84  ? -30.225 -5.060  -23.257 1.00 15.69 ? 86   ARG B C   1 
ATOM   2530 O  O   . ARG B 1 84  ? -29.557 -5.137  -24.290 1.00 13.37 ? 86   ARG B O   1 
ATOM   2531 C  CB  . ARG B 1 84  ? -28.130 -5.316  -21.873 1.00 17.21 ? 86   ARG B CB  1 
ATOM   2532 C  CG  . ARG B 1 84  ? -27.549 -5.607  -20.492 1.00 18.61 ? 86   ARG B CG  1 
ATOM   2533 C  CD  . ARG B 1 84  ? -26.036 -5.630  -20.511 1.00 18.98 ? 86   ARG B CD  1 
ATOM   2534 N  NE  . ARG B 1 84  ? -25.568 -4.355  -21.063 1.00 20.67 ? 86   ARG B NE  1 
ATOM   2535 C  CZ  . ARG B 1 84  ? -24.535 -4.182  -21.894 1.00 20.47 ? 86   ARG B CZ  1 
ATOM   2536 N  NH1 . ARG B 1 84  ? -23.759 -5.186  -22.279 1.00 19.68 ? 86   ARG B NH1 1 
ATOM   2537 N  NH2 . ARG B 1 84  ? -24.276 -2.954  -22.336 1.00 21.32 ? 86   ARG B NH2 1 
ATOM   2538 N  N   . GLU B 1 85  ? -31.476 -4.625  -23.216 1.00 14.69 ? 87   GLU B N   1 
ATOM   2539 C  CA  . GLU B 1 85  ? -32.284 -4.505  -24.410 1.00 15.17 ? 87   GLU B CA  1 
ATOM   2540 C  C   . GLU B 1 85  ? -32.645 -3.073  -24.725 1.00 14.96 ? 87   GLU B C   1 
ATOM   2541 O  O   . GLU B 1 85  ? -32.662 -2.191  -23.853 1.00 14.03 ? 87   GLU B O   1 
ATOM   2542 C  CB  . GLU B 1 85  ? -33.551 -5.358  -24.280 1.00 15.64 ? 87   GLU B CB  1 
ATOM   2543 C  CG  . GLU B 1 85  ? -33.214 -6.831  -24.146 1.00 16.58 ? 87   GLU B CG  1 
ATOM   2544 C  CD  . GLU B 1 85  ? -34.427 -7.764  -24.098 1.00 16.90 ? 87   GLU B CD  1 
ATOM   2545 O  OE1 . GLU B 1 85  ? -35.544 -7.357  -24.485 1.00 16.46 ? 87   GLU B OE1 1 
ATOM   2546 O  OE2 . GLU B 1 85  ? -34.238 -8.920  -23.656 1.00 18.04 ? 87   GLU B OE2 1 
ATOM   2547 N  N   . TYR B 1 86  ? -32.914 -2.891  -26.011 1.00 14.77 ? 88   TYR B N   1 
ATOM   2548 C  CA  . TYR B 1 86  ? -33.052 -1.615  -26.672 1.00 14.97 ? 88   TYR B CA  1 
ATOM   2549 C  C   . TYR B 1 86  ? -34.169 -1.733  -27.740 1.00 14.95 ? 88   TYR B C   1 
ATOM   2550 O  O   . TYR B 1 86  ? -34.439 -2.823  -28.212 1.00 14.29 ? 88   TYR B O   1 
ATOM   2551 C  CB  . TYR B 1 86  ? -31.710 -1.219  -27.316 1.00 14.55 ? 88   TYR B CB  1 
ATOM   2552 C  CG  . TYR B 1 86  ? -30.679 -0.839  -26.274 1.00 13.81 ? 88   TYR B CG  1 
ATOM   2553 C  CD1 . TYR B 1 86  ? -29.891 -1.813  -25.648 1.00 13.79 ? 88   TYR B CD1 1 
ATOM   2554 C  CD2 . TYR B 1 86  ? -30.525 0.466   -25.893 1.00 13.79 ? 88   TYR B CD2 1 
ATOM   2555 C  CE1 . TYR B 1 86  ? -29.000 -1.477  -24.634 1.00 14.02 ? 88   TYR B CE1 1 
ATOM   2556 C  CE2 . TYR B 1 86  ? -29.621 0.831   -24.893 1.00 13.74 ? 88   TYR B CE2 1 
ATOM   2557 C  CZ  . TYR B 1 86  ? -28.866 -0.142  -24.266 1.00 14.01 ? 88   TYR B CZ  1 
ATOM   2558 O  OH  . TYR B 1 86  ? -28.008 0.224   -23.266 1.00 13.92 ? 88   TYR B OH  1 
ATOM   2559 N  N   . ARG B 1 87  ? -34.820 -0.622  -28.065 1.00 15.72 ? 89   ARG B N   1 
ATOM   2560 C  CA  . ARG B 1 87  ? -35.683 -0.538  -29.237 1.00 17.31 ? 89   ARG B CA  1 
ATOM   2561 C  C   . ARG B 1 87  ? -35.162 0.547   -30.190 1.00 15.02 ? 89   ARG B C   1 
ATOM   2562 O  O   . ARG B 1 87  ? -34.777 1.644   -29.755 1.00 14.21 ? 89   ARG B O   1 
ATOM   2563 C  CB  . ARG B 1 87  ? -37.155 -0.320  -28.828 1.00 21.61 ? 89   ARG B CB  1 
ATOM   2564 C  CG  . ARG B 1 87  ? -37.509 1.093   -28.412 1.00 28.22 ? 89   ARG B CG  1 
ATOM   2565 C  CD  . ARG B 1 87  ? -38.867 1.160   -27.714 1.00 35.60 ? 89   ARG B CD  1 
ATOM   2566 N  NE  . ARG B 1 87  ? -39.135 2.428   -27.018 1.00 40.25 ? 89   ARG B NE  1 
ATOM   2567 C  CZ  . ARG B 1 87  ? -39.533 3.574   -27.598 1.00 49.35 ? 89   ARG B CZ  1 
ATOM   2568 N  NH1 . ARG B 1 87  ? -39.691 3.677   -28.924 1.00 52.45 ? 89   ARG B NH1 1 
ATOM   2569 N  NH2 . ARG B 1 87  ? -39.773 4.649   -26.839 1.00 52.44 ? 89   ARG B NH2 1 
ATOM   2570 N  N   . ALA B 1 88  ? -35.127 0.229   -31.481 1.00 13.13 ? 90   ALA B N   1 
ATOM   2571 C  CA  . ALA B 1 88  ? -34.631 1.152   -32.496 1.00 13.15 ? 90   ALA B CA  1 
ATOM   2572 C  C   . ALA B 1 88  ? -35.592 2.308   -32.710 1.00 13.79 ? 90   ALA B C   1 
ATOM   2573 O  O   . ALA B 1 88  ? -36.789 2.100   -32.731 1.00 13.83 ? 90   ALA B O   1 
ATOM   2574 C  CB  . ALA B 1 88  ? -34.394 0.423   -33.804 1.00 12.53 ? 90   ALA B CB  1 
ATOM   2575 N  N   . LEU B 1 89  ? -35.072 3.522   -32.832 1.00 14.86 ? 91   LEU B N   1 
ATOM   2576 C  CA  . LEU B 1 89  ? -35.907 4.713   -33.016 1.00 15.54 ? 91   LEU B CA  1 
ATOM   2577 C  C   . LEU B 1 89  ? -35.856 5.274   -34.415 1.00 15.60 ? 91   LEU B C   1 
ATOM   2578 O  O   . LEU B 1 89  ? -36.891 5.686   -34.961 1.00 15.77 ? 91   LEU B O   1 
ATOM   2579 C  CB  . LEU B 1 89  ? -35.471 5.821   -32.080 1.00 16.68 ? 91   LEU B CB  1 
ATOM   2580 C  CG  . LEU B 1 89  ? -35.444 5.500   -30.592 1.00 17.90 ? 91   LEU B CG  1 
ATOM   2581 C  CD1 . LEU B 1 89  ? -34.871 6.704   -29.866 1.00 18.91 ? 91   LEU B CD1 1 
ATOM   2582 C  CD2 . LEU B 1 89  ? -36.815 5.118   -30.065 1.00 18.95 ? 91   LEU B CD2 1 
ATOM   2583 N  N   . GLN B 1 90  ? -34.644 5.336   -34.962 1.00 15.16 ? 92   GLN B N   1 
ATOM   2584 C  CA  . GLN B 1 90  ? -34.370 5.965   -36.249 1.00 14.95 ? 92   GLN B CA  1 
ATOM   2585 C  C   . GLN B 1 90  ? -32.998 5.549   -36.763 1.00 15.48 ? 92   GLN B C   1 
ATOM   2586 O  O   . GLN B 1 90  ? -32.130 5.093   -35.990 1.00 15.06 ? 92   GLN B O   1 
ATOM   2587 C  CB  . GLN B 1 90  ? -34.429 7.489   -36.117 1.00 15.31 ? 92   GLN B CB  1 
ATOM   2588 C  CG  . GLN B 1 90  ? -33.537 8.055   -35.017 1.00 15.34 ? 92   GLN B CG  1 
ATOM   2589 C  CD  . GLN B 1 90  ? -32.293 8.764   -35.502 1.00 15.72 ? 92   GLN B CD  1 
ATOM   2590 O  OE1 . GLN B 1 90  ? -31.770 8.522   -36.604 1.00 15.21 ? 92   GLN B OE1 1 
ATOM   2591 N  NE2 . GLN B 1 90  ? -31.804 9.675   -34.663 1.00 16.42 ? 92   GLN B NE2 1 
ATOM   2592 N  N   . LEU B 1 91  ? -32.793 5.695   -38.063 1.00 14.97 ? 93   LEU B N   1 
ATOM   2593 C  CA  . LEU B 1 91  ? -31.447 5.605   -38.609 1.00 15.22 ? 93   LEU B CA  1 
ATOM   2594 C  C   . LEU B 1 91  ? -31.166 6.803   -39.499 1.00 15.26 ? 93   LEU B C   1 
ATOM   2595 O  O   . LEU B 1 91  ? -32.082 7.446   -39.985 1.00 15.65 ? 93   LEU B O   1 
ATOM   2596 C  CB  . LEU B 1 91  ? -31.216 4.279   -39.346 1.00 15.16 ? 93   LEU B CB  1 
ATOM   2597 C  CG  . LEU B 1 91  ? -32.054 3.945   -40.588 1.00 15.27 ? 93   LEU B CG  1 
ATOM   2598 C  CD1 . LEU B 1 91  ? -31.472 4.561   -41.864 1.00 16.02 ? 93   LEU B CD1 1 
ATOM   2599 C  CD2 . LEU B 1 91  ? -32.177 2.432   -40.730 1.00 16.15 ? 93   LEU B CD2 1 
ATOM   2600 N  N   . HIS B 1 92  ? -29.882 7.101   -39.678 1.00 15.36 ? 94   HIS B N   1 
ATOM   2601 C  CA  . HIS B 1 92  ? -29.447 8.232   -40.506 1.00 15.55 ? 94   HIS B CA  1 
ATOM   2602 C  C   . HIS B 1 92  ? -28.012 7.992   -40.946 1.00 15.58 ? 94   HIS B C   1 
ATOM   2603 O  O   . HIS B 1 92  ? -27.381 7.025   -40.515 1.00 14.54 ? 94   HIS B O   1 
ATOM   2604 C  CB  . HIS B 1 92  ? -29.581 9.543   -39.741 1.00 15.94 ? 94   HIS B CB  1 
ATOM   2605 C  CG  . HIS B 1 92  ? -28.748 9.589   -38.499 1.00 15.64 ? 94   HIS B CG  1 
ATOM   2606 N  ND1 . HIS B 1 92  ? -29.242 9.210   -37.276 1.00 15.81 ? 94   HIS B ND1 1 
ATOM   2607 C  CD2 . HIS B 1 92  ? -27.457 9.925   -38.291 1.00 15.55 ? 94   HIS B CD2 1 
ATOM   2608 C  CE1 . HIS B 1 92  ? -28.295 9.294   -36.364 1.00 15.25 ? 94   HIS B CE1 1 
ATOM   2609 N  NE2 . HIS B 1 92  ? -27.203 9.726   -36.953 1.00 15.00 ? 94   HIS B NE2 1 
ATOM   2610 N  N   . LEU B 1 93  ? -27.508 8.862   -41.803 1.00 16.19 ? 95   LEU B N   1 
ATOM   2611 C  CA  . LEU B 1 93  ? -26.216 8.653   -42.441 1.00 17.04 ? 95   LEU B CA  1 
ATOM   2612 C  C   . LEU B 1 93  ? -25.302 9.875   -42.290 1.00 16.65 ? 95   LEU B C   1 
ATOM   2613 O  O   . LEU B 1 93  ? -25.765 10.994  -42.087 1.00 17.45 ? 95   LEU B O   1 
ATOM   2614 C  CB  . LEU B 1 93  ? -26.430 8.351   -43.942 1.00 18.48 ? 95   LEU B CB  1 
ATOM   2615 C  CG  . LEU B 1 93  ? -27.328 7.153   -44.246 1.00 20.53 ? 95   LEU B CG  1 
ATOM   2616 C  CD1 . LEU B 1 93  ? -27.845 7.181   -45.682 1.00 22.90 ? 95   LEU B CD1 1 
ATOM   2617 C  CD2 . LEU B 1 93  ? -26.569 5.891   -44.010 1.00 21.06 ? 95   LEU B CD2 1 
ATOM   2618 N  N   . HIS B 1 94  ? -24.001 9.637   -42.401 1.00 16.35 ? 96   HIS B N   1 
ATOM   2619 C  CA  . HIS B 1 94  ? -23.010 10.691  -42.474 1.00 15.89 ? 96   HIS B CA  1 
ATOM   2620 C  C   . HIS B 1 94  ? -22.179 10.405  -43.686 1.00 16.13 ? 96   HIS B C   1 
ATOM   2621 O  O   . HIS B 1 94  ? -21.831 9.252   -43.957 1.00 16.01 ? 96   HIS B O   1 
ATOM   2622 C  CB  . HIS B 1 94  ? -22.159 10.732  -41.203 1.00 15.98 ? 96   HIS B CB  1 
ATOM   2623 C  CG  . HIS B 1 94  ? -22.968 10.959  -39.969 1.00 16.02 ? 96   HIS B CG  1 
ATOM   2624 N  ND1 . HIS B 1 94  ? -23.208 12.215  -39.456 1.00 17.01 ? 96   HIS B ND1 1 
ATOM   2625 C  CD2 . HIS B 1 94  ? -23.633 10.095  -39.175 1.00 16.16 ? 96   HIS B CD2 1 
ATOM   2626 C  CE1 . HIS B 1 94  ? -23.979 12.114  -38.389 1.00 16.80 ? 96   HIS B CE1 1 
ATOM   2627 N  NE2 . HIS B 1 94  ? -24.247 10.837  -38.199 1.00 16.67 ? 96   HIS B NE2 1 
ATOM   2628 N  N   . TRP B 1 95  ? -21.869 11.443  -44.447 1.00 16.88 ? 97   TRP B N   1 
ATOM   2629 C  CA  . TRP B 1 95  ? -21.147 11.240  -45.701 1.00 18.24 ? 97   TRP B CA  1 
ATOM   2630 C  C   . TRP B 1 95  ? -20.278 12.436  -46.084 1.00 19.63 ? 97   TRP B C   1 
ATOM   2631 O  O   . TRP B 1 95  ? -20.291 13.466  -45.419 1.00 19.47 ? 97   TRP B O   1 
ATOM   2632 C  CB  . TRP B 1 95  ? -22.163 10.950  -46.800 1.00 18.66 ? 97   TRP B CB  1 
ATOM   2633 C  CG  . TRP B 1 95  ? -23.082 12.060  -47.046 1.00 18.43 ? 97   TRP B CG  1 
ATOM   2634 C  CD1 . TRP B 1 95  ? -22.863 13.148  -47.853 1.00 19.53 ? 97   TRP B CD1 1 
ATOM   2635 C  CD2 . TRP B 1 95  ? -24.388 12.221  -46.509 1.00 18.78 ? 97   TRP B CD2 1 
ATOM   2636 N  NE1 . TRP B 1 95  ? -23.954 13.977  -47.840 1.00 18.88 ? 97   TRP B NE1 1 
ATOM   2637 C  CE2 . TRP B 1 95  ? -24.904 13.433  -47.020 1.00 18.83 ? 97   TRP B CE2 1 
ATOM   2638 C  CE3 . TRP B 1 95  ? -25.179 11.465  -45.635 1.00 18.53 ? 97   TRP B CE3 1 
ATOM   2639 C  CZ2 . TRP B 1 95  ? -26.172 13.891  -46.700 1.00 19.36 ? 97   TRP B CZ2 1 
ATOM   2640 C  CZ3 . TRP B 1 95  ? -26.429 11.937  -45.309 1.00 18.76 ? 97   TRP B CZ3 1 
ATOM   2641 C  CH2 . TRP B 1 95  ? -26.923 13.132  -45.856 1.00 18.62 ? 97   TRP B CH2 1 
ATOM   2642 N  N   . GLY B 1 96  ? -19.524 12.290  -47.168 1.00 21.68 ? 98   GLY B N   1 
ATOM   2643 C  CA  . GLY B 1 96  ? -18.522 13.288  -47.538 1.00 22.93 ? 98   GLY B CA  1 
ATOM   2644 C  C   . GLY B 1 96  ? -18.948 14.173  -48.688 1.00 23.65 ? 98   GLY B C   1 
ATOM   2645 O  O   . GLY B 1 96  ? -19.960 14.850  -48.614 1.00 22.92 ? 98   GLY B O   1 
ATOM   2646 N  N   . ALA B 1 97  ? -18.135 14.184  -49.732 1.00 26.14 ? 99   ALA B N   1 
ATOM   2647 C  CA  . ALA B 1 97  ? -18.404 14.954  -50.948 1.00 28.71 ? 99   ALA B CA  1 
ATOM   2648 C  C   . ALA B 1 97  ? -17.572 14.310  -52.054 1.00 31.82 ? 99   ALA B C   1 
ATOM   2649 O  O   . ALA B 1 97  ? -16.889 13.316  -51.793 1.00 34.77 ? 99   ALA B O   1 
ATOM   2650 C  CB  . ALA B 1 97  ? -18.039 16.411  -50.746 1.00 27.21 ? 99   ALA B CB  1 
ATOM   2651 N  N   . ALA B 1 98  ? -17.646 14.826  -53.279 1.00 33.76 ? 100  ALA B N   1 
ATOM   2652 C  CA  . ALA B 1 98  ? -16.908 14.238  -54.416 1.00 35.40 ? 100  ALA B CA  1 
ATOM   2653 C  C   . ALA B 1 98  ? -15.441 14.006  -54.070 1.00 33.93 ? 100  ALA B C   1 
ATOM   2654 O  O   . ALA B 1 98  ? -14.743 14.944  -53.731 1.00 35.40 ? 100  ALA B O   1 
ATOM   2655 C  CB  . ALA B 1 98  ? -17.003 15.146  -55.636 1.00 36.94 ? 100  ALA B CB  1 
ATOM   2656 N  N   . GLY B 1 99  ? -14.992 12.759  -54.109 1.00 34.00 ? 101  GLY B N   1 
ATOM   2657 C  CA  . GLY B 1 99  ? -13.621 12.430  -53.720 1.00 34.92 ? 101  GLY B CA  1 
ATOM   2658 C  C   . GLY B 1 99  ? -13.223 12.776  -52.281 1.00 35.29 ? 101  GLY B C   1 
ATOM   2659 O  O   . GLY B 1 99  ? -12.025 12.926  -51.980 1.00 35.84 ? 101  GLY B O   1 
ATOM   2660 N  N   . ARG B 1 100 ? -14.200 12.907  -51.384 1.00 29.42 ? 102  ARG B N   1 
ATOM   2661 C  CA  . ARG B 1 100 ? -13.911 13.243  -49.992 1.00 27.17 ? 102  ARG B CA  1 
ATOM   2662 C  C   . ARG B 1 100 ? -14.714 12.268  -49.107 1.00 23.63 ? 102  ARG B C   1 
ATOM   2663 O  O   . ARG B 1 100 ? -15.932 12.264  -49.175 1.00 22.54 ? 102  ARG B O   1 
ATOM   2664 C  CB  . ARG B 1 100 ? -14.301 14.690  -49.695 1.00 28.01 ? 102  ARG B CB  1 
ATOM   2665 N  N   . PRO B 1 101 ? -14.033 11.423  -48.316 1.00 21.28 ? 103  PRO B N   1 
ATOM   2666 C  CA  . PRO B 1 101 ? -14.781 10.530  -47.415 1.00 20.23 ? 103  PRO B CA  1 
ATOM   2667 C  C   . PRO B 1 101 ? -15.462 11.292  -46.275 1.00 19.23 ? 103  PRO B C   1 
ATOM   2668 O  O   . PRO B 1 101 ? -15.030 12.379  -45.896 1.00 20.11 ? 103  PRO B O   1 
ATOM   2669 C  CB  . PRO B 1 101 ? -13.694 9.595   -46.889 1.00 20.53 ? 103  PRO B CB  1 
ATOM   2670 C  CG  . PRO B 1 101 ? -12.452 10.442  -46.891 1.00 21.10 ? 103  PRO B CG  1 
ATOM   2671 C  CD  . PRO B 1 101 ? -12.573 11.263  -48.149 1.00 20.88 ? 103  PRO B CD  1 
ATOM   2672 N  N   . GLY B 1 102 ? -16.539 10.740  -45.739 1.00 18.23 ? 104  GLY B N   1 
ATOM   2673 C  CA  . GLY B 1 102 ? -17.253 11.397  -44.646 1.00 17.08 ? 104  GLY B CA  1 
ATOM   2674 C  C   . GLY B 1 102 ? -17.790 10.560  -43.503 1.00 15.44 ? 104  GLY B C   1 
ATOM   2675 O  O   . GLY B 1 102 ? -18.766 10.976  -42.853 1.00 15.22 ? 104  GLY B O   1 
ATOM   2676 N  N   . SER B 1 103 ? -17.146 9.424   -43.208 1.00 14.47 ? 105  SER B N   1 
ATOM   2677 C  CA  . SER B 1 103 ? -17.488 8.670   -42.007 1.00 13.67 ? 105  SER B CA  1 
ATOM   2678 C  C   . SER B 1 103 ? -17.134 9.505   -40.770 1.00 13.89 ? 105  SER B C   1 
ATOM   2679 O  O   . SER B 1 103 ? -16.321 10.463  -40.827 1.00 13.19 ? 105  SER B O   1 
ATOM   2680 C  CB  . SER B 1 103 ? -16.813 7.287   -41.962 1.00 13.49 ? 105  SER B CB  1 
ATOM   2681 O  OG  . SER B 1 103 ? -15.417 7.357   -41.741 1.00 13.53 ? 105  SER B OG  1 
ATOM   2682 N  N   . GLU B 1 104 ? -17.748 9.143   -39.648 1.00 13.91 ? 106  GLU B N   1 
ATOM   2683 C  CA  . GLU B 1 104 ? -17.504 9.833   -38.373 1.00 14.21 ? 106  GLU B CA  1 
ATOM   2684 C  C   . GLU B 1 104 ? -16.377 9.161   -37.627 1.00 13.93 ? 106  GLU B C   1 
ATOM   2685 O  O   . GLU B 1 104 ? -15.372 9.800   -37.293 1.00 13.88 ? 106  GLU B O   1 
ATOM   2686 C  CB  . GLU B 1 104 ? -18.777 9.847   -37.538 1.00 14.77 ? 106  GLU B CB  1 
ATOM   2687 C  CG  . GLU B 1 104 ? -19.898 10.639  -38.204 1.00 15.58 ? 106  GLU B CG  1 
ATOM   2688 C  CD  . GLU B 1 104 ? -20.583 11.544  -37.231 1.00 16.19 ? 106  GLU B CD  1 
ATOM   2689 O  OE1 . GLU B 1 104 ? -21.462 11.057  -36.507 1.00 17.84 ? 106  GLU B OE1 1 
ATOM   2690 O  OE2 . GLU B 1 104 ? -20.204 12.719  -37.135 1.00 16.59 ? 106  GLU B OE2 1 
ATOM   2691 N  N   . HIS B 1 105 ? -16.546 7.867   -37.369 1.00 13.24 ? 107  HIS B N   1 
ATOM   2692 C  CA  . HIS B 1 105 ? -15.470 7.054   -36.845 1.00 13.07 ? 107  HIS B CA  1 
ATOM   2693 C  C   . HIS B 1 105 ? -14.429 6.859   -37.957 1.00 13.35 ? 107  HIS B C   1 
ATOM   2694 O  O   . HIS B 1 105 ? -14.758 6.882   -39.156 1.00 13.94 ? 107  HIS B O   1 
ATOM   2695 C  CB  . HIS B 1 105 ? -15.985 5.724   -36.308 1.00 12.96 ? 107  HIS B CB  1 
ATOM   2696 C  CG  . HIS B 1 105 ? -16.814 5.886   -35.080 1.00 12.95 ? 107  HIS B CG  1 
ATOM   2697 N  ND1 . HIS B 1 105 ? -18.167 6.161   -35.129 1.00 13.23 ? 107  HIS B ND1 1 
ATOM   2698 C  CD2 . HIS B 1 105 ? -16.474 5.886   -33.776 1.00 12.75 ? 107  HIS B CD2 1 
ATOM   2699 C  CE1 . HIS B 1 105 ? -18.621 6.321   -33.904 1.00 12.96 ? 107  HIS B CE1 1 
ATOM   2700 N  NE2 . HIS B 1 105 ? -17.612 6.169   -33.065 1.00 13.15 ? 107  HIS B NE2 1 
ATOM   2701 N  N   . THR B 1 106 ? -13.189 6.672   -37.525 1.00 13.33 ? 108  THR B N   1 
ATOM   2702 C  CA  . THR B 1 106 ? -12.086 6.313   -38.381 1.00 13.19 ? 108  THR B CA  1 
ATOM   2703 C  C   . THR B 1 106 ? -11.391 5.083   -37.808 1.00 13.12 ? 108  THR B C   1 
ATOM   2704 O  O   . THR B 1 106 ? -11.536 4.777   -36.645 1.00 12.10 ? 108  THR B O   1 
ATOM   2705 C  CB  . THR B 1 106 ? -11.103 7.486   -38.506 1.00 13.27 ? 108  THR B CB  1 
ATOM   2706 O  OG1 . THR B 1 106 ? -10.693 7.878   -37.205 1.00 13.55 ? 108  THR B OG1 1 
ATOM   2707 C  CG2 . THR B 1 106 ? -11.772 8.712   -39.188 1.00 13.73 ? 108  THR B CG2 1 
ATOM   2708 N  N   . VAL B 1 107 ? -10.630 4.383   -38.658 1.00 13.47 ? 109  VAL B N   1 
ATOM   2709 C  CA  . VAL B 1 107 ? -9.847  3.226   -38.250 1.00 13.78 ? 109  VAL B CA  1 
ATOM   2710 C  C   . VAL B 1 107 ? -8.410  3.493   -38.631 1.00 14.16 ? 109  VAL B C   1 
ATOM   2711 O  O   . VAL B 1 107 ? -8.096  3.648   -39.812 1.00 14.12 ? 109  VAL B O   1 
ATOM   2712 C  CB  . VAL B 1 107 ? -10.338 1.922   -38.908 1.00 14.09 ? 109  VAL B CB  1 
ATOM   2713 C  CG1 . VAL B 1 107 ? -9.393  0.758   -38.607 1.00 14.21 ? 109  VAL B CG1 1 
ATOM   2714 C  CG2 . VAL B 1 107 ? -11.766 1.592   -38.421 1.00 14.38 ? 109  VAL B CG2 1 
ATOM   2715 N  N   . GLU B 1 108 ? -7.551  3.564   -37.620 1.00 14.40 ? 110  GLU B N   1 
ATOM   2716 C  CA  . GLU B 1 108 ? -6.154  3.926   -37.777 1.00 15.51 ? 110  GLU B CA  1 
ATOM   2717 C  C   . GLU B 1 108 ? -6.004  5.148   -38.676 1.00 15.98 ? 110  GLU B C   1 
ATOM   2718 O  O   . GLU B 1 108 ? -5.129  5.186   -39.517 1.00 15.88 ? 110  GLU B O   1 
ATOM   2719 C  CB  . GLU B 1 108 ? -5.343  2.732   -38.281 1.00 16.93 ? 110  GLU B CB  1 
ATOM   2720 C  CG  . GLU B 1 108 ? -5.502  1.523   -37.379 1.00 17.82 ? 110  GLU B CG  1 
ATOM   2721 C  CD  . GLU B 1 108 ? -4.511  0.421   -37.665 1.00 20.36 ? 110  GLU B CD  1 
ATOM   2722 O  OE1 . GLU B 1 108 ? -4.446  -0.029  -38.808 1.00 21.32 ? 110  GLU B OE1 1 
ATOM   2723 O  OE2 . GLU B 1 108 ? -3.808  -0.030  -36.731 1.00 23.35 ? 110  GLU B OE2 1 
ATOM   2724 N  N   . GLY B 1 109 ? -6.892  6.134   -38.502 1.00 15.74 ? 111  GLY B N   1 
ATOM   2725 C  CA  . GLY B 1 109 ? -6.823  7.380   -39.232 1.00 15.94 ? 111  GLY B CA  1 
ATOM   2726 C  C   . GLY B 1 109 ? -7.516  7.319   -40.585 1.00 16.94 ? 111  GLY B C   1 
ATOM   2727 O  O   . GLY B 1 109 ? -7.663  8.351   -41.207 1.00 17.68 ? 111  GLY B O   1 
ATOM   2728 N  N   . HIS B 1 110 ? -7.956  6.147   -41.040 1.00 16.70 ? 112  HIS B N   1 
ATOM   2729 C  CA  . HIS B 1 110 ? -8.667  6.043   -42.324 1.00 17.62 ? 112  HIS B CA  1 
ATOM   2730 C  C   . HIS B 1 110 ? -10.139 6.419   -42.162 1.00 17.01 ? 112  HIS B C   1 
ATOM   2731 O  O   . HIS B 1 110 ? -10.854 5.848   -41.343 1.00 14.63 ? 112  HIS B O   1 
ATOM   2732 C  CB  . HIS B 1 110 ? -8.573  4.613   -42.865 1.00 17.78 ? 112  HIS B CB  1 
ATOM   2733 C  CG  . HIS B 1 110 ? -9.301  4.407   -44.157 1.00 19.20 ? 112  HIS B CG  1 
ATOM   2734 N  ND1 . HIS B 1 110 ? -8.793  4.812   -45.373 1.00 19.47 ? 112  HIS B ND1 1 
ATOM   2735 C  CD2 . HIS B 1 110 ? -10.504 3.844   -44.421 1.00 19.53 ? 112  HIS B CD2 1 
ATOM   2736 C  CE1 . HIS B 1 110 ? -9.651  4.509   -46.330 1.00 19.63 ? 112  HIS B CE1 1 
ATOM   2737 N  NE2 . HIS B 1 110 ? -10.687 3.903   -45.782 1.00 20.34 ? 112  HIS B NE2 1 
ATOM   2738 N  N   . ARG B 1 111 ? -10.570 7.380   -42.961 1.00 17.64 ? 113  ARG B N   1 
ATOM   2739 C  CA  . ARG B 1 111 ? -11.963 7.794   -43.024 1.00 18.04 ? 113  ARG B CA  1 
ATOM   2740 C  C   . ARG B 1 111 ? -12.629 7.073   -44.177 1.00 18.51 ? 113  ARG B C   1 
ATOM   2741 O  O   . ARG B 1 111 ? -12.151 7.142   -45.322 1.00 19.23 ? 113  ARG B O   1 
ATOM   2742 C  CB  . ARG B 1 111 ? -12.074 9.309   -43.207 1.00 18.26 ? 113  ARG B CB  1 
ATOM   2743 C  CG  . ARG B 1 111 ? -13.487 9.846   -42.998 1.00 18.83 ? 113  ARG B CG  1 
ATOM   2744 C  CD  . ARG B 1 111 ? -13.575 11.371  -43.038 1.00 19.73 ? 113  ARG B CD  1 
ATOM   2745 N  NE  . ARG B 1 111 ? -12.670 11.997  -42.074 1.00 20.77 ? 113  ARG B NE  1 
ATOM   2746 C  CZ  . ARG B 1 111 ? -12.875 12.086  -40.762 1.00 21.29 ? 113  ARG B CZ  1 
ATOM   2747 N  NH1 . ARG B 1 111 ? -13.972 11.593  -40.194 1.00 22.37 ? 113  ARG B NH1 1 
ATOM   2748 N  NH2 . ARG B 1 111 ? -11.970 12.672  -39.999 1.00 20.84 ? 113  ARG B NH2 1 
ATOM   2749 N  N   . PHE B 1 112 ? -13.736 6.401   -43.888 1.00 17.47 ? 114  PHE B N   1 
ATOM   2750 C  CA  . PHE B 1 112 ? -14.502 5.677   -44.907 1.00 17.30 ? 114  PHE B CA  1 
ATOM   2751 C  C   . PHE B 1 112 ? -15.435 6.628   -45.669 1.00 16.67 ? 114  PHE B C   1 
ATOM   2752 O  O   . PHE B 1 112 ? -15.772 7.718   -45.178 1.00 16.69 ? 114  PHE B O   1 
ATOM   2753 C  CB  . PHE B 1 112 ? -15.279 4.523   -44.254 1.00 17.40 ? 114  PHE B CB  1 
ATOM   2754 C  CG  . PHE B 1 112 ? -14.398 3.503   -43.588 1.00 17.39 ? 114  PHE B CG  1 
ATOM   2755 C  CD1 . PHE B 1 112 ? -13.889 3.719   -42.311 1.00 18.11 ? 114  PHE B CD1 1 
ATOM   2756 C  CD2 . PHE B 1 112 ? -14.006 2.358   -44.276 1.00 17.57 ? 114  PHE B CD2 1 
ATOM   2757 C  CE1 . PHE B 1 112 ? -13.065 2.777   -41.716 1.00 18.94 ? 114  PHE B CE1 1 
ATOM   2758 C  CE2 . PHE B 1 112 ? -13.176 1.413   -43.692 1.00 18.31 ? 114  PHE B CE2 1 
ATOM   2759 C  CZ  . PHE B 1 112 ? -12.714 1.615   -42.407 1.00 18.33 ? 114  PHE B CZ  1 
ATOM   2760 N  N   . PRO B 1 113 ? -15.876 6.228   -46.882 1.00 16.92 ? 115  PRO B N   1 
ATOM   2761 C  CA  . PRO B 1 113 ? -16.782 7.110   -47.626 1.00 16.01 ? 115  PRO B CA  1 
ATOM   2762 C  C   . PRO B 1 113 ? -18.015 7.597   -46.823 1.00 15.85 ? 115  PRO B C   1 
ATOM   2763 O  O   . PRO B 1 113 ? -18.345 8.803   -46.849 1.00 14.82 ? 115  PRO B O   1 
ATOM   2764 C  CB  . PRO B 1 113 ? -17.192 6.248   -48.826 1.00 16.87 ? 115  PRO B CB  1 
ATOM   2765 C  CG  . PRO B 1 113 ? -15.996 5.377   -49.071 1.00 16.68 ? 115  PRO B CG  1 
ATOM   2766 C  CD  . PRO B 1 113 ? -15.463 5.061   -47.692 1.00 16.81 ? 115  PRO B CD  1 
ATOM   2767 N  N   . ALA B 1 114 ? -18.661 6.702   -46.080 1.00 14.65 ? 116  ALA B N   1 
ATOM   2768 C  CA  . ALA B 1 114 ? -19.857 7.092   -45.312 1.00 14.43 ? 116  ALA B CA  1 
ATOM   2769 C  C   . ALA B 1 114 ? -20.073 6.173   -44.116 1.00 13.56 ? 116  ALA B C   1 
ATOM   2770 O  O   . ALA B 1 114 ? -19.350 5.195   -43.946 1.00 13.55 ? 116  ALA B O   1 
ATOM   2771 C  CB  . ALA B 1 114 ? -21.095 7.102   -46.240 1.00 14.80 ? 116  ALA B CB  1 
ATOM   2772 N  N   . GLU B 1 115 ? -21.081 6.480   -43.303 1.00 13.63 ? 117  GLU B N   1 
ATOM   2773 C  CA  . GLU B 1 115 ? -21.370 5.714   -42.098 1.00 12.98 ? 117  GLU B CA  1 
ATOM   2774 C  C   . GLU B 1 115 ? -22.866 5.776   -41.803 1.00 13.22 ? 117  GLU B C   1 
ATOM   2775 O  O   . GLU B 1 115 ? -23.476 6.826   -41.914 1.00 13.80 ? 117  GLU B O   1 
ATOM   2776 C  CB  . GLU B 1 115 ? -20.569 6.289   -40.929 1.00 13.08 ? 117  GLU B CB  1 
ATOM   2777 C  CG  . GLU B 1 115 ? -20.608 5.526   -39.588 1.00 13.25 ? 117  GLU B CG  1 
ATOM   2778 C  CD  . GLU B 1 115 ? -19.589 6.070   -38.562 1.00 13.99 ? 117  GLU B CD  1 
ATOM   2779 O  OE1 . GLU B 1 115 ? -18.491 6.529   -38.986 1.00 12.68 ? 117  GLU B OE1 1 
ATOM   2780 O  OE2 . GLU B 1 115 ? -19.873 6.056   -37.319 1.00 14.75 ? 117  GLU B OE2 1 
ATOM   2781 N  N   . ILE B 1 116 ? -23.425 4.649   -41.393 1.00 12.93 ? 118  ILE B N   1 
ATOM   2782 C  CA  . ILE B 1 116 ? -24.807 4.568   -40.988 1.00 13.53 ? 118  ILE B CA  1 
ATOM   2783 C  C   . ILE B 1 116 ? -24.899 4.432   -39.476 1.00 13.28 ? 118  ILE B C   1 
ATOM   2784 O  O   . ILE B 1 116 ? -24.159 3.661   -38.873 1.00 13.05 ? 118  ILE B O   1 
ATOM   2785 C  CB  . ILE B 1 116 ? -25.576 3.416   -41.693 1.00 13.83 ? 118  ILE B CB  1 
ATOM   2786 C  CG1 . ILE B 1 116 ? -27.042 3.379   -41.220 1.00 14.66 ? 118  ILE B CG1 1 
ATOM   2787 C  CG2 . ILE B 1 116 ? -24.941 2.056   -41.472 1.00 14.10 ? 118  ILE B CG2 1 
ATOM   2788 C  CD1 . ILE B 1 116 ? -27.919 2.462   -42.045 1.00 15.41 ? 118  ILE B CD1 1 
ATOM   2789 N  N   . HIS B 1 117 ? -25.849 5.152   -38.896 1.00 12.55 ? 119  HIS B N   1 
ATOM   2790 C  CA  . HIS B 1 117 ? -26.149 5.076   -37.471 1.00 12.50 ? 119  HIS B CA  1 
ATOM   2791 C  C   . HIS B 1 117 ? -27.575 4.658   -37.247 1.00 12.50 ? 119  HIS B C   1 
ATOM   2792 O  O   . HIS B 1 117 ? -28.472 5.296   -37.761 1.00 12.40 ? 119  HIS B O   1 
ATOM   2793 C  CB  . HIS B 1 117 ? -25.919 6.432   -36.821 1.00 12.07 ? 119  HIS B CB  1 
ATOM   2794 C  CG  . HIS B 1 117 ? -24.485 6.838   -36.785 1.00 11.95 ? 119  HIS B CG  1 
ATOM   2795 N  ND1 . HIS B 1 117 ? -24.093 8.127   -36.530 1.00 11.91 ? 119  HIS B ND1 1 
ATOM   2796 C  CD2 . HIS B 1 117 ? -23.347 6.126   -36.962 1.00 11.39 ? 119  HIS B CD2 1 
ATOM   2797 C  CE1 . HIS B 1 117 ? -22.777 8.205   -36.560 1.00 11.74 ? 119  HIS B CE1 1 
ATOM   2798 N  NE2 . HIS B 1 117 ? -22.300 7.005   -36.827 1.00 11.94 ? 119  HIS B NE2 1 
ATOM   2799 N  N   . VAL B 1 118 ? -27.762 3.564   -36.507 1.00 12.26 ? 120  VAL B N   1 
ATOM   2800 C  CA  . VAL B 1 118 ? -29.061 3.130   -36.052 1.00 12.45 ? 120  VAL B CA  1 
ATOM   2801 C  C   . VAL B 1 118 ? -29.159 3.405   -34.552 1.00 12.89 ? 120  VAL B C   1 
ATOM   2802 O  O   . VAL B 1 118 ? -28.465 2.766   -33.747 1.00 12.57 ? 120  VAL B O   1 
ATOM   2803 C  CB  . VAL B 1 118 ? -29.307 1.635   -36.319 1.00 12.29 ? 120  VAL B CB  1 
ATOM   2804 C  CG1 . VAL B 1 118 ? -30.782 1.286   -36.085 1.00 12.12 ? 120  VAL B CG1 1 
ATOM   2805 C  CG2 . VAL B 1 118 ? -28.910 1.261   -37.741 1.00 12.67 ? 120  VAL B CG2 1 
ATOM   2806 N  N   . VAL B 1 119 ? -30.010 4.365   -34.192 1.00 12.95 ? 121  VAL B N   1 
ATOM   2807 C  CA  . VAL B 1 119 ? -30.107 4.871   -32.828 1.00 13.19 ? 121  VAL B CA  1 
ATOM   2808 C  C   . VAL B 1 119 ? -31.205 4.155   -32.048 1.00 12.76 ? 121  VAL B C   1 
ATOM   2809 O  O   . VAL B 1 119 ? -32.337 4.019   -32.534 1.00 12.56 ? 121  VAL B O   1 
ATOM   2810 C  CB  . VAL B 1 119 ? -30.398 6.380   -32.843 1.00 13.79 ? 121  VAL B CB  1 
ATOM   2811 C  CG1 . VAL B 1 119 ? -30.389 6.929   -31.445 1.00 14.31 ? 121  VAL B CG1 1 
ATOM   2812 C  CG2 . VAL B 1 119 ? -29.399 7.118   -33.731 1.00 13.92 ? 121  VAL B CG2 1 
ATOM   2813 N  N   . HIS B 1 120 ? -30.875 3.694   -30.843 1.00 12.01 ? 122  HIS B N   1 
ATOM   2814 C  CA  . HIS B 1 120 ? -31.782 2.918   -30.036 1.00 11.93 ? 122  HIS B CA  1 
ATOM   2815 C  C   . HIS B 1 120 ? -31.969 3.511   -28.638 1.00 12.22 ? 122  HIS B C   1 
ATOM   2816 O  O   . HIS B 1 120 ? -31.048 4.122   -28.081 1.00 11.68 ? 122  HIS B O   1 
ATOM   2817 C  CB  . HIS B 1 120 ? -31.267 1.489   -29.803 1.00 12.17 ? 122  HIS B CB  1 
ATOM   2818 C  CG  . HIS B 1 120 ? -31.068 0.674   -31.046 1.00 12.45 ? 122  HIS B CG  1 
ATOM   2819 N  ND1 . HIS B 1 120 ? -30.095 0.956   -31.985 1.00 12.53 ? 122  HIS B ND1 1 
ATOM   2820 C  CD2 . HIS B 1 120 ? -31.685 -0.456  -31.470 1.00 12.66 ? 122  HIS B CD2 1 
ATOM   2821 C  CE1 . HIS B 1 120 ? -30.128 0.040   -32.936 1.00 12.69 ? 122  HIS B CE1 1 
ATOM   2822 N  NE2 . HIS B 1 120 ? -31.079 -0.829  -32.644 1.00 13.12 ? 122  HIS B NE2 1 
ATOM   2823 N  N   . LEU B 1 121 ? -33.122 3.216   -28.039 1.00 11.91 ? 123  LEU B N   1 
ATOM   2824 C  CA  . LEU B 1 121 ? -33.448 3.637   -26.691 1.00 12.11 ? 123  LEU B CA  1 
ATOM   2825 C  C   . LEU B 1 121 ? -33.477 2.420   -25.791 1.00 12.40 ? 123  LEU B C   1 
ATOM   2826 O  O   . LEU B 1 121 ? -34.142 1.420   -26.112 1.00 12.14 ? 123  LEU B O   1 
ATOM   2827 C  CB  . LEU B 1 121 ? -34.816 4.294   -26.687 1.00 12.90 ? 123  LEU B CB  1 
ATOM   2828 C  CG  . LEU B 1 121 ? -35.341 4.824   -25.347 1.00 13.50 ? 123  LEU B CG  1 
ATOM   2829 C  CD1 . LEU B 1 121 ? -34.387 5.861   -24.788 1.00 13.81 ? 123  LEU B CD1 1 
ATOM   2830 C  CD2 . LEU B 1 121 ? -36.754 5.370   -25.542 1.00 14.32 ? 123  LEU B CD2 1 
ATOM   2831 N  N   . SER B 1 122 ? -32.788 2.502   -24.651 1.00 12.06 ? 124  SER B N   1 
ATOM   2832 C  CA  . SER B 1 122 ? -32.875 1.435   -23.625 1.00 12.68 ? 124  SER B CA  1 
ATOM   2833 C  C   . SER B 1 122 ? -34.329 1.215   -23.191 1.00 13.64 ? 124  SER B C   1 
ATOM   2834 O  O   . SER B 1 122 ? -35.044 2.169   -22.925 1.00 13.32 ? 124  SER B O   1 
ATOM   2835 C  CB  . SER B 1 122 ? -32.041 1.760   -22.374 1.00 12.08 ? 124  SER B CB  1 
ATOM   2836 O  OG  . SER B 1 122 ? -32.420 0.881   -21.314 1.00 12.02 ? 124  SER B OG  1 
ATOM   2837 N  N   . THR B 1 123 ? -34.725 -0.043  -23.065 1.00 15.10 ? 125  THR B N   1 
ATOM   2838 C  CA  . THR B 1 123 ? -36.059 -0.375  -22.564 1.00 17.20 ? 125  THR B CA  1 
ATOM   2839 C  C   . THR B 1 123 ? -36.310 0.040   -21.111 1.00 17.48 ? 125  THR B C   1 
ATOM   2840 O  O   . THR B 1 123 ? -37.456 0.038   -20.679 1.00 15.93 ? 125  THR B O   1 
ATOM   2841 C  CB  . THR B 1 123 ? -36.372 -1.874  -22.697 1.00 18.47 ? 125  THR B CB  1 
ATOM   2842 O  OG1 . THR B 1 123 ? -35.411 -2.614  -21.939 1.00 20.95 ? 125  THR B OG1 1 
ATOM   2843 C  CG2 . THR B 1 123 ? -36.333 -2.297  -24.143 1.00 18.97 ? 125  THR B CG2 1 
ATOM   2844 N  N   . ALA B 1 124 ? -35.263 0.413   -20.367 1.00 17.53 ? 126  ALA B N   1 
ATOM   2845 C  CA  . ALA B 1 124 ? -35.431 0.936   -19.012 1.00 17.80 ? 126  ALA B CA  1 
ATOM   2846 C  C   . ALA B 1 124 ? -35.849 2.396   -18.969 1.00 18.61 ? 126  ALA B C   1 
ATOM   2847 O  O   . ALA B 1 124 ? -36.095 2.935   -17.892 1.00 19.04 ? 126  ALA B O   1 
ATOM   2848 C  CB  . ALA B 1 124 ? -34.137 0.746   -18.218 1.00 18.33 ? 126  ALA B CB  1 
ATOM   2849 N  N   . PHE B 1 125 ? -35.891 3.067   -20.120 1.00 18.93 ? 127  PHE B N   1 
ATOM   2850 C  CA  . PHE B 1 125 ? -36.320 4.446   -20.176 1.00 20.06 ? 127  PHE B CA  1 
ATOM   2851 C  C   . PHE B 1 125 ? -37.503 4.531   -21.134 1.00 20.96 ? 127  PHE B C   1 
ATOM   2852 O  O   . PHE B 1 125 ? -37.469 3.959   -22.233 1.00 18.58 ? 127  PHE B O   1 
ATOM   2853 C  CB  . PHE B 1 125 ? -35.188 5.371   -20.663 1.00 19.62 ? 127  PHE B CB  1 
ATOM   2854 C  CG  . PHE B 1 125 ? -34.000 5.429   -19.734 1.00 18.83 ? 127  PHE B CG  1 
ATOM   2855 C  CD1 . PHE B 1 125 ? -33.969 6.319   -18.676 1.00 18.92 ? 127  PHE B CD1 1 
ATOM   2856 C  CD2 . PHE B 1 125 ? -32.926 4.583   -19.911 1.00 18.41 ? 127  PHE B CD2 1 
ATOM   2857 C  CE1 . PHE B 1 125 ? -32.868 6.368   -17.818 1.00 18.94 ? 127  PHE B CE1 1 
ATOM   2858 C  CE2 . PHE B 1 125 ? -31.830 4.613   -19.053 1.00 18.60 ? 127  PHE B CE2 1 
ATOM   2859 C  CZ  . PHE B 1 125 ? -31.796 5.518   -18.016 1.00 18.12 ? 127  PHE B CZ  1 
ATOM   2860 N  N   . ALA B 1 126 ? -38.533 5.267   -20.707 1.00 21.17 ? 128  ALA B N   1 
ATOM   2861 C  CA  . ALA B 1 126 ? -39.734 5.459   -21.514 1.00 22.66 ? 128  ALA B CA  1 
ATOM   2862 C  C   . ALA B 1 126 ? -39.511 6.477   -22.608 1.00 21.30 ? 128  ALA B C   1 
ATOM   2863 O  O   . ALA B 1 126 ? -40.078 6.368   -23.681 1.00 22.26 ? 128  ALA B O   1 
ATOM   2864 C  CB  . ALA B 1 126 ? -40.889 5.902   -20.628 1.00 23.72 ? 128  ALA B CB  1 
ATOM   2865 N  N   . ARG B 1 127 ? -38.668 7.458   -22.337 1.00 20.81 ? 129  ARG B N   1 
ATOM   2866 C  CA  . ARG B 1 127 ? -38.454 8.571   -23.221 1.00 20.17 ? 129  ARG B CA  1 
ATOM   2867 C  C   . ARG B 1 127 ? -36.969 8.797   -23.449 1.00 19.04 ? 129  ARG B C   1 
ATOM   2868 O  O   . ARG B 1 127 ? -36.149 8.582   -22.547 1.00 17.89 ? 129  ARG B O   1 
ATOM   2869 C  CB  . ARG B 1 127 ? -39.034 9.839   -22.585 1.00 22.57 ? 129  ARG B CB  1 
ATOM   2870 C  CG  . ARG B 1 127 ? -40.555 9.827   -22.354 1.00 24.80 ? 129  ARG B CG  1 
ATOM   2871 C  CD  . ARG B 1 127 ? -40.980 10.954  -21.412 1.00 26.29 ? 129  ARG B CD  1 
ATOM   2872 N  NE  . ARG B 1 127 ? -40.588 12.245  -21.969 1.00 28.07 ? 129  ARG B NE  1 
ATOM   2873 C  CZ  . ARG B 1 127 ? -41.290 12.951  -22.852 1.00 29.94 ? 129  ARG B CZ  1 
ATOM   2874 N  NH1 . ARG B 1 127 ? -42.484 12.529  -23.274 1.00 33.27 ? 129  ARG B NH1 1 
ATOM   2875 N  NH2 . ARG B 1 127 ? -40.804 14.101  -23.310 1.00 28.99 ? 129  ARG B NH2 1 
ATOM   2876 N  N   . VAL B 1 128 ? -36.662 9.325   -24.630 1.00 17.00 ? 130  VAL B N   1 
ATOM   2877 C  CA  . VAL B 1 128 ? -35.310 9.703   -25.017 1.00 16.65 ? 130  VAL B CA  1 
ATOM   2878 C  C   . VAL B 1 128 ? -34.749 10.754  -24.076 1.00 16.80 ? 130  VAL B C   1 
ATOM   2879 O  O   . VAL B 1 128 ? -33.589 10.664  -23.682 1.00 14.48 ? 130  VAL B O   1 
ATOM   2880 C  CB  . VAL B 1 128 ? -35.266 10.216  -26.475 1.00 16.75 ? 130  VAL B CB  1 
ATOM   2881 C  CG1 . VAL B 1 128 ? -33.927 10.879  -26.827 1.00 16.66 ? 130  VAL B CG1 1 
ATOM   2882 C  CG2 . VAL B 1 128 ? -35.528 9.072   -27.444 1.00 16.77 ? 130  VAL B CG2 1 
ATOM   2883 N  N   . ASP B 1 129 ? -35.559 11.752  -23.715 1.00 17.32 ? 131  ASP B N   1 
ATOM   2884 C  CA  . ASP B 1 129 ? -35.051 12.825  -22.868 1.00 18.46 ? 131  ASP B CA  1 
ATOM   2885 C  C   . ASP B 1 129 ? -34.644 12.396  -21.455 1.00 18.26 ? 131  ASP B C   1 
ATOM   2886 O  O   . ASP B 1 129 ? -33.732 12.989  -20.876 1.00 19.42 ? 131  ASP B O   1 
ATOM   2887 C  CB  . ASP B 1 129 ? -35.977 14.053  -22.874 1.00 19.25 ? 131  ASP B CB  1 
ATOM   2888 C  CG  . ASP B 1 129 ? -37.369 13.792  -22.316 1.00 20.75 ? 131  ASP B CG  1 
ATOM   2889 O  OD1 . ASP B 1 129 ? -37.688 12.732  -21.745 1.00 23.62 ? 131  ASP B OD1 1 
ATOM   2890 O  OD2 . ASP B 1 129 ? -38.182 14.716  -22.445 1.00 22.69 ? 131  ASP B OD2 1 
ATOM   2891 N  N   . GLU B 1 130 ? -35.282 11.354  -20.930 1.00 18.31 ? 132  GLU B N   1 
ATOM   2892 C  CA  . GLU B 1 130 ? -34.832 10.694  -19.706 1.00 19.91 ? 132  GLU B CA  1 
ATOM   2893 C  C   . GLU B 1 130 ? -33.502 9.950   -19.877 1.00 18.32 ? 132  GLU B C   1 
ATOM   2894 O  O   . GLU B 1 130 ? -32.722 9.830   -18.923 1.00 17.63 ? 132  GLU B O   1 
ATOM   2895 C  CB  . GLU B 1 130 ? -35.846 9.654   -19.245 1.00 23.41 ? 132  GLU B CB  1 
ATOM   2896 C  CG  . GLU B 1 130 ? -37.186 10.196  -18.810 1.00 28.46 ? 132  GLU B CG  1 
ATOM   2897 C  CD  . GLU B 1 130 ? -38.244 9.104   -18.636 1.00 35.61 ? 132  GLU B CD  1 
ATOM   2898 O  OE1 . GLU B 1 130 ? -37.909 7.893   -18.702 1.00 38.84 ? 132  GLU B OE1 1 
ATOM   2899 O  OE2 . GLU B 1 130 ? -39.428 9.466   -18.438 1.00 43.01 ? 132  GLU B OE2 1 
ATOM   2900 N  N   . ALA B 1 131 ? -33.287 9.385   -21.065 1.00 16.65 ? 133  ALA B N   1 
ATOM   2901 C  CA  . ALA B 1 131 ? -32.096 8.583   -21.344 1.00 15.92 ? 133  ALA B CA  1 
ATOM   2902 C  C   . ALA B 1 131 ? -30.850 9.440   -21.652 1.00 15.57 ? 133  ALA B C   1 
ATOM   2903 O  O   . ALA B 1 131 ? -29.718 8.967   -21.485 1.00 14.22 ? 133  ALA B O   1 
ATOM   2904 C  CB  . ALA B 1 131 ? -32.377 7.635   -22.503 1.00 15.98 ? 133  ALA B CB  1 
ATOM   2905 N  N   . LEU B 1 132 ? -31.051 10.683  -22.099 1.00 15.78 ? 134  LEU B N   1 
ATOM   2906 C  CA  . LEU B 1 132 ? -29.931 11.536  -22.472 1.00 15.72 ? 134  LEU B CA  1 
ATOM   2907 C  C   . LEU B 1 132 ? -29.077 11.800  -21.258 1.00 14.69 ? 134  LEU B C   1 
ATOM   2908 O  O   . LEU B 1 132 ? -29.588 12.213  -20.214 1.00 14.70 ? 134  LEU B O   1 
ATOM   2909 C  CB  . LEU B 1 132 ? -30.383 12.866  -23.073 1.00 16.97 ? 134  LEU B CB  1 
ATOM   2910 C  CG  . LEU B 1 132 ? -30.925 12.821  -24.494 1.00 18.22 ? 134  LEU B CG  1 
ATOM   2911 C  CD1 . LEU B 1 132 ? -31.533 14.176  -24.859 1.00 19.25 ? 134  LEU B CD1 1 
ATOM   2912 C  CD2 . LEU B 1 132 ? -29.846 12.422  -25.505 1.00 18.71 ? 134  LEU B CD2 1 
ATOM   2913 N  N   . GLY B 1 133 ? -27.784 11.516  -21.379 1.00 13.52 ? 135  GLY B N   1 
ATOM   2914 C  CA  . GLY B 1 133 ? -26.851 11.716  -20.286 1.00 13.26 ? 135  GLY B CA  1 
ATOM   2915 C  C   . GLY B 1 133 ? -26.784 10.591  -19.283 1.00 13.52 ? 135  GLY B C   1 
ATOM   2916 O  O   . GLY B 1 133 ? -25.980 10.669  -18.372 1.00 13.89 ? 135  GLY B O   1 
ATOM   2917 N  N   . ARG B 1 134 ? -27.625 9.559   -19.418 1.00 13.35 ? 136  ARG B N   1 
ATOM   2918 C  CA  . ARG B 1 134 ? -27.615 8.430   -18.485 1.00 13.98 ? 136  ARG B CA  1 
ATOM   2919 C  C   . ARG B 1 134 ? -26.800 7.314   -19.150 1.00 13.77 ? 136  ARG B C   1 
ATOM   2920 O  O   . ARG B 1 134 ? -26.885 7.149   -20.359 1.00 13.20 ? 136  ARG B O   1 
ATOM   2921 C  CB  . ARG B 1 134 ? -29.025 7.934   -18.171 1.00 14.36 ? 136  ARG B CB  1 
ATOM   2922 C  CG  . ARG B 1 134 ? -29.713 8.642   -17.015 1.00 14.97 ? 136  ARG B CG  1 
ATOM   2923 C  CD  . ARG B 1 134 ? -29.776 10.164  -17.115 1.00 15.42 ? 136  ARG B CD  1 
ATOM   2924 N  NE  . ARG B 1 134 ? -30.212 10.679  -15.803 1.00 15.90 ? 136  ARG B NE  1 
ATOM   2925 C  CZ  . ARG B 1 134 ? -31.483 10.795  -15.400 1.00 16.21 ? 136  ARG B CZ  1 
ATOM   2926 N  NH1 . ARG B 1 134 ? -32.490 10.486  -16.206 1.00 15.84 ? 136  ARG B NH1 1 
ATOM   2927 N  NH2 . ARG B 1 134 ? -31.759 11.228  -14.160 1.00 16.72 ? 136  ARG B NH2 1 
ATOM   2928 N  N   . PRO B 1 135 ? -25.982 6.584   -18.370 1.00 13.98 ? 137  PRO B N   1 
ATOM   2929 C  CA  . PRO B 1 135 ? -25.127 5.534   -18.970 1.00 14.07 ? 137  PRO B CA  1 
ATOM   2930 C  C   . PRO B 1 135 ? -25.956 4.427   -19.592 1.00 13.53 ? 137  PRO B C   1 
ATOM   2931 O  O   . PRO B 1 135 ? -26.832 3.865   -18.935 1.00 13.58 ? 137  PRO B O   1 
ATOM   2932 C  CB  . PRO B 1 135 ? -24.296 5.020   -17.789 1.00 14.48 ? 137  PRO B CB  1 
ATOM   2933 C  CG  . PRO B 1 135 ? -25.042 5.433   -16.571 1.00 14.76 ? 137  PRO B CG  1 
ATOM   2934 C  CD  . PRO B 1 135 ? -25.781 6.693   -16.914 1.00 14.46 ? 137  PRO B CD  1 
ATOM   2935 N  N   . GLY B 1 136 ? -25.690 4.149   -20.860 1.00 13.15 ? 138  GLY B N   1 
ATOM   2936 C  CA  . GLY B 1 136 ? -26.417 3.137   -21.595 1.00 13.30 ? 138  GLY B CA  1 
ATOM   2937 C  C   . GLY B 1 136 ? -27.850 3.496   -21.949 1.00 13.14 ? 138  GLY B C   1 
ATOM   2938 O  O   . GLY B 1 136 ? -28.592 2.621   -22.395 1.00 13.55 ? 138  GLY B O   1 
ATOM   2939 N  N   . GLY B 1 137 ? -28.254 4.755   -21.750 1.00 12.70 ? 139  GLY B N   1 
ATOM   2940 C  CA  . GLY B 1 137 ? -29.621 5.181   -22.036 1.00 12.64 ? 139  GLY B CA  1 
ATOM   2941 C  C   . GLY B 1 137 ? -29.910 5.052   -23.513 1.00 12.75 ? 139  GLY B C   1 
ATOM   2942 O  O   . GLY B 1 137 ? -30.969 4.549   -23.898 1.00 12.50 ? 139  GLY B O   1 
ATOM   2943 N  N   . LEU B 1 138 ? -28.949 5.483   -24.337 1.00 13.04 ? 140  LEU B N   1 
ATOM   2944 C  CA  . LEU B 1 138 ? -28.998 5.304   -25.786 1.00 13.29 ? 140  LEU B CA  1 
ATOM   2945 C  C   . LEU B 1 138 ? -27.854 4.398   -26.234 1.00 12.96 ? 140  LEU B C   1 
ATOM   2946 O  O   . LEU B 1 138 ? -26.767 4.378   -25.616 1.00 12.31 ? 140  LEU B O   1 
ATOM   2947 C  CB  . LEU B 1 138 ? -28.918 6.655   -26.506 1.00 14.33 ? 140  LEU B CB  1 
ATOM   2948 C  CG  . LEU B 1 138 ? -29.979 7.704   -26.132 1.00 15.75 ? 140  LEU B CG  1 
ATOM   2949 C  CD1 . LEU B 1 138 ? -29.720 9.008   -26.868 1.00 16.84 ? 140  LEU B CD1 1 
ATOM   2950 C  CD2 . LEU B 1 138 ? -31.362 7.187   -26.463 1.00 15.91 ? 140  LEU B CD2 1 
ATOM   2951 N  N   . ALA B 1 139 ? -28.114 3.645   -27.294 1.00 12.08 ? 141  ALA B N   1 
ATOM   2952 C  CA  . ALA B 1 139 ? -27.134 2.826   -27.945 1.00 12.32 ? 141  ALA B CA  1 
ATOM   2953 C  C   . ALA B 1 139 ? -27.248 3.000   -29.437 1.00 12.66 ? 141  ALA B C   1 
ATOM   2954 O  O   . ALA B 1 139 ? -28.351 2.923   -29.998 1.00 13.63 ? 141  ALA B O   1 
ATOM   2955 C  CB  . ALA B 1 139 ? -27.344 1.373   -27.586 1.00 12.11 ? 141  ALA B CB  1 
ATOM   2956 N  N   . VAL B 1 140 ? -26.117 3.244   -30.086 1.00 12.91 ? 142  VAL B N   1 
ATOM   2957 C  CA  . VAL B 1 140 ? -26.073 3.415   -31.535 1.00 12.79 ? 142  VAL B CA  1 
ATOM   2958 C  C   . VAL B 1 140 ? -25.272 2.256   -32.149 1.00 13.35 ? 142  VAL B C   1 
ATOM   2959 O  O   . VAL B 1 140 ? -24.162 1.942   -31.686 1.00 12.92 ? 142  VAL B O   1 
ATOM   2960 C  CB  . VAL B 1 140 ? -25.463 4.784   -31.927 1.00 12.71 ? 142  VAL B CB  1 
ATOM   2961 C  CG1 . VAL B 1 140 ? -25.496 4.969   -33.439 1.00 12.83 ? 142  VAL B CG1 1 
ATOM   2962 C  CG2 . VAL B 1 140 ? -26.180 5.920   -31.210 1.00 12.91 ? 142  VAL B CG2 1 
ATOM   2963 N  N   . LEU B 1 141 ? -25.839 1.618   -33.180 1.00 13.26 ? 143  LEU B N   1 
ATOM   2964 C  CA  . LEU B 1 141 ? -25.118 0.686   -34.020 1.00 13.28 ? 143  LEU B CA  1 
ATOM   2965 C  C   . LEU B 1 141 ? -24.588 1.455   -35.208 1.00 13.30 ? 143  LEU B C   1 
ATOM   2966 O  O   . LEU B 1 141 ? -25.362 2.118   -35.899 1.00 13.23 ? 143  LEU B O   1 
ATOM   2967 C  CB  . LEU B 1 141 ? -26.043 -0.456  -34.501 1.00 13.94 ? 143  LEU B CB  1 
ATOM   2968 C  CG  . LEU B 1 141 ? -26.696 -1.311  -33.417 1.00 14.53 ? 143  LEU B CG  1 
ATOM   2969 C  CD1 . LEU B 1 141 ? -27.465 -2.470  -34.030 1.00 14.99 ? 143  LEU B CD1 1 
ATOM   2970 C  CD2 . LEU B 1 141 ? -25.718 -1.829  -32.380 1.00 14.46 ? 143  LEU B CD2 1 
ATOM   2971 N  N   . ALA B 1 142 ? -23.280 1.368   -35.448 1.00 12.94 ? 144  ALA B N   1 
ATOM   2972 C  CA  . ALA B 1 142 ? -22.609 2.118   -36.509 1.00 12.73 ? 144  ALA B CA  1 
ATOM   2973 C  C   . ALA B 1 142 ? -21.932 1.174   -37.469 1.00 12.80 ? 144  ALA B C   1 
ATOM   2974 O  O   . ALA B 1 142 ? -21.297 0.189   -37.037 1.00 12.21 ? 144  ALA B O   1 
ATOM   2975 C  CB  . ALA B 1 142 ? -21.605 3.086   -35.925 1.00 12.76 ? 144  ALA B CB  1 
ATOM   2976 N  N   . ALA B 1 143 ? -22.072 1.441   -38.776 1.00 12.30 ? 145  ALA B N   1 
ATOM   2977 C  CA  . ALA B 1 143 ? -21.346 0.649   -39.782 1.00 12.71 ? 145  ALA B CA  1 
ATOM   2978 C  C   . ALA B 1 143 ? -20.759 1.541   -40.835 1.00 12.78 ? 145  ALA B C   1 
ATOM   2979 O  O   . ALA B 1 143 ? -21.409 2.517   -41.227 1.00 12.70 ? 145  ALA B O   1 
ATOM   2980 C  CB  . ALA B 1 143 ? -22.255 -0.376  -40.434 1.00 12.97 ? 145  ALA B CB  1 
ATOM   2981 N  N   . PHE B 1 144 ? -19.556 1.190   -41.311 1.00 12.88 ? 146  PHE B N   1 
ATOM   2982 C  CA  . PHE B 1 144 ? -18.945 1.920   -42.405 1.00 14.07 ? 146  PHE B CA  1 
ATOM   2983 C  C   . PHE B 1 144 ? -19.514 1.459   -43.752 1.00 14.51 ? 146  PHE B C   1 
ATOM   2984 O  O   . PHE B 1 144 ? -19.746 0.261   -43.955 1.00 15.14 ? 146  PHE B O   1 
ATOM   2985 C  CB  . PHE B 1 144 ? -17.434 1.715   -42.406 1.00 13.87 ? 146  PHE B CB  1 
ATOM   2986 C  CG  . PHE B 1 144 ? -16.756 2.171   -41.138 1.00 13.77 ? 146  PHE B CG  1 
ATOM   2987 C  CD1 . PHE B 1 144 ? -16.834 3.498   -40.737 1.00 13.89 ? 146  PHE B CD1 1 
ATOM   2988 C  CD2 . PHE B 1 144 ? -16.056 1.273   -40.349 1.00 13.90 ? 146  PHE B CD2 1 
ATOM   2989 C  CE1 . PHE B 1 144 ? -16.213 3.920   -39.590 1.00 14.02 ? 146  PHE B CE1 1 
ATOM   2990 C  CE2 . PHE B 1 144 ? -15.426 1.686   -39.187 1.00 13.84 ? 146  PHE B CE2 1 
ATOM   2991 C  CZ  . PHE B 1 144 ? -15.493 3.014   -38.812 1.00 14.23 ? 146  PHE B CZ  1 
ATOM   2992 N  N   . LEU B 1 145 ? -19.706 2.421   -44.642 1.00 15.89 ? 147  LEU B N   1 
ATOM   2993 C  CA  . LEU B 1 145 ? -20.086 2.211   -46.037 1.00 17.20 ? 147  LEU B CA  1 
ATOM   2994 C  C   . LEU B 1 145 ? -18.867 2.506   -46.919 1.00 18.10 ? 147  LEU B C   1 
ATOM   2995 O  O   . LEU B 1 145 ? -18.316 3.607   -46.860 1.00 17.78 ? 147  LEU B O   1 
ATOM   2996 C  CB  . LEU B 1 145 ? -21.225 3.151   -46.455 1.00 18.07 ? 147  LEU B CB  1 
ATOM   2997 C  CG  . LEU B 1 145 ? -22.446 3.407   -45.569 1.00 19.41 ? 147  LEU B CG  1 
ATOM   2998 C  CD1 . LEU B 1 145 ? -23.549 4.071   -46.381 1.00 19.87 ? 147  LEU B CD1 1 
ATOM   2999 C  CD2 . LEU B 1 145 ? -22.983 2.160   -44.925 1.00 20.18 ? 147  LEU B CD2 1 
ATOM   3000 N  N   . GLU B 1 146 ? -18.458 1.511   -47.714 1.00 19.63 ? 148  GLU B N   1 
ATOM   3001 C  CA  . GLU B 1 146 ? -17.321 1.607   -48.630 1.00 21.75 ? 148  GLU B CA  1 
ATOM   3002 C  C   . GLU B 1 146 ? -17.772 1.443   -50.075 1.00 21.52 ? 148  GLU B C   1 
ATOM   3003 O  O   . GLU B 1 146 ? -18.874 0.991   -50.345 1.00 19.75 ? 148  GLU B O   1 
ATOM   3004 C  CB  . GLU B 1 146 ? -16.316 0.475   -48.356 1.00 23.45 ? 148  GLU B CB  1 
ATOM   3005 C  CG  . GLU B 1 146 ? -15.589 0.604   -47.051 1.00 25.91 ? 148  GLU B CG  1 
ATOM   3006 C  CD  . GLU B 1 146 ? -14.396 -0.316  -46.979 1.00 27.69 ? 148  GLU B CD  1 
ATOM   3007 O  OE1 . GLU B 1 146 ? -14.597 -1.551  -46.806 1.00 28.76 ? 148  GLU B OE1 1 
ATOM   3008 O  OE2 . GLU B 1 146 ? -13.269 0.219   -47.092 1.00 28.64 ? 148  GLU B OE2 1 
ATOM   3009 N  N   . GLU B 1 147 ? -16.869 1.769   -50.988 1.00 22.85 ? 149  GLU B N   1 
ATOM   3010 C  CA  . GLU B 1 147 ? -17.111 1.584   -52.424 1.00 24.51 ? 149  GLU B CA  1 
ATOM   3011 C  C   . GLU B 1 147 ? -16.841 0.143   -52.847 1.00 24.15 ? 149  GLU B C   1 
ATOM   3012 O  O   . GLU B 1 147 ? -15.773 -0.398  -52.563 1.00 24.14 ? 149  GLU B O   1 
ATOM   3013 C  CB  . GLU B 1 147 ? -16.245 2.526   -53.252 1.00 26.36 ? 149  GLU B CB  1 
ATOM   3014 C  CG  . GLU B 1 147 ? -16.659 2.540   -54.708 1.00 28.56 ? 149  GLU B CG  1 
ATOM   3015 C  CD  . GLU B 1 147 ? -15.740 3.362   -55.569 1.00 29.19 ? 149  GLU B CD  1 
ATOM   3016 O  OE1 . GLU B 1 147 ? -15.577 4.555   -55.292 1.00 30.24 ? 149  GLU B OE1 1 
ATOM   3017 O  OE2 . GLU B 1 147 ? -15.205 2.796   -56.527 1.00 32.47 ? 149  GLU B OE2 1 
ATOM   3018 N  N   . GLY B 1 148 ? -17.814 -0.458  -53.526 1.00 23.48 ? 150  GLY B N   1 
ATOM   3019 C  CA  . GLY B 1 148 ? -17.676 -1.786  -54.113 1.00 25.39 ? 150  GLY B CA  1 
ATOM   3020 C  C   . GLY B 1 148 ? -18.184 -1.771  -55.550 1.00 27.19 ? 150  GLY B C   1 
ATOM   3021 O  O   . GLY B 1 148 ? -18.684 -0.756  -56.012 1.00 26.26 ? 150  GLY B O   1 
ATOM   3022 N  N   . PRO B 1 149 ? -18.048 -2.891  -56.267 1.00 30.17 ? 151  PRO B N   1 
ATOM   3023 C  CA  . PRO B 1 149 ? -18.388 -2.881  -57.704 1.00 33.13 ? 151  PRO B CA  1 
ATOM   3024 C  C   . PRO B 1 149 ? -19.876 -2.974  -58.033 1.00 34.74 ? 151  PRO B C   1 
ATOM   3025 O  O   . PRO B 1 149 ? -20.257 -2.714  -59.174 1.00 37.81 ? 151  PRO B O   1 
ATOM   3026 C  CB  . PRO B 1 149 ? -17.637 -4.105  -58.246 1.00 32.02 ? 151  PRO B CB  1 
ATOM   3027 C  CG  . PRO B 1 149 ? -17.469 -5.002  -57.066 1.00 31.42 ? 151  PRO B CG  1 
ATOM   3028 C  CD  . PRO B 1 149 ? -17.283 -4.093  -55.890 1.00 30.90 ? 151  PRO B CD  1 
ATOM   3029 N  N   . GLU B 1 150 ? -20.706 -3.342  -57.065 1.00 34.30 ? 152  GLU B N   1 
ATOM   3030 C  CA  . GLU B 1 150 ? -22.119 -3.619  -57.333 1.00 35.90 ? 152  GLU B CA  1 
ATOM   3031 C  C   . GLU B 1 150 ? -23.058 -2.638  -56.651 1.00 33.24 ? 152  GLU B C   1 
ATOM   3032 O  O   . GLU B 1 150 ? -22.741 -2.072  -55.604 1.00 30.95 ? 152  GLU B O   1 
ATOM   3033 C  CB  . GLU B 1 150 ? -22.466 -5.036  -56.891 1.00 39.81 ? 152  GLU B CB  1 
ATOM   3034 C  CG  . GLU B 1 150 ? -21.316 -6.004  -57.092 1.00 44.96 ? 152  GLU B CG  1 
ATOM   3035 C  CD  . GLU B 1 150 ? -21.770 -7.378  -57.475 1.00 51.19 ? 152  GLU B CD  1 
ATOM   3036 O  OE1 . GLU B 1 150 ? -22.111 -7.542  -58.674 1.00 57.72 ? 152  GLU B OE1 1 
ATOM   3037 O  OE2 . GLU B 1 150 ? -21.765 -8.275  -56.591 1.00 50.81 ? 152  GLU B OE2 1 
ATOM   3038 N  N   . GLU B 1 151 ? -24.220 -2.454  -57.265 1.00 30.69 ? 153  GLU B N   1 
ATOM   3039 C  CA  . GLU B 1 151 ? -25.307 -1.683  -56.678 1.00 30.27 ? 153  GLU B CA  1 
ATOM   3040 C  C   . GLU B 1 151 ? -25.799 -2.420  -55.454 1.00 26.04 ? 153  GLU B C   1 
ATOM   3041 O  O   . GLU B 1 151 ? -26.092 -3.612  -55.530 1.00 24.13 ? 153  GLU B O   1 
ATOM   3042 C  CB  . GLU B 1 151 ? -26.465 -1.538  -57.666 1.00 32.73 ? 153  GLU B CB  1 
ATOM   3043 C  CG  . GLU B 1 151 ? -26.131 -0.676  -58.875 1.00 37.70 ? 153  GLU B CG  1 
ATOM   3044 C  CD  . GLU B 1 151 ? -25.949 0.785   -58.511 1.00 41.42 ? 153  GLU B CD  1 
ATOM   3045 O  OE1 . GLU B 1 151 ? -26.792 1.282   -57.740 1.00 48.12 ? 153  GLU B OE1 1 
ATOM   3046 O  OE2 . GLU B 1 151 ? -24.979 1.432   -58.977 1.00 38.84 ? 153  GLU B OE2 1 
ATOM   3047 N  N   . ASN B 1 152 ? -25.866 -1.721  -54.322 1.00 23.40 ? 154  ASN B N   1 
ATOM   3048 C  CA  . ASN B 1 152 ? -26.379 -2.311  -53.078 1.00 21.00 ? 154  ASN B CA  1 
ATOM   3049 C  C   . ASN B 1 152 ? -27.879 -2.220  -53.064 1.00 19.62 ? 154  ASN B C   1 
ATOM   3050 O  O   . ASN B 1 152 ? -28.412 -1.122  -53.128 1.00 19.88 ? 154  ASN B O   1 
ATOM   3051 C  CB  . ASN B 1 152 ? -25.796 -1.580  -51.853 1.00 20.30 ? 154  ASN B CB  1 
ATOM   3052 C  CG  . ASN B 1 152 ? -26.220 -2.210  -50.546 1.00 19.81 ? 154  ASN B CG  1 
ATOM   3053 O  OD1 . ASN B 1 152 ? -27.417 -2.255  -50.235 1.00 19.63 ? 154  ASN B OD1 1 
ATOM   3054 N  ND2 . ASN B 1 152 ? -25.256 -2.687  -49.764 1.00 18.88 ? 154  ASN B ND2 1 
ATOM   3055 N  N   . SER B 1 153 ? -28.559 -3.354  -52.938 1.00 19.81 ? 155  SER B N   1 
ATOM   3056 C  CA  . SER B 1 153 ? -30.030 -3.375  -53.029 1.00 21.17 ? 155  SER B CA  1 
ATOM   3057 C  C   . SER B 1 153 ? -30.706 -2.670  -51.867 1.00 20.87 ? 155  SER B C   1 
ATOM   3058 O  O   . SER B 1 153 ? -31.666 -1.923  -52.067 1.00 21.71 ? 155  SER B O   1 
ATOM   3059 C  CB  . SER B 1 153 ? -30.562 -4.799  -53.097 1.00 21.62 ? 155  SER B CB  1 
ATOM   3060 O  OG  . SER B 1 153 ? -30.040 -5.460  -54.232 1.00 24.32 ? 155  SER B OG  1 
ATOM   3061 N  N   . ALA B 1 154 ? -30.237 -2.940  -50.651 1.00 20.45 ? 156  ALA B N   1 
ATOM   3062 C  CA  . ALA B 1 154 ? -30.830 -2.335  -49.456 1.00 19.57 ? 156  ALA B CA  1 
ATOM   3063 C  C   . ALA B 1 154 ? -30.760 -0.817  -49.503 1.00 18.81 ? 156  ALA B C   1 
ATOM   3064 O  O   . ALA B 1 154 ? -31.760 -0.144  -49.288 1.00 19.04 ? 156  ALA B O   1 
ATOM   3065 C  CB  . ALA B 1 154 ? -30.154 -2.855  -48.211 1.00 20.68 ? 156  ALA B CB  1 
ATOM   3066 N  N   . TYR B 1 155 ? -29.574 -0.289  -49.786 1.00 18.59 ? 157  TYR B N   1 
ATOM   3067 C  CA  . TYR B 1 155 ? -29.358 1.151   -49.801 1.00 19.64 ? 157  TYR B CA  1 
ATOM   3068 C  C   . TYR B 1 155 ? -30.070 1.846   -50.966 1.00 20.67 ? 157  TYR B C   1 
ATOM   3069 O  O   . TYR B 1 155 ? -30.460 2.998   -50.829 1.00 20.10 ? 157  TYR B O   1 
ATOM   3070 C  CB  . TYR B 1 155 ? -27.853 1.490   -49.749 1.00 18.92 ? 157  TYR B CB  1 
ATOM   3071 C  CG  . TYR B 1 155 ? -27.328 1.316   -48.347 1.00 18.59 ? 157  TYR B CG  1 
ATOM   3072 C  CD1 . TYR B 1 155 ? -26.934 0.072   -47.877 1.00 18.42 ? 157  TYR B CD1 1 
ATOM   3073 C  CD2 . TYR B 1 155 ? -27.292 2.391   -47.453 1.00 19.74 ? 157  TYR B CD2 1 
ATOM   3074 C  CE1 . TYR B 1 155 ? -26.468 -0.085  -46.580 1.00 18.35 ? 157  TYR B CE1 1 
ATOM   3075 C  CE2 . TYR B 1 155 ? -26.843 2.232   -46.149 1.00 18.50 ? 157  TYR B CE2 1 
ATOM   3076 C  CZ  . TYR B 1 155 ? -26.436 0.989   -45.718 1.00 17.91 ? 157  TYR B CZ  1 
ATOM   3077 O  OH  . TYR B 1 155 ? -25.986 0.819   -44.417 1.00 16.98 ? 157  TYR B OH  1 
ATOM   3078 N  N   . GLU B 1 156 ? -30.281 1.133   -52.075 1.00 23.34 ? 158  GLU B N   1 
ATOM   3079 C  CA  . GLU B 1 156 ? -31.029 1.689   -53.224 1.00 25.80 ? 158  GLU B CA  1 
ATOM   3080 C  C   . GLU B 1 156 ? -32.446 2.151   -52.864 1.00 24.44 ? 158  GLU B C   1 
ATOM   3081 O  O   . GLU B 1 156 ? -32.922 3.153   -53.399 1.00 23.38 ? 158  GLU B O   1 
ATOM   3082 C  CB  . GLU B 1 156 ? -31.060 0.682   -54.391 1.00 28.97 ? 158  GLU B CB  1 
ATOM   3083 C  CG  . GLU B 1 156 ? -31.603 1.229   -55.709 1.00 32.46 ? 158  GLU B CG  1 
ATOM   3084 C  CD  . GLU B 1 156 ? -30.879 2.475   -56.208 1.00 35.91 ? 158  GLU B CD  1 
ATOM   3085 O  OE1 . GLU B 1 156 ? -29.669 2.719   -55.873 1.00 35.04 ? 158  GLU B OE1 1 
ATOM   3086 O  OE2 . GLU B 1 156 ? -31.551 3.225   -56.952 1.00 40.35 ? 158  GLU B OE2 1 
ATOM   3087 N  N   . GLN B 1 157 ? -33.093 1.445   -51.931 1.00 23.22 ? 159  GLN B N   1 
ATOM   3088 C  CA  . GLN B 1 157 ? -34.398 1.856   -51.413 1.00 22.22 ? 159  GLN B CA  1 
ATOM   3089 C  C   . GLN B 1 157 ? -34.381 3.248   -50.757 1.00 23.90 ? 159  GLN B C   1 
ATOM   3090 O  O   . GLN B 1 157 ? -35.386 3.964   -50.779 1.00 23.11 ? 159  GLN B O   1 
ATOM   3091 C  CB  . GLN B 1 157 ? -34.909 0.853   -50.389 1.00 22.90 ? 159  GLN B CB  1 
ATOM   3092 C  CG  . GLN B 1 157 ? -35.201 -0.532  -50.935 1.00 22.81 ? 159  GLN B CG  1 
ATOM   3093 C  CD  . GLN B 1 157 ? -35.229 -1.585  -49.832 1.00 24.56 ? 159  GLN B CD  1 
ATOM   3094 O  OE1 . GLN B 1 157 ? -34.260 -1.725  -49.060 1.00 25.47 ? 159  GLN B OE1 1 
ATOM   3095 N  NE2 . GLN B 1 157 ? -36.312 -2.345  -49.757 1.00 23.71 ? 159  GLN B NE2 1 
ATOM   3096 N  N   . LEU B 1 158 ? -33.266 3.615   -50.130 1.00 23.13 ? 160  LEU B N   1 
ATOM   3097 C  CA  . LEU B 1 158 ? -33.132 4.938   -49.530 1.00 24.00 ? 160  LEU B CA  1 
ATOM   3098 C  C   . LEU B 1 158 ? -32.638 5.975   -50.530 1.00 23.29 ? 160  LEU B C   1 
ATOM   3099 O  O   . LEU B 1 158 ? -33.204 7.074   -50.650 1.00 22.72 ? 160  LEU B O   1 
ATOM   3100 C  CB  . LEU B 1 158 ? -32.175 4.859   -48.342 1.00 24.72 ? 160  LEU B CB  1 
ATOM   3101 C  CG  . LEU B 1 158 ? -32.614 3.898   -47.237 1.00 25.07 ? 160  LEU B CG  1 
ATOM   3102 C  CD1 . LEU B 1 158 ? -31.592 3.902   -46.104 1.00 25.36 ? 160  LEU B CD1 1 
ATOM   3103 C  CD2 . LEU B 1 158 ? -34.004 4.247   -46.712 1.00 25.42 ? 160  LEU B CD2 1 
ATOM   3104 N  N   . LEU B 1 159 ? -31.594 5.606   -51.258 1.00 23.33 ? 161  LEU B N   1 
ATOM   3105 C  CA  . LEU B 1 159 ? -30.892 6.526   -52.159 1.00 24.60 ? 161  LEU B CA  1 
ATOM   3106 C  C   . LEU B 1 159 ? -31.783 6.992   -53.307 1.00 25.74 ? 161  LEU B C   1 
ATOM   3107 O  O   . LEU B 1 159 ? -31.801 8.178   -53.627 1.00 24.02 ? 161  LEU B O   1 
ATOM   3108 C  CB  . LEU B 1 159 ? -29.617 5.883   -52.692 1.00 25.26 ? 161  LEU B CB  1 
ATOM   3109 C  CG  . LEU B 1 159 ? -28.572 5.594   -51.582 1.00 25.94 ? 161  LEU B CG  1 
ATOM   3110 C  CD1 . LEU B 1 159 ? -27.428 4.782   -52.144 1.00 26.03 ? 161  LEU B CD1 1 
ATOM   3111 C  CD2 . LEU B 1 159 ? -28.047 6.890   -50.964 1.00 26.58 ? 161  LEU B CD2 1 
ATOM   3112 N  N   . SER B 1 160 ? -32.557 6.068   -53.869 1.00 25.41 ? 162  SER B N   1 
ATOM   3113 C  CA  . SER B 1 160 ? -33.485 6.390   -54.957 1.00 26.94 ? 162  SER B CA  1 
ATOM   3114 C  C   . SER B 1 160 ? -34.561 7.416   -54.554 1.00 28.45 ? 162  SER B C   1 
ATOM   3115 O  O   . SER B 1 160 ? -35.154 8.032   -55.432 1.00 28.80 ? 162  SER B O   1 
ATOM   3116 C  CB  . SER B 1 160 ? -34.149 5.112   -55.501 1.00 25.69 ? 162  SER B CB  1 
ATOM   3117 O  OG  . SER B 1 160 ? -35.064 4.569   -54.556 1.00 24.82 ? 162  SER B OG  1 
ATOM   3118 N  N   . ARG B 1 161 ? -34.813 7.590   -53.250 1.00 29.94 ? 163  ARG B N   1 
ATOM   3119 C  CA  . ARG B 1 161 ? -35.783 8.575   -52.745 1.00 30.39 ? 163  ARG B CA  1 
ATOM   3120 C  C   . ARG B 1 161 ? -35.228 9.932   -52.327 1.00 28.09 ? 163  ARG B C   1 
ATOM   3121 O  O   . ARG B 1 161 ? -35.992 10.788  -51.855 1.00 28.12 ? 163  ARG B O   1 
ATOM   3122 C  CB  . ARG B 1 161 ? -36.538 7.990   -51.544 1.00 34.65 ? 163  ARG B CB  1 
ATOM   3123 C  CG  . ARG B 1 161 ? -37.174 6.637   -51.795 1.00 38.68 ? 163  ARG B CG  1 
ATOM   3124 C  CD  . ARG B 1 161 ? -37.952 6.600   -53.092 1.00 42.31 ? 163  ARG B CD  1 
ATOM   3125 N  NE  . ARG B 1 161 ? -39.074 5.673   -53.019 1.00 47.88 ? 163  ARG B NE  1 
ATOM   3126 C  CZ  . ARG B 1 161 ? -40.331 6.002   -52.710 1.00 52.66 ? 163  ARG B CZ  1 
ATOM   3127 N  NH1 . ARG B 1 161 ? -40.688 7.262   -52.421 1.00 50.29 ? 163  ARG B NH1 1 
ATOM   3128 N  NH2 . ARG B 1 161 ? -41.255 5.044   -52.688 1.00 54.46 ? 163  ARG B NH2 1 
ATOM   3129 N  N   . LEU B 1 162 ? -33.925 10.146  -52.467 1.00 24.69 ? 164  LEU B N   1 
ATOM   3130 C  CA  . LEU B 1 162 ? -33.332 11.397  -52.002 1.00 24.59 ? 164  LEU B CA  1 
ATOM   3131 C  C   . LEU B 1 162 ? -33.731 12.611  -52.859 1.00 25.69 ? 164  LEU B C   1 
ATOM   3132 O  O   . LEU B 1 162 ? -33.886 13.706  -52.323 1.00 24.18 ? 164  LEU B O   1 
ATOM   3133 C  CB  . LEU B 1 162 ? -31.815 11.274  -51.912 1.00 23.01 ? 164  LEU B CB  1 
ATOM   3134 C  CG  . LEU B 1 162 ? -31.322 10.260  -50.867 1.00 22.72 ? 164  LEU B CG  1 
ATOM   3135 C  CD1 . LEU B 1 162 ? -29.810 10.296  -50.861 1.00 23.11 ? 164  LEU B CD1 1 
ATOM   3136 C  CD2 . LEU B 1 162 ? -31.861 10.521  -49.477 1.00 22.28 ? 164  LEU B CD2 1 
ATOM   3137 N  N   . GLU B 1 163 ? -33.923 12.402  -54.164 1.00 29.22 ? 165  GLU B N   1 
ATOM   3138 C  CA  . GLU B 1 163 ? -34.430 13.461  -55.062 1.00 32.06 ? 165  GLU B CA  1 
ATOM   3139 C  C   . GLU B 1 163 ? -35.757 14.049  -54.575 1.00 32.42 ? 165  GLU B C   1 
ATOM   3140 O  O   . GLU B 1 163 ? -35.955 15.265  -54.614 1.00 33.81 ? 165  GLU B O   1 
ATOM   3141 C  CB  . GLU B 1 163 ? -34.584 12.936  -56.495 1.00 33.14 ? 165  GLU B CB  1 
ATOM   3142 N  N   . GLU B 1 164 ? -36.644 13.192  -54.073 1.00 32.72 ? 166  GLU B N   1 
ATOM   3143 C  CA  . GLU B 1 164 ? -37.891 13.658  -53.460 1.00 33.27 ? 166  GLU B CA  1 
ATOM   3144 C  C   . GLU B 1 164 ? -37.701 14.592  -52.281 1.00 32.63 ? 166  GLU B C   1 
ATOM   3145 O  O   . GLU B 1 164 ? -38.622 15.341  -51.968 1.00 31.33 ? 166  GLU B O   1 
ATOM   3146 C  CB  . GLU B 1 164 ? -38.722 12.493  -52.932 1.00 35.95 ? 166  GLU B CB  1 
ATOM   3147 C  CG  . GLU B 1 164 ? -39.341 11.635  -53.995 1.00 40.67 ? 166  GLU B CG  1 
ATOM   3148 C  CD  . GLU B 1 164 ? -39.983 10.409  -53.413 1.00 43.05 ? 166  GLU B CD  1 
ATOM   3149 O  OE1 . GLU B 1 164 ? -40.632 10.524  -52.348 1.00 45.45 ? 166  GLU B OE1 1 
ATOM   3150 O  OE2 . GLU B 1 164 ? -39.825 9.325   -54.013 1.00 47.49 ? 166  GLU B OE2 1 
ATOM   3151 N  N   . ILE B 1 165 ? -36.563 14.510  -51.582 1.00 29.32 ? 167  ILE B N   1 
ATOM   3152 C  CA  . ILE B 1 165 ? -36.380 15.292  -50.353 1.00 29.13 ? 167  ILE B CA  1 
ATOM   3153 C  C   . ILE B 1 165 ? -35.147 16.190  -50.399 1.00 29.06 ? 167  ILE B C   1 
ATOM   3154 O  O   . ILE B 1 165 ? -34.556 16.511  -49.369 1.00 26.80 ? 167  ILE B O   1 
ATOM   3155 C  CB  . ILE B 1 165 ? -36.400 14.389  -49.089 1.00 28.00 ? 167  ILE B CB  1 
ATOM   3156 C  CG1 . ILE B 1 165 ? -35.321 13.299  -49.157 1.00 27.62 ? 167  ILE B CG1 1 
ATOM   3157 C  CG2 . ILE B 1 165 ? -37.774 13.753  -48.947 1.00 28.21 ? 167  ILE B CG2 1 
ATOM   3158 C  CD1 . ILE B 1 165 ? -35.020 12.632  -47.821 1.00 28.06 ? 167  ILE B CD1 1 
ATOM   3159 N  N   . ALA B 1 166 ? -34.818 16.663  -51.601 1.00 30.33 ? 168  ALA B N   1 
ATOM   3160 C  CA  . ALA B 1 166 ? -33.610 17.448  -51.830 1.00 30.21 ? 168  ALA B CA  1 
ATOM   3161 C  C   . ALA B 1 166 ? -33.563 18.734  -50.988 1.00 30.77 ? 168  ALA B C   1 
ATOM   3162 O  O   . ALA B 1 166 ? -32.497 19.111  -50.503 1.00 31.22 ? 168  ALA B O   1 
ATOM   3163 C  CB  . ALA B 1 166 ? -33.479 17.761  -53.314 1.00 32.15 ? 168  ALA B CB  1 
ATOM   3164 N  N   . GLU B 1 167 ? -34.715 19.381  -50.788 1.00 30.47 ? 169  GLU B N   1 
ATOM   3165 C  CA  . GLU B 1 167 ? -34.792 20.623  -50.020 1.00 31.34 ? 169  GLU B CA  1 
ATOM   3166 C  C   . GLU B 1 167 ? -34.741 20.318  -48.535 1.00 32.45 ? 169  GLU B C   1 
ATOM   3167 O  O   . GLU B 1 167 ? -35.425 19.412  -48.052 1.00 32.80 ? 169  GLU B O   1 
ATOM   3168 C  CB  . GLU B 1 167 ? -36.084 21.404  -50.334 1.00 29.41 ? 169  GLU B CB  1 
ATOM   3169 N  N   . GLU B 1 168 ? -33.936 21.093  -47.817 1.00 32.83 ? 170  GLU B N   1 
ATOM   3170 C  CA  . GLU B 1 168 ? -33.888 21.047  -46.363 1.00 33.54 ? 170  GLU B CA  1 
ATOM   3171 C  C   . GLU B 1 168 ? -35.284 21.127  -45.769 1.00 32.54 ? 170  GLU B C   1 
ATOM   3172 O  O   . GLU B 1 168 ? -36.073 21.991  -46.151 1.00 33.23 ? 170  GLU B O   1 
ATOM   3173 C  CB  . GLU B 1 168 ? -33.054 22.229  -45.847 1.00 36.61 ? 170  GLU B CB  1 
ATOM   3174 C  CG  . GLU B 1 168 ? -33.005 22.381  -44.329 1.00 39.40 ? 170  GLU B CG  1 
ATOM   3175 C  CD  . GLU B 1 168 ? -32.284 23.644  -43.883 1.00 43.36 ? 170  GLU B CD  1 
ATOM   3176 O  OE1 . GLU B 1 168 ? -32.229 24.621  -44.652 1.00 42.76 ? 170  GLU B OE1 1 
ATOM   3177 O  OE2 . GLU B 1 168 ? -31.781 23.664  -42.740 1.00 49.77 ? 170  GLU B OE2 1 
ATOM   3178 N  N   . GLY B 1 169 ? -35.582 20.249  -44.817 1.00 29.27 ? 171  GLY B N   1 
ATOM   3179 C  CA  . GLY B 1 169 ? -36.885 20.240  -44.169 1.00 29.49 ? 171  GLY B CA  1 
ATOM   3180 C  C   . GLY B 1 169 ? -37.957 19.424  -44.880 1.00 30.06 ? 171  GLY B C   1 
ATOM   3181 O  O   . GLY B 1 169 ? -39.014 19.203  -44.319 1.00 32.16 ? 171  GLY B O   1 
ATOM   3182 N  N   . SER B 1 170 ? -37.707 18.957  -46.099 1.00 30.37 ? 172  SER B N   1 
ATOM   3183 C  CA  . SER B 1 170 ? -38.700 18.170  -46.795 1.00 30.62 ? 172  SER B CA  1 
ATOM   3184 C  C   . SER B 1 170 ? -38.668 16.720  -46.315 1.00 32.34 ? 172  SER B C   1 
ATOM   3185 O  O   . SER B 1 170 ? -37.640 16.226  -45.811 1.00 32.75 ? 172  SER B O   1 
ATOM   3186 C  CB  . SER B 1 170 ? -38.494 18.240  -48.299 1.00 29.85 ? 172  SER B CB  1 
ATOM   3187 O  OG  . SER B 1 170 ? -37.214 17.794  -48.658 1.00 29.16 ? 172  SER B OG  1 
ATOM   3188 N  N   . GLU B 1 171 ? -39.804 16.055  -46.469 1.00 31.29 ? 173  GLU B N   1 
ATOM   3189 C  CA  . GLU B 1 171 ? -39.939 14.655  -46.129 1.00 32.37 ? 173  GLU B CA  1 
ATOM   3190 C  C   . GLU B 1 171 ? -40.804 13.901  -47.131 1.00 32.20 ? 173  GLU B C   1 
ATOM   3191 O  O   . GLU B 1 171 ? -41.489 14.506  -47.940 1.00 30.69 ? 173  GLU B O   1 
ATOM   3192 C  CB  . GLU B 1 171 ? -40.540 14.521  -44.742 1.00 32.47 ? 173  GLU B CB  1 
ATOM   3193 C  CG  . GLU B 1 171 ? -41.953 15.027  -44.632 1.00 33.82 ? 173  GLU B CG  1 
ATOM   3194 C  CD  . GLU B 1 171 ? -42.425 14.948  -43.220 1.00 34.41 ? 173  GLU B CD  1 
ATOM   3195 O  OE1 . GLU B 1 171 ? -42.017 15.812  -42.431 1.00 36.86 ? 173  GLU B OE1 1 
ATOM   3196 O  OE2 . GLU B 1 171 ? -43.162 14.008  -42.893 1.00 33.68 ? 173  GLU B OE2 1 
ATOM   3197 N  N   . THR B 1 172 ? -40.768 12.574  -47.038 1.00 30.08 ? 174  THR B N   1 
ATOM   3198 C  CA  . THR B 1 172 ? -41.553 11.705  -47.889 1.00 29.89 ? 174  THR B CA  1 
ATOM   3199 C  C   . THR B 1 172 ? -41.796 10.355  -47.196 1.00 30.34 ? 174  THR B C   1 
ATOM   3200 O  O   . THR B 1 172 ? -41.134 10.030  -46.220 1.00 29.60 ? 174  THR B O   1 
ATOM   3201 C  CB  . THR B 1 172 ? -40.894 11.554  -49.278 1.00 29.82 ? 174  THR B CB  1 
ATOM   3202 O  OG1 . THR B 1 172 ? -41.782 10.853  -50.145 1.00 30.92 ? 174  THR B OG1 1 
ATOM   3203 C  CG2 . THR B 1 172 ? -39.562 10.822  -49.217 1.00 30.13 ? 174  THR B CG2 1 
ATOM   3204 N  N   . GLN B 1 173 ? -42.791 9.607   -47.664 1.00 30.91 ? 175  GLN B N   1 
ATOM   3205 C  CA  . GLN B 1 173 ? -43.093 8.288   -47.124 1.00 30.49 ? 175  GLN B CA  1 
ATOM   3206 C  C   . GLN B 1 173 ? -42.504 7.265   -48.065 1.00 28.89 ? 175  GLN B C   1 
ATOM   3207 O  O   . GLN B 1 173 ? -42.634 7.387   -49.279 1.00 27.91 ? 175  GLN B O   1 
ATOM   3208 C  CB  . GLN B 1 173 ? -44.598 8.083   -46.971 1.00 32.55 ? 175  GLN B CB  1 
ATOM   3209 C  CG  . GLN B 1 173 ? -45.266 9.078   -46.017 1.00 34.18 ? 175  GLN B CG  1 
ATOM   3210 C  CD  . GLN B 1 173 ? -44.929 8.827   -44.547 1.00 35.01 ? 175  GLN B CD  1 
ATOM   3211 O  OE1 . GLN B 1 173 ? -45.268 7.784   -43.987 1.00 35.90 ? 175  GLN B OE1 1 
ATOM   3212 N  NE2 . GLN B 1 173 ? -44.289 9.792   -43.914 1.00 34.89 ? 175  GLN B NE2 1 
ATOM   3213 N  N   . VAL B 1 174 ? -41.818 6.271   -47.509 1.00 26.75 ? 176  VAL B N   1 
ATOM   3214 C  CA  . VAL B 1 174 ? -41.202 5.230   -48.321 1.00 25.82 ? 176  VAL B CA  1 
ATOM   3215 C  C   . VAL B 1 174 ? -41.731 3.890   -47.869 1.00 24.54 ? 176  VAL B C   1 
ATOM   3216 O  O   . VAL B 1 174 ? -42.127 3.739   -46.703 1.00 24.11 ? 176  VAL B O   1 
ATOM   3217 C  CB  . VAL B 1 174 ? -39.659 5.281   -48.262 1.00 25.87 ? 176  VAL B CB  1 
ATOM   3218 C  CG1 . VAL B 1 174 ? -39.196 6.692   -48.579 1.00 26.30 ? 176  VAL B CG1 1 
ATOM   3219 C  CG2 . VAL B 1 174 ? -39.121 4.834   -46.902 1.00 25.66 ? 176  VAL B CG2 1 
ATOM   3220 N  N   . PRO B 1 175 ? -41.769 2.909   -48.785 1.00 24.47 ? 177  PRO B N   1 
ATOM   3221 C  CA  . PRO B 1 175 ? -42.219 1.584   -48.351 1.00 25.22 ? 177  PRO B CA  1 
ATOM   3222 C  C   . PRO B 1 175 ? -41.295 0.980   -47.297 1.00 25.19 ? 177  PRO B C   1 
ATOM   3223 O  O   . PRO B 1 175 ? -40.108 1.341   -47.221 1.00 25.00 ? 177  PRO B O   1 
ATOM   3224 C  CB  . PRO B 1 175 ? -42.177 0.740   -49.625 1.00 25.76 ? 177  PRO B CB  1 
ATOM   3225 C  CG  . PRO B 1 175 ? -41.466 1.549   -50.652 1.00 26.68 ? 177  PRO B CG  1 
ATOM   3226 C  CD  . PRO B 1 175 ? -41.553 2.983   -50.239 1.00 24.98 ? 177  PRO B CD  1 
ATOM   3227 N  N   . GLY B 1 176 ? -41.847 0.076   -46.501 1.00 23.96 ? 178  GLY B N   1 
ATOM   3228 C  CA  . GLY B 1 176 ? -41.070 -0.677  -45.543 1.00 24.10 ? 178  GLY B CA  1 
ATOM   3229 C  C   . GLY B 1 176 ? -39.996 -1.484  -46.227 1.00 23.95 ? 178  GLY B C   1 
ATOM   3230 O  O   . GLY B 1 176 ? -40.127 -1.835  -47.401 1.00 25.34 ? 178  GLY B O   1 
ATOM   3231 N  N   . LEU B 1 177 ? -38.908 -1.715  -45.491 1.00 22.38 ? 179  LEU B N   1 
ATOM   3232 C  CA  . LEU B 1 177 ? -37.739 -2.418  -45.988 1.00 20.95 ? 179  LEU B CA  1 
ATOM   3233 C  C   . LEU B 1 177 ? -37.086 -3.198  -44.856 1.00 20.33 ? 179  LEU B C   1 
ATOM   3234 O  O   . LEU B 1 177 ? -37.321 -2.917  -43.671 1.00 19.21 ? 179  LEU B O   1 
ATOM   3235 C  CB  . LEU B 1 177 ? -36.720 -1.425  -46.571 1.00 21.20 ? 179  LEU B CB  1 
ATOM   3236 C  CG  . LEU B 1 177 ? -36.062 -0.430  -45.604 1.00 21.32 ? 179  LEU B CG  1 
ATOM   3237 C  CD1 . LEU B 1 177 ? -34.629 -0.123  -46.009 1.00 22.62 ? 179  LEU B CD1 1 
ATOM   3238 C  CD2 . LEU B 1 177 ? -36.841 0.861   -45.478 1.00 23.04 ? 179  LEU B CD2 1 
ATOM   3239 N  N   . ASP B 1 178 ? -36.235 -4.150  -45.220 1.00 18.61 ? 180  ASP B N   1 
ATOM   3240 C  CA  . ASP B 1 178 ? -35.484 -4.890  -44.230 1.00 18.21 ? 180  ASP B CA  1 
ATOM   3241 C  C   . ASP B 1 178 ? -34.335 -4.011  -43.708 1.00 17.26 ? 180  ASP B C   1 
ATOM   3242 O  O   . ASP B 1 178 ? -33.315 -3.820  -44.381 1.00 16.60 ? 180  ASP B O   1 
ATOM   3243 C  CB  . ASP B 1 178 ? -34.940 -6.161  -44.847 1.00 19.81 ? 180  ASP B CB  1 
ATOM   3244 C  CG  . ASP B 1 178 ? -34.246 -7.055  -43.844 1.00 20.35 ? 180  ASP B CG  1 
ATOM   3245 O  OD1 . ASP B 1 178 ? -34.071 -6.702  -42.648 1.00 19.97 ? 180  ASP B OD1 1 
ATOM   3246 O  OD2 . ASP B 1 178 ? -33.890 -8.154  -44.291 1.00 21.39 ? 180  ASP B OD2 1 
ATOM   3247 N  N   . ILE B 1 179 ? -34.515 -3.488  -42.505 1.00 16.64 ? 181  ILE B N   1 
ATOM   3248 C  CA  . ILE B 1 179 ? -33.513 -2.607  -41.890 1.00 16.88 ? 181  ILE B CA  1 
ATOM   3249 C  C   . ILE B 1 179 ? -32.219 -3.379  -41.608 1.00 16.46 ? 181  ILE B C   1 
ATOM   3250 O  O   . ILE B 1 179 ? -31.133 -2.809  -41.700 1.00 16.16 ? 181  ILE B O   1 
ATOM   3251 C  CB  . ILE B 1 179 ? -34.067 -1.957  -40.593 1.00 17.00 ? 181  ILE B CB  1 
ATOM   3252 C  CG1 . ILE B 1 179 ? -35.355 -1.181  -40.870 1.00 17.59 ? 181  ILE B CG1 1 
ATOM   3253 C  CG2 . ILE B 1 179 ? -33.037 -1.032  -39.926 1.00 16.28 ? 181  ILE B CG2 1 
ATOM   3254 C  CD1 . ILE B 1 179 ? -35.241 -0.090  -41.917 1.00 17.99 ? 181  ILE B CD1 1 
ATOM   3255 N  N   . SER B 1 180 ? -32.327 -4.674  -41.284 1.00 16.07 ? 182  SER B N   1 
ATOM   3256 C  CA  . SER B 1 180 ? -31.144 -5.497  -41.000 1.00 15.84 ? 182  SER B CA  1 
ATOM   3257 C  C   . SER B 1 180 ? -30.251 -5.725  -42.222 1.00 16.34 ? 182  SER B C   1 
ATOM   3258 O  O   . SER B 1 180 ? -29.046 -5.981  -42.067 1.00 16.45 ? 182  SER B O   1 
ATOM   3259 C  CB  . SER B 1 180 ? -31.519 -6.829  -40.313 1.00 16.69 ? 182  SER B CB  1 
ATOM   3260 O  OG  . SER B 1 180 ? -32.094 -7.762  -41.220 1.00 16.50 ? 182  SER B OG  1 
ATOM   3261 N  N   . ALA B 1 181 ? -30.816 -5.616  -43.431 1.00 15.77 ? 183  ALA B N   1 
ATOM   3262 C  CA  . ALA B 1 181 ? -30.051 -5.744  -44.668 1.00 15.05 ? 183  ALA B CA  1 
ATOM   3263 C  C   . ALA B 1 181 ? -29.124 -4.564  -44.951 1.00 15.21 ? 183  ALA B C   1 
ATOM   3264 O  O   . ALA B 1 181 ? -28.260 -4.670  -45.803 1.00 15.50 ? 183  ALA B O   1 
ATOM   3265 C  CB  . ALA B 1 181 ? -31.000 -5.951  -45.861 1.00 15.27 ? 183  ALA B CB  1 
ATOM   3266 N  N   . LEU B 1 182 ? -29.311 -3.448  -44.250 1.00 14.92 ? 184  LEU B N   1 
ATOM   3267 C  CA  . LEU B 1 182 ? -28.405 -2.297  -44.315 1.00 14.77 ? 184  LEU B CA  1 
ATOM   3268 C  C   . LEU B 1 182 ? -27.106 -2.500  -43.527 1.00 15.38 ? 184  LEU B C   1 
ATOM   3269 O  O   . LEU B 1 182 ? -26.212 -1.646  -43.596 1.00 14.75 ? 184  LEU B O   1 
ATOM   3270 C  CB  . LEU B 1 182 ? -29.113 -1.053  -43.761 1.00 14.84 ? 184  LEU B CB  1 
ATOM   3271 C  CG  . LEU B 1 182 ? -30.430 -0.632  -44.413 1.00 15.00 ? 184  LEU B CG  1 
ATOM   3272 C  CD1 . LEU B 1 182 ? -31.172 0.387   -43.571 1.00 15.37 ? 184  LEU B CD1 1 
ATOM   3273 C  CD2 . LEU B 1 182 ? -30.165 -0.077  -45.813 1.00 15.78 ? 184  LEU B CD2 1 
ATOM   3274 N  N   . LEU B 1 183 ? -26.994 -3.618  -42.791 1.00 15.33 ? 185  LEU B N   1 
ATOM   3275 C  CA  . LEU B 1 183 ? -25.902 -3.827  -41.864 1.00 15.14 ? 185  LEU B CA  1 
ATOM   3276 C  C   . LEU B 1 183 ? -24.974 -4.937  -42.336 1.00 14.84 ? 185  LEU B C   1 
ATOM   3277 O  O   . LEU B 1 183 ? -25.345 -5.733  -43.193 1.00 13.98 ? 185  LEU B O   1 
ATOM   3278 C  CB  . LEU B 1 183 ? -26.434 -4.133  -40.455 1.00 15.32 ? 185  LEU B CB  1 
ATOM   3279 C  CG  . LEU B 1 183 ? -27.335 -3.054  -39.865 1.00 15.60 ? 185  LEU B CG  1 
ATOM   3280 C  CD1 . LEU B 1 183 ? -27.929 -3.529  -38.539 1.00 16.45 ? 185  LEU B CD1 1 
ATOM   3281 C  CD2 . LEU B 1 183 ? -26.568 -1.757  -39.689 1.00 16.56 ? 185  LEU B CD2 1 
ATOM   3282 N  N   . PRO B 1 184 ? -23.750 -4.986  -41.772 1.00 14.67 ? 186  PRO B N   1 
ATOM   3283 C  CA  . PRO B 1 184 ? -22.771 -5.959  -42.223 1.00 14.66 ? 186  PRO B CA  1 
ATOM   3284 C  C   . PRO B 1 184 ? -23.114 -7.409  -41.897 1.00 15.21 ? 186  PRO B C   1 
ATOM   3285 O  O   . PRO B 1 184 ? -24.108 -7.703  -41.232 1.00 14.76 ? 186  PRO B O   1 
ATOM   3286 C  CB  . PRO B 1 184 ? -21.467 -5.506  -41.512 1.00 14.83 ? 186  PRO B CB  1 
ATOM   3287 C  CG  . PRO B 1 184 ? -21.681 -4.092  -41.162 1.00 14.50 ? 186  PRO B CG  1 
ATOM   3288 C  CD  . PRO B 1 184 ? -23.144 -4.012  -40.840 1.00 14.76 ? 186  PRO B CD  1 
ATOM   3289 N  N   . SER B 1 185 ? -22.256 -8.306  -42.373 1.00 16.64 ? 187  SER B N   1 
ATOM   3290 C  CA  . SER B 1 185 ? -22.495 -9.733  -42.309 1.00 17.48 ? 187  SER B CA  1 
ATOM   3291 C  C   . SER B 1 185 ? -22.404 -10.366 -40.916 1.00 17.39 ? 187  SER B C   1 
ATOM   3292 O  O   . SER B 1 185 ? -23.295 -11.118 -40.510 1.00 16.83 ? 187  SER B O   1 
ATOM   3293 C  CB  . SER B 1 185 ? -21.531 -10.446 -43.273 1.00 18.74 ? 187  SER B CB  1 
ATOM   3294 O  OG  . SER B 1 185 ? -21.689 -11.844 -43.147 1.00 21.45 ? 187  SER B OG  1 
ATOM   3295 N  N   . ASP B 1 186 ? -21.333 -10.076 -40.184 1.00 16.56 ? 188  ASP B N   1 
ATOM   3296 C  CA  . ASP B 1 186 ? -21.031 -10.797 -38.969 1.00 17.23 ? 188  ASP B CA  1 
ATOM   3297 C  C   . ASP B 1 186 ? -21.410 -9.969  -37.722 1.00 17.03 ? 188  ASP B C   1 
ATOM   3298 O  O   . ASP B 1 186 ? -20.699 -9.048  -37.337 1.00 17.11 ? 188  ASP B O   1 
ATOM   3299 C  CB  . ASP B 1 186 ? -19.533 -11.202 -38.985 1.00 18.85 ? 188  ASP B CB  1 
ATOM   3300 C  CG  . ASP B 1 186 ? -19.183 -12.230 -37.921 1.00 19.67 ? 188  ASP B CG  1 
ATOM   3301 O  OD1 . ASP B 1 186 ? -19.941 -12.370 -36.939 1.00 19.65 ? 188  ASP B OD1 1 
ATOM   3302 O  OD2 . ASP B 1 186 ? -18.142 -12.907 -38.064 1.00 19.96 ? 188  ASP B OD2 1 
ATOM   3303 N  N   . PHE B 1 187 ? -22.529 -10.317 -37.088 1.00 15.32 ? 189  PHE B N   1 
ATOM   3304 C  CA  . PHE B 1 187 ? -22.971 -9.642  -35.855 1.00 14.93 ? 189  PHE B CA  1 
ATOM   3305 C  C   . PHE B 1 187 ? -22.162 -9.998  -34.599 1.00 14.13 ? 189  PHE B C   1 
ATOM   3306 O  O   . PHE B 1 187 ? -22.465 -9.467  -33.538 1.00 13.44 ? 189  PHE B O   1 
ATOM   3307 C  CB  . PHE B 1 187 ? -24.451 -9.932  -35.586 1.00 14.70 ? 189  PHE B CB  1 
ATOM   3308 C  CG  . PHE B 1 187 ? -25.409 -9.190  -36.485 1.00 14.63 ? 189  PHE B CG  1 
ATOM   3309 C  CD1 . PHE B 1 187 ? -24.995 -8.506  -37.638 1.00 14.51 ? 189  PHE B CD1 1 
ATOM   3310 C  CD2 . PHE B 1 187 ? -26.776 -9.241  -36.203 1.00 14.52 ? 189  PHE B CD2 1 
ATOM   3311 C  CE1 . PHE B 1 187 ? -25.924 -7.841  -38.446 1.00 14.55 ? 189  PHE B CE1 1 
ATOM   3312 C  CE2 . PHE B 1 187 ? -27.696 -8.599  -37.021 1.00 14.60 ? 189  PHE B CE2 1 
ATOM   3313 C  CZ  . PHE B 1 187 ? -27.271 -7.905  -38.143 1.00 14.36 ? 189  PHE B CZ  1 
ATOM   3314 N  N   . SER B 1 188 ? -21.162 -10.877 -34.745 1.00 14.11 ? 190  SER B N   1 
ATOM   3315 C  CA  . SER B 1 188 ? -20.230 -11.254 -33.676 1.00 14.85 ? 190  SER B CA  1 
ATOM   3316 C  C   . SER B 1 188 ? -18.955 -10.422 -33.587 1.00 14.46 ? 190  SER B C   1 
ATOM   3317 O  O   . SER B 1 188 ? -18.226 -10.559 -32.602 1.00 15.52 ? 190  SER B O   1 
ATOM   3318 C  CB  . SER B 1 188 ? -19.855 -12.748 -33.787 1.00 13.97 ? 190  SER B CB  1 
ATOM   3319 O  OG  . SER B 1 188 ? -18.825 -12.985 -34.744 1.00 14.45 ? 190  SER B OG  1 
ATOM   3320 N  N   . ARG B 1 189 ? -18.667 -9.609  -34.608 1.00 14.71 ? 191  ARG B N   1 
ATOM   3321 C  CA  . ARG B 1 189 ? -17.390 -8.878  -34.752 1.00 13.64 ? 191  ARG B CA  1 
ATOM   3322 C  C   . ARG B 1 189 ? -17.622 -7.387  -34.744 1.00 12.07 ? 191  ARG B C   1 
ATOM   3323 O  O   . ARG B 1 189 ? -18.036 -6.811  -35.748 1.00 10.76 ? 191  ARG B O   1 
ATOM   3324 C  CB  . ARG B 1 189 ? -16.678 -9.250  -36.062 1.00 15.14 ? 191  ARG B CB  1 
ATOM   3325 C  CG  . ARG B 1 189 ? -16.201 -10.684 -36.089 1.00 17.08 ? 191  ARG B CG  1 
ATOM   3326 C  CD  . ARG B 1 189 ? -15.574 -11.004 -37.419 1.00 19.19 ? 191  ARG B CD  1 
ATOM   3327 N  NE  . ARG B 1 189 ? -14.288 -10.341 -37.566 1.00 21.68 ? 191  ARG B NE  1 
ATOM   3328 C  CZ  . ARG B 1 189 ? -13.145 -10.772 -37.037 1.00 23.77 ? 191  ARG B CZ  1 
ATOM   3329 N  NH1 . ARG B 1 189 ? -13.085 -11.885 -36.311 1.00 23.87 ? 191  ARG B NH1 1 
ATOM   3330 N  NH2 . ARG B 1 189 ? -12.037 -10.077 -37.259 1.00 25.60 ? 191  ARG B NH2 1 
ATOM   3331 N  N   . TYR B 1 190 ? -17.335 -6.765  -33.599 1.00 11.08 ? 192  TYR B N   1 
ATOM   3332 C  CA  . TYR B 1 190 ? -17.584 -5.355  -33.411 1.00 10.64 ? 192  TYR B CA  1 
ATOM   3333 C  C   . TYR B 1 190 ? -16.637 -4.748  -32.368 1.00 11.09 ? 192  TYR B C   1 
ATOM   3334 O  O   . TYR B 1 190 ? -16.037 -5.484  -31.568 1.00 11.73 ? 192  TYR B O   1 
ATOM   3335 C  CB  . TYR B 1 190 ? -19.049 -5.090  -33.012 1.00 10.01 ? 192  TYR B CB  1 
ATOM   3336 C  CG  . TYR B 1 190 ? -19.556 -5.811  -31.806 1.00 10.01 ? 192  TYR B CG  1 
ATOM   3337 C  CD1 . TYR B 1 190 ? -19.349 -5.303  -30.521 1.00 10.22 ? 192  TYR B CD1 1 
ATOM   3338 C  CD2 . TYR B 1 190 ? -20.244 -7.020  -31.924 1.00 10.41 ? 192  TYR B CD2 1 
ATOM   3339 C  CE1 . TYR B 1 190 ? -19.829 -5.965  -29.391 1.00 10.14 ? 192  TYR B CE1 1 
ATOM   3340 C  CE2 . TYR B 1 190 ? -20.725 -7.695  -30.799 1.00 10.34 ? 192  TYR B CE2 1 
ATOM   3341 C  CZ  . TYR B 1 190 ? -20.529 -7.154  -29.534 1.00 10.23 ? 192  TYR B CZ  1 
ATOM   3342 O  OH  . TYR B 1 190 ? -21.003 -7.793  -28.408 1.00 10.10 ? 192  TYR B OH  1 
ATOM   3343 N  N   . PHE B 1 191 ? -16.517 -3.420  -32.424 1.00 10.62 ? 193  PHE B N   1 
ATOM   3344 C  CA  . PHE B 1 191 ? -15.872 -2.641  -31.406 1.00 11.21 ? 193  PHE B CA  1 
ATOM   3345 C  C   . PHE B 1 191 ? -16.947 -1.960  -30.561 1.00 11.36 ? 193  PHE B C   1 
ATOM   3346 O  O   . PHE B 1 191 ? -18.026 -1.655  -31.066 1.00 12.09 ? 193  PHE B O   1 
ATOM   3347 C  CB  . PHE B 1 191 ? -14.980 -1.564  -32.048 1.00 11.42 ? 193  PHE B CB  1 
ATOM   3348 C  CG  . PHE B 1 191 ? -13.896 -2.115  -32.917 1.00 11.76 ? 193  PHE B CG  1 
ATOM   3349 C  CD1 . PHE B 1 191 ? -12.762 -2.650  -32.360 1.00 11.93 ? 193  PHE B CD1 1 
ATOM   3350 C  CD2 . PHE B 1 191 ? -14.018 -2.097  -34.308 1.00 12.37 ? 193  PHE B CD2 1 
ATOM   3351 C  CE1 . PHE B 1 191 ? -11.745 -3.161  -33.160 1.00 12.37 ? 193  PHE B CE1 1 
ATOM   3352 C  CE2 . PHE B 1 191 ? -13.008 -2.594  -35.114 1.00 11.93 ? 193  PHE B CE2 1 
ATOM   3353 C  CZ  . PHE B 1 191 ? -11.868 -3.131  -34.538 1.00 12.30 ? 193  PHE B CZ  1 
ATOM   3354 N  N   . GLN B 1 192 ? -16.649 -1.669  -29.296 1.00 11.33 ? 194  GLN B N   1 
ATOM   3355 C  CA  . GLN B 1 192 ? -17.628 -1.027  -28.425 1.00 11.22 ? 194  GLN B CA  1 
ATOM   3356 C  C   . GLN B 1 192 ? -16.944 -0.124  -27.430 1.00 11.62 ? 194  GLN B C   1 
ATOM   3357 O  O   . GLN B 1 192 ? -15.875 -0.480  -26.869 1.00 11.15 ? 194  GLN B O   1 
ATOM   3358 C  CB  . GLN B 1 192 ? -18.430 -2.071  -27.671 1.00 11.46 ? 194  GLN B CB  1 
ATOM   3359 C  CG  . GLN B 1 192 ? -19.702 -1.546  -27.013 1.00 11.45 ? 194  GLN B CG  1 
ATOM   3360 C  CD  . GLN B 1 192 ? -20.559 -2.684  -26.548 1.00 11.67 ? 194  GLN B CD  1 
ATOM   3361 O  OE1 . GLN B 1 192 ? -20.329 -3.225  -25.473 1.00 12.42 ? 194  GLN B OE1 1 
ATOM   3362 N  NE2 . GLN B 1 192 ? -21.517 -3.099  -27.373 1.00 11.29 ? 194  GLN B NE2 1 
ATOM   3363 N  N   . TYR B 1 193 ? -17.558 1.045   -27.242 1.00 11.58 ? 195  TYR B N   1 
ATOM   3364 C  CA  . TYR B 1 193 ? -17.135 2.014   -26.248 1.00 11.98 ? 195  TYR B CA  1 
ATOM   3365 C  C   . TYR B 1 193 ? -18.302 2.940   -25.883 1.00 12.60 ? 195  TYR B C   1 
ATOM   3366 O  O   . TYR B 1 193 ? -19.330 2.979   -26.555 1.00 12.58 ? 195  TYR B O   1 
ATOM   3367 C  CB  . TYR B 1 193 ? -15.931 2.831   -26.766 1.00 11.74 ? 195  TYR B CB  1 
ATOM   3368 C  CG  . TYR B 1 193 ? -16.277 3.875   -27.779 1.00 10.76 ? 195  TYR B CG  1 
ATOM   3369 C  CD1 . TYR B 1 193 ? -16.534 3.551   -29.097 1.00 11.21 ? 195  TYR B CD1 1 
ATOM   3370 C  CD2 . TYR B 1 193 ? -16.385 5.205   -27.403 1.00 11.29 ? 195  TYR B CD2 1 
ATOM   3371 C  CE1 . TYR B 1 193 ? -16.886 4.533   -30.027 1.00 10.86 ? 195  TYR B CE1 1 
ATOM   3372 C  CE2 . TYR B 1 193 ? -16.738 6.185   -28.301 1.00 10.86 ? 195  TYR B CE2 1 
ATOM   3373 C  CZ  . TYR B 1 193 ? -16.986 5.846   -29.614 1.00 10.97 ? 195  TYR B CZ  1 
ATOM   3374 O  OH  . TYR B 1 193 ? -17.337 6.855   -30.455 1.00 10.26 ? 195  TYR B OH  1 
ATOM   3375 N  N   . GLU B 1 194 ? -18.108 3.688   -24.816 1.00 13.53 ? 196  GLU B N   1 
ATOM   3376 C  CA  . GLU B 1 194 ? -19.066 4.657   -24.371 1.00 15.36 ? 196  GLU B CA  1 
ATOM   3377 C  C   . GLU B 1 194 ? -18.598 6.094   -24.702 1.00 14.32 ? 196  GLU B C   1 
ATOM   3378 O  O   . GLU B 1 194 ? -17.457 6.470   -24.458 1.00 13.85 ? 196  GLU B O   1 
ATOM   3379 C  CB  . GLU B 1 194 ? -19.330 4.468   -22.873 1.00 18.80 ? 196  GLU B CB  1 
ATOM   3380 C  CG  . GLU B 1 194 ? -20.601 5.179   -22.414 1.00 22.34 ? 196  GLU B CG  1 
ATOM   3381 C  CD  . GLU B 1 194 ? -21.010 4.766   -20.997 1.00 27.79 ? 196  GLU B CD  1 
ATOM   3382 O  OE1 . GLU B 1 194 ? -21.171 3.548   -20.722 1.00 30.16 ? 196  GLU B OE1 1 
ATOM   3383 O  OE2 . GLU B 1 194 ? -21.160 5.668   -20.175 1.00 28.68 ? 196  GLU B OE2 1 
ATOM   3384 N  N   . GLY B 1 195 ? -19.509 6.876   -25.270 1.00 13.08 ? 197  GLY B N   1 
ATOM   3385 C  CA  . GLY B 1 195 ? -19.239 8.235   -25.673 1.00 12.07 ? 197  GLY B CA  1 
ATOM   3386 C  C   . GLY B 1 195 ? -20.512 9.058   -25.701 1.00 12.00 ? 197  GLY B C   1 
ATOM   3387 O  O   . GLY B 1 195 ? -21.290 9.047   -24.746 1.00 11.61 ? 197  GLY B O   1 
ATOM   3388 N  N   . SER B 1 196 ? -20.705 9.796   -26.790 1.00 11.82 ? 198  SER B N   1 
ATOM   3389 C  CA  . SER B 1 196 ? -21.678 10.862  -26.848 1.00 12.42 ? 198  SER B CA  1 
ATOM   3390 C  C   . SER B 1 196 ? -22.443 10.853  -28.167 1.00 13.68 ? 198  SER B C   1 
ATOM   3391 O  O   . SER B 1 196 ? -22.045 10.199  -29.123 1.00 14.03 ? 198  SER B O   1 
ATOM   3392 C  CB  . SER B 1 196 ? -20.963 12.220  -26.717 1.00 12.60 ? 198  SER B CB  1 
ATOM   3393 O  OG  . SER B 1 196 ? -20.237 12.572  -27.901 1.00 11.87 ? 198  SER B OG  1 
ATOM   3394 N  N   . LEU B 1 197 ? -23.508 11.636  -28.233 1.00 14.65 ? 199  LEU B N   1 
ATOM   3395 C  CA  . LEU B 1 197 ? -24.055 12.047  -29.529 1.00 15.54 ? 199  LEU B CA  1 
ATOM   3396 C  C   . LEU B 1 197 ? -22.982 12.857  -30.260 1.00 16.03 ? 199  LEU B C   1 
ATOM   3397 O  O   . LEU B 1 197 ? -22.228 13.625  -29.631 1.00 14.48 ? 199  LEU B O   1 
ATOM   3398 C  CB  . LEU B 1 197 ? -25.316 12.914  -29.374 1.00 16.49 ? 199  LEU B CB  1 
ATOM   3399 C  CG  . LEU B 1 197 ? -26.461 12.319  -28.547 1.00 17.14 ? 199  LEU B CG  1 
ATOM   3400 C  CD1 . LEU B 1 197 ? -27.603 13.316  -28.418 1.00 18.37 ? 199  LEU B CD1 1 
ATOM   3401 C  CD2 . LEU B 1 197 ? -26.936 11.014  -29.144 1.00 17.41 ? 199  LEU B CD2 1 
ATOM   3402 N  N   . THR B 1 198 ? -22.912 12.669  -31.579 1.00 15.76 ? 200  THR B N   1 
ATOM   3403 C  CA  . THR B 1 198 ? -21.924 13.358  -32.405 1.00 16.84 ? 200  THR B CA  1 
ATOM   3404 C  C   . THR B 1 198 ? -22.399 14.705  -32.925 1.00 17.16 ? 200  THR B C   1 
ATOM   3405 O  O   . THR B 1 198 ? -21.696 15.335  -33.719 1.00 17.11 ? 200  THR B O   1 
ATOM   3406 C  CB  . THR B 1 198 ? -21.480 12.505  -33.603 1.00 16.79 ? 200  THR B CB  1 
ATOM   3407 O  OG1 . THR B 1 198 ? -22.587 12.303  -34.499 1.00 17.10 ? 200  THR B OG1 1 
ATOM   3408 C  CG2 . THR B 1 198 ? -20.933 11.181  -33.128 1.00 16.56 ? 200  THR B CG2 1 
ATOM   3409 N  N   . THR B 1 199 ? -23.587 15.129  -32.507 1.00 17.35 ? 201  THR B N   1 
ATOM   3410 C  CA  . THR B 1 199 ? -24.060 16.469  -32.755 1.00 17.77 ? 201  THR B CA  1 
ATOM   3411 C  C   . THR B 1 199 ? -24.552 17.008  -31.432 1.00 18.08 ? 201  THR B C   1 
ATOM   3412 O  O   . THR B 1 199 ? -24.792 16.228  -30.502 1.00 16.23 ? 201  THR B O   1 
ATOM   3413 C  CB  . THR B 1 199 ? -25.242 16.518  -33.755 1.00 17.89 ? 201  THR B CB  1 
ATOM   3414 O  OG1 . THR B 1 199 ? -26.420 16.006  -33.141 1.00 17.51 ? 201  THR B OG1 1 
ATOM   3415 C  CG2 . THR B 1 199 ? -24.951 15.754  -35.026 1.00 18.44 ? 201  THR B CG2 1 
ATOM   3416 N  N   . PRO B 1 200 ? -24.714 18.347  -31.331 1.00 18.59 ? 202  PRO B N   1 
ATOM   3417 C  CA  . PRO B 1 200 ? -25.403 18.923  -30.164 1.00 18.80 ? 202  PRO B CA  1 
ATOM   3418 C  C   . PRO B 1 200 ? -26.745 18.223  -29.961 1.00 18.51 ? 202  PRO B C   1 
ATOM   3419 O  O   . PRO B 1 200 ? -27.399 17.884  -30.945 1.00 20.31 ? 202  PRO B O   1 
ATOM   3420 C  CB  . PRO B 1 200 ? -25.622 20.389  -30.565 1.00 19.55 ? 202  PRO B CB  1 
ATOM   3421 C  CG  . PRO B 1 200 ? -24.462 20.678  -31.471 1.00 19.77 ? 202  PRO B CG  1 
ATOM   3422 C  CD  . PRO B 1 200 ? -24.276 19.395  -32.271 1.00 19.41 ? 202  PRO B CD  1 
ATOM   3423 N  N   . PRO B 1 201 ? -27.152 17.971  -28.727 1.00 17.91 ? 203  PRO B N   1 
ATOM   3424 C  CA  . PRO B 1 201 ? -26.511 18.455  -27.508 1.00 17.29 ? 203  PRO B CA  1 
ATOM   3425 C  C   . PRO B 1 201 ? -25.294 17.672  -26.949 1.00 16.45 ? 203  PRO B C   1 
ATOM   3426 O  O   . PRO B 1 201 ? -24.865 17.958  -25.834 1.00 17.24 ? 203  PRO B O   1 
ATOM   3427 C  CB  . PRO B 1 201 ? -27.672 18.427  -26.515 1.00 17.94 ? 203  PRO B CB  1 
ATOM   3428 C  CG  . PRO B 1 201 ? -28.479 17.249  -26.942 1.00 18.16 ? 203  PRO B CG  1 
ATOM   3429 C  CD  . PRO B 1 201 ? -28.377 17.209  -28.448 1.00 18.09 ? 203  PRO B CD  1 
ATOM   3430 N  N   . CYS B 1 202 ? -24.729 16.729  -27.698 1.00 15.80 ? 204  CYS B N   1 
ATOM   3431 C  CA  . CYS B 1 202 ? -23.471 16.044  -27.315 1.00 15.56 ? 204  CYS B CA  1 
ATOM   3432 C  C   . CYS B 1 202 ? -23.544 15.288  -25.968 1.00 14.49 ? 204  CYS B C   1 
ATOM   3433 O  O   . CYS B 1 202 ? -22.550 15.174  -25.245 1.00 13.85 ? 204  CYS B O   1 
ATOM   3434 C  CB  . CYS B 1 202 ? -22.301 17.027  -27.281 1.00 16.07 ? 204  CYS B CB  1 
ATOM   3435 S  SG  . CYS B 1 202 ? -21.892 17.788  -28.871 1.00 17.89 ? 204  CYS B SG  1 
ATOM   3436 N  N   . ALA B 1 203 ? -24.728 14.793  -25.646 1.00 13.46 ? 205  ALA B N   1 
ATOM   3437 C  CA  . ALA B 1 203 ? -24.962 14.120  -24.392 1.00 12.89 ? 205  ALA B CA  1 
ATOM   3438 C  C   . ALA B 1 203 ? -24.098 12.872  -24.319 1.00 12.61 ? 205  ALA B C   1 
ATOM   3439 O  O   . ALA B 1 203 ? -23.974 12.140  -25.306 1.00 11.42 ? 205  ALA B O   1 
ATOM   3440 C  CB  . ALA B 1 203 ? -26.420 13.751  -24.266 1.00 13.07 ? 205  ALA B CB  1 
ATOM   3441 N  N   . GLN B 1 204 ? -23.511 12.657  -23.148 1.00 12.59 ? 206  GLN B N   1 
ATOM   3442 C  CA  . GLN B 1 204 ? -22.666 11.505  -22.878 1.00 13.06 ? 206  GLN B CA  1 
ATOM   3443 C  C   . GLN B 1 204 ? -23.476 10.283  -22.404 1.00 13.41 ? 206  GLN B C   1 
ATOM   3444 O  O   . GLN B 1 204 ? -24.711 10.355  -22.224 1.00 14.03 ? 206  GLN B O   1 
ATOM   3445 C  CB  . GLN B 1 204 ? -21.504 11.909  -21.927 1.00 13.44 ? 206  GLN B CB  1 
ATOM   3446 C  CG  . GLN B 1 204 ? -20.540 12.854  -22.649 1.00 13.27 ? 206  GLN B CG  1 
ATOM   3447 C  CD  . GLN B 1 204 ? -19.312 13.335  -21.887 1.00 14.09 ? 206  GLN B CD  1 
ATOM   3448 O  OE1 . GLN B 1 204 ? -18.410 13.912  -22.498 1.00 14.11 ? 206  GLN B OE1 1 
ATOM   3449 N  NE2 . GLN B 1 204 ? -19.259 13.116  -20.578 1.00 13.90 ? 206  GLN B NE2 1 
ATOM   3450 N  N   . GLY B 1 205 ? -22.802 9.146   -22.239 1.00 12.90 ? 207  GLY B N   1 
ATOM   3451 C  CA  . GLY B 1 205 ? -23.465 7.915   -21.784 1.00 13.62 ? 207  GLY B CA  1 
ATOM   3452 C  C   . GLY B 1 205 ? -24.043 7.061   -22.929 1.00 14.01 ? 207  GLY B C   1 
ATOM   3453 O  O   . GLY B 1 205 ? -24.743 6.093   -22.680 1.00 15.80 ? 207  GLY B O   1 
ATOM   3454 N  N   . VAL B 1 206 ? -23.715 7.392   -24.171 1.00 13.48 ? 208  VAL B N   1 
ATOM   3455 C  CA  . VAL B 1 206 ? -24.153 6.637   -25.346 1.00 13.19 ? 208  VAL B CA  1 
ATOM   3456 C  C   . VAL B 1 206 ? -23.213 5.447   -25.598 1.00 12.60 ? 208  VAL B C   1 
ATOM   3457 O  O   . VAL B 1 206 ? -22.010 5.633   -25.760 1.00 12.03 ? 208  VAL B O   1 
ATOM   3458 C  CB  . VAL B 1 206 ? -24.132 7.517   -26.623 1.00 13.38 ? 208  VAL B CB  1 
ATOM   3459 C  CG1 . VAL B 1 206 ? -24.667 6.757   -27.839 1.00 13.85 ? 208  VAL B CG1 1 
ATOM   3460 C  CG2 . VAL B 1 206 ? -24.915 8.782   -26.406 1.00 13.35 ? 208  VAL B CG2 1 
ATOM   3461 N  N   . ILE B 1 207 ? -23.756 4.234   -25.636 1.00 11.85 ? 209  ILE B N   1 
ATOM   3462 C  CA  . ILE B 1 207 ? -22.946 3.071   -26.004 1.00 12.05 ? 209  ILE B CA  1 
ATOM   3463 C  C   . ILE B 1 207 ? -22.873 2.968   -27.524 1.00 11.77 ? 209  ILE B C   1 
ATOM   3464 O  O   . ILE B 1 207 ? -23.905 2.774   -28.206 1.00 11.51 ? 209  ILE B O   1 
ATOM   3465 C  CB  . ILE B 1 207 ? -23.493 1.774   -25.398 1.00 12.40 ? 209  ILE B CB  1 
ATOM   3466 C  CG1 . ILE B 1 207 ? -23.469 1.882   -23.864 1.00 12.86 ? 209  ILE B CG1 1 
ATOM   3467 C  CG2 . ILE B 1 207 ? -22.689 0.563   -25.907 1.00 12.37 ? 209  ILE B CG2 1 
ATOM   3468 C  CD1 . ILE B 1 207 ? -24.173 0.731   -23.188 1.00 13.75 ? 209  ILE B CD1 1 
ATOM   3469 N  N   . TRP B 1 208 ? -21.657 3.093   -28.046 1.00 11.54 ? 210  TRP B N   1 
ATOM   3470 C  CA  . TRP B 1 208 ? -21.388 2.942   -29.468 1.00 11.46 ? 210  TRP B CA  1 
ATOM   3471 C  C   . TRP B 1 208 ? -20.889 1.540   -29.768 1.00 11.56 ? 210  TRP B C   1 
ATOM   3472 O  O   . TRP B 1 208 ? -19.951 1.072   -29.136 1.00 11.62 ? 210  TRP B O   1 
ATOM   3473 C  CB  . TRP B 1 208 ? -20.333 3.968   -29.921 1.00 11.64 ? 210  TRP B CB  1 
ATOM   3474 C  CG  . TRP B 1 208 ? -20.893 5.332   -30.023 1.00 11.70 ? 210  TRP B CG  1 
ATOM   3475 C  CD1 . TRP B 1 208 ? -20.933 6.296   -29.037 1.00 11.92 ? 210  TRP B CD1 1 
ATOM   3476 C  CD2 . TRP B 1 208 ? -21.521 5.895   -31.163 1.00 11.46 ? 210  TRP B CD2 1 
ATOM   3477 N  NE1 . TRP B 1 208 ? -21.563 7.427   -29.511 1.00 11.90 ? 210  TRP B NE1 1 
ATOM   3478 C  CE2 . TRP B 1 208 ? -21.953 7.195   -30.809 1.00 11.60 ? 210  TRP B CE2 1 
ATOM   3479 C  CE3 . TRP B 1 208 ? -21.786 5.421   -32.461 1.00 11.61 ? 210  TRP B CE3 1 
ATOM   3480 C  CZ2 . TRP B 1 208 ? -22.610 8.031   -31.711 1.00 11.65 ? 210  TRP B CZ2 1 
ATOM   3481 C  CZ3 . TRP B 1 208 ? -22.449 6.266   -33.357 1.00 11.06 ? 210  TRP B CZ3 1 
ATOM   3482 C  CH2 . TRP B 1 208 ? -22.849 7.546   -32.976 1.00 11.51 ? 210  TRP B CH2 1 
ATOM   3483 N  N   . THR B 1 209 ? -21.488 0.904   -30.763 1.00 11.15 ? 211  THR B N   1 
ATOM   3484 C  CA  . THR B 1 209 ? -21.048 -0.380  -31.268 1.00 11.35 ? 211  THR B CA  1 
ATOM   3485 C  C   . THR B 1 209 ? -20.796 -0.199  -32.759 1.00 11.28 ? 211  THR B C   1 
ATOM   3486 O  O   . THR B 1 209 ? -21.709 0.170   -33.515 1.00 10.94 ? 211  THR B O   1 
ATOM   3487 C  CB  . THR B 1 209 ? -22.116 -1.451  -31.008 1.00 11.37 ? 211  THR B CB  1 
ATOM   3488 O  OG1 . THR B 1 209 ? -22.410 -1.499  -29.615 1.00 11.17 ? 211  THR B OG1 1 
ATOM   3489 C  CG2 . THR B 1 209 ? -21.661 -2.810  -31.492 1.00 11.82 ? 211  THR B CG2 1 
ATOM   3490 N  N   . VAL B 1 210 ? -19.545 -0.406  -33.159 1.00 11.11 ? 212  VAL B N   1 
ATOM   3491 C  CA  . VAL B 1 210 ? -19.098 -0.177  -34.517 1.00 11.39 ? 212  VAL B CA  1 
ATOM   3492 C  C   . VAL B 1 210 ? -18.707 -1.535  -35.063 1.00 11.88 ? 212  VAL B C   1 
ATOM   3493 O  O   . VAL B 1 210 ? -17.796 -2.185  -34.546 1.00 12.15 ? 212  VAL B O   1 
ATOM   3494 C  CB  . VAL B 1 210 ? -17.875 0.796   -34.602 1.00 11.17 ? 212  VAL B CB  1 
ATOM   3495 C  CG1 . VAL B 1 210 ? -17.459 1.037   -36.051 1.00 10.95 ? 212  VAL B CG1 1 
ATOM   3496 C  CG2 . VAL B 1 210 ? -18.165 2.129   -33.936 1.00 11.07 ? 212  VAL B CG2 1 
ATOM   3497 N  N   . PHE B 1 211 ? -19.411 -1.956  -36.112 1.00 12.45 ? 213  PHE B N   1 
ATOM   3498 C  CA  . PHE B 1 211 ? -19.126 -3.185  -36.789 1.00 12.49 ? 213  PHE B CA  1 
ATOM   3499 C  C   . PHE B 1 211 ? -17.710 -3.177  -37.314 1.00 12.72 ? 213  PHE B C   1 
ATOM   3500 O  O   . PHE B 1 211 ? -17.253 -2.171  -37.823 1.00 12.29 ? 213  PHE B O   1 
ATOM   3501 C  CB  . PHE B 1 211 ? -20.096 -3.389  -37.952 1.00 13.08 ? 213  PHE B CB  1 
ATOM   3502 C  CG  . PHE B 1 211 ? -21.468 -3.801  -37.520 1.00 13.58 ? 213  PHE B CG  1 
ATOM   3503 C  CD1 . PHE B 1 211 ? -21.759 -5.125  -37.297 1.00 14.14 ? 213  PHE B CD1 1 
ATOM   3504 C  CD2 . PHE B 1 211 ? -22.460 -2.863  -37.306 1.00 14.33 ? 213  PHE B CD2 1 
ATOM   3505 C  CE1 . PHE B 1 211 ? -23.027 -5.515  -36.907 1.00 14.72 ? 213  PHE B CE1 1 
ATOM   3506 C  CE2 . PHE B 1 211 ? -23.726 -3.239  -36.891 1.00 14.69 ? 213  PHE B CE2 1 
ATOM   3507 C  CZ  . PHE B 1 211 ? -24.012 -4.570  -36.699 1.00 14.76 ? 213  PHE B CZ  1 
ATOM   3508 N  N   . ASN B 1 212 ? -17.039 -4.311  -37.190 1.00 13.93 ? 214  ASN B N   1 
ATOM   3509 C  CA  . ASN B 1 212 ? -15.729 -4.544  -37.829 1.00 16.68 ? 214  ASN B CA  1 
ATOM   3510 C  C   . ASN B 1 212 ? -15.820 -4.531  -39.352 1.00 16.36 ? 214  ASN B C   1 
ATOM   3511 O  O   . ASN B 1 212 ? -15.069 -3.836  -40.034 1.00 15.26 ? 214  ASN B O   1 
ATOM   3512 C  CB  . ASN B 1 212 ? -15.161 -5.893  -37.344 1.00 19.20 ? 214  ASN B CB  1 
ATOM   3513 C  CG  . ASN B 1 212 ? -13.866 -6.285  -38.036 1.00 24.34 ? 214  ASN B CG  1 
ATOM   3514 O  OD1 . ASN B 1 212 ? -12.832 -5.751  -37.694 1.00 33.05 ? 214  ASN B OD1 1 
ATOM   3515 N  ND2 . ASN B 1 212 ? -13.912 -7.263  -38.992 1.00 24.47 ? 214  ASN B ND2 1 
ATOM   3516 N  N   . GLN B 1 213 ? -16.764 -5.293  -39.884 1.00 16.50 ? 215  GLN B N   1 
ATOM   3517 C  CA  . GLN B 1 213 ? -16.920 -5.387  -41.342 1.00 17.05 ? 215  GLN B CA  1 
ATOM   3518 C  C   . GLN B 1 213 ? -17.738 -4.248  -41.872 1.00 17.65 ? 215  GLN B C   1 
ATOM   3519 O  O   . GLN B 1 213 ? -18.578 -3.667  -41.159 1.00 17.14 ? 215  GLN B O   1 
ATOM   3520 C  CB  . GLN B 1 213 ? -17.631 -6.674  -41.712 1.00 17.93 ? 215  GLN B CB  1 
ATOM   3521 C  CG  . GLN B 1 213 ? -16.908 -7.915  -41.262 1.00 18.80 ? 215  GLN B CG  1 
ATOM   3522 C  CD  . GLN B 1 213 ? -17.795 -9.121  -41.356 1.00 21.25 ? 215  GLN B CD  1 
ATOM   3523 O  OE1 . GLN B 1 213 ? -19.003 -9.020  -41.202 1.00 25.09 ? 215  GLN B OE1 1 
ATOM   3524 N  NE2 . GLN B 1 213 ? -17.205 -10.269 -41.589 1.00 22.37 ? 215  GLN B NE2 1 
ATOM   3525 N  N   . THR B 1 214 ? -17.502 -3.931  -43.136 1.00 19.21 ? 216  THR B N   1 
ATOM   3526 C  CA  . THR B 1 214 ? -18.187 -2.828  -43.796 1.00 20.31 ? 216  THR B CA  1 
ATOM   3527 C  C   . THR B 1 214 ? -19.307 -3.335  -44.697 1.00 20.39 ? 216  THR B C   1 
ATOM   3528 O  O   . THR B 1 214 ? -19.492 -4.531  -44.894 1.00 18.91 ? 216  THR B O   1 
ATOM   3529 C  CB  . THR B 1 214 ? -17.197 -2.037  -44.652 1.00 21.71 ? 216  THR B CB  1 
ATOM   3530 O  OG1 . THR B 1 214 ? -16.765 -2.850  -45.756 1.00 20.49 ? 216  THR B OG1 1 
ATOM   3531 C  CG2 . THR B 1 214 ? -15.974 -1.625  -43.804 1.00 21.69 ? 216  THR B CG2 1 
ATOM   3532 N  N   . VAL B 1 215 ? -20.065 -2.396  -45.221 1.00 19.87 ? 217  VAL B N   1 
ATOM   3533 C  CA  . VAL B 1 215 ? -21.026 -2.693  -46.251 1.00 22.01 ? 217  VAL B CA  1 
ATOM   3534 C  C   . VAL B 1 215 ? -20.574 -1.894  -47.471 1.00 21.44 ? 217  VAL B C   1 
ATOM   3535 O  O   . VAL B 1 215 ? -19.974 -0.829  -47.349 1.00 19.90 ? 217  VAL B O   1 
ATOM   3536 C  CB  . VAL B 1 215 ? -22.487 -2.430  -45.772 1.00 23.52 ? 217  VAL B CB  1 
ATOM   3537 C  CG1 . VAL B 1 215 ? -22.737 -0.985  -45.457 1.00 24.60 ? 217  VAL B CG1 1 
ATOM   3538 C  CG2 . VAL B 1 215 ? -23.483 -2.878  -46.814 1.00 26.53 ? 217  VAL B CG2 1 
ATOM   3539 N  N   . MET B 1 216 ? -20.839 -2.435  -48.645 1.00 22.70 ? 218  MET B N   1 
ATOM   3540 C  CA  . MET B 1 216 ? -20.380 -1.850  -49.896 1.00 23.65 ? 218  MET B CA  1 
ATOM   3541 C  C   . MET B 1 216 ? -21.530 -1.230  -50.691 1.00 22.55 ? 218  MET B C   1 
ATOM   3542 O  O   . MET B 1 216 ? -22.590 -1.839  -50.834 1.00 21.06 ? 218  MET B O   1 
ATOM   3543 C  CB  . MET B 1 216 ? -19.662 -2.916  -50.713 1.00 26.65 ? 218  MET B CB  1 
ATOM   3544 C  CG  . MET B 1 216 ? -18.230 -3.119  -50.259 1.00 29.38 ? 218  MET B CG  1 
ATOM   3545 S  SD  . MET B 1 216 ? -17.491 -4.401  -51.265 1.00 39.90 ? 218  MET B SD  1 
ATOM   3546 C  CE  . MET B 1 216 ? -18.272 -5.894  -50.647 1.00 39.47 ? 218  MET B CE  1 
ATOM   3547 N  N   . LEU B 1 217 ? -21.303 -0.011  -51.175 1.00 21.54 ? 219  LEU B N   1 
ATOM   3548 C  CA  . LEU B 1 217 ? -22.182 0.686   -52.096 1.00 21.62 ? 219  LEU B CA  1 
ATOM   3549 C  C   . LEU B 1 217 ? -21.391 0.948   -53.393 1.00 22.22 ? 219  LEU B C   1 
ATOM   3550 O  O   . LEU B 1 217 ? -20.169 1.005   -53.362 1.00 20.39 ? 219  LEU B O   1 
ATOM   3551 C  CB  . LEU B 1 217 ? -22.623 2.030   -51.513 1.00 21.60 ? 219  LEU B CB  1 
ATOM   3552 C  CG  . LEU B 1 217 ? -23.787 2.022   -50.514 1.00 22.16 ? 219  LEU B CG  1 
ATOM   3553 C  CD1 . LEU B 1 217 ? -23.513 1.143   -49.287 1.00 22.55 ? 219  LEU B CD1 1 
ATOM   3554 C  CD2 . LEU B 1 217 ? -24.095 3.455   -50.107 1.00 22.30 ? 219  LEU B CD2 1 
ATOM   3555 N  N   . SER B 1 218 ? -22.088 1.118   -54.519 1.00 22.14 ? 220  SER B N   1 
ATOM   3556 C  CA  . SER B 1 218 ? -21.412 1.469   -55.779 1.00 22.63 ? 220  SER B CA  1 
ATOM   3557 C  C   . SER B 1 218 ? -20.978 2.928   -55.746 1.00 23.03 ? 220  SER B C   1 
ATOM   3558 O  O   . SER B 1 218 ? -21.497 3.713   -54.960 1.00 23.61 ? 220  SER B O   1 
ATOM   3559 C  CB  . SER B 1 218 ? -22.339 1.244   -56.973 1.00 21.69 ? 220  SER B CB  1 
ATOM   3560 O  OG  . SER B 1 218 ? -23.382 2.210   -56.988 1.00 20.37 ? 220  SER B OG  1 
ATOM   3561 N  N   . ALA B 1 219 ? -20.047 3.305   -56.621 1.00 24.77 ? 221  ALA B N   1 
ATOM   3562 C  CA  . ALA B 1 219 ? -19.610 4.708   -56.716 1.00 24.71 ? 221  ALA B CA  1 
ATOM   3563 C  C   . ALA B 1 219 ? -20.773 5.639   -57.063 1.00 24.04 ? 221  ALA B C   1 
ATOM   3564 O  O   . ALA B 1 219 ? -20.884 6.713   -56.479 1.00 25.82 ? 221  ALA B O   1 
ATOM   3565 C  CB  . ALA B 1 219 ? -18.477 4.862   -57.725 1.00 26.14 ? 221  ALA B CB  1 
ATOM   3566 N  N   . LYS B 1 220 ? -21.661 5.216   -57.974 1.00 23.48 ? 222  LYS B N   1 
ATOM   3567 C  CA  . LYS B 1 220 ? -22.865 6.007   -58.315 1.00 23.18 ? 222  LYS B CA  1 
ATOM   3568 C  C   . LYS B 1 220 ? -23.773 6.200   -57.101 1.00 22.88 ? 222  LYS B C   1 
ATOM   3569 O  O   . LYS B 1 220 ? -24.269 7.296   -56.869 1.00 24.02 ? 222  LYS B O   1 
ATOM   3570 C  CB  . LYS B 1 220 ? -23.670 5.382   -59.478 1.00 23.19 ? 222  LYS B CB  1 
ATOM   3571 N  N   . GLN B 1 221 ? -23.980 5.137   -56.328 1.00 22.38 ? 223  GLN B N   1 
ATOM   3572 C  CA  . GLN B 1 221 ? -24.726 5.248   -55.053 1.00 22.66 ? 223  GLN B CA  1 
ATOM   3573 C  C   . GLN B 1 221 ? -24.114 6.243   -54.063 1.00 21.77 ? 223  GLN B C   1 
ATOM   3574 O  O   . GLN B 1 221 ? -24.818 7.073   -53.489 1.00 21.59 ? 223  GLN B O   1 
ATOM   3575 C  CB  . GLN B 1 221 ? -24.887 3.876   -54.392 1.00 21.90 ? 223  GLN B CB  1 
ATOM   3576 C  CG  . GLN B 1 221 ? -25.973 3.052   -55.049 1.00 22.69 ? 223  GLN B CG  1 
ATOM   3577 C  CD  . GLN B 1 221 ? -26.107 1.672   -54.457 1.00 22.48 ? 223  GLN B CD  1 
ATOM   3578 O  OE1 . GLN B 1 221 ? -25.109 1.001   -54.183 1.00 23.17 ? 223  GLN B OE1 1 
ATOM   3579 N  NE2 . GLN B 1 221 ? -27.345 1.225   -54.265 1.00 23.61 ? 223  GLN B NE2 1 
ATOM   3580 N  N   . LEU B 1 222 ? -22.812 6.144   -53.853 1.00 22.59 ? 224  LEU B N   1 
ATOM   3581 C  CA  . LEU B 1 222 ? -22.116 7.090   -52.966 1.00 23.33 ? 224  LEU B CA  1 
ATOM   3582 C  C   . LEU B 1 222 ? -22.187 8.515   -53.505 1.00 24.85 ? 224  LEU B C   1 
ATOM   3583 O  O   . LEU B 1 222 ? -22.379 9.460   -52.738 1.00 22.91 ? 224  LEU B O   1 
ATOM   3584 C  CB  . LEU B 1 222 ? -20.665 6.657   -52.749 1.00 24.28 ? 224  LEU B CB  1 
ATOM   3585 C  CG  . LEU B 1 222 ? -20.549 5.401   -51.885 1.00 25.03 ? 224  LEU B CG  1 
ATOM   3586 C  CD1 . LEU B 1 222 ? -19.192 4.755   -52.076 1.00 25.90 ? 224  LEU B CD1 1 
ATOM   3587 C  CD2 . LEU B 1 222 ? -20.792 5.743   -50.412 1.00 25.11 ? 224  LEU B CD2 1 
ATOM   3588 N  N   . HIS B 1 223 ? -22.088 8.662   -54.828 1.00 25.96 ? 225  HIS B N   1 
ATOM   3589 C  CA  . HIS B 1 223 ? -22.315 9.962   -55.450 1.00 28.86 ? 225  HIS B CA  1 
ATOM   3590 C  C   . HIS B 1 223 ? -23.739 10.460  -55.177 1.00 25.71 ? 225  HIS B C   1 
ATOM   3591 O  O   . HIS B 1 223 ? -23.930 11.600  -54.760 1.00 25.36 ? 225  HIS B O   1 
ATOM   3592 C  CB  . HIS B 1 223 ? -22.029 9.928   -56.957 1.00 32.78 ? 225  HIS B CB  1 
ATOM   3593 C  CG  . HIS B 1 223 ? -22.090 11.285  -57.596 1.00 41.50 ? 225  HIS B CG  1 
ATOM   3594 N  ND1 . HIS B 1 223 ? -23.221 11.758  -58.237 1.00 45.82 ? 225  HIS B ND1 1 
ATOM   3595 C  CD2 . HIS B 1 223 ? -21.184 12.295  -57.641 1.00 44.51 ? 225  HIS B CD2 1 
ATOM   3596 C  CE1 . HIS B 1 223 ? -22.998 12.986  -58.675 1.00 45.35 ? 225  HIS B CE1 1 
ATOM   3597 N  NE2 . HIS B 1 223 ? -21.771 13.336  -58.325 1.00 46.51 ? 225  HIS B NE2 1 
ATOM   3598 N  N   . THR B 1 224 ? -24.736 9.600   -55.383 1.00 23.91 ? 226  THR B N   1 
ATOM   3599 C  CA  . THR B 1 224 ? -26.124 9.975   -55.091 1.00 23.91 ? 226  THR B CA  1 
ATOM   3600 C  C   . THR B 1 224 ? -26.301 10.470  -53.651 1.00 23.82 ? 226  THR B C   1 
ATOM   3601 O  O   . THR B 1 224 ? -26.931 11.525  -53.415 1.00 22.42 ? 226  THR B O   1 
ATOM   3602 C  CB  . THR B 1 224 ? -27.081 8.815   -55.388 1.00 24.26 ? 226  THR B CB  1 
ATOM   3603 O  OG1 . THR B 1 224 ? -26.940 8.455   -56.769 1.00 24.59 ? 226  THR B OG1 1 
ATOM   3604 C  CG2 . THR B 1 224 ? -28.532 9.196   -55.097 1.00 25.08 ? 226  THR B CG2 1 
ATOM   3605 N  N   . LEU B 1 225 ? -25.700 9.746   -52.701 1.00 22.35 ? 227  LEU B N   1 
ATOM   3606 C  CA  . LEU B 1 225 ? -25.782 10.138  -51.285 1.00 22.14 ? 227  LEU B CA  1 
ATOM   3607 C  C   . LEU B 1 225 ? -25.255 11.543  -50.995 1.00 22.48 ? 227  LEU B C   1 
ATOM   3608 O  O   . LEU B 1 225 ? -25.895 12.315  -50.267 1.00 23.10 ? 227  LEU B O   1 
ATOM   3609 C  CB  . LEU B 1 225 ? -25.049 9.127   -50.406 1.00 20.15 ? 227  LEU B CB  1 
ATOM   3610 C  CG  . LEU B 1 225 ? -25.082 9.379   -48.910 1.00 19.91 ? 227  LEU B CG  1 
ATOM   3611 C  CD1 . LEU B 1 225 ? -26.492 9.574   -48.389 1.00 19.83 ? 227  LEU B CD1 1 
ATOM   3612 C  CD2 . LEU B 1 225 ? -24.397 8.223   -48.191 1.00 21.15 ? 227  LEU B CD2 1 
ATOM   3613 N  N   . SER B 1 226 ? -24.091 11.861  -51.542 1.00 24.62 ? 228  SER B N   1 
ATOM   3614 C  CA  . SER B 1 226 ? -23.426 13.120  -51.211 1.00 28.34 ? 228  SER B CA  1 
ATOM   3615 C  C   . SER B 1 226 ? -23.832 14.292  -52.094 1.00 29.89 ? 228  SER B C   1 
ATOM   3616 O  O   . SER B 1 226 ? -23.567 15.424  -51.727 1.00 31.07 ? 228  SER B O   1 
ATOM   3617 C  CB  . SER B 1 226 ? -21.915 12.957  -51.275 1.00 29.84 ? 228  SER B CB  1 
ATOM   3618 O  OG  . SER B 1 226 ? -21.542 12.572  -52.572 1.00 30.59 ? 228  SER B OG  1 
ATOM   3619 N  N   . ASP B 1 227 ? -24.476 14.032  -53.230 1.00 33.10 ? 229  ASP B N   1 
ATOM   3620 C  CA  . ASP B 1 227 ? -24.736 15.091  -54.211 1.00 36.43 ? 229  ASP B CA  1 
ATOM   3621 C  C   . ASP B 1 227 ? -26.200 15.440  -54.435 1.00 32.59 ? 229  ASP B C   1 
ATOM   3622 O  O   . ASP B 1 227 ? -26.493 16.290  -55.264 1.00 34.32 ? 229  ASP B O   1 
ATOM   3623 C  CB  . ASP B 1 227 ? -24.019 14.768  -55.527 1.00 40.69 ? 229  ASP B CB  1 
ATOM   3624 C  CG  . ASP B 1 227 ? -22.528 15.074  -55.451 1.00 49.33 ? 229  ASP B CG  1 
ATOM   3625 O  OD1 . ASP B 1 227 ? -22.160 16.252  -55.693 1.00 57.65 ? 229  ASP B OD1 1 
ATOM   3626 O  OD2 . ASP B 1 227 ? -21.725 14.162  -55.125 1.00 53.86 ? 229  ASP B OD2 1 
ATOM   3627 N  N   . THR B 1 228 ? -27.115 14.855  -53.672 1.00 29.67 ? 230  THR B N   1 
ATOM   3628 C  CA  . THR B 1 228 ? -28.543 15.098  -53.885 1.00 28.42 ? 230  THR B CA  1 
ATOM   3629 C  C   . THR B 1 228 ? -29.168 16.078  -52.897 1.00 28.81 ? 230  THR B C   1 
ATOM   3630 O  O   . THR B 1 228 ? -30.034 16.860  -53.288 1.00 27.66 ? 230  THR B O   1 
ATOM   3631 C  CB  . THR B 1 228 ? -29.325 13.779  -53.868 1.00 27.72 ? 230  THR B CB  1 
ATOM   3632 O  OG1 . THR B 1 228 ? -28.709 12.869  -54.774 1.00 26.35 ? 230  THR B OG1 1 
ATOM   3633 C  CG2 . THR B 1 228 ? -30.775 13.989  -54.274 1.00 28.84 ? 230  THR B CG2 1 
ATOM   3634 N  N   . LEU B 1 229 ? -28.746 16.055  -51.630 1.00 27.80 ? 231  LEU B N   1 
ATOM   3635 C  CA  . LEU B 1 229 ? -29.458 16.799  -50.588 1.00 27.38 ? 231  LEU B CA  1 
ATOM   3636 C  C   . LEU B 1 229 ? -28.895 18.184  -50.356 1.00 28.24 ? 231  LEU B C   1 
ATOM   3637 O  O   . LEU B 1 229 ? -27.691 18.404  -50.496 1.00 27.98 ? 231  LEU B O   1 
ATOM   3638 C  CB  . LEU B 1 229 ? -29.465 16.019  -49.274 1.00 27.28 ? 231  LEU B CB  1 
ATOM   3639 C  CG  . LEU B 1 229 ? -30.105 14.634  -49.296 1.00 27.59 ? 231  LEU B CG  1 
ATOM   3640 C  CD1 . LEU B 1 229 ? -30.067 14.010  -47.904 1.00 28.00 ? 231  LEU B CD1 1 
ATOM   3641 C  CD2 . LEU B 1 229 ? -31.539 14.689  -49.792 1.00 27.66 ? 231  LEU B CD2 1 
ATOM   3642 N  N   . TRP B 1 230 ? -29.782 19.110  -49.988 1.00 29.10 ? 232  TRP B N   1 
ATOM   3643 C  CA  . TRP B 1 230 ? -29.416 20.493  -49.703 1.00 31.93 ? 232  TRP B CA  1 
ATOM   3644 C  C   . TRP B 1 230 ? -29.690 20.785  -48.234 1.00 31.45 ? 232  TRP B C   1 
ATOM   3645 O  O   . TRP B 1 230 ? -30.626 20.237  -47.647 1.00 30.29 ? 232  TRP B O   1 
ATOM   3646 C  CB  . TRP B 1 230 ? -30.122 21.470  -50.690 1.00 33.55 ? 232  TRP B CB  1 
ATOM   3647 C  CG  . TRP B 1 230 ? -29.534 21.305  -52.070 1.00 37.03 ? 232  TRP B CG  1 
ATOM   3648 C  CD1 . TRP B 1 230 ? -29.805 20.301  -52.958 1.00 40.34 ? 232  TRP B CD1 1 
ATOM   3649 C  CD2 . TRP B 1 230 ? -28.508 22.105  -52.680 1.00 40.04 ? 232  TRP B CD2 1 
ATOM   3650 N  NE1 . TRP B 1 230 ? -29.031 20.437  -54.092 1.00 40.56 ? 232  TRP B NE1 1 
ATOM   3651 C  CE2 . TRP B 1 230 ? -28.230 21.537  -53.951 1.00 41.34 ? 232  TRP B CE2 1 
ATOM   3652 C  CE3 . TRP B 1 230 ? -27.808 23.252  -52.286 1.00 40.25 ? 232  TRP B CE3 1 
ATOM   3653 C  CZ2 . TRP B 1 230 ? -27.283 22.081  -54.828 1.00 42.02 ? 232  TRP B CZ2 1 
ATOM   3654 C  CZ3 . TRP B 1 230 ? -26.864 23.797  -53.161 1.00 41.11 ? 232  TRP B CZ3 1 
ATOM   3655 C  CH2 . TRP B 1 230 ? -26.613 23.207  -54.417 1.00 42.10 ? 232  TRP B CH2 1 
ATOM   3656 N  N   . GLY B 1 231 ? -28.829 21.616  -47.647 1.00 33.30 ? 233  GLY B N   1 
ATOM   3657 C  CA  . GLY B 1 231 ? -28.848 21.934  -46.226 1.00 35.81 ? 233  GLY B CA  1 
ATOM   3658 C  C   . GLY B 1 231 ? -29.167 23.393  -45.959 1.00 40.60 ? 233  GLY B C   1 
ATOM   3659 O  O   . GLY B 1 231 ? -29.798 24.039  -46.795 1.00 40.61 ? 233  GLY B O   1 
ATOM   3660 N  N   . PRO B 1 232 ? -28.748 23.917  -44.781 1.00 45.37 ? 234  PRO B N   1 
ATOM   3661 C  CA  . PRO B 1 232 ? -28.933 25.323  -44.395 1.00 47.59 ? 234  PRO B CA  1 
ATOM   3662 C  C   . PRO B 1 232 ? -28.271 26.321  -45.347 1.00 50.58 ? 234  PRO B C   1 
ATOM   3663 O  O   . PRO B 1 232 ? -27.199 26.043  -45.878 1.00 50.12 ? 234  PRO B O   1 
ATOM   3664 C  CB  . PRO B 1 232 ? -28.279 25.395  -43.011 1.00 46.31 ? 234  PRO B CB  1 
ATOM   3665 C  CG  . PRO B 1 232 ? -28.374 24.021  -42.474 1.00 46.24 ? 234  PRO B CG  1 
ATOM   3666 C  CD  . PRO B 1 232 ? -28.202 23.124  -43.661 1.00 46.26 ? 234  PRO B CD  1 
ATOM   3667 N  N   . GLY B 1 233 ? -28.907 27.479  -45.541 1.00 54.72 ? 235  GLY B N   1 
ATOM   3668 C  CA  . GLY B 1 233 ? -28.463 28.459  -46.539 1.00 55.14 ? 235  GLY B CA  1 
ATOM   3669 C  C   . GLY B 1 233 ? -28.768 27.949  -47.937 1.00 56.02 ? 235  GLY B C   1 
ATOM   3670 O  O   . GLY B 1 233 ? -29.761 27.250  -48.143 1.00 55.08 ? 235  GLY B O   1 
ATOM   3671 N  N   . ASP B 1 234 ? -27.920 28.298  -48.899 1.00 55.44 ? 236  ASP B N   1 
ATOM   3672 C  CA  . ASP B 1 234 ? -28.014 27.748  -50.247 1.00 53.36 ? 236  ASP B CA  1 
ATOM   3673 C  C   . ASP B 1 234 ? -26.868 26.759  -50.411 1.00 51.15 ? 236  ASP B C   1 
ATOM   3674 O  O   . ASP B 1 234 ? -26.157 26.775  -51.414 1.00 55.53 ? 236  ASP B O   1 
ATOM   3675 C  CB  . ASP B 1 234 ? -27.940 28.870  -51.288 1.00 54.18 ? 236  ASP B CB  1 
ATOM   3676 N  N   . SER B 1 235 ? -26.708 25.882  -49.421 1.00 47.35 ? 237  SER B N   1 
ATOM   3677 C  CA  . SER B 1 235 ? -25.525 25.025  -49.304 1.00 44.32 ? 237  SER B CA  1 
ATOM   3678 C  C   . SER B 1 235 ? -25.901 23.551  -49.464 1.00 39.29 ? 237  SER B C   1 
ATOM   3679 O  O   . SER B 1 235 ? -26.965 23.125  -49.023 1.00 36.37 ? 237  SER B O   1 
ATOM   3680 C  CB  . SER B 1 235 ? -24.842 25.250  -47.948 1.00 43.97 ? 237  SER B CB  1 
ATOM   3681 O  OG  . SER B 1 235 ? -25.521 24.570  -46.887 1.00 45.59 ? 237  SER B OG  1 
ATOM   3682 N  N   . ARG B 1 236 ? -25.018 22.785  -50.088 1.00 36.59 ? 238  ARG B N   1 
ATOM   3683 C  CA  . ARG B 1 236 ? -25.208 21.350  -50.230 1.00 36.02 ? 238  ARG B CA  1 
ATOM   3684 C  C   . ARG B 1 236 ? -25.064 20.650  -48.873 1.00 34.11 ? 238  ARG B C   1 
ATOM   3685 O  O   . ARG B 1 236 ? -24.295 21.098  -48.019 1.00 32.75 ? 238  ARG B O   1 
ATOM   3686 C  CB  . ARG B 1 236 ? -24.189 20.764  -51.189 1.00 37.66 ? 238  ARG B CB  1 
ATOM   3687 C  CG  . ARG B 1 236 ? -24.441 21.044  -52.657 1.00 39.26 ? 238  ARG B CG  1 
ATOM   3688 C  CD  . ARG B 1 236 ? -23.358 20.362  -53.474 1.00 41.11 ? 238  ARG B CD  1 
ATOM   3689 N  NE  . ARG B 1 236 ? -23.661 20.294  -54.899 1.00 45.29 ? 238  ARG B NE  1 
ATOM   3690 C  CZ  . ARG B 1 236 ? -24.572 19.494  -55.462 1.00 47.00 ? 238  ARG B CZ  1 
ATOM   3691 N  NH1 . ARG B 1 236 ? -25.332 18.671  -54.737 1.00 45.76 ? 238  ARG B NH1 1 
ATOM   3692 N  NH2 . ARG B 1 236 ? -24.739 19.531  -56.779 1.00 48.55 ? 238  ARG B NH2 1 
ATOM   3693 N  N   . LEU B 1 237 ? -25.814 19.562  -48.689 1.00 30.36 ? 239  LEU B N   1 
ATOM   3694 C  CA  . LEU B 1 237 ? -25.720 18.757  -47.470 1.00 27.70 ? 239  LEU B CA  1 
ATOM   3695 C  C   . LEU B 1 237 ? -24.619 17.706  -47.682 1.00 26.17 ? 239  LEU B C   1 
ATOM   3696 O  O   . LEU B 1 237 ? -24.840 16.634  -48.256 1.00 25.06 ? 239  LEU B O   1 
ATOM   3697 C  CB  . LEU B 1 237 ? -27.080 18.155  -47.116 1.00 26.87 ? 239  LEU B CB  1 
ATOM   3698 C  CG  . LEU B 1 237 ? -27.224 17.378  -45.792 1.00 28.13 ? 239  LEU B CG  1 
ATOM   3699 C  CD1 . LEU B 1 237 ? -26.288 17.840  -44.700 1.00 29.24 ? 239  LEU B CD1 1 
ATOM   3700 C  CD2 . LEU B 1 237 ? -28.658 17.332  -45.293 1.00 27.83 ? 239  LEU B CD2 1 
ATOM   3701 N  N   . GLN B 1 238 ? -23.420 18.076  -47.239 1.00 24.84 ? 240  GLN B N   1 
ATOM   3702 C  CA  . GLN B 1 238 ? -22.194 17.326  -47.459 1.00 25.41 ? 240  GLN B CA  1 
ATOM   3703 C  C   . GLN B 1 238 ? -21.271 17.473  -46.259 1.00 23.29 ? 240  GLN B C   1 
ATOM   3704 O  O   . GLN B 1 238 ? -21.413 18.412  -45.478 1.00 21.47 ? 240  GLN B O   1 
ATOM   3705 C  CB  . GLN B 1 238 ? -21.454 17.888  -48.672 1.00 27.27 ? 240  GLN B CB  1 
ATOM   3706 C  CG  . GLN B 1 238 ? -22.159 17.647  -49.992 1.00 29.65 ? 240  GLN B CG  1 
ATOM   3707 C  CD  . GLN B 1 238 ? -21.380 18.196  -51.161 1.00 29.39 ? 240  GLN B CD  1 
ATOM   3708 O  OE1 . GLN B 1 238 ? -20.717 19.226  -51.051 1.00 29.16 ? 240  GLN B OE1 1 
ATOM   3709 N  NE2 . GLN B 1 238 ? -21.428 17.492  -52.273 1.00 30.65 ? 240  GLN B NE2 1 
ATOM   3710 N  N   . LEU B 1 239 ? -20.324 16.546  -46.139 1.00 22.68 ? 241  LEU B N   1 
ATOM   3711 C  CA  . LEU B 1 239 ? -19.306 16.579  -45.098 1.00 22.67 ? 241  LEU B CA  1 
ATOM   3712 C  C   . LEU B 1 239 ? -19.937 16.763  -43.698 1.00 21.84 ? 241  LEU B C   1 
ATOM   3713 O  O   . LEU B 1 239 ? -19.486 17.565  -42.877 1.00 20.50 ? 241  LEU B O   1 
ATOM   3714 C  CB  . LEU B 1 239 ? -18.270 17.666  -45.422 1.00 23.89 ? 241  LEU B CB  1 
ATOM   3715 C  CG  . LEU B 1 239 ? -17.606 17.537  -46.812 1.00 24.65 ? 241  LEU B CG  1 
ATOM   3716 C  CD1 . LEU B 1 239 ? -16.888 18.825  -47.184 1.00 27.36 ? 241  LEU B CD1 1 
ATOM   3717 C  CD2 . LEU B 1 239 ? -16.642 16.369  -46.946 1.00 25.31 ? 241  LEU B CD2 1 
ATOM   3718 N  N   . ASN B 1 240 ? -20.987 15.988  -43.440 1.00 19.93 ? 242  ASN B N   1 
ATOM   3719 C  CA  . ASN B 1 240 ? -21.795 16.137  -42.224 1.00 18.95 ? 242  ASN B CA  1 
ATOM   3720 C  C   . ASN B 1 240 ? -21.321 15.156  -41.156 1.00 18.87 ? 242  ASN B C   1 
ATOM   3721 O  O   . ASN B 1 240 ? -22.064 14.250  -40.717 1.00 18.42 ? 242  ASN B O   1 
ATOM   3722 C  CB  . ASN B 1 240 ? -23.304 15.990  -42.531 1.00 19.16 ? 242  ASN B CB  1 
ATOM   3723 C  CG  . ASN B 1 240 ? -23.654 14.679  -43.217 1.00 18.86 ? 242  ASN B CG  1 
ATOM   3724 O  OD1 . ASN B 1 240 ? -22.843 14.104  -43.951 1.00 18.34 ? 242  ASN B OD1 1 
ATOM   3725 N  ND2 . ASN B 1 240 ? -24.860 14.192  -42.961 1.00 18.55 ? 242  ASN B ND2 1 
ATOM   3726 N  N   . PHE B 1 241 ? -20.049 15.306  -40.794 1.00 17.85 ? 243  PHE B N   1 
ATOM   3727 C  CA  . PHE B 1 241 ? -19.422 14.483  -39.772 1.00 17.80 ? 243  PHE B CA  1 
ATOM   3728 C  C   . PHE B 1 241 ? -18.682 15.380  -38.824 1.00 16.85 ? 243  PHE B C   1 
ATOM   3729 O  O   . PHE B 1 241 ? -18.193 16.426  -39.226 1.00 16.40 ? 243  PHE B O   1 
ATOM   3730 C  CB  . PHE B 1 241 ? -18.475 13.417  -40.372 1.00 17.27 ? 243  PHE B CB  1 
ATOM   3731 C  CG  . PHE B 1 241 ? -17.330 13.974  -41.169 1.00 18.93 ? 243  PHE B CG  1 
ATOM   3732 C  CD1 . PHE B 1 241 ? -17.462 14.195  -42.545 1.00 18.55 ? 243  PHE B CD1 1 
ATOM   3733 C  CD2 . PHE B 1 241 ? -16.101 14.265  -40.560 1.00 18.92 ? 243  PHE B CD2 1 
ATOM   3734 C  CE1 . PHE B 1 241 ? -16.409 14.711  -43.279 1.00 19.35 ? 243  PHE B CE1 1 
ATOM   3735 C  CE2 . PHE B 1 241 ? -15.052 14.798  -41.293 1.00 19.28 ? 243  PHE B CE2 1 
ATOM   3736 C  CZ  . PHE B 1 241 ? -15.202 15.018  -42.655 1.00 18.95 ? 243  PHE B CZ  1 
ATOM   3737 N  N   . ARG B 1 242 ? -18.584 14.944  -37.572 1.00 15.69 ? 244  ARG B N   1 
ATOM   3738 C  CA  . ARG B 1 242 ? -17.817 15.641  -36.565 1.00 15.03 ? 244  ARG B CA  1 
ATOM   3739 C  C   . ARG B 1 242 ? -16.369 15.156  -36.605 1.00 15.15 ? 244  ARG B C   1 
ATOM   3740 O  O   . ARG B 1 242 ? -16.104 13.990  -36.862 1.00 14.54 ? 244  ARG B O   1 
ATOM   3741 C  CB  . ARG B 1 242 ? -18.430 15.361  -35.188 1.00 15.22 ? 244  ARG B CB  1 
ATOM   3742 C  CG  . ARG B 1 242 ? -17.845 16.202  -34.063 1.00 15.81 ? 244  ARG B CG  1 
ATOM   3743 C  CD  . ARG B 1 242 ? -18.344 15.727  -32.715 1.00 15.74 ? 244  ARG B CD  1 
ATOM   3744 N  NE  . ARG B 1 242 ? -18.016 16.654  -31.648 1.00 16.11 ? 244  ARG B NE  1 
ATOM   3745 C  CZ  . ARG B 1 242 ? -18.311 16.462  -30.364 1.00 16.21 ? 244  ARG B CZ  1 
ATOM   3746 N  NH1 . ARG B 1 242 ? -18.957 15.363  -29.975 1.00 16.21 ? 244  ARG B NH1 1 
ATOM   3747 N  NH2 . ARG B 1 242 ? -17.952 17.372  -29.458 1.00 16.33 ? 244  ARG B NH2 1 
ATOM   3748 N  N   . ALA B 1 243 ? -15.447 16.043  -36.282 1.00 15.75 ? 245  ALA B N   1 
ATOM   3749 C  CA  . ALA B 1 243 ? -14.045 15.676  -36.056 1.00 16.68 ? 245  ALA B CA  1 
ATOM   3750 C  C   . ALA B 1 243 ? -13.879 14.640  -34.948 1.00 17.38 ? 245  ALA B C   1 
ATOM   3751 O  O   . ALA B 1 243 ? -14.655 14.617  -33.977 1.00 16.73 ? 245  ALA B O   1 
ATOM   3752 C  CB  . ALA B 1 243 ? -13.246 16.932  -35.708 1.00 17.30 ? 245  ALA B CB  1 
ATOM   3753 N  N   . THR B 1 244 ? -12.858 13.799  -35.114 1.00 17.60 ? 246  THR B N   1 
ATOM   3754 C  CA  . THR B 1 244 ? -12.415 12.791  -34.158 1.00 17.99 ? 246  THR B CA  1 
ATOM   3755 C  C   . THR B 1 244 ? -12.161 13.402  -32.787 1.00 16.17 ? 246  THR B C   1 
ATOM   3756 O  O   . THR B 1 244 ? -11.526 14.409  -32.708 1.00 15.25 ? 246  THR B O   1 
ATOM   3757 C  CB  . THR B 1 244 ? -11.067 12.196  -34.628 1.00 19.68 ? 246  THR B CB  1 
ATOM   3758 O  OG1 . THR B 1 244 ? -11.145 11.885  -36.010 1.00 24.89 ? 246  THR B OG1 1 
ATOM   3759 C  CG2 . THR B 1 244 ? -10.726 10.985  -33.876 1.00 21.66 ? 246  THR B CG2 1 
ATOM   3760 N  N   . GLN B 1 245 ? -12.623 12.737  -31.729 1.00 15.20 ? 247  GLN B N   1 
ATOM   3761 C  CA  . GLN B 1 245 ? -12.486 13.182  -30.361 1.00 15.16 ? 247  GLN B CA  1 
ATOM   3762 C  C   . GLN B 1 245 ? -11.510 12.274  -29.636 1.00 14.80 ? 247  GLN B C   1 
ATOM   3763 O  O   . GLN B 1 245 ? -11.397 11.111  -29.982 1.00 15.61 ? 247  GLN B O   1 
ATOM   3764 C  CB  . GLN B 1 245 ? -13.844 13.135  -29.667 1.00 15.30 ? 247  GLN B CB  1 
ATOM   3765 C  CG  . GLN B 1 245 ? -14.908 13.970  -30.373 1.00 16.37 ? 247  GLN B CG  1 
ATOM   3766 C  CD  . GLN B 1 245 ? -14.566 15.455  -30.397 1.00 17.18 ? 247  GLN B CD  1 
ATOM   3767 O  OE1 . GLN B 1 245 ? -14.258 16.035  -29.363 1.00 17.75 ? 247  GLN B OE1 1 
ATOM   3768 N  NE2 . GLN B 1 245 ? -14.577 16.060  -31.581 1.00 17.76 ? 247  GLN B NE2 1 
ATOM   3769 N  N   . PRO B 1 246 ? -10.791 12.801  -28.630 1.00 14.54 ? 248  PRO B N   1 
ATOM   3770 C  CA  . PRO B 1 246 ? -9.870  11.978  -27.837 1.00 13.96 ? 248  PRO B CA  1 
ATOM   3771 C  C   . PRO B 1 246 ? -10.566 10.972  -26.932 1.00 12.85 ? 248  PRO B C   1 
ATOM   3772 O  O   . PRO B 1 246 ? -11.584 11.285  -26.325 1.00 11.59 ? 248  PRO B O   1 
ATOM   3773 C  CB  . PRO B 1 246 ? -9.121  13.015  -26.957 1.00 13.83 ? 248  PRO B CB  1 
ATOM   3774 C  CG  . PRO B 1 246 ? -10.032 14.168  -26.897 1.00 13.68 ? 248  PRO B CG  1 
ATOM   3775 C  CD  . PRO B 1 246 ? -10.744 14.217  -28.216 1.00 14.24 ? 248  PRO B CD  1 
ATOM   3776 N  N   . LEU B 1 247 ? -9.989  9.784   -26.838 1.00 13.25 ? 249  LEU B N   1 
ATOM   3777 C  CA  . LEU B 1 247 ? -10.503 8.750   -25.947 1.00 13.44 ? 249  LEU B CA  1 
ATOM   3778 C  C   . LEU B 1 247 ? -10.413 9.129   -24.479 1.00 13.88 ? 249  LEU B C   1 
ATOM   3779 O  O   . LEU B 1 247 ? -11.255 8.714   -23.672 1.00 12.68 ? 249  LEU B O   1 
ATOM   3780 C  CB  . LEU B 1 247 ? -9.813  7.410   -26.226 1.00 13.60 ? 249  LEU B CB  1 
ATOM   3781 C  CG  . LEU B 1 247 ? -10.362 6.636   -27.429 1.00 14.19 ? 249  LEU B CG  1 
ATOM   3782 C  CD1 . LEU B 1 247 ? -9.446  5.457   -27.779 1.00 14.77 ? 249  LEU B CD1 1 
ATOM   3783 C  CD2 . LEU B 1 247 ? -11.771 6.120   -27.158 1.00 14.26 ? 249  LEU B CD2 1 
ATOM   3784 N  N   . ASN B 1 248 ? -9.417  9.946   -24.112 1.00 14.45 ? 250  ASN B N   1 
ATOM   3785 C  CA  . ASN B 1 248 ? -9.265  10.379  -22.722 1.00 14.99 ? 250  ASN B CA  1 
ATOM   3786 C  C   . ASN B 1 248 ? -9.250  9.239   -21.719 1.00 13.95 ? 250  ASN B C   1 
ATOM   3787 O  O   . ASN B 1 248 ? -9.894  9.274   -20.686 1.00 13.79 ? 250  ASN B O   1 
ATOM   3788 C  CB  . ASN B 1 248 ? -10.351 11.407  -22.378 1.00 16.52 ? 250  ASN B CB  1 
ATOM   3789 C  CG  . ASN B 1 248 ? -9.977  12.795  -22.802 1.00 18.03 ? 250  ASN B CG  1 
ATOM   3790 O  OD1 . ASN B 1 248 ? -8.801  13.119  -22.855 1.00 21.10 ? 250  ASN B OD1 1 
ATOM   3791 N  ND2 . ASN B 1 248 ? -10.972 13.627  -23.110 1.00 18.84 ? 250  ASN B ND2 1 
ATOM   3792 N  N   . GLY B 1 249 ? -8.508  8.194   -22.051 1.00 12.95 ? 251  GLY B N   1 
ATOM   3793 C  CA  . GLY B 1 249 ? -8.370  7.070   -21.175 1.00 13.20 ? 251  GLY B CA  1 
ATOM   3794 C  C   . GLY B 1 249 ? -9.399  5.963   -21.345 1.00 13.15 ? 251  GLY B C   1 
ATOM   3795 O  O   . GLY B 1 249 ? -9.213  4.884   -20.791 1.00 13.01 ? 251  GLY B O   1 
ATOM   3796 N  N   . ARG B 1 250 ? -10.476 6.212   -22.094 1.00 12.77 ? 252  ARG B N   1 
ATOM   3797 C  CA  . ARG B 1 250 ? -11.380 5.140   -22.507 1.00 13.15 ? 252  ARG B CA  1 
ATOM   3798 C  C   . ARG B 1 250 ? -10.641 4.114   -23.372 1.00 13.37 ? 252  ARG B C   1 
ATOM   3799 O  O   . ARG B 1 250 ? -9.863  4.478   -24.246 1.00 13.10 ? 252  ARG B O   1 
ATOM   3800 C  CB  . ARG B 1 250 ? -12.592 5.682   -23.282 1.00 12.64 ? 252  ARG B CB  1 
ATOM   3801 C  CG  . ARG B 1 250 ? -13.573 6.485   -22.454 1.00 12.51 ? 252  ARG B CG  1 
ATOM   3802 C  CD  . ARG B 1 250 ? -14.583 7.175   -23.333 1.00 11.97 ? 252  ARG B CD  1 
ATOM   3803 N  NE  . ARG B 1 250 ? -13.984 8.213   -24.167 1.00 11.52 ? 252  ARG B NE  1 
ATOM   3804 C  CZ  . ARG B 1 250 ? -14.603 8.843   -25.169 1.00 11.50 ? 252  ARG B CZ  1 
ATOM   3805 N  NH1 . ARG B 1 250 ? -15.856 8.534   -25.505 1.00 11.26 ? 252  ARG B NH1 1 
ATOM   3806 N  NH2 . ARG B 1 250 ? -13.969 9.790   -25.847 1.00 11.09 ? 252  ARG B NH2 1 
ATOM   3807 N  N   . VAL B 1 251 ? -10.914 2.835   -23.133 1.00 13.68 ? 253  VAL B N   1 
ATOM   3808 C  CA  . VAL B 1 251 ? -10.308 1.767   -23.907 1.00 14.26 ? 253  VAL B CA  1 
ATOM   3809 C  C   . VAL B 1 251 ? -11.439 1.164   -24.730 1.00 14.20 ? 253  VAL B C   1 
ATOM   3810 O  O   . VAL B 1 251 ? -12.466 0.774   -24.177 1.00 15.97 ? 253  VAL B O   1 
ATOM   3811 C  CB  . VAL B 1 251 ? -9.685  0.719   -22.986 1.00 14.78 ? 253  VAL B CB  1 
ATOM   3812 C  CG1 . VAL B 1 251 ? -9.187  -0.498  -23.767 1.00 15.25 ? 253  VAL B CG1 1 
ATOM   3813 C  CG2 . VAL B 1 251 ? -8.546  1.336   -22.168 1.00 15.47 ? 253  VAL B CG2 1 
ATOM   3814 N  N   . ILE B 1 252 ? -11.266 1.119   -26.039 1.00 13.30 ? 254  ILE B N   1 
ATOM   3815 C  CA  . ILE B 1 252 ? -12.270 0.532   -26.925 1.00 13.01 ? 254  ILE B CA  1 
ATOM   3816 C  C   . ILE B 1 252 ? -12.195 -0.990  -26.768 1.00 12.86 ? 254  ILE B C   1 
ATOM   3817 O  O   . ILE B 1 252 ? -11.099 -1.551  -26.795 1.00 11.78 ? 254  ILE B O   1 
ATOM   3818 C  CB  . ILE B 1 252 ? -12.009 0.950   -28.381 1.00 13.03 ? 254  ILE B CB  1 
ATOM   3819 C  CG1 . ILE B 1 252 ? -12.109 2.461   -28.500 1.00 13.05 ? 254  ILE B CG1 1 
ATOM   3820 C  CG2 . ILE B 1 252 ? -12.984 0.262   -29.312 1.00 13.48 ? 254  ILE B CG2 1 
ATOM   3821 C  CD1 . ILE B 1 252 ? -11.637 3.019   -29.815 1.00 13.29 ? 254  ILE B CD1 1 
ATOM   3822 N  N   . GLU B 1 253 ? -13.347 -1.650  -26.607 1.00 12.76 ? 255  GLU B N   1 
ATOM   3823 C  CA  . GLU B 1 253 ? -13.385 -3.093  -26.540 1.00 13.64 ? 255  GLU B CA  1 
ATOM   3824 C  C   . GLU B 1 253 ? -13.670 -3.681  -27.919 1.00 13.29 ? 255  GLU B C   1 
ATOM   3825 O  O   . GLU B 1 253 ? -14.212 -3.006  -28.808 1.00 12.56 ? 255  GLU B O   1 
ATOM   3826 C  CB  . GLU B 1 253 ? -14.402 -3.583  -25.523 1.00 15.94 ? 255  GLU B CB  1 
ATOM   3827 C  CG  . GLU B 1 253 ? -14.155 -3.084  -24.106 1.00 18.49 ? 255  GLU B CG  1 
ATOM   3828 C  CD  . GLU B 1 253 ? -14.933 -3.883  -23.068 1.00 21.69 ? 255  GLU B CD  1 
ATOM   3829 O  OE1 . GLU B 1 253 ? -16.091 -4.196  -23.282 1.00 22.36 ? 255  GLU B OE1 1 
ATOM   3830 O  OE2 . GLU B 1 253 ? -14.354 -4.282  -22.052 1.00 30.46 ? 255  GLU B OE2 1 
ATOM   3831 N  N   . ALA B 1 254 ? -13.237 -4.919  -28.092 1.00 12.83 ? 256  ALA B N   1 
ATOM   3832 C  CA  . ALA B 1 254 ? -13.425 -5.680  -29.313 1.00 13.33 ? 256  ALA B CA  1 
ATOM   3833 C  C   . ALA B 1 254 ? -13.985 -7.031  -28.920 1.00 13.59 ? 256  ALA B C   1 
ATOM   3834 O  O   . ALA B 1 254 ? -13.549 -7.636  -27.917 1.00 13.20 ? 256  ALA B O   1 
ATOM   3835 C  CB  . ALA B 1 254 ? -12.101 -5.857  -30.063 1.00 13.64 ? 256  ALA B CB  1 
ATOM   3836 N  N   . SER B 1 255 ? -14.937 -7.500  -29.721 1.00 13.31 ? 257  SER B N   1 
ATOM   3837 C  CA  . SER B 1 255 ? -15.605 -8.762  -29.485 1.00 13.94 ? 257  SER B CA  1 
ATOM   3838 C  C   . SER B 1 255 ? -14.846 -9.977  -30.055 1.00 15.16 ? 257  SER B C   1 
ATOM   3839 O  O   . SER B 1 255 ? -15.340 -11.104 -29.983 1.00 15.99 ? 257  SER B O   1 
ATOM   3840 C  CB  . SER B 1 255 ? -17.011 -8.718  -30.109 1.00 13.63 ? 257  SER B CB  1 
ATOM   3841 O  OG  . SER B 1 255 ? -16.928 -8.623  -31.517 1.00 13.29 ? 257  SER B OG  1 
ATOM   3842 N  N   . PHE B 1 256 ? -13.679 -9.757  -30.632 1.00 15.38 ? 258  PHE B N   1 
ATOM   3843 C  CA  . PHE B 1 256 ? -12.955 -10.805 -31.316 1.00 16.91 ? 258  PHE B CA  1 
ATOM   3844 C  C   . PHE B 1 256 ? -11.474 -10.622 -31.018 1.00 17.97 ? 258  PHE B C   1 
ATOM   3845 O  O   . PHE B 1 256 ? -11.040 -9.500  -30.758 1.00 16.77 ? 258  PHE B O   1 
ATOM   3846 C  CB  . PHE B 1 256 ? -13.217 -10.711 -32.826 1.00 17.21 ? 258  PHE B CB  1 
ATOM   3847 C  CG  . PHE B 1 256 ? -12.886 -9.381  -33.400 1.00 16.47 ? 258  PHE B CG  1 
ATOM   3848 C  CD1 . PHE B 1 256 ? -13.798 -8.340  -33.336 1.00 16.31 ? 258  PHE B CD1 1 
ATOM   3849 C  CD2 . PHE B 1 256 ? -11.633 -9.141  -33.956 1.00 17.71 ? 258  PHE B CD2 1 
ATOM   3850 C  CE1 . PHE B 1 256 ? -13.491 -7.089  -33.839 1.00 15.75 ? 258  PHE B CE1 1 
ATOM   3851 C  CE2 . PHE B 1 256 ? -11.311 -7.882  -34.459 1.00 17.63 ? 258  PHE B CE2 1 
ATOM   3852 C  CZ  . PHE B 1 256 ? -12.253 -6.855  -34.408 1.00 17.04 ? 258  PHE B CZ  1 
ATOM   3853 N  N   . PRO B 1 257 ? -10.706 -11.724 -31.005 1.00 21.04 ? 259  PRO B N   1 
ATOM   3854 C  CA  . PRO B 1 257 ? -9.288  -11.668 -30.670 1.00 23.04 ? 259  PRO B CA  1 
ATOM   3855 C  C   . PRO B 1 257 ? -8.450  -11.032 -31.748 1.00 27.46 ? 259  PRO B C   1 
ATOM   3856 O  O   . PRO B 1 257 ? -7.361  -10.548 -31.429 1.00 30.49 ? 259  PRO B O   1 
ATOM   3857 C  CB  . PRO B 1 257 ? -8.893  -13.142 -30.503 1.00 22.65 ? 259  PRO B CB  1 
ATOM   3858 C  CG  . PRO B 1 257 ? -9.875  -13.878 -31.316 1.00 22.55 ? 259  PRO B CG  1 
ATOM   3859 C  CD  . PRO B 1 257 ? -11.161 -13.106 -31.240 1.00 21.66 ? 259  PRO B CD  1 
ATOM   3860 O  OXT . PRO B 1 257 ? -8.832  -10.966 -32.926 1.00 28.62 ? 259  PRO B OXT 1 
ATOM   3861 N  N   . TRP C 1 7   ? -63.050 -33.525 -26.080 1.00 40.81 ? 9    TRP C N   1 
ATOM   3862 C  CA  . TRP C 1 7   ? -61.875 -34.400 -25.770 1.00 38.50 ? 9    TRP C CA  1 
ATOM   3863 C  C   . TRP C 1 7   ? -61.410 -34.219 -24.327 1.00 37.10 ? 9    TRP C C   1 
ATOM   3864 O  O   . TRP C 1 7   ? -61.609 -33.166 -23.717 1.00 38.07 ? 9    TRP C O   1 
ATOM   3865 C  CB  . TRP C 1 7   ? -60.709 -34.147 -26.739 1.00 36.62 ? 9    TRP C CB  1 
ATOM   3866 C  CG  . TRP C 1 7   ? -60.075 -32.786 -26.621 1.00 34.61 ? 9    TRP C CG  1 
ATOM   3867 C  CD1 . TRP C 1 7   ? -60.425 -31.663 -27.302 1.00 33.41 ? 9    TRP C CD1 1 
ATOM   3868 C  CD2 . TRP C 1 7   ? -58.969 -32.421 -25.779 1.00 33.30 ? 9    TRP C CD2 1 
ATOM   3869 N  NE1 . TRP C 1 7   ? -59.611 -30.620 -26.940 1.00 35.28 ? 9    TRP C NE1 1 
ATOM   3870 C  CE2 . TRP C 1 7   ? -58.705 -31.057 -26.008 1.00 34.04 ? 9    TRP C CE2 1 
ATOM   3871 C  CE3 . TRP C 1 7   ? -58.177 -33.119 -24.856 1.00 34.30 ? 9    TRP C CE3 1 
ATOM   3872 C  CZ2 . TRP C 1 7   ? -57.684 -30.364 -25.345 1.00 34.66 ? 9    TRP C CZ2 1 
ATOM   3873 C  CZ3 . TRP C 1 7   ? -57.157 -32.429 -24.185 1.00 35.03 ? 9    TRP C CZ3 1 
ATOM   3874 C  CH2 . TRP C 1 7   ? -56.925 -31.063 -24.436 1.00 35.29 ? 9    TRP C CH2 1 
ATOM   3875 N  N   . ARG C 1 8   ? -60.772 -35.260 -23.807 1.00 37.17 ? 10   ARG C N   1 
ATOM   3876 C  CA  . ARG C 1 8   ? -60.331 -35.309 -22.414 1.00 36.22 ? 10   ARG C CA  1 
ATOM   3877 C  C   . ARG C 1 8   ? -59.009 -36.063 -22.318 1.00 35.61 ? 10   ARG C C   1 
ATOM   3878 O  O   . ARG C 1 8   ? -58.640 -36.818 -23.230 1.00 34.46 ? 10   ARG C O   1 
ATOM   3879 C  CB  . ARG C 1 8   ? -61.408 -36.005 -21.552 1.00 35.30 ? 10   ARG C CB  1 
ATOM   3880 N  N   . TYR C 1 9   ? -58.296 -35.857 -21.214 1.00 35.67 ? 11   TYR C N   1 
ATOM   3881 C  CA  . TYR C 1 9   ? -57.168 -36.728 -20.859 1.00 37.54 ? 11   TYR C CA  1 
ATOM   3882 C  C   . TYR C 1 9   ? -57.669 -37.981 -20.110 1.00 40.23 ? 11   TYR C C   1 
ATOM   3883 O  O   . TYR C 1 9   ? -58.628 -37.907 -19.342 1.00 38.26 ? 11   TYR C O   1 
ATOM   3884 C  CB  . TYR C 1 9   ? -56.151 -35.975 -19.996 1.00 36.81 ? 11   TYR C CB  1 
ATOM   3885 C  CG  . TYR C 1 9   ? -55.326 -34.952 -20.749 1.00 34.69 ? 11   TYR C CG  1 
ATOM   3886 C  CD1 . TYR C 1 9   ? -54.264 -35.346 -21.566 1.00 33.87 ? 11   TYR C CD1 1 
ATOM   3887 C  CD2 . TYR C 1 9   ? -55.584 -33.589 -20.621 1.00 34.07 ? 11   TYR C CD2 1 
ATOM   3888 C  CE1 . TYR C 1 9   ? -53.497 -34.407 -22.247 1.00 32.73 ? 11   TYR C CE1 1 
ATOM   3889 C  CE2 . TYR C 1 9   ? -54.831 -32.646 -21.306 1.00 32.74 ? 11   TYR C CE2 1 
ATOM   3890 C  CZ  . TYR C 1 9   ? -53.788 -33.057 -22.114 1.00 31.81 ? 11   TYR C CZ  1 
ATOM   3891 O  OH  . TYR C 1 9   ? -53.037 -32.108 -22.777 1.00 31.21 ? 11   TYR C OH  1 
ATOM   3892 N  N   . GLY C 1 10  ? -57.018 -39.120 -20.346 1.00 44.35 ? 12   GLY C N   1 
ATOM   3893 C  CA  . GLY C 1 10  ? -57.332 -40.383 -19.656 1.00 48.77 ? 12   GLY C CA  1 
ATOM   3894 C  C   . GLY C 1 10  ? -58.762 -40.889 -19.819 1.00 53.32 ? 12   GLY C C   1 
ATOM   3895 O  O   . GLY C 1 10  ? -59.485 -41.054 -18.835 1.00 56.81 ? 12   GLY C O   1 
ATOM   3896 N  N   . GLY C 1 11  ? -59.169 -41.136 -21.061 1.00 55.66 ? 13   GLY C N   1 
ATOM   3897 C  CA  . GLY C 1 11  ? -60.504 -41.645 -21.347 1.00 55.80 ? 13   GLY C CA  1 
ATOM   3898 C  C   . GLY C 1 11  ? -61.134 -41.070 -22.598 1.00 55.19 ? 13   GLY C C   1 
ATOM   3899 O  O   . GLY C 1 11  ? -60.744 -40.009 -23.088 1.00 51.60 ? 13   GLY C O   1 
ATOM   3900 N  N   . ASP C 1 12  ? -62.143 -41.785 -23.081 1.00 54.75 ? 14   ASP C N   1 
ATOM   3901 C  CA  . ASP C 1 12  ? -62.859 -41.462 -24.315 1.00 54.24 ? 14   ASP C CA  1 
ATOM   3902 C  C   . ASP C 1 12  ? -63.481 -40.054 -24.305 1.00 51.82 ? 14   ASP C C   1 
ATOM   3903 O  O   . ASP C 1 12  ? -63.702 -39.499 -23.225 1.00 52.67 ? 14   ASP C O   1 
ATOM   3904 C  CB  . ASP C 1 12  ? -63.949 -42.523 -24.557 1.00 57.14 ? 14   ASP C CB  1 
ATOM   3905 C  CG  . ASP C 1 12  ? -63.385 -43.839 -25.067 1.00 59.27 ? 14   ASP C CG  1 
ATOM   3906 O  OD1 . ASP C 1 12  ? -62.145 -44.008 -25.125 1.00 62.71 ? 14   ASP C OD1 1 
ATOM   3907 O  OD2 . ASP C 1 12  ? -64.198 -44.714 -25.411 1.00 66.51 ? 14   ASP C OD2 1 
ATOM   3908 N  N   . PRO C 1 13  ? -63.765 -39.465 -25.480 1.00 49.01 ? 15   PRO C N   1 
ATOM   3909 C  CA  . PRO C 1 13  ? -63.608 -40.091 -26.825 1.00 47.11 ? 15   PRO C CA  1 
ATOM   3910 C  C   . PRO C 1 13  ? -62.154 -40.246 -27.297 1.00 46.48 ? 15   PRO C C   1 
ATOM   3911 O  O   . PRO C 1 13  ? -61.324 -39.394 -26.969 1.00 45.07 ? 15   PRO C O   1 
ATOM   3912 C  CB  . PRO C 1 13  ? -64.349 -39.116 -27.747 1.00 47.11 ? 15   PRO C CB  1 
ATOM   3913 C  CG  . PRO C 1 13  ? -64.278 -37.795 -27.044 1.00 47.55 ? 15   PRO C CG  1 
ATOM   3914 C  CD  . PRO C 1 13  ? -64.262 -38.079 -25.565 1.00 46.86 ? 15   PRO C CD  1 
ATOM   3915 N  N   . PRO C 1 14  ? -61.841 -41.317 -28.069 1.00 45.61 ? 16   PRO C N   1 
ATOM   3916 C  CA  . PRO C 1 14  ? -60.465 -41.410 -28.554 1.00 42.96 ? 16   PRO C CA  1 
ATOM   3917 C  C   . PRO C 1 14  ? -60.165 -40.232 -29.481 1.00 39.93 ? 16   PRO C C   1 
ATOM   3918 O  O   . PRO C 1 14  ? -61.055 -39.760 -30.220 1.00 35.50 ? 16   PRO C O   1 
ATOM   3919 C  CB  . PRO C 1 14  ? -60.426 -42.754 -29.310 1.00 44.99 ? 16   PRO C CB  1 
ATOM   3920 C  CG  . PRO C 1 14  ? -61.692 -43.461 -28.935 1.00 45.02 ? 16   PRO C CG  1 
ATOM   3921 C  CD  . PRO C 1 14  ? -62.681 -42.361 -28.683 1.00 45.56 ? 16   PRO C CD  1 
ATOM   3922 N  N   . TRP C 1 15  ? -58.934 -39.741 -29.406 1.00 34.77 ? 17   TRP C N   1 
ATOM   3923 C  CA  . TRP C 1 15  ? -58.602 -38.452 -30.010 1.00 34.85 ? 17   TRP C CA  1 
ATOM   3924 C  C   . TRP C 1 15  ? -58.784 -38.419 -31.536 1.00 32.97 ? 17   TRP C C   1 
ATOM   3925 O  O   . TRP C 1 15  ? -59.319 -37.435 -32.046 1.00 34.20 ? 17   TRP C O   1 
ATOM   3926 C  CB  . TRP C 1 15  ? -57.202 -37.982 -29.571 1.00 33.76 ? 17   TRP C CB  1 
ATOM   3927 C  CG  . TRP C 1 15  ? -57.163 -37.423 -28.176 1.00 32.69 ? 17   TRP C CG  1 
ATOM   3928 C  CD1 . TRP C 1 15  ? -58.144 -37.496 -27.215 1.00 34.92 ? 17   TRP C CD1 1 
ATOM   3929 C  CD2 . TRP C 1 15  ? -56.075 -36.730 -27.580 1.00 32.86 ? 17   TRP C CD2 1 
ATOM   3930 N  NE1 . TRP C 1 15  ? -57.732 -36.862 -26.064 1.00 34.83 ? 17   TRP C NE1 1 
ATOM   3931 C  CE2 . TRP C 1 15  ? -56.460 -36.391 -26.258 1.00 34.23 ? 17   TRP C CE2 1 
ATOM   3932 C  CE3 . TRP C 1 15  ? -54.807 -36.347 -28.036 1.00 32.31 ? 17   TRP C CE3 1 
ATOM   3933 C  CZ2 . TRP C 1 15  ? -55.615 -35.677 -25.385 1.00 34.74 ? 17   TRP C CZ2 1 
ATOM   3934 C  CZ3 . TRP C 1 15  ? -53.974 -35.648 -27.179 1.00 32.54 ? 17   TRP C CZ3 1 
ATOM   3935 C  CH2 . TRP C 1 15  ? -54.379 -35.314 -25.865 1.00 32.70 ? 17   TRP C CH2 1 
ATOM   3936 N  N   . PRO C 1 16  ? -58.389 -39.491 -32.254 1.00 31.18 ? 18   PRO C N   1 
ATOM   3937 C  CA  . PRO C 1 16  ? -58.621 -39.481 -33.709 1.00 31.90 ? 18   PRO C CA  1 
ATOM   3938 C  C   . PRO C 1 16  ? -60.095 -39.405 -34.133 1.00 33.96 ? 18   PRO C C   1 
ATOM   3939 O  O   . PRO C 1 16  ? -60.369 -39.000 -35.269 1.00 32.55 ? 18   PRO C O   1 
ATOM   3940 C  CB  . PRO C 1 16  ? -57.958 -40.776 -34.180 1.00 31.52 ? 18   PRO C CB  1 
ATOM   3941 C  CG  . PRO C 1 16  ? -56.884 -41.017 -33.162 1.00 31.33 ? 18   PRO C CG  1 
ATOM   3942 C  CD  . PRO C 1 16  ? -57.530 -40.622 -31.862 1.00 30.81 ? 18   PRO C CD  1 
ATOM   3943 N  N   . ARG C 1 17  ? -61.019 -39.781 -33.233 1.00 35.43 ? 19   ARG C N   1 
ATOM   3944 C  CA  . ARG C 1 17  ? -62.464 -39.604 -33.453 1.00 37.98 ? 19   ARG C CA  1 
ATOM   3945 C  C   . ARG C 1 17  ? -62.862 -38.135 -33.364 1.00 39.08 ? 19   ARG C C   1 
ATOM   3946 O  O   . ARG C 1 17  ? -63.684 -37.680 -34.142 1.00 44.60 ? 19   ARG C O   1 
ATOM   3947 C  CB  . ARG C 1 17  ? -63.291 -40.446 -32.468 1.00 37.83 ? 19   ARG C CB  1 
ATOM   3948 N  N   . VAL C 1 18  ? -62.275 -37.402 -32.421 1.00 39.65 ? 20   VAL C N   1 
ATOM   3949 C  CA  . VAL C 1 18  ? -62.460 -35.946 -32.290 1.00 37.17 ? 20   VAL C CA  1 
ATOM   3950 C  C   . VAL C 1 18  ? -61.780 -35.219 -33.454 1.00 35.65 ? 20   VAL C C   1 
ATOM   3951 O  O   . VAL C 1 18  ? -62.399 -34.380 -34.097 1.00 33.74 ? 20   VAL C O   1 
ATOM   3952 C  CB  . VAL C 1 18  ? -61.865 -35.414 -30.946 1.00 39.54 ? 20   VAL C CB  1 
ATOM   3953 C  CG1 . VAL C 1 18  ? -61.866 -33.879 -30.871 1.00 41.78 ? 20   VAL C CG1 1 
ATOM   3954 C  CG2 . VAL C 1 18  ? -62.625 -35.988 -29.760 1.00 41.02 ? 20   VAL C CG2 1 
ATOM   3955 N  N   . SER C 1 19  ? -60.494 -35.529 -33.660 1.00 31.85 ? 21   SER C N   1 
ATOM   3956 C  CA  . SER C 1 19  ? -59.630 -34.924 -34.660 1.00 29.76 ? 21   SER C CA  1 
ATOM   3957 C  C   . SER C 1 19  ? -58.831 -36.018 -35.365 1.00 26.61 ? 21   SER C C   1 
ATOM   3958 O  O   . SER C 1 19  ? -57.863 -36.526 -34.807 1.00 23.42 ? 21   SER C O   1 
ATOM   3959 C  CB  . SER C 1 19  ? -58.660 -33.939 -34.003 1.00 30.75 ? 21   SER C CB  1 
ATOM   3960 O  OG  . SER C 1 19  ? -59.311 -32.721 -33.699 1.00 32.52 ? 21   SER C OG  1 
ATOM   3961 N  N   . PRO C 1 20  ? -59.236 -36.391 -36.598 1.00 25.47 ? 22   PRO C N   1 
ATOM   3962 C  CA  . PRO C 1 20  ? -58.472 -37.333 -37.402 1.00 23.68 ? 22   PRO C CA  1 
ATOM   3963 C  C   . PRO C 1 20  ? -56.994 -37.007 -37.584 1.00 21.91 ? 22   PRO C C   1 
ATOM   3964 O  O   . PRO C 1 20  ? -56.191 -37.933 -37.752 1.00 20.95 ? 22   PRO C O   1 
ATOM   3965 C  CB  . PRO C 1 20  ? -59.213 -37.310 -38.740 1.00 24.55 ? 22   PRO C CB  1 
ATOM   3966 C  CG  . PRO C 1 20  ? -60.649 -37.169 -38.311 1.00 25.69 ? 22   PRO C CG  1 
ATOM   3967 C  CD  . PRO C 1 20  ? -60.595 -36.198 -37.152 1.00 25.91 ? 22   PRO C CD  1 
ATOM   3968 N  N   . ALA C 1 21  ? -56.646 -35.714 -37.568 1.00 21.92 ? 23   ALA C N   1 
ATOM   3969 C  CA  . ALA C 1 21  ? -55.238 -35.266 -37.628 1.00 22.55 ? 23   ALA C CA  1 
ATOM   3970 C  C   . ALA C 1 21  ? -54.378 -35.874 -36.526 1.00 21.51 ? 23   ALA C C   1 
ATOM   3971 O  O   . ALA C 1 21  ? -53.160 -36.044 -36.704 1.00 20.27 ? 23   ALA C O   1 
ATOM   3972 C  CB  . ALA C 1 21  ? -55.163 -33.752 -37.533 1.00 22.74 ? 23   ALA C CB  1 
ATOM   3973 N  N   . CYS C 1 22  ? -55.018 -36.195 -35.399 1.00 20.81 ? 24   CYS C N   1 
ATOM   3974 C  CA  . CYS C 1 22  ? -54.327 -36.821 -34.274 1.00 21.74 ? 24   CYS C CA  1 
ATOM   3975 C  C   . CYS C 1 22  ? -53.727 -38.181 -34.625 1.00 21.84 ? 24   CYS C C   1 
ATOM   3976 O  O   . CYS C 1 22  ? -52.836 -38.637 -33.918 1.00 21.78 ? 24   CYS C O   1 
ATOM   3977 C  CB  . CYS C 1 22  ? -55.227 -36.887 -33.027 1.00 21.20 ? 24   CYS C CB  1 
ATOM   3978 S  SG  . CYS C 1 22  ? -55.743 -35.283 -32.341 1.00 22.85 ? 24   CYS C SG  1 
ATOM   3979 N  N   . ALA C 1 23  ? -54.177 -38.800 -35.735 1.00 21.45 ? 25   ALA C N   1 
ATOM   3980 C  CA  . ALA C 1 23  ? -53.549 -39.996 -36.281 1.00 21.17 ? 25   ALA C CA  1 
ATOM   3981 C  C   . ALA C 1 23  ? -52.578 -39.712 -37.409 1.00 20.72 ? 25   ALA C C   1 
ATOM   3982 O  O   . ALA C 1 23  ? -52.227 -40.620 -38.145 1.00 21.10 ? 25   ALA C O   1 
ATOM   3983 C  CB  . ALA C 1 23  ? -54.621 -40.993 -36.743 1.00 22.25 ? 25   ALA C CB  1 
ATOM   3984 N  N   . GLY C 1 24  ? -52.105 -38.473 -37.549 1.00 21.81 ? 26   GLY C N   1 
ATOM   3985 C  CA  . GLY C 1 24  ? -51.035 -38.166 -38.506 1.00 21.30 ? 26   GLY C CA  1 
ATOM   3986 C  C   . GLY C 1 24  ? -49.744 -38.892 -38.176 1.00 21.62 ? 26   GLY C C   1 
ATOM   3987 O  O   . GLY C 1 24  ? -49.581 -39.390 -37.067 1.00 23.17 ? 26   GLY C O   1 
ATOM   3988 N  N   . ARG C 1 25  ? -48.833 -38.957 -39.142 1.00 22.41 ? 27   ARG C N   1 
ATOM   3989 C  CA  . ARG C 1 25  ? -47.567 -39.679 -38.998 1.00 25.25 ? 27   ARG C CA  1 
ATOM   3990 C  C   . ARG C 1 25  ? -46.456 -38.920 -38.238 1.00 23.36 ? 27   ARG C C   1 
ATOM   3991 O  O   . ARG C 1 25  ? -45.406 -39.505 -37.942 1.00 22.33 ? 27   ARG C O   1 
ATOM   3992 C  CB  . ARG C 1 25  ? -47.007 -40.060 -40.379 1.00 30.07 ? 27   ARG C CB  1 
ATOM   3993 C  CG  . ARG C 1 25  ? -47.702 -41.255 -41.000 1.00 35.45 ? 27   ARG C CG  1 
ATOM   3994 C  CD  . ARG C 1 25  ? -47.134 -41.633 -42.361 1.00 40.26 ? 27   ARG C CD  1 
ATOM   3995 N  NE  . ARG C 1 25  ? -45.675 -41.811 -42.390 1.00 43.58 ? 27   ARG C NE  1 
ATOM   3996 C  CZ  . ARG C 1 25  ? -45.002 -42.846 -41.874 1.00 47.22 ? 27   ARG C CZ  1 
ATOM   3997 N  NH1 . ARG C 1 25  ? -45.624 -43.840 -41.228 1.00 46.46 ? 27   ARG C NH1 1 
ATOM   3998 N  NH2 . ARG C 1 25  ? -43.672 -42.879 -41.996 1.00 48.56 ? 27   ARG C NH2 1 
ATOM   3999 N  N   . PHE C 1 26  ? -46.664 -37.636 -37.967 1.00 21.70 ? 28   PHE C N   1 
ATOM   4000 C  CA  . PHE C 1 26  ? -45.611 -36.772 -37.416 1.00 21.23 ? 28   PHE C CA  1 
ATOM   4001 C  C   . PHE C 1 26  ? -46.128 -35.973 -36.224 1.00 19.96 ? 28   PHE C C   1 
ATOM   4002 O  O   . PHE C 1 26  ? -46.227 -34.739 -36.257 1.00 19.08 ? 28   PHE C O   1 
ATOM   4003 C  CB  . PHE C 1 26  ? -45.054 -35.889 -38.532 1.00 21.25 ? 28   PHE C CB  1 
ATOM   4004 C  CG  . PHE C 1 26  ? -44.550 -36.677 -39.711 1.00 21.01 ? 28   PHE C CG  1 
ATOM   4005 C  CD1 . PHE C 1 26  ? -43.550 -37.618 -39.542 1.00 21.05 ? 28   PHE C CD1 1 
ATOM   4006 C  CD2 . PHE C 1 26  ? -45.102 -36.505 -40.985 1.00 21.78 ? 28   PHE C CD2 1 
ATOM   4007 C  CE1 . PHE C 1 26  ? -43.088 -38.374 -40.609 1.00 21.24 ? 28   PHE C CE1 1 
ATOM   4008 C  CE2 . PHE C 1 26  ? -44.647 -37.262 -42.067 1.00 20.90 ? 28   PHE C CE2 1 
ATOM   4009 C  CZ  . PHE C 1 26  ? -43.632 -38.195 -41.875 1.00 21.63 ? 28   PHE C CZ  1 
ATOM   4010 N  N   . GLN C 1 27  ? -46.456 -36.714 -35.169 1.00 18.04 ? 29   GLN C N   1 
ATOM   4011 C  CA  . GLN C 1 27  ? -47.060 -36.154 -33.992 1.00 18.27 ? 29   GLN C CA  1 
ATOM   4012 C  C   . GLN C 1 27  ? -46.050 -35.913 -32.860 1.00 18.29 ? 29   GLN C C   1 
ATOM   4013 O  O   . GLN C 1 27  ? -44.913 -36.365 -32.907 1.00 17.74 ? 29   GLN C O   1 
ATOM   4014 C  CB  . GLN C 1 27  ? -48.182 -37.061 -33.489 1.00 18.85 ? 29   GLN C CB  1 
ATOM   4015 C  CG  . GLN C 1 27  ? -49.357 -37.231 -34.454 1.00 19.12 ? 29   GLN C CG  1 
ATOM   4016 C  CD  . GLN C 1 27  ? -50.306 -36.053 -34.451 1.00 18.58 ? 29   GLN C CD  1 
ATOM   4017 O  OE1 . GLN C 1 27  ? -51.014 -35.842 -33.483 1.00 17.53 ? 29   GLN C OE1 1 
ATOM   4018 N  NE2 . GLN C 1 27  ? -50.339 -35.291 -35.554 1.00 18.29 ? 29   GLN C NE2 1 
ATOM   4019 N  N   . SER C 1 28  ? -46.526 -35.204 -31.849 1.00 19.07 ? 30   SER C N   1 
ATOM   4020 C  CA  . SER C 1 28  ? -45.787 -34.900 -30.641 1.00 19.59 ? 30   SER C CA  1 
ATOM   4021 C  C   . SER C 1 28  ? -46.672 -35.260 -29.467 1.00 20.46 ? 30   SER C C   1 
ATOM   4022 O  O   . SER C 1 28  ? -47.896 -35.322 -29.635 1.00 21.25 ? 30   SER C O   1 
ATOM   4023 C  CB  . SER C 1 28  ? -45.466 -33.418 -30.617 1.00 19.16 ? 30   SER C CB  1 
ATOM   4024 O  OG  . SER C 1 28  ? -44.647 -33.065 -31.711 1.00 17.35 ? 30   SER C OG  1 
ATOM   4025 N  N   . PRO C 1 29  ? -46.108 -35.488 -28.275 1.00 21.12 ? 31   PRO C N   1 
ATOM   4026 C  CA  . PRO C 1 29  ? -44.677 -35.438 -27.986 1.00 21.35 ? 31   PRO C CA  1 
ATOM   4027 C  C   . PRO C 1 29  ? -43.985 -36.716 -28.426 1.00 22.26 ? 31   PRO C C   1 
ATOM   4028 O  O   . PRO C 1 29  ? -44.644 -37.627 -28.932 1.00 23.24 ? 31   PRO C O   1 
ATOM   4029 C  CB  . PRO C 1 29  ? -44.643 -35.317 -26.466 1.00 21.58 ? 31   PRO C CB  1 
ATOM   4030 C  CG  . PRO C 1 29  ? -45.849 -36.099 -26.025 1.00 22.12 ? 31   PRO C CG  1 
ATOM   4031 C  CD  . PRO C 1 29  ? -46.901 -35.836 -27.081 1.00 21.58 ? 31   PRO C CD  1 
ATOM   4032 N  N   . VAL C 1 30  ? -42.673 -36.764 -28.230 1.00 21.59 ? 32   VAL C N   1 
ATOM   4033 C  CA  . VAL C 1 30  ? -41.841 -37.893 -28.602 1.00 23.15 ? 32   VAL C CA  1 
ATOM   4034 C  C   . VAL C 1 30  ? -40.859 -38.209 -27.484 1.00 24.73 ? 32   VAL C C   1 
ATOM   4035 O  O   . VAL C 1 30  ? -40.601 -37.369 -26.598 1.00 24.35 ? 32   VAL C O   1 
ATOM   4036 C  CB  . VAL C 1 30  ? -41.037 -37.658 -29.890 1.00 23.20 ? 32   VAL C CB  1 
ATOM   4037 C  CG1 . VAL C 1 30  ? -41.980 -37.448 -31.072 1.00 24.10 ? 32   VAL C CG1 1 
ATOM   4038 C  CG2 . VAL C 1 30  ? -40.059 -36.495 -29.760 1.00 22.88 ? 32   VAL C CG2 1 
ATOM   4039 N  N   . ASP C 1 31  ? -40.318 -39.423 -27.546 1.00 24.93 ? 33   ASP C N   1 
ATOM   4040 C  CA  . ASP C 1 31  ? -39.264 -39.855 -26.637 1.00 25.52 ? 33   ASP C CA  1 
ATOM   4041 C  C   . ASP C 1 31  ? -37.943 -39.448 -27.250 1.00 24.39 ? 33   ASP C C   1 
ATOM   4042 O  O   . ASP C 1 31  ? -37.626 -39.849 -28.367 1.00 25.40 ? 33   ASP C O   1 
ATOM   4043 C  CB  . ASP C 1 31  ? -39.307 -41.378 -26.432 1.00 26.61 ? 33   ASP C CB  1 
ATOM   4044 C  CG  . ASP C 1 31  ? -38.238 -41.864 -25.464 1.00 27.03 ? 33   ASP C CG  1 
ATOM   4045 O  OD1 . ASP C 1 31  ? -38.190 -41.352 -24.315 1.00 26.49 ? 33   ASP C OD1 1 
ATOM   4046 O  OD2 . ASP C 1 31  ? -37.433 -42.728 -25.864 1.00 28.06 ? 33   ASP C OD2 1 
ATOM   4047 N  N   . ILE C 1 32  ? -37.171 -38.649 -26.526 1.00 24.00 ? 34   ILE C N   1 
ATOM   4048 C  CA  . ILE C 1 32  ? -35.882 -38.170 -27.014 1.00 23.98 ? 34   ILE C CA  1 
ATOM   4049 C  C   . ILE C 1 32  ? -34.824 -39.131 -26.508 1.00 26.24 ? 34   ILE C C   1 
ATOM   4050 O  O   . ILE C 1 32  ? -34.698 -39.338 -25.295 1.00 26.71 ? 34   ILE C O   1 
ATOM   4051 C  CB  . ILE C 1 32  ? -35.563 -36.752 -26.494 1.00 22.63 ? 34   ILE C CB  1 
ATOM   4052 C  CG1 . ILE C 1 32  ? -36.633 -35.765 -26.947 1.00 22.73 ? 34   ILE C CG1 1 
ATOM   4053 C  CG2 . ILE C 1 32  ? -34.187 -36.289 -26.964 1.00 22.54 ? 34   ILE C CG2 1 
ATOM   4054 C  CD1 . ILE C 1 32  ? -36.629 -34.467 -26.167 1.00 23.11 ? 34   ILE C CD1 1 
ATOM   4055 N  N   . ARG C 1 33  ? -34.075 -39.709 -27.434 1.00 26.22 ? 35   ARG C N   1 
ATOM   4056 C  CA  . ARG C 1 33  ? -32.943 -40.565 -27.118 1.00 28.94 ? 35   ARG C CA  1 
ATOM   4057 C  C   . ARG C 1 33  ? -31.680 -39.856 -27.580 1.00 25.55 ? 35   ARG C C   1 
ATOM   4058 O  O   . ARG C 1 33  ? -31.347 -39.922 -28.751 1.00 23.74 ? 35   ARG C O   1 
ATOM   4059 C  CB  . ARG C 1 33  ? -33.110 -41.917 -27.819 1.00 32.58 ? 35   ARG C CB  1 
ATOM   4060 C  CG  . ARG C 1 33  ? -34.405 -42.620 -27.447 1.00 36.38 ? 35   ARG C CG  1 
ATOM   4061 C  CD  . ARG C 1 33  ? -34.400 -44.040 -27.956 1.00 40.07 ? 35   ARG C CD  1 
ATOM   4062 N  NE  . ARG C 1 33  ? -33.327 -44.787 -27.313 1.00 46.29 ? 35   ARG C NE  1 
ATOM   4063 C  CZ  . ARG C 1 33  ? -32.776 -45.908 -27.778 1.00 53.42 ? 35   ARG C CZ  1 
ATOM   4064 N  NH1 . ARG C 1 33  ? -33.185 -46.476 -28.919 1.00 53.80 ? 35   ARG C NH1 1 
ATOM   4065 N  NH2 . ARG C 1 33  ? -31.795 -46.476 -27.082 1.00 56.61 ? 35   ARG C NH2 1 
ATOM   4066 N  N   . PRO C 1 34  ? -30.985 -39.148 -26.663 1.00 26.13 ? 36   PRO C N   1 
ATOM   4067 C  CA  . PRO C 1 34  ? -29.860 -38.283 -27.033 1.00 26.18 ? 36   PRO C CA  1 
ATOM   4068 C  C   . PRO C 1 34  ? -28.769 -38.939 -27.871 1.00 27.69 ? 36   PRO C C   1 
ATOM   4069 O  O   . PRO C 1 34  ? -28.146 -38.255 -28.690 1.00 25.28 ? 36   PRO C O   1 
ATOM   4070 C  CB  . PRO C 1 34  ? -29.287 -37.863 -25.683 1.00 26.29 ? 36   PRO C CB  1 
ATOM   4071 C  CG  . PRO C 1 34  ? -30.427 -37.938 -24.760 1.00 26.59 ? 36   PRO C CG  1 
ATOM   4072 C  CD  . PRO C 1 34  ? -31.227 -39.107 -25.213 1.00 26.08 ? 36   PRO C CD  1 
ATOM   4073 N  N   . GLN C 1 35  ? -28.537 -40.242 -27.669 1.00 32.09 ? 37   GLN C N   1 
ATOM   4074 C  CA  . GLN C 1 35  ? -27.517 -40.985 -28.433 1.00 36.17 ? 37   GLN C CA  1 
ATOM   4075 C  C   . GLN C 1 35  ? -27.867 -41.175 -29.905 1.00 33.63 ? 37   GLN C C   1 
ATOM   4076 O  O   . GLN C 1 35  ? -26.967 -41.370 -30.709 1.00 34.14 ? 37   GLN C O   1 
ATOM   4077 C  CB  . GLN C 1 35  ? -27.210 -42.368 -27.807 1.00 43.93 ? 37   GLN C CB  1 
ATOM   4078 C  CG  . GLN C 1 35  ? -25.973 -42.406 -26.916 1.00 51.51 ? 37   GLN C CG  1 
ATOM   4079 C  CD  . GLN C 1 35  ? -26.065 -41.485 -25.715 1.00 59.72 ? 37   GLN C CD  1 
ATOM   4080 O  OE1 . GLN C 1 35  ? -25.180 -40.650 -25.486 1.00 65.11 ? 37   GLN C OE1 1 
ATOM   4081 N  NE2 . GLN C 1 35  ? -27.140 -41.627 -24.936 1.00 66.51 ? 37   GLN C NE2 1 
ATOM   4082 N  N   . LEU C 1 36  ? -29.157 -41.147 -30.250 1.00 31.85 ? 38   LEU C N   1 
ATOM   4083 C  CA  . LEU C 1 36  ? -29.600 -41.210 -31.653 1.00 30.08 ? 38   LEU C CA  1 
ATOM   4084 C  C   . LEU C 1 36  ? -29.922 -39.829 -32.252 1.00 29.93 ? 38   LEU C C   1 
ATOM   4085 O  O   . LEU C 1 36  ? -30.256 -39.721 -33.435 1.00 30.87 ? 38   LEU C O   1 
ATOM   4086 C  CB  . LEU C 1 36  ? -30.820 -42.135 -31.773 1.00 30.21 ? 38   LEU C CB  1 
ATOM   4087 C  CG  . LEU C 1 36  ? -30.684 -43.542 -31.156 1.00 31.71 ? 38   LEU C CG  1 
ATOM   4088 C  CD1 . LEU C 1 36  ? -31.916 -44.417 -31.441 1.00 32.29 ? 38   LEU C CD1 1 
ATOM   4089 C  CD2 . LEU C 1 36  ? -29.416 -44.238 -31.626 1.00 30.72 ? 38   LEU C CD2 1 
ATOM   4090 N  N   . ALA C 1 37  ? -29.824 -38.774 -31.452 1.00 27.91 ? 39   ALA C N   1 
ATOM   4091 C  CA  . ALA C 1 37  ? -29.995 -37.417 -31.973 1.00 26.44 ? 39   ALA C CA  1 
ATOM   4092 C  C   . ALA C 1 37  ? -28.815 -37.052 -32.851 1.00 24.77 ? 39   ALA C C   1 
ATOM   4093 O  O   . ALA C 1 37  ? -27.706 -37.496 -32.607 1.00 26.43 ? 39   ALA C O   1 
ATOM   4094 C  CB  . ALA C 1 37  ? -30.149 -36.416 -30.848 1.00 26.18 ? 39   ALA C CB  1 
ATOM   4095 N  N   . ALA C 1 38  ? -29.071 -36.253 -33.875 1.00 23.03 ? 40   ALA C N   1 
ATOM   4096 C  CA  . ALA C 1 38  ? -28.065 -35.859 -34.840 1.00 22.82 ? 40   ALA C CA  1 
ATOM   4097 C  C   . ALA C 1 38  ? -27.503 -34.502 -34.431 1.00 22.68 ? 40   ALA C C   1 
ATOM   4098 O  O   . ALA C 1 38  ? -28.251 -33.523 -34.354 1.00 21.45 ? 40   ALA C O   1 
ATOM   4099 C  CB  . ALA C 1 38  ? -28.675 -35.772 -36.229 1.00 22.89 ? 40   ALA C CB  1 
ATOM   4100 N  N   . PHE C 1 39  ? -26.192 -34.453 -34.171 1.00 23.27 ? 41   PHE C N   1 
ATOM   4101 C  CA  . PHE C 1 39  ? -25.519 -33.199 -33.859 1.00 23.00 ? 41   PHE C CA  1 
ATOM   4102 C  C   . PHE C 1 39  ? -25.549 -32.364 -35.117 1.00 22.05 ? 41   PHE C C   1 
ATOM   4103 O  O   . PHE C 1 39  ? -25.049 -32.770 -36.158 1.00 22.25 ? 41   PHE C O   1 
ATOM   4104 C  CB  . PHE C 1 39  ? -24.082 -33.404 -33.335 1.00 23.24 ? 41   PHE C CB  1 
ATOM   4105 C  CG  . PHE C 1 39  ? -23.285 -32.126 -33.197 1.00 22.50 ? 41   PHE C CG  1 
ATOM   4106 C  CD1 . PHE C 1 39  ? -23.825 -31.002 -32.576 1.00 24.92 ? 41   PHE C CD1 1 
ATOM   4107 C  CD2 . PHE C 1 39  ? -21.990 -32.032 -33.706 1.00 24.66 ? 41   PHE C CD2 1 
ATOM   4108 C  CE1 . PHE C 1 39  ? -23.090 -29.814 -32.462 1.00 24.73 ? 41   PHE C CE1 1 
ATOM   4109 C  CE2 . PHE C 1 39  ? -21.251 -30.846 -33.590 1.00 24.67 ? 41   PHE C CE2 1 
ATOM   4110 C  CZ  . PHE C 1 39  ? -21.799 -29.740 -32.962 1.00 23.48 ? 41   PHE C CZ  1 
ATOM   4111 N  N   . SER C 1 40  ? -26.138 -31.184 -34.996 1.00 22.16 ? 42   SER C N   1 
ATOM   4112 C  CA  . SER C 1 40  ? -26.394 -30.300 -36.125 1.00 22.22 ? 42   SER C CA  1 
ATOM   4113 C  C   . SER C 1 40  ? -25.829 -28.930 -35.770 1.00 23.42 ? 42   SER C C   1 
ATOM   4114 O  O   . SER C 1 40  ? -26.539 -28.078 -35.202 1.00 21.21 ? 42   SER C O   1 
ATOM   4115 C  CB  . SER C 1 40  ? -27.906 -30.255 -36.394 1.00 23.67 ? 42   SER C CB  1 
ATOM   4116 O  OG  . SER C 1 40  ? -28.456 -31.578 -36.362 1.00 24.89 ? 42   SER C OG  1 
ATOM   4117 N  N   . PRO C 1 41  ? -24.541 -28.702 -36.099 1.00 25.03 ? 43   PRO C N   1 
ATOM   4118 C  CA  . PRO C 1 41  ? -23.903 -27.467 -35.647 1.00 25.66 ? 43   PRO C CA  1 
ATOM   4119 C  C   . PRO C 1 41  ? -24.456 -26.183 -36.223 1.00 24.59 ? 43   PRO C C   1 
ATOM   4120 O  O   . PRO C 1 41  ? -24.115 -25.136 -35.727 1.00 23.51 ? 43   PRO C O   1 
ATOM   4121 C  CB  . PRO C 1 41  ? -22.423 -27.636 -36.043 1.00 26.53 ? 43   PRO C CB  1 
ATOM   4122 C  CG  . PRO C 1 41  ? -22.332 -28.892 -36.824 1.00 27.07 ? 43   PRO C CG  1 
ATOM   4123 C  CD  . PRO C 1 41  ? -23.552 -29.698 -36.545 1.00 27.40 ? 43   PRO C CD  1 
ATOM   4124 N  N   . ALA C 1 42  ? -25.293 -26.260 -37.252 1.00 23.96 ? 44   ALA C N   1 
ATOM   4125 C  CA  . ALA C 1 42  ? -25.994 -25.089 -37.760 1.00 23.36 ? 44   ALA C CA  1 
ATOM   4126 C  C   . ALA C 1 42  ? -26.968 -24.476 -36.752 1.00 22.20 ? 44   ALA C C   1 
ATOM   4127 O  O   . ALA C 1 42  ? -27.295 -23.304 -36.868 1.00 22.16 ? 44   ALA C O   1 
ATOM   4128 C  CB  . ALA C 1 42  ? -26.731 -25.442 -39.043 1.00 23.90 ? 44   ALA C CB  1 
ATOM   4129 N  N   . LEU C 1 43  ? -27.413 -25.264 -35.778 1.00 21.38 ? 45   LEU C N   1 
ATOM   4130 C  CA  . LEU C 1 43  ? -28.368 -24.825 -34.790 1.00 22.43 ? 45   LEU C CA  1 
ATOM   4131 C  C   . LEU C 1 43  ? -27.770 -23.758 -33.866 1.00 23.81 ? 45   LEU C C   1 
ATOM   4132 O  O   . LEU C 1 43  ? -26.856 -24.043 -33.104 1.00 24.05 ? 45   LEU C O   1 
ATOM   4133 C  CB  . LEU C 1 43  ? -28.885 -26.017 -33.977 1.00 21.64 ? 45   LEU C CB  1 
ATOM   4134 C  CG  . LEU C 1 43  ? -29.697 -27.034 -34.780 1.00 23.05 ? 45   LEU C CG  1 
ATOM   4135 C  CD1 . LEU C 1 43  ? -30.116 -28.189 -33.883 1.00 22.67 ? 45   LEU C CD1 1 
ATOM   4136 C  CD2 . LEU C 1 43  ? -30.906 -26.379 -35.454 1.00 23.18 ? 45   LEU C CD2 1 
ATOM   4137 N  N   . ARG C 1 44  ? -28.322 -22.550 -33.932 1.00 23.56 ? 46   ARG C N   1 
ATOM   4138 C  CA  . ARG C 1 44  ? -27.752 -21.369 -33.264 1.00 24.20 ? 46   ARG C CA  1 
ATOM   4139 C  C   . ARG C 1 44  ? -28.368 -21.215 -31.896 1.00 20.81 ? 46   ARG C C   1 
ATOM   4140 O  O   . ARG C 1 44  ? -29.447 -21.739 -31.663 1.00 19.38 ? 46   ARG C O   1 
ATOM   4141 C  CB  . ARG C 1 44  ? -28.102 -20.106 -34.057 1.00 28.36 ? 46   ARG C CB  1 
ATOM   4142 C  CG  . ARG C 1 44  ? -27.572 -20.075 -35.480 1.00 33.31 ? 46   ARG C CG  1 
ATOM   4143 C  CD  . ARG C 1 44  ? -26.081 -19.755 -35.532 1.00 37.42 ? 46   ARG C CD  1 
ATOM   4144 N  NE  . ARG C 1 44  ? -25.301 -20.896 -36.021 1.00 42.47 ? 46   ARG C NE  1 
ATOM   4145 C  CZ  . ARG C 1 44  ? -24.465 -21.665 -35.320 1.00 44.30 ? 46   ARG C CZ  1 
ATOM   4146 N  NH1 . ARG C 1 44  ? -24.204 -21.461 -34.023 1.00 48.61 ? 46   ARG C NH1 1 
ATOM   4147 N  NH2 . ARG C 1 44  ? -23.850 -22.658 -35.951 1.00 45.58 ? 46   ARG C NH2 1 
ATOM   4148 N  N   . PRO C 1 45  ? -27.725 -20.443 -31.001 1.00 18.75 ? 47   PRO C N   1 
ATOM   4149 C  CA  . PRO C 1 45  ? -28.396 -20.110 -29.737 1.00 18.19 ? 47   PRO C CA  1 
ATOM   4150 C  C   . PRO C 1 45  ? -29.743 -19.405 -29.956 1.00 16.96 ? 47   PRO C C   1 
ATOM   4151 O  O   . PRO C 1 45  ? -29.850 -18.495 -30.773 1.00 17.10 ? 47   PRO C O   1 
ATOM   4152 C  CB  . PRO C 1 45  ? -27.382 -19.173 -29.032 1.00 18.13 ? 47   PRO C CB  1 
ATOM   4153 C  CG  . PRO C 1 45  ? -26.068 -19.519 -29.643 1.00 18.15 ? 47   PRO C CG  1 
ATOM   4154 C  CD  . PRO C 1 45  ? -26.390 -19.829 -31.078 1.00 19.09 ? 47   PRO C CD  1 
ATOM   4155 N  N   . LEU C 1 46  ? -30.761 -19.838 -29.231 1.00 17.28 ? 48   LEU C N   1 
ATOM   4156 C  CA  . LEU C 1 46  ? -32.070 -19.198 -29.284 1.00 16.96 ? 48   LEU C CA  1 
ATOM   4157 C  C   . LEU C 1 46  ? -31.948 -17.727 -28.875 1.00 16.51 ? 48   LEU C C   1 
ATOM   4158 O  O   . LEU C 1 46  ? -31.177 -17.399 -27.967 1.00 15.71 ? 48   LEU C O   1 
ATOM   4159 C  CB  . LEU C 1 46  ? -33.046 -19.917 -28.366 1.00 17.68 ? 48   LEU C CB  1 
ATOM   4160 C  CG  . LEU C 1 46  ? -33.267 -21.408 -28.638 1.00 18.82 ? 48   LEU C CG  1 
ATOM   4161 C  CD1 . LEU C 1 46  ? -34.223 -21.982 -27.608 1.00 19.13 ? 48   LEU C CD1 1 
ATOM   4162 C  CD2 . LEU C 1 46  ? -33.767 -21.629 -30.074 1.00 19.32 ? 48   LEU C CD2 1 
ATOM   4163 N  N   . GLU C 1 47  ? -32.678 -16.854 -29.561 1.00 15.51 ? 49   GLU C N   1 
ATOM   4164 C  CA  . GLU C 1 47  ? -32.743 -15.431 -29.193 1.00 16.17 ? 49   GLU C CA  1 
ATOM   4165 C  C   . GLU C 1 47  ? -34.168 -15.057 -28.762 1.00 15.19 ? 49   GLU C C   1 
ATOM   4166 O  O   . GLU C 1 47  ? -35.128 -15.230 -29.535 1.00 15.02 ? 49   GLU C O   1 
ATOM   4167 C  CB  . GLU C 1 47  ? -32.271 -14.566 -30.361 1.00 16.75 ? 49   GLU C CB  1 
ATOM   4168 C  CG  . GLU C 1 47  ? -30.880 -14.935 -30.857 1.00 17.40 ? 49   GLU C CG  1 
ATOM   4169 C  CD  . GLU C 1 47  ? -30.372 -14.066 -31.984 1.00 18.41 ? 49   GLU C CD  1 
ATOM   4170 O  OE1 . GLU C 1 47  ? -31.113 -13.189 -32.487 1.00 19.43 ? 49   GLU C OE1 1 
ATOM   4171 O  OE2 . GLU C 1 47  ? -29.200 -14.254 -32.384 1.00 19.73 ? 49   GLU C OE2 1 
ATOM   4172 N  N   . LEU C 1 48  ? -34.301 -14.586 -27.528 1.00 14.23 ? 50   LEU C N   1 
ATOM   4173 C  CA  . LEU C 1 48  ? -35.577 -14.217 -26.929 1.00 14.76 ? 50   LEU C CA  1 
ATOM   4174 C  C   . LEU C 1 48  ? -35.488 -12.787 -26.403 1.00 14.96 ? 50   LEU C C   1 
ATOM   4175 O  O   . LEU C 1 48  ? -34.827 -12.547 -25.375 1.00 15.52 ? 50   LEU C O   1 
ATOM   4176 C  CB  . LEU C 1 48  ? -35.929 -15.149 -25.770 1.00 14.84 ? 50   LEU C CB  1 
ATOM   4177 C  CG  . LEU C 1 48  ? -36.534 -16.527 -26.067 1.00 15.16 ? 50   LEU C CG  1 
ATOM   4178 C  CD1 . LEU C 1 48  ? -35.525 -17.456 -26.739 1.00 15.36 ? 50   LEU C CD1 1 
ATOM   4179 C  CD2 . LEU C 1 48  ? -37.046 -17.171 -24.783 1.00 15.78 ? 50   LEU C CD2 1 
ATOM   4180 N  N   . LEU C 1 49  ? -36.142 -11.856 -27.089 1.00 14.15 ? 51   LEU C N   1 
ATOM   4181 C  CA  . LEU C 1 49  ? -36.152 -10.437 -26.690 1.00 14.14 ? 51   LEU C CA  1 
ATOM   4182 C  C   . LEU C 1 49  ? -37.557 -9.992  -26.338 1.00 14.62 ? 51   LEU C C   1 
ATOM   4183 O  O   . LEU C 1 49  ? -38.528 -10.491 -26.913 1.00 13.89 ? 51   LEU C O   1 
ATOM   4184 C  CB  . LEU C 1 49  ? -35.589 -9.556  -27.814 1.00 13.72 ? 51   LEU C CB  1 
ATOM   4185 C  CG  . LEU C 1 49  ? -34.170 -9.911  -28.315 1.00 14.08 ? 51   LEU C CG  1 
ATOM   4186 C  CD1 . LEU C 1 49  ? -33.701 -8.964  -29.407 1.00 13.95 ? 51   LEU C CD1 1 
ATOM   4187 C  CD2 . LEU C 1 49  ? -33.157 -9.921  -27.166 1.00 14.53 ? 51   LEU C CD2 1 
ATOM   4188 N  N   . GLY C 1 50  ? -37.658 -9.036  -25.408 1.00 14.38 ? 52   GLY C N   1 
ATOM   4189 C  CA  . GLY C 1 50  ? -38.951 -8.482  -24.976 1.00 15.32 ? 52   GLY C CA  1 
ATOM   4190 C  C   . GLY C 1 50  ? -39.659 -9.315  -23.918 1.00 15.23 ? 52   GLY C C   1 
ATOM   4191 O  O   . GLY C 1 50  ? -40.823 -9.046  -23.613 1.00 15.37 ? 52   GLY C O   1 
ATOM   4192 N  N   . PHE C 1 51  ? -38.970 -10.316 -23.358 1.00 15.55 ? 53   PHE C N   1 
ATOM   4193 C  CA  . PHE C 1 51  ? -39.576 -11.278 -22.436 1.00 16.06 ? 53   PHE C CA  1 
ATOM   4194 C  C   . PHE C 1 51  ? -39.592 -10.749 -21.003 1.00 17.22 ? 53   PHE C C   1 
ATOM   4195 O  O   . PHE C 1 51  ? -40.285 -11.306 -20.144 1.00 18.10 ? 53   PHE C O   1 
ATOM   4196 C  CB  . PHE C 1 51  ? -38.851 -12.640 -22.480 1.00 16.43 ? 53   PHE C CB  1 
ATOM   4197 C  CG  . PHE C 1 51  ? -39.276 -13.545 -23.630 1.00 16.72 ? 53   PHE C CG  1 
ATOM   4198 C  CD1 . PHE C 1 51  ? -39.113 -13.151 -24.955 1.00 16.26 ? 53   PHE C CD1 1 
ATOM   4199 C  CD2 . PHE C 1 51  ? -39.852 -14.791 -23.370 1.00 16.74 ? 53   PHE C CD2 1 
ATOM   4200 C  CE1 . PHE C 1 51  ? -39.505 -13.971 -25.992 1.00 16.52 ? 53   PHE C CE1 1 
ATOM   4201 C  CE2 . PHE C 1 51  ? -40.271 -15.613 -24.406 1.00 16.46 ? 53   PHE C CE2 1 
ATOM   4202 C  CZ  . PHE C 1 51  ? -40.094 -15.204 -25.720 1.00 16.17 ? 53   PHE C CZ  1 
ATOM   4203 N  N   . GLN C 1 52  ? -38.839 -9.686  -20.733 1.00 18.09 ? 54   GLN C N   1 
ATOM   4204 C  CA  . GLN C 1 52  ? -38.719 -9.158  -19.375 1.00 19.00 ? 54   GLN C CA  1 
ATOM   4205 C  C   . GLN C 1 52  ? -39.826 -8.139  -19.123 1.00 19.78 ? 54   GLN C C   1 
ATOM   4206 O  O   . GLN C 1 52  ? -39.592 -6.941  -19.173 1.00 19.39 ? 54   GLN C O   1 
ATOM   4207 C  CB  . GLN C 1 52  ? -37.349 -8.504  -19.167 1.00 20.71 ? 54   GLN C CB  1 
ATOM   4208 C  CG  . GLN C 1 52  ? -36.146 -9.334  -19.582 1.00 22.32 ? 54   GLN C CG  1 
ATOM   4209 C  CD  . GLN C 1 52  ? -34.841 -8.560  -19.398 1.00 24.31 ? 54   GLN C CD  1 
ATOM   4210 O  OE1 . GLN C 1 52  ? -34.065 -8.865  -18.518 1.00 25.69 ? 54   GLN C OE1 1 
ATOM   4211 N  NE2 . GLN C 1 52  ? -34.625 -7.531  -20.216 1.00 26.25 ? 54   GLN C NE2 1 
ATOM   4212 N  N   . LEU C 1 53  ? -41.032 -8.606  -18.824 1.00 20.55 ? 55   LEU C N   1 
ATOM   4213 C  CA  . LEU C 1 53  ? -42.182 -7.698  -18.784 1.00 21.76 ? 55   LEU C CA  1 
ATOM   4214 C  C   . LEU C 1 53  ? -42.245 -6.908  -17.476 1.00 21.79 ? 55   LEU C C   1 
ATOM   4215 O  O   . LEU C 1 53  ? -41.931 -7.438  -16.419 1.00 21.15 ? 55   LEU C O   1 
ATOM   4216 C  CB  . LEU C 1 53  ? -43.487 -8.468  -18.941 1.00 22.94 ? 55   LEU C CB  1 
ATOM   4217 C  CG  . LEU C 1 53  ? -43.658 -9.308  -20.207 1.00 23.54 ? 55   LEU C CG  1 
ATOM   4218 C  CD1 . LEU C 1 53  ? -44.933 -10.128 -20.105 1.00 24.29 ? 55   LEU C CD1 1 
ATOM   4219 C  CD2 . LEU C 1 53  ? -43.664 -8.406  -21.427 1.00 24.71 ? 55   LEU C CD2 1 
ATOM   4220 N  N   . PRO C 1 54  ? -42.675 -5.644  -17.550 1.00 23.84 ? 56   PRO C N   1 
ATOM   4221 C  CA  . PRO C 1 54  ? -42.862 -4.849  -16.340 1.00 25.64 ? 56   PRO C CA  1 
ATOM   4222 C  C   . PRO C 1 54  ? -44.118 -5.298  -15.562 1.00 26.30 ? 56   PRO C C   1 
ATOM   4223 O  O   . PRO C 1 54  ? -44.915 -6.052  -16.102 1.00 24.63 ? 56   PRO C O   1 
ATOM   4224 C  CB  . PRO C 1 54  ? -43.046 -3.437  -16.896 1.00 25.09 ? 56   PRO C CB  1 
ATOM   4225 C  CG  . PRO C 1 54  ? -43.767 -3.670  -18.185 1.00 24.87 ? 56   PRO C CG  1 
ATOM   4226 C  CD  . PRO C 1 54  ? -43.158 -4.924  -18.748 1.00 24.38 ? 56   PRO C CD  1 
ATOM   4227 N  N   . PRO C 1 55  ? -44.289 -4.833  -14.313 1.00 28.69 ? 57   PRO C N   1 
ATOM   4228 C  CA  . PRO C 1 55  ? -45.430 -5.257  -13.484 1.00 29.69 ? 57   PRO C CA  1 
ATOM   4229 C  C   . PRO C 1 55  ? -46.810 -4.950  -14.083 1.00 30.54 ? 57   PRO C C   1 
ATOM   4230 O  O   . PRO C 1 55  ? -47.746 -5.718  -13.833 1.00 32.19 ? 57   PRO C O   1 
ATOM   4231 C  CB  . PRO C 1 55  ? -45.233 -4.490  -12.165 1.00 30.97 ? 57   PRO C CB  1 
ATOM   4232 C  CG  . PRO C 1 55  ? -43.777 -4.141  -12.125 1.00 31.64 ? 57   PRO C CG  1 
ATOM   4233 C  CD  . PRO C 1 55  ? -43.344 -3.979  -13.564 1.00 30.31 ? 57   PRO C CD  1 
ATOM   4234 N  N   . LEU C 1 56  ? -46.928 -3.883  -14.874 1.00 29.62 ? 58   LEU C N   1 
ATOM   4235 C  CA  . LEU C 1 56  ? -48.169 -3.539  -15.578 1.00 30.98 ? 58   LEU C CA  1 
ATOM   4236 C  C   . LEU C 1 56  ? -47.894 -3.346  -17.055 1.00 31.52 ? 58   LEU C C   1 
ATOM   4237 O  O   . LEU C 1 56  ? -46.853 -2.808  -17.386 1.00 33.85 ? 58   LEU C O   1 
ATOM   4238 C  CB  . LEU C 1 56  ? -48.760 -2.230  -15.032 1.00 32.25 ? 58   LEU C CB  1 
ATOM   4239 C  CG  . LEU C 1 56  ? -49.170 -2.223  -13.561 1.00 32.62 ? 58   LEU C CG  1 
ATOM   4240 C  CD1 . LEU C 1 56  ? -49.543 -0.800  -13.166 1.00 32.98 ? 58   LEU C CD1 1 
ATOM   4241 C  CD2 . LEU C 1 56  ? -50.327 -3.186  -13.309 1.00 33.25 ? 58   LEU C CD2 1 
ATOM   4242 N  N   . PRO C 1 57  ? -48.809 -3.724  -17.955 1.00 30.43 ? 59   PRO C N   1 
ATOM   4243 C  CA  . PRO C 1 57  ? -50.142 -4.239  -17.630 1.00 29.71 ? 59   PRO C CA  1 
ATOM   4244 C  C   . PRO C 1 57  ? -50.119 -5.661  -17.111 1.00 29.65 ? 59   PRO C C   1 
ATOM   4245 O  O   . PRO C 1 57  ? -49.131 -6.370  -17.304 1.00 28.40 ? 59   PRO C O   1 
ATOM   4246 C  CB  . PRO C 1 57  ? -50.856 -4.203  -18.979 1.00 30.92 ? 59   PRO C CB  1 
ATOM   4247 C  CG  . PRO C 1 57  ? -49.747 -4.313  -19.990 1.00 30.84 ? 59   PRO C CG  1 
ATOM   4248 C  CD  . PRO C 1 57  ? -48.664 -3.474  -19.399 1.00 30.09 ? 59   PRO C CD  1 
ATOM   4249 N  N   . GLU C 1 58  ? -51.203 -6.054  -16.447 1.00 27.05 ? 60   GLU C N   1 
ATOM   4250 C  CA  . GLU C 1 58  ? -51.380 -7.413  -15.948 1.00 27.70 ? 60   GLU C CA  1 
ATOM   4251 C  C   . GLU C 1 58  ? -51.632 -8.396  -17.078 1.00 25.93 ? 60   GLU C C   1 
ATOM   4252 O  O   . GLU C 1 58  ? -51.951 -8.011  -18.201 1.00 23.61 ? 60   GLU C O   1 
ATOM   4253 C  CB  . GLU C 1 58  ? -52.533 -7.475  -14.935 1.00 31.09 ? 60   GLU C CB  1 
ATOM   4254 C  CG  . GLU C 1 58  ? -52.212 -6.799  -13.610 1.00 34.19 ? 60   GLU C CG  1 
ATOM   4255 C  CD  . GLU C 1 58  ? -53.344 -6.914  -12.610 1.00 38.30 ? 60   GLU C CD  1 
ATOM   4256 O  OE1 . GLU C 1 58  ? -54.476 -6.525  -12.967 1.00 41.06 ? 60   GLU C OE1 1 
ATOM   4257 O  OE2 . GLU C 1 58  ? -53.102 -7.395  -11.480 1.00 39.60 ? 60   GLU C OE2 1 
ATOM   4258 N  N   . LEU C 1 59  ? -51.453 -9.671  -16.763 1.00 25.58 ? 61   LEU C N   1 
ATOM   4259 C  CA  . LEU C 1 59  ? -51.624 -10.749 -17.732 1.00 26.10 ? 61   LEU C CA  1 
ATOM   4260 C  C   . LEU C 1 59  ? -52.751 -11.697 -17.284 1.00 26.44 ? 61   LEU C C   1 
ATOM   4261 O  O   . LEU C 1 59  ? -52.891 -12.009 -16.087 1.00 25.13 ? 61   LEU C O   1 
ATOM   4262 C  CB  . LEU C 1 59  ? -50.327 -11.541 -17.868 1.00 25.94 ? 61   LEU C CB  1 
ATOM   4263 C  CG  . LEU C 1 59  ? -49.170 -10.922 -18.660 1.00 27.13 ? 61   LEU C CG  1 
ATOM   4264 C  CD1 . LEU C 1 59  ? -48.633 -9.678  -17.998 1.00 28.77 ? 61   LEU C CD1 1 
ATOM   4265 C  CD2 . LEU C 1 59  ? -48.050 -11.943 -18.804 1.00 28.22 ? 61   LEU C CD2 1 
ATOM   4266 N  N   . ARG C 1 60  ? -53.523 -12.166 -18.260 1.00 27.30 ? 62   ARG C N   1 
ATOM   4267 C  CA  . ARG C 1 60  ? -54.577 -13.164 -18.029 1.00 27.36 ? 62   ARG C CA  1 
ATOM   4268 C  C   . ARG C 1 60  ? -53.987 -14.545 -17.742 1.00 25.31 ? 62   ARG C C   1 
ATOM   4269 O  O   . ARG C 1 60  ? -53.183 -15.070 -18.513 1.00 23.18 ? 62   ARG C O   1 
ATOM   4270 C  CB  . ARG C 1 60  ? -55.493 -13.227 -19.251 1.00 30.00 ? 62   ARG C CB  1 
ATOM   4271 C  CG  . ARG C 1 60  ? -56.752 -14.067 -19.083 1.00 33.33 ? 62   ARG C CG  1 
ATOM   4272 C  CD  . ARG C 1 60  ? -57.432 -14.213 -20.435 1.00 37.53 ? 62   ARG C CD  1 
ATOM   4273 N  NE  . ARG C 1 60  ? -58.757 -14.812 -20.350 1.00 42.53 ? 62   ARG C NE  1 
ATOM   4274 C  CZ  . ARG C 1 60  ? -59.512 -15.134 -21.403 1.00 45.90 ? 62   ARG C CZ  1 
ATOM   4275 N  NH1 . ARG C 1 60  ? -59.070 -14.954 -22.649 1.00 46.21 ? 62   ARG C NH1 1 
ATOM   4276 N  NH2 . ARG C 1 60  ? -60.715 -15.673 -21.211 1.00 44.81 ? 62   ARG C NH2 1 
ATOM   4277 N  N   . LEU C 1 61  ? -54.388 -15.125 -16.619 1.00 25.21 ? 63   LEU C N   1 
ATOM   4278 C  CA  . LEU C 1 61  ? -54.051 -16.490 -16.270 1.00 25.48 ? 63   LEU C CA  1 
ATOM   4279 C  C   . LEU C 1 61  ? -55.366 -17.262 -16.137 1.00 27.12 ? 63   LEU C C   1 
ATOM   4280 O  O   . LEU C 1 61  ? -56.249 -16.845 -15.358 1.00 25.35 ? 63   LEU C O   1 
ATOM   4281 C  CB  . LEU C 1 61  ? -53.282 -16.506 -14.948 1.00 25.56 ? 63   LEU C CB  1 
ATOM   4282 C  CG  . LEU C 1 61  ? -52.704 -17.836 -14.506 1.00 24.78 ? 63   LEU C CG  1 
ATOM   4283 C  CD1 . LEU C 1 61  ? -51.599 -18.276 -15.443 1.00 25.53 ? 63   LEU C CD1 1 
ATOM   4284 C  CD2 . LEU C 1 61  ? -52.200 -17.742 -13.071 1.00 25.07 ? 63   LEU C CD2 1 
ATOM   4285 N  N   . ARG C 1 62  ? -55.498 -18.363 -16.887 1.00 26.33 ? 64   ARG C N   1 
ATOM   4286 C  CA  . ARG C 1 62  ? -56.787 -19.046 -17.055 1.00 26.70 ? 64   ARG C CA  1 
ATOM   4287 C  C   . ARG C 1 62  ? -56.648 -20.530 -16.806 1.00 25.46 ? 64   ARG C C   1 
ATOM   4288 O  O   . ARG C 1 62  ? -55.701 -21.153 -17.302 1.00 24.31 ? 64   ARG C O   1 
ATOM   4289 C  CB  . ARG C 1 62  ? -57.333 -18.832 -18.472 1.00 27.48 ? 64   ARG C CB  1 
ATOM   4290 N  N   . ASN C 1 63  ? -57.585 -21.091 -16.032 1.00 24.69 ? 65   ASN C N   1 
ATOM   4291 C  CA  . ASN C 1 63  ? -57.777 -22.548 -15.943 1.00 24.97 ? 65   ASN C CA  1 
ATOM   4292 C  C   . ASN C 1 63  ? -58.738 -22.859 -17.055 1.00 25.69 ? 65   ASN C C   1 
ATOM   4293 O  O   . ASN C 1 63  ? -59.906 -22.471 -16.981 1.00 25.44 ? 65   ASN C O   1 
ATOM   4294 C  CB  . ASN C 1 63  ? -58.389 -22.955 -14.602 1.00 26.17 ? 65   ASN C CB  1 
ATOM   4295 C  CG  . ASN C 1 63  ? -58.732 -24.449 -14.508 1.00 27.38 ? 65   ASN C CG  1 
ATOM   4296 O  OD1 . ASN C 1 63  ? -58.733 -25.195 -15.490 1.00 28.15 ? 65   ASN C OD1 1 
ATOM   4297 N  ND2 . ASN C 1 63  ? -59.029 -24.889 -13.294 1.00 28.95 ? 65   ASN C ND2 1 
ATOM   4298 N  N   . ASN C 1 64  ? -58.260 -23.531 -18.093 1.00 25.87 ? 66   ASN C N   1 
ATOM   4299 C  CA  . ASN C 1 64  ? -59.138 -23.867 -19.225 1.00 27.53 ? 66   ASN C CA  1 
ATOM   4300 C  C   . ASN C 1 64  ? -59.613 -25.312 -19.190 1.00 28.13 ? 66   ASN C C   1 
ATOM   4301 O  O   . ASN C 1 64  ? -60.066 -25.844 -20.206 1.00 29.50 ? 66   ASN C O   1 
ATOM   4302 C  CB  . ASN C 1 64  ? -58.460 -23.537 -20.561 1.00 26.75 ? 66   ASN C CB  1 
ATOM   4303 C  CG  . ASN C 1 64  ? -57.221 -24.362 -20.826 1.00 26.36 ? 66   ASN C CG  1 
ATOM   4304 O  OD1 . ASN C 1 64  ? -57.050 -25.476 -20.320 1.00 25.29 ? 66   ASN C OD1 1 
ATOM   4305 N  ND2 . ASN C 1 64  ? -56.326 -23.800 -21.632 1.00 29.07 ? 66   ASN C ND2 1 
ATOM   4306 N  N   . GLY C 1 65  ? -59.446 -25.972 -18.048 1.00 28.96 ? 67   GLY C N   1 
ATOM   4307 C  CA  . GLY C 1 65  ? -59.832 -27.368 -17.914 1.00 29.88 ? 67   GLY C CA  1 
ATOM   4308 C  C   . GLY C 1 65  ? -58.825 -28.386 -18.401 1.00 30.01 ? 67   GLY C C   1 
ATOM   4309 O  O   . GLY C 1 65  ? -58.905 -29.537 -17.985 1.00 30.78 ? 67   GLY C O   1 
ATOM   4310 N  N   . HIS C 1 66  ? -57.906 -27.995 -19.295 1.00 30.45 ? 68   HIS C N   1 
ATOM   4311 C  CA  . HIS C 1 66  ? -56.823 -28.872 -19.779 1.00 30.51 ? 68   HIS C CA  1 
ATOM   4312 C  C   . HIS C 1 66  ? -55.417 -28.493 -19.286 1.00 27.25 ? 68   HIS C C   1 
ATOM   4313 O  O   . HIS C 1 66  ? -54.528 -29.328 -19.274 1.00 26.17 ? 68   HIS C O   1 
ATOM   4314 C  CB  . HIS C 1 66  ? -56.848 -28.871 -21.303 1.00 36.02 ? 68   HIS C CB  1 
ATOM   4315 C  CG  . HIS C 1 66  ? -58.165 -29.294 -21.866 1.00 42.52 ? 68   HIS C CG  1 
ATOM   4316 N  ND1 . HIS C 1 66  ? -58.827 -28.579 -22.841 1.00 47.21 ? 68   HIS C ND1 1 
ATOM   4317 C  CD2 . HIS C 1 66  ? -58.966 -30.346 -21.558 1.00 46.38 ? 68   HIS C CD2 1 
ATOM   4318 C  CE1 . HIS C 1 66  ? -59.967 -29.188 -23.128 1.00 48.09 ? 68   HIS C CE1 1 
ATOM   4319 N  NE2 . HIS C 1 66  ? -60.077 -30.259 -22.359 1.00 46.79 ? 68   HIS C NE2 1 
ATOM   4320 N  N   . SER C 1 67  ? -55.220 -27.227 -18.935 1.00 26.13 ? 69   SER C N   1 
ATOM   4321 C  CA  . SER C 1 67  ? -53.973 -26.733 -18.351 1.00 24.94 ? 69   SER C CA  1 
ATOM   4322 C  C   . SER C 1 67  ? -54.242 -25.401 -17.677 1.00 24.01 ? 69   SER C C   1 
ATOM   4323 O  O   . SER C 1 67  ? -55.382 -24.959 -17.605 1.00 24.78 ? 69   SER C O   1 
ATOM   4324 C  CB  . SER C 1 67  ? -52.898 -26.557 -19.430 1.00 25.53 ? 69   SER C CB  1 
ATOM   4325 O  OG  . SER C 1 67  ? -51.651 -26.164 -18.851 1.00 25.70 ? 69   SER C OG  1 
ATOM   4326 N  N   . VAL C 1 68  ? -53.186 -24.771 -17.170 1.00 23.29 ? 70   VAL C N   1 
ATOM   4327 C  CA  . VAL C 1 68  ? -53.235 -23.359 -16.806 1.00 21.93 ? 70   VAL C CA  1 
ATOM   4328 C  C   . VAL C 1 68  ? -52.478 -22.611 -17.877 1.00 22.08 ? 70   VAL C C   1 
ATOM   4329 O  O   . VAL C 1 68  ? -51.387 -23.019 -18.260 1.00 22.32 ? 70   VAL C O   1 
ATOM   4330 C  CB  . VAL C 1 68  ? -52.693 -23.052 -15.393 1.00 21.94 ? 70   VAL C CB  1 
ATOM   4331 C  CG1 . VAL C 1 68  ? -51.321 -23.661 -15.145 1.00 21.22 ? 70   VAL C CG1 1 
ATOM   4332 C  CG2 . VAL C 1 68  ? -52.706 -21.552 -15.143 1.00 21.28 ? 70   VAL C CG2 1 
ATOM   4333 N  N   . GLN C 1 69  ? -53.075 -21.542 -18.389 1.00 22.43 ? 71   GLN C N   1 
ATOM   4334 C  CA  . GLN C 1 69  ? -52.524 -20.845 -19.544 1.00 21.11 ? 71   GLN C CA  1 
ATOM   4335 C  C   . GLN C 1 69  ? -52.404 -19.355 -19.269 1.00 20.80 ? 71   GLN C C   1 
ATOM   4336 O  O   . GLN C 1 69  ? -53.377 -18.710 -18.868 1.00 21.57 ? 71   GLN C O   1 
ATOM   4337 C  CB  . GLN C 1 69  ? -53.377 -21.072 -20.785 1.00 21.51 ? 71   GLN C CB  1 
ATOM   4338 C  CG  . GLN C 1 69  ? -52.821 -20.406 -22.040 1.00 21.33 ? 71   GLN C CG  1 
ATOM   4339 C  CD  . GLN C 1 69  ? -53.449 -20.889 -23.321 1.00 21.42 ? 71   GLN C CD  1 
ATOM   4340 O  OE1 . GLN C 1 69  ? -53.817 -20.088 -24.176 1.00 22.88 ? 71   GLN C OE1 1 
ATOM   4341 N  NE2 . GLN C 1 69  ? -53.531 -22.189 -23.484 1.00 21.52 ? 71   GLN C NE2 1 
ATOM   4342 N  N   . LEU C 1 70  ? -51.204 -18.827 -19.542 1.00 19.70 ? 72   LEU C N   1 
ATOM   4343 C  CA  . LEU C 1 70  ? -50.881 -17.416 -19.390 1.00 19.45 ? 72   LEU C CA  1 
ATOM   4344 C  C   . LEU C 1 70  ? -50.871 -16.769 -20.750 1.00 18.90 ? 72   LEU C C   1 
ATOM   4345 O  O   . LEU C 1 70  ? -50.076 -17.157 -21.610 1.00 18.50 ? 72   LEU C O   1 
ATOM   4346 C  CB  . LEU C 1 70  ? -49.500 -17.273 -18.754 1.00 19.59 ? 72   LEU C CB  1 
ATOM   4347 C  CG  . LEU C 1 70  ? -49.058 -15.841 -18.475 1.00 20.03 ? 72   LEU C CG  1 
ATOM   4348 C  CD1 . LEU C 1 70  ? -49.899 -15.248 -17.350 1.00 20.76 ? 72   LEU C CD1 1 
ATOM   4349 C  CD2 . LEU C 1 70  ? -47.588 -15.785 -18.129 1.00 19.56 ? 72   LEU C CD2 1 
ATOM   4350 N  N   . THR C 1 71  ? -51.730 -15.776 -20.948 1.00 18.80 ? 73   THR C N   1 
ATOM   4351 C  CA  . THR C 1 71  ? -51.739 -15.022 -22.194 1.00 19.79 ? 73   THR C CA  1 
ATOM   4352 C  C   . THR C 1 71  ? -50.564 -14.002 -22.233 1.00 20.04 ? 73   THR C C   1 
ATOM   4353 O  O   . THR C 1 71  ? -50.414 -13.190 -21.337 1.00 20.97 ? 73   THR C O   1 
ATOM   4354 C  CB  . THR C 1 71  ? -53.091 -14.293 -22.395 1.00 19.51 ? 73   THR C CB  1 
ATOM   4355 O  OG1 . THR C 1 71  ? -54.142 -15.260 -22.390 1.00 20.36 ? 73   THR C OG1 1 
ATOM   4356 C  CG2 . THR C 1 71  ? -53.116 -13.540 -23.718 1.00 20.20 ? 73   THR C CG2 1 
ATOM   4357 N  N   . LEU C 1 72  ? -49.757 -14.047 -23.291 1.00 20.04 ? 74   LEU C N   1 
ATOM   4358 C  CA  . LEU C 1 72  ? -48.579 -13.174 -23.402 1.00 19.91 ? 74   LEU C CA  1 
ATOM   4359 C  C   . LEU C 1 72  ? -48.912 -11.974 -24.273 1.00 20.74 ? 74   LEU C C   1 
ATOM   4360 O  O   . LEU C 1 72  ? -49.645 -12.118 -25.255 1.00 21.17 ? 74   LEU C O   1 
ATOM   4361 C  CB  . LEU C 1 72  ? -47.394 -13.969 -23.975 1.00 19.27 ? 74   LEU C CB  1 
ATOM   4362 C  CG  . LEU C 1 72  ? -46.951 -15.119 -23.064 1.00 18.60 ? 74   LEU C CG  1 
ATOM   4363 C  CD1 . LEU C 1 72  ? -45.852 -15.961 -23.685 1.00 18.57 ? 74   LEU C CD1 1 
ATOM   4364 C  CD2 . LEU C 1 72  ? -46.508 -14.610 -21.705 1.00 18.80 ? 74   LEU C CD2 1 
ATOM   4365 N  N   . PRO C 1 73  ? -48.354 -10.787 -23.947 1.00 20.99 ? 75   PRO C N   1 
ATOM   4366 C  CA  . PRO C 1 73  ? -48.667 -9.589  -24.715 1.00 20.94 ? 75   PRO C CA  1 
ATOM   4367 C  C   . PRO C 1 73  ? -47.868 -9.535  -26.020 1.00 21.32 ? 75   PRO C C   1 
ATOM   4368 O  O   . PRO C 1 73  ? -47.009 -10.373 -26.237 1.00 21.25 ? 75   PRO C O   1 
ATOM   4369 C  CB  . PRO C 1 73  ? -48.240 -8.470  -23.765 1.00 21.18 ? 75   PRO C CB  1 
ATOM   4370 C  CG  . PRO C 1 73  ? -47.048 -9.043  -23.084 1.00 20.59 ? 75   PRO C CG  1 
ATOM   4371 C  CD  . PRO C 1 73  ? -47.445 -10.472 -22.824 1.00 21.13 ? 75   PRO C CD  1 
ATOM   4372 N  N   . PRO C 1 74  ? -48.169 -8.570  -26.899 1.00 22.83 ? 76   PRO C N   1 
ATOM   4373 C  CA  . PRO C 1 74  ? -47.324 -8.362  -28.072 1.00 23.43 ? 76   PRO C CA  1 
ATOM   4374 C  C   . PRO C 1 74  ? -45.883 -7.975  -27.692 1.00 22.07 ? 76   PRO C C   1 
ATOM   4375 O  O   . PRO C 1 74  ? -45.653 -7.446  -26.614 1.00 20.90 ? 76   PRO C O   1 
ATOM   4376 C  CB  . PRO C 1 74  ? -47.989 -7.187  -28.789 1.00 25.02 ? 76   PRO C CB  1 
ATOM   4377 C  CG  . PRO C 1 74  ? -49.383 -7.125  -28.245 1.00 25.78 ? 76   PRO C CG  1 
ATOM   4378 C  CD  . PRO C 1 74  ? -49.266 -7.580  -26.830 1.00 24.90 ? 76   PRO C CD  1 
ATOM   4379 N  N   . GLY C 1 75  ? -44.941 -8.276  -28.578 1.00 20.98 ? 77   GLY C N   1 
ATOM   4380 C  CA  . GLY C 1 75  ? -43.556 -7.823  -28.441 1.00 20.48 ? 77   GLY C CA  1 
ATOM   4381 C  C   . GLY C 1 75  ? -42.562 -8.813  -27.848 1.00 18.87 ? 77   GLY C C   1 
ATOM   4382 O  O   . GLY C 1 75  ? -41.406 -8.436  -27.626 1.00 17.58 ? 77   GLY C O   1 
ATOM   4383 N  N   . LEU C 1 76  ? -42.980 -10.058 -27.608 1.00 16.86 ? 78   LEU C N   1 
ATOM   4384 C  CA  . LEU C 1 76  ? -42.046 -11.097 -27.168 1.00 16.93 ? 78   LEU C CA  1 
ATOM   4385 C  C   . LEU C 1 76  ? -41.523 -11.761 -28.428 1.00 17.03 ? 78   LEU C C   1 
ATOM   4386 O  O   . LEU C 1 76  ? -42.212 -12.613 -29.034 1.00 17.34 ? 78   LEU C O   1 
ATOM   4387 C  CB  . LEU C 1 76  ? -42.687 -12.103 -26.204 1.00 17.19 ? 78   LEU C CB  1 
ATOM   4388 C  CG  . LEU C 1 76  ? -42.859 -11.612 -24.754 1.00 17.95 ? 78   LEU C CG  1 
ATOM   4389 C  CD1 . LEU C 1 76  ? -43.889 -10.499 -24.650 1.00 17.97 ? 78   LEU C CD1 1 
ATOM   4390 C  CD2 . LEU C 1 76  ? -43.227 -12.750 -23.830 1.00 18.55 ? 78   LEU C CD2 1 
ATOM   4391 N  N   . GLU C 1 77  ? -40.332 -11.339 -28.852 1.00 16.63 ? 79   GLU C N   1 
ATOM   4392 C  CA  . GLU C 1 77  ? -39.776 -11.767 -30.131 1.00 17.38 ? 79   GLU C CA  1 
ATOM   4393 C  C   . GLU C 1 77  ? -38.745 -12.892 -29.914 1.00 16.66 ? 79   GLU C C   1 
ATOM   4394 O  O   . GLU C 1 77  ? -37.928 -12.844 -28.984 1.00 15.67 ? 79   GLU C O   1 
ATOM   4395 C  CB  . GLU C 1 77  ? -39.197 -10.573 -30.880 1.00 17.44 ? 79   GLU C CB  1 
ATOM   4396 C  CG  . GLU C 1 77  ? -40.244 -9.496  -31.123 1.00 18.95 ? 79   GLU C CG  1 
ATOM   4397 C  CD  . GLU C 1 77  ? -39.724 -8.263  -31.828 1.00 22.09 ? 79   GLU C CD  1 
ATOM   4398 O  OE1 . GLU C 1 77  ? -38.578 -8.279  -32.331 1.00 25.44 ? 79   GLU C OE1 1 
ATOM   4399 O  OE2 . GLU C 1 77  ? -40.455 -7.241  -31.863 1.00 24.92 ? 79   GLU C OE2 1 
ATOM   4400 N  N   . MET C 1 78  ? -38.802 -13.893 -30.789 1.00 16.26 ? 80   MET C N   1 
ATOM   4401 C  CA  . MET C 1 78  ? -37.984 -15.084 -30.673 1.00 16.41 ? 80   MET C CA  1 
ATOM   4402 C  C   . MET C 1 78  ? -37.451 -15.458 -32.054 1.00 16.50 ? 80   MET C C   1 
ATOM   4403 O  O   . MET C 1 78  ? -38.162 -15.332 -33.062 1.00 17.04 ? 80   MET C O   1 
ATOM   4404 C  CB  . MET C 1 78  ? -38.776 -16.220 -30.014 1.00 17.01 ? 80   MET C CB  1 
ATOM   4405 C  CG  . MET C 1 78  ? -37.988 -17.494 -29.702 1.00 17.90 ? 80   MET C CG  1 
ATOM   4406 S  SD  . MET C 1 78  ? -37.822 -18.633 -31.101 1.00 18.81 ? 80   MET C SD  1 
ATOM   4407 C  CE  . MET C 1 78  ? -39.423 -19.449 -31.070 1.00 19.54 ? 80   MET C CE  1 
ATOM   4408 N  N   . ALA C 1 79  ? -36.200 -15.899 -32.106 1.00 15.40 ? 81   ALA C N   1 
ATOM   4409 C  CA  . ALA C 1 79  ? -35.608 -16.320 -33.368 1.00 15.52 ? 81   ALA C CA  1 
ATOM   4410 C  C   . ALA C 1 79  ? -35.012 -17.707 -33.217 1.00 16.10 ? 81   ALA C C   1 
ATOM   4411 O  O   . ALA C 1 79  ? -34.271 -17.970 -32.259 1.00 15.47 ? 81   ALA C O   1 
ATOM   4412 C  CB  . ALA C 1 79  ? -34.571 -15.331 -33.845 1.00 15.81 ? 81   ALA C CB  1 
ATOM   4413 N  N   . LEU C 1 80  ? -35.393 -18.608 -34.131 1.00 15.78 ? 82   LEU C N   1 
ATOM   4414 C  CA  . LEU C 1 80  ? -34.812 -19.949 -34.216 1.00 15.94 ? 82   LEU C CA  1 
ATOM   4415 C  C   . LEU C 1 80  ? -33.534 -19.982 -35.043 1.00 16.59 ? 82   LEU C C   1 
ATOM   4416 O  O   . LEU C 1 80  ? -32.787 -20.968 -34.999 1.00 15.65 ? 82   LEU C O   1 
ATOM   4417 C  CB  . LEU C 1 80  ? -35.823 -20.924 -34.837 1.00 16.22 ? 82   LEU C CB  1 
ATOM   4418 C  CG  . LEU C 1 80  ? -37.082 -21.247 -34.015 1.00 16.78 ? 82   LEU C CG  1 
ATOM   4419 C  CD1 . LEU C 1 80  ? -37.907 -22.275 -34.784 1.00 17.02 ? 82   LEU C CD1 1 
ATOM   4420 C  CD2 . LEU C 1 80  ? -36.732 -21.769 -32.630 1.00 16.81 ? 82   LEU C CD2 1 
ATOM   4421 N  N   . GLY C 1 81  ? -33.326 -18.927 -35.826 1.00 16.00 ? 83   GLY C N   1 
ATOM   4422 C  CA  . GLY C 1 81  ? -32.211 -18.828 -36.730 1.00 16.76 ? 83   GLY C CA  1 
ATOM   4423 C  C   . GLY C 1 81  ? -32.284 -17.493 -37.425 1.00 16.97 ? 83   GLY C C   1 
ATOM   4424 O  O   . GLY C 1 81  ? -33.267 -16.754 -37.237 1.00 16.52 ? 83   GLY C O   1 
ATOM   4425 N  N   . PRO C 1 82  ? -31.262 -17.164 -38.227 1.00 17.76 ? 84   PRO C N   1 
ATOM   4426 C  CA  . PRO C 1 82  ? -31.179 -15.845 -38.852 1.00 18.01 ? 84   PRO C CA  1 
ATOM   4427 C  C   . PRO C 1 82  ? -32.406 -15.534 -39.706 1.00 19.15 ? 84   PRO C C   1 
ATOM   4428 O  O   . PRO C 1 82  ? -32.688 -16.264 -40.643 1.00 19.51 ? 84   PRO C O   1 
ATOM   4429 C  CB  . PRO C 1 82  ? -29.930 -15.959 -39.730 1.00 17.87 ? 84   PRO C CB  1 
ATOM   4430 C  CG  . PRO C 1 82  ? -29.128 -17.039 -39.136 1.00 17.36 ? 84   PRO C CG  1 
ATOM   4431 C  CD  . PRO C 1 82  ? -30.082 -18.000 -38.538 1.00 17.72 ? 84   PRO C CD  1 
ATOM   4432 N  N   . GLY C 1 83  ? -33.162 -14.500 -39.340 1.00 19.34 ? 85   GLY C N   1 
ATOM   4433 C  CA  . GLY C 1 83  ? -34.387 -14.159 -40.063 1.00 21.08 ? 85   GLY C CA  1 
ATOM   4434 C  C   . GLY C 1 83  ? -35.613 -15.047 -39.826 1.00 21.63 ? 85   GLY C C   1 
ATOM   4435 O  O   . GLY C 1 83  ? -36.682 -14.748 -40.360 1.00 23.39 ? 85   GLY C O   1 
ATOM   4436 N  N   . ARG C 1 84  ? -35.476 -16.100 -39.007 1.00 19.88 ? 86   ARG C N   1 
ATOM   4437 C  CA  . ARG C 1 84  ? -36.529 -17.089 -38.780 1.00 17.92 ? 86   ARG C CA  1 
ATOM   4438 C  C   . ARG C 1 84  ? -37.176 -16.739 -37.442 1.00 16.81 ? 86   ARG C C   1 
ATOM   4439 O  O   . ARG C 1 84  ? -36.842 -17.314 -36.382 1.00 15.56 ? 86   ARG C O   1 
ATOM   4440 C  CB  . ARG C 1 84  ? -35.953 -18.510 -38.816 1.00 18.76 ? 86   ARG C CB  1 
ATOM   4441 C  CG  . ARG C 1 84  ? -35.345 -18.870 -40.182 1.00 19.52 ? 86   ARG C CG  1 
ATOM   4442 C  CD  . ARG C 1 84  ? -34.741 -20.270 -40.250 1.00 20.46 ? 86   ARG C CD  1 
ATOM   4443 N  NE  . ARG C 1 84  ? -35.673 -21.253 -39.702 1.00 20.95 ? 86   ARG C NE  1 
ATOM   4444 C  CZ  . ARG C 1 84  ? -35.387 -22.198 -38.803 1.00 22.18 ? 86   ARG C CZ  1 
ATOM   4445 N  NH1 . ARG C 1 84  ? -34.147 -22.408 -38.369 1.00 24.05 ? 86   ARG C NH1 1 
ATOM   4446 N  NH2 . ARG C 1 84  ? -36.362 -22.971 -38.350 1.00 21.80 ? 86   ARG C NH2 1 
ATOM   4447 N  N   . GLU C 1 85  ? -38.130 -15.806 -37.507 1.00 15.43 ? 87   GLU C N   1 
ATOM   4448 C  CA  . GLU C 1 85  ? -38.617 -15.112 -36.324 1.00 16.00 ? 87   GLU C CA  1 
ATOM   4449 C  C   . GLU C 1 85  ? -40.067 -15.399 -35.985 1.00 16.31 ? 87   GLU C C   1 
ATOM   4450 O  O   . GLU C 1 85  ? -40.899 -15.719 -36.861 1.00 16.27 ? 87   GLU C O   1 
ATOM   4451 C  CB  . GLU C 1 85  ? -38.405 -13.612 -36.473 1.00 17.01 ? 87   GLU C CB  1 
ATOM   4452 C  CG  . GLU C 1 85  ? -36.931 -13.255 -36.581 1.00 18.05 ? 87   GLU C CG  1 
ATOM   4453 C  CD  . GLU C 1 85  ? -36.662 -11.759 -36.624 1.00 18.33 ? 87   GLU C CD  1 
ATOM   4454 O  OE1 . GLU C 1 85  ? -37.516 -10.966 -36.217 1.00 18.24 ? 87   GLU C OE1 1 
ATOM   4455 O  OE2 . GLU C 1 85  ? -35.576 -11.373 -37.080 1.00 20.42 ? 87   GLU C OE2 1 
ATOM   4456 N  N   . TYR C 1 86  ? -40.326 -15.305 -34.688 1.00 16.16 ? 88   TYR C N   1 
ATOM   4457 C  CA  . TYR C 1 86  ? -41.563 -15.712 -34.048 1.00 16.57 ? 88   TYR C CA  1 
ATOM   4458 C  C   . TYR C 1 86  ? -41.962 -14.668 -33.005 1.00 17.21 ? 88   TYR C C   1 
ATOM   4459 O  O   . TYR C 1 86  ? -41.123 -13.890 -32.554 1.00 18.08 ? 88   TYR C O   1 
ATOM   4460 C  CB  . TYR C 1 86  ? -41.377 -17.071 -33.382 1.00 15.49 ? 88   TYR C CB  1 
ATOM   4461 C  CG  . TYR C 1 86  ? -41.236 -18.180 -34.398 1.00 15.73 ? 88   TYR C CG  1 
ATOM   4462 C  CD1 . TYR C 1 86  ? -40.018 -18.427 -35.011 1.00 15.49 ? 88   TYR C CD1 1 
ATOM   4463 C  CD2 . TYR C 1 86  ? -42.342 -18.954 -34.786 1.00 15.51 ? 88   TYR C CD2 1 
ATOM   4464 C  CE1 . TYR C 1 86  ? -39.892 -19.396 -35.997 1.00 15.62 ? 88   TYR C CE1 1 
ATOM   4465 C  CE2 . TYR C 1 86  ? -42.220 -19.948 -35.751 1.00 15.32 ? 88   TYR C CE2 1 
ATOM   4466 C  CZ  . TYR C 1 86  ? -41.004 -20.150 -36.368 1.00 15.37 ? 88   TYR C CZ  1 
ATOM   4467 O  OH  . TYR C 1 86  ? -40.844 -21.110 -37.335 1.00 15.34 ? 88   TYR C OH  1 
ATOM   4468 N  N   . ARG C 1 87  ? -43.239 -14.659 -32.645 1.00 17.63 ? 89   ARG C N   1 
ATOM   4469 C  CA  . ARG C 1 87  ? -43.737 -13.908 -31.498 1.00 19.23 ? 89   ARG C CA  1 
ATOM   4470 C  C   . ARG C 1 87  ? -44.489 -14.841 -30.549 1.00 18.01 ? 89   ARG C C   1 
ATOM   4471 O  O   . ARG C 1 87  ? -45.295 -15.693 -30.991 1.00 15.75 ? 89   ARG C O   1 
ATOM   4472 C  CB  . ARG C 1 87  ? -44.621 -12.738 -31.944 1.00 22.32 ? 89   ARG C CB  1 
ATOM   4473 C  CG  . ARG C 1 87  ? -45.935 -13.111 -32.619 1.00 27.33 ? 89   ARG C CG  1 
ATOM   4474 C  CD  . ARG C 1 87  ? -46.506 -11.912 -33.370 1.00 33.37 ? 89   ARG C CD  1 
ATOM   4475 N  NE  . ARG C 1 87  ? -47.749 -12.145 -34.109 1.00 35.89 ? 89   ARG C NE  1 
ATOM   4476 C  CZ  . ARG C 1 87  ? -48.979 -12.150 -33.582 1.00 42.25 ? 89   ARG C CZ  1 
ATOM   4477 N  NH1 . ARG C 1 87  ? -49.185 -11.990 -32.273 1.00 44.35 ? 89   ARG C NH1 1 
ATOM   4478 N  NH2 . ARG C 1 87  ? -50.032 -12.340 -34.381 1.00 46.43 ? 89   ARG C NH2 1 
ATOM   4479 N  N   . ALA C 1 88  ? -44.230 -14.690 -29.248 1.00 16.45 ? 90   ALA C N   1 
ATOM   4480 C  CA  . ALA C 1 88  ? -44.825 -15.561 -28.253 1.00 16.32 ? 90   ALA C CA  1 
ATOM   4481 C  C   . ALA C 1 88  ? -46.302 -15.193 -28.043 1.00 16.88 ? 90   ALA C C   1 
ATOM   4482 O  O   . ALA C 1 88  ? -46.648 -14.006 -27.960 1.00 16.78 ? 90   ALA C O   1 
ATOM   4483 C  CB  . ALA C 1 88  ? -44.070 -15.487 -26.949 1.00 17.04 ? 90   ALA C CB  1 
ATOM   4484 N  N   . LEU C 1 89  ? -47.156 -16.210 -27.995 1.00 16.52 ? 91   LEU C N   1 
ATOM   4485 C  CA  . LEU C 1 89  ? -48.600 -16.018 -27.792 1.00 18.17 ? 91   LEU C CA  1 
ATOM   4486 C  C   . LEU C 1 89  ? -49.061 -16.310 -26.383 1.00 17.41 ? 91   LEU C C   1 
ATOM   4487 O  O   . LEU C 1 89  ? -49.868 -15.578 -25.817 1.00 17.08 ? 91   LEU C O   1 
ATOM   4488 C  CB  . LEU C 1 89  ? -49.375 -16.943 -28.732 1.00 19.30 ? 91   LEU C CB  1 
ATOM   4489 C  CG  . LEU C 1 89  ? -49.073 -16.710 -30.197 1.00 20.66 ? 91   LEU C CG  1 
ATOM   4490 C  CD1 . LEU C 1 89  ? -49.771 -17.783 -30.982 1.00 21.65 ? 91   LEU C CD1 1 
ATOM   4491 C  CD2 . LEU C 1 89  ? -49.513 -15.335 -30.663 1.00 21.37 ? 91   LEU C CD2 1 
ATOM   4492 N  N   . GLN C 1 90  ? -48.554 -17.400 -25.826 1.00 17.77 ? 92   GLN C N   1 
ATOM   4493 C  CA  . GLN C 1 90  ? -49.034 -17.907 -24.547 1.00 17.97 ? 92   GLN C CA  1 
ATOM   4494 C  C   . GLN C 1 90  ? -48.079 -18.958 -24.032 1.00 16.98 ? 92   GLN C C   1 
ATOM   4495 O  O   . GLN C 1 90  ? -47.292 -19.508 -24.790 1.00 17.35 ? 92   GLN C O   1 
ATOM   4496 C  CB  . GLN C 1 90  ? -50.434 -18.535 -24.714 1.00 17.53 ? 92   GLN C CB  1 
ATOM   4497 C  CG  . GLN C 1 90  ? -50.537 -19.604 -25.801 1.00 18.14 ? 92   GLN C CG  1 
ATOM   4498 C  CD  . GLN C 1 90  ? -50.588 -21.049 -25.294 1.00 18.80 ? 92   GLN C CD  1 
ATOM   4499 O  OE1 . GLN C 1 90  ? -50.175 -21.367 -24.176 1.00 19.59 ? 92   GLN C OE1 1 
ATOM   4500 N  NE2 . GLN C 1 90  ? -51.103 -21.941 -26.139 1.00 18.83 ? 92   GLN C NE2 1 
ATOM   4501 N  N   . LEU C 1 91  ? -48.171 -19.240 -22.743 1.00 16.90 ? 93   LEU C N   1 
ATOM   4502 C  CA  . LEU C 1 91  ? -47.519 -20.398 -22.185 1.00 17.66 ? 93   LEU C CA  1 
ATOM   4503 C  C   . LEU C 1 91  ? -48.470 -21.180 -21.285 1.00 17.22 ? 93   LEU C C   1 
ATOM   4504 O  O   . LEU C 1 91  ? -49.429 -20.647 -20.777 1.00 17.05 ? 93   LEU C O   1 
ATOM   4505 C  CB  . LEU C 1 91  ? -46.225 -20.002 -21.441 1.00 17.93 ? 93   LEU C CB  1 
ATOM   4506 C  CG  . LEU C 1 91  ? -46.332 -19.031 -20.261 1.00 18.21 ? 93   LEU C CG  1 
ATOM   4507 C  CD1 . LEU C 1 91  ? -46.747 -19.733 -18.972 1.00 18.56 ? 93   LEU C CD1 1 
ATOM   4508 C  CD2 . LEU C 1 91  ? -45.004 -18.308 -20.037 1.00 19.34 ? 93   LEU C CD2 1 
ATOM   4509 N  N   . HIS C 1 92  ? -48.182 -22.460 -21.111 1.00 18.52 ? 94   HIS C N   1 
ATOM   4510 C  CA  . HIS C 1 92  ? -49.001 -23.318 -20.261 1.00 18.52 ? 94   HIS C CA  1 
ATOM   4511 C  C   . HIS C 1 92  ? -48.145 -24.492 -19.829 1.00 19.00 ? 94   HIS C C   1 
ATOM   4512 O  O   . HIS C 1 92  ? -47.009 -24.669 -20.308 1.00 19.43 ? 94   HIS C O   1 
ATOM   4513 C  CB  . HIS C 1 92  ? -50.244 -23.788 -21.037 1.00 18.67 ? 94   HIS C CB  1 
ATOM   4514 C  CG  . HIS C 1 92  ? -49.903 -24.554 -22.260 1.00 17.84 ? 94   HIS C CG  1 
ATOM   4515 N  ND1 . HIS C 1 92  ? -49.742 -23.950 -23.481 1.00 18.20 ? 94   HIS C ND1 1 
ATOM   4516 C  CD2 . HIS C 1 92  ? -49.590 -25.857 -22.437 1.00 18.59 ? 94   HIS C CD2 1 
ATOM   4517 C  CE1 . HIS C 1 92  ? -49.362 -24.850 -24.366 1.00 18.16 ? 94   HIS C CE1 1 
ATOM   4518 N  NE2 . HIS C 1 92  ? -49.287 -26.021 -23.761 1.00 17.60 ? 94   HIS C NE2 1 
ATOM   4519 N  N   . LEU C 1 93  ? -48.697 -25.302 -18.933 1.00 19.29 ? 95   LEU C N   1 
ATOM   4520 C  CA  . LEU C 1 93  ? -47.958 -26.376 -18.310 1.00 20.52 ? 95   LEU C CA  1 
ATOM   4521 C  C   . LEU C 1 93  ? -48.650 -27.734 -18.460 1.00 20.93 ? 95   LEU C C   1 
ATOM   4522 O  O   . LEU C 1 93  ? -49.878 -27.808 -18.648 1.00 21.39 ? 95   LEU C O   1 
ATOM   4523 C  CB  . LEU C 1 93  ? -47.776 -26.051 -16.822 1.00 22.50 ? 95   LEU C CB  1 
ATOM   4524 C  CG  . LEU C 1 93  ? -47.096 -24.715 -16.499 1.00 24.01 ? 95   LEU C CG  1 
ATOM   4525 C  CD1 . LEU C 1 93  ? -47.389 -24.302 -15.069 1.00 26.54 ? 95   LEU C CD1 1 
ATOM   4526 C  CD2 . LEU C 1 93  ? -45.607 -24.865 -16.689 1.00 24.79 ? 95   LEU C CD2 1 
ATOM   4527 N  N   . HIS C 1 94  ? -47.832 -28.782 -18.373 1.00 20.88 ? 96   HIS C N   1 
ATOM   4528 C  CA  . HIS C 1 94  ? -48.259 -30.162 -18.319 1.00 22.26 ? 96   HIS C CA  1 
ATOM   4529 C  C   . HIS C 1 94  ? -47.668 -30.838 -17.094 1.00 23.82 ? 96   HIS C C   1 
ATOM   4530 O  O   . HIS C 1 94  ? -46.489 -30.673 -16.799 1.00 23.33 ? 96   HIS C O   1 
ATOM   4531 C  CB  . HIS C 1 94  ? -47.815 -30.880 -19.567 1.00 21.92 ? 96   HIS C CB  1 
ATOM   4532 C  CG  . HIS C 1 94  ? -48.423 -30.316 -20.804 1.00 21.78 ? 96   HIS C CG  1 
ATOM   4533 N  ND1 . HIS C 1 94  ? -49.669 -30.696 -21.247 1.00 22.08 ? 96   HIS C ND1 1 
ATOM   4534 C  CD2 . HIS C 1 94  ? -47.982 -29.378 -21.667 1.00 20.93 ? 96   HIS C CD2 1 
ATOM   4535 C  CE1 . HIS C 1 94  ? -49.962 -30.032 -22.344 1.00 22.32 ? 96   HIS C CE1 1 
ATOM   4536 N  NE2 . HIS C 1 94  ? -48.955 -29.227 -22.617 1.00 21.70 ? 96   HIS C NE2 1 
ATOM   4537 N  N   . TRP C 1 95  ? -48.487 -31.610 -16.391 1.00 24.56 ? 97   TRP C N   1 
ATOM   4538 C  CA  . TRP C 1 95  ? -48.077 -32.164 -15.098 1.00 26.88 ? 97   TRP C CA  1 
ATOM   4539 C  C   . TRP C 1 95  ? -48.798 -33.462 -14.702 1.00 28.75 ? 97   TRP C C   1 
ATOM   4540 O  O   . TRP C 1 95  ? -49.698 -33.918 -15.403 1.00 27.92 ? 97   TRP C O   1 
ATOM   4541 C  CB  . TRP C 1 95  ? -48.276 -31.105 -14.047 1.00 26.06 ? 97   TRP C CB  1 
ATOM   4542 C  CG  . TRP C 1 95  ? -49.692 -30.754 -13.821 1.00 25.62 ? 97   TRP C CG  1 
ATOM   4543 C  CD1 . TRP C 1 95  ? -50.608 -31.457 -13.082 1.00 25.40 ? 97   TRP C CD1 1 
ATOM   4544 C  CD2 . TRP C 1 95  ? -50.377 -29.605 -14.326 1.00 25.06 ? 97   TRP C CD2 1 
ATOM   4545 N  NE1 . TRP C 1 95  ? -51.815 -30.809 -13.096 1.00 25.36 ? 97   TRP C NE1 1 
ATOM   4546 C  CE2 . TRP C 1 95  ? -51.699 -29.663 -13.840 1.00 24.61 ? 97   TRP C CE2 1 
ATOM   4547 C  CE3 . TRP C 1 95  ? -50.001 -28.525 -15.143 1.00 24.28 ? 97   TRP C CE3 1 
ATOM   4548 C  CZ2 . TRP C 1 95  ? -52.646 -28.681 -14.131 1.00 25.69 ? 97   TRP C CZ2 1 
ATOM   4549 C  CZ3 . TRP C 1 95  ? -50.948 -27.542 -15.428 1.00 24.44 ? 97   TRP C CZ3 1 
ATOM   4550 C  CH2 . TRP C 1 95  ? -52.253 -27.625 -14.924 1.00 25.46 ? 97   TRP C CH2 1 
ATOM   4551 N  N   . GLY C 1 96  ? -48.381 -34.056 -13.580 1.00 31.79 ? 98   GLY C N   1 
ATOM   4552 C  CA  . GLY C 1 96  ? -48.822 -35.394 -13.199 1.00 33.23 ? 98   GLY C CA  1 
ATOM   4553 C  C   . GLY C 1 96  ? -49.802 -35.401 -12.043 1.00 35.24 ? 98   GLY C C   1 
ATOM   4554 O  O   . GLY C 1 96  ? -50.856 -34.773 -12.113 1.00 36.12 ? 98   GLY C O   1 
ATOM   4555 N  N   . ALA C 1 97  ? -49.461 -36.148 -10.996 1.00 36.78 ? 99   ALA C N   1 
ATOM   4556 C  CA  . ALA C 1 97  ? -50.236 -36.202 -9.752  1.00 37.80 ? 99   ALA C CA  1 
ATOM   4557 C  C   . ALA C 1 97  ? -49.315 -36.720 -8.648  1.00 39.22 ? 99   ALA C C   1 
ATOM   4558 O  O   . ALA C 1 97  ? -48.140 -37.009 -8.906  1.00 38.97 ? 99   ALA C O   1 
ATOM   4559 C  CB  . ALA C 1 97  ? -51.464 -37.094 -9.919  1.00 37.00 ? 99   ALA C CB  1 
ATOM   4560 N  N   . ALA C 1 98  ? -49.825 -36.816 -7.422  1.00 42.54 ? 100  ALA C N   1 
ATOM   4561 C  CA  . ALA C 1 98  ? -48.973 -37.152 -6.273  1.00 44.08 ? 100  ALA C CA  1 
ATOM   4562 C  C   . ALA C 1 98  ? -48.180 -38.412 -6.590  1.00 42.60 ? 100  ALA C C   1 
ATOM   4563 O  O   . ALA C 1 98  ? -48.761 -39.436 -6.932  1.00 42.95 ? 100  ALA C O   1 
ATOM   4564 C  CB  . ALA C 1 98  ? -49.802 -37.328 -5.005  1.00 43.80 ? 100  ALA C CB  1 
ATOM   4565 N  N   . GLY C 1 99  ? -46.855 -38.296 -6.554  1.00 42.92 ? 101  GLY C N   1 
ATOM   4566 C  CA  . GLY C 1 99  ? -45.960 -39.412 -6.835  1.00 43.26 ? 101  GLY C CA  1 
ATOM   4567 C  C   . GLY C 1 99  ? -45.934 -39.926 -8.269  1.00 45.74 ? 101  GLY C C   1 
ATOM   4568 O  O   . GLY C 1 99  ? -45.485 -41.056 -8.503  1.00 47.39 ? 101  GLY C O   1 
ATOM   4569 N  N   . ARG C 1 100 ? -46.399 -39.122 -9.232  1.00 41.97 ? 102  ARG C N   1 
ATOM   4570 C  CA  . ARG C 1 100 ? -46.413 -39.536 -10.642 1.00 40.60 ? 102  ARG C CA  1 
ATOM   4571 C  C   . ARG C 1 100 ? -46.013 -38.367 -11.563 1.00 35.78 ? 102  ARG C C   1 
ATOM   4572 O  O   . ARG C 1 100 ? -46.627 -37.303 -11.505 1.00 33.21 ? 102  ARG C O   1 
ATOM   4573 C  CB  . ARG C 1 100 ? -47.793 -40.058 -11.034 1.00 44.24 ? 102  ARG C CB  1 
ATOM   4574 C  CG  . ARG C 1 100 ? -48.282 -41.230 -10.187 1.00 47.47 ? 102  ARG C CG  1 
ATOM   4575 C  CD  . ARG C 1 100 ? -49.674 -41.651 -10.606 1.00 50.69 ? 102  ARG C CD  1 
ATOM   4576 N  NE  . ARG C 1 100 ? -49.680 -42.135 -11.988 1.00 54.83 ? 102  ARG C NE  1 
ATOM   4577 C  CZ  . ARG C 1 100 ? -50.773 -42.436 -12.687 1.00 57.97 ? 102  ARG C CZ  1 
ATOM   4578 N  NH1 . ARG C 1 100 ? -51.989 -42.310 -12.150 1.00 60.07 ? 102  ARG C NH1 1 
ATOM   4579 N  NH2 . ARG C 1 100 ? -50.651 -42.871 -13.941 1.00 58.44 ? 102  ARG C NH2 1 
ATOM   4580 N  N   . PRO C 1 101 ? -44.973 -38.557 -12.392 1.00 31.40 ? 103  PRO C N   1 
ATOM   4581 C  CA  . PRO C 1 101 ? -44.522 -37.475 -13.276 1.00 31.02 ? 103  PRO C CA  1 
ATOM   4582 C  C   . PRO C 1 101 ? -45.490 -37.233 -14.457 1.00 29.76 ? 103  PRO C C   1 
ATOM   4583 O  O   . PRO C 1 101 ? -46.267 -38.111 -14.811 1.00 29.64 ? 103  PRO C O   1 
ATOM   4584 C  CB  . PRO C 1 101 ? -43.152 -37.964 -13.748 1.00 30.37 ? 103  PRO C CB  1 
ATOM   4585 C  CG  . PRO C 1 101 ? -43.223 -39.454 -13.657 1.00 31.48 ? 103  PRO C CG  1 
ATOM   4586 C  CD  . PRO C 1 101 ? -44.177 -39.787 -12.565 1.00 31.18 ? 103  PRO C CD  1 
ATOM   4587 N  N   . GLY C 1 102 ? -45.471 -36.034 -15.026 1.00 29.03 ? 104  GLY C N   1 
ATOM   4588 C  CA  . GLY C 1 102 ? -46.400 -35.687 -16.089 1.00 28.41 ? 104  GLY C CA  1 
ATOM   4589 C  C   . GLY C 1 102 ? -45.864 -34.782 -17.176 1.00 27.45 ? 104  GLY C C   1 
ATOM   4590 O  O   . GLY C 1 102 ? -46.640 -34.032 -17.781 1.00 27.12 ? 104  GLY C O   1 
ATOM   4591 N  N   . SER C 1 103 ? -44.554 -34.846 -17.434 1.00 25.96 ? 105  SER C N   1 
ATOM   4592 C  CA  . SER C 1 103 ? -43.991 -34.202 -18.622 1.00 24.17 ? 105  SER C CA  1 
ATOM   4593 C  C   . SER C 1 103 ? -44.565 -34.871 -19.882 1.00 24.37 ? 105  SER C C   1 
ATOM   4594 O  O   . SER C 1 103 ? -44.975 -36.035 -19.843 1.00 23.86 ? 105  SER C O   1 
ATOM   4595 C  CB  . SER C 1 103 ? -42.462 -34.269 -18.627 1.00 23.04 ? 105  SER C CB  1 
ATOM   4596 O  OG  . SER C 1 103 ? -41.940 -35.545 -19.007 1.00 22.43 ? 105  SER C OG  1 
ATOM   4597 N  N   . GLU C 1 104 ? -44.568 -34.142 -20.992 1.00 23.08 ? 106  GLU C N   1 
ATOM   4598 C  CA  . GLU C 1 104 ? -44.996 -34.689 -22.297 1.00 22.72 ? 106  GLU C CA  1 
ATOM   4599 C  C   . GLU C 1 104 ? -43.875 -35.405 -23.006 1.00 21.39 ? 106  GLU C C   1 
ATOM   4600 O  O   . GLU C 1 104 ? -43.976 -36.586 -23.340 1.00 20.99 ? 106  GLU C O   1 
ATOM   4601 C  CB  . GLU C 1 104 ? -45.529 -33.560 -23.171 1.00 22.02 ? 106  GLU C CB  1 
ATOM   4602 C  CG  . GLU C 1 104 ? -46.747 -32.927 -22.560 1.00 23.15 ? 106  GLU C CG  1 
ATOM   4603 C  CD  . GLU C 1 104 ? -47.872 -32.770 -23.545 1.00 23.47 ? 106  GLU C CD  1 
ATOM   4604 O  OE1 . GLU C 1 104 ? -47.891 -31.743 -24.237 1.00 22.70 ? 106  GLU C OE1 1 
ATOM   4605 O  OE2 . GLU C 1 104 ? -48.719 -33.678 -23.612 1.00 22.87 ? 106  GLU C OE2 1 
ATOM   4606 N  N   . HIS C 1 105 ? -42.795 -34.690 -23.268 1.00 21.09 ? 107  HIS C N   1 
ATOM   4607 C  CA  . HIS C 1 105 ? -41.613 -35.329 -23.814 1.00 20.47 ? 107  HIS C CA  1 
ATOM   4608 C  C   . HIS C 1 105 ? -40.971 -36.193 -22.723 1.00 21.54 ? 107  HIS C C   1 
ATOM   4609 O  O   . HIS C 1 105 ? -41.202 -35.984 -21.523 1.00 22.32 ? 107  HIS C O   1 
ATOM   4610 C  CB  . HIS C 1 105 ? -40.642 -34.295 -24.375 1.00 20.09 ? 107  HIS C CB  1 
ATOM   4611 C  CG  . HIS C 1 105 ? -41.162 -33.605 -25.602 1.00 20.45 ? 107  HIS C CG  1 
ATOM   4612 N  ND1 . HIS C 1 105 ? -41.977 -32.497 -25.547 1.00 20.31 ? 107  HIS C ND1 1 
ATOM   4613 C  CD2 . HIS C 1 105 ? -41.017 -33.902 -26.915 1.00 20.34 ? 107  HIS C CD2 1 
ATOM   4614 C  CE1 . HIS C 1 105 ? -42.294 -32.128 -26.777 1.00 19.97 ? 107  HIS C CE1 1 
ATOM   4615 N  NE2 . HIS C 1 105 ? -41.733 -32.973 -27.623 1.00 20.26 ? 107  HIS C NE2 1 
ATOM   4616 N  N   . THR C 1 106 ? -40.223 -37.194 -23.159 1.00 22.14 ? 108  THR C N   1 
ATOM   4617 C  CA  . THR C 1 106 ? -39.497 -38.069 -22.264 1.00 23.55 ? 108  THR C CA  1 
ATOM   4618 C  C   . THR C 1 106 ? -38.091 -38.160 -22.818 1.00 24.39 ? 108  THR C C   1 
ATOM   4619 O  O   . THR C 1 106 ? -37.862 -37.912 -24.012 1.00 23.25 ? 108  THR C O   1 
ATOM   4620 C  CB  . THR C 1 106 ? -40.141 -39.481 -22.133 1.00 24.09 ? 108  THR C CB  1 
ATOM   4621 O  OG1 . THR C 1 106 ? -40.126 -40.171 -23.392 1.00 25.37 ? 108  THR C OG1 1 
ATOM   4622 C  CG2 . THR C 1 106 ? -41.565 -39.395 -21.596 1.00 24.39 ? 108  THR C CG2 1 
ATOM   4623 N  N   . VAL C 1 107 ? -37.142 -38.506 -21.956 1.00 25.53 ? 109  VAL C N   1 
ATOM   4624 C  CA  . VAL C 1 107 ? -35.756 -38.663 -22.381 1.00 27.15 ? 109  VAL C CA  1 
ATOM   4625 C  C   . VAL C 1 107 ? -35.295 -40.058 -21.993 1.00 29.44 ? 109  VAL C C   1 
ATOM   4626 O  O   . VAL C 1 107 ? -35.309 -40.404 -20.816 1.00 29.48 ? 109  VAL C O   1 
ATOM   4627 C  CB  . VAL C 1 107 ? -34.864 -37.605 -21.736 1.00 26.86 ? 109  VAL C CB  1 
ATOM   4628 C  CG1 . VAL C 1 107 ? -33.390 -37.866 -22.040 1.00 26.28 ? 109  VAL C CG1 1 
ATOM   4629 C  CG2 . VAL C 1 107 ? -35.291 -36.219 -22.210 1.00 27.43 ? 109  VAL C CG2 1 
ATOM   4630 N  N   . GLU C 1 108 ? -34.905 -40.840 -22.994 1.00 30.80 ? 110  GLU C N   1 
ATOM   4631 C  CA  . GLU C 1 108 ? -34.626 -42.272 -22.854 1.00 33.52 ? 110  GLU C CA  1 
ATOM   4632 C  C   . GLU C 1 108 ? -35.668 -42.964 -21.978 1.00 32.74 ? 110  GLU C C   1 
ATOM   4633 O  O   . GLU C 1 108 ? -35.316 -43.752 -21.105 1.00 33.70 ? 110  GLU C O   1 
ATOM   4634 C  CB  . GLU C 1 108 ? -33.204 -42.510 -22.316 1.00 35.39 ? 110  GLU C CB  1 
ATOM   4635 C  CG  . GLU C 1 108 ? -32.101 -41.955 -23.209 1.00 39.80 ? 110  GLU C CG  1 
ATOM   4636 C  CD  . GLU C 1 108 ? -30.692 -42.103 -22.624 1.00 45.20 ? 110  GLU C CD  1 
ATOM   4637 O  OE1 . GLU C 1 108 ? -30.553 -42.453 -21.424 1.00 48.80 ? 110  GLU C OE1 1 
ATOM   4638 O  OE2 . GLU C 1 108 ? -29.704 -41.853 -23.359 1.00 45.38 ? 110  GLU C OE2 1 
ATOM   4639 N  N   . GLY C 1 109 ? -36.944 -42.644 -22.194 1.00 29.84 ? 111  GLY C N   1 
ATOM   4640 C  CA  . GLY C 1 109 ? -38.033 -43.225 -21.423 1.00 29.74 ? 111  GLY C CA  1 
ATOM   4641 C  C   . GLY C 1 109 ? -38.395 -42.543 -20.109 1.00 29.54 ? 111  GLY C C   1 
ATOM   4642 O  O   . GLY C 1 109 ? -39.480 -42.778 -19.589 1.00 29.01 ? 111  GLY C O   1 
ATOM   4643 N  N   . HIS C 1 110 ? -37.510 -41.707 -19.563 1.00 30.32 ? 112  HIS C N   1 
ATOM   4644 C  CA  . HIS C 1 110 ? -37.779 -41.014 -18.308 1.00 30.15 ? 112  HIS C CA  1 
ATOM   4645 C  C   . HIS C 1 110 ? -38.759 -39.848 -18.511 1.00 28.57 ? 112  HIS C C   1 
ATOM   4646 O  O   . HIS C 1 110 ? -38.553 -38.996 -19.371 1.00 26.85 ? 112  HIS C O   1 
ATOM   4647 C  CB  . HIS C 1 110 ? -36.478 -40.498 -17.680 1.00 32.23 ? 112  HIS C CB  1 
ATOM   4648 C  CG  . HIS C 1 110 ? -36.694 -39.745 -16.402 1.00 34.90 ? 112  HIS C CG  1 
ATOM   4649 N  ND1 . HIS C 1 110 ? -36.985 -40.372 -15.209 1.00 35.22 ? 112  HIS C ND1 1 
ATOM   4650 C  CD2 . HIS C 1 110 ? -36.711 -38.415 -16.142 1.00 34.96 ? 112  HIS C CD2 1 
ATOM   4651 C  CE1 . HIS C 1 110 ? -37.152 -39.463 -14.264 1.00 35.67 ? 112  HIS C CE1 1 
ATOM   4652 N  NE2 . HIS C 1 110 ? -36.992 -38.267 -14.804 1.00 36.71 ? 112  HIS C NE2 1 
ATOM   4653 N  N   . ARG C 1 111 ? -39.807 -39.835 -17.696 1.00 27.69 ? 113  ARG C N   1 
ATOM   4654 C  CA  . ARG C 1 111 ? -40.779 -38.785 -17.647 1.00 27.92 ? 113  ARG C CA  1 
ATOM   4655 C  C   . ARG C 1 111 ? -40.450 -37.906 -16.451 1.00 29.12 ? 113  ARG C C   1 
ATOM   4656 O  O   . ARG C 1 111 ? -40.205 -38.396 -15.334 1.00 28.93 ? 113  ARG C O   1 
ATOM   4657 C  CB  . ARG C 1 111 ? -42.183 -39.374 -17.512 1.00 30.38 ? 113  ARG C CB  1 
ATOM   4658 C  CG  . ARG C 1 111 ? -43.331 -38.374 -17.650 1.00 30.22 ? 113  ARG C CG  1 
ATOM   4659 C  CD  . ARG C 1 111 ? -44.675 -39.069 -17.511 1.00 32.28 ? 113  ARG C CD  1 
ATOM   4660 N  NE  . ARG C 1 111 ? -44.826 -40.096 -18.543 1.00 33.86 ? 113  ARG C NE  1 
ATOM   4661 C  CZ  . ARG C 1 111 ? -45.118 -39.861 -19.821 1.00 34.26 ? 113  ARG C CZ  1 
ATOM   4662 N  NH1 . ARG C 1 111 ? -45.330 -38.623 -20.253 1.00 34.85 ? 113  ARG C NH1 1 
ATOM   4663 N  NH2 . ARG C 1 111 ? -45.214 -40.872 -20.676 1.00 32.95 ? 113  ARG C NH2 1 
ATOM   4664 N  N   . PHE C 1 112 ? -40.457 -36.605 -16.696 1.00 26.62 ? 114  PHE C N   1 
ATOM   4665 C  CA  . PHE C 1 112 ? -40.107 -35.610 -15.707 1.00 25.94 ? 114  PHE C CA  1 
ATOM   4666 C  C   . PHE C 1 112 ? -41.359 -35.177 -14.976 1.00 26.37 ? 114  PHE C C   1 
ATOM   4667 O  O   . PHE C 1 112 ? -42.476 -35.386 -15.473 1.00 25.53 ? 114  PHE C O   1 
ATOM   4668 C  CB  . PHE C 1 112 ? -39.425 -34.422 -16.389 1.00 26.17 ? 114  PHE C CB  1 
ATOM   4669 C  CG  . PHE C 1 112 ? -38.118 -34.780 -17.027 1.00 25.79 ? 114  PHE C CG  1 
ATOM   4670 C  CD1 . PHE C 1 112 ? -38.077 -35.316 -18.304 1.00 26.22 ? 114  PHE C CD1 1 
ATOM   4671 C  CD2 . PHE C 1 112 ? -36.927 -34.604 -16.338 1.00 26.13 ? 114  PHE C CD2 1 
ATOM   4672 C  CE1 . PHE C 1 112 ? -36.872 -35.664 -18.890 1.00 25.68 ? 114  PHE C CE1 1 
ATOM   4673 C  CE2 . PHE C 1 112 ? -35.716 -34.947 -16.909 1.00 25.96 ? 114  PHE C CE2 1 
ATOM   4674 C  CZ  . PHE C 1 112 ? -35.687 -35.472 -18.195 1.00 27.18 ? 114  PHE C CZ  1 
ATOM   4675 N  N   . PRO C 1 113 ? -41.191 -34.587 -13.777 1.00 26.84 ? 115  PRO C N   1 
ATOM   4676 C  CA  . PRO C 1 113 ? -42.372 -34.165 -13.028 1.00 27.64 ? 115  PRO C CA  1 
ATOM   4677 C  C   . PRO C 1 113 ? -43.328 -33.249 -13.803 1.00 27.16 ? 115  PRO C C   1 
ATOM   4678 O  O   . PRO C 1 113 ? -44.538 -33.448 -13.715 1.00 29.60 ? 115  PRO C O   1 
ATOM   4679 C  CB  . PRO C 1 113 ? -41.777 -33.459 -11.801 1.00 26.72 ? 115  PRO C CB  1 
ATOM   4680 C  CG  . PRO C 1 113 ? -40.503 -34.202 -11.573 1.00 27.53 ? 115  PRO C CG  1 
ATOM   4681 C  CD  . PRO C 1 113 ? -39.977 -34.550 -12.939 1.00 27.01 ? 115  PRO C CD  1 
ATOM   4682 N  N   . ALA C 1 114 ? -42.807 -32.274 -14.552 1.00 26.09 ? 116  ALA C N   1 
ATOM   4683 C  CA  . ALA C 1 114 ? -43.678 -31.365 -15.334 1.00 24.42 ? 116  ALA C CA  1 
ATOM   4684 C  C   . ALA C 1 114 ? -42.982 -30.804 -16.575 1.00 22.95 ? 116  ALA C C   1 
ATOM   4685 O  O   . ALA C 1 114 ? -41.812 -31.115 -16.827 1.00 21.92 ? 116  ALA C O   1 
ATOM   4686 C  CB  . ALA C 1 114 ? -44.214 -30.255 -14.450 1.00 23.84 ? 116  ALA C CB  1 
ATOM   4687 N  N   . GLU C 1 115 ? -43.720 -30.023 -17.362 1.00 21.63 ? 117  GLU C N   1 
ATOM   4688 C  CA  . GLU C 1 115 ? -43.198 -29.441 -18.606 1.00 20.72 ? 117  GLU C CA  1 
ATOM   4689 C  C   . GLU C 1 115 ? -43.887 -28.113 -18.887 1.00 21.17 ? 117  GLU C C   1 
ATOM   4690 O  O   . GLU C 1 115 ? -45.120 -27.975 -18.730 1.00 21.66 ? 117  GLU C O   1 
ATOM   4691 C  CB  . GLU C 1 115 ? -43.384 -30.410 -19.771 1.00 21.24 ? 117  GLU C CB  1 
ATOM   4692 C  CG  . GLU C 1 115 ? -42.560 -30.090 -21.024 1.00 20.56 ? 117  GLU C CG  1 
ATOM   4693 C  CD  . GLU C 1 115 ? -42.591 -31.206 -22.066 1.00 20.11 ? 117  GLU C CD  1 
ATOM   4694 O  OE1 . GLU C 1 115 ? -42.506 -32.396 -21.687 1.00 18.57 ? 117  GLU C OE1 1 
ATOM   4695 O  OE2 . GLU C 1 115 ? -42.696 -30.905 -23.283 1.00 20.23 ? 117  GLU C OE2 1 
ATOM   4696 N  N   . ILE C 1 116 ? -43.090 -27.132 -19.281 1.00 19.68 ? 118  ILE C N   1 
ATOM   4697 C  CA  . ILE C 1 116 ? -43.603 -25.836 -19.690 1.00 19.61 ? 118  ILE C CA  1 
ATOM   4698 C  C   . ILE C 1 116 ? -43.505 -25.705 -21.201 1.00 18.03 ? 118  ILE C C   1 
ATOM   4699 O  O   . ILE C 1 116 ? -42.518 -26.114 -21.794 1.00 17.78 ? 118  ILE C O   1 
ATOM   4700 C  CB  . ILE C 1 116 ? -42.892 -24.640 -19.008 1.00 20.54 ? 118  ILE C CB  1 
ATOM   4701 C  CG1 . ILE C 1 116 ? -43.526 -23.307 -19.469 1.00 21.36 ? 118  ILE C CG1 1 
ATOM   4702 C  CG2 . ILE C 1 116 ? -41.389 -24.644 -19.258 1.00 19.52 ? 118  ILE C CG2 1 
ATOM   4703 C  CD1 . ILE C 1 116 ? -43.281 -22.142 -18.541 1.00 22.49 ? 118  ILE C CD1 1 
ATOM   4704 N  N   . HIS C 1 117 ? -44.537 -25.107 -21.791 1.00 17.74 ? 119  HIS C N   1 
ATOM   4705 C  CA  . HIS C 1 117 ? -44.609 -24.852 -23.224 1.00 16.61 ? 119  HIS C CA  1 
ATOM   4706 C  C   . HIS C 1 117 ? -44.867 -23.395 -23.457 1.00 15.76 ? 119  HIS C C   1 
ATOM   4707 O  O   . HIS C 1 117 ? -45.798 -22.841 -22.891 1.00 16.75 ? 119  HIS C O   1 
ATOM   4708 C  CB  . HIS C 1 117 ? -45.723 -25.678 -23.864 1.00 17.49 ? 119  HIS C CB  1 
ATOM   4709 C  CG  . HIS C 1 117 ? -45.429 -27.139 -23.927 1.00 17.59 ? 119  HIS C CG  1 
ATOM   4710 N  ND1 . HIS C 1 117 ? -46.403 -28.080 -24.178 1.00 17.28 ? 119  HIS C ND1 1 
ATOM   4711 C  CD2 . HIS C 1 117 ? -44.267 -27.827 -23.778 1.00 17.46 ? 119  HIS C CD2 1 
ATOM   4712 C  CE1 . HIS C 1 117 ? -45.857 -29.283 -24.185 1.00 17.67 ? 119  HIS C CE1 1 
ATOM   4713 N  NE2 . HIS C 1 117 ? -44.562 -29.157 -23.950 1.00 17.56 ? 119  HIS C NE2 1 
ATOM   4714 N  N   . VAL C 1 118 ? -44.033 -22.777 -24.279 1.00 15.12 ? 120  VAL C N   1 
ATOM   4715 C  CA  . VAL C 1 118 ? -44.187 -21.386 -24.668 1.00 15.14 ? 120  VAL C CA  1 
ATOM   4716 C  C   . VAL C 1 118 ? -44.435 -21.396 -26.172 1.00 14.75 ? 120  VAL C C   1 
ATOM   4717 O  O   . VAL C 1 118 ? -43.543 -21.748 -26.950 1.00 14.21 ? 120  VAL C O   1 
ATOM   4718 C  CB  . VAL C 1 118 ? -42.926 -20.570 -24.370 1.00 15.22 ? 120  VAL C CB  1 
ATOM   4719 C  CG1 . VAL C 1 118 ? -43.161 -19.092 -24.652 1.00 15.30 ? 120  VAL C CG1 1 
ATOM   4720 C  CG2 . VAL C 1 118 ? -42.515 -20.764 -22.917 1.00 16.04 ? 120  VAL C CG2 1 
ATOM   4721 N  N   . VAL C 1 119 ? -45.642 -21.006 -26.562 1.00 14.64 ? 121  VAL C N   1 
ATOM   4722 C  CA  . VAL C 1 119 ? -46.142 -21.201 -27.921 1.00 15.17 ? 121  VAL C CA  1 
ATOM   4723 C  C   . VAL C 1 119 ? -45.981 -19.891 -28.693 1.00 14.60 ? 121  VAL C C   1 
ATOM   4724 O  O   . VAL C 1 119 ? -46.373 -18.828 -28.202 1.00 16.09 ? 121  VAL C O   1 
ATOM   4725 C  CB  . VAL C 1 119 ? -47.631 -21.654 -27.901 1.00 16.11 ? 121  VAL C CB  1 
ATOM   4726 C  CG1 . VAL C 1 119 ? -48.164 -21.836 -29.314 1.00 16.95 ? 121  VAL C CG1 1 
ATOM   4727 C  CG2 . VAL C 1 119 ? -47.815 -22.945 -27.094 1.00 16.06 ? 121  VAL C CG2 1 
ATOM   4728 N  N   . HIS C 1 120 ? -45.384 -19.975 -29.883 1.00 14.10 ? 122  HIS C N   1 
ATOM   4729 C  CA  . HIS C 1 120 ? -45.094 -18.829 -30.718 1.00 13.82 ? 122  HIS C CA  1 
ATOM   4730 C  C   . HIS C 1 120 ? -45.652 -18.993 -32.122 1.00 13.83 ? 122  HIS C C   1 
ATOM   4731 O  O   . HIS C 1 120 ? -45.749 -20.108 -32.633 1.00 14.13 ? 122  HIS C O   1 
ATOM   4732 C  CB  . HIS C 1 120 ? -43.588 -18.647 -30.941 1.00 14.37 ? 122  HIS C CB  1 
ATOM   4733 C  CG  . HIS C 1 120 ? -42.781 -18.453 -29.696 1.00 14.61 ? 122  HIS C CG  1 
ATOM   4734 N  ND1 . HIS C 1 120 ? -42.606 -19.446 -28.753 1.00 14.73 ? 122  HIS C ND1 1 
ATOM   4735 C  CD2 . HIS C 1 120 ? -42.025 -17.407 -29.287 1.00 15.28 ? 122  HIS C CD2 1 
ATOM   4736 C  CE1 . HIS C 1 120 ? -41.820 -18.998 -27.788 1.00 15.03 ? 122  HIS C CE1 1 
ATOM   4737 N  NE2 . HIS C 1 120 ? -41.459 -17.762 -28.083 1.00 15.30 ? 122  HIS C NE2 1 
ATOM   4738 N  N   . LEU C 1 121 ? -45.892 -17.844 -32.758 1.00 13.83 ? 123  LEU C N   1 
ATOM   4739 C  CA  . LEU C 1 121 ? -46.407 -17.734 -34.098 1.00 14.07 ? 123  LEU C CA  1 
ATOM   4740 C  C   . LEU C 1 121 ? -45.326 -17.144 -34.994 1.00 14.39 ? 123  LEU C C   1 
ATOM   4741 O  O   . LEU C 1 121 ? -44.761 -16.089 -34.686 1.00 14.16 ? 123  LEU C O   1 
ATOM   4742 C  CB  . LEU C 1 121 ? -47.626 -16.804 -34.078 1.00 14.44 ? 123  LEU C CB  1 
ATOM   4743 C  CG  . LEU C 1 121 ? -48.231 -16.473 -35.444 1.00 14.80 ? 123  LEU C CG  1 
ATOM   4744 C  CD1 . LEU C 1 121 ? -48.666 -17.755 -36.145 1.00 15.16 ? 123  LEU C CD1 1 
ATOM   4745 C  CD2 . LEU C 1 121 ? -49.385 -15.505 -35.294 1.00 15.32 ? 123  LEU C CD2 1 
ATOM   4746 N  N   . SER C 1 122 ? -45.051 -17.797 -36.112 1.00 14.56 ? 124  SER C N   1 
ATOM   4747 C  CA  . SER C 1 122 ? -44.164 -17.209 -37.123 1.00 15.23 ? 124  SER C CA  1 
ATOM   4748 C  C   . SER C 1 122 ? -44.656 -15.830 -37.580 1.00 15.93 ? 124  SER C C   1 
ATOM   4749 O  O   . SER C 1 122 ? -45.842 -15.653 -37.874 1.00 14.17 ? 124  SER C O   1 
ATOM   4750 C  CB  . SER C 1 122 ? -44.019 -18.130 -38.331 1.00 15.82 ? 124  SER C CB  1 
ATOM   4751 O  OG  . SER C 1 122 ? -43.518 -17.443 -39.476 1.00 15.80 ? 124  SER C OG  1 
ATOM   4752 N  N   . THR C 1 123 ? -43.732 -14.876 -37.669 1.00 15.96 ? 125  THR C N   1 
ATOM   4753 C  CA  . THR C 1 123 ? -44.039 -13.531 -38.148 1.00 17.78 ? 125  THR C CA  1 
ATOM   4754 C  C   . THR C 1 123 ? -44.407 -13.513 -39.634 1.00 17.67 ? 125  THR C C   1 
ATOM   4755 O  O   . THR C 1 123 ? -44.917 -12.519 -40.103 1.00 18.05 ? 125  THR C O   1 
ATOM   4756 C  CB  . THR C 1 123 ? -42.865 -12.527 -37.903 1.00 19.10 ? 125  THR C CB  1 
ATOM   4757 O  OG1 . THR C 1 123 ? -41.717 -12.932 -38.651 1.00 22.12 ? 125  THR C OG1 1 
ATOM   4758 C  CG2 . THR C 1 123 ? -42.474 -12.495 -36.462 1.00 20.00 ? 125  THR C CG2 1 
ATOM   4759 N  N   . ALA C 1 124 ? -44.157 -14.594 -40.377 1.00 18.24 ? 126  ALA C N   1 
ATOM   4760 C  CA  . ALA C 1 124 ? -44.725 -14.724 -41.727 1.00 19.21 ? 126  ALA C CA  1 
ATOM   4761 C  C   . ALA C 1 124 ? -46.252 -14.887 -41.771 1.00 18.97 ? 126  ALA C C   1 
ATOM   4762 O  O   . ALA C 1 124 ? -46.850 -14.780 -42.843 1.00 19.69 ? 126  ALA C O   1 
ATOM   4763 C  CB  . ALA C 1 124 ? -44.045 -15.855 -42.494 1.00 20.18 ? 126  ALA C CB  1 
ATOM   4764 N  N   . PHE C 1 125 ? -46.897 -15.167 -40.645 1.00 18.83 ? 127  PHE C N   1 
ATOM   4765 C  CA  . PHE C 1 125 ? -48.351 -15.348 -40.637 1.00 19.54 ? 127  PHE C CA  1 
ATOM   4766 C  C   . PHE C 1 125 ? -49.004 -14.338 -39.709 1.00 20.28 ? 127  PHE C C   1 
ATOM   4767 O  O   . PHE C 1 125 ? -48.567 -14.198 -38.577 1.00 21.92 ? 127  PHE C O   1 
ATOM   4768 C  CB  . PHE C 1 125 ? -48.696 -16.759 -40.154 1.00 18.27 ? 127  PHE C CB  1 
ATOM   4769 C  CG  . PHE C 1 125 ? -48.157 -17.843 -41.018 1.00 17.86 ? 127  PHE C CG  1 
ATOM   4770 C  CD1 . PHE C 1 125 ? -48.903 -18.339 -42.082 1.00 18.22 ? 127  PHE C CD1 1 
ATOM   4771 C  CD2 . PHE C 1 125 ? -46.908 -18.394 -40.766 1.00 17.71 ? 127  PHE C CD2 1 
ATOM   4772 C  CE1 . PHE C 1 125 ? -48.407 -19.359 -42.872 1.00 17.50 ? 127  PHE C CE1 1 
ATOM   4773 C  CE2 . PHE C 1 125 ? -46.404 -19.413 -41.549 1.00 17.12 ? 127  PHE C CE2 1 
ATOM   4774 C  CZ  . PHE C 1 125 ? -47.151 -19.894 -42.606 1.00 17.79 ? 127  PHE C CZ  1 
ATOM   4775 N  N   . ALA C 1 126 ? -50.067 -13.675 -40.160 1.00 21.19 ? 128  ALA C N   1 
ATOM   4776 C  CA  . ALA C 1 126 ? -50.773 -12.704 -39.309 1.00 22.43 ? 128  ALA C CA  1 
ATOM   4777 C  C   . ALA C 1 126 ? -51.569 -13.336 -38.171 1.00 22.18 ? 128  ALA C C   1 
ATOM   4778 O  O   . ALA C 1 126 ? -51.714 -12.723 -37.111 1.00 21.71 ? 128  ALA C O   1 
ATOM   4779 C  CB  . ALA C 1 126 ? -51.672 -11.793 -40.141 1.00 22.73 ? 128  ALA C CB  1 
ATOM   4780 N  N   . ARG C 1 127 ? -52.043 -14.567 -38.367 1.00 21.81 ? 129  ARG C N   1 
ATOM   4781 C  CA  . ARG C 1 127 ? -52.919 -15.221 -37.412 1.00 22.86 ? 129  ARG C CA  1 
ATOM   4782 C  C   . ARG C 1 127 ? -52.521 -16.668 -37.174 1.00 20.98 ? 129  ARG C C   1 
ATOM   4783 O  O   . ARG C 1 127 ? -52.045 -17.352 -38.077 1.00 21.12 ? 129  ARG C O   1 
ATOM   4784 C  CB  . ARG C 1 127 ? -54.351 -15.216 -37.951 1.00 25.64 ? 129  ARG C CB  1 
ATOM   4785 C  CG  . ARG C 1 127 ? -54.945 -13.843 -38.253 1.00 28.69 ? 129  ARG C CG  1 
ATOM   4786 C  CD  . ARG C 1 127 ? -56.210 -14.013 -39.090 1.00 32.66 ? 129  ARG C CD  1 
ATOM   4787 N  NE  . ARG C 1 127 ? -57.140 -14.905 -38.399 1.00 35.47 ? 129  ARG C NE  1 
ATOM   4788 C  CZ  . ARG C 1 127 ? -58.232 -14.533 -37.728 1.00 38.58 ? 129  ARG C CZ  1 
ATOM   4789 N  NH1 . ARG C 1 127 ? -58.617 -13.255 -37.689 1.00 40.61 ? 129  ARG C NH1 1 
ATOM   4790 N  NH2 . ARG C 1 127 ? -58.968 -15.461 -37.102 1.00 37.32 ? 129  ARG C NH2 1 
ATOM   4791 N  N   . VAL C 1 128 ? -52.782 -17.150 -35.972 1.00 19.84 ? 130  VAL C N   1 
ATOM   4792 C  CA  . VAL C 1 128 ? -52.503 -18.540 -35.617 1.00 20.22 ? 130  VAL C CA  1 
ATOM   4793 C  C   . VAL C 1 128 ? -53.192 -19.518 -36.582 1.00 20.31 ? 130  VAL C C   1 
ATOM   4794 O  O   . VAL C 1 128 ? -52.589 -20.526 -36.965 1.00 18.09 ? 130  VAL C O   1 
ATOM   4795 C  CB  . VAL C 1 128 ? -52.963 -18.843 -34.180 1.00 21.13 ? 130  VAL C CB  1 
ATOM   4796 C  CG1 . VAL C 1 128 ? -52.859 -20.328 -33.851 1.00 22.25 ? 130  VAL C CG1 1 
ATOM   4797 C  CG2 . VAL C 1 128 ? -52.102 -18.089 -33.203 1.00 22.97 ? 130  VAL C CG2 1 
ATOM   4798 N  N   . ASP C 1 129 ? -54.447 -19.230 -36.969 1.00 20.45 ? 131  ASP C N   1 
ATOM   4799 C  CA  . ASP C 1 129 ? -55.189 -20.190 -37.815 1.00 21.70 ? 131  ASP C CA  1 
ATOM   4800 C  C   . ASP C 1 129 ? -54.604 -20.401 -39.216 1.00 20.86 ? 131  ASP C C   1 
ATOM   4801 O  O   . ASP C 1 129 ? -54.660 -21.505 -39.732 1.00 21.65 ? 131  ASP C O   1 
ATOM   4802 C  CB  . ASP C 1 129 ? -56.704 -19.944 -37.839 1.00 24.00 ? 131  ASP C CB  1 
ATOM   4803 C  CG  . ASP C 1 129 ? -57.101 -18.586 -38.334 1.00 25.66 ? 131  ASP C CG  1 
ATOM   4804 O  OD1 . ASP C 1 129 ? -56.285 -17.812 -38.854 1.00 29.81 ? 131  ASP C OD1 1 
ATOM   4805 O  OD2 . ASP C 1 129 ? -58.282 -18.276 -38.168 1.00 29.66 ? 131  ASP C OD2 1 
ATOM   4806 N  N   . GLU C 1 130 ? -53.987 -19.367 -39.777 1.00 20.53 ? 132  GLU C N   1 
ATOM   4807 C  CA  . GLU C 1 130 ? -53.199 -19.501 -40.990 1.00 21.69 ? 132  GLU C CA  1 
ATOM   4808 C  C   . GLU C 1 130 ? -51.942 -20.364 -40.853 1.00 19.83 ? 132  GLU C C   1 
ATOM   4809 O  O   . GLU C 1 130 ? -51.471 -20.987 -41.826 1.00 16.76 ? 132  GLU C O   1 
ATOM   4810 C  CB  . GLU C 1 130 ? -52.741 -18.134 -41.471 1.00 26.44 ? 132  GLU C CB  1 
ATOM   4811 C  CG  . GLU C 1 130 ? -53.838 -17.213 -41.945 1.00 30.72 ? 132  GLU C CG  1 
ATOM   4812 C  CD  . GLU C 1 130 ? -53.270 -15.870 -42.377 1.00 36.12 ? 132  GLU C CD  1 
ATOM   4813 O  OE1 . GLU C 1 130 ? -52.299 -15.875 -43.152 1.00 40.65 ? 132  GLU C OE1 1 
ATOM   4814 O  OE2 . GLU C 1 130 ? -53.767 -14.824 -41.920 1.00 39.76 ? 132  GLU C OE2 1 
ATOM   4815 N  N   . ALA C 1 131 ? -51.355 -20.341 -39.666 1.00 18.45 ? 133  ALA C N   1 
ATOM   4816 C  CA  . ALA C 1 131 ? -50.115 -21.062 -39.404 1.00 18.46 ? 133  ALA C CA  1 
ATOM   4817 C  C   . ALA C 1 131 ? -50.341 -22.563 -39.150 1.00 18.10 ? 133  ALA C C   1 
ATOM   4818 O  O   . ALA C 1 131 ? -49.430 -23.359 -39.357 1.00 17.24 ? 133  ALA C O   1 
ATOM   4819 C  CB  . ALA C 1 131 ? -49.403 -20.437 -38.214 1.00 17.89 ? 133  ALA C CB  1 
ATOM   4820 N  N   . LEU C 1 132 ? -51.536 -22.933 -38.683 1.00 19.25 ? 134  LEU C N   1 
ATOM   4821 C  CA  . LEU C 1 132 ? -51.852 -24.325 -38.333 1.00 20.00 ? 134  LEU C CA  1 
ATOM   4822 C  C   . LEU C 1 132 ? -51.695 -25.183 -39.546 1.00 18.73 ? 134  LEU C C   1 
ATOM   4823 O  O   . LEU C 1 132 ? -52.243 -24.866 -40.599 1.00 18.19 ? 134  LEU C O   1 
ATOM   4824 C  CB  . LEU C 1 132 ? -53.284 -24.475 -37.800 1.00 21.79 ? 134  LEU C CB  1 
ATOM   4825 C  CG  . LEU C 1 132 ? -53.464 -23.939 -36.372 1.00 25.10 ? 134  LEU C CG  1 
ATOM   4826 C  CD1 . LEU C 1 132 ? -54.913 -23.639 -36.020 1.00 25.95 ? 134  LEU C CD1 1 
ATOM   4827 C  CD2 . LEU C 1 132 ? -52.872 -24.896 -35.361 1.00 25.46 ? 134  LEU C CD2 1 
ATOM   4828 N  N   . GLY C 1 133 ? -50.889 -26.225 -39.421 1.00 18.12 ? 135  GLY C N   1 
ATOM   4829 C  CA  . GLY C 1 133 ? -50.617 -27.133 -40.530 1.00 18.35 ? 135  GLY C CA  1 
ATOM   4830 C  C   . GLY C 1 133 ? -49.504 -26.717 -41.457 1.00 18.59 ? 135  GLY C C   1 
ATOM   4831 O  O   . GLY C 1 133 ? -49.074 -27.519 -42.292 1.00 19.39 ? 135  GLY C O   1 
ATOM   4832 N  N   . ARG C 1 134 ? -49.020 -25.474 -41.345 1.00 18.10 ? 136  ARG C N   1 
ATOM   4833 C  CA  . ARG C 1 134 ? -47.967 -24.980 -42.239 1.00 18.03 ? 136  ARG C CA  1 
ATOM   4834 C  C   . ARG C 1 134 ? -46.600 -25.240 -41.591 1.00 17.92 ? 136  ARG C C   1 
ATOM   4835 O  O   . ARG C 1 134 ? -46.444 -25.029 -40.396 1.00 17.67 ? 136  ARG C O   1 
ATOM   4836 C  CB  . ARG C 1 134 ? -48.151 -23.487 -42.521 1.00 18.55 ? 136  ARG C CB  1 
ATOM   4837 C  CG  . ARG C 1 134 ? -48.966 -23.148 -43.749 1.00 19.73 ? 136  ARG C CG  1 
ATOM   4838 C  CD  . ARG C 1 134 ? -50.382 -23.697 -43.716 1.00 20.26 ? 136  ARG C CD  1 
ATOM   4839 N  NE  . ARG C 1 134 ? -51.044 -23.473 -45.011 1.00 20.51 ? 136  ARG C NE  1 
ATOM   4840 C  CZ  . ARG C 1 134 ? -51.702 -22.374 -45.379 1.00 20.52 ? 136  ARG C CZ  1 
ATOM   4841 N  NH1 . ARG C 1 134 ? -51.849 -21.348 -44.555 1.00 20.12 ? 136  ARG C NH1 1 
ATOM   4842 N  NH2 . ARG C 1 134 ? -52.245 -22.314 -46.606 1.00 20.57 ? 136  ARG C NH2 1 
ATOM   4843 N  N   . PRO C 1 135 ? -45.612 -25.691 -42.370 1.00 17.91 ? 137  PRO C N   1 
ATOM   4844 C  CA  . PRO C 1 135 ? -44.304 -26.006 -41.781 1.00 17.94 ? 137  PRO C CA  1 
ATOM   4845 C  C   . PRO C 1 135 ? -43.632 -24.774 -41.154 1.00 17.20 ? 137  PRO C C   1 
ATOM   4846 O  O   . PRO C 1 135 ? -43.444 -23.759 -41.820 1.00 16.86 ? 137  PRO C O   1 
ATOM   4847 C  CB  . PRO C 1 135 ? -43.494 -26.519 -42.973 1.00 19.11 ? 137  PRO C CB  1 
ATOM   4848 C  CG  . PRO C 1 135 ? -44.113 -25.857 -44.168 1.00 19.86 ? 137  PRO C CG  1 
ATOM   4849 C  CD  . PRO C 1 135 ? -45.591 -25.778 -43.850 1.00 18.91 ? 137  PRO C CD  1 
ATOM   4850 N  N   . GLY C 1 136 ? -43.342 -24.860 -39.860 1.00 17.14 ? 138  GLY C N   1 
ATOM   4851 C  CA  . GLY C 1 136 ? -42.732 -23.761 -39.132 1.00 16.89 ? 138  GLY C CA  1 
ATOM   4852 C  C   . GLY C 1 136 ? -43.685 -22.632 -38.802 1.00 16.35 ? 138  GLY C C   1 
ATOM   4853 O  O   . GLY C 1 136 ? -43.247 -21.578 -38.326 1.00 16.09 ? 138  GLY C O   1 
ATOM   4854 N  N   . GLY C 1 137 ? -44.991 -22.836 -39.013 1.00 15.07 ? 139  GLY C N   1 
ATOM   4855 C  CA  . GLY C 1 137 ? -45.968 -21.816 -38.730 1.00 14.26 ? 139  GLY C CA  1 
ATOM   4856 C  C   . GLY C 1 137 ? -46.021 -21.505 -37.234 1.00 14.78 ? 139  GLY C C   1 
ATOM   4857 O  O   . GLY C 1 137 ? -46.136 -20.340 -36.836 1.00 12.99 ? 139  GLY C O   1 
ATOM   4858 N  N   . LEU C 1 138 ? -45.978 -22.569 -36.425 1.00 14.91 ? 140  LEU C N   1 
ATOM   4859 C  CA  . LEU C 1 138 ? -45.891 -22.476 -34.975 1.00 15.29 ? 140  LEU C CA  1 
ATOM   4860 C  C   . LEU C 1 138 ? -44.580 -23.092 -34.511 1.00 14.93 ? 140  LEU C C   1 
ATOM   4861 O  O   . LEU C 1 138 ? -44.058 -24.037 -35.129 1.00 13.81 ? 140  LEU C O   1 
ATOM   4862 C  CB  . LEU C 1 138 ? -47.056 -23.213 -34.295 1.00 16.66 ? 140  LEU C CB  1 
ATOM   4863 C  CG  . LEU C 1 138 ? -48.457 -22.777 -34.684 1.00 18.46 ? 140  LEU C CG  1 
ATOM   4864 C  CD1 . LEU C 1 138 ? -49.503 -23.583 -33.899 1.00 19.99 ? 140  LEU C CD1 1 
ATOM   4865 C  CD2 . LEU C 1 138 ? -48.642 -21.275 -34.500 1.00 18.79 ? 140  LEU C CD2 1 
ATOM   4866 N  N   . ALA C 1 139 ? -44.065 -22.546 -33.410 1.00 15.05 ? 141  ALA C N   1 
ATOM   4867 C  CA  . ALA C 1 139 ? -42.865 -23.042 -32.766 1.00 14.71 ? 141  ALA C CA  1 
ATOM   4868 C  C   . ALA C 1 139 ? -43.088 -23.029 -31.262 1.00 15.04 ? 141  ALA C C   1 
ATOM   4869 O  O   . ALA C 1 139 ? -43.568 -22.034 -30.715 1.00 15.35 ? 141  ALA C O   1 
ATOM   4870 C  CB  . ALA C 1 139 ? -41.671 -22.179 -33.142 1.00 14.36 ? 141  ALA C CB  1 
ATOM   4871 N  N   . VAL C 1 140 ? -42.780 -24.142 -30.604 1.00 15.26 ? 142  VAL C N   1 
ATOM   4872 C  CA  . VAL C 1 140 ? -42.984 -24.260 -29.167 1.00 15.32 ? 142  VAL C CA  1 
ATOM   4873 C  C   . VAL C 1 140 ? -41.623 -24.461 -28.529 1.00 15.89 ? 142  VAL C C   1 
ATOM   4874 O  O   . VAL C 1 140 ? -40.826 -25.293 -28.988 1.00 16.09 ? 142  VAL C O   1 
ATOM   4875 C  CB  . VAL C 1 140 ? -43.965 -25.402 -28.785 1.00 15.83 ? 142  VAL C CB  1 
ATOM   4876 C  CG1 . VAL C 1 140 ? -44.244 -25.391 -27.281 1.00 16.42 ? 142  VAL C CG1 1 
ATOM   4877 C  CG2 . VAL C 1 140 ? -45.270 -25.257 -29.559 1.00 15.82 ? 142  VAL C CG2 1 
ATOM   4878 N  N   . LEU C 1 141 ? -41.349 -23.667 -27.497 1.00 16.24 ? 143  LEU C N   1 
ATOM   4879 C  CA  . LEU C 1 141 ? -40.192 -23.887 -26.648 1.00 16.37 ? 143  LEU C CA  1 
ATOM   4880 C  C   . LEU C 1 141 ? -40.676 -24.682 -25.471 1.00 15.95 ? 143  LEU C C   1 
ATOM   4881 O  O   . LEU C 1 141 ? -41.628 -24.269 -24.797 1.00 16.26 ? 143  LEU C O   1 
ATOM   4882 C  CB  . LEU C 1 141 ? -39.607 -22.565 -26.154 1.00 17.05 ? 143  LEU C CB  1 
ATOM   4883 C  CG  . LEU C 1 141 ? -39.143 -21.602 -27.254 1.00 17.17 ? 143  LEU C CG  1 
ATOM   4884 C  CD1 . LEU C 1 141 ? -38.457 -20.402 -26.609 1.00 17.77 ? 143  LEU C CD1 1 
ATOM   4885 C  CD2 . LEU C 1 141 ? -38.203 -22.295 -28.227 1.00 17.64 ? 143  LEU C CD2 1 
ATOM   4886 N  N   . ALA C 1 142 ? -40.012 -25.811 -25.236 1.00 15.35 ? 144  ALA C N   1 
ATOM   4887 C  CA  . ALA C 1 142 ? -40.348 -26.730 -24.156 1.00 15.40 ? 144  ALA C CA  1 
ATOM   4888 C  C   . ALA C 1 142 ? -39.189 -26.890 -23.193 1.00 16.32 ? 144  ALA C C   1 
ATOM   4889 O  O   . ALA C 1 142 ? -38.056 -27.100 -23.632 1.00 15.67 ? 144  ALA C O   1 
ATOM   4890 C  CB  . ALA C 1 142 ? -40.689 -28.086 -24.723 1.00 15.11 ? 144  ALA C CB  1 
ATOM   4891 N  N   . ALA C 1 143 ? -39.497 -26.861 -21.894 1.00 16.65 ? 145  ALA C N   1 
ATOM   4892 C  CA  . ALA C 1 143 ? -38.523 -27.173 -20.843 1.00 17.66 ? 145  ALA C CA  1 
ATOM   4893 C  C   . ALA C 1 143 ? -39.113 -28.118 -19.798 1.00 17.81 ? 145  ALA C C   1 
ATOM   4894 O  O   . ALA C 1 143 ? -40.270 -27.979 -19.406 1.00 17.92 ? 145  ALA C O   1 
ATOM   4895 C  CB  . ALA C 1 143 ? -38.026 -25.902 -20.169 1.00 17.27 ? 145  ALA C CB  1 
ATOM   4896 N  N   . PHE C 1 144 ? -38.298 -29.054 -19.339 1.00 19.36 ? 146  PHE C N   1 
ATOM   4897 C  CA  . PHE C 1 144 ? -38.682 -29.940 -18.234 1.00 20.98 ? 146  PHE C CA  1 
ATOM   4898 C  C   . PHE C 1 144 ? -38.562 -29.249 -16.890 1.00 21.68 ? 146  PHE C C   1 
ATOM   4899 O  O   . PHE C 1 144 ? -37.627 -28.479 -16.669 1.00 21.56 ? 146  PHE C O   1 
ATOM   4900 C  CB  . PHE C 1 144 ? -37.788 -31.175 -18.209 1.00 21.49 ? 146  PHE C CB  1 
ATOM   4901 C  CG  . PHE C 1 144 ? -37.856 -31.991 -19.457 1.00 21.33 ? 146  PHE C CG  1 
ATOM   4902 C  CD1 . PHE C 1 144 ? -39.068 -32.541 -19.880 1.00 22.15 ? 146  PHE C CD1 1 
ATOM   4903 C  CD2 . PHE C 1 144 ? -36.719 -32.210 -20.219 1.00 21.60 ? 146  PHE C CD2 1 
ATOM   4904 C  CE1 . PHE C 1 144 ? -39.121 -33.297 -21.036 1.00 22.06 ? 146  PHE C CE1 1 
ATOM   4905 C  CE2 . PHE C 1 144 ? -36.765 -32.967 -21.374 1.00 21.35 ? 146  PHE C CE2 1 
ATOM   4906 C  CZ  . PHE C 1 144 ? -37.965 -33.517 -21.779 1.00 21.74 ? 146  PHE C CZ  1 
ATOM   4907 N  N   . LEU C 1 145 ? -39.499 -29.551 -15.993 1.00 23.48 ? 147  LEU C N   1 
ATOM   4908 C  CA  . LEU C 1 145 ? -39.461 -29.083 -14.617 1.00 24.83 ? 147  LEU C CA  1 
ATOM   4909 C  C   . LEU C 1 145 ? -39.193 -30.299 -13.729 1.00 27.50 ? 147  LEU C C   1 
ATOM   4910 O  O   . LEU C 1 145 ? -39.921 -31.303 -13.803 1.00 27.77 ? 147  LEU C O   1 
ATOM   4911 C  CB  . LEU C 1 145 ? -40.771 -28.424 -14.201 1.00 24.67 ? 147  LEU C CB  1 
ATOM   4912 C  CG  . LEU C 1 145 ? -41.471 -27.418 -15.114 1.00 25.40 ? 147  LEU C CG  1 
ATOM   4913 C  CD1 . LEU C 1 145 ? -42.613 -26.771 -14.356 1.00 25.63 ? 147  LEU C CD1 1 
ATOM   4914 C  CD2 . LEU C 1 145 ? -40.531 -26.360 -15.651 1.00 25.52 ? 147  LEU C CD2 1 
ATOM   4915 N  N   . GLU C 1 146 ? -38.141 -30.192 -12.912 1.00 30.17 ? 148  GLU C N   1 
ATOM   4916 C  CA  . GLU C 1 146 ? -37.675 -31.237 -11.993 1.00 30.40 ? 148  GLU C CA  1 
ATOM   4917 C  C   . GLU C 1 146 ? -37.772 -30.720 -10.568 1.00 29.85 ? 148  GLU C C   1 
ATOM   4918 O  O   . GLU C 1 146 ? -37.923 -29.521 -10.336 1.00 28.36 ? 148  GLU C O   1 
ATOM   4919 C  CB  . GLU C 1 146 ? -36.197 -31.569 -12.255 1.00 33.28 ? 148  GLU C CB  1 
ATOM   4920 C  CG  . GLU C 1 146 ? -35.947 -32.452 -13.450 1.00 35.29 ? 148  GLU C CG  1 
ATOM   4921 C  CD  . GLU C 1 146 ? -34.512 -32.929 -13.532 1.00 35.81 ? 148  GLU C CD  1 
ATOM   4922 O  OE1 . GLU C 1 146 ? -33.577 -32.085 -13.498 1.00 37.50 ? 148  GLU C OE1 1 
ATOM   4923 O  OE2 . GLU C 1 146 ? -34.328 -34.152 -13.658 1.00 35.44 ? 148  GLU C OE2 1 
ATOM   4924 N  N   . GLU C 1 147 ? -37.681 -31.636 -9.612  1.00 30.76 ? 149  GLU C N   1 
ATOM   4925 C  CA  . GLU C 1 147 ? -37.681 -31.259 -8.205  1.00 32.36 ? 149  GLU C CA  1 
ATOM   4926 C  C   . GLU C 1 147 ? -36.271 -30.849 -7.806  1.00 31.59 ? 149  GLU C C   1 
ATOM   4927 O  O   . GLU C 1 147 ? -35.307 -31.569 -8.095  1.00 31.43 ? 149  GLU C O   1 
ATOM   4928 C  CB  . GLU C 1 147 ? -38.158 -32.393 -7.303  1.00 33.24 ? 149  GLU C CB  1 
ATOM   4929 C  CG  . GLU C 1 147 ? -38.434 -31.929 -5.876  1.00 36.94 ? 149  GLU C CG  1 
ATOM   4930 C  CD  . GLU C 1 147 ? -38.578 -33.082 -4.903  1.00 39.82 ? 149  GLU C CD  1 
ATOM   4931 O  OE1 . GLU C 1 147 ? -39.410 -33.972 -5.150  1.00 42.74 ? 149  GLU C OE1 1 
ATOM   4932 O  OE2 . GLU C 1 147 ? -37.856 -33.092 -3.894  1.00 44.31 ? 149  GLU C OE2 1 
ATOM   4933 N  N   . GLY C 1 148 ? -36.171 -29.697 -7.147  1.00 31.46 ? 150  GLY C N   1 
ATOM   4934 C  CA  . GLY C 1 148 ? -34.931 -29.243 -6.516  1.00 32.84 ? 150  GLY C CA  1 
ATOM   4935 C  C   . GLY C 1 148 ? -35.164 -28.765 -5.084  1.00 34.43 ? 150  GLY C C   1 
ATOM   4936 O  O   . GLY C 1 148 ? -36.313 -28.645 -4.635  1.00 35.68 ? 150  GLY C O   1 
ATOM   4937 N  N   . PRO C 1 149 ? -34.076 -28.485 -4.348  1.00 36.02 ? 151  PRO C N   1 
ATOM   4938 C  CA  . PRO C 1 149 ? -34.234 -28.101 -2.931  1.00 36.12 ? 151  PRO C CA  1 
ATOM   4939 C  C   . PRO C 1 149 ? -34.770 -26.695 -2.664  1.00 35.87 ? 151  PRO C C   1 
ATOM   4940 O  O   . PRO C 1 149 ? -35.242 -26.445 -1.563  1.00 35.18 ? 151  PRO C O   1 
ATOM   4941 C  CB  . PRO C 1 149 ? -32.819 -28.257 -2.362  1.00 36.99 ? 151  PRO C CB  1 
ATOM   4942 C  CG  . PRO C 1 149 ? -31.910 -28.153 -3.543  1.00 37.99 ? 151  PRO C CG  1 
ATOM   4943 C  CD  . PRO C 1 149 ? -32.666 -28.699 -4.718  1.00 35.99 ? 151  PRO C CD  1 
ATOM   4944 N  N   . GLU C 1 150 ? -34.696 -25.779 -3.631  1.00 35.74 ? 152  GLU C N   1 
ATOM   4945 C  CA  . GLU C 1 150 ? -35.112 -24.396 -3.400  1.00 35.62 ? 152  GLU C CA  1 
ATOM   4946 C  C   . GLU C 1 150 ? -36.443 -24.102 -4.036  1.00 34.97 ? 152  GLU C C   1 
ATOM   4947 O  O   . GLU C 1 150 ? -36.791 -24.690 -5.066  1.00 33.05 ? 152  GLU C O   1 
ATOM   4948 C  CB  . GLU C 1 150 ? -34.103 -23.419 -3.986  1.00 39.59 ? 152  GLU C CB  1 
ATOM   4949 C  CG  . GLU C 1 150 ? -32.802 -23.308 -3.225  1.00 44.62 ? 152  GLU C CG  1 
ATOM   4950 C  CD  . GLU C 1 150 ? -31.819 -22.383 -3.930  1.00 50.60 ? 152  GLU C CD  1 
ATOM   4951 O  OE1 . GLU C 1 150 ? -32.155 -21.182 -4.110  1.00 53.77 ? 152  GLU C OE1 1 
ATOM   4952 O  OE2 . GLU C 1 150 ? -30.725 -22.865 -4.326  1.00 50.44 ? 152  GLU C OE2 1 
ATOM   4953 N  N   . GLU C 1 151 ? -37.159 -23.160 -3.433  1.00 32.70 ? 153  GLU C N   1 
ATOM   4954 C  CA  . GLU C 1 151 ? -38.338 -22.589 -4.031  1.00 33.41 ? 153  GLU C CA  1 
ATOM   4955 C  C   . GLU C 1 151 ? -37.904 -21.776 -5.263  1.00 30.90 ? 153  GLU C C   1 
ATOM   4956 O  O   . GLU C 1 151 ? -36.978 -20.948 -5.197  1.00 29.91 ? 153  GLU C O   1 
ATOM   4957 C  CB  . GLU C 1 151 ? -39.088 -21.713 -3.017  1.00 37.15 ? 153  GLU C CB  1 
ATOM   4958 C  CG  . GLU C 1 151 ? -40.236 -20.925 -3.627  1.00 43.25 ? 153  GLU C CG  1 
ATOM   4959 C  CD  . GLU C 1 151 ? -41.322 -20.525 -2.639  1.00 47.70 ? 153  GLU C CD  1 
ATOM   4960 O  OE1 . GLU C 1 151 ? -41.888 -21.434 -1.994  1.00 49.59 ? 153  GLU C OE1 1 
ATOM   4961 O  OE2 . GLU C 1 151 ? -41.635 -19.311 -2.530  1.00 46.47 ? 153  GLU C OE2 1 
ATOM   4962 N  N   . ASN C 1 152 ? -38.543 -22.052 -6.397  1.00 26.77 ? 154  ASN C N   1 
ATOM   4963 C  CA  . ASN C 1 152 ? -38.301 -21.304 -7.622  1.00 24.77 ? 154  ASN C CA  1 
ATOM   4964 C  C   . ASN C 1 152 ? -39.078 -20.021 -7.593  1.00 24.98 ? 154  ASN C C   1 
ATOM   4965 O  O   . ASN C 1 152 ? -40.313 -20.035 -7.556  1.00 26.43 ? 154  ASN C O   1 
ATOM   4966 C  CB  . ASN C 1 152 ? -38.717 -22.121 -8.849  1.00 23.10 ? 154  ASN C CB  1 
ATOM   4967 C  CG  . ASN C 1 152 ? -38.303 -21.457 -10.145 1.00 20.64 ? 154  ASN C CG  1 
ATOM   4968 O  OD1 . ASN C 1 152 ? -38.711 -20.328 -10.417 1.00 20.93 ? 154  ASN C OD1 1 
ATOM   4969 N  ND2 . ASN C 1 152 ? -37.516 -22.159 -10.962 1.00 19.32 ? 154  ASN C ND2 1 
ATOM   4970 N  N   . SER C 1 153 ? -38.371 -18.906 -7.662  1.00 24.67 ? 155  SER C N   1 
ATOM   4971 C  CA  . SER C 1 153 ? -39.021 -17.623 -7.474  1.00 26.08 ? 155  SER C CA  1 
ATOM   4972 C  C   . SER C 1 153 ? -39.867 -17.204 -8.705  1.00 25.53 ? 155  SER C C   1 
ATOM   4973 O  O   . SER C 1 153 ? -40.945 -16.626 -8.544  1.00 23.80 ? 155  SER C O   1 
ATOM   4974 C  CB  . SER C 1 153 ? -37.982 -16.570 -7.077  1.00 28.34 ? 155  SER C CB  1 
ATOM   4975 O  OG  . SER C 1 153 ? -37.261 -16.189 -8.203  1.00 33.20 ? 155  SER C OG  1 
ATOM   4976 N  N   . ALA C 1 154 ? -39.404 -17.509 -9.921  1.00 23.69 ? 156  ALA C N   1 
ATOM   4977 C  CA  . ALA C 1 154 ? -40.181 -17.213 -11.135 1.00 22.96 ? 156  ALA C CA  1 
ATOM   4978 C  C   . ALA C 1 154 ? -41.504 -18.001 -11.184 1.00 22.09 ? 156  ALA C C   1 
ATOM   4979 O  O   . ALA C 1 154 ? -42.552 -17.437 -11.428 1.00 22.32 ? 156  ALA C O   1 
ATOM   4980 C  CB  . ALA C 1 154 ? -39.364 -17.506 -12.372 1.00 22.32 ? 156  ALA C CB  1 
ATOM   4981 N  N   . TYR C 1 155 ? -41.437 -19.286 -10.898 1.00 22.29 ? 157  TYR C N   1 
ATOM   4982 C  CA  . TYR C 1 155 ? -42.637 -20.130 -10.926 1.00 22.73 ? 157  TYR C CA  1 
ATOM   4983 C  C   . TYR C 1 155 ? -43.598 -19.800 -9.798  1.00 24.35 ? 157  TYR C C   1 
ATOM   4984 O  O   . TYR C 1 155 ? -44.815 -19.926 -9.966  1.00 23.69 ? 157  TYR C O   1 
ATOM   4985 C  CB  . TYR C 1 155 ? -42.245 -21.604 -10.946 1.00 22.22 ? 157  TYR C CB  1 
ATOM   4986 C  CG  . TYR C 1 155 ? -41.850 -22.019 -12.340 1.00 21.82 ? 157  TYR C CG  1 
ATOM   4987 C  CD1 . TYR C 1 155 ? -40.562 -21.807 -12.819 1.00 21.07 ? 157  TYR C CD1 1 
ATOM   4988 C  CD2 . TYR C 1 155 ? -42.798 -22.562 -13.212 1.00 20.82 ? 157  TYR C CD2 1 
ATOM   4989 C  CE1 . TYR C 1 155 ? -40.212 -22.161 -14.108 1.00 20.41 ? 157  TYR C CE1 1 
ATOM   4990 C  CE2 . TYR C 1 155 ? -42.459 -22.914 -14.505 1.00 20.46 ? 157  TYR C CE2 1 
ATOM   4991 C  CZ  . TYR C 1 155 ? -41.173 -22.713 -14.957 1.00 20.31 ? 157  TYR C CZ  1 
ATOM   4992 O  OH  . TYR C 1 155 ? -40.859 -23.065 -16.256 1.00 20.13 ? 157  TYR C OH  1 
ATOM   4993 N  N   . GLU C 1 156 ? -43.063 -19.324 -8.671  1.00 25.17 ? 158  GLU C N   1 
ATOM   4994 C  CA  . GLU C 1 156 ? -43.902 -18.890 -7.540  1.00 26.22 ? 158  GLU C CA  1 
ATOM   4995 C  C   . GLU C 1 156 ? -44.939 -17.856 -7.926  1.00 25.14 ? 158  GLU C C   1 
ATOM   4996 O  O   . GLU C 1 156 ? -46.047 -17.888 -7.405  1.00 25.63 ? 158  GLU C O   1 
ATOM   4997 C  CB  . GLU C 1 156 ? -43.047 -18.355 -6.365  1.00 28.89 ? 158  GLU C CB  1 
ATOM   4998 C  CG  . GLU C 1 156 ? -43.835 -17.996 -5.098  1.00 31.07 ? 158  GLU C CG  1 
ATOM   4999 C  CD  . GLU C 1 156 ? -44.579 -19.182 -4.486  1.00 32.51 ? 158  GLU C CD  1 
ATOM   5000 O  OE1 . GLU C 1 156 ? -44.343 -20.370 -4.863  1.00 33.77 ? 158  GLU C OE1 1 
ATOM   5001 O  OE2 . GLU C 1 156 ? -45.411 -18.913 -3.596  1.00 39.56 ? 158  GLU C OE2 1 
ATOM   5002 N  N   . GLN C 1 157 ? -44.595 -16.954 -8.844  1.00 24.49 ? 159  GLN C N   1 
ATOM   5003 C  CA  . GLN C 1 157 ? -45.545 -15.958 -9.335  1.00 24.26 ? 159  GLN C CA  1 
ATOM   5004 C  C   . GLN C 1 157 ? -46.820 -16.554 -9.985  1.00 25.50 ? 159  GLN C C   1 
ATOM   5005 O  O   . GLN C 1 157 ? -47.878 -15.915 -9.981  1.00 25.61 ? 159  GLN C O   1 
ATOM   5006 C  CB  . GLN C 1 157 ? -44.870 -15.058 -10.355 1.00 24.36 ? 159  GLN C CB  1 
ATOM   5007 C  CG  . GLN C 1 157 ? -43.790 -14.156 -9.777  1.00 24.64 ? 159  GLN C CG  1 
ATOM   5008 C  CD  . GLN C 1 157 ? -42.880 -13.635 -10.866 1.00 23.65 ? 159  GLN C CD  1 
ATOM   5009 O  OE1 . GLN C 1 157 ? -42.314 -14.426 -11.628 1.00 25.13 ? 159  GLN C OE1 1 
ATOM   5010 N  NE2 . GLN C 1 157 ? -42.734 -12.328 -10.959 1.00 23.07 ? 159  GLN C NE2 1 
ATOM   5011 N  N   . LEU C 1 158 ? -46.701 -17.742 -10.565 1.00 24.55 ? 160  LEU C N   1 
ATOM   5012 C  CA  . LEU C 1 158 ? -47.824 -18.408 -11.206 1.00 25.56 ? 160  LEU C CA  1 
ATOM   5013 C  C   . LEU C 1 158 ? -48.473 -19.390 -10.241 1.00 25.04 ? 160  LEU C C   1 
ATOM   5014 O  O   . LEU C 1 158 ? -49.680 -19.423 -10.123 1.00 24.46 ? 160  LEU C O   1 
ATOM   5015 C  CB  . LEU C 1 158 ? -47.366 -19.147 -12.467 1.00 25.39 ? 160  LEU C CB  1 
ATOM   5016 C  CG  . LEU C 1 158 ? -46.721 -18.294 -13.566 1.00 26.12 ? 160  LEU C CG  1 
ATOM   5017 C  CD1 . LEU C 1 158 ? -46.360 -19.139 -14.774 1.00 26.22 ? 160  LEU C CD1 1 
ATOM   5018 C  CD2 . LEU C 1 158 ? -47.609 -17.143 -13.993 1.00 27.79 ? 160  LEU C CD2 1 
ATOM   5019 N  N   . LEU C 1 159 ? -47.659 -20.158 -9.538  1.00 25.62 ? 161  LEU C N   1 
ATOM   5020 C  CA  . LEU C 1 159 ? -48.161 -21.206 -8.638  1.00 27.53 ? 161  LEU C CA  1 
ATOM   5021 C  C   . LEU C 1 159 ? -48.965 -20.646 -7.468  1.00 28.67 ? 161  LEU C C   1 
ATOM   5022 O  O   . LEU C 1 159 ? -49.971 -21.228 -7.069  1.00 31.46 ? 161  LEU C O   1 
ATOM   5023 C  CB  . LEU C 1 159 ? -47.023 -22.075 -8.131  1.00 26.22 ? 161  LEU C CB  1 
ATOM   5024 C  CG  . LEU C 1 159 ? -46.264 -22.827 -9.229  1.00 26.79 ? 161  LEU C CG  1 
ATOM   5025 C  CD1 . LEU C 1 159 ? -45.066 -23.517 -8.612  1.00 27.15 ? 161  LEU C CD1 1 
ATOM   5026 C  CD2 . LEU C 1 159 ? -47.142 -23.823 -9.981  1.00 28.49 ? 161  LEU C CD2 1 
ATOM   5027 N  N   . SER C 1 160 ? -48.557 -19.485 -6.977  1.00 28.51 ? 162  SER C N   1 
ATOM   5028 C  CA  . SER C 1 160 ? -49.269 -18.813 -5.897  1.00 29.78 ? 162  SER C CA  1 
ATOM   5029 C  C   . SER C 1 160 ? -50.649 -18.287 -6.312  1.00 30.05 ? 162  SER C C   1 
ATOM   5030 O  O   . SER C 1 160 ? -51.426 -17.923 -5.448  1.00 29.34 ? 162  SER C O   1 
ATOM   5031 C  CB  . SER C 1 160 ? -48.412 -17.671 -5.320  1.00 28.24 ? 162  SER C CB  1 
ATOM   5032 O  OG  . SER C 1 160 ? -48.370 -16.552 -6.193  1.00 27.98 ? 162  SER C OG  1 
ATOM   5033 N  N   . ARG C 1 161 ? -50.942 -18.231 -7.614  1.00 31.52 ? 163  ARG C N   1 
ATOM   5034 C  CA  . ARG C 1 161 ? -52.225 -17.754 -8.107  1.00 32.16 ? 163  ARG C CA  1 
ATOM   5035 C  C   . ARG C 1 161 ? -53.181 -18.866 -8.538  1.00 31.91 ? 163  ARG C C   1 
ATOM   5036 O  O   . ARG C 1 161 ? -54.284 -18.564 -9.010  1.00 31.91 ? 163  ARG C O   1 
ATOM   5037 C  CB  . ARG C 1 161 ? -52.022 -16.789 -9.292  1.00 34.93 ? 163  ARG C CB  1 
ATOM   5038 C  CG  . ARG C 1 161 ? -51.077 -15.623 -9.042  1.00 37.10 ? 163  ARG C CG  1 
ATOM   5039 C  CD  . ARG C 1 161 ? -51.406 -14.867 -7.771  1.00 40.18 ? 163  ARG C CD  1 
ATOM   5040 N  NE  . ARG C 1 161 ? -51.312 -13.423 -7.941  1.00 45.25 ? 163  ARG C NE  1 
ATOM   5041 C  CZ  . ARG C 1 161 ? -52.313 -12.614 -8.309  1.00 49.79 ? 163  ARG C CZ  1 
ATOM   5042 N  NH1 . ARG C 1 161 ? -53.537 -13.072 -8.567  1.00 48.96 ? 163  ARG C NH1 1 
ATOM   5043 N  NH2 . ARG C 1 161 ? -52.086 -11.310 -8.424  1.00 53.13 ? 163  ARG C NH2 1 
ATOM   5044 N  N   . LEU C 1 162 ? -52.784 -20.131 -8.394  1.00 30.33 ? 164  LEU C N   1 
ATOM   5045 C  CA  . LEU C 1 162 ? -53.628 -21.232 -8.849  1.00 30.19 ? 164  LEU C CA  1 
ATOM   5046 C  C   . LEU C 1 162 ? -54.907 -21.392 -7.993  1.00 32.75 ? 164  LEU C C   1 
ATOM   5047 O  O   . LEU C 1 162 ? -55.967 -21.703 -8.534  1.00 32.31 ? 164  LEU C O   1 
ATOM   5048 C  CB  . LEU C 1 162 ? -52.831 -22.537 -8.936  1.00 28.28 ? 164  LEU C CB  1 
ATOM   5049 C  CG  . LEU C 1 162 ? -51.652 -22.550 -9.922  1.00 26.94 ? 164  LEU C CG  1 
ATOM   5050 C  CD1 . LEU C 1 162 ? -51.057 -23.936 -10.027 1.00 25.68 ? 164  LEU C CD1 1 
ATOM   5051 C  CD2 . LEU C 1 162 ? -52.053 -22.052 -11.312 1.00 27.52 ? 164  LEU C CD2 1 
ATOM   5052 N  N   . GLU C 1 163 ? -54.814 -21.131 -6.688  1.00 34.34 ? 165  GLU C N   1 
ATOM   5053 C  CA  . GLU C 1 163 ? -55.986 -21.155 -5.799  1.00 35.50 ? 165  GLU C CA  1 
ATOM   5054 C  C   . GLU C 1 163 ? -57.108 -20.243 -6.290  1.00 37.60 ? 165  GLU C C   1 
ATOM   5055 O  O   . GLU C 1 163 ? -58.273 -20.620 -6.231  1.00 42.55 ? 165  GLU C O   1 
ATOM   5056 C  CB  . GLU C 1 163 ? -55.606 -20.793 -4.360  1.00 36.42 ? 165  GLU C CB  1 
ATOM   5057 N  N   . GLU C 1 164 ? -56.768 -19.065 -6.800  1.00 36.41 ? 166  GLU C N   1 
ATOM   5058 C  CA  . GLU C 1 164 ? -57.769 -18.171 -7.380  1.00 36.45 ? 166  GLU C CA  1 
ATOM   5059 C  C   . GLU C 1 164 ? -58.549 -18.715 -8.569  1.00 35.70 ? 166  GLU C C   1 
ATOM   5060 O  O   . GLU C 1 164 ? -59.608 -18.190 -8.894  1.00 36.62 ? 166  GLU C O   1 
ATOM   5061 C  CB  . GLU C 1 164 ? -57.108 -16.907 -7.889  1.00 38.55 ? 166  GLU C CB  1 
ATOM   5062 C  CG  . GLU C 1 164 ? -56.807 -15.915 -6.815  1.00 42.07 ? 166  GLU C CG  1 
ATOM   5063 C  CD  . GLU C 1 164 ? -55.763 -14.943 -7.267  1.00 41.96 ? 166  GLU C CD  1 
ATOM   5064 O  OE1 . GLU C 1 164 ? -55.972 -14.274 -8.301  1.00 44.43 ? 166  GLU C OE1 1 
ATOM   5065 O  OE2 . GLU C 1 164 ? -54.717 -14.880 -6.610  1.00 45.13 ? 166  GLU C OE2 1 
ATOM   5066 N  N   . ILE C 1 165 ? -57.996 -19.695 -9.266  1.00 33.19 ? 167  ILE C N   1 
ATOM   5067 C  CA  . ILE C 1 165 ? -58.582 -20.169 -10.507 1.00 33.30 ? 167  ILE C CA  1 
ATOM   5068 C  C   . ILE C 1 165 ? -58.769 -21.683 -10.458 1.00 31.42 ? 167  ILE C C   1 
ATOM   5069 O  O   . ILE C 1 165 ? -58.739 -22.354 -11.495 1.00 31.17 ? 167  ILE C O   1 
ATOM   5070 C  CB  . ILE C 1 165 ? -57.727 -19.713 -11.723 1.00 31.49 ? 167  ILE C CB  1 
ATOM   5071 C  CG1 . ILE C 1 165 ? -56.292 -20.263 -11.638 1.00 31.10 ? 167  ILE C CG1 1 
ATOM   5072 C  CG2 . ILE C 1 165 ? -57.721 -18.190 -11.797 1.00 31.33 ? 167  ILE C CG2 1 
ATOM   5073 C  CD1 . ILE C 1 165 ? -55.500 -20.151 -12.935 1.00 30.90 ? 167  ILE C CD1 1 
ATOM   5074 N  N   . ALA C 1 166 ? -58.998 -22.211 -9.254  1.00 31.98 ? 168  ALA C N   1 
ATOM   5075 C  CA  . ALA C 1 166 ? -59.102 -23.669 -9.046  1.00 33.37 ? 168  ALA C CA  1 
ATOM   5076 C  C   . ALA C 1 166 ? -60.199 -24.330 -9.901  1.00 34.08 ? 168  ALA C C   1 
ATOM   5077 O  O   . ALA C 1 166 ? -60.006 -25.448 -10.412 1.00 32.83 ? 168  ALA C O   1 
ATOM   5078 C  CB  . ALA C 1 166 ? -59.318 -23.977 -7.569  1.00 33.16 ? 168  ALA C CB  1 
ATOM   5079 N  N   . GLU C 1 167 ? -61.322 -23.625 -10.069 1.00 35.94 ? 169  GLU C N   1 
ATOM   5080 C  CA  . GLU C 1 167 ? -62.462 -24.159 -10.810 1.00 40.70 ? 169  GLU C CA  1 
ATOM   5081 C  C   . GLU C 1 167 ? -62.242 -24.040 -12.317 1.00 39.88 ? 169  GLU C C   1 
ATOM   5082 O  O   . GLU C 1 167 ? -61.774 -23.007 -12.813 1.00 39.32 ? 169  GLU C O   1 
ATOM   5083 C  CB  . GLU C 1 167 ? -63.784 -23.471 -10.409 1.00 43.22 ? 169  GLU C CB  1 
ATOM   5084 C  CG  . GLU C 1 167 ? -64.344 -23.888 -9.043  1.00 49.09 ? 169  GLU C CG  1 
ATOM   5085 C  CD  . GLU C 1 167 ? -64.710 -25.376 -8.944  1.00 54.56 ? 169  GLU C CD  1 
ATOM   5086 O  OE1 . GLU C 1 167 ? -65.216 -25.951 -9.931  1.00 61.13 ? 169  GLU C OE1 1 
ATOM   5087 O  OE2 . GLU C 1 167 ? -64.486 -25.989 -7.876  1.00 57.56 ? 169  GLU C OE2 1 
ATOM   5088 N  N   . GLU C 1 168 ? -62.592 -25.105 -13.032 1.00 38.08 ? 170  GLU C N   1 
ATOM   5089 C  CA  . GLU C 1 168 ? -62.529 -25.129 -14.480 1.00 38.90 ? 170  GLU C CA  1 
ATOM   5090 C  C   . GLU C 1 168 ? -63.207 -23.896 -15.065 1.00 37.34 ? 170  GLU C C   1 
ATOM   5091 O  O   . GLU C 1 168 ? -64.268 -23.476 -14.586 1.00 34.96 ? 170  GLU C O   1 
ATOM   5092 C  CB  . GLU C 1 168 ? -63.208 -26.380 -15.019 1.00 41.30 ? 170  GLU C CB  1 
ATOM   5093 C  CG  . GLU C 1 168 ? -63.247 -26.456 -16.541 1.00 44.55 ? 170  GLU C CG  1 
ATOM   5094 C  CD  . GLU C 1 168 ? -63.914 -27.710 -17.044 1.00 47.19 ? 170  GLU C CD  1 
ATOM   5095 O  OE1 . GLU C 1 168 ? -64.891 -28.144 -16.401 1.00 49.23 ? 170  GLU C OE1 1 
ATOM   5096 O  OE2 . GLU C 1 168 ? -63.469 -28.252 -18.084 1.00 50.34 ? 170  GLU C OE2 1 
ATOM   5097 N  N   . GLY C 1 169 ? -62.568 -23.310 -16.081 1.00 34.21 ? 171  GLY C N   1 
ATOM   5098 C  CA  . GLY C 1 169 ? -63.074 -22.116 -16.741 1.00 31.58 ? 171  GLY C CA  1 
ATOM   5099 C  C   . GLY C 1 169 ? -62.843 -20.787 -16.045 1.00 31.87 ? 171  GLY C C   1 
ATOM   5100 O  O   . GLY C 1 169 ? -63.176 -19.761 -16.618 1.00 33.92 ? 171  GLY C O   1 
ATOM   5101 N  N   . SER C 1 170 ? -62.294 -20.768 -14.828 1.00 30.43 ? 172  SER C N   1 
ATOM   5102 C  CA  . SER C 1 170 ? -62.078 -19.498 -14.131 1.00 32.52 ? 172  SER C CA  1 
ATOM   5103 C  C   . SER C 1 170 ? -60.732 -18.869 -14.552 1.00 34.46 ? 172  SER C C   1 
ATOM   5104 O  O   . SER C 1 170 ? -59.826 -19.558 -15.044 1.00 33.10 ? 172  SER C O   1 
ATOM   5105 C  CB  . SER C 1 170 ? -62.149 -19.667 -12.618 1.00 31.84 ? 172  SER C CB  1 
ATOM   5106 O  OG  . SER C 1 170 ? -61.232 -20.635 -12.173 1.00 34.70 ? 172  SER C OG  1 
ATOM   5107 N  N   . GLU C 1 171 ? -60.633 -17.557 -14.373 1.00 33.28 ? 173  GLU C N   1 
ATOM   5108 C  CA  . GLU C 1 171 ? -59.439 -16.817 -14.721 1.00 34.39 ? 173  GLU C CA  1 
ATOM   5109 C  C   . GLU C 1 171 ? -59.143 -15.687 -13.744 1.00 34.59 ? 173  GLU C C   1 
ATOM   5110 O  O   . GLU C 1 171 ? -60.011 -15.263 -12.974 1.00 33.22 ? 173  GLU C O   1 
ATOM   5111 C  CB  . GLU C 1 171 ? -59.569 -16.270 -16.131 1.00 34.81 ? 173  GLU C CB  1 
ATOM   5112 C  CG  . GLU C 1 171 ? -60.689 -15.272 -16.313 1.00 35.56 ? 173  GLU C CG  1 
ATOM   5113 C  CD  . GLU C 1 171 ? -60.755 -14.816 -17.732 1.00 37.26 ? 173  GLU C CD  1 
ATOM   5114 O  OE1 . GLU C 1 171 ? -61.055 -15.673 -18.582 1.00 40.14 ? 173  GLU C OE1 1 
ATOM   5115 O  OE2 . GLU C 1 171 ? -60.472 -13.631 -18.014 1.00 39.03 ? 173  GLU C OE2 1 
ATOM   5116 N  N   . THR C 1 172 ? -57.904 -15.212 -13.784 1.00 32.55 ? 174  THR C N   1 
ATOM   5117 C  CA  . THR C 1 172 ? -57.478 -14.078 -12.973 1.00 32.35 ? 174  THR C CA  1 
ATOM   5118 C  C   . THR C 1 172 ? -56.409 -13.266 -13.717 1.00 32.51 ? 174  THR C C   1 
ATOM   5119 O  O   . THR C 1 172 ? -55.814 -13.743 -14.679 1.00 33.42 ? 174  THR C O   1 
ATOM   5120 C  CB  . THR C 1 172 ? -56.998 -14.551 -11.581 1.00 32.41 ? 174  THR C CB  1 
ATOM   5121 O  OG1 . THR C 1 172 ? -56.797 -13.421 -10.737 1.00 33.24 ? 174  THR C OG1 1 
ATOM   5122 C  CG2 . THR C 1 172 ? -55.714 -15.370 -11.663 1.00 31.68 ? 174  THR C CG2 1 
ATOM   5123 N  N   . GLN C 1 173 ? -56.247 -12.013 -13.315 1.00 30.65 ? 175  GLN C N   1 
ATOM   5124 C  CA  . GLN C 1 173 ? -55.205 -11.146 -13.828 1.00 30.54 ? 175  GLN C CA  1 
ATOM   5125 C  C   . GLN C 1 173 ? -54.032 -11.208 -12.859 1.00 29.56 ? 175  GLN C C   1 
ATOM   5126 O  O   . GLN C 1 173 ? -54.228 -11.078 -11.663 1.00 29.46 ? 175  GLN C O   1 
ATOM   5127 C  CB  . GLN C 1 173 ? -55.711 -9.717  -13.943 1.00 30.95 ? 175  GLN C CB  1 
ATOM   5128 C  CG  . GLN C 1 173 ? -56.860 -9.556  -14.920 1.00 32.67 ? 175  GLN C CG  1 
ATOM   5129 C  CD  . GLN C 1 173 ? -56.424 -9.714  -16.365 1.00 33.55 ? 175  GLN C CD  1 
ATOM   5130 O  OE1 . GLN C 1 173 ? -55.689 -8.882  -16.897 1.00 36.37 ? 175  GLN C OE1 1 
ATOM   5131 N  NE2 . GLN C 1 173 ? -56.872 -10.782 -17.004 1.00 32.87 ? 175  GLN C NE2 1 
ATOM   5132 N  N   . VAL C 1 174 ? -52.829 -11.451 -13.374 1.00 28.53 ? 176  VAL C N   1 
ATOM   5133 C  CA  . VAL C 1 174 ? -51.609 -11.492 -12.556 1.00 26.89 ? 176  VAL C CA  1 
ATOM   5134 C  C   . VAL C 1 174 ? -50.658 -10.363 -12.966 1.00 26.04 ? 176  VAL C C   1 
ATOM   5135 O  O   . VAL C 1 174 ? -50.717 -9.885  -14.092 1.00 24.21 ? 176  VAL C O   1 
ATOM   5136 C  CB  . VAL C 1 174 ? -50.911 -12.870 -12.619 1.00 27.90 ? 176  VAL C CB  1 
ATOM   5137 C  CG1 . VAL C 1 174 ? -51.926 -13.971 -12.325 1.00 28.39 ? 176  VAL C CG1 1 
ATOM   5138 C  CG2 . VAL C 1 174 ? -50.217 -13.121 -13.964 1.00 26.84 ? 176  VAL C CG2 1 
ATOM   5139 N  N   . PRO C 1 175 ? -49.794 -9.909  -12.045 1.00 26.51 ? 177  PRO C N   1 
ATOM   5140 C  CA  . PRO C 1 175 ? -48.833 -8.883  -12.449 1.00 27.79 ? 177  PRO C CA  1 
ATOM   5141 C  C   . PRO C 1 175 ? -47.866 -9.377  -13.533 1.00 25.50 ? 177  PRO C C   1 
ATOM   5142 O  O   . PRO C 1 175 ? -47.617 -10.573 -13.635 1.00 25.18 ? 177  PRO C O   1 
ATOM   5143 C  CB  . PRO C 1 175 ? -48.064 -8.598  -11.154 1.00 27.69 ? 177  PRO C CB  1 
ATOM   5144 C  CG  . PRO C 1 175 ? -48.996 -8.972  -10.069 1.00 27.84 ? 177  PRO C CG  1 
ATOM   5145 C  CD  . PRO C 1 175 ? -49.732 -10.162 -10.593 1.00 27.38 ? 177  PRO C CD  1 
ATOM   5146 N  N   . GLY C 1 176 ? -47.332 -8.455  -14.322 1.00 26.16 ? 178  GLY C N   1 
ATOM   5147 C  CA  . GLY C 1 176 ? -46.270 -8.778  -15.273 1.00 25.63 ? 178  GLY C CA  1 
ATOM   5148 C  C   . GLY C 1 176 ? -45.096 -9.455  -14.593 1.00 23.88 ? 178  GLY C C   1 
ATOM   5149 O  O   . GLY C 1 176 ? -44.814 -9.210  -13.409 1.00 23.80 ? 178  GLY C O   1 
ATOM   5150 N  N   . LEU C 1 177 ? -44.448 -10.355 -15.325 1.00 22.30 ? 179  LEU C N   1 
ATOM   5151 C  CA  . LEU C 1 177 ? -43.266 -11.067 -14.828 1.00 22.14 ? 179  LEU C CA  1 
ATOM   5152 C  C   . LEU C 1 177 ? -42.264 -11.286 -15.966 1.00 20.66 ? 179  LEU C C   1 
ATOM   5153 O  O   . LEU C 1 177 ? -42.606 -11.180 -17.151 1.00 20.14 ? 179  LEU C O   1 
ATOM   5154 C  CB  . LEU C 1 177 ? -43.650 -12.420 -14.218 1.00 21.74 ? 179  LEU C CB  1 
ATOM   5155 C  CG  . LEU C 1 177 ? -44.310 -13.431 -15.171 1.00 22.83 ? 179  LEU C CG  1 
ATOM   5156 C  CD1 . LEU C 1 177 ? -43.930 -14.871 -14.855 1.00 23.14 ? 179  LEU C CD1 1 
ATOM   5157 C  CD2 . LEU C 1 177 ? -45.830 -13.283 -15.177 1.00 24.57 ? 179  LEU C CD2 1 
ATOM   5158 N  N   . ASP C 1 178 ? -41.040 -11.613 -15.592 1.00 19.62 ? 180  ASP C N   1 
ATOM   5159 C  CA  . ASP C 1 178 ? -40.010 -11.932 -16.563 1.00 19.07 ? 180  ASP C CA  1 
ATOM   5160 C  C   . ASP C 1 178 ? -40.229 -13.351 -17.054 1.00 17.21 ? 180  ASP C C   1 
ATOM   5161 O  O   . ASP C 1 178 ? -39.899 -14.309 -16.389 1.00 16.61 ? 180  ASP C O   1 
ATOM   5162 C  CB  . ASP C 1 178 ? -38.635 -11.778 -15.942 1.00 20.68 ? 180  ASP C CB  1 
ATOM   5163 C  CG  . ASP C 1 178 ? -37.507 -12.063 -16.928 1.00 21.92 ? 180  ASP C CG  1 
ATOM   5164 O  OD1 . ASP C 1 178 ? -37.775 -12.482 -18.076 1.00 21.39 ? 180  ASP C OD1 1 
ATOM   5165 O  OD2 . ASP C 1 178 ? -36.337 -11.879 -16.524 1.00 22.23 ? 180  ASP C OD2 1 
ATOM   5166 N  N   . ILE C 1 179 ? -40.753 -13.460 -18.263 1.00 16.44 ? 181  ILE C N   1 
ATOM   5167 C  CA  . ILE C 1 179 ? -41.100 -14.747 -18.840 1.00 16.66 ? 181  ILE C CA  1 
ATOM   5168 C  C   . ILE C 1 179 ? -39.831 -15.572 -19.101 1.00 16.49 ? 181  ILE C C   1 
ATOM   5169 O  O   . ILE C 1 179 ? -39.832 -16.791 -18.922 1.00 16.29 ? 181  ILE C O   1 
ATOM   5170 C  CB  . ILE C 1 179 ? -41.917 -14.558 -20.157 1.00 16.78 ? 181  ILE C CB  1 
ATOM   5171 C  CG1 . ILE C 1 179 ? -43.197 -13.735 -19.910 1.00 16.93 ? 181  ILE C CG1 1 
ATOM   5172 C  CG2 . ILE C 1 179 ? -42.242 -15.895 -20.824 1.00 16.57 ? 181  ILE C CG2 1 
ATOM   5173 C  CD1 . ILE C 1 179 ? -44.206 -14.360 -18.958 1.00 18.18 ? 181  ILE C CD1 1 
ATOM   5174 N  N   . SER C 1 180 ? -38.737 -14.908 -19.470 1.00 16.23 ? 182  SER C N   1 
ATOM   5175 C  CA  . SER C 1 180 ? -37.461 -15.595 -19.702 1.00 16.53 ? 182  SER C CA  1 
ATOM   5176 C  C   . SER C 1 180 ? -36.912 -16.286 -18.449 1.00 16.22 ? 182  SER C C   1 
ATOM   5177 O  O   . SER C 1 180 ? -36.174 -17.266 -18.557 1.00 17.11 ? 182  SER C O   1 
ATOM   5178 C  CB  . SER C 1 180 ? -36.417 -14.626 -20.299 1.00 16.75 ? 182  SER C CB  1 
ATOM   5179 O  OG  . SER C 1 180 ? -35.949 -13.718 -19.307 1.00 17.55 ? 182  SER C OG  1 
ATOM   5180 N  N   . ALA C 1 181 ? -37.300 -15.824 -17.261 1.00 16.10 ? 183  ALA C N   1 
ATOM   5181 C  CA  . ALA C 1 181 ? -36.840 -16.431 -16.013 1.00 15.68 ? 183  ALA C CA  1 
ATOM   5182 C  C   . ALA C 1 181 ? -37.428 -17.818 -15.762 1.00 16.16 ? 183  ALA C C   1 
ATOM   5183 O  O   . ALA C 1 181 ? -36.903 -18.565 -14.954 1.00 15.90 ? 183  ALA C O   1 
ATOM   5184 C  CB  . ALA C 1 181 ? -37.149 -15.519 -14.841 1.00 16.21 ? 183  ALA C CB  1 
ATOM   5185 N  N   . LEU C 1 182 ? -38.508 -18.162 -16.471 1.00 16.46 ? 184  LEU C N   1 
ATOM   5186 C  CA  . LEU C 1 182 ? -39.111 -19.490 -16.417 1.00 16.40 ? 184  LEU C CA  1 
ATOM   5187 C  C   . LEU C 1 182 ? -38.343 -20.536 -17.190 1.00 17.00 ? 184  LEU C C   1 
ATOM   5188 O  O   . LEU C 1 182 ? -38.680 -21.722 -17.098 1.00 18.30 ? 184  LEU C O   1 
ATOM   5189 C  CB  . LEU C 1 182 ? -40.541 -19.430 -16.936 1.00 16.35 ? 184  LEU C CB  1 
ATOM   5190 C  CG  . LEU C 1 182 ? -41.458 -18.472 -16.171 1.00 17.25 ? 184  LEU C CG  1 
ATOM   5191 C  CD1 . LEU C 1 182 ? -42.736 -18.176 -16.940 1.00 17.17 ? 184  LEU C CD1 1 
ATOM   5192 C  CD2 . LEU C 1 182 ? -41.753 -19.035 -14.787 1.00 17.32 ? 184  LEU C CD2 1 
ATOM   5193 N  N   . LEU C 1 183 ? -37.299 -20.129 -17.913 1.00 16.93 ? 185  LEU C N   1 
ATOM   5194 C  CA  . LEU C 1 183 ? -36.585 -21.009 -18.816 1.00 18.36 ? 185  LEU C CA  1 
ATOM   5195 C  C   . LEU C 1 183 ? -35.174 -21.373 -18.325 1.00 17.79 ? 185  LEU C C   1 
ATOM   5196 O  O   . LEU C 1 183 ? -34.605 -20.665 -17.516 1.00 17.59 ? 185  LEU C O   1 
ATOM   5197 C  CB  . LEU C 1 183 ? -36.517 -20.357 -20.203 1.00 18.59 ? 185  LEU C CB  1 
ATOM   5198 C  CG  . LEU C 1 183 ? -37.903 -20.104 -20.804 1.00 19.92 ? 185  LEU C CG  1 
ATOM   5199 C  CD1 . LEU C 1 183 ? -37.757 -19.385 -22.138 1.00 21.16 ? 185  LEU C CD1 1 
ATOM   5200 C  CD2 . LEU C 1 183 ? -38.686 -21.401 -20.981 1.00 21.32 ? 185  LEU C CD2 1 
ATOM   5201 N  N   . PRO C 1 184 ? -34.611 -22.487 -18.820 1.00 18.43 ? 186  PRO C N   1 
ATOM   5202 C  CA  . PRO C 1 184 ? -33.288 -22.937 -18.387 1.00 18.68 ? 186  PRO C CA  1 
ATOM   5203 C  C   . PRO C 1 184 ? -32.139 -21.964 -18.662 1.00 17.94 ? 186  PRO C C   1 
ATOM   5204 O  O   . PRO C 1 184 ? -32.301 -20.927 -19.299 1.00 16.23 ? 186  PRO C O   1 
ATOM   5205 C  CB  . PRO C 1 184 ? -33.070 -24.227 -19.190 1.00 18.37 ? 186  PRO C CB  1 
ATOM   5206 C  CG  . PRO C 1 184 ? -34.438 -24.672 -19.505 1.00 18.90 ? 186  PRO C CG  1 
ATOM   5207 C  CD  . PRO C 1 184 ? -35.187 -23.425 -19.795 1.00 18.67 ? 186  PRO C CD  1 
ATOM   5208 N  N   . SER C 1 185 ? -30.977 -22.342 -18.171 1.00 18.19 ? 187  SER C N   1 
ATOM   5209 C  CA  . SER C 1 185 ? -29.842 -21.456 -18.193 1.00 18.93 ? 187  SER C CA  1 
ATOM   5210 C  C   . SER C 1 185 ? -29.242 -21.233 -19.580 1.00 17.60 ? 187  SER C C   1 
ATOM   5211 O  O   . SER C 1 185 ? -28.977 -20.102 -19.952 1.00 17.59 ? 187  SER C O   1 
ATOM   5212 C  CB  . SER C 1 185 ? -28.780 -21.917 -17.189 1.00 19.24 ? 187  SER C CB  1 
ATOM   5213 O  OG  . SER C 1 185 ? -27.598 -21.178 -17.439 1.00 22.99 ? 187  SER C OG  1 
ATOM   5214 N  N   . ASP C 1 186 ? -29.103 -22.280 -20.373 1.00 18.06 ? 188  ASP C N   1 
ATOM   5215 C  CA  . ASP C 1 186 ? -28.237 -22.250 -21.539 1.00 18.32 ? 188  ASP C CA  1 
ATOM   5216 C  C   . ASP C 1 186 ? -29.109 -22.377 -22.803 1.00 17.98 ? 188  ASP C C   1 
ATOM   5217 O  O   . ASP C 1 186 ? -29.611 -23.453 -23.137 1.00 18.62 ? 188  ASP C O   1 
ATOM   5218 C  CB  . ASP C 1 186 ? -27.208 -23.365 -21.460 1.00 18.77 ? 188  ASP C CB  1 
ATOM   5219 C  CG  . ASP C 1 186 ? -26.173 -23.302 -22.575 1.00 20.03 ? 188  ASP C CG  1 
ATOM   5220 O  OD1 . ASP C 1 186 ? -26.327 -22.548 -23.561 1.00 19.47 ? 188  ASP C OD1 1 
ATOM   5221 O  OD2 . ASP C 1 186 ? -25.184 -24.044 -22.467 1.00 21.26 ? 188  ASP C OD2 1 
ATOM   5222 N  N   . PHE C 1 187 ? -29.242 -21.261 -23.499 1.00 16.54 ? 189  PHE C N   1 
ATOM   5223 C  CA  . PHE C 1 187 ? -30.057 -21.153 -24.722 1.00 16.77 ? 189  PHE C CA  1 
ATOM   5224 C  C   . PHE C 1 187 ? -29.377 -21.732 -25.967 1.00 16.67 ? 189  PHE C C   1 
ATOM   5225 O  O   . PHE C 1 187 ? -29.991 -21.752 -27.039 1.00 16.25 ? 189  PHE C O   1 
ATOM   5226 C  CB  . PHE C 1 187 ? -30.422 -19.679 -24.978 1.00 15.92 ? 189  PHE C CB  1 
ATOM   5227 C  CG  . PHE C 1 187 ? -31.523 -19.117 -24.105 1.00 15.22 ? 189  PHE C CG  1 
ATOM   5228 C  CD1 . PHE C 1 187 ? -31.994 -19.756 -22.970 1.00 15.28 ? 189  PHE C CD1 1 
ATOM   5229 C  CD2 . PHE C 1 187 ? -32.033 -17.867 -24.407 1.00 15.59 ? 189  PHE C CD2 1 
ATOM   5230 C  CE1 . PHE C 1 187 ? -33.004 -19.194 -22.191 1.00 15.18 ? 189  PHE C CE1 1 
ATOM   5231 C  CE2 . PHE C 1 187 ? -33.048 -17.295 -23.638 1.00 16.03 ? 189  PHE C CE2 1 
ATOM   5232 C  CZ  . PHE C 1 187 ? -33.531 -17.964 -22.527 1.00 15.67 ? 189  PHE C CZ  1 
ATOM   5233 N  N   . SER C 1 188 ? -28.117 -22.160 -25.847 1.00 16.66 ? 190  SER C N   1 
ATOM   5234 C  CA  . SER C 1 188 ? -27.408 -22.825 -26.927 1.00 17.59 ? 190  SER C CA  1 
ATOM   5235 C  C   . SER C 1 188 ? -27.593 -24.344 -26.946 1.00 17.95 ? 190  SER C C   1 
ATOM   5236 O  O   . SER C 1 188 ? -27.160 -24.966 -27.917 1.00 19.74 ? 190  SER C O   1 
ATOM   5237 C  CB  . SER C 1 188 ? -25.905 -22.507 -26.870 1.00 18.79 ? 190  SER C CB  1 
ATOM   5238 O  OG  . SER C 1 188 ? -25.287 -23.238 -25.802 1.00 19.60 ? 190  SER C OG  1 
ATOM   5239 N  N   . ARG C 1 189 ? -28.249 -24.931 -25.931 1.00 18.02 ? 191  ARG C N   1 
ATOM   5240 C  CA  . ARG C 1 189 ? -28.299 -26.400 -25.744 1.00 18.95 ? 191  ARG C CA  1 
ATOM   5241 C  C   . ARG C 1 189 ? -29.724 -26.931 -25.782 1.00 17.79 ? 191  ARG C C   1 
ATOM   5242 O  O   . ARG C 1 189 ? -30.471 -26.837 -24.797 1.00 17.45 ? 191  ARG C O   1 
ATOM   5243 C  CB  . ARG C 1 189 ? -27.635 -26.815 -24.408 1.00 21.28 ? 191  ARG C CB  1 
ATOM   5244 C  CG  . ARG C 1 189 ? -26.113 -26.727 -24.406 1.00 23.52 ? 191  ARG C CG  1 
ATOM   5245 C  CD  . ARG C 1 189 ? -25.524 -27.133 -23.048 1.00 25.28 ? 191  ARG C CD  1 
ATOM   5246 N  NE  . ARG C 1 189 ? -25.623 -28.581 -22.809 1.00 25.89 ? 191  ARG C NE  1 
ATOM   5247 C  CZ  . ARG C 1 189 ? -24.765 -29.502 -23.256 1.00 27.99 ? 191  ARG C CZ  1 
ATOM   5248 N  NH1 . ARG C 1 189 ? -23.706 -29.173 -23.988 1.00 29.16 ? 191  ARG C NH1 1 
ATOM   5249 N  NH2 . ARG C 1 189 ? -24.975 -30.787 -22.970 1.00 29.83 ? 191  ARG C NH2 1 
ATOM   5250 N  N   . TYR C 1 190 ? -30.111 -27.490 -26.927 1.00 17.80 ? 192  TYR C N   1 
ATOM   5251 C  CA  . TYR C 1 190 ? -31.476 -27.964 -27.108 1.00 17.43 ? 192  TYR C CA  1 
ATOM   5252 C  C   . TYR C 1 190 ? -31.596 -29.085 -28.144 1.00 18.03 ? 192  TYR C C   1 
ATOM   5253 O  O   . TYR C 1 190 ? -30.687 -29.333 -28.940 1.00 18.66 ? 192  TYR C O   1 
ATOM   5254 C  CB  . TYR C 1 190 ? -32.396 -26.789 -27.496 1.00 16.17 ? 192  TYR C CB  1 
ATOM   5255 C  CG  . TYR C 1 190 ? -31.975 -26.011 -28.716 1.00 15.45 ? 192  TYR C CG  1 
ATOM   5256 C  CD1 . TYR C 1 190 ? -32.294 -26.454 -30.013 1.00 14.90 ? 192  TYR C CD1 1 
ATOM   5257 C  CD2 . TYR C 1 190 ? -31.260 -24.799 -28.596 1.00 15.79 ? 192  TYR C CD2 1 
ATOM   5258 C  CE1 . TYR C 1 190 ? -31.901 -25.732 -31.142 1.00 14.89 ? 192  TYR C CE1 1 
ATOM   5259 C  CE2 . TYR C 1 190 ? -30.861 -24.079 -29.724 1.00 14.95 ? 192  TYR C CE2 1 
ATOM   5260 C  CZ  . TYR C 1 190 ? -31.191 -24.544 -30.987 1.00 14.60 ? 192  TYR C CZ  1 
ATOM   5261 O  OH  . TYR C 1 190 ? -30.827 -23.826 -32.093 1.00 14.19 ? 192  TYR C OH  1 
ATOM   5262 N  N   . PHE C 1 191 ? -32.742 -29.749 -28.082 1.00 18.57 ? 193  PHE C N   1 
ATOM   5263 C  CA  . PHE C 1 191 ? -33.196 -30.699 -29.083 1.00 18.58 ? 193  PHE C CA  1 
ATOM   5264 C  C   . PHE C 1 191 ? -34.217 -29.996 -29.967 1.00 18.19 ? 193  PHE C C   1 
ATOM   5265 O  O   . PHE C 1 191 ? -34.921 -29.086 -29.505 1.00 18.45 ? 193  PHE C O   1 
ATOM   5266 C  CB  . PHE C 1 191 ? -33.824 -31.926 -28.411 1.00 19.07 ? 193  PHE C CB  1 
ATOM   5267 C  CG  . PHE C 1 191 ? -32.870 -32.668 -27.523 1.00 19.33 ? 193  PHE C CG  1 
ATOM   5268 C  CD1 . PHE C 1 191 ? -31.837 -33.413 -28.075 1.00 20.03 ? 193  PHE C CD1 1 
ATOM   5269 C  CD2 . PHE C 1 191 ? -32.977 -32.584 -26.138 1.00 19.98 ? 193  PHE C CD2 1 
ATOM   5270 C  CE1 . PHE C 1 191 ? -30.933 -34.095 -27.255 1.00 21.35 ? 193  PHE C CE1 1 
ATOM   5271 C  CE2 . PHE C 1 191 ? -32.077 -33.253 -25.315 1.00 20.12 ? 193  PHE C CE2 1 
ATOM   5272 C  CZ  . PHE C 1 191 ? -31.056 -34.003 -25.873 1.00 20.40 ? 193  PHE C CZ  1 
ATOM   5273 N  N   . GLN C 1 192 ? -34.269 -30.393 -31.241 1.00 17.75 ? 194  GLN C N   1 
ATOM   5274 C  CA  . GLN C 1 192 ? -35.231 -29.842 -32.183 1.00 17.97 ? 194  GLN C CA  1 
ATOM   5275 C  C   . GLN C 1 192 ? -35.745 -30.890 -33.176 1.00 18.39 ? 194  GLN C C   1 
ATOM   5276 O  O   . GLN C 1 192 ? -34.984 -31.690 -33.686 1.00 18.25 ? 194  GLN C O   1 
ATOM   5277 C  CB  . GLN C 1 192 ? -34.617 -28.688 -32.946 1.00 17.69 ? 194  GLN C CB  1 
ATOM   5278 C  CG  . GLN C 1 192 ? -35.624 -27.760 -33.590 1.00 17.13 ? 194  GLN C CG  1 
ATOM   5279 C  CD  . GLN C 1 192 ? -34.994 -26.485 -34.104 1.00 16.71 ? 194  GLN C CD  1 
ATOM   5280 O  OE1 . GLN C 1 192 ? -34.397 -26.442 -35.170 1.00 16.65 ? 194  GLN C OE1 1 
ATOM   5281 N  NE2 . GLN C 1 192 ? -35.141 -25.433 -33.346 1.00 16.70 ? 194  GLN C NE2 1 
ATOM   5282 N  N   . TYR C 1 193 ? -37.044 -30.852 -33.441 1.00 18.80 ? 195  TYR C N   1 
ATOM   5283 C  CA  . TYR C 1 193 ? -37.679 -31.696 -34.469 1.00 19.01 ? 195  TYR C CA  1 
ATOM   5284 C  C   . TYR C 1 193 ? -39.016 -31.049 -34.855 1.00 20.19 ? 195  TYR C C   1 
ATOM   5285 O  O   . TYR C 1 193 ? -39.483 -30.121 -34.188 1.00 19.71 ? 195  TYR C O   1 
ATOM   5286 C  CB  . TYR C 1 193 ? -37.912 -33.122 -33.931 1.00 18.35 ? 195  TYR C CB  1 
ATOM   5287 C  CG  . TYR C 1 193 ? -39.055 -33.246 -32.952 1.00 18.27 ? 195  TYR C CG  1 
ATOM   5288 C  CD1 . TYR C 1 193 ? -38.898 -32.868 -31.615 1.00 18.28 ? 195  TYR C CD1 1 
ATOM   5289 C  CD2 . TYR C 1 193 ? -40.303 -33.743 -33.349 1.00 18.61 ? 195  TYR C CD2 1 
ATOM   5290 C  CE1 . TYR C 1 193 ? -39.945 -32.955 -30.719 1.00 17.11 ? 195  TYR C CE1 1 
ATOM   5291 C  CE2 . TYR C 1 193 ? -41.355 -33.851 -32.440 1.00 18.20 ? 195  TYR C CE2 1 
ATOM   5292 C  CZ  . TYR C 1 193 ? -41.152 -33.463 -31.125 1.00 17.42 ? 195  TYR C CZ  1 
ATOM   5293 O  OH  . TYR C 1 193 ? -42.183 -33.503 -30.217 1.00 17.26 ? 195  TYR C OH  1 
ATOM   5294 N  N   . GLU C 1 194 ? -39.639 -31.555 -35.911 1.00 20.54 ? 196  GLU C N   1 
ATOM   5295 C  CA  . GLU C 1 194 ? -40.933 -31.051 -36.342 1.00 21.65 ? 196  GLU C CA  1 
ATOM   5296 C  C   . GLU C 1 194 ? -41.990 -32.071 -35.991 1.00 20.49 ? 196  GLU C C   1 
ATOM   5297 O  O   . GLU C 1 194 ? -41.822 -33.259 -36.250 1.00 20.68 ? 196  GLU C O   1 
ATOM   5298 C  CB  . GLU C 1 194 ? -40.910 -30.773 -37.845 1.00 24.96 ? 196  GLU C CB  1 
ATOM   5299 C  CG  . GLU C 1 194 ? -42.099 -29.959 -38.328 1.00 28.68 ? 196  GLU C CG  1 
ATOM   5300 C  CD  . GLU C 1 194 ? -41.922 -29.450 -39.756 1.00 33.78 ? 196  GLU C CD  1 
ATOM   5301 O  OE1 . GLU C 1 194 ? -40.802 -28.989 -40.112 1.00 37.59 ? 196  GLU C OE1 1 
ATOM   5302 O  OE2 . GLU C 1 194 ? -42.905 -29.522 -40.524 1.00 34.06 ? 196  GLU C OE2 1 
ATOM   5303 N  N   . GLY C 1 195 ? -43.072 -31.614 -35.375 1.00 19.16 ? 197  GLY C N   1 
ATOM   5304 C  CA  . GLY C 1 195 ? -44.156 -32.492 -34.971 1.00 18.83 ? 197  GLY C CA  1 
ATOM   5305 C  C   . GLY C 1 195 ? -45.463 -31.744 -34.972 1.00 18.62 ? 197  GLY C C   1 
ATOM   5306 O  O   . GLY C 1 195 ? -45.745 -31.015 -35.924 1.00 19.09 ? 197  GLY C O   1 
ATOM   5307 N  N   . SER C 1 196 ? -46.235 -31.889 -33.895 1.00 18.88 ? 198  SER C N   1 
ATOM   5308 C  CA  . SER C 1 196 ? -47.624 -31.449 -33.854 1.00 18.91 ? 198  SER C CA  1 
ATOM   5309 C  C   . SER C 1 196 ? -48.002 -30.757 -32.551 1.00 19.90 ? 198  SER C C   1 
ATOM   5310 O  O   . SER C 1 196 ? -47.265 -30.800 -31.565 1.00 20.34 ? 198  SER C O   1 
ATOM   5311 C  CB  . SER C 1 196 ? -48.546 -32.683 -34.034 1.00 19.28 ? 198  SER C CB  1 
ATOM   5312 O  OG  . SER C 1 196 ? -48.664 -33.485 -32.848 1.00 18.31 ? 198  SER C OG  1 
ATOM   5313 N  N   . LEU C 1 197 ? -49.181 -30.161 -32.541 1.00 20.10 ? 199  LEU C N   1 
ATOM   5314 C  CA  . LEU C 1 197 ? -49.859 -29.852 -31.296 1.00 20.65 ? 199  LEU C CA  1 
ATOM   5315 C  C   . LEU C 1 197 ? -50.094 -31.196 -30.550 1.00 22.71 ? 199  LEU C C   1 
ATOM   5316 O  O   . LEU C 1 197 ? -50.319 -32.263 -31.193 1.00 20.55 ? 199  LEU C O   1 
ATOM   5317 C  CB  . LEU C 1 197 ? -51.191 -29.139 -31.570 1.00 21.48 ? 199  LEU C CB  1 
ATOM   5318 C  CG  . LEU C 1 197 ? -51.195 -27.816 -32.361 1.00 21.50 ? 199  LEU C CG  1 
ATOM   5319 C  CD1 . LEU C 1 197 ? -52.603 -27.241 -32.421 1.00 22.37 ? 199  LEU C CD1 1 
ATOM   5320 C  CD2 . LEU C 1 197 ? -50.245 -26.795 -31.764 1.00 21.20 ? 199  LEU C CD2 1 
ATOM   5321 N  N   . THR C 1 198 ? -49.981 -31.153 -29.219 1.00 22.11 ? 200  THR C N   1 
ATOM   5322 C  CA  . THR C 1 198 ? -50.087 -32.355 -28.387 1.00 22.58 ? 200  THR C CA  1 
ATOM   5323 C  C   . THR C 1 198 ? -51.491 -32.539 -27.831 1.00 22.66 ? 200  THR C C   1 
ATOM   5324 O  O   . THR C 1 198 ? -51.708 -33.457 -27.045 1.00 22.37 ? 200  THR C O   1 
ATOM   5325 C  CB  . THR C 1 198 ? -49.049 -32.393 -27.219 1.00 22.05 ? 200  THR C CB  1 
ATOM   5326 O  OG1 . THR C 1 198 ? -49.344 -31.374 -26.272 1.00 22.29 ? 200  THR C OG1 1 
ATOM   5327 C  CG2 . THR C 1 198 ? -47.634 -32.227 -27.724 1.00 22.24 ? 200  THR C CG2 1 
ATOM   5328 N  N   . THR C 1 199 ? -52.415 -31.646 -28.197 1.00 22.61 ? 201  THR C N   1 
ATOM   5329 C  CA  . THR C 1 199 ? -53.846 -31.838 -27.999 1.00 22.90 ? 201  THR C CA  1 
ATOM   5330 C  C   . THR C 1 199 ? -54.533 -31.692 -29.355 1.00 23.36 ? 201  THR C C   1 
ATOM   5331 O  O   . THR C 1 199 ? -53.908 -31.233 -30.334 1.00 22.38 ? 201  THR C O   1 
ATOM   5332 C  CB  . THR C 1 199 ? -54.452 -30.786 -27.044 1.00 23.96 ? 201  THR C CB  1 
ATOM   5333 O  OG1 . THR C 1 199 ? -54.426 -29.491 -27.658 1.00 22.60 ? 201  THR C OG1 1 
ATOM   5334 C  CG2 . THR C 1 199 ? -53.698 -30.749 -25.700 1.00 24.20 ? 201  THR C CG2 1 
ATOM   5335 N  N   . PRO C 1 200 ? -55.818 -32.075 -29.437 1.00 23.42 ? 202  PRO C N   1 
ATOM   5336 C  CA  . PRO C 1 200 ? -56.570 -31.722 -30.637 1.00 23.31 ? 202  PRO C CA  1 
ATOM   5337 C  C   . PRO C 1 200 ? -56.560 -30.200 -30.831 1.00 22.73 ? 202  PRO C C   1 
ATOM   5338 O  O   . PRO C 1 200 ? -56.575 -29.474 -29.838 1.00 22.89 ? 202  PRO C O   1 
ATOM   5339 C  CB  . PRO C 1 200 ? -57.980 -32.251 -30.335 1.00 24.53 ? 202  PRO C CB  1 
ATOM   5340 C  CG  . PRO C 1 200 ? -57.731 -33.420 -29.445 1.00 25.02 ? 202  PRO C CG  1 
ATOM   5341 C  CD  . PRO C 1 200 ? -56.599 -32.956 -28.554 1.00 25.28 ? 202  PRO C CD  1 
ATOM   5342 N  N   . PRO C 1 201 ? -56.496 -29.701 -32.064 1.00 21.85 ? 203  PRO C N   1 
ATOM   5343 C  CA  . PRO C 1 201 ? -56.657 -30.487 -33.295 1.00 21.53 ? 203  PRO C CA  1 
ATOM   5344 C  C   . PRO C 1 201 ? -55.403 -31.200 -33.829 1.00 21.17 ? 203  PRO C C   1 
ATOM   5345 O  O   . PRO C 1 201 ? -55.435 -31.686 -34.968 1.00 21.86 ? 203  PRO C O   1 
ATOM   5346 C  CB  . PRO C 1 201 ? -57.153 -29.427 -34.290 1.00 22.04 ? 203  PRO C CB  1 
ATOM   5347 C  CG  . PRO C 1 201 ? -56.474 -28.181 -33.839 1.00 21.83 ? 203  PRO C CG  1 
ATOM   5348 C  CD  . PRO C 1 201 ? -56.522 -28.256 -32.334 1.00 21.46 ? 203  PRO C CD  1 
ATOM   5349 N  N   . CYS C 1 202 ? -54.326 -31.298 -33.040 1.00 20.47 ? 204  CYS C N   1 
ATOM   5350 C  CA  . CYS C 1 202 ? -53.127 -32.078 -33.430 1.00 20.19 ? 204  CYS C CA  1 
ATOM   5351 C  C   . CYS C 1 202 ? -52.500 -31.648 -34.760 1.00 19.27 ? 204  CYS C C   1 
ATOM   5352 O  O   . CYS C 1 202 ? -51.931 -32.467 -35.480 1.00 18.32 ? 204  CYS C O   1 
ATOM   5353 C  CB  . CYS C 1 202 ? -53.430 -33.584 -33.469 1.00 21.70 ? 204  CYS C CB  1 
ATOM   5354 S  SG  . CYS C 1 202 ? -53.953 -34.310 -31.888 1.00 22.50 ? 204  CYS C SG  1 
ATOM   5355 N  N   . ALA C 1 203 ? -52.573 -30.351 -35.073 1.00 18.98 ? 205  ALA C N   1 
ATOM   5356 C  CA  . ALA C 1 203 ? -52.012 -29.829 -36.336 1.00 18.19 ? 205  ALA C CA  1 
ATOM   5357 C  C   . ALA C 1 203 ? -50.510 -30.091 -36.402 1.00 18.31 ? 205  ALA C C   1 
ATOM   5358 O  O   . ALA C 1 203 ? -49.816 -29.908 -35.390 1.00 18.06 ? 205  ALA C O   1 
ATOM   5359 C  CB  . ALA C 1 203 ? -52.282 -28.342 -36.451 1.00 18.19 ? 205  ALA C CB  1 
ATOM   5360 N  N   . GLN C 1 204 ? -50.025 -30.522 -37.569 1.00 17.41 ? 206  GLN C N   1 
ATOM   5361 C  CA  . GLN C 1 204 ? -48.608 -30.814 -37.801 1.00 18.04 ? 206  GLN C CA  1 
ATOM   5362 C  C   . GLN C 1 204 ? -47.888 -29.539 -38.298 1.00 17.23 ? 206  GLN C C   1 
ATOM   5363 O  O   . GLN C 1 204 ? -48.483 -28.476 -38.366 1.00 17.68 ? 206  GLN C O   1 
ATOM   5364 C  CB  . GLN C 1 204 ? -48.428 -32.033 -38.747 1.00 18.27 ? 206  GLN C CB  1 
ATOM   5365 C  CG  . GLN C 1 204 ? -48.981 -33.300 -38.084 1.00 19.31 ? 206  GLN C CG  1 
ATOM   5366 C  CD  . GLN C 1 204 ? -48.728 -34.631 -38.779 1.00 19.90 ? 206  GLN C CD  1 
ATOM   5367 O  OE1 . GLN C 1 204 ? -48.860 -35.673 -38.146 1.00 20.15 ? 206  GLN C OE1 1 
ATOM   5368 N  NE2 . GLN C 1 204 ? -48.393 -34.614 -40.061 1.00 19.53 ? 206  GLN C NE2 1 
ATOM   5369 N  N   . GLY C 1 205 ? -46.592 -29.637 -38.541 1.00 17.06 ? 207  GLY C N   1 
ATOM   5370 C  CA  . GLY C 1 205 ? -45.792 -28.488 -38.971 1.00 17.22 ? 207  GLY C CA  1 
ATOM   5371 C  C   . GLY C 1 205 ? -45.173 -27.719 -37.808 1.00 17.58 ? 207  GLY C C   1 
ATOM   5372 O  O   . GLY C 1 205 ? -44.495 -26.699 -38.036 1.00 19.05 ? 207  GLY C O   1 
ATOM   5373 N  N   . VAL C 1 206 ? -45.404 -28.171 -36.572 1.00 16.71 ? 208  VAL C N   1 
ATOM   5374 C  CA  . VAL C 1 206 ? -44.965 -27.421 -35.386 1.00 17.04 ? 208  VAL C CA  1 
ATOM   5375 C  C   . VAL C 1 206 ? -43.481 -27.696 -35.147 1.00 16.60 ? 208  VAL C C   1 
ATOM   5376 O  O   . VAL C 1 206 ? -43.091 -28.845 -35.063 1.00 15.35 ? 208  VAL C O   1 
ATOM   5377 C  CB  . VAL C 1 206 ? -45.739 -27.807 -34.118 1.00 17.45 ? 208  VAL C CB  1 
ATOM   5378 C  CG1 . VAL C 1 206 ? -45.249 -26.980 -32.924 1.00 18.01 ? 208  VAL C CG1 1 
ATOM   5379 C  CG2 . VAL C 1 206 ? -47.236 -27.576 -34.299 1.00 17.48 ? 208  VAL C CG2 1 
ATOM   5380 N  N   . ILE C 1 207 ? -42.650 -26.649 -35.064 1.00 16.24 ? 209  ILE C N   1 
ATOM   5381 C  CA  . ILE C 1 207 ? -41.254 -26.853 -34.724 1.00 15.73 ? 209  ILE C CA  1 
ATOM   5382 C  C   . ILE C 1 207 ? -41.143 -26.894 -33.204 1.00 16.75 ? 209  ILE C C   1 
ATOM   5383 O  O   . ILE C 1 207 ? -41.490 -25.922 -32.515 1.00 16.51 ? 209  ILE C O   1 
ATOM   5384 C  CB  . ILE C 1 207 ? -40.329 -25.784 -35.311 1.00 16.30 ? 209  ILE C CB  1 
ATOM   5385 C  CG1 . ILE C 1 207 ? -40.380 -25.839 -36.835 1.00 15.69 ? 209  ILE C CG1 1 
ATOM   5386 C  CG2 . ILE C 1 207 ? -38.886 -26.031 -34.833 1.00 15.78 ? 209  ILE C CG2 1 
ATOM   5387 C  CD1 . ILE C 1 207 ? -39.694 -24.656 -37.491 1.00 16.78 ? 209  ILE C CD1 1 
ATOM   5388 N  N   . TRP C 1 208 ? -40.710 -28.044 -32.694 1.00 16.78 ? 210  TRP C N   1 
ATOM   5389 C  CA  . TRP C 1 208 ? -40.506 -28.258 -31.246 1.00 16.68 ? 210  TRP C CA  1 
ATOM   5390 C  C   . TRP C 1 208 ? -39.037 -28.100 -30.893 1.00 16.14 ? 210  TRP C C   1 
ATOM   5391 O  O   . TRP C 1 208 ? -38.174 -28.757 -31.482 1.00 16.29 ? 210  TRP C O   1 
ATOM   5392 C  CB  . TRP C 1 208 ? -40.958 -29.666 -30.832 1.00 16.53 ? 210  TRP C CB  1 
ATOM   5393 C  CG  . TRP C 1 208 ? -42.384 -29.743 -30.697 1.00 16.70 ? 210  TRP C CG  1 
ATOM   5394 C  CD1 . TRP C 1 208 ? -43.287 -30.108 -31.661 1.00 16.49 ? 210  TRP C CD1 1 
ATOM   5395 C  CD2 . TRP C 1 208 ? -43.136 -29.436 -29.537 1.00 17.24 ? 210  TRP C CD2 1 
ATOM   5396 N  NE1 . TRP C 1 208 ? -44.558 -30.039 -31.160 1.00 16.42 ? 210  TRP C NE1 1 
ATOM   5397 C  CE2 . TRP C 1 208 ? -44.501 -29.636 -29.858 1.00 16.58 ? 210  TRP C CE2 1 
ATOM   5398 C  CE3 . TRP C 1 208 ? -42.802 -29.003 -28.248 1.00 17.32 ? 210  TRP C CE3 1 
ATOM   5399 C  CZ2 . TRP C 1 208 ? -45.512 -29.404 -28.953 1.00 17.25 ? 210  TRP C CZ2 1 
ATOM   5400 C  CZ3 . TRP C 1 208 ? -43.810 -28.791 -27.347 1.00 16.85 ? 210  TRP C CZ3 1 
ATOM   5401 C  CH2 . TRP C 1 208 ? -45.151 -28.991 -27.694 1.00 17.51 ? 210  TRP C CH2 1 
ATOM   5402 N  N   . THR C 1 209 ? -38.764 -27.233 -29.932 1.00 16.27 ? 211  THR C N   1 
ATOM   5403 C  CA  . THR C 1 209 ? -37.410 -27.020 -29.416 1.00 15.50 ? 211  THR C CA  1 
ATOM   5404 C  C   . THR C 1 209 ? -37.474 -27.347 -27.927 1.00 15.71 ? 211  THR C C   1 
ATOM   5405 O  O   . THR C 1 209 ? -38.202 -26.714 -27.178 1.00 15.78 ? 211  THR C O   1 
ATOM   5406 C  CB  . THR C 1 209 ? -36.944 -25.577 -29.660 1.00 15.00 ? 211  THR C CB  1 
ATOM   5407 O  OG1 . THR C 1 209 ? -36.883 -25.339 -31.070 1.00 14.29 ? 211  THR C OG1 1 
ATOM   5408 C  CG2 . THR C 1 209 ? -35.572 -25.327 -29.044 1.00 15.00 ? 211  THR C CG2 1 
ATOM   5409 N  N   . VAL C 1 210 ? -36.749 -28.385 -27.524 1.00 16.45 ? 212  VAL C N   1 
ATOM   5410 C  CA  . VAL C 1 210 ? -36.746 -28.870 -26.150 1.00 17.21 ? 212  VAL C CA  1 
ATOM   5411 C  C   . VAL C 1 210 ? -35.376 -28.601 -25.529 1.00 16.72 ? 212  VAL C C   1 
ATOM   5412 O  O   . VAL C 1 210 ? -34.357 -29.088 -26.015 1.00 17.57 ? 212  VAL C O   1 
ATOM   5413 C  CB  . VAL C 1 210 ? -37.071 -30.378 -26.085 1.00 17.53 ? 212  VAL C CB  1 
ATOM   5414 C  CG1 . VAL C 1 210 ? -37.135 -30.868 -24.633 1.00 17.75 ? 212  VAL C CG1 1 
ATOM   5415 C  CG2 . VAL C 1 210 ? -38.391 -30.647 -26.812 1.00 18.06 ? 212  VAL C CG2 1 
ATOM   5416 N  N   . PHE C 1 211 ? -35.357 -27.791 -24.478 1.00 17.54 ? 213  PHE C N   1 
ATOM   5417 C  CA  . PHE C 1 211 ? -34.091 -27.460 -23.815 1.00 18.13 ? 213  PHE C CA  1 
ATOM   5418 C  C   . PHE C 1 211 ? -33.453 -28.723 -23.244 1.00 18.29 ? 213  PHE C C   1 
ATOM   5419 O  O   . PHE C 1 211 ? -34.168 -29.582 -22.720 1.00 19.20 ? 213  PHE C O   1 
ATOM   5420 C  CB  . PHE C 1 211 ? -34.310 -26.456 -22.685 1.00 17.86 ? 213  PHE C CB  1 
ATOM   5421 C  CG  . PHE C 1 211 ? -34.589 -25.047 -23.140 1.00 18.40 ? 213  PHE C CG  1 
ATOM   5422 C  CD1 . PHE C 1 211 ? -33.559 -24.156 -23.356 1.00 18.70 ? 213  PHE C CD1 1 
ATOM   5423 C  CD2 . PHE C 1 211 ? -35.882 -24.600 -23.305 1.00 17.96 ? 213  PHE C CD2 1 
ATOM   5424 C  CE1 . PHE C 1 211 ? -33.825 -22.848 -23.718 1.00 19.04 ? 213  PHE C CE1 1 
ATOM   5425 C  CE2 . PHE C 1 211 ? -36.151 -23.309 -23.672 1.00 18.55 ? 213  PHE C CE2 1 
ATOM   5426 C  CZ  . PHE C 1 211 ? -35.125 -22.425 -23.885 1.00 18.22 ? 213  PHE C CZ  1 
ATOM   5427 N  N   . ASN C 1 212 ? -32.135 -28.837 -23.365 1.00 19.93 ? 214  ASN C N   1 
ATOM   5428 C  CA  . ASN C 1 212 ? -31.371 -29.924 -22.725 1.00 22.73 ? 214  ASN C CA  1 
ATOM   5429 C  C   . ASN C 1 212 ? -31.462 -29.806 -21.201 1.00 22.49 ? 214  ASN C C   1 
ATOM   5430 O  O   . ASN C 1 212 ? -31.764 -30.781 -20.507 1.00 21.80 ? 214  ASN C O   1 
ATOM   5431 C  CB  . ASN C 1 212 ? -29.894 -29.903 -23.161 1.00 25.44 ? 214  ASN C CB  1 
ATOM   5432 C  CG  . ASN C 1 212 ? -28.965 -30.657 -22.186 1.00 32.04 ? 214  ASN C CG  1 
ATOM   5433 O  OD1 . ASN C 1 212 ? -28.101 -30.075 -21.465 1.00 33.60 ? 214  ASN C OD1 1 
ATOM   5434 N  ND2 . ASN C 1 212 ? -29.148 -31.944 -22.145 1.00 35.93 ? 214  ASN C ND2 1 
ATOM   5435 N  N   . GLN C 1 213 ? -31.231 -28.600 -20.696 1.00 23.25 ? 215  GLN C N   1 
ATOM   5436 C  CA  . GLN C 1 213 ? -31.248 -28.354 -19.244 1.00 24.15 ? 215  GLN C CA  1 
ATOM   5437 C  C   . GLN C 1 213 ? -32.645 -28.127 -18.719 1.00 24.94 ? 215  GLN C C   1 
ATOM   5438 O  O   . GLN C 1 213 ? -33.528 -27.584 -19.413 1.00 23.78 ? 215  GLN C O   1 
ATOM   5439 C  CB  . GLN C 1 213 ? -30.421 -27.141 -18.899 1.00 24.04 ? 215  GLN C CB  1 
ATOM   5440 C  CG  . GLN C 1 213 ? -28.971 -27.261 -19.302 1.00 24.97 ? 215  GLN C CG  1 
ATOM   5441 C  CD  . GLN C 1 213 ? -28.168 -25.996 -19.078 1.00 27.34 ? 215  GLN C CD  1 
ATOM   5442 O  OE1 . GLN C 1 213 ? -26.922 -26.029 -19.001 1.00 30.39 ? 215  GLN C OE1 1 
ATOM   5443 N  NE2 . GLN C 1 213 ? -28.842 -24.880 -18.979 1.00 27.36 ? 215  GLN C NE2 1 
ATOM   5444 N  N   . THR C 1 214 ? -32.831 -28.528 -17.473 1.00 24.87 ? 216  THR C N   1 
ATOM   5445 C  CA  . THR C 1 214 ? -34.109 -28.410 -16.808 1.00 26.81 ? 216  THR C CA  1 
ATOM   5446 C  C   . THR C 1 214 ? -34.178 -27.192 -15.903 1.00 26.50 ? 216  THR C C   1 
ATOM   5447 O  O   . THR C 1 214 ? -33.201 -26.472 -15.714 1.00 25.93 ? 216  THR C O   1 
ATOM   5448 C  CB  . THR C 1 214 ? -34.395 -29.672 -15.996 1.00 29.11 ? 216  THR C CB  1 
ATOM   5449 O  OG1 . THR C 1 214 ? -33.552 -29.697 -14.840 1.00 28.74 ? 216  THR C OG1 1 
ATOM   5450 C  CG2 . THR C 1 214 ? -34.140 -30.910 -16.860 1.00 29.35 ? 216  THR C CG2 1 
ATOM   5451 N  N   . VAL C 1 215 ? -35.375 -26.951 -15.389 1.00 26.55 ? 217  VAL C N   1 
ATOM   5452 C  CA  . VAL C 1 215 ? -35.630 -25.928 -14.393 1.00 27.26 ? 217  VAL C CA  1 
ATOM   5453 C  C   . VAL C 1 215 ? -36.062 -26.679 -13.115 1.00 27.70 ? 217  VAL C C   1 
ATOM   5454 O  O   . VAL C 1 215 ? -36.675 -27.744 -13.201 1.00 26.68 ? 217  VAL C O   1 
ATOM   5455 C  CB  . VAL C 1 215 ? -36.688 -24.950 -14.949 1.00 29.41 ? 217  VAL C CB  1 
ATOM   5456 C  CG1 . VAL C 1 215 ? -37.334 -24.135 -13.859 1.00 31.58 ? 217  VAL C CG1 1 
ATOM   5457 C  CG2 . VAL C 1 215 ? -36.023 -24.023 -15.962 1.00 31.02 ? 217  VAL C CG2 1 
ATOM   5458 N  N   . MET C 1 216 ? -35.721 -26.139 -11.943 1.00 26.98 ? 218  MET C N   1 
ATOM   5459 C  CA  . MET C 1 216 ? -35.999 -26.803 -10.667 1.00 28.17 ? 218  MET C CA  1 
ATOM   5460 C  C   . MET C 1 216 ? -37.074 -26.069 -9.897  1.00 25.94 ? 218  MET C C   1 
ATOM   5461 O  O   . MET C 1 216 ? -37.001 -24.855 -9.718  1.00 25.18 ? 218  MET C O   1 
ATOM   5462 C  CB  . MET C 1 216 ? -34.729 -26.921 -9.819  1.00 32.27 ? 218  MET C CB  1 
ATOM   5463 C  CG  . MET C 1 216 ? -33.839 -28.080 -10.233 1.00 36.62 ? 218  MET C CG  1 
ATOM   5464 S  SD  . MET C 1 216 ? -32.371 -28.231 -9.186  1.00 49.80 ? 218  MET C SD  1 
ATOM   5465 C  CE  . MET C 1 216 ? -31.355 -26.821 -9.661  1.00 47.49 ? 218  MET C CE  1 
ATOM   5466 N  N   . LEU C 1 217 ? -38.088 -26.819 -9.478  1.00 24.63 ? 219  LEU C N   1 
ATOM   5467 C  CA  . LEU C 1 217 ? -39.113 -26.351 -8.552  1.00 25.33 ? 219  LEU C CA  1 
ATOM   5468 C  C   . LEU C 1 217 ? -39.000 -27.153 -7.252  1.00 25.07 ? 219  LEU C C   1 
ATOM   5469 O  O   . LEU C 1 217 ? -38.542 -28.299 -7.250  1.00 25.00 ? 219  LEU C O   1 
ATOM   5470 C  CB  . LEU C 1 217 ? -40.519 -26.562 -9.136  1.00 25.26 ? 219  LEU C CB  1 
ATOM   5471 C  CG  . LEU C 1 217 ? -41.030 -25.479 -10.085 1.00 25.06 ? 219  LEU C CG  1 
ATOM   5472 C  CD1 . LEU C 1 217 ? -40.119 -25.344 -11.291 1.00 24.99 ? 219  LEU C CD1 1 
ATOM   5473 C  CD2 . LEU C 1 217 ? -42.448 -25.792 -10.520 1.00 25.15 ? 219  LEU C CD2 1 
ATOM   5474 N  N   . SER C 1 218 ? -39.455 -26.568 -6.155  1.00 26.69 ? 220  SER C N   1 
ATOM   5475 C  CA  . SER C 1 218 ? -39.494 -27.307 -4.874  1.00 28.64 ? 220  SER C CA  1 
ATOM   5476 C  C   . SER C 1 218 ? -40.559 -28.394 -4.928  1.00 30.60 ? 220  SER C C   1 
ATOM   5477 O  O   . SER C 1 218 ? -41.438 -28.398 -5.812  1.00 31.47 ? 220  SER C O   1 
ATOM   5478 C  CB  . SER C 1 218 ? -39.737 -26.375 -3.692  1.00 27.61 ? 220  SER C CB  1 
ATOM   5479 O  OG  . SER C 1 218 ? -41.071 -25.910 -3.669  1.00 29.01 ? 220  SER C OG  1 
ATOM   5480 N  N   . ALA C 1 219 ? -40.467 -29.330 -3.993  1.00 32.57 ? 221  ALA C N   1 
ATOM   5481 C  CA  . ALA C 1 219 ? -41.488 -30.359 -3.851  1.00 32.91 ? 221  ALA C CA  1 
ATOM   5482 C  C   . ALA C 1 219 ? -42.854 -29.743 -3.563  1.00 31.77 ? 221  ALA C C   1 
ATOM   5483 O  O   . ALA C 1 219 ? -43.854 -30.183 -4.128  1.00 33.73 ? 221  ALA C O   1 
ATOM   5484 C  CB  . ALA C 1 219 ? -41.105 -31.346 -2.757  1.00 35.92 ? 221  ALA C CB  1 
ATOM   5485 N  N   . LYS C 1 220 ? -42.896 -28.708 -2.714  1.00 31.37 ? 222  LYS C N   1 
ATOM   5486 C  CA  . LYS C 1 220 ? -44.150 -28.009 -2.412  1.00 30.63 ? 222  LYS C CA  1 
ATOM   5487 C  C   . LYS C 1 220 ? -44.747 -27.392 -3.677  1.00 29.48 ? 222  LYS C C   1 
ATOM   5488 O  O   . LYS C 1 220 ? -45.967 -27.441 -3.903  1.00 29.42 ? 222  LYS C O   1 
ATOM   5489 C  CB  . LYS C 1 220 ? -43.952 -26.919 -1.347  1.00 29.82 ? 222  LYS C CB  1 
ATOM   5490 N  N   . GLN C 1 221 ? -43.883 -26.796 -4.488  1.00 28.34 ? 223  GLN C N   1 
ATOM   5491 C  CA  . GLN C 1 221 ? -44.320 -26.148 -5.736  1.00 27.93 ? 223  GLN C CA  1 
ATOM   5492 C  C   . GLN C 1 221 ? -44.939 -27.123 -6.734  1.00 26.46 ? 223  GLN C C   1 
ATOM   5493 O  O   . GLN C 1 221 ? -45.990 -26.844 -7.313  1.00 26.66 ? 223  GLN C O   1 
ATOM   5494 C  CB  . GLN C 1 221 ? -43.169 -25.363 -6.360  1.00 26.22 ? 223  GLN C CB  1 
ATOM   5495 C  CG  . GLN C 1 221 ? -42.946 -24.030 -5.653  1.00 25.80 ? 223  GLN C CG  1 
ATOM   5496 C  CD  . GLN C 1 221 ? -41.779 -23.256 -6.225  1.00 24.29 ? 223  GLN C CD  1 
ATOM   5497 O  OE1 . GLN C 1 221 ? -40.720 -23.814 -6.489  1.00 23.95 ? 223  GLN C OE1 1 
ATOM   5498 N  NE2 . GLN C 1 221 ? -41.972 -21.959 -6.417  1.00 25.26 ? 223  GLN C NE2 1 
ATOM   5499 N  N   . LEU C 1 222 ? -44.293 -28.262 -6.914  1.00 28.14 ? 224  LEU C N   1 
ATOM   5500 C  CA  . LEU C 1 222 ? -44.818 -29.313 -7.786  1.00 29.75 ? 224  LEU C CA  1 
ATOM   5501 C  C   . LEU C 1 222 ? -46.148 -29.850 -7.271  1.00 31.50 ? 224  LEU C C   1 
ATOM   5502 O  O   . LEU C 1 222 ? -47.059 -30.099 -8.057  1.00 30.53 ? 224  LEU C O   1 
ATOM   5503 C  CB  . LEU C 1 222 ? -43.797 -30.445 -7.959  1.00 28.66 ? 224  LEU C CB  1 
ATOM   5504 C  CG  . LEU C 1 222 ? -42.584 -30.039 -8.804  1.00 28.69 ? 224  LEU C CG  1 
ATOM   5505 C  CD1 . LEU C 1 222 ? -41.530 -31.135 -8.829  1.00 28.02 ? 224  LEU C CD1 1 
ATOM   5506 C  CD2 . LEU C 1 222 ? -43.014 -29.664 -10.222 1.00 28.39 ? 224  LEU C CD2 1 
ATOM   5507 N  N   . HIS C 1 223 ? -46.249 -30.004 -5.952  1.00 33.58 ? 225  HIS C N   1 
ATOM   5508 C  CA  . HIS C 1 223 ? -47.493 -30.415 -5.334  1.00 36.45 ? 225  HIS C CA  1 
ATOM   5509 C  C   . HIS C 1 223 ? -48.589 -29.377 -5.597  1.00 34.29 ? 225  HIS C C   1 
ATOM   5510 O  O   . HIS C 1 223 ? -49.681 -29.741 -6.031  1.00 31.14 ? 225  HIS C O   1 
ATOM   5511 C  CB  . HIS C 1 223 ? -47.315 -30.672 -3.841  1.00 39.79 ? 225  HIS C CB  1 
ATOM   5512 C  CG  . HIS C 1 223 ? -48.517 -31.293 -3.212  1.00 47.43 ? 225  HIS C CG  1 
ATOM   5513 N  ND1 . HIS C 1 223 ? -49.489 -30.552 -2.573  1.00 50.10 ? 225  HIS C ND1 1 
ATOM   5514 C  CD2 . HIS C 1 223 ? -48.933 -32.582 -3.166  1.00 51.27 ? 225  HIS C CD2 1 
ATOM   5515 C  CE1 . HIS C 1 223 ? -50.439 -31.360 -2.136  1.00 50.68 ? 225  HIS C CE1 1 
ATOM   5516 N  NE2 . HIS C 1 223 ? -50.128 -32.595 -2.488  1.00 52.43 ? 225  HIS C NE2 1 
ATOM   5517 N  N   . THR C 1 224 ? -48.278 -28.093 -5.401  1.00 31.25 ? 226  THR C N   1 
ATOM   5518 C  CA  . THR C 1 224 ? -49.231 -27.021 -5.681  1.00 31.49 ? 226  THR C CA  1 
ATOM   5519 C  C   . THR C 1 224 ? -49.728 -27.055 -7.119  1.00 32.86 ? 226  THR C C   1 
ATOM   5520 O  O   . THR C 1 224 ? -50.915 -26.811 -7.367  1.00 32.90 ? 226  THR C O   1 
ATOM   5521 C  CB  . THR C 1 224 ? -48.631 -25.629 -5.387  1.00 33.14 ? 226  THR C CB  1 
ATOM   5522 O  OG1 . THR C 1 224 ? -48.359 -25.527 -3.988  1.00 32.71 ? 226  THR C OG1 1 
ATOM   5523 C  CG2 . THR C 1 224 ? -49.587 -24.493 -5.772  1.00 32.73 ? 226  THR C CG2 1 
ATOM   5524 N  N   . LEU C 1 225 ? -48.823 -27.362 -8.051  1.00 32.98 ? 227  LEU C N   1 
ATOM   5525 C  CA  . LEU C 1 225 ? -49.150 -27.392 -9.481  1.00 31.16 ? 227  LEU C CA  1 
ATOM   5526 C  C   . LEU C 1 225 ? -50.147 -28.506 -9.802  1.00 31.47 ? 227  LEU C C   1 
ATOM   5527 O  O   . LEU C 1 225 ? -51.118 -28.283 -10.535 1.00 31.00 ? 227  LEU C O   1 
ATOM   5528 C  CB  . LEU C 1 225 ? -47.876 -27.570 -10.331 1.00 29.71 ? 227  LEU C CB  1 
ATOM   5529 C  CG  . LEU C 1 225 ? -48.028 -27.578 -11.866 1.00 28.74 ? 227  LEU C CG  1 
ATOM   5530 C  CD1 . LEU C 1 225 ? -48.733 -26.324 -12.353 1.00 27.58 ? 227  LEU C CD1 1 
ATOM   5531 C  CD2 . LEU C 1 225 ? -46.676 -27.750 -12.536 1.00 27.65 ? 227  LEU C CD2 1 
ATOM   5532 N  N   . SER C 1 226 ? -49.882 -29.693 -9.266  1.00 32.93 ? 228  SER C N   1 
ATOM   5533 C  CA  . SER C 1 226 ? -50.668 -30.892 -9.566  1.00 33.55 ? 228  SER C CA  1 
ATOM   5534 C  C   . SER C 1 226 ? -51.930 -31.069 -8.701  1.00 36.22 ? 228  SER C C   1 
ATOM   5535 O  O   . SER C 1 226 ? -52.833 -31.813 -9.085  1.00 36.43 ? 228  SER C O   1 
ATOM   5536 C  CB  . SER C 1 226 ? -49.777 -32.130 -9.450  1.00 33.92 ? 228  SER C CB  1 
ATOM   5537 O  OG  . SER C 1 226 ? -49.326 -32.328 -8.120  1.00 33.85 ? 228  SER C OG  1 
ATOM   5538 N  N   . ASP C 1 227 ? -52.012 -30.360 -7.577  1.00 36.49 ? 229  ASP C N   1 
ATOM   5539 C  CA  . ASP C 1 227 ? -53.039 -30.604 -6.552  1.00 38.93 ? 229  ASP C CA  1 
ATOM   5540 C  C   . ASP C 1 227 ? -54.068 -29.469 -6.389  1.00 36.15 ? 229  ASP C C   1 
ATOM   5541 O  O   . ASP C 1 227 ? -55.007 -29.618 -5.620  1.00 38.19 ? 229  ASP C O   1 
ATOM   5542 C  CB  . ASP C 1 227 ? -52.330 -30.892 -5.213  1.00 42.73 ? 229  ASP C CB  1 
ATOM   5543 C  CG  . ASP C 1 227 ? -53.275 -31.383 -4.117  1.00 50.04 ? 229  ASP C CG  1 
ATOM   5544 O  OD1 . ASP C 1 227 ? -53.836 -32.497 -4.251  1.00 51.84 ? 229  ASP C OD1 1 
ATOM   5545 O  OD2 . ASP C 1 227 ? -53.447 -30.641 -3.115  1.00 55.16 ? 229  ASP C OD2 1 
ATOM   5546 N  N   . THR C 1 228 ? -53.929 -28.359 -7.116  1.00 33.63 ? 230  THR C N   1 
ATOM   5547 C  CA  . THR C 1 228 ? -54.778 -27.173 -6.892  1.00 31.79 ? 230  THR C CA  1 
ATOM   5548 C  C   . THR C 1 228 ? -55.945 -27.018 -7.881  1.00 31.02 ? 230  THR C C   1 
ATOM   5549 O  O   . THR C 1 228 ? -56.999 -26.499 -7.505  1.00 31.77 ? 230  THR C O   1 
ATOM   5550 C  CB  . THR C 1 228 ? -53.919 -25.883 -6.898  1.00 31.24 ? 230  THR C CB  1 
ATOM   5551 O  OG1 . THR C 1 228 ? -52.903 -25.985 -5.893  1.00 32.79 ? 230  THR C OG1 1 
ATOM   5552 C  CG2 . THR C 1 228 ? -54.745 -24.648 -6.616  1.00 29.82 ? 230  THR C CG2 1 
ATOM   5553 N  N   . LEU C 1 229 ? -55.767 -27.445 -9.131  1.00 29.91 ? 231  LEU C N   1 
ATOM   5554 C  CA  . LEU C 1 229 ? -56.730 -27.124 -10.185 1.00 30.43 ? 231  LEU C CA  1 
ATOM   5555 C  C   . LEU C 1 229 ? -57.698 -28.267 -10.431 1.00 31.17 ? 231  LEU C C   1 
ATOM   5556 O  O   . LEU C 1 229 ? -57.324 -29.444 -10.330 1.00 29.37 ? 231  LEU C O   1 
ATOM   5557 C  CB  . LEU C 1 229 ? -56.008 -26.792 -11.497 1.00 30.76 ? 231  LEU C CB  1 
ATOM   5558 C  CG  . LEU C 1 229 ? -55.014 -25.623 -11.459 1.00 29.95 ? 231  LEU C CG  1 
ATOM   5559 C  CD1 . LEU C 1 229 ? -54.405 -25.423 -12.839 1.00 30.68 ? 231  LEU C CD1 1 
ATOM   5560 C  CD2 . LEU C 1 229 ? -55.689 -24.338 -10.993 1.00 29.07 ? 231  LEU C CD2 1 
ATOM   5561 N  N   . TRP C 1 230 ? -58.927 -27.895 -10.792 1.00 34.33 ? 232  TRP C N   1 
ATOM   5562 C  CA  . TRP C 1 230 ? -59.991 -28.844 -11.126 1.00 39.96 ? 232  TRP C CA  1 
ATOM   5563 C  C   . TRP C 1 230 ? -60.372 -28.692 -12.597 1.00 38.93 ? 232  TRP C C   1 
ATOM   5564 O  O   . TRP C 1 230 ? -60.368 -27.581 -13.125 1.00 36.58 ? 232  TRP C O   1 
ATOM   5565 C  CB  . TRP C 1 230 ? -61.189 -28.637 -10.190 1.00 41.57 ? 232  TRP C CB  1 
ATOM   5566 C  CG  . TRP C 1 230 ? -60.825 -29.017 -8.782  1.00 46.60 ? 232  TRP C CG  1 
ATOM   5567 C  CD1 . TRP C 1 230 ? -60.082 -28.283 -7.894  1.00 49.85 ? 232  TRP C CD1 1 
ATOM   5568 C  CD2 . TRP C 1 230 ? -61.123 -30.247 -8.127  1.00 50.20 ? 232  TRP C CD2 1 
ATOM   5569 N  NE1 . TRP C 1 230 ? -59.921 -28.974 -6.721  1.00 50.98 ? 232  TRP C NE1 1 
ATOM   5570 C  CE2 . TRP C 1 230 ? -60.552 -30.183 -6.834  1.00 52.01 ? 232  TRP C CE2 1 
ATOM   5571 C  CE3 . TRP C 1 230 ? -61.826 -31.398 -8.500  1.00 50.19 ? 232  TRP C CE3 1 
ATOM   5572 C  CZ2 . TRP C 1 230 ? -60.675 -31.225 -5.910  1.00 53.48 ? 232  TRP C CZ2 1 
ATOM   5573 C  CZ3 . TRP C 1 230 ? -61.943 -32.435 -7.585  1.00 52.72 ? 232  TRP C CZ3 1 
ATOM   5574 C  CH2 . TRP C 1 230 ? -61.371 -32.340 -6.303  1.00 53.35 ? 232  TRP C CH2 1 
ATOM   5575 N  N   . GLY C 1 231 ? -60.686 -29.825 -13.231 1.00 40.02 ? 233  GLY C N   1 
ATOM   5576 C  CA  . GLY C 1 231 ? -60.895 -29.935 -14.669 1.00 42.82 ? 233  GLY C CA  1 
ATOM   5577 C  C   . GLY C 1 231 ? -62.303 -30.392 -15.033 1.00 46.61 ? 233  GLY C C   1 
ATOM   5578 O  O   . GLY C 1 231 ? -63.246 -30.104 -14.292 1.00 46.24 ? 233  GLY C O   1 
ATOM   5579 N  N   . PRO C 1 232 ? -62.459 -31.094 -16.183 1.00 49.57 ? 234  PRO C N   1 
ATOM   5580 C  CA  . PRO C 1 232 ? -63.780 -31.501 -16.677 1.00 52.01 ? 234  PRO C CA  1 
ATOM   5581 C  C   . PRO C 1 232 ? -64.577 -32.311 -15.670 1.00 56.31 ? 234  PRO C C   1 
ATOM   5582 O  O   . PRO C 1 232 ? -64.036 -33.240 -15.064 1.00 55.74 ? 234  PRO C O   1 
ATOM   5583 C  CB  . PRO C 1 232 ? -63.450 -32.368 -17.895 1.00 51.30 ? 234  PRO C CB  1 
ATOM   5584 C  CG  . PRO C 1 232 ? -62.147 -31.851 -18.371 1.00 51.34 ? 234  PRO C CG  1 
ATOM   5585 C  CD  . PRO C 1 232 ? -61.398 -31.499 -17.120 1.00 48.87 ? 234  PRO C CD  1 
ATOM   5586 N  N   . GLY C 1 233 ? -65.848 -31.944 -15.493 1.00 63.99 ? 235  GLY C N   1 
ATOM   5587 C  CA  . GLY C 1 233 ? -66.744 -32.638 -14.568 1.00 64.68 ? 235  GLY C CA  1 
ATOM   5588 C  C   . GLY C 1 233 ? -66.347 -32.339 -13.139 1.00 64.46 ? 235  GLY C C   1 
ATOM   5589 O  O   . GLY C 1 233 ? -65.996 -31.204 -12.827 1.00 66.13 ? 235  GLY C O   1 
ATOM   5590 N  N   . ASP C 1 234 ? -66.377 -33.362 -12.287 1.00 62.83 ? 236  ASP C N   1 
ATOM   5591 C  CA  . ASP C 1 234 ? -66.034 -33.224 -10.878 1.00 60.83 ? 236  ASP C CA  1 
ATOM   5592 C  C   . ASP C 1 234 ? -64.667 -33.853 -10.655 1.00 61.63 ? 236  ASP C C   1 
ATOM   5593 O  O   . ASP C 1 234 ? -64.492 -34.671 -9.753  1.00 65.09 ? 236  ASP C O   1 
ATOM   5594 C  CB  . ASP C 1 234 ? -67.099 -33.915 -10.024 1.00 59.28 ? 236  ASP C CB  1 
ATOM   5595 N  N   . SER C 1 235 ? -63.696 -33.450 -11.473 1.00 57.45 ? 237  SER C N   1 
ATOM   5596 C  CA  . SER C 1 235 ? -62.406 -34.142 -11.570 1.00 54.83 ? 237  SER C CA  1 
ATOM   5597 C  C   . SER C 1 235 ? -61.213 -33.199 -11.352 1.00 49.55 ? 237  SER C C   1 
ATOM   5598 O  O   . SER C 1 235 ? -61.270 -32.028 -11.723 1.00 47.37 ? 237  SER C O   1 
ATOM   5599 C  CB  . SER C 1 235 ? -62.296 -34.787 -12.949 1.00 56.65 ? 237  SER C CB  1 
ATOM   5600 O  OG  . SER C 1 235 ? -61.347 -35.830 -12.932 1.00 60.90 ? 237  SER C OG  1 
ATOM   5601 N  N   . ARG C 1 236 ? -60.141 -33.708 -10.750 1.00 43.93 ? 238  ARG C N   1 
ATOM   5602 C  CA  . ARG C 1 236 ? -58.906 -32.932 -10.613 1.00 43.46 ? 238  ARG C CA  1 
ATOM   5603 C  C   . ARG C 1 236 ? -58.231 -32.767 -11.971 1.00 39.82 ? 238  ARG C C   1 
ATOM   5604 O  O   . ARG C 1 236 ? -58.268 -33.666 -12.817 1.00 38.14 ? 238  ARG C O   1 
ATOM   5605 C  CB  . ARG C 1 236 ? -57.917 -33.591 -9.661  1.00 44.20 ? 238  ARG C CB  1 
ATOM   5606 C  CG  . ARG C 1 236 ? -58.263 -33.502 -8.192  1.00 47.20 ? 238  ARG C CG  1 
ATOM   5607 C  CD  . ARG C 1 236 ? -57.068 -33.969 -7.372  1.00 49.17 ? 238  ARG C CD  1 
ATOM   5608 N  NE  . ARG C 1 236 ? -57.234 -33.752 -5.940  1.00 50.73 ? 238  ARG C NE  1 
ATOM   5609 C  CZ  . ARG C 1 236 ? -57.165 -32.570 -5.321  1.00 53.18 ? 238  ARG C CZ  1 
ATOM   5610 N  NH1 . ARG C 1 236 ? -56.953 -31.433 -5.993  1.00 52.81 ? 238  ARG C NH1 1 
ATOM   5611 N  NH2 . ARG C 1 236 ? -57.334 -32.521 -4.002  1.00 53.54 ? 238  ARG C NH2 1 
ATOM   5612 N  N   . LEU C 1 237 ? -57.622 -31.608 -12.176 1.00 38.11 ? 239  LEU C N   1 
ATOM   5613 C  CA  . LEU C 1 237 ? -56.877 -31.342 -13.401 1.00 35.65 ? 239  LEU C CA  1 
ATOM   5614 C  C   . LEU C 1 237 ? -55.464 -31.832 -13.134 1.00 35.06 ? 239  LEU C C   1 
ATOM   5615 O  O   . LEU C 1 237 ? -54.653 -31.129 -12.518 1.00 33.95 ? 239  LEU C O   1 
ATOM   5616 C  CB  . LEU C 1 237 ? -56.955 -29.851 -13.767 1.00 36.54 ? 239  LEU C CB  1 
ATOM   5617 C  CG  . LEU C 1 237 ? -56.240 -29.340 -15.024 1.00 35.47 ? 239  LEU C CG  1 
ATOM   5618 C  CD1 . LEU C 1 237 ? -56.213 -30.356 -16.140 1.00 36.21 ? 239  LEU C CD1 1 
ATOM   5619 C  CD2 . LEU C 1 237 ? -56.830 -28.013 -15.480 1.00 34.68 ? 239  LEU C CD2 1 
ATOM   5620 N  N   . GLN C 1 238 ? -55.225 -33.082 -13.549 1.00 32.31 ? 240  GLN C N   1 
ATOM   5621 C  CA  . GLN C 1 238 ? -53.986 -33.817 -13.310 1.00 32.76 ? 240  GLN C CA  1 
ATOM   5622 C  C   . GLN C 1 238 ? -53.684 -34.699 -14.494 1.00 31.79 ? 240  GLN C C   1 
ATOM   5623 O  O   . GLN C 1 238 ? -54.568 -34.987 -15.290 1.00 32.87 ? 240  GLN C O   1 
ATOM   5624 C  CB  . GLN C 1 238 ? -54.133 -34.747 -12.098 1.00 33.95 ? 240  GLN C CB  1 
ATOM   5625 C  CG  . GLN C 1 238 ? -54.419 -34.042 -10.796 1.00 35.63 ? 240  GLN C CG  1 
ATOM   5626 C  CD  . GLN C 1 238 ? -54.310 -34.959 -9.576  1.00 36.71 ? 240  GLN C CD  1 
ATOM   5627 O  OE1 . GLN C 1 238 ? -53.836 -34.534 -8.525  1.00 37.77 ? 240  GLN C OE1 1 
ATOM   5628 N  NE2 . GLN C 1 238 ? -54.743 -36.212 -9.713  1.00 35.96 ? 240  GLN C NE2 1 
ATOM   5629 N  N   . LEU C 1 239 ? -52.435 -35.140 -14.589 1.00 31.18 ? 241  LEU C N   1 
ATOM   5630 C  CA  . LEU C 1 239 ? -52.010 -36.084 -15.605 1.00 32.60 ? 241  LEU C CA  1 
ATOM   5631 C  C   . LEU C 1 239 ? -52.405 -35.595 -17.020 1.00 32.12 ? 241  LEU C C   1 
ATOM   5632 O  O   . LEU C 1 239 ? -52.870 -36.371 -17.867 1.00 33.57 ? 241  LEU C O   1 
ATOM   5633 C  CB  . LEU C 1 239 ? -52.595 -37.465 -15.301 1.00 34.25 ? 241  LEU C CB  1 
ATOM   5634 C  CG  . LEU C 1 239 ? -52.234 -38.021 -13.914 1.00 34.44 ? 241  LEU C CG  1 
ATOM   5635 C  CD1 . LEU C 1 239 ? -53.242 -39.075 -13.489 1.00 36.69 ? 241  LEU C CD1 1 
ATOM   5636 C  CD2 . LEU C 1 239 ? -50.821 -38.586 -13.903 1.00 34.48 ? 241  LEU C CD2 1 
ATOM   5637 N  N   . ASN C 1 240 ? -52.191 -34.306 -17.265 1.00 28.43 ? 242  ASN C N   1 
ATOM   5638 C  CA  . ASN C 1 240 ? -52.630 -33.662 -18.511 1.00 28.15 ? 242  ASN C CA  1 
ATOM   5639 C  C   . ASN C 1 240 ? -51.524 -33.684 -19.578 1.00 26.53 ? 242  ASN C C   1 
ATOM   5640 O  O   . ASN C 1 240 ? -51.089 -32.644 -20.065 1.00 28.72 ? 242  ASN C O   1 
ATOM   5641 C  CB  . ASN C 1 240 ? -53.158 -32.247 -18.224 1.00 26.94 ? 242  ASN C CB  1 
ATOM   5642 C  CG  . ASN C 1 240 ? -52.122 -31.347 -17.548 1.00 25.64 ? 242  ASN C CG  1 
ATOM   5643 O  OD1 . ASN C 1 240 ? -51.166 -31.834 -16.947 1.00 26.05 ? 242  ASN C OD1 1 
ATOM   5644 N  ND2 . ASN C 1 240 ? -52.305 -30.037 -17.663 1.00 24.20 ? 242  ASN C ND2 1 
ATOM   5645 N  N   . PHE C 1 241 ? -51.067 -34.886 -19.918 1.00 25.59 ? 243  PHE C N   1 
ATOM   5646 C  CA  . PHE C 1 241 ? -50.042 -35.092 -20.941 1.00 25.92 ? 243  PHE C CA  1 
ATOM   5647 C  C   . PHE C 1 241 ? -50.482 -36.164 -21.930 1.00 26.82 ? 243  PHE C C   1 
ATOM   5648 O  O   . PHE C 1 241 ? -51.279 -37.040 -21.594 1.00 26.73 ? 243  PHE C O   1 
ATOM   5649 C  CB  . PHE C 1 241 ? -48.679 -35.460 -20.318 1.00 26.00 ? 243  PHE C CB  1 
ATOM   5650 C  CG  . PHE C 1 241 ? -48.691 -36.740 -19.529 1.00 26.10 ? 243  PHE C CG  1 
ATOM   5651 C  CD1 . PHE C 1 241 ? -49.004 -36.729 -18.161 1.00 26.35 ? 243  PHE C CD1 1 
ATOM   5652 C  CD2 . PHE C 1 241 ? -48.415 -37.962 -20.150 1.00 25.90 ? 243  PHE C CD2 1 
ATOM   5653 C  CE1 . PHE C 1 241 ? -49.045 -37.922 -17.432 1.00 26.89 ? 243  PHE C CE1 1 
ATOM   5654 C  CE2 . PHE C 1 241 ? -48.445 -39.151 -19.422 1.00 26.43 ? 243  PHE C CE2 1 
ATOM   5655 C  CZ  . PHE C 1 241 ? -48.759 -39.129 -18.065 1.00 25.13 ? 243  PHE C CZ  1 
ATOM   5656 N  N   . ARG C 1 242 ? -49.949 -36.095 -23.143 1.00 25.50 ? 244  ARG C N   1 
ATOM   5657 C  CA  . ARG C 1 242 ? -50.230 -37.071 -24.173 1.00 25.17 ? 244  ARG C CA  1 
ATOM   5658 C  C   . ARG C 1 242 ? -49.103 -38.072 -24.190 1.00 25.54 ? 244  ARG C C   1 
ATOM   5659 O  O   . ARG C 1 242 ? -47.965 -37.696 -23.958 1.00 25.35 ? 244  ARG C O   1 
ATOM   5660 C  CB  . ARG C 1 242 ? -50.305 -36.369 -25.522 1.00 24.85 ? 244  ARG C CB  1 
ATOM   5661 C  CG  . ARG C 1 242 ? -50.710 -37.284 -26.655 1.00 25.19 ? 244  ARG C CG  1 
ATOM   5662 C  CD  . ARG C 1 242 ? -50.472 -36.638 -28.007 1.00 25.86 ? 244  ARG C CD  1 
ATOM   5663 N  NE  . ARG C 1 242 ? -51.231 -37.318 -29.062 1.00 25.21 ? 244  ARG C NE  1 
ATOM   5664 C  CZ  . ARG C 1 242 ? -51.239 -36.964 -30.350 1.00 26.73 ? 244  ARG C CZ  1 
ATOM   5665 N  NH1 . ARG C 1 242 ? -50.512 -35.918 -30.795 1.00 25.49 ? 244  ARG C NH1 1 
ATOM   5666 N  NH2 . ARG C 1 242 ? -51.986 -37.671 -31.212 1.00 26.09 ? 244  ARG C NH2 1 
ATOM   5667 N  N   . ALA C 1 243 ? -49.407 -39.340 -24.482 1.00 25.56 ? 245  ALA C N   1 
ATOM   5668 C  CA  . ALA C 1 243 ? -48.359 -40.369 -24.644 1.00 25.47 ? 245  ALA C CA  1 
ATOM   5669 C  C   . ALA C 1 243 ? -47.410 -40.030 -25.792 1.00 27.03 ? 245  ALA C C   1 
ATOM   5670 O  O   . ALA C 1 243 ? -47.803 -39.350 -26.764 1.00 28.03 ? 245  ALA C O   1 
ATOM   5671 C  CB  . ALA C 1 243 ? -48.983 -41.741 -24.880 1.00 25.95 ? 245  ALA C CB  1 
ATOM   5672 N  N   . THR C 1 244 ? -46.170 -40.508 -25.699 1.00 25.77 ? 246  THR C N   1 
ATOM   5673 C  CA  . THR C 1 244 ? -45.200 -40.229 -26.740 1.00 25.40 ? 246  THR C CA  1 
ATOM   5674 C  C   . THR C 1 244 ? -45.581 -40.955 -28.026 1.00 26.24 ? 246  THR C C   1 
ATOM   5675 O  O   . THR C 1 244 ? -46.197 -42.015 -27.992 1.00 26.90 ? 246  THR C O   1 
ATOM   5676 C  CB  . THR C 1 244 ? -43.773 -40.595 -26.335 1.00 25.95 ? 246  THR C CB  1 
ATOM   5677 O  OG1 . THR C 1 244 ? -43.770 -41.902 -25.768 1.00 25.42 ? 246  THR C OG1 1 
ATOM   5678 C  CG2 . THR C 1 244 ? -43.243 -39.597 -25.319 1.00 27.24 ? 246  THR C CG2 1 
ATOM   5679 N  N   . GLN C 1 245 ? -45.188 -40.372 -29.153 1.00 24.82 ? 247  GLN C N   1 
ATOM   5680 C  CA  . GLN C 1 245 ? -45.655 -40.768 -30.463 1.00 24.18 ? 247  GLN C CA  1 
ATOM   5681 C  C   . GLN C 1 245 ? -44.456 -41.221 -31.271 1.00 24.32 ? 247  GLN C C   1 
ATOM   5682 O  O   . GLN C 1 245 ? -43.356 -40.767 -31.021 1.00 25.31 ? 247  GLN C O   1 
ATOM   5683 C  CB  . GLN C 1 245 ? -46.336 -39.578 -31.146 1.00 23.45 ? 247  GLN C CB  1 
ATOM   5684 C  CG  . GLN C 1 245 ? -47.524 -39.011 -30.398 1.00 23.34 ? 247  GLN C CG  1 
ATOM   5685 C  CD  . GLN C 1 245 ? -48.683 -39.984 -30.319 1.00 25.12 ? 247  GLN C CD  1 
ATOM   5686 O  OE1 . GLN C 1 245 ? -49.079 -40.551 -31.322 1.00 26.29 ? 247  GLN C OE1 1 
ATOM   5687 N  NE2 . GLN C 1 245 ? -49.238 -40.174 -29.120 1.00 26.68 ? 247  GLN C NE2 1 
ATOM   5688 N  N   . PRO C 1 246 ? -44.661 -42.130 -32.245 1.00 24.21 ? 248  PRO C N   1 
ATOM   5689 C  CA  . PRO C 1 246 ? -43.533 -42.631 -33.013 1.00 24.72 ? 248  PRO C CA  1 
ATOM   5690 C  C   . PRO C 1 246 ? -42.916 -41.569 -33.923 1.00 25.60 ? 248  PRO C C   1 
ATOM   5691 O  O   . PRO C 1 246 ? -43.640 -40.739 -34.494 1.00 25.38 ? 248  PRO C O   1 
ATOM   5692 C  CB  . PRO C 1 246 ? -44.137 -43.776 -33.841 1.00 24.96 ? 248  PRO C CB  1 
ATOM   5693 C  CG  . PRO C 1 246 ? -45.584 -43.509 -33.883 1.00 24.33 ? 248  PRO C CG  1 
ATOM   5694 C  CD  . PRO C 1 246 ? -45.928 -42.783 -32.625 1.00 24.60 ? 248  PRO C CD  1 
ATOM   5695 N  N   . LEU C 1 247 ? -41.590 -41.610 -34.037 1.00 25.24 ? 249  LEU C N   1 
ATOM   5696 C  CA  . LEU C 1 247 ? -40.845 -40.665 -34.851 1.00 25.43 ? 249  LEU C CA  1 
ATOM   5697 C  C   . LEU C 1 247 ? -41.134 -40.842 -36.333 1.00 25.58 ? 249  LEU C C   1 
ATOM   5698 O  O   . LEU C 1 247 ? -41.075 -39.871 -37.097 1.00 24.49 ? 249  LEU C O   1 
ATOM   5699 C  CB  . LEU C 1 247 ? -39.336 -40.791 -34.589 1.00 25.47 ? 249  LEU C CB  1 
ATOM   5700 C  CG  . LEU C 1 247 ? -38.818 -40.233 -33.244 1.00 25.71 ? 249  LEU C CG  1 
ATOM   5701 C  CD1 . LEU C 1 247 ? -37.338 -40.539 -33.060 1.00 26.13 ? 249  LEU C CD1 1 
ATOM   5702 C  CD2 . LEU C 1 247 ? -39.028 -38.732 -33.174 1.00 27.02 ? 249  LEU C CD2 1 
ATOM   5703 N  N   . ASN C 1 248 ? -41.413 -42.088 -36.740 1.00 25.03 ? 250  ASN C N   1 
ATOM   5704 C  CA  . ASN C 1 248 ? -41.680 -42.431 -38.139 1.00 24.22 ? 250  ASN C CA  1 
ATOM   5705 C  C   . ASN C 1 248 ? -40.666 -41.887 -39.101 1.00 23.68 ? 250  ASN C C   1 
ATOM   5706 O  O   . ASN C 1 248 ? -41.016 -41.312 -40.110 1.00 24.82 ? 250  ASN C O   1 
ATOM   5707 C  CB  . ASN C 1 248 ? -43.107 -42.019 -38.545 1.00 24.89 ? 250  ASN C CB  1 
ATOM   5708 C  CG  . ASN C 1 248 ? -44.152 -42.858 -37.862 1.00 25.87 ? 250  ASN C CG  1 
ATOM   5709 O  OD1 . ASN C 1 248 ? -43.956 -44.060 -37.702 1.00 28.91 ? 250  ASN C OD1 1 
ATOM   5710 N  ND2 . ASN C 1 248 ? -45.246 -42.251 -37.439 1.00 24.95 ? 250  ASN C ND2 1 
ATOM   5711 N  N   . GLY C 1 249 ? -39.394 -42.077 -38.775 1.00 23.90 ? 251  GLY C N   1 
ATOM   5712 C  CA  . GLY C 1 249 ? -38.294 -41.636 -39.634 1.00 23.37 ? 251  GLY C CA  1 
ATOM   5713 C  C   . GLY C 1 249 ? -37.721 -40.257 -39.325 1.00 22.77 ? 251  GLY C C   1 
ATOM   5714 O  O   . GLY C 1 249 ? -36.643 -39.928 -39.811 1.00 22.98 ? 251  GLY C O   1 
ATOM   5715 N  N   . ARG C 1 250 ? -38.432 -39.433 -38.557 1.00 22.15 ? 252  ARG C N   1 
ATOM   5716 C  CA  . ARG C 1 250 ? -37.891 -38.140 -38.122 1.00 21.19 ? 252  ARG C CA  1 
ATOM   5717 C  C   . ARG C 1 250 ? -36.637 -38.388 -37.276 1.00 22.73 ? 252  ARG C C   1 
ATOM   5718 O  O   . ARG C 1 250 ? -36.661 -39.257 -36.388 1.00 23.29 ? 252  ARG C O   1 
ATOM   5719 C  CB  . ARG C 1 250 ? -38.913 -37.366 -37.281 1.00 20.10 ? 252  ARG C CB  1 
ATOM   5720 C  CG  . ARG C 1 250 ? -40.069 -36.785 -38.068 1.00 19.26 ? 252  ARG C CG  1 
ATOM   5721 C  CD  . ARG C 1 250 ? -41.090 -36.164 -37.160 1.00 18.02 ? 252  ARG C CD  1 
ATOM   5722 N  NE  . ARG C 1 250 ? -41.793 -37.178 -36.369 1.00 18.13 ? 252  ARG C NE  1 
ATOM   5723 C  CZ  . ARG C 1 250 ? -42.673 -36.915 -35.416 1.00 17.24 ? 252  ARG C CZ  1 
ATOM   5724 N  NH1 . ARG C 1 250 ? -42.986 -35.665 -35.118 1.00 17.70 ? 252  ARG C NH1 1 
ATOM   5725 N  NH2 . ARG C 1 250 ? -43.268 -37.911 -34.764 1.00 17.51 ? 252  ARG C NH2 1 
ATOM   5726 N  N   . VAL C 1 251 ? -35.564 -37.650 -37.567 1.00 22.45 ? 253  VAL C N   1 
ATOM   5727 C  CA  . VAL C 1 251 ? -34.363 -37.640 -36.739 1.00 23.32 ? 253  VAL C CA  1 
ATOM   5728 C  C   . VAL C 1 251 ? -34.372 -36.371 -35.879 1.00 24.04 ? 253  VAL C C   1 
ATOM   5729 O  O   . VAL C 1 251 ? -34.440 -35.255 -36.405 1.00 23.62 ? 253  VAL C O   1 
ATOM   5730 C  CB  . VAL C 1 251 ? -33.078 -37.651 -37.582 1.00 23.35 ? 253  VAL C CB  1 
ATOM   5731 C  CG1 . VAL C 1 251 ? -31.847 -37.584 -36.677 1.00 24.08 ? 253  VAL C CG1 1 
ATOM   5732 C  CG2 . VAL C 1 251 ? -33.024 -38.900 -38.453 1.00 23.20 ? 253  VAL C CG2 1 
ATOM   5733 N  N   . ILE C 1 252 ? -34.252 -36.554 -34.567 1.00 23.86 ? 254  ILE C N   1 
ATOM   5734 C  CA  . ILE C 1 252 ? -34.171 -35.435 -33.635 1.00 24.44 ? 254  ILE C CA  1 
ATOM   5735 C  C   . ILE C 1 252 ? -32.785 -34.819 -33.749 1.00 24.40 ? 254  ILE C C   1 
ATOM   5736 O  O   . ILE C 1 252 ? -31.786 -35.541 -33.767 1.00 22.97 ? 254  ILE C O   1 
ATOM   5737 C  CB  . ILE C 1 252 ? -34.440 -35.891 -32.194 1.00 25.21 ? 254  ILE C CB  1 
ATOM   5738 C  CG1 . ILE C 1 252 ? -35.805 -36.591 -32.134 1.00 25.65 ? 254  ILE C CG1 1 
ATOM   5739 C  CG2 . ILE C 1 252 ? -34.421 -34.704 -31.250 1.00 24.58 ? 254  ILE C CG2 1 
ATOM   5740 C  CD1 . ILE C 1 252 ? -36.185 -37.099 -30.777 1.00 26.86 ? 254  ILE C CD1 1 
ATOM   5741 N  N   . GLU C 1 253 ? -32.724 -33.492 -33.862 1.00 22.75 ? 255  GLU C N   1 
ATOM   5742 C  CA  . GLU C 1 253 ? -31.443 -32.796 -33.991 1.00 22.75 ? 255  GLU C CA  1 
ATOM   5743 C  C   . GLU C 1 253 ? -31.051 -32.267 -32.631 1.00 22.30 ? 255  GLU C C   1 
ATOM   5744 O  O   . GLU C 1 253 ? -31.931 -31.964 -31.836 1.00 21.36 ? 255  GLU C O   1 
ATOM   5745 C  CB  . GLU C 1 253 ? -31.529 -31.684 -35.013 1.00 24.07 ? 255  GLU C CB  1 
ATOM   5746 C  CG  . GLU C 1 253 ? -31.677 -32.242 -36.427 1.00 26.69 ? 255  GLU C CG  1 
ATOM   5747 C  CD  . GLU C 1 253 ? -31.902 -31.181 -37.479 1.00 29.65 ? 255  GLU C CD  1 
ATOM   5748 O  OE1 . GLU C 1 253 ? -31.419 -30.049 -37.328 1.00 29.88 ? 255  GLU C OE1 1 
ATOM   5749 O  OE2 . GLU C 1 253 ? -32.591 -31.487 -38.475 1.00 38.99 ? 255  GLU C OE2 1 
ATOM   5750 N  N   . ALA C 1 254 ? -29.746 -32.222 -32.359 1.00 20.45 ? 256  ALA C N   1 
ATOM   5751 C  CA  . ALA C 1 254 ? -29.207 -31.643 -31.114 1.00 21.38 ? 256  ALA C CA  1 
ATOM   5752 C  C   . ALA C 1 254 ? -28.270 -30.502 -31.479 1.00 20.49 ? 256  ALA C C   1 
ATOM   5753 O  O   . ALA C 1 254 ? -27.488 -30.631 -32.430 1.00 21.89 ? 256  ALA C O   1 
ATOM   5754 C  CB  . ALA C 1 254 ? -28.464 -32.696 -30.300 1.00 21.20 ? 256  ALA C CB  1 
ATOM   5755 N  N   . SER C 1 255 ? -28.348 -29.384 -30.743 1.00 20.11 ? 257  SER C N   1 
ATOM   5756 C  CA  . SER C 1 255 ? -27.466 -28.212 -30.989 1.00 20.23 ? 257  SER C CA  1 
ATOM   5757 C  C   . SER C 1 255 ? -26.047 -28.346 -30.390 1.00 19.80 ? 257  SER C C   1 
ATOM   5758 O  O   . SER C 1 255 ? -25.246 -27.411 -30.468 1.00 17.87 ? 257  SER C O   1 
ATOM   5759 C  CB  . SER C 1 255 ? -28.102 -26.928 -30.423 1.00 20.10 ? 257  SER C CB  1 
ATOM   5760 O  OG  . SER C 1 255 ? -28.212 -27.003 -29.012 1.00 20.45 ? 257  SER C OG  1 
ATOM   5761 N  N   . PHE C 1 256 ? -25.758 -29.504 -29.806 1.00 20.33 ? 258  PHE C N   1 
ATOM   5762 C  CA  . PHE C 1 256 ? -24.541 -29.734 -29.027 1.00 22.41 ? 258  PHE C CA  1 
ATOM   5763 C  C   . PHE C 1 256 ? -24.123 -31.191 -29.253 1.00 23.23 ? 258  PHE C C   1 
ATOM   5764 O  O   . PHE C 1 256 ? -24.981 -32.045 -29.478 1.00 21.90 ? 258  PHE C O   1 
ATOM   5765 C  CB  . PHE C 1 256 ? -24.804 -29.466 -27.534 1.00 21.61 ? 258  PHE C CB  1 
ATOM   5766 C  CG  . PHE C 1 256 ? -25.896 -30.318 -26.964 1.00 22.92 ? 258  PHE C CG  1 
ATOM   5767 C  CD1 . PHE C 1 256 ? -27.234 -29.934 -27.088 1.00 22.66 ? 258  PHE C CD1 1 
ATOM   5768 C  CD2 . PHE C 1 256 ? -25.599 -31.554 -26.382 1.00 22.39 ? 258  PHE C CD2 1 
ATOM   5769 C  CE1 . PHE C 1 256 ? -28.248 -30.741 -26.604 1.00 23.34 ? 258  PHE C CE1 1 
ATOM   5770 C  CE2 . PHE C 1 256 ? -26.613 -32.364 -25.900 1.00 24.01 ? 258  PHE C CE2 1 
ATOM   5771 C  CZ  . PHE C 1 256 ? -27.947 -31.953 -26.011 1.00 23.17 ? 258  PHE C CZ  1 
ATOM   5772 N  N   . PRO C 1 257 ? -22.811 -31.474 -29.200 1.00 26.68 ? 259  PRO C N   1 
ATOM   5773 C  CA  . PRO C 1 257 ? -22.303 -32.828 -29.448 1.00 27.47 ? 259  PRO C CA  1 
ATOM   5774 C  C   . PRO C 1 257 ? -22.414 -33.781 -28.251 1.00 28.92 ? 259  PRO C C   1 
ATOM   5775 O  O   . PRO C 1 257 ? -22.372 -34.996 -28.458 1.00 32.08 ? 259  PRO C O   1 
ATOM   5776 C  CB  . PRO C 1 257 ? -20.839 -32.573 -29.802 1.00 27.93 ? 259  PRO C CB  1 
ATOM   5777 C  CG  . PRO C 1 257 ? -20.480 -31.374 -29.016 1.00 27.34 ? 259  PRO C CG  1 
ATOM   5778 C  CD  . PRO C 1 257 ? -21.707 -30.508 -29.026 1.00 26.95 ? 259  PRO C CD  1 
ATOM   5779 O  OXT . PRO C 1 257 ? -22.556 -33.422 -27.072 1.00 28.36 ? 259  PRO C OXT 1 
ATOM   5780 N  N   . TRP D 1 7   ? -51.954 13.755  -8.178  1.00 35.48 ? 9    TRP D N   1 
ATOM   5781 C  CA  . TRP D 1 7   ? -52.471 15.076  -7.674  1.00 34.29 ? 9    TRP D CA  1 
ATOM   5782 C  C   . TRP D 1 7   ? -52.288 16.189  -8.696  1.00 35.18 ? 9    TRP D C   1 
ATOM   5783 O  O   . TRP D 1 7   ? -51.385 16.129  -9.547  1.00 33.12 ? 9    TRP D O   1 
ATOM   5784 C  CB  . TRP D 1 7   ? -51.796 15.497  -6.351  1.00 32.83 ? 9    TRP D CB  1 
ATOM   5785 C  CG  . TRP D 1 7   ? -50.346 15.941  -6.469  1.00 30.28 ? 9    TRP D CG  1 
ATOM   5786 C  CD1 . TRP D 1 7   ? -49.241 15.157  -6.325  1.00 29.76 ? 9    TRP D CD1 1 
ATOM   5787 C  CD2 . TRP D 1 7   ? -49.860 17.268  -6.746  1.00 29.62 ? 9    TRP D CD2 1 
ATOM   5788 N  NE1 . TRP D 1 7   ? -48.101 15.909  -6.496  1.00 30.31 ? 9    TRP D NE1 1 
ATOM   5789 C  CE2 . TRP D 1 7   ? -48.454 17.206  -6.756  1.00 29.21 ? 9    TRP D CE2 1 
ATOM   5790 C  CE3 . TRP D 1 7   ? -50.479 18.498  -6.986  1.00 29.76 ? 9    TRP D CE3 1 
ATOM   5791 C  CZ2 . TRP D 1 7   ? -47.657 18.325  -6.997  1.00 29.48 ? 9    TRP D CZ2 1 
ATOM   5792 C  CZ3 . TRP D 1 7   ? -49.683 19.611  -7.228  1.00 30.93 ? 9    TRP D CZ3 1 
ATOM   5793 C  CH2 . TRP D 1 7   ? -48.289 19.515  -7.231  1.00 29.81 ? 9    TRP D CH2 1 
ATOM   5794 N  N   . ARG D 1 8   ? -53.115 17.220  -8.572  1.00 34.87 ? 10   ARG D N   1 
ATOM   5795 C  CA  . ARG D 1 8   ? -52.991 18.408  -9.404  1.00 38.35 ? 10   ARG D CA  1 
ATOM   5796 C  C   . ARG D 1 8   ? -53.529 19.647  -8.702  1.00 37.91 ? 10   ARG D C   1 
ATOM   5797 O  O   . ARG D 1 8   ? -54.168 19.562  -7.647  1.00 36.03 ? 10   ARG D O   1 
ATOM   5798 C  CB  . ARG D 1 8   ? -53.745 18.207  -10.714 1.00 42.94 ? 10   ARG D CB  1 
ATOM   5799 C  CG  . ARG D 1 8   ? -55.106 17.572  -10.524 1.00 47.37 ? 10   ARG D CG  1 
ATOM   5800 C  CD  . ARG D 1 8   ? -56.102 18.030  -11.564 1.00 53.30 ? 10   ARG D CD  1 
ATOM   5801 N  NE  . ARG D 1 8   ? -57.336 17.257  -11.450 1.00 60.35 ? 10   ARG D NE  1 
ATOM   5802 C  CZ  . ARG D 1 8   ? -58.462 17.494  -12.124 1.00 66.17 ? 10   ARG D CZ  1 
ATOM   5803 N  NH1 . ARG D 1 8   ? -58.548 18.509  -12.990 1.00 68.50 ? 10   ARG D NH1 1 
ATOM   5804 N  NH2 . ARG D 1 8   ? -59.519 16.702  -11.928 1.00 65.12 ? 10   ARG D NH2 1 
ATOM   5805 N  N   . TYR D 1 9   ? -53.242 20.790  -9.312  1.00 36.11 ? 11   TYR D N   1 
ATOM   5806 C  CA  . TYR D 1 9   ? -53.829 22.057  -8.927  1.00 37.17 ? 11   TYR D CA  1 
ATOM   5807 C  C   . TYR D 1 9   ? -55.244 22.159  -9.483  1.00 40.83 ? 11   TYR D C   1 
ATOM   5808 O  O   . TYR D 1 9   ? -55.520 21.632  -10.555 1.00 42.86 ? 11   TYR D O   1 
ATOM   5809 C  CB  . TYR D 1 9   ? -52.977 23.220  -9.440  1.00 34.54 ? 11   TYR D CB  1 
ATOM   5810 C  CG  . TYR D 1 9   ? -51.631 23.323  -8.749  1.00 33.53 ? 11   TYR D CG  1 
ATOM   5811 C  CD1 . TYR D 1 9   ? -51.540 23.734  -7.413  1.00 31.93 ? 11   TYR D CD1 1 
ATOM   5812 C  CD2 . TYR D 1 9   ? -50.448 23.013  -9.420  1.00 31.54 ? 11   TYR D CD2 1 
ATOM   5813 C  CE1 . TYR D 1 9   ? -50.315 23.832  -6.768  1.00 30.07 ? 11   TYR D CE1 1 
ATOM   5814 C  CE2 . TYR D 1 9   ? -49.216 23.121  -8.778  1.00 31.28 ? 11   TYR D CE2 1 
ATOM   5815 C  CZ  . TYR D 1 9   ? -49.161 23.526  -7.452  1.00 29.74 ? 11   TYR D CZ  1 
ATOM   5816 O  OH  . TYR D 1 9   ? -47.944 23.618  -6.824  1.00 27.88 ? 11   TYR D OH  1 
ATOM   5817 N  N   . GLY D 1 10  ? -56.124 22.819  -8.730  1.00 44.21 ? 12   GLY D N   1 
ATOM   5818 C  CA  . GLY D 1 10  ? -57.484 23.135  -9.167  1.00 49.29 ? 12   GLY D CA  1 
ATOM   5819 C  C   . GLY D 1 10  ? -58.361 21.954  -9.546  1.00 55.05 ? 12   GLY D C   1 
ATOM   5820 O  O   . GLY D 1 10  ? -59.086 22.022  -10.543 1.00 60.87 ? 12   GLY D O   1 
ATOM   5821 N  N   . GLY D 1 11  ? -58.298 20.874  -8.765  1.00 58.17 ? 13   GLY D N   1 
ATOM   5822 C  CA  . GLY D 1 11  ? -59.092 19.673  -9.041  1.00 55.58 ? 13   GLY D CA  1 
ATOM   5823 C  C   . GLY D 1 11  ? -58.679 18.434  -8.266  1.00 55.99 ? 13   GLY D C   1 
ATOM   5824 O  O   . GLY D 1 11  ? -57.678 18.440  -7.547  1.00 53.15 ? 13   GLY D O   1 
ATOM   5825 N  N   . ASP D 1 12  ? -59.462 17.370  -8.442  1.00 54.24 ? 14   ASP D N   1 
ATOM   5826 C  CA  . ASP D 1 12  ? -59.282 16.093  -7.740  1.00 54.58 ? 14   ASP D CA  1 
ATOM   5827 C  C   . ASP D 1 12  ? -58.042 15.326  -8.244  1.00 53.07 ? 14   ASP D C   1 
ATOM   5828 O  O   . ASP D 1 12  ? -57.576 15.598  -9.354  1.00 54.48 ? 14   ASP D O   1 
ATOM   5829 C  CB  . ASP D 1 12  ? -60.540 15.222  -7.921  1.00 57.35 ? 14   ASP D CB  1 
ATOM   5830 C  CG  . ASP D 1 12  ? -61.758 15.792  -7.211  1.00 59.05 ? 14   ASP D CG  1 
ATOM   5831 O  OD1 . ASP D 1 12  ? -61.636 16.310  -6.083  1.00 59.72 ? 14   ASP D OD1 1 
ATOM   5832 O  OD2 . ASP D 1 12  ? -62.858 15.714  -7.787  1.00 67.88 ? 14   ASP D OD2 1 
ATOM   5833 N  N   . PRO D 1 13  ? -57.498 14.372  -7.471  1.00 48.38 ? 15   PRO D N   1 
ATOM   5834 C  CA  . PRO D 1 13  ? -57.990 13.949  -6.139  1.00 45.33 ? 15   PRO D CA  1 
ATOM   5835 C  C   . PRO D 1 13  ? -57.770 14.977  -4.998  1.00 41.91 ? 15   PRO D C   1 
ATOM   5836 O  O   . PRO D 1 13  ? -56.792 15.736  -5.044  1.00 37.30 ? 15   PRO D O   1 
ATOM   5837 C  CB  . PRO D 1 13  ? -57.170 12.673  -5.868  1.00 45.48 ? 15   PRO D CB  1 
ATOM   5838 C  CG  . PRO D 1 13  ? -55.900 12.870  -6.632  1.00 45.24 ? 15   PRO D CG  1 
ATOM   5839 C  CD  . PRO D 1 13  ? -56.298 13.611  -7.881  1.00 46.04 ? 15   PRO D CD  1 
ATOM   5840 N  N   . PRO D 1 14  ? -58.678 15.005  -3.981  1.00 40.28 ? 16   PRO D N   1 
ATOM   5841 C  CA  . PRO D 1 14  ? -58.425 15.811  -2.774  1.00 36.79 ? 16   PRO D CA  1 
ATOM   5842 C  C   . PRO D 1 14  ? -57.056 15.469  -2.183  1.00 32.64 ? 16   PRO D C   1 
ATOM   5843 O  O   . PRO D 1 14  ? -56.744 14.300  -1.991  1.00 31.18 ? 16   PRO D O   1 
ATOM   5844 C  CB  . PRO D 1 14  ? -59.555 15.400  -1.814  1.00 37.85 ? 16   PRO D CB  1 
ATOM   5845 C  CG  . PRO D 1 14  ? -60.646 14.882  -2.689  1.00 39.27 ? 16   PRO D CG  1 
ATOM   5846 C  CD  . PRO D 1 14  ? -59.969 14.287  -3.896  1.00 40.82 ? 16   PRO D CD  1 
ATOM   5847 N  N   . TRP D 1 15  ? -56.235 16.490  -1.945  1.00 30.33 ? 17   TRP D N   1 
ATOM   5848 C  CA  . TRP D 1 15  ? -54.876 16.289  -1.443  1.00 27.53 ? 17   TRP D CA  1 
ATOM   5849 C  C   . TRP D 1 15  ? -54.804 15.454  -0.135  1.00 28.42 ? 17   TRP D C   1 
ATOM   5850 O  O   . TRP D 1 15  ? -53.913 14.604  -0.011  1.00 25.73 ? 17   TRP D O   1 
ATOM   5851 C  CB  . TRP D 1 15  ? -54.166 17.636  -1.296  1.00 26.71 ? 17   TRP D CB  1 
ATOM   5852 C  CG  . TRP D 1 15  ? -53.750 18.273  -2.595  1.00 25.81 ? 17   TRP D CG  1 
ATOM   5853 C  CD1 . TRP D 1 15  ? -54.146 17.924  -3.872  1.00 24.71 ? 17   TRP D CD1 1 
ATOM   5854 C  CD2 . TRP D 1 15  ? -52.873 19.382  -2.737  1.00 24.76 ? 17   TRP D CD2 1 
ATOM   5855 N  NE1 . TRP D 1 15  ? -53.542 18.746  -4.786  1.00 26.80 ? 17   TRP D NE1 1 
ATOM   5856 C  CE2 . TRP D 1 15  ? -52.755 19.651  -4.126  1.00 25.26 ? 17   TRP D CE2 1 
ATOM   5857 C  CE3 . TRP D 1 15  ? -52.153 20.169  -1.828  1.00 24.88 ? 17   TRP D CE3 1 
ATOM   5858 C  CZ2 . TRP D 1 15  ? -51.947 20.681  -4.630  1.00 25.90 ? 17   TRP D CZ2 1 
ATOM   5859 C  CZ3 . TRP D 1 15  ? -51.352 21.202  -2.325  1.00 25.50 ? 17   TRP D CZ3 1 
ATOM   5860 C  CH2 . TRP D 1 15  ? -51.253 21.444  -3.721  1.00 25.34 ? 17   TRP D CH2 1 
ATOM   5861 N  N   . PRO D 1 16  ? -55.754 15.650  0.821   1.00 29.30 ? 18   PRO D N   1 
ATOM   5862 C  CA  . PRO D 1 16  ? -55.745 14.780  2.024   1.00 30.46 ? 18   PRO D CA  1 
ATOM   5863 C  C   . PRO D 1 16  ? -55.935 13.274  1.730   1.00 31.04 ? 18   PRO D C   1 
ATOM   5864 O  O   . PRO D 1 16  ? -55.440 12.443  2.497   1.00 31.09 ? 18   PRO D O   1 
ATOM   5865 C  CB  . PRO D 1 16  ? -56.898 15.334  2.876   1.00 30.67 ? 18   PRO D CB  1 
ATOM   5866 C  CG  . PRO D 1 16  ? -56.980 16.759  2.462   1.00 31.65 ? 18   PRO D CG  1 
ATOM   5867 C  CD  . PRO D 1 16  ? -56.730 16.738  0.968   1.00 31.39 ? 18   PRO D CD  1 
ATOM   5868 N  N   . ARG D 1 17  ? -56.638 12.944  0.639   1.00 31.06 ? 19   ARG D N   1 
ATOM   5869 C  CA  . ARG D 1 17  ? -56.744 11.563  0.147   1.00 32.63 ? 19   ARG D CA  1 
ATOM   5870 C  C   . ARG D 1 17  ? -55.382 11.066  -0.331  1.00 32.84 ? 19   ARG D C   1 
ATOM   5871 O  O   . ARG D 1 17  ? -55.030 9.925   -0.079  1.00 36.03 ? 19   ARG D O   1 
ATOM   5872 C  CB  . ARG D 1 17  ? -57.780 11.455  -0.996  1.00 32.20 ? 19   ARG D CB  1 
ATOM   5873 N  N   . VAL D 1 18  ? -54.620 11.932  -0.996  1.00 32.66 ? 20   VAL D N   1 
ATOM   5874 C  CA  . VAL D 1 18  ? -53.262 11.596  -1.469  1.00 35.02 ? 20   VAL D CA  1 
ATOM   5875 C  C   . VAL D 1 18  ? -52.258 11.465  -0.313  1.00 33.29 ? 20   VAL D C   1 
ATOM   5876 O  O   . VAL D 1 18  ? -51.505 10.477  -0.242  1.00 32.37 ? 20   VAL D O   1 
ATOM   5877 C  CB  . VAL D 1 18  ? -52.720 12.632  -2.493  1.00 35.95 ? 20   VAL D CB  1 
ATOM   5878 C  CG1 . VAL D 1 18  ? -51.323 12.227  -2.981  1.00 37.00 ? 20   VAL D CG1 1 
ATOM   5879 C  CG2 . VAL D 1 18  ? -53.685 12.788  -3.666  1.00 37.08 ? 20   VAL D CG2 1 
ATOM   5880 N  N   . SER D 1 19  ? -52.236 12.471  0.569   1.00 31.13 ? 21   SER D N   1 
ATOM   5881 C  CA  . SER D 1 19  ? -51.383 12.452  1.758   1.00 28.75 ? 21   SER D CA  1 
ATOM   5882 C  C   . SER D 1 19  ? -52.123 13.081  2.944   1.00 26.91 ? 21   SER D C   1 
ATOM   5883 O  O   . SER D 1 19  ? -52.501 14.262  2.871   1.00 23.94 ? 21   SER D O   1 
ATOM   5884 C  CB  . SER D 1 19  ? -50.103 13.216  1.502   1.00 29.65 ? 21   SER D CB  1 
ATOM   5885 O  OG  . SER D 1 19  ? -49.343 13.322  2.713   1.00 33.40 ? 21   SER D OG  1 
ATOM   5886 N  N   . PRO D 1 20  ? -52.322 12.307  4.033   1.00 26.14 ? 22   PRO D N   1 
ATOM   5887 C  CA  . PRO D 1 20  ? -52.989 12.842  5.236   1.00 27.03 ? 22   PRO D CA  1 
ATOM   5888 C  C   . PRO D 1 20  ? -52.352 14.127  5.779   1.00 25.62 ? 22   PRO D C   1 
ATOM   5889 O  O   . PRO D 1 20  ? -53.045 14.976  6.331   1.00 24.04 ? 22   PRO D O   1 
ATOM   5890 C  CB  . PRO D 1 20  ? -52.841 11.699  6.250   1.00 26.90 ? 22   PRO D CB  1 
ATOM   5891 C  CG  . PRO D 1 20  ? -52.819 10.465  5.411   1.00 27.49 ? 22   PRO D CG  1 
ATOM   5892 C  CD  . PRO D 1 20  ? -52.088 10.850  4.155   1.00 26.97 ? 22   PRO D CD  1 
ATOM   5893 N  N   . ALA D 1 21  ? -51.041 14.258  5.607   1.00 24.20 ? 23   ALA D N   1 
ATOM   5894 C  CA  . ALA D 1 21  ? -50.315 15.433  6.075   1.00 23.56 ? 23   ALA D CA  1 
ATOM   5895 C  C   . ALA D 1 21  ? -50.788 16.749  5.414   1.00 22.38 ? 23   ALA D C   1 
ATOM   5896 O  O   . ALA D 1 21  ? -50.605 17.827  5.993   1.00 22.10 ? 23   ALA D O   1 
ATOM   5897 C  CB  . ALA D 1 21  ? -48.815 15.230  5.872   1.00 22.93 ? 23   ALA D CB  1 
ATOM   5898 N  N   . CYS D 1 22  ? -51.398 16.664  4.223   1.00 20.87 ? 24   CYS D N   1 
ATOM   5899 C  CA  . CYS D 1 22  ? -52.002 17.836  3.579   1.00 20.45 ? 24   CYS D CA  1 
ATOM   5900 C  C   . CYS D 1 22  ? -53.193 18.454  4.348   1.00 19.23 ? 24   CYS D C   1 
ATOM   5901 O  O   . CYS D 1 22  ? -53.637 19.530  3.988   1.00 19.02 ? 24   CYS D O   1 
ATOM   5902 C  CB  . CYS D 1 22  ? -52.422 17.521  2.147   1.00 21.79 ? 24   CYS D CB  1 
ATOM   5903 S  SG  . CYS D 1 22  ? -51.034 17.112  1.050   1.00 22.78 ? 24   CYS D SG  1 
ATOM   5904 N  N   . ALA D 1 23  ? -53.702 17.750  5.355   1.00 18.89 ? 25   ALA D N   1 
ATOM   5905 C  CA  . ALA D 1 23  ? -54.729 18.272  6.267   1.00 18.90 ? 25   ALA D CA  1 
ATOM   5906 C  C   . ALA D 1 23  ? -54.153 18.607  7.633   1.00 19.05 ? 25   ALA D C   1 
ATOM   5907 O  O   . ALA D 1 23  ? -54.913 18.735  8.603   1.00 17.92 ? 25   ALA D O   1 
ATOM   5908 C  CB  . ALA D 1 23  ? -55.837 17.260  6.417   1.00 18.58 ? 25   ALA D CB  1 
ATOM   5909 N  N   . GLY D 1 24  ? -52.827 18.785  7.714   1.00 17.89 ? 26   GLY D N   1 
ATOM   5910 C  CA  . GLY D 1 24  ? -52.200 19.204  8.972   1.00 17.84 ? 26   GLY D CA  1 
ATOM   5911 C  C   . GLY D 1 24  ? -52.575 20.630  9.357   1.00 17.34 ? 26   GLY D C   1 
ATOM   5912 O  O   . GLY D 1 24  ? -52.973 21.434  8.510   1.00 17.21 ? 26   GLY D O   1 
ATOM   5913 N  N   . ARG D 1 25  ? -52.427 20.942  10.643  1.00 16.32 ? 27   ARG D N   1 
ATOM   5914 C  CA  . ARG D 1 25  ? -52.768 22.265  11.173  1.00 15.73 ? 27   ARG D CA  1 
ATOM   5915 C  C   . ARG D 1 25  ? -51.792 23.352  10.734  1.00 16.07 ? 27   ARG D C   1 
ATOM   5916 O  O   . ARG D 1 25  ? -52.147 24.534  10.730  1.00 15.54 ? 27   ARG D O   1 
ATOM   5917 C  CB  . ARG D 1 25  ? -52.828 22.217  12.711  1.00 15.15 ? 27   ARG D CB  1 
ATOM   5918 C  CG  . ARG D 1 25  ? -53.463 23.449  13.358  1.00 14.88 ? 27   ARG D CG  1 
ATOM   5919 C  CD  . ARG D 1 25  ? -53.661 23.347  14.872  1.00 14.57 ? 27   ARG D CD  1 
ATOM   5920 N  NE  . ARG D 1 25  ? -53.883 24.696  15.414  1.00 14.56 ? 27   ARG D NE  1 
ATOM   5921 C  CZ  . ARG D 1 25  ? -55.020 25.397  15.342  1.00 14.20 ? 27   ARG D CZ  1 
ATOM   5922 N  NH1 . ARG D 1 25  ? -56.115 24.888  14.806  1.00 14.53 ? 27   ARG D NH1 1 
ATOM   5923 N  NH2 . ARG D 1 25  ? -55.062 26.641  15.818  1.00 14.57 ? 27   ARG D NH2 1 
ATOM   5924 N  N   . PHE D 1 26  ? -50.554 22.970  10.398  1.00 16.03 ? 28   PHE D N   1 
ATOM   5925 C  CA  . PHE D 1 26  ? -49.452 23.950  10.248  1.00 16.27 ? 28   PHE D CA  1 
ATOM   5926 C  C   . PHE D 1 26  ? -48.820 23.878  8.869   1.00 17.02 ? 28   PHE D C   1 
ATOM   5927 O  O   . PHE D 1 26  ? -47.658 23.448  8.692   1.00 16.46 ? 28   PHE D O   1 
ATOM   5928 C  CB  . PHE D 1 26  ? -48.437 23.717  11.348  1.00 16.49 ? 28   PHE D CB  1 
ATOM   5929 C  CG  . PHE D 1 26  ? -49.023 23.812  12.730  1.00 17.27 ? 28   PHE D CG  1 
ATOM   5930 C  CD1 . PHE D 1 26  ? -49.524 25.034  13.199  1.00 17.56 ? 28   PHE D CD1 1 
ATOM   5931 C  CD2 . PHE D 1 26  ? -49.068 22.712  13.569  1.00 17.70 ? 28   PHE D CD2 1 
ATOM   5932 C  CE1 . PHE D 1 26  ? -50.075 25.139  14.471  1.00 16.97 ? 28   PHE D CE1 1 
ATOM   5933 C  CE2 . PHE D 1 26  ? -49.603 22.819  14.857  1.00 17.73 ? 28   PHE D CE2 1 
ATOM   5934 C  CZ  . PHE D 1 26  ? -50.097 24.041  15.301  1.00 17.74 ? 28   PHE D CZ  1 
ATOM   5935 N  N   . GLN D 1 27  ? -49.616 24.288  7.901   1.00 16.50 ? 29   GLN D N   1 
ATOM   5936 C  CA  . GLN D 1 27  ? -49.282 24.154  6.477   1.00 17.26 ? 29   GLN D CA  1 
ATOM   5937 C  C   . GLN D 1 27  ? -48.724 25.434  5.866   1.00 16.83 ? 29   GLN D C   1 
ATOM   5938 O  O   . GLN D 1 27  ? -48.755 26.520  6.487   1.00 16.63 ? 29   GLN D O   1 
ATOM   5939 C  CB  . GLN D 1 27  ? -50.526 23.728  5.710   1.00 17.75 ? 29   GLN D CB  1 
ATOM   5940 C  CG  . GLN D 1 27  ? -51.050 22.357  6.096   1.00 18.75 ? 29   GLN D CG  1 
ATOM   5941 C  CD  . GLN D 1 27  ? -50.288 21.237  5.407   1.00 19.21 ? 29   GLN D CD  1 
ATOM   5942 O  OE1 . GLN D 1 27  ? -50.476 20.978  4.206   1.00 19.86 ? 29   GLN D OE1 1 
ATOM   5943 N  NE2 . GLN D 1 27  ? -49.435 20.570  6.155   1.00 17.78 ? 29   GLN D NE2 1 
ATOM   5944 N  N   . SER D 1 28  ? -48.195 25.292  4.646   1.00 15.96 ? 30   SER D N   1 
ATOM   5945 C  CA  . SER D 1 28  ? -47.621 26.384  3.878   1.00 15.44 ? 30   SER D CA  1 
ATOM   5946 C  C   . SER D 1 28  ? -48.286 26.392  2.498   1.00 15.16 ? 30   SER D C   1 
ATOM   5947 O  O   . SER D 1 28  ? -48.807 25.360  2.091   1.00 15.42 ? 30   SER D O   1 
ATOM   5948 C  CB  . SER D 1 28  ? -46.107 26.187  3.749   1.00 15.44 ? 30   SER D CB  1 
ATOM   5949 O  OG  . SER D 1 28  ? -45.440 26.357  4.991   1.00 14.28 ? 30   SER D OG  1 
ATOM   5950 N  N   . PRO D 1 29  ? -48.308 27.518  1.770   1.00 15.10 ? 31   PRO D N   1 
ATOM   5951 C  CA  . PRO D 1 29  ? -47.743 28.798  2.164   1.00 16.12 ? 31   PRO D CA  1 
ATOM   5952 C  C   . PRO D 1 29  ? -48.673 29.596  3.091   1.00 16.75 ? 31   PRO D C   1 
ATOM   5953 O  O   . PRO D 1 29  ? -49.800 29.181  3.327   1.00 16.81 ? 31   PRO D O   1 
ATOM   5954 C  CB  . PRO D 1 29  ? -47.628 29.530  0.829   1.00 15.67 ? 31   PRO D CB  1 
ATOM   5955 C  CG  . PRO D 1 29  ? -48.826 29.067  0.081   1.00 15.32 ? 31   PRO D CG  1 
ATOM   5956 C  CD  . PRO D 1 29  ? -49.064 27.640  0.514   1.00 15.50 ? 31   PRO D CD  1 
ATOM   5957 N  N   . VAL D 1 30  ? -48.192 30.738  3.566   1.00 17.41 ? 32   VAL D N   1 
ATOM   5958 C  CA  . VAL D 1 30  ? -48.953 31.597  4.480   1.00 18.61 ? 32   VAL D CA  1 
ATOM   5959 C  C   . VAL D 1 30  ? -48.925 33.037  3.981   1.00 20.18 ? 32   VAL D C   1 
ATOM   5960 O  O   . VAL D 1 30  ? -48.113 33.409  3.113   1.00 20.13 ? 32   VAL D O   1 
ATOM   5961 C  CB  . VAL D 1 30  ? -48.422 31.541  5.925   1.00 18.51 ? 32   VAL D CB  1 
ATOM   5962 C  CG1 . VAL D 1 30  ? -48.503 30.122  6.489   1.00 18.70 ? 32   VAL D CG1 1 
ATOM   5963 C  CG2 . VAL D 1 30  ? -46.973 32.052  6.025   1.00 18.81 ? 32   VAL D CG2 1 
ATOM   5964 N  N   . ASP D 1 31  ? -49.814 33.847  4.546   1.00 21.05 ? 33   ASP D N   1 
ATOM   5965 C  CA  . ASP D 1 31  ? -49.806 35.309  4.335   1.00 21.46 ? 33   ASP D CA  1 
ATOM   5966 C  C   . ASP D 1 31  ? -48.940 35.945  5.398   1.00 21.14 ? 33   ASP D C   1 
ATOM   5967 O  O   . ASP D 1 31  ? -49.212 35.815  6.606   1.00 21.15 ? 33   ASP D O   1 
ATOM   5968 C  CB  . ASP D 1 31  ? -51.231 35.839  4.411   1.00 22.35 ? 33   ASP D CB  1 
ATOM   5969 C  CG  . ASP D 1 31  ? -51.312 37.342  4.197   1.00 23.75 ? 33   ASP D CG  1 
ATOM   5970 O  OD1 . ASP D 1 31  ? -50.742 37.860  3.200   1.00 22.87 ? 33   ASP D OD1 1 
ATOM   5971 O  OD2 . ASP D 1 31  ? -51.972 37.989  5.026   1.00 22.91 ? 33   ASP D OD2 1 
ATOM   5972 N  N   . ILE D 1 32  ? -47.869 36.591  4.965   1.00 20.63 ? 34   ILE D N   1 
ATOM   5973 C  CA  . ILE D 1 32  ? -46.922 37.209  5.882   1.00 21.54 ? 34   ILE D CA  1 
ATOM   5974 C  C   . ILE D 1 32  ? -47.440 38.610  6.191   1.00 24.08 ? 34   ILE D C   1 
ATOM   5975 O  O   . ILE D 1 32  ? -47.736 39.364  5.271   1.00 23.43 ? 34   ILE D O   1 
ATOM   5976 C  CB  . ILE D 1 32  ? -45.524 37.319  5.260   1.00 22.16 ? 34   ILE D CB  1 
ATOM   5977 C  CG1 . ILE D 1 32  ? -44.949 35.921  4.930   1.00 22.40 ? 34   ILE D CG1 1 
ATOM   5978 C  CG2 . ILE D 1 32  ? -44.576 38.072  6.187   1.00 21.82 ? 34   ILE D CG2 1 
ATOM   5979 C  CD1 . ILE D 1 32  ? -43.903 35.965  3.825   1.00 21.50 ? 34   ILE D CD1 1 
ATOM   5980 N  N   . ARG D 1 33  ? -47.564 38.922  7.479   1.00 25.33 ? 35   ARG D N   1 
ATOM   5981 C  CA  . ARG D 1 33  ? -48.019 40.232  7.945   1.00 27.20 ? 35   ARG D CA  1 
ATOM   5982 C  C   . ARG D 1 33  ? -46.874 40.858  8.704   1.00 25.59 ? 35   ARG D C   1 
ATOM   5983 O  O   . ARG D 1 33  ? -46.690 40.592  9.892   1.00 25.39 ? 35   ARG D O   1 
ATOM   5984 C  CB  . ARG D 1 33  ? -49.272 40.095  8.802   1.00 30.30 ? 35   ARG D CB  1 
ATOM   5985 C  CG  . ARG D 1 33  ? -50.564 40.090  7.987   1.00 34.04 ? 35   ARG D CG  1 
ATOM   5986 C  CD  . ARG D 1 33  ? -51.606 39.179  8.601   1.00 39.10 ? 35   ARG D CD  1 
ATOM   5987 N  NE  . ARG D 1 33  ? -51.391 37.771  8.221   1.00 45.81 ? 35   ARG D NE  1 
ATOM   5988 C  CZ  . ARG D 1 33  ? -51.544 36.699  9.015   1.00 48.09 ? 35   ARG D CZ  1 
ATOM   5989 N  NH1 . ARG D 1 33  ? -51.902 36.823  10.302  1.00 50.56 ? 35   ARG D NH1 1 
ATOM   5990 N  NH2 . ARG D 1 33  ? -51.331 35.474  8.511   1.00 42.28 ? 35   ARG D NH2 1 
ATOM   5991 N  N   . PRO D 1 34  ? -46.071 41.680  8.013   1.00 26.60 ? 36   PRO D N   1 
ATOM   5992 C  CA  . PRO D 1 34  ? -44.863 42.217  8.641   1.00 29.53 ? 36   PRO D CA  1 
ATOM   5993 C  C   . PRO D 1 34  ? -45.078 42.904  10.006  1.00 33.62 ? 36   PRO D C   1 
ATOM   5994 O  O   . PRO D 1 34  ? -44.168 42.872  10.830  1.00 32.88 ? 36   PRO D O   1 
ATOM   5995 C  CB  . PRO D 1 34  ? -44.338 43.207  7.598   1.00 28.57 ? 36   PRO D CB  1 
ATOM   5996 C  CG  . PRO D 1 34  ? -44.851 42.681  6.306   1.00 27.99 ? 36   PRO D CG  1 
ATOM   5997 C  CD  . PRO D 1 34  ? -46.211 42.143  6.622   1.00 27.03 ? 36   PRO D CD  1 
ATOM   5998 N  N   . GLN D 1 35  ? -46.268 43.472  10.234  1.00 37.63 ? 37   GLN D N   1 
ATOM   5999 C  CA  . GLN D 1 35  ? -46.640 44.090  11.523  1.00 42.90 ? 37   GLN D CA  1 
ATOM   6000 C  C   . GLN D 1 35  ? -46.662 43.094  12.666  1.00 39.51 ? 37   GLN D C   1 
ATOM   6001 O  O   . GLN D 1 35  ? -46.359 43.458  13.792  1.00 39.48 ? 37   GLN D O   1 
ATOM   6002 C  CB  . GLN D 1 35  ? -48.052 44.712  11.463  1.00 49.74 ? 37   GLN D CB  1 
ATOM   6003 C  CG  . GLN D 1 35  ? -48.226 45.897  10.526  1.00 56.47 ? 37   GLN D CG  1 
ATOM   6004 C  CD  . GLN D 1 35  ? -47.809 47.210  11.157  1.00 64.10 ? 37   GLN D CD  1 
ATOM   6005 O  OE1 . GLN D 1 35  ? -48.656 48.036  11.512  1.00 70.43 ? 37   GLN D OE1 1 
ATOM   6006 N  NE2 . GLN D 1 35  ? -46.500 47.407  11.314  1.00 65.71 ? 37   GLN D NE2 1 
ATOM   6007 N  N   . LEU D 1 36  ? -47.073 41.860  12.378  1.00 36.31 ? 38   LEU D N   1 
ATOM   6008 C  CA  . LEU D 1 36  ? -47.204 40.811  13.388  1.00 33.41 ? 38   LEU D CA  1 
ATOM   6009 C  C   . LEU D 1 36  ? -45.981 39.903  13.526  1.00 31.17 ? 38   LEU D C   1 
ATOM   6010 O  O   . LEU D 1 36  ? -46.007 38.972  14.341  1.00 29.18 ? 38   LEU D O   1 
ATOM   6011 C  CB  . LEU D 1 36  ? -48.420 39.935  13.063  1.00 35.35 ? 38   LEU D CB  1 
ATOM   6012 C  CG  . LEU D 1 36  ? -49.748 40.673  12.860  1.00 38.86 ? 38   LEU D CG  1 
ATOM   6013 C  CD1 . LEU D 1 36  ? -50.890 39.668  12.754  1.00 39.28 ? 38   LEU D CD1 1 
ATOM   6014 C  CD2 . LEU D 1 36  ? -50.017 41.674  13.981  1.00 39.19 ? 38   LEU D CD2 1 
ATOM   6015 N  N   . ALA D 1 37  ? -44.937 40.133  12.727  1.00 27.12 ? 39   ALA D N   1 
ATOM   6016 C  CA  . ALA D 1 37  ? -43.748 39.293  12.797  1.00 26.06 ? 39   ALA D CA  1 
ATOM   6017 C  C   . ALA D 1 37  ? -42.956 39.673  14.021  1.00 25.65 ? 39   ALA D C   1 
ATOM   6018 O  O   . ALA D 1 37  ? -42.932 40.839  14.400  1.00 26.80 ? 39   ALA D O   1 
ATOM   6019 C  CB  . ALA D 1 37  ? -42.893 39.435  11.555  1.00 25.36 ? 39   ALA D CB  1 
ATOM   6020 N  N   . ALA D 1 38  ? -42.324 38.689  14.642  1.00 24.52 ? 40   ALA D N   1 
ATOM   6021 C  CA  . ALA D 1 38  ? -41.526 38.912  15.832  1.00 25.06 ? 40   ALA D CA  1 
ATOM   6022 C  C   . ALA D 1 38  ? -40.097 39.174  15.382  1.00 26.88 ? 40   ALA D C   1 
ATOM   6023 O  O   . ALA D 1 38  ? -39.483 38.295  14.754  1.00 24.82 ? 40   ALA D O   1 
ATOM   6024 C  CB  . ALA D 1 38  ? -41.570 37.695  16.745  1.00 24.44 ? 40   ALA D CB  1 
ATOM   6025 N  N   . PHE D 1 39  ? -39.560 40.347  15.725  1.00 26.73 ? 41   PHE D N   1 
ATOM   6026 C  CA  . PHE D 1 39  ? -38.154 40.641  15.456  1.00 28.53 ? 41   PHE D CA  1 
ATOM   6027 C  C   . PHE D 1 39  ? -37.302 39.695  16.279  1.00 27.94 ? 41   PHE D C   1 
ATOM   6028 O  O   . PHE D 1 39  ? -37.489 39.604  17.480  1.00 29.16 ? 41   PHE D O   1 
ATOM   6029 C  CB  . PHE D 1 39  ? -37.787 42.113  15.770  1.00 28.90 ? 41   PHE D CB  1 
ATOM   6030 C  CG  . PHE D 1 39  ? -36.304 42.392  15.719  1.00 29.18 ? 41   PHE D CG  1 
ATOM   6031 C  CD1 . PHE D 1 39  ? -35.527 41.952  14.639  1.00 29.64 ? 41   PHE D CD1 1 
ATOM   6032 C  CD2 . PHE D 1 39  ? -35.667 43.081  16.758  1.00 29.49 ? 41   PHE D CD2 1 
ATOM   6033 C  CE1 . PHE D 1 39  ? -34.153 42.187  14.598  1.00 30.20 ? 41   PHE D CE1 1 
ATOM   6034 C  CE2 . PHE D 1 39  ? -34.292 43.333  16.718  1.00 29.86 ? 41   PHE D CE2 1 
ATOM   6035 C  CZ  . PHE D 1 39  ? -33.529 42.884  15.639  1.00 30.82 ? 41   PHE D CZ  1 
ATOM   6036 N  N   . SER D 1 40  ? -36.373 39.000  15.628  1.00 28.40 ? 42   SER D N   1 
ATOM   6037 C  CA  . SER D 1 40  ? -35.549 37.981  16.290  1.00 30.35 ? 42   SER D CA  1 
ATOM   6038 C  C   . SER D 1 40  ? -34.046 38.181  15.954  1.00 28.97 ? 42   SER D C   1 
ATOM   6039 O  O   . SER D 1 40  ? -33.574 37.703  14.928  1.00 30.22 ? 42   SER D O   1 
ATOM   6040 C  CB  . SER D 1 40  ? -36.069 36.583  15.901  1.00 32.74 ? 42   SER D CB  1 
ATOM   6041 O  OG  . SER D 1 40  ? -37.505 36.561  15.998  1.00 35.54 ? 42   SER D OG  1 
ATOM   6042 N  N   . PRO D 1 41  ? -33.298 38.901  16.817  1.00 28.61 ? 43   PRO D N   1 
ATOM   6043 C  CA  . PRO D 1 41  ? -31.880 39.244  16.540  1.00 27.34 ? 43   PRO D CA  1 
ATOM   6044 C  C   . PRO D 1 41  ? -30.931 38.066  16.376  1.00 25.58 ? 43   PRO D C   1 
ATOM   6045 O  O   . PRO D 1 41  ? -29.841 38.258  15.855  1.00 26.76 ? 43   PRO D O   1 
ATOM   6046 C  CB  . PRO D 1 41  ? -31.436 40.079  17.759  1.00 27.18 ? 43   PRO D CB  1 
ATOM   6047 C  CG  . PRO D 1 41  ? -32.625 40.283  18.608  1.00 28.32 ? 43   PRO D CG  1 
ATOM   6048 C  CD  . PRO D 1 41  ? -33.818 39.590  18.017  1.00 28.85 ? 43   PRO D CD  1 
ATOM   6049 N  N   . ALA D 1 42  ? -31.319 36.873  16.817  1.00 23.77 ? 44   ALA D N   1 
ATOM   6050 C  CA  . ALA D 1 42  ? -30.508 35.679  16.591  1.00 23.51 ? 44   ALA D CA  1 
ATOM   6051 C  C   . ALA D 1 42  ? -30.477 35.218  15.129  1.00 22.20 ? 44   ALA D C   1 
ATOM   6052 O  O   . ALA D 1 42  ? -29.622 34.404  14.764  1.00 21.76 ? 44   ALA D O   1 
ATOM   6053 C  CB  . ALA D 1 42  ? -30.992 34.532  17.477  1.00 23.48 ? 44   ALA D CB  1 
ATOM   6054 N  N   . LEU D 1 43  ? -31.436 35.677  14.325  1.00 22.54 ? 45   LEU D N   1 
ATOM   6055 C  CA  . LEU D 1 43  ? -31.478 35.368  12.895  1.00 22.57 ? 45   LEU D CA  1 
ATOM   6056 C  C   . LEU D 1 43  ? -30.411 36.161  12.135  1.00 24.09 ? 45   LEU D C   1 
ATOM   6057 O  O   . LEU D 1 43  ? -30.581 37.353  11.888  1.00 24.41 ? 45   LEU D O   1 
ATOM   6058 C  CB  . LEU D 1 43  ? -32.866 35.681  12.325  1.00 22.40 ? 45   LEU D CB  1 
ATOM   6059 C  CG  . LEU D 1 43  ? -34.010 34.784  12.832  1.00 22.53 ? 45   LEU D CG  1 
ATOM   6060 C  CD1 . LEU D 1 43  ? -35.283 35.132  12.082  1.00 23.16 ? 45   LEU D CD1 1 
ATOM   6061 C  CD2 . LEU D 1 43  ? -33.676 33.313  12.657  1.00 23.23 ? 45   LEU D CD2 1 
ATOM   6062 N  N   . ARG D 1 44  ? -29.321 35.493  11.774  1.00 25.26 ? 46   ARG D N   1 
ATOM   6063 C  CA  . ARG D 1 44  ? -28.178 36.146  11.118  1.00 26.64 ? 46   ARG D CA  1 
ATOM   6064 C  C   . ARG D 1 44  ? -28.234 35.989  9.592   1.00 24.26 ? 46   ARG D C   1 
ATOM   6065 O  O   . ARG D 1 44  ? -29.108 35.292  9.074   1.00 22.78 ? 46   ARG D O   1 
ATOM   6066 C  CB  . ARG D 1 44  ? -26.864 35.570  11.646  1.00 29.96 ? 46   ARG D CB  1 
ATOM   6067 C  CG  . ARG D 1 44  ? -26.743 35.389  13.151  1.00 35.85 ? 46   ARG D CG  1 
ATOM   6068 C  CD  . ARG D 1 44  ? -27.071 36.587  14.053  1.00 39.98 ? 46   ARG D CD  1 
ATOM   6069 N  NE  . ARG D 1 44  ? -27.050 37.930  13.460  1.00 45.24 ? 46   ARG D NE  1 
ATOM   6070 C  CZ  . ARG D 1 44  ? -25.991 38.557  12.943  1.00 51.53 ? 46   ARG D CZ  1 
ATOM   6071 N  NH1 . ARG D 1 44  ? -24.794 37.967  12.878  1.00 57.10 ? 46   ARG D NH1 1 
ATOM   6072 N  NH2 . ARG D 1 44  ? -26.140 39.791  12.451  1.00 53.82 ? 46   ARG D NH2 1 
ATOM   6073 N  N   . PRO D 1 45  ? -27.313 36.648  8.859   1.00 23.11 ? 47   PRO D N   1 
ATOM   6074 C  CA  . PRO D 1 45  ? -27.352 36.454  7.402   1.00 22.58 ? 47   PRO D CA  1 
ATOM   6075 C  C   . PRO D 1 45  ? -27.149 34.997  6.952   1.00 20.96 ? 47   PRO D C   1 
ATOM   6076 O  O   . PRO D 1 45  ? -26.398 34.240  7.562   1.00 19.19 ? 47   PRO D O   1 
ATOM   6077 C  CB  . PRO D 1 45  ? -26.240 37.380  6.899   1.00 23.21 ? 47   PRO D CB  1 
ATOM   6078 C  CG  . PRO D 1 45  ? -26.249 38.493  7.916   1.00 23.16 ? 47   PRO D CG  1 
ATOM   6079 C  CD  . PRO D 1 45  ? -26.399 37.746  9.221   1.00 23.62 ? 47   PRO D CD  1 
ATOM   6080 N  N   . LEU D 1 46  ? -27.878 34.608  5.918   1.00 22.18 ? 48   LEU D N   1 
ATOM   6081 C  CA  . LEU D 1 46  ? -27.789 33.242  5.392   1.00 24.09 ? 48   LEU D CA  1 
ATOM   6082 C  C   . LEU D 1 46  ? -26.455 33.125  4.696   1.00 24.30 ? 48   LEU D C   1 
ATOM   6083 O  O   . LEU D 1 46  ? -25.977 34.107  4.153   1.00 24.05 ? 48   LEU D O   1 
ATOM   6084 C  CB  . LEU D 1 46  ? -28.902 32.954  4.397   1.00 24.84 ? 48   LEU D CB  1 
ATOM   6085 C  CG  . LEU D 1 46  ? -30.322 33.259  4.865   1.00 26.31 ? 48   LEU D CG  1 
ATOM   6086 C  CD1 . LEU D 1 46  ? -31.271 32.924  3.731   1.00 28.24 ? 48   LEU D CD1 1 
ATOM   6087 C  CD2 . LEU D 1 46  ? -30.672 32.520  6.149   1.00 25.17 ? 48   LEU D CD2 1 
ATOM   6088 N  N   . GLU D 1 47  ? -25.854 31.945  4.752   1.00 24.92 ? 49   GLU D N   1 
ATOM   6089 C  CA  . GLU D 1 47  ? -24.574 31.699  4.099   1.00 27.47 ? 49   GLU D CA  1 
ATOM   6090 C  C   . GLU D 1 47  ? -24.685 30.514  3.147   1.00 27.57 ? 49   GLU D C   1 
ATOM   6091 O  O   . GLU D 1 47  ? -25.116 29.439  3.553   1.00 26.90 ? 49   GLU D O   1 
ATOM   6092 C  CB  . GLU D 1 47  ? -23.500 31.469  5.154   1.00 30.31 ? 49   GLU D CB  1 
ATOM   6093 C  CG  . GLU D 1 47  ? -23.185 32.752  5.913   1.00 33.47 ? 49   GLU D CG  1 
ATOM   6094 C  CD  . GLU D 1 47  ? -22.149 32.586  7.006   1.00 38.94 ? 49   GLU D CD  1 
ATOM   6095 O  OE1 . GLU D 1 47  ? -21.606 31.466  7.192   1.00 41.96 ? 49   GLU D OE1 1 
ATOM   6096 O  OE2 . GLU D 1 47  ? -21.873 33.598  7.687   1.00 42.09 ? 49   GLU D OE2 1 
ATOM   6097 N  N   . LEU D 1 48  ? -24.307 30.743  1.889   1.00 26.69 ? 50   LEU D N   1 
ATOM   6098 C  CA  . LEU D 1 48  ? -24.318 29.743  0.818   1.00 26.77 ? 50   LEU D CA  1 
ATOM   6099 C  C   . LEU D 1 48  ? -22.881 29.457  0.390   1.00 26.42 ? 50   LEU D C   1 
ATOM   6100 O  O   . LEU D 1 48  ? -22.085 30.373  0.262   1.00 28.00 ? 50   LEU D O   1 
ATOM   6101 C  CB  . LEU D 1 48  ? -25.113 30.266  -0.374  1.00 27.63 ? 50   LEU D CB  1 
ATOM   6102 C  CG  . LEU D 1 48  ? -26.640 30.145  -0.335  1.00 29.11 ? 50   LEU D CG  1 
ATOM   6103 C  CD1 . LEU D 1 48  ? -27.245 30.578  0.979   1.00 30.28 ? 50   LEU D CD1 1 
ATOM   6104 C  CD2 . LEU D 1 48  ? -27.261 30.965  -1.460  1.00 29.63 ? 50   LEU D CD2 1 
ATOM   6105 N  N   . LEU D 1 49  ? -22.540 28.191  0.217   1.00 25.14 ? 51   LEU D N   1 
ATOM   6106 C  CA  . LEU D 1 49  ? -21.263 27.782  -0.381  1.00 26.20 ? 51   LEU D CA  1 
ATOM   6107 C  C   . LEU D 1 49  ? -21.534 26.832  -1.542  1.00 24.13 ? 51   LEU D C   1 
ATOM   6108 O  O   . LEU D 1 49  ? -22.435 26.002  -1.458  1.00 22.94 ? 51   LEU D O   1 
ATOM   6109 C  CB  . LEU D 1 49  ? -20.386 27.063  0.646   1.00 28.88 ? 51   LEU D CB  1 
ATOM   6110 C  CG  . LEU D 1 49  ? -19.974 27.869  1.881   1.00 34.01 ? 51   LEU D CG  1 
ATOM   6111 C  CD1 . LEU D 1 49  ? -19.490 26.957  3.002   1.00 35.28 ? 51   LEU D CD1 1 
ATOM   6112 C  CD2 . LEU D 1 49  ? -18.890 28.870  1.511   1.00 36.38 ? 51   LEU D CD2 1 
ATOM   6113 N  N   . GLY D 1 50  ? -20.755 26.954  -2.622  1.00 21.66 ? 52   GLY D N   1 
ATOM   6114 C  CA  . GLY D 1 50  ? -20.827 26.025  -3.729  1.00 19.96 ? 52   GLY D CA  1 
ATOM   6115 C  C   . GLY D 1 50  ? -21.896 26.310  -4.757  1.00 19.43 ? 52   GLY D C   1 
ATOM   6116 O  O   . GLY D 1 50  ? -22.093 25.515  -5.663  1.00 19.73 ? 52   GLY D O   1 
ATOM   6117 N  N   . PHE D 1 51  ? -22.561 27.450  -4.651  1.00 18.75 ? 53   PHE D N   1 
ATOM   6118 C  CA  . PHE D 1 51  ? -23.660 27.791  -5.542  1.00 18.98 ? 53   PHE D CA  1 
ATOM   6119 C  C   . PHE D 1 51  ? -23.197 28.338  -6.890  1.00 20.60 ? 53   PHE D C   1 
ATOM   6120 O  O   . PHE D 1 51  ? -24.002 28.365  -7.841  1.00 19.05 ? 53   PHE D O   1 
ATOM   6121 C  CB  . PHE D 1 51  ? -24.606 28.798  -4.872  1.00 18.65 ? 53   PHE D CB  1 
ATOM   6122 C  CG  . PHE D 1 51  ? -25.617 28.156  -3.943  1.00 18.95 ? 53   PHE D CG  1 
ATOM   6123 C  CD1 . PHE D 1 51  ? -25.200 27.438  -2.823  1.00 18.46 ? 53   PHE D CD1 1 
ATOM   6124 C  CD2 . PHE D 1 51  ? -26.986 28.252  -4.200  1.00 19.11 ? 53   PHE D CD2 1 
ATOM   6125 C  CE1 . PHE D 1 51  ? -26.128 26.838  -1.977  1.00 19.29 ? 53   PHE D CE1 1 
ATOM   6126 C  CE2 . PHE D 1 51  ? -27.916 27.681  -3.334  1.00 19.01 ? 53   PHE D CE2 1 
ATOM   6127 C  CZ  . PHE D 1 51  ? -27.485 26.961  -2.232  1.00 18.56 ? 53   PHE D CZ  1 
ATOM   6128 N  N   . GLN D 1 52  ? -21.929 28.752  -7.000  1.00 21.47 ? 54   GLN D N   1 
ATOM   6129 C  CA  . GLN D 1 52  ? -21.417 29.242  -8.296  1.00 24.27 ? 54   GLN D CA  1 
ATOM   6130 C  C   . GLN D 1 52  ? -20.917 28.104  -9.166  1.00 22.10 ? 54   GLN D C   1 
ATOM   6131 O  O   . GLN D 1 52  ? -19.741 27.773  -9.153  1.00 21.59 ? 54   GLN D O   1 
ATOM   6132 C  CB  . GLN D 1 52  ? -20.314 30.281  -8.109  1.00 28.31 ? 54   GLN D CB  1 
ATOM   6133 C  CG  . GLN D 1 52  ? -20.837 31.630  -7.667  1.00 32.19 ? 54   GLN D CG  1 
ATOM   6134 C  CD  . GLN D 1 52  ? -20.392 31.981  -6.284  1.00 39.08 ? 54   GLN D CD  1 
ATOM   6135 O  OE1 . GLN D 1 52  ? -19.617 32.929  -6.095  1.00 47.51 ? 54   GLN D OE1 1 
ATOM   6136 N  NE2 . GLN D 1 52  ? -20.835 31.199  -5.302  1.00 41.38 ? 54   GLN D NE2 1 
ATOM   6137 N  N   . LEU D 1 53  ? -21.812 27.511  -9.932  1.00 21.25 ? 55   LEU D N   1 
ATOM   6138 C  CA  . LEU D 1 53  ? -21.467 26.307  -10.664 1.00 21.35 ? 55   LEU D CA  1 
ATOM   6139 C  C   . LEU D 1 53  ? -20.853 26.617  -12.008 1.00 20.50 ? 55   LEU D C   1 
ATOM   6140 O  O   . LEU D 1 53  ? -21.279 27.565  -12.670 1.00 19.99 ? 55   LEU D O   1 
ATOM   6141 C  CB  . LEU D 1 53  ? -22.687 25.429  -10.884 1.00 21.71 ? 55   LEU D CB  1 
ATOM   6142 C  CG  . LEU D 1 53  ? -23.385 24.960  -9.615  1.00 22.01 ? 55   LEU D CG  1 
ATOM   6143 C  CD1 . LEU D 1 53  ? -24.760 24.403  -9.957  1.00 22.31 ? 55   LEU D CD1 1 
ATOM   6144 C  CD2 . LEU D 1 53  ? -22.554 23.902  -8.923  1.00 23.69 ? 55   LEU D CD2 1 
ATOM   6145 N  N   . PRO D 1 54  ? -19.870 25.791  -12.434 1.00 20.67 ? 56   PRO D N   1 
ATOM   6146 C  CA  . PRO D 1 54  ? -19.313 25.892  -13.779 1.00 20.22 ? 56   PRO D CA  1 
ATOM   6147 C  C   . PRO D 1 54  ? -20.313 25.316  -14.788 1.00 20.34 ? 56   PRO D C   1 
ATOM   6148 O  O   . PRO D 1 54  ? -21.261 24.645  -14.368 1.00 20.12 ? 56   PRO D O   1 
ATOM   6149 C  CB  . PRO D 1 54  ? -18.064 25.005  -13.702 1.00 20.48 ? 56   PRO D CB  1 
ATOM   6150 C  CG  . PRO D 1 54  ? -18.421 23.963  -12.719 1.00 20.48 ? 56   PRO D CG  1 
ATOM   6151 C  CD  . PRO D 1 54  ? -19.327 24.624  -11.708 1.00 20.50 ? 56   PRO D CD  1 
ATOM   6152 N  N   . PRO D 1 55  ? -20.091 25.536  -16.104 1.00 20.54 ? 57   PRO D N   1 
ATOM   6153 C  CA  . PRO D 1 55  ? -20.974 24.997  -17.160 1.00 20.16 ? 57   PRO D CA  1 
ATOM   6154 C  C   . PRO D 1 55  ? -21.212 23.496  -17.109 1.00 19.69 ? 57   PRO D C   1 
ATOM   6155 O  O   . PRO D 1 55  ? -22.330 23.060  -17.362 1.00 18.68 ? 57   PRO D O   1 
ATOM   6156 C  CB  . PRO D 1 55  ? -20.240 25.347  -18.464 1.00 21.49 ? 57   PRO D CB  1 
ATOM   6157 C  CG  . PRO D 1 55  ? -19.337 26.490  -18.129 1.00 21.17 ? 57   PRO D CG  1 
ATOM   6158 C  CD  . PRO D 1 55  ? -19.006 26.365  -16.659 1.00 21.28 ? 57   PRO D CD  1 
ATOM   6159 N  N   . LEU D 1 56  ? -20.170 22.725  -16.812 1.00 19.38 ? 58   LEU D N   1 
ATOM   6160 C  CA  . LEU D 1 56  ? -20.265 21.273  -16.728 1.00 19.59 ? 58   LEU D CA  1 
ATOM   6161 C  C   . LEU D 1 56  ? -19.898 20.790  -15.329 1.00 19.18 ? 58   LEU D C   1 
ATOM   6162 O  O   . LEU D 1 56  ? -19.021 21.374  -14.689 1.00 20.46 ? 58   LEU D O   1 
ATOM   6163 C  CB  . LEU D 1 56  ? -19.322 20.586  -17.723 1.00 20.34 ? 58   LEU D CB  1 
ATOM   6164 C  CG  . LEU D 1 56  ? -19.498 20.905  -19.197 1.00 20.32 ? 58   LEU D CG  1 
ATOM   6165 C  CD1 . LEU D 1 56  ? -18.425 20.151  -19.963 1.00 21.13 ? 58   LEU D CD1 1 
ATOM   6166 C  CD2 . LEU D 1 56  ? -20.883 20.537  -19.701 1.00 20.42 ? 58   LEU D CD2 1 
ATOM   6167 N  N   . PRO D 1 57  ? -20.514 19.715  -14.858 1.00 18.99 ? 59   PRO D N   1 
ATOM   6168 C  CA  . PRO D 1 57  ? -21.552 18.955  -15.596 1.00 19.32 ? 59   PRO D CA  1 
ATOM   6169 C  C   . PRO D 1 57  ? -22.895 19.698  -15.707 1.00 18.79 ? 59   PRO D C   1 
ATOM   6170 O  O   . PRO D 1 57  ? -23.197 20.605  -14.922 1.00 18.30 ? 59   PRO D O   1 
ATOM   6171 C  CB  . PRO D 1 57  ? -21.711 17.693  -14.766 1.00 19.74 ? 59   PRO D CB  1 
ATOM   6172 C  CG  . PRO D 1 57  ? -21.318 18.117  -13.380 1.00 19.98 ? 59   PRO D CG  1 
ATOM   6173 C  CD  . PRO D 1 57  ? -20.202 19.106  -13.558 1.00 19.09 ? 59   PRO D CD  1 
ATOM   6174 N  N   . GLU D 1 58  ? -23.679 19.326  -16.699 1.00 18.20 ? 60   GLU D N   1 
ATOM   6175 C  CA  . GLU D 1 58  ? -24.984 19.944  -16.896 1.00 18.99 ? 60   GLU D CA  1 
ATOM   6176 C  C   . GLU D 1 58  ? -25.969 19.505  -15.813 1.00 17.95 ? 60   GLU D C   1 
ATOM   6177 O  O   . GLU D 1 58  ? -25.737 18.528  -15.133 1.00 17.56 ? 60   GLU D O   1 
ATOM   6178 C  CB  . GLU D 1 58  ? -25.535 19.618  -18.279 1.00 19.77 ? 60   GLU D CB  1 
ATOM   6179 C  CG  . GLU D 1 58  ? -24.721 20.242  -19.393 1.00 21.52 ? 60   GLU D CG  1 
ATOM   6180 C  CD  . GLU D 1 58  ? -25.445 20.180  -20.722 1.00 23.78 ? 60   GLU D CD  1 
ATOM   6181 O  OE1 . GLU D 1 58  ? -25.717 19.049  -21.187 1.00 23.90 ? 60   GLU D OE1 1 
ATOM   6182 O  OE2 . GLU D 1 58  ? -25.759 21.265  -21.268 1.00 26.14 ? 60   GLU D OE2 1 
ATOM   6183 N  N   . LEU D 1 59  ? -27.060 20.257  -15.684 1.00 18.92 ? 61   LEU D N   1 
ATOM   6184 C  CA  . LEU D 1 59  ? -28.149 19.999  -14.732 1.00 19.17 ? 61   LEU D CA  1 
ATOM   6185 C  C   . LEU D 1 59  ? -29.437 19.629  -15.479 1.00 18.94 ? 61   LEU D C   1 
ATOM   6186 O  O   . LEU D 1 59  ? -29.696 20.129  -16.596 1.00 19.53 ? 61   LEU D O   1 
ATOM   6187 C  CB  . LEU D 1 59  ? -28.433 21.260  -13.913 1.00 19.73 ? 61   LEU D CB  1 
ATOM   6188 C  CG  . LEU D 1 59  ? -27.260 21.913  -13.183 1.00 21.79 ? 61   LEU D CG  1 
ATOM   6189 C  CD1 . LEU D 1 59  ? -27.751 23.049  -12.293 1.00 22.13 ? 61   LEU D CD1 1 
ATOM   6190 C  CD2 . LEU D 1 59  ? -26.523 20.889  -12.360 1.00 23.99 ? 61   LEU D CD2 1 
ATOM   6191 N  N   . ARG D 1 60  ? -30.257 18.800  -14.855 1.00 17.32 ? 62   ARG D N   1 
ATOM   6192 C  CA  . ARG D 1 60  ? -31.499 18.378  -15.457 1.00 18.17 ? 62   ARG D CA  1 
ATOM   6193 C  C   . ARG D 1 60  ? -32.599 19.402  -15.131 1.00 18.31 ? 62   ARG D C   1 
ATOM   6194 O  O   . ARG D 1 60  ? -32.769 19.802  -13.967 1.00 18.43 ? 62   ARG D O   1 
ATOM   6195 C  CB  . ARG D 1 60  ? -31.874 16.978  -14.989 1.00 19.14 ? 62   ARG D CB  1 
ATOM   6196 C  CG  . ARG D 1 60  ? -30.787 15.962  -15.300 1.00 21.57 ? 62   ARG D CG  1 
ATOM   6197 C  CD  . ARG D 1 60  ? -31.254 14.504  -15.199 1.00 21.91 ? 62   ARG D CD  1 
ATOM   6198 N  NE  . ARG D 1 60  ? -31.873 14.027  -16.436 1.00 21.71 ? 62   ARG D NE  1 
ATOM   6199 C  CZ  . ARG D 1 60  ? -31.225 13.588  -17.520 1.00 20.61 ? 62   ARG D CZ  1 
ATOM   6200 N  NH1 . ARG D 1 60  ? -29.902 13.567  -17.573 1.00 20.59 ? 62   ARG D NH1 1 
ATOM   6201 N  NH2 . ARG D 1 60  ? -31.921 13.178  -18.584 1.00 20.30 ? 62   ARG D NH2 1 
ATOM   6202 N  N   . LEU D 1 61  ? -33.292 19.864  -16.169 1.00 16.92 ? 63   LEU D N   1 
ATOM   6203 C  CA  . LEU D 1 61  ? -34.393 20.812  -16.029 1.00 17.39 ? 63   LEU D CA  1 
ATOM   6204 C  C   . LEU D 1 61  ? -35.616 20.131  -16.596 1.00 18.32 ? 63   LEU D C   1 
ATOM   6205 O  O   . LEU D 1 61  ? -35.609 19.707  -17.750 1.00 18.31 ? 63   LEU D O   1 
ATOM   6206 C  CB  . LEU D 1 61  ? -34.112 22.087  -16.810 1.00 17.99 ? 63   LEU D CB  1 
ATOM   6207 C  CG  . LEU D 1 61  ? -35.149 23.214  -16.715 1.00 17.94 ? 63   LEU D CG  1 
ATOM   6208 C  CD1 . LEU D 1 61  ? -35.023 23.898  -15.372 1.00 17.35 ? 63   LEU D CD1 1 
ATOM   6209 C  CD2 . LEU D 1 61  ? -34.948 24.224  -17.835 1.00 18.47 ? 63   LEU D CD2 1 
ATOM   6210 N  N   . ARG D 1 62  ? -36.673 20.066  -15.799 1.00 18.20 ? 64   ARG D N   1 
ATOM   6211 C  CA  . ARG D 1 62  ? -37.824 19.217  -16.080 1.00 18.95 ? 64   ARG D CA  1 
ATOM   6212 C  C   . ARG D 1 62  ? -39.156 19.959  -15.858 1.00 19.11 ? 64   ARG D C   1 
ATOM   6213 O  O   . ARG D 1 62  ? -39.379 20.593  -14.813 1.00 18.55 ? 64   ARG D O   1 
ATOM   6214 C  CB  . ARG D 1 62  ? -37.760 18.010  -15.159 1.00 20.37 ? 64   ARG D CB  1 
ATOM   6215 C  CG  . ARG D 1 62  ? -38.874 17.018  -15.332 1.00 24.03 ? 64   ARG D CG  1 
ATOM   6216 C  CD  . ARG D 1 62  ? -38.651 15.780  -14.475 1.00 26.87 ? 64   ARG D CD  1 
ATOM   6217 N  NE  . ARG D 1 62  ? -39.794 14.882  -14.608 1.00 30.55 ? 64   ARG D NE  1 
ATOM   6218 C  CZ  . ARG D 1 62  ? -40.052 14.126  -15.681 1.00 37.14 ? 64   ARG D CZ  1 
ATOM   6219 N  NH1 . ARG D 1 62  ? -39.232 14.101  -16.747 1.00 38.00 ? 64   ARG D NH1 1 
ATOM   6220 N  NH2 . ARG D 1 62  ? -41.146 13.357  -15.694 1.00 40.14 ? 64   ARG D NH2 1 
ATOM   6221 N  N   . ASN D 1 63  ? -40.017 19.848  -16.856 1.00 18.63 ? 65   ASN D N   1 
ATOM   6222 C  CA  . ASN D 1 63  ? -41.438 20.127  -16.723 1.00 19.28 ? 65   ASN D CA  1 
ATOM   6223 C  C   . ASN D 1 63  ? -42.096 18.891  -16.128 1.00 19.16 ? 65   ASN D C   1 
ATOM   6224 O  O   . ASN D 1 63  ? -42.342 17.913  -16.836 1.00 19.66 ? 65   ASN D O   1 
ATOM   6225 C  CB  . ASN D 1 63  ? -42.028 20.442  -18.092 1.00 19.56 ? 65   ASN D CB  1 
ATOM   6226 C  CG  . ASN D 1 63  ? -43.518 20.712  -18.042 1.00 20.20 ? 65   ASN D CG  1 
ATOM   6227 O  OD1 . ASN D 1 63  ? -44.181 20.474  -17.020 1.00 21.25 ? 65   ASN D OD1 1 
ATOM   6228 N  ND2 . ASN D 1 63  ? -44.059 21.200  -19.155 1.00 20.12 ? 65   ASN D ND2 1 
ATOM   6229 N  N   . ASN D 1 64  ? -42.369 18.924  -14.826 1.00 18.55 ? 66   ASN D N   1 
ATOM   6230 C  CA  . ASN D 1 64  ? -43.023 17.795  -14.177 1.00 20.96 ? 66   ASN D CA  1 
ATOM   6231 C  C   . ASN D 1 64  ? -44.573 17.860  -14.210 1.00 22.02 ? 66   ASN D C   1 
ATOM   6232 O  O   . ASN D 1 64  ? -45.234 17.065  -13.551 1.00 21.87 ? 66   ASN D O   1 
ATOM   6233 C  CB  . ASN D 1 64  ? -42.505 17.589  -12.746 1.00 20.28 ? 66   ASN D CB  1 
ATOM   6234 C  CG  . ASN D 1 64  ? -42.669 18.823  -11.882 1.00 20.90 ? 66   ASN D CG  1 
ATOM   6235 O  OD1 . ASN D 1 64  ? -43.633 19.567  -12.035 1.00 20.52 ? 66   ASN D OD1 1 
ATOM   6236 N  ND2 . ASN D 1 64  ? -41.707 19.066  -10.994 1.00 20.19 ? 66   ASN D ND2 1 
ATOM   6237 N  N   . GLY D 1 65  ? -45.144 18.788  -14.980 1.00 23.42 ? 67   GLY D N   1 
ATOM   6238 C  CA  . GLY D 1 65  ? -46.603 18.924  -15.046 1.00 24.47 ? 67   GLY D CA  1 
ATOM   6239 C  C   . GLY D 1 65  ? -47.190 19.872  -14.010 1.00 24.22 ? 67   GLY D C   1 
ATOM   6240 O  O   . GLY D 1 65  ? -48.285 20.373  -14.207 1.00 26.48 ? 67   GLY D O   1 
ATOM   6241 N  N   . HIS D 1 66  ? -46.474 20.145  -12.927 1.00 23.68 ? 68   HIS D N   1 
ATOM   6242 C  CA  . HIS D 1 66  ? -46.925 21.126  -11.941 1.00 24.36 ? 68   HIS D CA  1 
ATOM   6243 C  C   . HIS D 1 66  ? -45.927 22.260  -11.637 1.00 22.05 ? 68   HIS D C   1 
ATOM   6244 O  O   . HIS D 1 66  ? -46.272 23.237  -10.961 1.00 20.37 ? 68   HIS D O   1 
ATOM   6245 C  CB  . HIS D 1 66  ? -47.408 20.416  -10.675 1.00 28.21 ? 68   HIS D CB  1 
ATOM   6246 C  CG  . HIS D 1 66  ? -46.533 19.294  -10.243 1.00 32.31 ? 68   HIS D CG  1 
ATOM   6247 N  ND1 . HIS D 1 66  ? -45.440 19.485  -9.427  1.00 36.16 ? 68   HIS D ND1 1 
ATOM   6248 C  CD2 . HIS D 1 66  ? -46.578 17.968  -10.515 1.00 35.20 ? 68   HIS D CD2 1 
ATOM   6249 C  CE1 . HIS D 1 66  ? -44.842 18.323  -9.218  1.00 38.34 ? 68   HIS D CE1 1 
ATOM   6250 N  NE2 . HIS D 1 66  ? -45.512 17.388  -9.871  1.00 38.36 ? 68   HIS D NE2 1 
ATOM   6251 N  N   . SER D 1 67  ? -44.713 22.165  -12.167 1.00 19.93 ? 69   SER D N   1 
ATOM   6252 C  CA  . SER D 1 67  ? -43.742 23.259  -12.099 1.00 18.53 ? 69   SER D CA  1 
ATOM   6253 C  C   . SER D 1 67  ? -42.613 22.971  -13.098 1.00 17.65 ? 69   SER D C   1 
ATOM   6254 O  O   . SER D 1 67  ? -42.655 21.971  -13.814 1.00 17.66 ? 69   SER D O   1 
ATOM   6255 C  CB  . SER D 1 67  ? -43.162 23.362  -10.695 1.00 17.93 ? 69   SER D CB  1 
ATOM   6256 O  OG  . SER D 1 67  ? -42.305 24.459  -10.635 1.00 19.28 ? 69   SER D OG  1 
ATOM   6257 N  N   . VAL D 1 68  ? -41.628 23.855  -13.141 1.00 17.13 ? 70   VAL D N   1 
ATOM   6258 C  CA  . VAL D 1 68  ? -40.354 23.566  -13.789 1.00 17.30 ? 70   VAL D CA  1 
ATOM   6259 C  C   . VAL D 1 68  ? -39.322 23.462  -12.672 1.00 17.24 ? 70   VAL D C   1 
ATOM   6260 O  O   . VAL D 1 68  ? -39.201 24.363  -11.837 1.00 16.34 ? 70   VAL D O   1 
ATOM   6261 C  CB  . VAL D 1 68  ? -39.961 24.571  -14.902 1.00 17.19 ? 70   VAL D CB  1 
ATOM   6262 C  CG1 . VAL D 1 68  ? -39.850 25.994  -14.394 1.00 16.91 ? 70   VAL D CG1 1 
ATOM   6263 C  CG2 . VAL D 1 68  ? -38.653 24.144  -15.549 1.00 18.16 ? 70   VAL D CG2 1 
ATOM   6264 N  N   . GLN D 1 69  ? -38.613 22.335  -12.651 1.00 16.87 ? 71   GLN D N   1 
ATOM   6265 C  CA  . GLN D 1 69  ? -37.716 21.972  -11.554 1.00 17.48 ? 71   GLN D CA  1 
ATOM   6266 C  C   . GLN D 1 69  ? -36.299 21.744  -12.075 1.00 16.69 ? 71   GLN D C   1 
ATOM   6267 O  O   . GLN D 1 69  ? -36.089 20.993  -13.019 1.00 16.41 ? 71   GLN D O   1 
ATOM   6268 C  CB  . GLN D 1 69  ? -38.193 20.693  -10.863 1.00 18.31 ? 71   GLN D CB  1 
ATOM   6269 C  CG  . GLN D 1 69  ? -37.323 20.269  -9.677  1.00 19.78 ? 71   GLN D CG  1 
ATOM   6270 C  CD  . GLN D 1 69  ? -38.019 19.354  -8.680  1.00 20.56 ? 71   GLN D CD  1 
ATOM   6271 O  OE1 . GLN D 1 69  ? -37.427 18.422  -8.142  1.00 21.08 ? 71   GLN D OE1 1 
ATOM   6272 N  NE2 . GLN D 1 69  ? -39.253 19.651  -8.389  1.00 20.70 ? 71   GLN D NE2 1 
ATOM   6273 N  N   . LEU D 1 70  ? -35.345 22.384  -11.432 1.00 15.47 ? 72   LEU D N   1 
ATOM   6274 C  CA  . LEU D 1 70  ? -33.960 22.245  -11.784 1.00 14.97 ? 72   LEU D CA  1 
ATOM   6275 C  C   . LEU D 1 70  ? -33.330 21.421  -10.690 1.00 14.81 ? 72   LEU D C   1 
ATOM   6276 O  O   . LEU D 1 70  ? -33.348 21.815  -9.515  1.00 14.45 ? 72   LEU D O   1 
ATOM   6277 C  CB  . LEU D 1 70  ? -33.304 23.611  -11.874 1.00 14.93 ? 72   LEU D CB  1 
ATOM   6278 C  CG  . LEU D 1 70  ? -31.808 23.609  -12.165 1.00 14.68 ? 72   LEU D CG  1 
ATOM   6279 C  CD1 . LEU D 1 70  ? -31.548 23.169  -13.604 1.00 14.98 ? 72   LEU D CD1 1 
ATOM   6280 C  CD2 . LEU D 1 70  ? -31.242 25.000  -11.916 1.00 14.60 ? 72   LEU D CD2 1 
ATOM   6281 N  N   . THR D 1 71  ? -32.756 20.293  -11.073 1.00 14.75 ? 73   THR D N   1 
ATOM   6282 C  CA  . THR D 1 71  ? -32.090 19.412  -10.105 1.00 15.71 ? 73   THR D CA  1 
ATOM   6283 C  C   . THR D 1 71  ? -30.708 19.956  -9.833  1.00 15.32 ? 73   THR D C   1 
ATOM   6284 O  O   . THR D 1 71  ? -29.957 20.237  -10.779 1.00 15.05 ? 73   THR D O   1 
ATOM   6285 C  CB  . THR D 1 71  ? -31.972 17.992  -10.660 1.00 16.68 ? 73   THR D CB  1 
ATOM   6286 O  OG1 . THR D 1 71  ? -33.278 17.516  -10.987 1.00 18.71 ? 73   THR D OG1 1 
ATOM   6287 C  CG2 . THR D 1 71  ? -31.311 17.044  -9.648  1.00 17.13 ? 73   THR D CG2 1 
ATOM   6288 N  N   . LEU D 1 72  ? -30.367 20.110  -8.556  1.00 15.26 ? 74   LEU D N   1 
ATOM   6289 C  CA  . LEU D 1 72  ? -29.073 20.669  -8.173  1.00 16.09 ? 74   LEU D CA  1 
ATOM   6290 C  C   . LEU D 1 72  ? -28.088 19.562  -7.808  1.00 16.47 ? 74   LEU D C   1 
ATOM   6291 O  O   . LEU D 1 72  ? -28.490 18.526  -7.317  1.00 17.34 ? 74   LEU D O   1 
ATOM   6292 C  CB  . LEU D 1 72  ? -29.237 21.647  -7.027  1.00 16.42 ? 74   LEU D CB  1 
ATOM   6293 C  CG  . LEU D 1 72  ? -30.091 22.867  -7.366  1.00 16.76 ? 74   LEU D CG  1 
ATOM   6294 C  CD1 . LEU D 1 72  ? -30.364 23.687  -6.096  1.00 16.90 ? 74   LEU D CD1 1 
ATOM   6295 C  CD2 . LEU D 1 72  ? -29.442 23.727  -8.437  1.00 16.49 ? 74   LEU D CD2 1 
ATOM   6296 N  N   . PRO D 1 73  ? -26.787 19.772  -8.070  1.00 17.35 ? 75   PRO D N   1 
ATOM   6297 C  CA  . PRO D 1 73  ? -25.792 18.725  -7.796  1.00 18.18 ? 75   PRO D CA  1 
ATOM   6298 C  C   . PRO D 1 73  ? -25.429 18.695  -6.316  1.00 18.68 ? 75   PRO D C   1 
ATOM   6299 O  O   . PRO D 1 73  ? -25.804 19.601  -5.565  1.00 18.15 ? 75   PRO D O   1 
ATOM   6300 C  CB  . PRO D 1 73  ? -24.590 19.184  -8.620  1.00 17.93 ? 75   PRO D CB  1 
ATOM   6301 C  CG  . PRO D 1 73  ? -24.666 20.681  -8.524  1.00 17.74 ? 75   PRO D CG  1 
ATOM   6302 C  CD  . PRO D 1 73  ? -26.152 21.004  -8.563  1.00 17.20 ? 75   PRO D CD  1 
ATOM   6303 N  N   . PRO D 1 74  ? -24.679 17.676  -5.889  1.00 21.30 ? 76   PRO D N   1 
ATOM   6304 C  CA  . PRO D 1 74  ? -24.147 17.715  -4.518  1.00 21.01 ? 76   PRO D CA  1 
ATOM   6305 C  C   . PRO D 1 74  ? -23.142 18.837  -4.366  1.00 20.35 ? 76   PRO D C   1 
ATOM   6306 O  O   . PRO D 1 74  ? -22.611 19.315  -5.359  1.00 20.34 ? 76   PRO D O   1 
ATOM   6307 C  CB  . PRO D 1 74  ? -23.438 16.356  -4.365  1.00 21.28 ? 76   PRO D CB  1 
ATOM   6308 C  CG  . PRO D 1 74  ? -23.878 15.537  -5.523  1.00 22.13 ? 76   PRO D CG  1 
ATOM   6309 C  CD  . PRO D 1 74  ? -24.202 16.487  -6.629  1.00 22.62 ? 76   PRO D CD  1 
ATOM   6310 N  N   . GLY D 1 75  ? -22.869 19.224  -3.127  1.00 20.22 ? 77   GLY D N   1 
ATOM   6311 C  CA  . GLY D 1 75  ? -21.913 20.271  -2.821  1.00 20.17 ? 77   GLY D CA  1 
ATOM   6312 C  C   . GLY D 1 75  ? -22.441 21.686  -2.623  1.00 20.26 ? 77   GLY D C   1 
ATOM   6313 O  O   . GLY D 1 75  ? -21.641 22.595  -2.421  1.00 19.90 ? 77   GLY D O   1 
ATOM   6314 N  N   . LEU D 1 76  ? -23.759 21.895  -2.668  1.00 19.41 ? 78   LEU D N   1 
ATOM   6315 C  CA  . LEU D 1 76  ? -24.331 23.220  -2.412  1.00 19.47 ? 78   LEU D CA  1 
ATOM   6316 C  C   . LEU D 1 76  ? -24.754 23.293  -0.944  1.00 20.22 ? 78   LEU D C   1 
ATOM   6317 O  O   . LEU D 1 76  ? -25.745 22.691  -0.563  1.00 19.53 ? 78   LEU D O   1 
ATOM   6318 C  CB  . LEU D 1 76  ? -25.522 23.501  -3.317  1.00 19.34 ? 78   LEU D CB  1 
ATOM   6319 C  CG  . LEU D 1 76  ? -25.132 24.039  -4.684  1.00 19.94 ? 78   LEU D CG  1 
ATOM   6320 C  CD1 . LEU D 1 76  ? -24.377 22.967  -5.458  1.00 21.27 ? 78   LEU D CD1 1 
ATOM   6321 C  CD2 . LEU D 1 76  ? -26.327 24.558  -5.475  1.00 19.66 ? 78   LEU D CD2 1 
ATOM   6322 N  N   . GLU D 1 77  ? -23.987 24.011  -0.135  1.00 20.27 ? 79   GLU D N   1 
ATOM   6323 C  CA  . GLU D 1 77  ? -24.215 24.049  1.309   1.00 22.29 ? 79   GLU D CA  1 
ATOM   6324 C  C   . GLU D 1 77  ? -24.902 25.356  1.665   1.00 21.21 ? 79   GLU D C   1 
ATOM   6325 O  O   . GLU D 1 77  ? -24.597 26.419  1.105   1.00 20.62 ? 79   GLU D O   1 
ATOM   6326 C  CB  . GLU D 1 77  ? -22.905 23.924  2.062   1.00 24.82 ? 79   GLU D CB  1 
ATOM   6327 C  CG  . GLU D 1 77  ? -22.073 22.746  1.601   1.00 29.83 ? 79   GLU D CG  1 
ATOM   6328 C  CD  . GLU D 1 77  ? -20.827 22.515  2.442   1.00 33.52 ? 79   GLU D CD  1 
ATOM   6329 O  OE1 . GLU D 1 77  ? -20.337 23.449  3.105   1.00 37.67 ? 79   GLU D OE1 1 
ATOM   6330 O  OE2 . GLU D 1 77  ? -20.341 21.372  2.438   1.00 40.81 ? 79   GLU D OE2 1 
ATOM   6331 N  N   . MET D 1 78  ? -25.844 25.260  2.584   1.00 19.68 ? 80   MET D N   1 
ATOM   6332 C  CA  . MET D 1 78  ? -26.576 26.416  3.061   1.00 19.33 ? 80   MET D CA  1 
ATOM   6333 C  C   . MET D 1 78  ? -26.694 26.298  4.579   1.00 19.13 ? 80   MET D C   1 
ATOM   6334 O  O   . MET D 1 78  ? -27.081 25.262  5.089   1.00 18.28 ? 80   MET D O   1 
ATOM   6335 C  CB  . MET D 1 78  ? -27.936 26.470  2.369   1.00 19.12 ? 80   MET D CB  1 
ATOM   6336 C  CG  . MET D 1 78  ? -28.754 27.714  2.636   1.00 19.72 ? 80   MET D CG  1 
ATOM   6337 S  SD  . MET D 1 78  ? -29.678 27.674  4.201   1.00 20.49 ? 80   MET D SD  1 
ATOM   6338 C  CE  . MET D 1 78  ? -30.934 26.458  3.798   1.00 19.90 ? 80   MET D CE  1 
ATOM   6339 N  N   . ALA D 1 79  ? -26.358 27.370  5.291   1.00 19.52 ? 81   ALA D N   1 
ATOM   6340 C  CA  . ALA D 1 79  ? -26.516 27.416  6.741   1.00 19.69 ? 81   ALA D CA  1 
ATOM   6341 C  C   . ALA D 1 79  ? -27.541 28.480  7.134   1.00 19.62 ? 81   ALA D C   1 
ATOM   6342 O  O   . ALA D 1 79  ? -27.414 29.645  6.744   1.00 17.88 ? 81   ALA D O   1 
ATOM   6343 C  CB  . ALA D 1 79  ? -25.181 27.689  7.412   1.00 20.50 ? 81   ALA D CB  1 
ATOM   6344 N  N   . LEU D 1 80  ? -28.550 28.082  7.912   1.00 19.90 ? 82   LEU D N   1 
ATOM   6345 C  CA  . LEU D 1 80  ? -29.509 29.055  8.457   1.00 20.60 ? 82   LEU D CA  1 
ATOM   6346 C  C   . LEU D 1 80  ? -28.950 29.814  9.660   1.00 21.90 ? 82   LEU D C   1 
ATOM   6347 O  O   . LEU D 1 80  ? -29.533 30.801  10.092  1.00 20.58 ? 82   LEU D O   1 
ATOM   6348 C  CB  . LEU D 1 80  ? -30.824 28.375  8.857   1.00 20.91 ? 82   LEU D CB  1 
ATOM   6349 C  CG  . LEU D 1 80  ? -31.639 27.751  7.710   1.00 20.85 ? 82   LEU D CG  1 
ATOM   6350 C  CD1 . LEU D 1 80  ? -32.865 27.111  8.318   1.00 20.56 ? 82   LEU D CD1 1 
ATOM   6351 C  CD2 . LEU D 1 80  ? -32.026 28.752  6.638   1.00 20.95 ? 82   LEU D CD2 1 
ATOM   6352 N  N   . GLY D 1 81  ? -27.844 29.326  10.204  1.00 22.15 ? 83   GLY D N   1 
ATOM   6353 C  CA  . GLY D 1 81  ? -27.212 29.918  11.357  1.00 23.77 ? 83   GLY D CA  1 
ATOM   6354 C  C   . GLY D 1 81  ? -26.194 28.913  11.851  1.00 24.71 ? 83   GLY D C   1 
ATOM   6355 O  O   . GLY D 1 81  ? -26.089 27.812  11.290  1.00 24.29 ? 83   GLY D O   1 
ATOM   6356 N  N   . PRO D 1 82  ? -25.429 29.277  12.888  1.00 25.73 ? 84   PRO D N   1 
ATOM   6357 C  CA  . PRO D 1 82  ? -24.462 28.323  13.438  1.00 26.87 ? 84   PRO D CA  1 
ATOM   6358 C  C   . PRO D 1 82  ? -25.134 27.005  13.846  1.00 26.97 ? 84   PRO D C   1 
ATOM   6359 O  O   . PRO D 1 82  ? -26.171 27.017  14.498  1.00 27.67 ? 84   PRO D O   1 
ATOM   6360 C  CB  . PRO D 1 82  ? -23.873 29.085  14.630  1.00 27.58 ? 84   PRO D CB  1 
ATOM   6361 C  CG  . PRO D 1 82  ? -23.940 30.517  14.188  1.00 28.06 ? 84   PRO D CG  1 
ATOM   6362 C  CD  . PRO D 1 82  ? -25.261 30.625  13.468  1.00 27.31 ? 84   PRO D CD  1 
ATOM   6363 N  N   . GLY D 1 83  ? -24.591 25.884  13.386  1.00 26.19 ? 85   GLY D N   1 
ATOM   6364 C  CA  . GLY D 1 83  ? -25.189 24.579  13.654  1.00 26.18 ? 85   GLY D CA  1 
ATOM   6365 C  C   . GLY D 1 83  ? -26.536 24.251  13.008  1.00 25.79 ? 85   GLY D C   1 
ATOM   6366 O  O   . GLY D 1 83  ? -27.195 23.318  13.453  1.00 27.59 ? 85   GLY D O   1 
ATOM   6367 N  N   . ARG D 1 84  ? -26.956 24.998  11.985  1.00 23.97 ? 86   ARG D N   1 
ATOM   6368 C  CA  . ARG D 1 84  ? -28.201 24.723  11.257  1.00 23.15 ? 86   ARG D CA  1 
ATOM   6369 C  C   . ARG D 1 84  ? -27.844 24.579  9.757   1.00 21.87 ? 86   ARG D C   1 
ATOM   6370 O  O   . ARG D 1 84  ? -28.025 25.501  8.947   1.00 21.30 ? 86   ARG D O   1 
ATOM   6371 C  CB  . ARG D 1 84  ? -29.231 25.837  11.476  1.00 24.56 ? 86   ARG D CB  1 
ATOM   6372 C  CG  . ARG D 1 84  ? -29.546 26.166  12.936  1.00 25.40 ? 86   ARG D CG  1 
ATOM   6373 C  CD  . ARG D 1 84  ? -30.249 27.524  13.047  1.00 26.46 ? 86   ARG D CD  1 
ATOM   6374 N  NE  . ARG D 1 84  ? -31.572 27.545  12.428  1.00 27.44 ? 86   ARG D NE  1 
ATOM   6375 C  CZ  . ARG D 1 84  ? -32.258 28.649  12.110  1.00 31.23 ? 86   ARG D CZ  1 
ATOM   6376 N  NH1 . ARG D 1 84  ? -31.775 29.876  12.326  1.00 32.94 ? 86   ARG D NH1 1 
ATOM   6377 N  NH2 . ARG D 1 84  ? -33.449 28.534  11.544  1.00 33.19 ? 86   ARG D NH2 1 
ATOM   6378 N  N   . GLU D 1 85  ? -27.356 23.398  9.410   1.00 20.05 ? 87   GLU D N   1 
ATOM   6379 C  CA  . GLU D 1 85  ? -26.681 23.173  8.129   1.00 21.39 ? 87   GLU D CA  1 
ATOM   6380 C  C   . GLU D 1 85  ? -27.491 22.310  7.196   1.00 18.60 ? 87   GLU D C   1 
ATOM   6381 O  O   . GLU D 1 85  ? -28.080 21.313  7.619   1.00 15.38 ? 87   GLU D O   1 
ATOM   6382 C  CB  . GLU D 1 85  ? -25.371 22.478  8.378   1.00 24.87 ? 87   GLU D CB  1 
ATOM   6383 C  CG  . GLU D 1 85  ? -24.501 23.172  9.403   1.00 29.96 ? 87   GLU D CG  1 
ATOM   6384 C  CD  . GLU D 1 85  ? -23.389 23.938  8.780   1.00 36.30 ? 87   GLU D CD  1 
ATOM   6385 O  OE1 . GLU D 1 85  ? -23.635 24.689  7.798   1.00 41.77 ? 87   GLU D OE1 1 
ATOM   6386 O  OE2 . GLU D 1 85  ? -22.262 23.754  9.282   1.00 43.96 ? 87   GLU D OE2 1 
ATOM   6387 N  N   . TYR D 1 86  ? -27.491 22.694  5.926   1.00 16.98 ? 88   TYR D N   1 
ATOM   6388 C  CA  . TYR D 1 86  ? -28.337 22.073  4.922   1.00 16.88 ? 88   TYR D CA  1 
ATOM   6389 C  C   . TYR D 1 86  ? -27.567 21.909  3.618   1.00 17.80 ? 88   TYR D C   1 
ATOM   6390 O  O   . TYR D 1 86  ? -26.535 22.548  3.414   1.00 17.61 ? 88   TYR D O   1 
ATOM   6391 C  CB  . TYR D 1 86  ? -29.569 22.959  4.675   1.00 16.60 ? 88   TYR D CB  1 
ATOM   6392 C  CG  . TYR D 1 86  ? -30.499 22.987  5.852   1.00 16.84 ? 88   TYR D CG  1 
ATOM   6393 C  CD1 . TYR D 1 86  ? -30.259 23.836  6.947   1.00 17.57 ? 88   TYR D CD1 1 
ATOM   6394 C  CD2 . TYR D 1 86  ? -31.602 22.140  5.902   1.00 17.12 ? 88   TYR D CD2 1 
ATOM   6395 C  CE1 . TYR D 1 86  ? -31.097 23.823  8.053   1.00 17.80 ? 88   TYR D CE1 1 
ATOM   6396 C  CE2 . TYR D 1 86  ? -32.443 22.124  6.997   1.00 17.21 ? 88   TYR D CE2 1 
ATOM   6397 C  CZ  . TYR D 1 86  ? -32.184 22.962  8.074   1.00 18.05 ? 88   TYR D CZ  1 
ATOM   6398 O  OH  . TYR D 1 86  ? -33.024 22.922  9.162   1.00 17.89 ? 88   TYR D OH  1 
ATOM   6399 N  N   . ARG D 1 87  ? -28.089 21.059  2.743   1.00 19.12 ? 89   ARG D N   1 
ATOM   6400 C  CA  . ARG D 1 87  ? -27.622 21.008  1.358   1.00 20.98 ? 89   ARG D CA  1 
ATOM   6401 C  C   . ARG D 1 87  ? -28.779 21.090  0.372   1.00 17.72 ? 89   ARG D C   1 
ATOM   6402 O  O   . ARG D 1 87  ? -29.854 20.545  0.603   1.00 16.17 ? 89   ARG D O   1 
ATOM   6403 C  CB  . ARG D 1 87  ? -26.683 19.813  1.095   1.00 24.81 ? 89   ARG D CB  1 
ATOM   6404 C  CG  . ARG D 1 87  ? -27.285 18.446  1.282   1.00 30.14 ? 89   ARG D CG  1 
ATOM   6405 C  CD  . ARG D 1 87  ? -26.207 17.457  1.755   1.00 35.78 ? 89   ARG D CD  1 
ATOM   6406 N  NE  . ARG D 1 87  ? -26.673 16.060  1.785   1.00 40.29 ? 89   ARG D NE  1 
ATOM   6407 C  CZ  . ARG D 1 87  ? -27.512 15.539  2.695   1.00 45.57 ? 89   ARG D CZ  1 
ATOM   6408 N  NH1 . ARG D 1 87  ? -28.051 16.299  3.661   1.00 45.56 ? 89   ARG D NH1 1 
ATOM   6409 N  NH2 . ARG D 1 87  ? -27.848 14.249  2.625   1.00 44.74 ? 89   ARG D NH2 1 
ATOM   6410 N  N   . ALA D 1 88  ? -28.530 21.786  -0.726  1.00 16.34 ? 90   ALA D N   1 
ATOM   6411 C  CA  . ALA D 1 88  ? -29.561 22.071  -1.697  1.00 16.70 ? 90   ALA D CA  1 
ATOM   6412 C  C   . ALA D 1 88  ? -29.849 20.841  -2.551  1.00 17.26 ? 90   ALA D C   1 
ATOM   6413 O  O   . ALA D 1 88  ? -28.917 20.127  -2.955  1.00 17.77 ? 90   ALA D O   1 
ATOM   6414 C  CB  . ALA D 1 88  ? -29.156 23.258  -2.567  1.00 16.78 ? 90   ALA D CB  1 
ATOM   6415 N  N   . LEU D 1 89  ? -31.130 20.590  -2.812  1.00 15.82 ? 91   LEU D N   1 
ATOM   6416 C  CA  . LEU D 1 89  ? -31.559 19.490  -3.665  1.00 15.60 ? 91   LEU D CA  1 
ATOM   6417 C  C   . LEU D 1 89  ? -32.012 19.910  -5.051  1.00 14.99 ? 91   LEU D C   1 
ATOM   6418 O  O   . LEU D 1 89  ? -31.672 19.276  -6.043  1.00 14.00 ? 91   LEU D O   1 
ATOM   6419 C  CB  . LEU D 1 89  ? -32.705 18.750  -3.011  1.00 16.42 ? 91   LEU D CB  1 
ATOM   6420 C  CG  . LEU D 1 89  ? -32.397 18.149  -1.640  1.00 17.13 ? 91   LEU D CG  1 
ATOM   6421 C  CD1 . LEU D 1 89  ? -33.706 17.638  -1.093  1.00 18.68 ? 91   LEU D CD1 1 
ATOM   6422 C  CD2 . LEU D 1 89  ? -31.369 17.024  -1.755  1.00 17.32 ? 91   LEU D CD2 1 
ATOM   6423 N  N   . GLN D 1 90  ? -32.807 20.963  -5.105  1.00 14.26 ? 92   GLN D N   1 
ATOM   6424 C  CA  . GLN D 1 90  ? -33.472 21.351  -6.328  1.00 14.47 ? 92   GLN D CA  1 
ATOM   6425 C  C   . GLN D 1 90  ? -34.080 22.710  -6.112  1.00 14.66 ? 92   GLN D C   1 
ATOM   6426 O  O   . GLN D 1 90  ? -34.270 23.137  -4.970  1.00 13.68 ? 92   GLN D O   1 
ATOM   6427 C  CB  . GLN D 1 90  ? -34.569 20.337  -6.706  1.00 14.20 ? 92   GLN D CB  1 
ATOM   6428 C  CG  . GLN D 1 90  ? -35.536 19.998  -5.578  1.00 14.40 ? 92   GLN D CG  1 
ATOM   6429 C  CD  . GLN D 1 90  ? -36.905 20.672  -5.687  1.00 14.42 ? 92   GLN D CD  1 
ATOM   6430 O  OE1 . GLN D 1 90  ? -37.075 21.742  -6.288  1.00 14.02 ? 92   GLN D OE1 1 
ATOM   6431 N  NE2 . GLN D 1 90  ? -37.896 20.040  -5.072  1.00 15.49 ? 92   GLN D NE2 1 
ATOM   6432 N  N   . LEU D 1 91  ? -34.375 23.383  -7.220  1.00 14.38 ? 93   LEU D N   1 
ATOM   6433 C  CA  . LEU D 1 91  ? -35.196 24.561  -7.192  1.00 14.36 ? 93   LEU D CA  1 
ATOM   6434 C  C   . LEU D 1 91  ? -36.321 24.453  -8.231  1.00 15.39 ? 93   LEU D C   1 
ATOM   6435 O  O   . LEU D 1 91  ? -36.249 23.691  -9.214  1.00 15.44 ? 93   LEU D O   1 
ATOM   6436 C  CB  . LEU D 1 91  ? -34.349 25.839  -7.346  1.00 14.53 ? 93   LEU D CB  1 
ATOM   6437 C  CG  . LEU D 1 91  ? -33.563 26.038  -8.654  1.00 14.42 ? 93   LEU D CG  1 
ATOM   6438 C  CD1 . LEU D 1 91  ? -34.420 26.620  -9.758  1.00 14.79 ? 93   LEU D CD1 1 
ATOM   6439 C  CD2 . LEU D 1 91  ? -32.358 26.930  -8.398  1.00 14.48 ? 93   LEU D CD2 1 
ATOM   6440 N  N   . HIS D 1 92  ? -37.388 25.199  -7.983  1.00 15.42 ? 94   HIS D N   1 
ATOM   6441 C  CA  . HIS D 1 92  ? -38.509 25.246  -8.900  1.00 15.88 ? 94   HIS D CA  1 
ATOM   6442 C  C   . HIS D 1 92  ? -39.262 26.551  -8.701  1.00 15.86 ? 94   HIS D C   1 
ATOM   6443 O  O   . HIS D 1 92  ? -38.925 27.348  -7.805  1.00 15.37 ? 94   HIS D O   1 
ATOM   6444 C  CB  . HIS D 1 92  ? -39.424 24.048  -8.692  1.00 16.39 ? 94   HIS D CB  1 
ATOM   6445 C  CG  . HIS D 1 92  ? -39.973 23.971  -7.310  1.00 16.97 ? 94   HIS D CG  1 
ATOM   6446 N  ND1 . HIS D 1 92  ? -39.288 23.362  -6.283  1.00 17.10 ? 94   HIS D ND1 1 
ATOM   6447 C  CD2 . HIS D 1 92  ? -41.108 24.471  -6.767  1.00 17.21 ? 94   HIS D CD2 1 
ATOM   6448 C  CE1 . HIS D 1 92  ? -39.980 23.478  -5.167  1.00 16.99 ? 94   HIS D CE1 1 
ATOM   6449 N  NE2 . HIS D 1 92  ? -41.086 24.142  -5.439  1.00 17.22 ? 94   HIS D NE2 1 
ATOM   6450 N  N   . LEU D 1 93  ? -40.261 26.758  -9.543  1.00 16.80 ? 95   LEU D N   1 
ATOM   6451 C  CA  . LEU D 1 93  ? -40.978 28.024  -9.600  1.00 17.90 ? 95   LEU D CA  1 
ATOM   6452 C  C   . LEU D 1 93  ? -42.502 27.854  -9.529  1.00 18.02 ? 95   LEU D C   1 
ATOM   6453 O  O   . LEU D 1 93  ? -43.074 26.801  -9.862  1.00 17.30 ? 95   LEU D O   1 
ATOM   6454 C  CB  . LEU D 1 93  ? -40.616 28.759  -10.893 1.00 18.63 ? 95   LEU D CB  1 
ATOM   6455 C  CG  . LEU D 1 93  ? -39.132 29.014  -11.179 1.00 19.82 ? 95   LEU D CG  1 
ATOM   6456 C  CD1 . LEU D 1 93  ? -38.960 29.496  -12.612 1.00 21.26 ? 95   LEU D CD1 1 
ATOM   6457 C  CD2 . LEU D 1 93  ? -38.551 30.011  -10.214 1.00 20.21 ? 95   LEU D CD2 1 
ATOM   6458 N  N   . HIS D 1 94  ? -43.145 28.930  -9.089  1.00 18.61 ? 96   HIS D N   1 
ATOM   6459 C  CA  . HIS D 1 94  ? -44.595 29.009  -9.006  1.00 19.18 ? 96   HIS D CA  1 
ATOM   6460 C  C   . HIS D 1 94  ? -44.962 30.354  -9.641  1.00 19.15 ? 96   HIS D C   1 
ATOM   6461 O  O   . HIS D 1 94  ? -44.309 31.371  -9.378  1.00 18.81 ? 96   HIS D O   1 
ATOM   6462 C  CB  . HIS D 1 94  ? -45.058 28.945  -7.546  1.00 20.02 ? 96   HIS D CB  1 
ATOM   6463 C  CG  . HIS D 1 94  ? -44.763 27.647  -6.862  1.00 19.55 ? 96   HIS D CG  1 
ATOM   6464 N  ND1 . HIS D 1 94  ? -45.600 26.558  -6.945  1.00 20.12 ? 96   HIS D ND1 1 
ATOM   6465 C  CD2 . HIS D 1 94  ? -43.736 27.264  -6.063  1.00 19.88 ? 96   HIS D CD2 1 
ATOM   6466 C  CE1 . HIS D 1 94  ? -45.103 25.559  -6.244  1.00 19.02 ? 96   HIS D CE1 1 
ATOM   6467 N  NE2 . HIS D 1 94  ? -43.979 25.963  -5.689  1.00 19.09 ? 96   HIS D NE2 1 
ATOM   6468 N  N   . TRP D 1 95  ? -45.980 30.343  -10.491 1.00 20.27 ? 97   TRP D N   1 
ATOM   6469 C  CA  . TRP D 1 95  ? -46.313 31.521  -11.306 1.00 21.95 ? 97   TRP D CA  1 
ATOM   6470 C  C   . TRP D 1 95  ? -47.797 31.548  -11.641 1.00 22.53 ? 97   TRP D C   1 
ATOM   6471 O  O   . TRP D 1 95  ? -48.519 30.592  -11.374 1.00 21.64 ? 97   TRP D O   1 
ATOM   6472 C  CB  . TRP D 1 95  ? -45.487 31.530  -12.601 1.00 22.01 ? 97   TRP D CB  1 
ATOM   6473 C  CG  . TRP D 1 95  ? -45.743 30.368  -13.473 1.00 22.35 ? 97   TRP D CG  1 
ATOM   6474 C  CD1 . TRP D 1 95  ? -46.765 30.215  -14.362 1.00 23.58 ? 97   TRP D CD1 1 
ATOM   6475 C  CD2 . TRP D 1 95  ? -44.974 29.168  -13.542 1.00 22.46 ? 97   TRP D CD2 1 
ATOM   6476 N  NE1 . TRP D 1 95  ? -46.688 28.990  -14.982 1.00 22.65 ? 97   TRP D NE1 1 
ATOM   6477 C  CE2 . TRP D 1 95  ? -45.592 28.331  -14.500 1.00 22.83 ? 97   TRP D CE2 1 
ATOM   6478 C  CE3 . TRP D 1 95  ? -43.843 28.699  -12.863 1.00 22.34 ? 97   TRP D CE3 1 
ATOM   6479 C  CZ2 . TRP D 1 95  ? -45.099 27.069  -14.819 1.00 23.26 ? 97   TRP D CZ2 1 
ATOM   6480 C  CZ3 . TRP D 1 95  ? -43.344 27.440  -13.195 1.00 22.38 ? 97   TRP D CZ3 1 
ATOM   6481 C  CH2 . TRP D 1 95  ? -43.977 26.640  -14.155 1.00 22.35 ? 97   TRP D CH2 1 
ATOM   6482 N  N   . GLY D 1 96  ? -48.227 32.664  -12.230 1.00 26.07 ? 98   GLY D N   1 
ATOM   6483 C  CA  . GLY D 1 96  ? -49.638 32.898  -12.486 1.00 27.44 ? 98   GLY D CA  1 
ATOM   6484 C  C   . GLY D 1 96  ? -50.023 32.714  -13.942 1.00 29.47 ? 98   GLY D C   1 
ATOM   6485 O  O   . GLY D 1 96  ? -49.891 31.625  -14.506 1.00 27.42 ? 98   GLY D O   1 
ATOM   6486 N  N   . ALA D 1 97  ? -50.536 33.788  -14.537 1.00 32.82 ? 99   ALA D N   1 
ATOM   6487 C  CA  . ALA D 1 97  ? -51.032 33.784  -15.920 1.00 33.08 ? 99   ALA D CA  1 
ATOM   6488 C  C   . ALA D 1 97  ? -51.121 35.228  -16.392 1.00 34.79 ? 99   ALA D C   1 
ATOM   6489 O  O   . ALA D 1 97  ? -50.736 36.154  -15.640 1.00 35.62 ? 99   ALA D O   1 
ATOM   6490 C  CB  . ALA D 1 97  ? -52.389 33.086  -16.013 1.00 33.03 ? 99   ALA D CB  1 
ATOM   6491 N  N   . ALA D 1 98  ? -51.582 35.425  -17.630 1.00 35.43 ? 100  ALA D N   1 
ATOM   6492 C  CA  . ALA D 1 98  ? -51.759 36.779  -18.195 1.00 37.45 ? 100  ALA D CA  1 
ATOM   6493 C  C   . ALA D 1 98  ? -52.504 37.691  -17.212 1.00 35.34 ? 100  ALA D C   1 
ATOM   6494 O  O   . ALA D 1 98  ? -53.636 37.409  -16.836 1.00 35.28 ? 100  ALA D O   1 
ATOM   6495 C  CB  . ALA D 1 98  ? -52.510 36.714  -19.517 1.00 37.63 ? 100  ALA D CB  1 
ATOM   6496 N  N   . GLY D 1 99  ? -51.828 38.737  -16.758 1.00 37.03 ? 101  GLY D N   1 
ATOM   6497 C  CA  . GLY D 1 99  ? -52.394 39.682  -15.797 1.00 42.23 ? 101  GLY D CA  1 
ATOM   6498 C  C   . GLY D 1 99  ? -52.733 39.191  -14.390 1.00 44.04 ? 101  GLY D C   1 
ATOM   6499 O  O   . GLY D 1 99  ? -53.321 39.952  -13.621 1.00 46.55 ? 101  GLY D O   1 
ATOM   6500 N  N   . ARG D 1 100 ? -52.348 37.958  -14.035 1.00 42.99 ? 102  ARG D N   1 
ATOM   6501 C  CA  . ARG D 1 100 ? -52.766 37.321  -12.775 1.00 39.21 ? 102  ARG D CA  1 
ATOM   6502 C  C   . ARG D 1 100 ? -51.532 36.808  -12.037 1.00 37.90 ? 102  ARG D C   1 
ATOM   6503 O  O   . ARG D 1 100 ? -50.786 35.990  -12.589 1.00 35.67 ? 102  ARG D O   1 
ATOM   6504 C  CB  . ARG D 1 100 ? -53.719 36.167  -13.054 1.00 41.32 ? 102  ARG D CB  1 
ATOM   6505 C  CG  . ARG D 1 100 ? -54.985 36.597  -13.779 1.00 43.74 ? 102  ARG D CG  1 
ATOM   6506 C  CD  . ARG D 1 100 ? -55.773 35.407  -14.298 1.00 44.45 ? 102  ARG D CD  1 
ATOM   6507 N  NE  . ARG D 1 100 ? -56.374 34.660  -13.204 1.00 47.89 ? 102  ARG D NE  1 
ATOM   6508 C  CZ  . ARG D 1 100 ? -56.998 33.482  -13.321 1.00 52.18 ? 102  ARG D CZ  1 
ATOM   6509 N  NH1 . ARG D 1 100 ? -57.127 32.877  -14.508 1.00 52.92 ? 102  ARG D NH1 1 
ATOM   6510 N  NH2 . ARG D 1 100 ? -57.508 32.897  -12.230 1.00 51.14 ? 102  ARG D NH2 1 
ATOM   6511 N  N   . PRO D 1 101 ? -51.311 37.279  -10.796 1.00 34.73 ? 103  PRO D N   1 
ATOM   6512 C  CA  . PRO D 1 101 ? -50.105 36.908  -10.053 1.00 32.55 ? 103  PRO D CA  1 
ATOM   6513 C  C   . PRO D 1 101 ? -50.160 35.458  -9.550  1.00 30.00 ? 103  PRO D C   1 
ATOM   6514 O  O   . PRO D 1 101 ? -51.247 34.875  -9.453  1.00 27.04 ? 103  PRO D O   1 
ATOM   6515 C  CB  . PRO D 1 101 ? -50.093 37.902  -8.892  1.00 33.16 ? 103  PRO D CB  1 
ATOM   6516 C  CG  . PRO D 1 101 ? -51.531 38.230  -8.656  1.00 34.22 ? 103  PRO D CG  1 
ATOM   6517 C  CD  . PRO D 1 101 ? -52.219 38.122  -9.987  1.00 34.96 ? 103  PRO D CD  1 
ATOM   6518 N  N   . GLY D 1 102 ? -48.995 34.879  -9.258  1.00 26.98 ? 104  GLY D N   1 
ATOM   6519 C  CA  . GLY D 1 102 ? -48.932 33.449  -8.926  1.00 26.16 ? 104  GLY D CA  1 
ATOM   6520 C  C   . GLY D 1 102 ? -47.929 33.001  -7.879  1.00 24.73 ? 104  GLY D C   1 
ATOM   6521 O  O   . GLY D 1 102 ? -47.613 31.813  -7.824  1.00 22.47 ? 104  GLY D O   1 
ATOM   6522 N  N   . SER D 1 103 ? -47.455 33.926  -7.042  1.00 23.17 ? 105  SER D N   1 
ATOM   6523 C  CA  . SER D 1 103 ? -46.635 33.566  -5.891  1.00 22.81 ? 105  SER D CA  1 
ATOM   6524 C  C   . SER D 1 103 ? -47.464 32.730  -4.916  1.00 22.06 ? 105  SER D C   1 
ATOM   6525 O  O   . SER D 1 103 ? -48.702 32.717  -4.974  1.00 21.49 ? 105  SER D O   1 
ATOM   6526 C  CB  . SER D 1 103 ? -46.042 34.805  -5.216  1.00 23.56 ? 105  SER D CB  1 
ATOM   6527 O  OG  . SER D 1 103 ? -47.009 35.560  -4.512  1.00 23.73 ? 105  SER D OG  1 
ATOM   6528 N  N   . GLU D 1 104 ? -46.763 31.987  -4.063  1.00 20.99 ? 106  GLU D N   1 
ATOM   6529 C  CA  . GLU D 1 104 ? -47.400 31.127  -3.063  1.00 20.02 ? 106  GLU D CA  1 
ATOM   6530 C  C   . GLU D 1 104 ? -47.618 31.903  -1.771  1.00 19.19 ? 106  GLU D C   1 
ATOM   6531 O  O   . GLU D 1 104 ? -48.725 31.974  -1.268  1.00 18.53 ? 106  GLU D O   1 
ATOM   6532 C  CB  . GLU D 1 104 ? -46.558 29.872  -2.820  1.00 19.26 ? 106  GLU D CB  1 
ATOM   6533 C  CG  . GLU D 1 104 ? -46.552 28.936  -4.012  1.00 19.78 ? 106  GLU D CG  1 
ATOM   6534 C  CD  . GLU D 1 104 ? -46.657 27.467  -3.638  1.00 20.59 ? 106  GLU D CD  1 
ATOM   6535 O  OE1 . GLU D 1 104 ? -45.700 26.913  -3.069  1.00 22.62 ? 106  GLU D OE1 1 
ATOM   6536 O  OE2 . GLU D 1 104 ? -47.687 26.854  -3.933  1.00 20.82 ? 106  GLU D OE2 1 
ATOM   6537 N  N   . HIS D 1 105 ? -46.551 32.475  -1.240  1.00 19.22 ? 107  HIS D N   1 
ATOM   6538 C  CA  . HIS D 1 105 ? -46.675 33.352  -0.091  1.00 20.32 ? 107  HIS D CA  1 
ATOM   6539 C  C   . HIS D 1 105 ? -47.255 34.687  -0.573  1.00 20.89 ? 107  HIS D C   1 
ATOM   6540 O  O   . HIS D 1 105 ? -47.149 35.046  -1.752  1.00 18.55 ? 107  HIS D O   1 
ATOM   6541 C  CB  . HIS D 1 105 ? -45.331 33.531  0.619   1.00 20.02 ? 107  HIS D CB  1 
ATOM   6542 C  CG  . HIS D 1 105 ? -44.854 32.283  1.297   1.00 20.64 ? 107  HIS D CG  1 
ATOM   6543 N  ND1 . HIS D 1 105 ? -44.205 31.269  0.617   1.00 20.96 ? 107  HIS D ND1 1 
ATOM   6544 C  CD2 . HIS D 1 105 ? -44.957 31.872  2.582   1.00 19.77 ? 107  HIS D CD2 1 
ATOM   6545 C  CE1 . HIS D 1 105 ? -43.920 30.293  1.460   1.00 20.92 ? 107  HIS D CE1 1 
ATOM   6546 N  NE2 . HIS D 1 105 ? -44.373 30.629  2.656   1.00 20.82 ? 107  HIS D NE2 1 
ATOM   6547 N  N   . THR D 1 106 ? -47.910 35.383  0.346   1.00 21.99 ? 108  THR D N   1 
ATOM   6548 C  CA  . THR D 1 106 ? -48.425 36.722  0.085   1.00 22.22 ? 108  THR D CA  1 
ATOM   6549 C  C   . THR D 1 106 ? -47.927 37.589  1.193   1.00 22.84 ? 108  THR D C   1 
ATOM   6550 O  O   . THR D 1 106 ? -47.571 37.079  2.252   1.00 21.70 ? 108  THR D O   1 
ATOM   6551 C  CB  . THR D 1 106 ? -49.959 36.746  0.042   1.00 22.26 ? 108  THR D CB  1 
ATOM   6552 O  OG1 . THR D 1 106 ? -50.492 36.190  1.251   1.00 22.37 ? 108  THR D OG1 1 
ATOM   6553 C  CG2 . THR D 1 106 ? -50.467 35.949  -1.153  1.00 21.93 ? 108  THR D CG2 1 
ATOM   6554 N  N   . VAL D 1 107 ? -47.899 38.900  0.959   1.00 24.49 ? 109  VAL D N   1 
ATOM   6555 C  CA  . VAL D 1 107 ? -47.537 39.863  2.011   1.00 26.64 ? 109  VAL D CA  1 
ATOM   6556 C  C   . VAL D 1 107 ? -48.685 40.864  2.205   1.00 27.44 ? 109  VAL D C   1 
ATOM   6557 O  O   . VAL D 1 107 ? -49.038 41.577  1.272   1.00 27.89 ? 109  VAL D O   1 
ATOM   6558 C  CB  . VAL D 1 107 ? -46.222 40.599  1.706   1.00 25.90 ? 109  VAL D CB  1 
ATOM   6559 C  CG1 . VAL D 1 107 ? -45.892 41.584  2.820   1.00 25.25 ? 109  VAL D CG1 1 
ATOM   6560 C  CG2 . VAL D 1 107 ? -45.067 39.606  1.536   1.00 26.42 ? 109  VAL D CG2 1 
ATOM   6561 N  N   . GLU D 1 108 ? -49.266 40.883  3.406   1.00 29.12 ? 110  GLU D N   1 
ATOM   6562 C  CA  . GLU D 1 108 ? -50.498 41.639  3.689   1.00 31.92 ? 110  GLU D CA  1 
ATOM   6563 C  C   . GLU D 1 108 ? -51.532 41.441  2.577   1.00 29.55 ? 110  GLU D C   1 
ATOM   6564 O  O   . GLU D 1 108 ? -52.099 42.402  2.058   1.00 28.44 ? 110  GLU D O   1 
ATOM   6565 C  CB  . GLU D 1 108 ? -50.174 43.139  3.905   1.00 35.82 ? 110  GLU D CB  1 
ATOM   6566 C  CG  . GLU D 1 108 ? -49.794 43.496  5.338   1.00 41.74 ? 110  GLU D CG  1 
ATOM   6567 C  CD  . GLU D 1 108 ? -48.992 44.796  5.442   1.00 47.78 ? 110  GLU D CD  1 
ATOM   6568 O  OE1 . GLU D 1 108 ? -49.016 45.598  4.486   1.00 55.13 ? 110  GLU D OE1 1 
ATOM   6569 O  OE2 . GLU D 1 108 ? -48.327 45.032  6.479   1.00 50.02 ? 110  GLU D OE2 1 
ATOM   6570 N  N   . GLY D 1 109 ? -51.716 40.191  2.162   1.00 27.18 ? 111  GLY D N   1 
ATOM   6571 C  CA  . GLY D 1 109 ? -52.707 39.834  1.153   1.00 26.16 ? 111  GLY D CA  1 
ATOM   6572 C  C   . GLY D 1 109 ? -52.254 40.019  -0.287  1.00 25.80 ? 111  GLY D C   1 
ATOM   6573 O  O   . GLY D 1 109 ? -52.894 39.511  -1.186  1.00 25.49 ? 111  GLY D O   1 
ATOM   6574 N  N   . HIS D 1 110 ? -51.164 40.737  -0.513  1.00 25.22 ? 112  HIS D N   1 
ATOM   6575 C  CA  . HIS D 1 110 ? -50.632 40.930  -1.857  1.00 27.69 ? 112  HIS D CA  1 
ATOM   6576 C  C   . HIS D 1 110 ? -49.925 39.674  -2.429  1.00 26.84 ? 112  HIS D C   1 
ATOM   6577 O  O   . HIS D 1 110 ? -48.963 39.181  -1.849  1.00 26.87 ? 112  HIS D O   1 
ATOM   6578 C  CB  . HIS D 1 110 ? -49.636 42.081  -1.835  1.00 28.25 ? 112  HIS D CB  1 
ATOM   6579 C  CG  . HIS D 1 110 ? -49.052 42.396  -3.170  1.00 31.66 ? 112  HIS D CG  1 
ATOM   6580 N  ND1 . HIS D 1 110 ? -49.791 42.945  -4.195  1.00 33.97 ? 112  HIS D ND1 1 
ATOM   6581 C  CD2 . HIS D 1 110 ? -47.798 42.226  -3.652  1.00 33.59 ? 112  HIS D CD2 1 
ATOM   6582 C  CE1 . HIS D 1 110 ? -49.011 43.111  -5.251  1.00 35.14 ? 112  HIS D CE1 1 
ATOM   6583 N  NE2 . HIS D 1 110 ? -47.798 42.679  -4.948  1.00 34.76 ? 112  HIS D NE2 1 
ATOM   6584 N  N   . ARG D 1 111 ? -50.397 39.203  -3.575  1.00 26.31 ? 113  ARG D N   1 
ATOM   6585 C  CA  . ARG D 1 111 ? -49.759 38.109  -4.313  1.00 27.89 ? 113  ARG D CA  1 
ATOM   6586 C  C   . ARG D 1 111 ? -48.804 38.714  -5.344  1.00 27.97 ? 113  ARG D C   1 
ATOM   6587 O  O   . ARG D 1 111 ? -49.169 39.677  -6.021  1.00 28.12 ? 113  ARG D O   1 
ATOM   6588 C  CB  . ARG D 1 111 ? -50.814 37.240  -4.995  1.00 27.96 ? 113  ARG D CB  1 
ATOM   6589 C  CG  . ARG D 1 111 ? -50.262 35.902  -5.475  1.00 28.85 ? 113  ARG D CG  1 
ATOM   6590 C  CD  . ARG D 1 111 ? -51.337 34.948  -5.956  1.00 28.67 ? 113  ARG D CD  1 
ATOM   6591 N  NE  . ARG D 1 111 ? -52.352 34.639  -4.943  1.00 30.81 ? 113  ARG D NE  1 
ATOM   6592 C  CZ  . ARG D 1 111 ? -52.173 33.881  -3.853  1.00 31.17 ? 113  ARG D CZ  1 
ATOM   6593 N  NH1 . ARG D 1 111 ? -50.993 33.322  -3.570  1.00 31.98 ? 113  ARG D NH1 1 
ATOM   6594 N  NH2 . ARG D 1 111 ? -53.195 33.671  -3.020  1.00 31.25 ? 113  ARG D NH2 1 
ATOM   6595 N  N   . PHE D 1 112 ? -47.592 38.155  -5.447  1.00 26.10 ? 114  PHE D N   1 
ATOM   6596 C  CA  . PHE D 1 112 ? -46.563 38.641  -6.369  1.00 25.32 ? 114  PHE D CA  1 
ATOM   6597 C  C   . PHE D 1 112 ? -46.635 37.837  -7.664  1.00 22.90 ? 114  PHE D C   1 
ATOM   6598 O  O   . PHE D 1 112 ? -47.263 36.773  -7.700  1.00 22.57 ? 114  PHE D O   1 
ATOM   6599 C  CB  . PHE D 1 112 ? -45.162 38.536  -5.751  1.00 25.98 ? 114  PHE D CB  1 
ATOM   6600 C  CG  . PHE D 1 112 ? -44.975 39.350  -4.502  1.00 26.47 ? 114  PHE D CG  1 
ATOM   6601 C  CD1 . PHE D 1 112 ? -45.515 38.932  -3.289  1.00 26.60 ? 114  PHE D CD1 1 
ATOM   6602 C  CD2 . PHE D 1 112 ? -44.223 40.530  -4.525  1.00 26.53 ? 114  PHE D CD2 1 
ATOM   6603 C  CE1 . PHE D 1 112 ? -45.320 39.687  -2.132  1.00 26.62 ? 114  PHE D CE1 1 
ATOM   6604 C  CE2 . PHE D 1 112 ? -44.024 41.275  -3.375  1.00 26.59 ? 114  PHE D CE2 1 
ATOM   6605 C  CZ  . PHE D 1 112 ? -44.578 40.853  -2.173  1.00 26.72 ? 114  PHE D CZ  1 
ATOM   6606 N  N   . PRO D 1 113 ? -46.034 38.352  -8.749  1.00 22.82 ? 115  PRO D N   1 
ATOM   6607 C  CA  . PRO D 1 113 ? -46.144 37.637  -10.045 1.00 23.20 ? 115  PRO D CA  1 
ATOM   6608 C  C   . PRO D 1 113 ? -45.700 36.171  -10.010 1.00 21.44 ? 115  PRO D C   1 
ATOM   6609 O  O   . PRO D 1 113 ? -46.402 35.303  -10.515 1.00 21.14 ? 115  PRO D O   1 
ATOM   6610 C  CB  . PRO D 1 113 ? -45.250 38.460  -10.974 1.00 23.16 ? 115  PRO D CB  1 
ATOM   6611 C  CG  . PRO D 1 113 ? -45.325 39.840  -10.407 1.00 24.10 ? 115  PRO D CG  1 
ATOM   6612 C  CD  . PRO D 1 113 ? -45.419 39.681  -8.915  1.00 23.59 ? 115  PRO D CD  1 
ATOM   6613 N  N   . ALA D 1 114 ? -44.574 35.893  -9.372  1.00 21.63 ? 116  ALA D N   1 
ATOM   6614 C  CA  . ALA D 1 114 ? -44.100 34.498  -9.271  1.00 21.52 ? 116  ALA D CA  1 
ATOM   6615 C  C   . ALA D 1 114 ? -43.230 34.316  -8.038  1.00 20.67 ? 116  ALA D C   1 
ATOM   6616 O  O   . ALA D 1 114 ? -43.011 35.265  -7.313  1.00 20.44 ? 116  ALA D O   1 
ATOM   6617 C  CB  . ALA D 1 114 ? -43.349 34.113  -10.554 1.00 21.68 ? 116  ALA D CB  1 
ATOM   6618 N  N   . GLU D 1 115 ? -42.747 33.096  -7.795  1.00 20.22 ? 117  GLU D N   1 
ATOM   6619 C  CA  . GLU D 1 115 ? -41.929 32.809  -6.614  1.00 19.34 ? 117  GLU D CA  1 
ATOM   6620 C  C   . GLU D 1 115 ? -40.971 31.654  -6.924  1.00 18.70 ? 117  GLU D C   1 
ATOM   6621 O  O   . GLU D 1 115 ? -41.365 30.693  -7.567  1.00 19.04 ? 117  GLU D O   1 
ATOM   6622 C  CB  . GLU D 1 115 ? -42.855 32.420  -5.435  1.00 19.64 ? 117  GLU D CB  1 
ATOM   6623 C  CG  . GLU D 1 115 ? -42.228 32.412  -4.027  1.00 20.06 ? 117  GLU D CG  1 
ATOM   6624 C  CD  . GLU D 1 115 ? -43.263 32.125  -2.913  1.00 20.34 ? 117  GLU D CD  1 
ATOM   6625 O  OE1 . GLU D 1 115 ? -44.411 32.627  -3.021  1.00 19.87 ? 117  GLU D OE1 1 
ATOM   6626 O  OE2 . GLU D 1 115 ? -42.957 31.383  -1.929  1.00 19.89 ? 117  GLU D OE2 1 
ATOM   6627 N  N   . ILE D 1 116 ? -39.735 31.762  -6.445  1.00 18.57 ? 118  ILE D N   1 
ATOM   6628 C  CA  . ILE D 1 116 ? -38.742 30.694  -6.543  1.00 17.75 ? 118  ILE D CA  1 
ATOM   6629 C  C   . ILE D 1 116 ? -38.563 30.027  -5.171  1.00 17.21 ? 118  ILE D C   1 
ATOM   6630 O  O   . ILE D 1 116 ? -38.506 30.700  -4.158  1.00 16.80 ? 118  ILE D O   1 
ATOM   6631 C  CB  . ILE D 1 116 ? -37.369 31.176  -7.104  1.00 17.29 ? 118  ILE D CB  1 
ATOM   6632 C  CG1 . ILE D 1 116 ? -36.365 30.012  -7.134  1.00 17.50 ? 118  ILE D CG1 1 
ATOM   6633 C  CG2 . ILE D 1 116 ? -36.770 32.333  -6.304  1.00 16.93 ? 118  ILE D CG2 1 
ATOM   6634 C  CD1 . ILE D 1 116 ? -35.106 30.313  -7.914  1.00 18.36 ? 118  ILE D CD1 1 
ATOM   6635 N  N   . HIS D 1 117 ? -38.456 28.699  -5.190  1.00 17.06 ? 119  HIS D N   1 
ATOM   6636 C  CA  . HIS D 1 117 ? -38.127 27.881  -4.039  1.00 15.75 ? 119  HIS D CA  1 
ATOM   6637 C  C   . HIS D 1 117 ? -36.860 27.076  -4.275  1.00 15.28 ? 119  HIS D C   1 
ATOM   6638 O  O   . HIS D 1 117 ? -36.759 26.370  -5.272  1.00 14.45 ? 119  HIS D O   1 
ATOM   6639 C  CB  . HIS D 1 117 ? -39.235 26.900  -3.811  1.00 15.65 ? 119  HIS D CB  1 
ATOM   6640 C  CG  . HIS D 1 117 ? -40.494 27.535  -3.357  1.00 15.58 ? 119  HIS D CG  1 
ATOM   6641 N  ND1 . HIS D 1 117 ? -41.703 26.893  -3.435  1.00 15.52 ? 119  HIS D ND1 1 
ATOM   6642 C  CD2 . HIS D 1 117 ? -40.740 28.758  -2.834  1.00 15.11 ? 119  HIS D CD2 1 
ATOM   6643 C  CE1 . HIS D 1 117 ? -42.647 27.698  -2.975  1.00 15.64 ? 119  HIS D CE1 1 
ATOM   6644 N  NE2 . HIS D 1 117 ? -42.086 28.835  -2.611  1.00 14.90 ? 119  HIS D NE2 1 
ATOM   6645 N  N   . VAL D 1 118 ? -35.928 27.163  -3.339  1.00 14.74 ? 120  VAL D N   1 
ATOM   6646 C  CA  . VAL D 1 118 ? -34.724 26.349  -3.362  1.00 14.78 ? 120  VAL D CA  1 
ATOM   6647 C  C   . VAL D 1 118 ? -34.819 25.427  -2.159  1.00 14.93 ? 120  VAL D C   1 
ATOM   6648 O  O   . VAL D 1 118 ? -34.780 25.893  -1.002  1.00 15.01 ? 120  VAL D O   1 
ATOM   6649 C  CB  . VAL D 1 118 ? -33.464 27.217  -3.325  1.00 14.61 ? 120  VAL D CB  1 
ATOM   6650 C  CG1 . VAL D 1 118 ? -32.215 26.374  -3.544  1.00 15.12 ? 120  VAL D CG1 1 
ATOM   6651 C  CG2 . VAL D 1 118 ? -33.525 28.287  -4.415  1.00 14.81 ? 120  VAL D CG2 1 
ATOM   6652 N  N   . VAL D 1 119 ? -34.973 24.130  -2.438  1.00 14.34 ? 121  VAL D N   1 
ATOM   6653 C  CA  . VAL D 1 119 ? -35.307 23.131  -1.425  1.00 14.40 ? 121  VAL D CA  1 
ATOM   6654 C  C   . VAL D 1 119 ? -34.035 22.444  -0.956  1.00 15.13 ? 121  VAL D C   1 
ATOM   6655 O  O   . VAL D 1 119 ? -33.225 22.002  -1.800  1.00 14.10 ? 121  VAL D O   1 
ATOM   6656 C  CB  . VAL D 1 119 ? -36.257 22.064  -1.998  1.00 14.82 ? 121  VAL D CB  1 
ATOM   6657 C  CG1 . VAL D 1 119 ? -36.597 21.011  -0.938  1.00 14.74 ? 121  VAL D CG1 1 
ATOM   6658 C  CG2 . VAL D 1 119 ? -37.518 22.725  -2.531  1.00 15.57 ? 121  VAL D CG2 1 
ATOM   6659 N  N   . HIS D 1 120 ? -33.878 22.355  0.370   1.00 14.19 ? 122  HIS D N   1 
ATOM   6660 C  CA  . HIS D 1 120 ? -32.685 21.825  1.020   1.00 14.58 ? 122  HIS D CA  1 
ATOM   6661 C  C   . HIS D 1 120 ? -33.003 20.743  2.039   1.00 15.11 ? 122  HIS D C   1 
ATOM   6662 O  O   . HIS D 1 120 ? -34.067 20.751  2.687   1.00 15.33 ? 122  HIS D O   1 
ATOM   6663 C  CB  . HIS D 1 120 ? -31.938 22.902  1.818   1.00 14.53 ? 122  HIS D CB  1 
ATOM   6664 C  CG  . HIS D 1 120 ? -31.490 24.074  1.009   1.00 14.42 ? 122  HIS D CG  1 
ATOM   6665 N  ND1 . HIS D 1 120 ? -32.363 25.028  0.535   1.00 14.68 ? 122  HIS D ND1 1 
ATOM   6666 C  CD2 . HIS D 1 120 ? -30.258 24.462  0.615   1.00 14.32 ? 122  HIS D CD2 1 
ATOM   6667 C  CE1 . HIS D 1 120 ? -31.684 25.952  -0.123  1.00 14.61 ? 122  HIS D CE1 1 
ATOM   6668 N  NE2 . HIS D 1 120 ? -30.408 25.626  -0.098  1.00 14.27 ? 122  HIS D NE2 1 
ATOM   6669 N  N   . LEU D 1 121 ? -32.017 19.871  2.227   1.00 14.82 ? 123  LEU D N   1 
ATOM   6670 C  CA  . LEU D 1 121 ? -32.075 18.751  3.145   1.00 14.87 ? 123  LEU D CA  1 
ATOM   6671 C  C   . LEU D 1 121 ? -31.096 18.994  4.288   1.00 14.89 ? 123  LEU D C   1 
ATOM   6672 O  O   . LEU D 1 121 ? -29.926 19.331  4.047   1.00 15.30 ? 123  LEU D O   1 
ATOM   6673 C  CB  . LEU D 1 121 ? -31.693 17.486  2.398   1.00 15.40 ? 123  LEU D CB  1 
ATOM   6674 C  CG  . LEU D 1 121 ? -31.682 16.162  3.169   1.00 15.91 ? 123  LEU D CG  1 
ATOM   6675 C  CD1 . LEU D 1 121 ? -33.013 15.878  3.853   1.00 16.03 ? 123  LEU D CD1 1 
ATOM   6676 C  CD2 . LEU D 1 121 ? -31.304 15.038  2.203   1.00 16.72 ? 123  LEU D CD2 1 
ATOM   6677 N  N   . SER D 1 122 ? -31.557 18.825  5.525   1.00 14.25 ? 124  SER D N   1 
ATOM   6678 C  CA  . SER D 1 122 ? -30.676 18.917  6.666   1.00 15.31 ? 124  SER D CA  1 
ATOM   6679 C  C   . SER D 1 122 ? -29.537 17.883  6.536   1.00 16.10 ? 124  SER D C   1 
ATOM   6680 O  O   . SER D 1 122 ? -29.767 16.731  6.140   1.00 15.19 ? 124  SER D O   1 
ATOM   6681 C  CB  . SER D 1 122 ? -31.430 18.677  7.975   1.00 15.18 ? 124  SER D CB  1 
ATOM   6682 O  OG  . SER D 1 122 ? -30.547 18.359  9.028   1.00 14.20 ? 124  SER D OG  1 
ATOM   6683 N  N   . THR D 1 123 ? -28.326 18.307  6.887   1.00 16.65 ? 125  THR D N   1 
ATOM   6684 C  CA  . THR D 1 123 ? -27.190 17.387  6.895   1.00 18.40 ? 125  THR D CA  1 
ATOM   6685 C  C   . THR D 1 123 ? -27.330 16.246  7.892   1.00 18.29 ? 125  THR D C   1 
ATOM   6686 O  O   . THR D 1 123 ? -26.550 15.301  7.826   1.00 17.62 ? 125  THR D O   1 
ATOM   6687 C  CB  . THR D 1 123 ? -25.858 18.092  7.155   1.00 19.47 ? 125  THR D CB  1 
ATOM   6688 O  OG1 . THR D 1 123 ? -25.898 18.741  8.429   1.00 21.24 ? 125  THR D OG1 1 
ATOM   6689 C  CG2 . THR D 1 123 ? -25.576 19.106  6.053   1.00 19.34 ? 125  THR D CG2 1 
ATOM   6690 N  N   . ALA D 1 124 ? -28.313 16.300  8.799   1.00 17.02 ? 126  ALA D N   1 
ATOM   6691 C  CA  . ALA D 1 124 ? -28.577 15.162  9.691   1.00 17.01 ? 126  ALA D CA  1 
ATOM   6692 C  C   . ALA D 1 124 ? -29.247 13.973  8.990   1.00 16.95 ? 126  ALA D C   1 
ATOM   6693 O  O   . ALA D 1 124 ? -29.309 12.896  9.561   1.00 16.49 ? 126  ALA D O   1 
ATOM   6694 C  CB  . ALA D 1 124 ? -29.404 15.613  10.889  1.00 17.07 ? 126  ALA D CB  1 
ATOM   6695 N  N   . PHE D 1 125 ? -29.764 14.171  7.773   1.00 16.26 ? 127  PHE D N   1 
ATOM   6696 C  CA  . PHE D 1 125 ? -30.459 13.131  7.044   1.00 17.86 ? 127  PHE D CA  1 
ATOM   6697 C  C   . PHE D 1 125 ? -29.803 12.831  5.706   1.00 17.90 ? 127  PHE D C   1 
ATOM   6698 O  O   . PHE D 1 125 ? -29.404 13.738  5.004   1.00 17.78 ? 127  PHE D O   1 
ATOM   6699 C  CB  . PHE D 1 125 ? -31.918 13.526  6.794   1.00 18.22 ? 127  PHE D CB  1 
ATOM   6700 C  CG  . PHE D 1 125 ? -32.705 13.725  8.059   1.00 18.96 ? 127  PHE D CG  1 
ATOM   6701 C  CD1 . PHE D 1 125 ? -33.319 12.648  8.688   1.00 19.50 ? 127  PHE D CD1 1 
ATOM   6702 C  CD2 . PHE D 1 125 ? -32.786 14.983  8.649   1.00 19.69 ? 127  PHE D CD2 1 
ATOM   6703 C  CE1 . PHE D 1 125 ? -34.024 12.825  9.867   1.00 19.77 ? 127  PHE D CE1 1 
ATOM   6704 C  CE2 . PHE D 1 125 ? -33.503 15.170  9.835   1.00 19.91 ? 127  PHE D CE2 1 
ATOM   6705 C  CZ  . PHE D 1 125 ? -34.118 14.092  10.440  1.00 19.09 ? 127  PHE D CZ  1 
ATOM   6706 N  N   . ALA D 1 126 ? -29.763 11.554  5.345   1.00 18.92 ? 128  ALA D N   1 
ATOM   6707 C  CA  . ALA D 1 126 ? -29.172 11.114  4.075   1.00 19.59 ? 128  ALA D CA  1 
ATOM   6708 C  C   . ALA D 1 126 ? -30.151 11.282  2.923   1.00 21.34 ? 128  ALA D C   1 
ATOM   6709 O  O   . ALA D 1 126 ? -29.743 11.525  1.799   1.00 22.46 ? 128  ALA D O   1 
ATOM   6710 C  CB  . ALA D 1 126 ? -28.739 9.652   4.169   1.00 20.18 ? 128  ALA D CB  1 
ATOM   6711 N  N   . ARG D 1 127 ? -31.446 11.144  3.192   1.00 22.84 ? 129  ARG D N   1 
ATOM   6712 C  CA  . ARG D 1 127 ? -32.454 11.196  2.145   1.00 23.97 ? 129  ARG D CA  1 
ATOM   6713 C  C   . ARG D 1 127 ? -33.630 12.031  2.568   1.00 22.94 ? 129  ARG D C   1 
ATOM   6714 O  O   . ARG D 1 127 ? -33.978 12.072  3.737   1.00 19.48 ? 129  ARG D O   1 
ATOM   6715 C  CB  . ARG D 1 127 ? -32.984 9.800   1.854   1.00 25.98 ? 129  ARG D CB  1 
ATOM   6716 C  CG  . ARG D 1 127 ? -31.918 8.788   1.495   1.00 30.50 ? 129  ARG D CG  1 
ATOM   6717 C  CD  . ARG D 1 127 ? -32.490 7.670   0.639   1.00 32.44 ? 129  ARG D CD  1 
ATOM   6718 N  NE  . ARG D 1 127 ? -33.614 7.040   1.304   1.00 33.23 ? 129  ARG D NE  1 
ATOM   6719 C  CZ  . ARG D 1 127 ? -33.513 6.168   2.297   1.00 37.86 ? 129  ARG D CZ  1 
ATOM   6720 N  NH1 . ARG D 1 127 ? -32.318 5.777   2.757   1.00 42.09 ? 129  ARG D NH1 1 
ATOM   6721 N  NH2 . ARG D 1 127 ? -34.623 5.662   2.830   1.00 37.48 ? 129  ARG D NH2 1 
ATOM   6722 N  N   . VAL D 1 128 ? -34.294 12.618  1.579   1.00 23.56 ? 130  VAL D N   1 
ATOM   6723 C  CA  . VAL D 1 128 ? -35.524 13.384  1.816   1.00 24.93 ? 130  VAL D CA  1 
ATOM   6724 C  C   . VAL D 1 128 ? -36.552 12.562  2.564   1.00 26.11 ? 130  VAL D C   1 
ATOM   6725 O  O   . VAL D 1 128 ? -37.152 13.049  3.517   1.00 26.46 ? 130  VAL D O   1 
ATOM   6726 C  CB  . VAL D 1 128 ? -36.159 13.878  0.498   1.00 25.92 ? 130  VAL D CB  1 
ATOM   6727 C  CG1 . VAL D 1 128 ? -37.594 14.394  0.715   1.00 27.59 ? 130  VAL D CG1 1 
ATOM   6728 C  CG2 . VAL D 1 128 ? -35.298 14.951  -0.098  1.00 24.61 ? 130  VAL D CG2 1 
ATOM   6729 N  N   . ASP D 1 129 ? -36.748 11.310  2.163   1.00 27.80 ? 131  ASP D N   1 
ATOM   6730 C  CA  . ASP D 1 129 ? -37.840 10.530  2.754   1.00 29.46 ? 131  ASP D CA  1 
ATOM   6731 C  C   . ASP D 1 129 ? -37.714 10.306  4.272   1.00 27.43 ? 131  ASP D C   1 
ATOM   6732 O  O   . ASP D 1 129 ? -38.712 10.228  4.961   1.00 28.18 ? 131  ASP D O   1 
ATOM   6733 C  CB  . ASP D 1 129 ? -38.120 9.228   1.987   1.00 34.37 ? 131  ASP D CB  1 
ATOM   6734 C  CG  . ASP D 1 129 ? -36.867 8.503   1.567   1.00 35.66 ? 131  ASP D CG  1 
ATOM   6735 O  OD1 . ASP D 1 129 ? -36.195 8.945   0.596   1.00 36.88 ? 131  ASP D OD1 1 
ATOM   6736 O  OD2 . ASP D 1 129 ? -36.568 7.507   2.218   1.00 39.26 ? 131  ASP D OD2 1 
ATOM   6737 N  N   . GLU D 1 130 ? -36.504 10.303  4.792   1.00 25.43 ? 132  GLU D N   1 
ATOM   6738 C  CA  . GLU D 1 130 ? -36.269 10.232  6.226   1.00 25.73 ? 132  GLU D CA  1 
ATOM   6739 C  C   . GLU D 1 130 ? -36.489 11.606  6.901   1.00 23.75 ? 132  GLU D C   1 
ATOM   6740 O  O   . GLU D 1 130 ? -36.819 11.675  8.083   1.00 22.53 ? 132  GLU D O   1 
ATOM   6741 C  CB  . GLU D 1 130 ? -34.828 9.790   6.507   1.00 29.54 ? 132  GLU D CB  1 
ATOM   6742 C  CG  . GLU D 1 130 ? -34.336 8.584   5.693   1.00 33.10 ? 132  GLU D CG  1 
ATOM   6743 C  CD  . GLU D 1 130 ? -32.821 8.424   5.716   1.00 37.47 ? 132  GLU D CD  1 
ATOM   6744 O  OE1 . GLU D 1 130 ? -32.050 9.418   5.917   1.00 36.32 ? 132  GLU D OE1 1 
ATOM   6745 O  OE2 . GLU D 1 130 ? -32.410 7.257   5.543   1.00 43.74 ? 132  GLU D OE2 1 
ATOM   6746 N  N   . ALA D 1 131 ? -36.242 12.683  6.163   1.00 20.81 ? 133  ALA D N   1 
ATOM   6747 C  CA  . ALA D 1 131 ? -36.407 14.042  6.690   1.00 20.50 ? 133  ALA D CA  1 
ATOM   6748 C  C   . ALA D 1 131 ? -37.860 14.509  6.736   1.00 19.58 ? 133  ALA D C   1 
ATOM   6749 O  O   . ALA D 1 131 ? -38.172 15.458  7.466   1.00 20.28 ? 133  ALA D O   1 
ATOM   6750 C  CB  . ALA D 1 131 ? -35.578 15.012  5.874   1.00 19.65 ? 133  ALA D CB  1 
ATOM   6751 N  N   . LEU D 1 132 ? -38.738 13.865  5.968   1.00 18.92 ? 134  LEU D N   1 
ATOM   6752 C  CA  . LEU D 1 132 ? -40.121 14.309  5.862   1.00 19.44 ? 134  LEU D CA  1 
ATOM   6753 C  C   . LEU D 1 132 ? -40.779 14.237  7.219   1.00 18.41 ? 134  LEU D C   1 
ATOM   6754 O  O   . LEU D 1 132 ? -40.737 13.214  7.882   1.00 17.18 ? 134  LEU D O   1 
ATOM   6755 C  CB  . LEU D 1 132 ? -40.931 13.450  4.881   1.00 19.87 ? 134  LEU D CB  1 
ATOM   6756 C  CG  . LEU D 1 132 ? -40.597 13.615  3.395   1.00 21.11 ? 134  LEU D CG  1 
ATOM   6757 C  CD1 . LEU D 1 132 ? -41.182 12.452  2.594   1.00 21.32 ? 134  LEU D CD1 1 
ATOM   6758 C  CD2 . LEU D 1 132 ? -41.063 14.963  2.860   1.00 20.82 ? 134  LEU D CD2 1 
ATOM   6759 N  N   . GLY D 1 133 ? -41.361 15.341  7.644   1.00 18.34 ? 135  GLY D N   1 
ATOM   6760 C  CA  . GLY D 1 133 ? -42.059 15.374  8.909   1.00 18.01 ? 135  GLY D CA  1 
ATOM   6761 C  C   . GLY D 1 133 ? -41.167 15.532  10.126  1.00 18.84 ? 135  GLY D C   1 
ATOM   6762 O  O   . GLY D 1 133 ? -41.689 15.569  11.210  1.00 18.87 ? 135  GLY D O   1 
ATOM   6763 N  N   . ARG D 1 134 ? -39.842 15.632  9.974   1.00 18.41 ? 136  ARG D N   1 
ATOM   6764 C  CA  . ARG D 1 134 ? -38.957 15.755  11.136  1.00 18.76 ? 136  ARG D CA  1 
ATOM   6765 C  C   . ARG D 1 134 ? -38.672 17.237  11.334  1.00 17.96 ? 136  ARG D C   1 
ATOM   6766 O  O   . ARG D 1 134 ? -38.640 17.981  10.355  1.00 17.99 ? 136  ARG D O   1 
ATOM   6767 C  CB  . ARG D 1 134 ? -37.642 14.992  10.935  1.00 20.51 ? 136  ARG D CB  1 
ATOM   6768 C  CG  . ARG D 1 134 ? -37.666 13.550  11.383  1.00 22.70 ? 136  ARG D CG  1 
ATOM   6769 C  CD  . ARG D 1 134 ? -38.730 12.728  10.702  1.00 24.45 ? 136  ARG D CD  1 
ATOM   6770 N  NE  . ARG D 1 134 ? -38.945 11.506  11.440  1.00 27.05 ? 136  ARG D NE  1 
ATOM   6771 C  CZ  . ARG D 1 134 ? -38.161 10.426  11.413  1.00 28.66 ? 136  ARG D CZ  1 
ATOM   6772 N  NH1 . ARG D 1 134 ? -37.049 10.366  10.674  1.00 29.82 ? 136  ARG D NH1 1 
ATOM   6773 N  NH2 . ARG D 1 134 ? -38.493 9.389   12.166  1.00 29.90 ? 136  ARG D NH2 1 
ATOM   6774 N  N   . PRO D 1 135 ? -38.429 17.666  12.586  1.00 17.80 ? 137  PRO D N   1 
ATOM   6775 C  CA  . PRO D 1 135 ? -38.217 19.106  12.848  1.00 17.69 ? 137  PRO D CA  1 
ATOM   6776 C  C   . PRO D 1 135 ? -36.970 19.631  12.156  1.00 16.46 ? 137  PRO D C   1 
ATOM   6777 O  O   . PRO D 1 135 ? -35.896 19.128  12.413  1.00 16.64 ? 137  PRO D O   1 
ATOM   6778 C  CB  . PRO D 1 135 ? -38.074 19.202  14.392  1.00 18.15 ? 137  PRO D CB  1 
ATOM   6779 C  CG  . PRO D 1 135 ? -38.236 17.835  14.933  1.00 18.81 ? 137  PRO D CG  1 
ATOM   6780 C  CD  . PRO D 1 135 ? -38.508 16.864  13.819  1.00 18.38 ? 137  PRO D CD  1 
ATOM   6781 N  N   . GLY D 1 136 ? -37.132 20.597  11.254  1.00 15.70 ? 138  GLY D N   1 
ATOM   6782 C  CA  . GLY D 1 136 ? -36.024 21.176  10.530  1.00 15.48 ? 138  GLY D CA  1 
ATOM   6783 C  C   . GLY D 1 136 ? -35.341 20.227  9.541   1.00 15.64 ? 138  GLY D C   1 
ATOM   6784 O  O   . GLY D 1 136 ? -34.216 20.484  9.126   1.00 16.34 ? 138  GLY D O   1 
ATOM   6785 N  N   . GLY D 1 137 ? -36.028 19.156  9.153   1.00 15.40 ? 139  GLY D N   1 
ATOM   6786 C  CA  . GLY D 1 137 ? -35.465 18.156  8.255   1.00 16.05 ? 139  GLY D CA  1 
ATOM   6787 C  C   . GLY D 1 137 ? -35.260 18.710  6.858   1.00 15.60 ? 139  GLY D C   1 
ATOM   6788 O  O   . GLY D 1 137 ? -34.295 18.355  6.191   1.00 15.08 ? 139  GLY D O   1 
ATOM   6789 N  N   . LEU D 1 138 ? -36.185 19.570  6.437   1.00 15.32 ? 140  LEU D N   1 
ATOM   6790 C  CA  . LEU D 1 138 ? -36.097 20.277  5.176   1.00 15.39 ? 140  LEU D CA  1 
ATOM   6791 C  C   . LEU D 1 138 ? -36.151 21.774  5.440   1.00 15.19 ? 140  LEU D C   1 
ATOM   6792 O  O   . LEU D 1 138 ? -36.751 22.231  6.441   1.00 14.14 ? 140  LEU D O   1 
ATOM   6793 C  CB  . LEU D 1 138 ? -37.242 19.869  4.250   1.00 15.81 ? 140  LEU D CB  1 
ATOM   6794 C  CG  . LEU D 1 138 ? -37.324 18.382  3.905   1.00 16.85 ? 140  LEU D CG  1 
ATOM   6795 C  CD1 . LEU D 1 138 ? -38.619 18.067  3.163   1.00 17.41 ? 140  LEU D CD1 1 
ATOM   6796 C  CD2 . LEU D 1 138 ? -36.125 17.948  3.071   1.00 17.23 ? 140  LEU D CD2 1 
ATOM   6797 N  N   . ALA D 1 139 ? -35.516 22.530  4.548   1.00 14.53 ? 141  ALA D N   1 
ATOM   6798 C  CA  . ALA D 1 139 ? -35.571 23.986  4.574   1.00 14.96 ? 141  ALA D CA  1 
ATOM   6799 C  C   . ALA D 1 139 ? -35.716 24.513  3.160   1.00 15.38 ? 141  ALA D C   1 
ATOM   6800 O  O   . ALA D 1 139 ? -34.973 24.079  2.256   1.00 15.43 ? 141  ALA D O   1 
ATOM   6801 C  CB  . ALA D 1 139 ? -34.329 24.539  5.210   1.00 14.83 ? 141  ALA D CB  1 
ATOM   6802 N  N   . VAL D 1 140 ? -36.639 25.455  2.960   1.00 15.38 ? 142  VAL D N   1 
ATOM   6803 C  CA  . VAL D 1 140 ? -36.843 26.057  1.654   1.00 15.66 ? 142  VAL D CA  1 
ATOM   6804 C  C   . VAL D 1 140 ? -36.471 27.539  1.725   1.00 17.10 ? 142  VAL D C   1 
ATOM   6805 O  O   . VAL D 1 140 ? -36.876 28.239  2.680   1.00 18.97 ? 142  VAL D O   1 
ATOM   6806 C  CB  . VAL D 1 140 ? -38.295 25.896  1.156   1.00 15.19 ? 142  VAL D CB  1 
ATOM   6807 C  CG1 . VAL D 1 140 ? -38.438 26.417  -0.273  1.00 14.91 ? 142  VAL D CG1 1 
ATOM   6808 C  CG2 . VAL D 1 140 ? -38.732 24.453  1.218   1.00 15.07 ? 142  VAL D CG2 1 
ATOM   6809 N  N   . LEU D 1 141 ? -35.669 28.003  0.768   1.00 16.42 ? 143  LEU D N   1 
ATOM   6810 C  CA  . LEU D 1 141 ? -35.413 29.436  0.569   1.00 17.08 ? 143  LEU D CA  1 
ATOM   6811 C  C   . LEU D 1 141 ? -36.390 29.909  -0.478  1.00 18.08 ? 143  LEU D C   1 
ATOM   6812 O  O   . LEU D 1 141 ? -36.526 29.275  -1.545  1.00 16.76 ? 143  LEU D O   1 
ATOM   6813 C  CB  . LEU D 1 141 ? -33.992 29.707  0.081   1.00 17.13 ? 143  LEU D CB  1 
ATOM   6814 C  CG  . LEU D 1 141 ? -32.859 29.310  1.031   1.00 17.88 ? 143  LEU D CG  1 
ATOM   6815 C  CD1 . LEU D 1 141 ? -31.538 29.877  0.522   1.00 18.79 ? 143  LEU D CD1 1 
ATOM   6816 C  CD2 . LEU D 1 141 ? -33.095 29.756  2.468   1.00 18.32 ? 143  LEU D CD2 1 
ATOM   6817 N  N   . ALA D 1 142 ? -37.093 31.004  -0.181  1.00 18.14 ? 144  ALA D N   1 
ATOM   6818 C  CA  . ALA D 1 142 ? -38.174 31.474  -1.054  1.00 18.21 ? 144  ALA D CA  1 
ATOM   6819 C  C   . ALA D 1 142 ? -37.962 32.940  -1.373  1.00 19.13 ? 144  ALA D C   1 
ATOM   6820 O  O   . ALA D 1 142 ? -37.660 33.720  -0.480  1.00 19.23 ? 144  ALA D O   1 
ATOM   6821 C  CB  . ALA D 1 142 ? -39.517 31.272  -0.394  1.00 19.20 ? 144  ALA D CB  1 
ATOM   6822 N  N   . ALA D 1 143 ? -38.095 33.299  -2.643  1.00 19.10 ? 145  ALA D N   1 
ATOM   6823 C  CA  . ALA D 1 143 ? -38.030 34.699  -3.059  1.00 19.98 ? 145  ALA D CA  1 
ATOM   6824 C  C   . ALA D 1 143 ? -39.134 35.021  -4.053  1.00 19.47 ? 145  ALA D C   1 
ATOM   6825 O  O   . ALA D 1 143 ? -39.497 34.218  -4.900  1.00 19.29 ? 145  ALA D O   1 
ATOM   6826 C  CB  . ALA D 1 143 ? -36.668 35.044  -3.640  1.00 20.56 ? 145  ALA D CB  1 
ATOM   6827 N  N   . PHE D 1 144 ? -39.678 36.224  -3.923  1.00 20.29 ? 146  PHE D N   1 
ATOM   6828 C  CA  . PHE D 1 144 ? -40.701 36.713  -4.844  1.00 20.59 ? 146  PHE D CA  1 
ATOM   6829 C  C   . PHE D 1 144 ? -40.023 37.234  -6.106  1.00 19.52 ? 146  PHE D C   1 
ATOM   6830 O  O   . PHE D 1 144 ? -38.966 37.843  -6.037  1.00 18.97 ? 146  PHE D O   1 
ATOM   6831 C  CB  . PHE D 1 144 ? -41.493 37.852  -4.194  1.00 20.21 ? 146  PHE D CB  1 
ATOM   6832 C  CG  . PHE D 1 144 ? -42.225 37.445  -2.955  1.00 20.04 ? 146  PHE D CG  1 
ATOM   6833 C  CD1 . PHE D 1 144 ? -43.220 36.488  -3.012  1.00 20.05 ? 146  PHE D CD1 1 
ATOM   6834 C  CD2 . PHE D 1 144 ? -41.952 38.042  -1.737  1.00 20.42 ? 146  PHE D CD2 1 
ATOM   6835 C  CE1 . PHE D 1 144 ? -43.897 36.106  -1.871  1.00 20.14 ? 146  PHE D CE1 1 
ATOM   6836 C  CE2 . PHE D 1 144 ? -42.627 37.658  -0.590  1.00 20.28 ? 146  PHE D CE2 1 
ATOM   6837 C  CZ  . PHE D 1 144 ? -43.612 36.705  -0.659  1.00 20.03 ? 146  PHE D CZ  1 
ATOM   6838 N  N   . LEU D 1 145 ? -40.642 36.979  -7.244  1.00 20.94 ? 147  LEU D N   1 
ATOM   6839 C  CA  . LEU D 1 145 ? -40.240 37.562  -8.516  1.00 22.18 ? 147  LEU D CA  1 
ATOM   6840 C  C   . LEU D 1 145 ? -41.270 38.629  -8.914  1.00 22.35 ? 147  LEU D C   1 
ATOM   6841 O  O   . LEU D 1 145 ? -42.459 38.358  -8.922  1.00 21.78 ? 147  LEU D O   1 
ATOM   6842 C  CB  . LEU D 1 145 ? -40.158 36.487  -9.603  1.00 22.03 ? 147  LEU D CB  1 
ATOM   6843 C  CG  . LEU D 1 145 ? -39.409 35.185  -9.263  1.00 23.36 ? 147  LEU D CG  1 
ATOM   6844 C  CD1 . LEU D 1 145 ? -39.237 34.368  -10.537 1.00 23.55 ? 147  LEU D CD1 1 
ATOM   6845 C  CD2 . LEU D 1 145 ? -38.062 35.438  -8.613  1.00 24.14 ? 147  LEU D CD2 1 
ATOM   6846 N  N   . GLU D 1 146 ? -40.784 39.823  -9.235  1.00 25.08 ? 148  GLU D N   1 
ATOM   6847 C  CA  . GLU D 1 146 ? -41.606 40.970  -9.632  1.00 27.58 ? 148  GLU D CA  1 
ATOM   6848 C  C   . GLU D 1 146 ? -41.188 41.459  -11.008 1.00 30.01 ? 148  GLU D C   1 
ATOM   6849 O  O   . GLU D 1 146 ? -40.085 41.146  -11.501 1.00 27.61 ? 148  GLU D O   1 
ATOM   6850 C  CB  . GLU D 1 146 ? -41.426 42.124  -8.657  1.00 29.32 ? 148  GLU D CB  1 
ATOM   6851 C  CG  . GLU D 1 146 ? -41.949 41.848  -7.266  1.00 30.99 ? 148  GLU D CG  1 
ATOM   6852 C  CD  . GLU D 1 146 ? -42.047 43.099  -6.410  1.00 30.84 ? 148  GLU D CD  1 
ATOM   6853 O  OE1 . GLU D 1 146 ? -41.002 43.698  -6.101  1.00 31.55 ? 148  GLU D OE1 1 
ATOM   6854 O  OE2 . GLU D 1 146 ? -43.178 43.446  -6.011  1.00 33.59 ? 148  GLU D OE2 1 
ATOM   6855 N  N   . GLU D 1 147 ? -42.065 42.258  -11.607 1.00 31.67 ? 149  GLU D N   1 
ATOM   6856 C  CA  . GLU D 1 147 ? -41.792 42.841  -12.909 1.00 34.90 ? 149  GLU D CA  1 
ATOM   6857 C  C   . GLU D 1 147 ? -40.865 44.049  -12.761 1.00 36.14 ? 149  GLU D C   1 
ATOM   6858 O  O   . GLU D 1 147 ? -41.146 44.956  -11.975 1.00 36.16 ? 149  GLU D O   1 
ATOM   6859 C  CB  . GLU D 1 147 ? -43.080 43.242  -13.607 1.00 37.56 ? 149  GLU D CB  1 
ATOM   6860 C  CG  . GLU D 1 147 ? -42.899 43.440  -15.106 1.00 40.95 ? 149  GLU D CG  1 
ATOM   6861 C  CD  . GLU D 1 147 ? -44.056 44.185  -15.730 1.00 41.49 ? 149  GLU D CD  1 
ATOM   6862 O  OE1 . GLU D 1 147 ? -45.200 43.703  -15.646 1.00 44.35 ? 149  GLU D OE1 1 
ATOM   6863 O  OE2 . GLU D 1 147 ? -43.809 45.259  -16.297 1.00 45.06 ? 149  GLU D OE2 1 
ATOM   6864 N  N   . GLY D 1 148 ? -39.761 44.033  -13.512 1.00 35.43 ? 150  GLY D N   1 
ATOM   6865 C  CA  . GLY D 1 148 ? -38.798 45.133  -13.562 1.00 37.37 ? 150  GLY D CA  1 
ATOM   6866 C  C   . GLY D 1 148 ? -38.500 45.576  -14.999 1.00 39.10 ? 150  GLY D C   1 
ATOM   6867 O  O   . GLY D 1 148 ? -38.934 44.926  -15.968 1.00 37.83 ? 150  GLY D O   1 
ATOM   6868 N  N   . PRO D 1 149 ? -37.768 46.695  -15.153 1.00 40.06 ? 151  PRO D N   1 
ATOM   6869 C  CA  . PRO D 1 149 ? -37.432 47.208  -16.488 1.00 41.96 ? 151  PRO D CA  1 
ATOM   6870 C  C   . PRO D 1 149 ? -36.365 46.406  -17.253 1.00 40.52 ? 151  PRO D C   1 
ATOM   6871 O  O   . PRO D 1 149 ? -36.495 46.257  -18.460 1.00 42.75 ? 151  PRO D O   1 
ATOM   6872 C  CB  . PRO D 1 149 ? -36.932 48.626  -16.198 1.00 41.79 ? 151  PRO D CB  1 
ATOM   6873 C  CG  . PRO D 1 149 ? -36.407 48.554  -14.805 1.00 42.45 ? 151  PRO D CG  1 
ATOM   6874 C  CD  . PRO D 1 149 ? -37.353 47.632  -14.094 1.00 41.17 ? 151  PRO D CD  1 
ATOM   6875 N  N   . GLU D 1 150 ? -35.333 45.913  -16.568 1.00 39.91 ? 152  GLU D N   1 
ATOM   6876 C  CA  . GLU D 1 150 ? -34.232 45.184  -17.216 1.00 38.23 ? 152  GLU D CA  1 
ATOM   6877 C  C   . GLU D 1 150 ? -34.518 43.678  -17.339 1.00 39.48 ? 152  GLU D C   1 
ATOM   6878 O  O   . GLU D 1 150 ? -35.266 43.096  -16.537 1.00 38.73 ? 152  GLU D O   1 
ATOM   6879 C  CB  . GLU D 1 150 ? -32.924 45.387  -16.447 1.00 37.96 ? 152  GLU D CB  1 
ATOM   6880 N  N   . GLU D 1 151 ? -33.923 43.055  -18.356 1.00 37.67 ? 153  GLU D N   1 
ATOM   6881 C  CA  . GLU D 1 151 ? -33.908 41.594  -18.489 1.00 38.09 ? 153  GLU D CA  1 
ATOM   6882 C  C   . GLU D 1 151 ? -32.972 41.014  -17.432 1.00 35.02 ? 153  GLU D C   1 
ATOM   6883 O  O   . GLU D 1 151 ? -31.836 41.464  -17.294 1.00 32.26 ? 153  GLU D O   1 
ATOM   6884 C  CB  . GLU D 1 151 ? -33.427 41.177  -19.886 1.00 40.96 ? 153  GLU D CB  1 
ATOM   6885 C  CG  . GLU D 1 151 ? -33.634 39.705  -20.186 1.00 45.36 ? 153  GLU D CG  1 
ATOM   6886 C  CD  . GLU D 1 151 ? -32.927 39.244  -21.445 1.00 49.28 ? 153  GLU D CD  1 
ATOM   6887 O  OE1 . GLU D 1 151 ? -31.674 39.135  -21.430 1.00 52.85 ? 153  GLU D OE1 1 
ATOM   6888 O  OE2 . GLU D 1 151 ? -33.633 38.972  -22.436 1.00 51.50 ? 153  GLU D OE2 1 
ATOM   6889 N  N   . ASN D 1 152 ? -33.453 40.035  -16.668 1.00 34.26 ? 154  ASN D N   1 
ATOM   6890 C  CA  . ASN D 1 152 ? -32.605 39.355  -15.688 1.00 31.29 ? 154  ASN D CA  1 
ATOM   6891 C  C   . ASN D 1 152 ? -31.816 38.271  -16.410 1.00 31.41 ? 154  ASN D C   1 
ATOM   6892 O  O   . ASN D 1 152 ? -32.389 37.307  -16.902 1.00 31.18 ? 154  ASN D O   1 
ATOM   6893 C  CB  . ASN D 1 152 ? -33.458 38.753  -14.568 1.00 30.79 ? 154  ASN D CB  1 
ATOM   6894 C  CG  . ASN D 1 152 ? -32.623 38.205  -13.427 1.00 28.21 ? 154  ASN D CG  1 
ATOM   6895 O  OD1 . ASN D 1 152 ? -31.677 37.443  -13.629 1.00 27.26 ? 154  ASN D OD1 1 
ATOM   6896 N  ND2 . ASN D 1 152 ? -32.979 38.583  -12.217 1.00 28.16 ? 154  ASN D ND2 1 
ATOM   6897 N  N   . SER D 1 153 ? -30.505 38.434  -16.479 1.00 32.12 ? 155  SER D N   1 
ATOM   6898 C  CA  . SER D 1 153 ? -29.671 37.543  -17.275 1.00 33.38 ? 155  SER D CA  1 
ATOM   6899 C  C   . SER D 1 153 ? -29.479 36.184  -16.600 1.00 31.40 ? 155  SER D C   1 
ATOM   6900 O  O   . SER D 1 153 ? -29.354 35.168  -17.276 1.00 30.54 ? 155  SER D O   1 
ATOM   6901 C  CB  . SER D 1 153 ? -28.320 38.204  -17.598 1.00 35.21 ? 155  SER D CB  1 
ATOM   6902 O  OG  . SER D 1 153 ? -27.733 38.794  -16.465 1.00 36.38 ? 155  SER D OG  1 
ATOM   6903 N  N   . ALA D 1 154 ? -29.482 36.161  -15.269 1.00 31.32 ? 156  ALA D N   1 
ATOM   6904 C  CA  . ALA D 1 154 ? -29.459 34.889  -14.537 1.00 29.06 ? 156  ALA D CA  1 
ATOM   6905 C  C   . ALA D 1 154 ? -30.672 34.028  -14.912 1.00 28.48 ? 156  ALA D C   1 
ATOM   6906 O  O   . ALA D 1 154 ? -30.512 32.865  -15.304 1.00 28.64 ? 156  ALA D O   1 
ATOM   6907 C  CB  . ALA D 1 154 ? -29.408 35.136  -13.038 1.00 30.78 ? 156  ALA D CB  1 
ATOM   6908 N  N   . TYR D 1 155 ? -31.873 34.612  -14.854 1.00 27.03 ? 157  TYR D N   1 
ATOM   6909 C  CA  . TYR D 1 155 ? -33.093 33.867  -15.185 1.00 26.33 ? 157  TYR D CA  1 
ATOM   6910 C  C   . TYR D 1 155 ? -33.207 33.506  -16.662 1.00 26.84 ? 157  TYR D C   1 
ATOM   6911 O  O   . TYR D 1 155 ? -33.759 32.453  -17.000 1.00 27.26 ? 157  TYR D O   1 
ATOM   6912 C  CB  . TYR D 1 155 ? -34.367 34.592  -14.698 1.00 25.45 ? 157  TYR D CB  1 
ATOM   6913 C  CG  . TYR D 1 155 ? -34.657 34.310  -13.243 1.00 23.76 ? 157  TYR D CG  1 
ATOM   6914 C  CD1 . TYR D 1 155 ? -33.994 35.013  -12.229 1.00 22.98 ? 157  TYR D CD1 1 
ATOM   6915 C  CD2 . TYR D 1 155 ? -35.562 33.307  -12.869 1.00 23.05 ? 157  TYR D CD2 1 
ATOM   6916 C  CE1 . TYR D 1 155 ? -34.231 34.730  -10.894 1.00 22.66 ? 157  TYR D CE1 1 
ATOM   6917 C  CE2 . TYR D 1 155 ? -35.817 33.032  -11.524 1.00 22.61 ? 157  TYR D CE2 1 
ATOM   6918 C  CZ  . TYR D 1 155 ? -35.149 33.739  -10.546 1.00 22.08 ? 157  TYR D CZ  1 
ATOM   6919 O  OH  . TYR D 1 155 ? -35.377 33.458  -9.215  1.00 23.64 ? 157  TYR D OH  1 
ATOM   6920 N  N   . GLU D 1 156 ? -32.677 34.362  -17.530 1.00 27.56 ? 158  GLU D N   1 
ATOM   6921 C  CA  . GLU D 1 156 ? -32.741 34.134  -18.981 1.00 27.64 ? 158  GLU D CA  1 
ATOM   6922 C  C   . GLU D 1 156 ? -32.158 32.782  -19.385 1.00 27.66 ? 158  GLU D C   1 
ATOM   6923 O  O   . GLU D 1 156 ? -32.715 32.107  -20.264 1.00 26.29 ? 158  GLU D O   1 
ATOM   6924 C  CB  . GLU D 1 156 ? -32.027 35.271  -19.736 1.00 28.49 ? 158  GLU D CB  1 
ATOM   6925 C  CG  . GLU D 1 156 ? -32.246 35.297  -21.247 1.00 28.94 ? 158  GLU D CG  1 
ATOM   6926 C  CD  . GLU D 1 156 ? -33.713 35.309  -21.653 1.00 29.51 ? 158  GLU D CD  1 
ATOM   6927 O  OE1 . GLU D 1 156 ? -34.594 35.757  -20.864 1.00 28.69 ? 158  GLU D OE1 1 
ATOM   6928 O  OE2 . GLU D 1 156 ? -33.990 34.846  -22.773 1.00 28.79 ? 158  GLU D OE2 1 
ATOM   6929 N  N   . GLN D 1 157 ? -31.064 32.396  -18.719 1.00 27.31 ? 159  GLN D N   1 
ATOM   6930 C  CA  . GLN D 1 157 ? -30.472 31.064  -18.845 1.00 28.55 ? 159  GLN D CA  1 
ATOM   6931 C  C   . GLN D 1 157 ? -31.455 29.902  -18.727 1.00 27.27 ? 159  GLN D C   1 
ATOM   6932 O  O   . GLN D 1 157 ? -31.357 28.935  -19.469 1.00 28.21 ? 159  GLN D O   1 
ATOM   6933 C  CB  . GLN D 1 157 ? -29.365 30.871  -17.810 1.00 31.09 ? 159  GLN D CB  1 
ATOM   6934 C  CG  . GLN D 1 157 ? -28.121 31.702  -18.078 1.00 32.32 ? 159  GLN D CG  1 
ATOM   6935 C  CD  . GLN D 1 157 ? -26.861 31.115  -17.473 1.00 35.17 ? 159  GLN D CD  1 
ATOM   6936 O  OE1 . GLN D 1 157 ? -26.155 31.788  -16.717 1.00 33.92 ? 159  GLN D OE1 1 
ATOM   6937 N  NE2 . GLN D 1 157 ? -26.547 29.857  -17.830 1.00 37.11 ? 159  GLN D NE2 1 
ATOM   6938 N  N   . LEU D 1 158 ? -32.390 29.983  -17.791 1.00 26.47 ? 160  LEU D N   1 
ATOM   6939 C  CA  . LEU D 1 158 ? -33.394 28.945  -17.652 1.00 24.72 ? 160  LEU D CA  1 
ATOM   6940 C  C   . LEU D 1 158 ? -34.601 29.214  -18.519 1.00 24.57 ? 160  LEU D C   1 
ATOM   6941 O  O   . LEU D 1 158 ? -35.155 28.270  -19.114 1.00 22.58 ? 160  LEU D O   1 
ATOM   6942 C  CB  . LEU D 1 158 ? -33.824 28.794  -16.187 1.00 26.15 ? 160  LEU D CB  1 
ATOM   6943 C  CG  . LEU D 1 158 ? -32.708 28.445  -15.202 1.00 26.80 ? 160  LEU D CG  1 
ATOM   6944 C  CD1 . LEU D 1 158 ? -33.264 28.448  -13.786 1.00 27.85 ? 160  LEU D CD1 1 
ATOM   6945 C  CD2 . LEU D 1 158 ? -32.076 27.100  -15.528 1.00 26.96 ? 160  LEU D CD2 1 
ATOM   6946 N  N   . LEU D 1 159 ? -35.038 30.480  -18.574 1.00 23.74 ? 161  LEU D N   1 
ATOM   6947 C  CA  . LEU D 1 159 ? -36.281 30.815  -19.286 1.00 25.07 ? 161  LEU D CA  1 
ATOM   6948 C  C   . LEU D 1 159 ? -36.175 30.525  -20.791 1.00 24.24 ? 161  LEU D C   1 
ATOM   6949 O  O   . LEU D 1 159 ? -37.141 30.081  -21.401 1.00 23.13 ? 161  LEU D O   1 
ATOM   6950 C  CB  . LEU D 1 159 ? -36.693 32.270  -19.048 1.00 25.55 ? 161  LEU D CB  1 
ATOM   6951 C  CG  . LEU D 1 159 ? -37.093 32.621  -17.599 1.00 27.23 ? 161  LEU D CG  1 
ATOM   6952 C  CD1 . LEU D 1 159 ? -37.249 34.116  -17.441 1.00 26.55 ? 161  LEU D CD1 1 
ATOM   6953 C  CD2 . LEU D 1 159 ? -38.364 31.917  -17.184 1.00 27.76 ? 161  LEU D CD2 1 
ATOM   6954 N  N   . SER D 1 160 ? -34.984 30.728  -21.354 1.00 24.81 ? 162  SER D N   1 
ATOM   6955 C  CA  . SER D 1 160 ? -34.733 30.430  -22.765 1.00 25.34 ? 162  SER D CA  1 
ATOM   6956 C  C   . SER D 1 160 ? -34.782 28.946  -23.097 1.00 26.06 ? 162  SER D C   1 
ATOM   6957 O  O   . SER D 1 160 ? -34.850 28.602  -24.276 1.00 26.59 ? 162  SER D O   1 
ATOM   6958 C  CB  . SER D 1 160 ? -33.376 30.987  -23.192 1.00 25.59 ? 162  SER D CB  1 
ATOM   6959 O  OG  . SER D 1 160 ? -32.358 30.329  -22.482 1.00 25.17 ? 162  SER D OG  1 
ATOM   6960 N  N   . ARG D 1 161 ? -34.758 28.072  -22.084 1.00 24.58 ? 163  ARG D N   1 
ATOM   6961 C  CA  . ARG D 1 161 ? -34.867 26.626  -22.288 1.00 25.16 ? 163  ARG D CA  1 
ATOM   6962 C  C   . ARG D 1 161 ? -36.263 26.046  -22.078 1.00 25.08 ? 163  ARG D C   1 
ATOM   6963 O  O   . ARG D 1 161 ? -36.459 24.853  -22.277 1.00 25.13 ? 163  ARG D O   1 
ATOM   6964 C  CB  . ARG D 1 161 ? -33.861 25.918  -21.375 1.00 26.95 ? 163  ARG D CB  1 
ATOM   6965 C  CG  . ARG D 1 161 ? -32.429 26.474  -21.462 1.00 27.33 ? 163  ARG D CG  1 
ATOM   6966 C  CD  . ARG D 1 161 ? -31.846 26.380  -22.867 1.00 28.02 ? 163  ARG D CD  1 
ATOM   6967 N  NE  . ARG D 1 161 ? -31.682 24.981  -23.254 1.00 29.08 ? 163  ARG D NE  1 
ATOM   6968 C  CZ  . ARG D 1 161 ? -30.558 24.260  -23.136 1.00 28.71 ? 163  ARG D CZ  1 
ATOM   6969 N  NH1 . ARG D 1 161 ? -29.429 24.777  -22.663 1.00 27.81 ? 163  ARG D NH1 1 
ATOM   6970 N  NH2 . ARG D 1 161 ? -30.572 22.988  -23.494 1.00 29.25 ? 163  ARG D NH2 1 
ATOM   6971 N  N   . LEU D 1 162 ? -37.240 26.862  -21.687 1.00 23.74 ? 164  LEU D N   1 
ATOM   6972 C  CA  . LEU D 1 162 ? -38.567 26.335  -21.423 1.00 24.15 ? 164  LEU D CA  1 
ATOM   6973 C  C   . LEU D 1 162 ? -39.252 25.808  -22.677 1.00 24.35 ? 164  LEU D C   1 
ATOM   6974 O  O   . LEU D 1 162 ? -39.966 24.809  -22.595 1.00 23.53 ? 164  LEU D O   1 
ATOM   6975 C  CB  . LEU D 1 162 ? -39.456 27.386  -20.743 1.00 23.91 ? 164  LEU D CB  1 
ATOM   6976 C  CG  . LEU D 1 162 ? -39.028 27.862  -19.348 1.00 23.78 ? 164  LEU D CG  1 
ATOM   6977 C  CD1 . LEU D 1 162 ? -40.161 28.696  -18.742 1.00 24.27 ? 164  LEU D CD1 1 
ATOM   6978 C  CD2 . LEU D 1 162 ? -38.642 26.736  -18.396 1.00 23.16 ? 164  LEU D CD2 1 
ATOM   6979 N  N   . GLU D 1 163 ? -39.027 26.448  -23.835 1.00 26.19 ? 165  GLU D N   1 
ATOM   6980 C  CA  . GLU D 1 163 ? -39.648 25.992  -25.090 1.00 27.09 ? 165  GLU D CA  1 
ATOM   6981 C  C   . GLU D 1 163 ? -39.308 24.520  -25.359 1.00 27.04 ? 165  GLU D C   1 
ATOM   6982 O  O   . GLU D 1 163 ? -40.198 23.756  -25.685 1.00 26.05 ? 165  GLU D O   1 
ATOM   6983 C  CB  . GLU D 1 163 ? -39.279 26.898  -26.293 1.00 28.61 ? 165  GLU D CB  1 
ATOM   6984 N  N   . GLU D 1 164 ? -38.048 24.114  -25.147 1.00 28.29 ? 166  GLU D N   1 
ATOM   6985 C  CA  . GLU D 1 164 ? -37.639 22.685  -25.240 1.00 28.82 ? 166  GLU D CA  1 
ATOM   6986 C  C   . GLU D 1 164 ? -38.433 21.734  -24.362 1.00 26.74 ? 166  GLU D C   1 
ATOM   6987 O  O   . GLU D 1 164 ? -38.526 20.556  -24.682 1.00 26.06 ? 166  GLU D O   1 
ATOM   6988 C  CB  . GLU D 1 164 ? -36.181 22.477  -24.818 1.00 32.00 ? 166  GLU D CB  1 
ATOM   6989 C  CG  . GLU D 1 164 ? -35.157 22.985  -25.790 1.00 35.61 ? 166  GLU D CG  1 
ATOM   6990 C  CD  . GLU D 1 164 ? -33.827 23.241  -25.114 1.00 37.01 ? 166  GLU D CD  1 
ATOM   6991 O  OE1 . GLU D 1 164 ? -33.200 22.306  -24.549 1.00 35.34 ? 166  GLU D OE1 1 
ATOM   6992 O  OE2 . GLU D 1 164 ? -33.424 24.413  -25.117 1.00 42.70 ? 166  GLU D OE2 1 
ATOM   6993 N  N   . ILE D 1 165 ? -38.950 22.213  -23.236 1.00 23.98 ? 167  ILE D N   1 
ATOM   6994 C  CA  . ILE D 1 165 ? -39.695 21.334  -22.327 1.00 23.43 ? 167  ILE D CA  1 
ATOM   6995 C  C   . ILE D 1 165 ? -41.165 21.709  -22.160 1.00 24.10 ? 167  ILE D C   1 
ATOM   6996 O  O   . ILE D 1 165 ? -41.767 21.493  -21.102 1.00 23.12 ? 167  ILE D O   1 
ATOM   6997 C  CB  . ILE D 1 165 ? -38.998 21.208  -20.962 1.00 21.75 ? 167  ILE D CB  1 
ATOM   6998 C  CG1 . ILE D 1 165 ? -38.712 22.577  -20.351 1.00 20.67 ? 167  ILE D CG1 1 
ATOM   6999 C  CG2 . ILE D 1 165 ? -37.711 20.412  -21.135 1.00 22.46 ? 167  ILE D CG2 1 
ATOM   7000 C  CD1 . ILE D 1 165 ? -38.323 22.526  -18.888 1.00 20.18 ? 167  ILE D CD1 1 
ATOM   7001 N  N   . ALA D 1 166 ? -41.752 22.247  -23.221 1.00 25.09 ? 168  ALA D N   1 
ATOM   7002 C  CA  . ALA D 1 166 ? -43.158 22.640  -23.197 1.00 23.97 ? 168  ALA D CA  1 
ATOM   7003 C  C   . ALA D 1 166 ? -44.061 21.467  -22.831 1.00 23.34 ? 168  ALA D C   1 
ATOM   7004 O  O   . ALA D 1 166 ? -45.004 21.636  -22.090 1.00 21.61 ? 168  ALA D O   1 
ATOM   7005 C  CB  . ALA D 1 166 ? -43.558 23.234  -24.544 1.00 24.75 ? 168  ALA D CB  1 
ATOM   7006 N  N   . GLU D 1 167 ? -43.756 20.282  -23.345 1.00 24.38 ? 169  GLU D N   1 
ATOM   7007 C  CA  . GLU D 1 167 ? -44.575 19.098  -23.114 1.00 26.64 ? 169  GLU D CA  1 
ATOM   7008 C  C   . GLU D 1 167 ? -44.507 18.672  -21.652 1.00 27.01 ? 169  GLU D C   1 
ATOM   7009 O  O   . GLU D 1 167 ? -43.430 18.598  -21.059 1.00 23.69 ? 169  GLU D O   1 
ATOM   7010 C  CB  . GLU D 1 167 ? -44.099 17.944  -24.011 1.00 30.01 ? 169  GLU D CB  1 
ATOM   7011 C  CG  . GLU D 1 167 ? -44.903 16.640  -23.895 1.00 32.02 ? 169  GLU D CG  1 
ATOM   7012 C  CD  . GLU D 1 167 ? -44.215 15.426  -24.541 1.00 35.14 ? 169  GLU D CD  1 
ATOM   7013 O  OE1 . GLU D 1 167 ? -43.004 15.481  -24.858 1.00 37.48 ? 169  GLU D OE1 1 
ATOM   7014 O  OE2 . GLU D 1 167 ? -44.884 14.391  -24.727 1.00 35.90 ? 169  GLU D OE2 1 
ATOM   7015 N  N   . GLU D 1 168 ? -45.665 18.390  -21.071 1.00 27.90 ? 170  GLU D N   1 
ATOM   7016 C  CA  . GLU D 1 168 ? -45.726 17.867  -19.714 1.00 29.24 ? 170  GLU D CA  1 
ATOM   7017 C  C   . GLU D 1 168 ? -44.856 16.608  -19.609 1.00 27.02 ? 170  GLU D C   1 
ATOM   7018 O  O   . GLU D 1 168 ? -44.921 15.726  -20.469 1.00 23.89 ? 170  GLU D O   1 
ATOM   7019 C  CB  . GLU D 1 168 ? -47.171 17.531  -19.361 1.00 31.60 ? 170  GLU D CB  1 
ATOM   7020 C  CG  . GLU D 1 168 ? -47.364 16.748  -18.073 1.00 35.98 ? 170  GLU D CG  1 
ATOM   7021 C  CD  . GLU D 1 168 ? -48.762 16.159  -17.953 1.00 40.20 ? 170  GLU D CD  1 
ATOM   7022 O  OE1 . GLU D 1 168 ? -49.486 16.104  -18.970 1.00 45.52 ? 170  GLU D OE1 1 
ATOM   7023 O  OE2 . GLU D 1 168 ? -49.138 15.745  -16.842 1.00 44.34 ? 170  GLU D OE2 1 
ATOM   7024 N  N   . GLY D 1 169 ? -44.057 16.527  -18.551 1.00 24.57 ? 171  GLY D N   1 
ATOM   7025 C  CA  . GLY D 1 169 ? -43.190 15.366  -18.345 1.00 24.79 ? 171  GLY D CA  1 
ATOM   7026 C  C   . GLY D 1 169 ? -41.910 15.320  -19.186 1.00 23.49 ? 171  GLY D C   1 
ATOM   7027 O  O   . GLY D 1 169 ? -41.260 14.289  -19.259 1.00 24.55 ? 171  GLY D O   1 
ATOM   7028 N  N   . SER D 1 170 ? -41.545 16.424  -19.817 1.00 22.50 ? 172  SER D N   1 
ATOM   7029 C  CA  . SER D 1 170 ? -40.331 16.478  -20.623 1.00 21.78 ? 172  SER D CA  1 
ATOM   7030 C  C   . SER D 1 170 ? -39.205 17.113  -19.836 1.00 20.96 ? 172  SER D C   1 
ATOM   7031 O  O   . SER D 1 170 ? -39.431 17.861  -18.863 1.00 19.42 ? 172  SER D O   1 
ATOM   7032 C  CB  . SER D 1 170 ? -40.559 17.263  -21.908 1.00 21.96 ? 172  SER D CB  1 
ATOM   7033 O  OG  . SER D 1 170 ? -40.750 18.629  -21.620 1.00 22.68 ? 172  SER D OG  1 
ATOM   7034 N  N   . GLU D 1 171 ? -37.981 16.814  -20.262 1.00 20.48 ? 173  GLU D N   1 
ATOM   7035 C  CA  . GLU D 1 171 ? -36.810 17.356  -19.613 1.00 20.62 ? 173  GLU D CA  1 
ATOM   7036 C  C   . GLU D 1 171 ? -35.670 17.608  -20.596 1.00 19.73 ? 173  GLU D C   1 
ATOM   7037 O  O   . GLU D 1 171 ? -35.671 17.105  -21.725 1.00 18.58 ? 173  GLU D O   1 
ATOM   7038 C  CB  . GLU D 1 171 ? -36.375 16.461  -18.461 1.00 22.57 ? 173  GLU D CB  1 
ATOM   7039 C  CG  . GLU D 1 171 ? -35.865 15.086  -18.851 1.00 24.96 ? 173  GLU D CG  1 
ATOM   7040 C  CD  . GLU D 1 171 ? -35.559 14.212  -17.642 1.00 27.51 ? 173  GLU D CD  1 
ATOM   7041 O  OE1 . GLU D 1 171 ? -36.479 13.889  -16.885 1.00 32.76 ? 173  GLU D OE1 1 
ATOM   7042 O  OE2 . GLU D 1 171 ? -34.405 13.832  -17.443 1.00 29.27 ? 173  GLU D OE2 1 
ATOM   7043 N  N   . THR D 1 172 ? -34.740 18.442  -20.163 1.00 18.74 ? 174  THR D N   1 
ATOM   7044 C  CA  . THR D 1 172 ? -33.571 18.784  -20.942 1.00 20.26 ? 174  THR D CA  1 
ATOM   7045 C  C   . THR D 1 172 ? -32.403 19.032  -19.980 1.00 20.94 ? 174  THR D C   1 
ATOM   7046 O  O   . THR D 1 172 ? -32.596 19.237  -18.777 1.00 20.26 ? 174  THR D O   1 
ATOM   7047 C  CB  . THR D 1 172 ? -33.846 19.995  -21.873 1.00 21.42 ? 174  THR D CB  1 
ATOM   7048 O  OG1 . THR D 1 172 ? -32.779 20.136  -22.811 1.00 21.07 ? 174  THR D OG1 1 
ATOM   7049 C  CG2 . THR D 1 172 ? -33.996 21.291  -21.097 1.00 21.23 ? 174  THR D CG2 1 
ATOM   7050 N  N   . GLN D 1 173 ? -31.194 18.934  -20.507 1.00 21.51 ? 175  GLN D N   1 
ATOM   7051 C  CA  . GLN D 1 173 ? -29.989 19.244  -19.759 1.00 21.00 ? 175  GLN D CA  1 
ATOM   7052 C  C   . GLN D 1 173 ? -29.586 20.683  -20.072 1.00 20.03 ? 175  GLN D C   1 
ATOM   7053 O  O   . GLN D 1 173 ? -29.661 21.109  -21.227 1.00 20.71 ? 175  GLN D O   1 
ATOM   7054 C  CB  . GLN D 1 173 ? -28.878 18.234  -20.088 1.00 22.70 ? 175  GLN D CB  1 
ATOM   7055 C  CG  . GLN D 1 173 ? -29.122 16.855  -19.468 1.00 23.95 ? 175  GLN D CG  1 
ATOM   7056 C  CD  . GLN D 1 173 ? -27.933 15.909  -19.596 1.00 25.52 ? 175  GLN D CD  1 
ATOM   7057 O  OE1 . GLN D 1 173 ? -27.205 15.673  -18.624 1.00 29.24 ? 175  GLN D OE1 1 
ATOM   7058 N  NE2 . GLN D 1 173 ? -27.731 15.361  -20.786 1.00 25.64 ? 175  GLN D NE2 1 
ATOM   7059 N  N   . VAL D 1 174 ? -29.208 21.440  -19.043 1.00 18.41 ? 176  VAL D N   1 
ATOM   7060 C  CA  . VAL D 1 174 ? -28.745 22.828  -19.187 1.00 19.52 ? 176  VAL D CA  1 
ATOM   7061 C  C   . VAL D 1 174 ? -27.393 23.043  -18.467 1.00 19.70 ? 176  VAL D C   1 
ATOM   7062 O  O   . VAL D 1 174 ? -27.106 22.372  -17.494 1.00 20.06 ? 176  VAL D O   1 
ATOM   7063 C  CB  . VAL D 1 174 ? -29.781 23.841  -18.665 1.00 20.13 ? 176  VAL D CB  1 
ATOM   7064 C  CG1 . VAL D 1 174 ? -31.165 23.465  -19.178 1.00 20.46 ? 176  VAL D CG1 1 
ATOM   7065 C  CG2 . VAL D 1 174 ? -29.799 23.930  -17.126 1.00 20.55 ? 176  VAL D CG2 1 
ATOM   7066 N  N   . PRO D 1 175 ? -26.579 23.995  -18.938 1.00 20.71 ? 177  PRO D N   1 
ATOM   7067 C  CA  . PRO D 1 175 ? -25.288 24.234  -18.282 1.00 21.19 ? 177  PRO D CA  1 
ATOM   7068 C  C   . PRO D 1 175 ? -25.447 24.742  -16.861 1.00 21.72 ? 177  PRO D C   1 
ATOM   7069 O  O   . PRO D 1 175 ? -26.431 25.433  -16.564 1.00 21.92 ? 177  PRO D O   1 
ATOM   7070 C  CB  . PRO D 1 175 ? -24.625 25.319  -19.136 1.00 21.34 ? 177  PRO D CB  1 
ATOM   7071 C  CG  . PRO D 1 175 ? -25.605 25.711  -20.182 1.00 22.37 ? 177  PRO D CG  1 
ATOM   7072 C  CD  . PRO D 1 175 ? -26.740 24.759  -20.188 1.00 21.73 ? 177  PRO D CD  1 
ATOM   7073 N  N   . GLY D 1 176 ? -24.487 24.411  -15.999 1.00 20.54 ? 178  GLY D N   1 
ATOM   7074 C  CA  . GLY D 1 176 ? -24.422 24.985  -14.657 1.00 21.11 ? 178  GLY D CA  1 
ATOM   7075 C  C   . GLY D 1 176 ? -24.373 26.501  -14.759 1.00 21.70 ? 178  GLY D C   1 
ATOM   7076 O  O   . GLY D 1 176 ? -23.987 27.046  -15.794 1.00 21.13 ? 178  GLY D O   1 
ATOM   7077 N  N   . LEU D 1 177 ? -24.827 27.165  -13.702 1.00 21.60 ? 179  LEU D N   1 
ATOM   7078 C  CA  . LEU D 1 177 ? -24.870 28.620  -13.611 1.00 21.97 ? 179  LEU D CA  1 
ATOM   7079 C  C   . LEU D 1 177 ? -24.717 29.029  -12.143 1.00 21.36 ? 179  LEU D C   1 
ATOM   7080 O  O   . LEU D 1 177 ? -24.716 28.177  -11.242 1.00 20.74 ? 179  LEU D O   1 
ATOM   7081 C  CB  . LEU D 1 177 ? -26.173 29.185  -14.195 1.00 24.30 ? 179  LEU D CB  1 
ATOM   7082 C  CG  . LEU D 1 177 ? -27.513 28.852  -13.520 1.00 26.41 ? 179  LEU D CG  1 
ATOM   7083 C  CD1 . LEU D 1 177 ? -28.583 29.888  -13.841 1.00 27.25 ? 179  LEU D CD1 1 
ATOM   7084 C  CD2 . LEU D 1 177 ? -27.998 27.460  -13.911 1.00 26.61 ? 179  LEU D CD2 1 
ATOM   7085 N  N   . ASP D 1 178 ? -24.572 30.325  -11.900 1.00 20.70 ? 180  ASP D N   1 
ATOM   7086 C  CA  . ASP D 1 178 ? -24.571 30.827  -10.519 1.00 20.70 ? 180  ASP D CA  1 
ATOM   7087 C  C   . ASP D 1 178 ? -25.979 30.743  -9.971  1.00 19.88 ? 180  ASP D C   1 
ATOM   7088 O  O   . ASP D 1 178 ? -26.822 31.594  -10.226 1.00 19.32 ? 180  ASP D O   1 
ATOM   7089 C  CB  . ASP D 1 178 ? -24.082 32.262  -10.453 1.00 21.05 ? 180  ASP D CB  1 
ATOM   7090 C  CG  . ASP D 1 178 ? -23.948 32.766  -9.035  1.00 22.02 ? 180  ASP D CG  1 
ATOM   7091 O  OD1 . ASP D 1 178 ? -24.371 32.109  -8.062  1.00 22.16 ? 180  ASP D OD1 1 
ATOM   7092 O  OD2 . ASP D 1 178 ? -23.370 33.832  -8.882  1.00 23.34 ? 180  ASP D OD2 1 
ATOM   7093 N  N   . ILE D 1 179 ? -26.217 29.715  -9.185  1.00 21.00 ? 181  ILE D N   1 
ATOM   7094 C  CA  . ILE D 1 179 ? -27.537 29.478  -8.632  1.00 20.60 ? 181  ILE D CA  1 
ATOM   7095 C  C   . ILE D 1 179 ? -27.920 30.635  -7.687  1.00 20.52 ? 181  ILE D C   1 
ATOM   7096 O  O   . ILE D 1 179 ? -29.083 31.037  -7.639  1.00 20.78 ? 181  ILE D O   1 
ATOM   7097 C  CB  . ILE D 1 179 ? -27.599 28.106  -7.916  1.00 19.99 ? 181  ILE D CB  1 
ATOM   7098 C  CG1 . ILE D 1 179 ? -27.263 26.967  -8.902  1.00 19.47 ? 181  ILE D CG1 1 
ATOM   7099 C  CG2 . ILE D 1 179 ? -28.965 27.876  -7.260  1.00 19.39 ? 181  ILE D CG2 1 
ATOM   7100 C  CD1 . ILE D 1 179 ? -28.251 26.820  -10.041 1.00 20.20 ? 181  ILE D CD1 1 
ATOM   7101 N  N   . SER D 1 180 ? -26.945 31.187  -6.976  1.00 21.39 ? 182  SER D N   1 
ATOM   7102 C  CA  . SER D 1 180 ? -27.235 32.261  -6.015  1.00 23.25 ? 182  SER D CA  1 
ATOM   7103 C  C   . SER D 1 180 ? -27.650 33.557  -6.702  1.00 23.17 ? 182  SER D C   1 
ATOM   7104 O  O   . SER D 1 180 ? -28.297 34.398  -6.080  1.00 24.26 ? 182  SER D O   1 
ATOM   7105 C  CB  . SER D 1 180 ? -26.081 32.468  -5.025  1.00 23.74 ? 182  SER D CB  1 
ATOM   7106 O  OG  . SER D 1 180 ? -24.968 33.060  -5.649  1.00 26.21 ? 182  SER D OG  1 
ATOM   7107 N  N   . ALA D 1 181 ? -27.363 33.686  -8.000  1.00 22.57 ? 183  ALA D N   1 
ATOM   7108 C  CA  . ALA D 1 181 ? -27.828 34.842  -8.784  1.00 22.02 ? 183  ALA D CA  1 
ATOM   7109 C  C   . ALA D 1 181 ? -29.313 34.797  -9.110  1.00 21.66 ? 183  ALA D C   1 
ATOM   7110 O  O   . ALA D 1 181 ? -29.845 35.774  -9.640  1.00 22.79 ? 183  ALA D O   1 
ATOM   7111 C  CB  . ALA D 1 181 ? -27.020 34.970  -10.065 1.00 22.28 ? 183  ALA D CB  1 
ATOM   7112 N  N   . LEU D 1 182 ? -29.972 33.670  -8.839  1.00 20.53 ? 184  LEU D N   1 
ATOM   7113 C  CA  . LEU D 1 182 ? -31.428 33.563  -8.974  1.00 21.06 ? 184  LEU D CA  1 
ATOM   7114 C  C   . LEU D 1 182 ? -32.166 34.079  -7.734  1.00 20.90 ? 184  LEU D C   1 
ATOM   7115 O  O   . LEU D 1 182 ? -33.392 34.168  -7.739  1.00 22.06 ? 184  LEU D O   1 
ATOM   7116 C  CB  . LEU D 1 182 ? -31.846 32.114  -9.218  1.00 19.93 ? 184  LEU D CB  1 
ATOM   7117 C  CG  . LEU D 1 182 ? -31.234 31.434  -10.446 1.00 19.86 ? 184  LEU D CG  1 
ATOM   7118 C  CD1 . LEU D 1 182 ? -31.580 29.956  -10.424 1.00 19.34 ? 184  LEU D CD1 1 
ATOM   7119 C  CD2 . LEU D 1 182 ? -31.701 32.098  -11.735 1.00 19.81 ? 184  LEU D CD2 1 
ATOM   7120 N  N   . LEU D 1 183 ? -31.418 34.380  -6.685  1.00 22.15 ? 185  LEU D N   1 
ATOM   7121 C  CA  . LEU D 1 183 ? -31.949 34.861  -5.407  1.00 22.83 ? 185  LEU D CA  1 
ATOM   7122 C  C   . LEU D 1 183 ? -31.555 36.313  -5.177  1.00 24.02 ? 185  LEU D C   1 
ATOM   7123 O  O   . LEU D 1 183 ? -30.633 36.800  -5.811  1.00 24.13 ? 185  LEU D O   1 
ATOM   7124 C  CB  . LEU D 1 183 ? -31.354 34.026  -4.274  1.00 22.18 ? 185  LEU D CB  1 
ATOM   7125 C  CG  . LEU D 1 183 ? -31.704 32.555  -4.301  1.00 21.55 ? 185  LEU D CG  1 
ATOM   7126 C  CD1 . LEU D 1 183 ? -31.016 31.865  -3.140  1.00 22.27 ? 185  LEU D CD1 1 
ATOM   7127 C  CD2 . LEU D 1 183 ? -33.201 32.385  -4.217  1.00 22.47 ? 185  LEU D CD2 1 
ATOM   7128 N  N   . PRO D 1 184 ? -32.218 37.003  -4.225  1.00 26.50 ? 186  PRO D N   1 
ATOM   7129 C  CA  . PRO D 1 184 ? -31.823 38.394  -3.932  1.00 26.01 ? 186  PRO D CA  1 
ATOM   7130 C  C   . PRO D 1 184 ? -30.398 38.502  -3.400  1.00 25.21 ? 186  PRO D C   1 
ATOM   7131 O  O   . PRO D 1 184 ? -29.864 37.524  -2.879  1.00 22.96 ? 186  PRO D O   1 
ATOM   7132 C  CB  . PRO D 1 184 ? -32.832 38.830  -2.860  1.00 26.59 ? 186  PRO D CB  1 
ATOM   7133 C  CG  . PRO D 1 184 ? -33.963 37.868  -2.970  1.00 26.69 ? 186  PRO D CG  1 
ATOM   7134 C  CD  . PRO D 1 184 ? -33.351 36.573  -3.392  1.00 26.24 ? 186  PRO D CD  1 
ATOM   7135 N  N   . SER D 1 185 ? -29.791 39.676  -3.526  1.00 26.31 ? 187  SER D N   1 
ATOM   7136 C  CA  . SER D 1 185 ? -28.431 39.899  -3.009  1.00 28.71 ? 187  SER D CA  1 
ATOM   7137 C  C   . SER D 1 185 ? -28.413 40.082  -1.493  1.00 27.94 ? 187  SER D C   1 
ATOM   7138 O  O   . SER D 1 185 ? -27.403 39.827  -0.844  1.00 26.98 ? 187  SER D O   1 
ATOM   7139 C  CB  . SER D 1 185 ? -27.780 41.105  -3.686  1.00 32.20 ? 187  SER D CB  1 
ATOM   7140 O  OG  . SER D 1 185 ? -28.714 42.161  -3.846  1.00 36.10 ? 187  SER D OG  1 
ATOM   7141 N  N   . ASP D 1 186 ? -29.538 40.518  -0.934  1.00 28.88 ? 188  ASP D N   1 
ATOM   7142 C  CA  . ASP D 1 186 ? -29.651 40.757  0.500   1.00 28.92 ? 188  ASP D CA  1 
ATOM   7143 C  C   . ASP D 1 186 ? -30.033 39.441  1.225   1.00 26.84 ? 188  ASP D C   1 
ATOM   7144 O  O   . ASP D 1 186 ? -31.190 39.026  1.195   1.00 25.95 ? 188  ASP D O   1 
ATOM   7145 C  CB  . ASP D 1 186 ? -30.689 41.860  0.748   1.00 29.56 ? 188  ASP D CB  1 
ATOM   7146 C  CG  . ASP D 1 186 ? -30.742 42.302  2.204   1.00 32.56 ? 188  ASP D CG  1 
ATOM   7147 O  OD1 . ASP D 1 186 ? -30.102 41.670  3.065   1.00 33.52 ? 188  ASP D OD1 1 
ATOM   7148 O  OD2 . ASP D 1 186 ? -31.421 43.302  2.489   1.00 36.87 ? 188  ASP D OD2 1 
ATOM   7149 N  N   . PHE D 1 187 ? -29.054 38.817  1.875   1.00 26.63 ? 189  PHE D N   1 
ATOM   7150 C  CA  . PHE D 1 187 ? -29.257 37.561  2.633   1.00 28.61 ? 189  PHE D CA  1 
ATOM   7151 C  C   . PHE D 1 187 ? -29.466 37.809  4.141   1.00 25.84 ? 189  PHE D C   1 
ATOM   7152 O  O   . PHE D 1 187 ? -29.524 36.868  4.924   1.00 24.33 ? 189  PHE D O   1 
ATOM   7153 C  CB  . PHE D 1 187 ? -28.069 36.600  2.444   1.00 31.69 ? 189  PHE D CB  1 
ATOM   7154 C  CG  . PHE D 1 187 ? -27.922 36.056  1.048   1.00 38.53 ? 189  PHE D CG  1 
ATOM   7155 C  CD1 . PHE D 1 187 ? -28.779 35.075  0.574   1.00 43.10 ? 189  PHE D CD1 1 
ATOM   7156 C  CD2 . PHE D 1 187 ? -26.897 36.508  0.205   1.00 46.40 ? 189  PHE D CD2 1 
ATOM   7157 C  CE1 . PHE D 1 187 ? -28.643 34.561  -0.718  1.00 46.39 ? 189  PHE D CE1 1 
ATOM   7158 C  CE2 . PHE D 1 187 ? -26.748 35.996  -1.084  1.00 48.40 ? 189  PHE D CE2 1 
ATOM   7159 C  CZ  . PHE D 1 187 ? -27.622 35.018  -1.542  1.00 46.51 ? 189  PHE D CZ  1 
ATOM   7160 N  N   . SER D 1 188 ? -29.564 39.071  4.538   1.00 25.13 ? 190  SER D N   1 
ATOM   7161 C  CA  . SER D 1 188 ? -29.681 39.454  5.946   1.00 25.46 ? 190  SER D CA  1 
ATOM   7162 C  C   . SER D 1 188 ? -31.119 39.783  6.383   1.00 23.31 ? 190  SER D C   1 
ATOM   7163 O  O   . SER D 1 188 ? -31.437 39.712  7.573   1.00 23.74 ? 190  SER D O   1 
ATOM   7164 C  CB  . SER D 1 188 ? -28.783 40.670  6.204   1.00 25.79 ? 190  SER D CB  1 
ATOM   7165 O  OG  . SER D 1 188 ? -29.373 41.792  5.583   1.00 28.51 ? 190  SER D OG  1 
ATOM   7166 N  N   . ARG D 1 189 ? -31.967 40.169  5.436   1.00 23.79 ? 191  ARG D N   1 
ATOM   7167 C  CA  . ARG D 1 189 ? -33.335 40.598  5.739   1.00 24.08 ? 191  ARG D CA  1 
ATOM   7168 C  C   . ARG D 1 189 ? -34.333 39.554  5.243   1.00 22.64 ? 191  ARG D C   1 
ATOM   7169 O  O   . ARG D 1 189 ? -34.538 39.400  4.041   1.00 22.64 ? 191  ARG D O   1 
ATOM   7170 C  CB  . ARG D 1 189 ? -33.626 41.970  5.118   1.00 25.82 ? 191  ARG D CB  1 
ATOM   7171 C  CG  . ARG D 1 189 ? -32.723 43.080  5.669   1.00 27.46 ? 191  ARG D CG  1 
ATOM   7172 C  CD  . ARG D 1 189 ? -33.003 44.417  5.002   1.00 29.23 ? 191  ARG D CD  1 
ATOM   7173 N  NE  . ARG D 1 189 ? -34.230 45.020  5.509   1.00 32.35 ? 191  ARG D NE  1 
ATOM   7174 C  CZ  . ARG D 1 189 ? -34.345 45.735  6.637   1.00 33.16 ? 191  ARG D CZ  1 
ATOM   7175 N  NH1 . ARG D 1 189 ? -33.304 45.972  7.435   1.00 33.11 ? 191  ARG D NH1 1 
ATOM   7176 N  NH2 . ARG D 1 189 ? -35.534 46.224  6.966   1.00 35.32 ? 191  ARG D NH2 1 
ATOM   7177 N  N   . TYR D 1 190 ? -34.966 38.857  6.183   1.00 19.92 ? 192  TYR D N   1 
ATOM   7178 C  CA  . TYR D 1 190 ? -35.891 37.787  5.828   1.00 19.33 ? 192  TYR D CA  1 
ATOM   7179 C  C   . TYR D 1 190 ? -36.886 37.471  6.918   1.00 18.56 ? 192  TYR D C   1 
ATOM   7180 O  O   . TYR D 1 190 ? -36.706 37.850  8.076   1.00 17.39 ? 192  TYR D O   1 
ATOM   7181 C  CB  . TYR D 1 190 ? -35.120 36.508  5.455   1.00 18.69 ? 192  TYR D CB  1 
ATOM   7182 C  CG  . TYR D 1 190 ? -34.172 36.004  6.507   1.00 18.16 ? 192  TYR D CG  1 
ATOM   7183 C  CD1 . TYR D 1 190 ? -34.608 35.167  7.518   1.00 17.84 ? 192  TYR D CD1 1 
ATOM   7184 C  CD2 . TYR D 1 190 ? -32.832 36.356  6.486   1.00 18.44 ? 192  TYR D CD2 1 
ATOM   7185 C  CE1 . TYR D 1 190 ? -33.743 34.694  8.480   1.00 17.76 ? 192  TYR D CE1 1 
ATOM   7186 C  CE2 . TYR D 1 190 ? -31.955 35.872  7.439   1.00 18.77 ? 192  TYR D CE2 1 
ATOM   7187 C  CZ  . TYR D 1 190 ? -32.421 35.047  8.443   1.00 18.18 ? 192  TYR D CZ  1 
ATOM   7188 O  OH  . TYR D 1 190 ? -31.552 34.548  9.397   1.00 17.65 ? 192  TYR D OH  1 
ATOM   7189 N  N   . PHE D 1 191 ? -37.938 36.773  6.498   1.00 17.70 ? 193  PHE D N   1 
ATOM   7190 C  CA  . PHE D 1 191 ? -38.930 36.206  7.371   1.00 18.89 ? 193  PHE D CA  1 
ATOM   7191 C  C   . PHE D 1 191 ? -38.658 34.705  7.488   1.00 18.84 ? 193  PHE D C   1 
ATOM   7192 O  O   . PHE D 1 191 ? -38.191 34.080  6.523   1.00 17.95 ? 193  PHE D O   1 
ATOM   7193 C  CB  . PHE D 1 191 ? -40.308 36.404  6.773   1.00 18.80 ? 193  PHE D CB  1 
ATOM   7194 C  CG  . PHE D 1 191 ? -40.677 37.836  6.594   1.00 20.98 ? 193  PHE D CG  1 
ATOM   7195 C  CD1 . PHE D 1 191 ? -41.087 38.600  7.692   1.00 21.88 ? 193  PHE D CD1 1 
ATOM   7196 C  CD2 . PHE D 1 191 ? -40.612 38.440  5.342   1.00 21.79 ? 193  PHE D CD2 1 
ATOM   7197 C  CE1 . PHE D 1 191 ? -41.432 39.941  7.543   1.00 22.24 ? 193  PHE D CE1 1 
ATOM   7198 C  CE2 . PHE D 1 191 ? -40.954 39.792  5.186   1.00 22.88 ? 193  PHE D CE2 1 
ATOM   7199 C  CZ  . PHE D 1 191 ? -41.364 40.541  6.290   1.00 22.60 ? 193  PHE D CZ  1 
ATOM   7200 N  N   . GLN D 1 192 ? -38.990 34.130  8.645   1.00 17.72 ? 194  GLN D N   1 
ATOM   7201 C  CA  . GLN D 1 192 ? -38.788 32.715  8.879   1.00 17.57 ? 194  GLN D CA  1 
ATOM   7202 C  C   . GLN D 1 192 ? -39.868 32.147  9.760   1.00 17.51 ? 194  GLN D C   1 
ATOM   7203 O  O   . GLN D 1 192 ? -40.191 32.720  10.798  1.00 19.10 ? 194  GLN D O   1 
ATOM   7204 C  CB  . GLN D 1 192 ? -37.425 32.477  9.501   1.00 18.11 ? 194  GLN D CB  1 
ATOM   7205 C  CG  . GLN D 1 192 ? -37.017 31.007  9.536   1.00 18.03 ? 194  GLN D CG  1 
ATOM   7206 C  CD  . GLN D 1 192 ? -35.546 30.873  9.836   1.00 18.54 ? 194  GLN D CD  1 
ATOM   7207 O  OE1 . GLN D 1 192 ? -35.172 30.658  10.975  1.00 18.67 ? 194  GLN D OE1 1 
ATOM   7208 N  NE2 . GLN D 1 192 ? -34.697 31.058  8.816   1.00 18.07 ? 194  GLN D NE2 1 
ATOM   7209 N  N   . TYR D 1 193 ? -40.437 31.027  9.328   1.00 16.57 ? 195  TYR D N   1 
ATOM   7210 C  CA  . TYR D 1 193 ? -41.443 30.306  10.105  1.00 16.45 ? 195  TYR D CA  1 
ATOM   7211 C  C   . TYR D 1 193 ? -41.386 28.807  9.769   1.00 16.70 ? 195  TYR D C   1 
ATOM   7212 O  O   . TYR D 1 193 ? -40.812 28.400  8.734   1.00 16.70 ? 195  TYR D O   1 
ATOM   7213 C  CB  . TYR D 1 193 ? -42.835 30.874  9.782   1.00 15.51 ? 195  TYR D CB  1 
ATOM   7214 C  CG  . TYR D 1 193 ? -43.390 30.434  8.452   1.00 14.14 ? 195  TYR D CG  1 
ATOM   7215 C  CD1 . TYR D 1 193 ? -43.023 31.069  7.278   1.00 14.06 ? 195  TYR D CD1 1 
ATOM   7216 C  CD2 . TYR D 1 193 ? -44.294 29.390  8.372   1.00 14.16 ? 195  TYR D CD2 1 
ATOM   7217 C  CE1 . TYR D 1 193 ? -43.520 30.660  6.053   1.00 14.42 ? 195  TYR D CE1 1 
ATOM   7218 C  CE2 . TYR D 1 193 ? -44.813 28.971  7.152   1.00 14.20 ? 195  TYR D CE2 1 
ATOM   7219 C  CZ  . TYR D 1 193 ? -44.409 29.596  5.993   1.00 14.30 ? 195  TYR D CZ  1 
ATOM   7220 O  OH  . TYR D 1 193 ? -44.913 29.185  4.772   1.00 15.33 ? 195  TYR D OH  1 
ATOM   7221 N  N   . GLU D 1 194 ? -42.033 28.007  10.604  1.00 16.80 ? 196  GLU D N   1 
ATOM   7222 C  CA  . GLU D 1 194 ? -42.132 26.584  10.386  1.00 17.80 ? 196  GLU D CA  1 
ATOM   7223 C  C   . GLU D 1 194 ? -43.484 26.196  9.752   1.00 17.21 ? 196  GLU D C   1 
ATOM   7224 O  O   . GLU D 1 194 ? -44.557 26.580  10.232  1.00 16.56 ? 196  GLU D O   1 
ATOM   7225 C  CB  . GLU D 1 194 ? -41.872 25.796  11.672  1.00 20.21 ? 196  GLU D CB  1 
ATOM   7226 C  CG  . GLU D 1 194 ? -41.570 24.321  11.381  1.00 22.15 ? 196  GLU D CG  1 
ATOM   7227 C  CD  . GLU D 1 194 ? -41.196 23.510  12.612  1.00 24.35 ? 196  GLU D CD  1 
ATOM   7228 O  OE1 . GLU D 1 194 ? -40.378 23.970  13.437  1.00 26.96 ? 196  GLU D OE1 1 
ATOM   7229 O  OE2 . GLU D 1 194 ? -41.727 22.400  12.758  1.00 25.83 ? 196  GLU D OE2 1 
ATOM   7230 N  N   . GLY D 1 195 ? -43.411 25.447  8.653   1.00 15.66 ? 197  GLY D N   1 
ATOM   7231 C  CA  . GLY D 1 195 ? -44.603 24.983  7.962   1.00 15.45 ? 197  GLY D CA  1 
ATOM   7232 C  C   . GLY D 1 195 ? -44.394 23.641  7.293   1.00 15.69 ? 197  GLY D C   1 
ATOM   7233 O  O   . GLY D 1 195 ? -43.849 22.718  7.903   1.00 16.10 ? 197  GLY D O   1 
ATOM   7234 N  N   . SER D 1 196 ? -44.805 23.554  6.035   1.00 15.40 ? 198  SER D N   1 
ATOM   7235 C  CA  . SER D 1 196 ? -44.954 22.304  5.333   1.00 15.27 ? 198  SER D CA  1 
ATOM   7236 C  C   . SER D 1 196 ? -44.506 22.407  3.892   1.00 15.69 ? 198  SER D C   1 
ATOM   7237 O  O   . SER D 1 196 ? -44.342 23.485  3.375   1.00 14.83 ? 198  SER D O   1 
ATOM   7238 C  CB  . SER D 1 196 ? -46.437 21.885  5.336   1.00 14.87 ? 198  SER D CB  1 
ATOM   7239 O  OG  . SER D 1 196 ? -47.209 22.565  4.330   1.00 14.22 ? 198  SER D OG  1 
ATOM   7240 N  N   . LEU D 1 197 ? -44.386 21.259  3.226   1.00 16.93 ? 199  LEU D N   1 
ATOM   7241 C  CA  . LEU D 1 197 ? -44.287 21.234  1.779   1.00 17.86 ? 199  LEU D CA  1 
ATOM   7242 C  C   . LEU D 1 197 ? -45.643 21.723  1.255   1.00 19.59 ? 199  LEU D C   1 
ATOM   7243 O  O   . LEU D 1 197 ? -46.679 21.485  1.908   1.00 18.38 ? 199  LEU D O   1 
ATOM   7244 C  CB  . LEU D 1 197 ? -43.987 19.822  1.271   1.00 18.46 ? 199  LEU D CB  1 
ATOM   7245 C  CG  . LEU D 1 197 ? -42.659 19.208  1.759   1.00 19.88 ? 199  LEU D CG  1 
ATOM   7246 C  CD1 . LEU D 1 197 ? -42.495 17.815  1.168   1.00 21.50 ? 199  LEU D CD1 1 
ATOM   7247 C  CD2 . LEU D 1 197 ? -41.451 20.070  1.421   1.00 19.41 ? 199  LEU D CD2 1 
ATOM   7248 N  N   . THR D 1 198 ? -45.627 22.463  0.139   1.00 20.23 ? 200  THR D N   1 
ATOM   7249 C  CA  . THR D 1 198 ? -46.837 23.093  -0.393  1.00 21.86 ? 200  THR D CA  1 
ATOM   7250 C  C   . THR D 1 198 ? -47.536 22.250  -1.450  1.00 22.58 ? 200  THR D C   1 
ATOM   7251 O  O   . THR D 1 198 ? -48.508 22.704  -2.050  1.00 21.85 ? 200  THR D O   1 
ATOM   7252 C  CB  . THR D 1 198 ? -46.590 24.500  -0.979  1.00 21.96 ? 200  THR D CB  1 
ATOM   7253 O  OG1 . THR D 1 198 ? -45.842 24.410  -2.201  1.00 23.78 ? 200  THR D OG1 1 
ATOM   7254 C  CG2 . THR D 1 198 ? -45.877 25.360  0.010   1.00 22.16 ? 200  THR D CG2 1 
ATOM   7255 N  N   . THR D 1 199 ? -47.039 21.043  -1.681  1.00 22.18 ? 201  THR D N   1 
ATOM   7256 C  CA  . THR D 1 199 ? -47.733 20.068  -2.501  1.00 23.33 ? 201  THR D CA  1 
ATOM   7257 C  C   . THR D 1 199 ? -47.665 18.775  -1.718  1.00 22.75 ? 201  THR D C   1 
ATOM   7258 O  O   . THR D 1 199 ? -46.856 18.670  -0.767  1.00 22.63 ? 201  THR D O   1 
ATOM   7259 C  CB  . THR D 1 199 ? -47.052 19.841  -3.893  1.00 23.96 ? 201  THR D CB  1 
ATOM   7260 O  OG1 . THR D 1 199 ? -45.792 19.190  -3.716  1.00 23.25 ? 201  THR D OG1 1 
ATOM   7261 C  CG2 . THR D 1 199 ? -46.848 21.142  -4.642  1.00 24.00 ? 201  THR D CG2 1 
ATOM   7262 N  N   . PRO D 1 200 ? -48.466 17.772  -2.123  1.00 22.41 ? 202  PRO D N   1 
ATOM   7263 C  CA  . PRO D 1 200 ? -48.283 16.489  -1.469  1.00 23.59 ? 202  PRO D CA  1 
ATOM   7264 C  C   . PRO D 1 200 ? -46.826 16.052  -1.586  1.00 25.07 ? 202  PRO D C   1 
ATOM   7265 O  O   . PRO D 1 200 ? -46.185 16.354  -2.622  1.00 27.09 ? 202  PRO D O   1 
ATOM   7266 C  CB  . PRO D 1 200 ? -49.212 15.553  -2.245  1.00 22.83 ? 202  PRO D CB  1 
ATOM   7267 C  CG  . PRO D 1 200 ? -50.302 16.460  -2.735  1.00 23.50 ? 202  PRO D CG  1 
ATOM   7268 C  CD  . PRO D 1 200 ? -49.568 17.731  -3.103  1.00 23.48 ? 202  PRO D CD  1 
ATOM   7269 N  N   . PRO D 1 201 ? -46.291 15.371  -0.574  1.00 24.11 ? 203  PRO D N   1 
ATOM   7270 C  CA  . PRO D 1 201 ? -47.040 14.882  0.591   1.00 23.42 ? 203  PRO D CA  1 
ATOM   7271 C  C   . PRO D 1 201 ? -47.304 15.916  1.734   1.00 22.34 ? 203  PRO D C   1 
ATOM   7272 O  O   . PRO D 1 201 ? -47.865 15.525  2.735   1.00 24.57 ? 203  PRO D O   1 
ATOM   7273 C  CB  . PRO D 1 201 ? -46.152 13.742  1.096   1.00 24.28 ? 203  PRO D CB  1 
ATOM   7274 C  CG  . PRO D 1 201 ? -44.769 14.230  0.794   1.00 24.74 ? 203  PRO D CG  1 
ATOM   7275 C  CD  . PRO D 1 201 ? -44.870 14.980  -0.520  1.00 24.22 ? 203  PRO D CD  1 
ATOM   7276 N  N   . CYS D 1 202 ? -46.956 17.196  1.570   1.00 20.92 ? 204  CYS D N   1 
ATOM   7277 C  CA  . CYS D 1 202 ? -47.334 18.285  2.515   1.00 20.31 ? 204  CYS D CA  1 
ATOM   7278 C  C   . CYS D 1 202 ? -46.805 18.089  3.950   1.00 20.01 ? 204  CYS D C   1 
ATOM   7279 O  O   . CYS D 1 202 ? -47.410 18.577  4.928   1.00 17.81 ? 204  CYS D O   1 
ATOM   7280 C  CB  . CYS D 1 202 ? -48.852 18.477  2.604   1.00 20.51 ? 204  CYS D CB  1 
ATOM   7281 S  SG  . CYS D 1 202 ? -49.822 18.774  1.104   1.00 21.68 ? 204  CYS D SG  1 
ATOM   7282 N  N   . ALA D 1 203 ? -45.699 17.353  4.080   1.00 18.31 ? 205  ALA D N   1 
ATOM   7283 C  CA  . ALA D 1 203 ? -45.145 17.053  5.371   1.00 17.03 ? 205  ALA D CA  1 
ATOM   7284 C  C   . ALA D 1 203 ? -44.730 18.345  6.094   1.00 16.71 ? 205  ALA D C   1 
ATOM   7285 O  O   . ALA D 1 203 ? -44.185 19.280  5.475   1.00 15.28 ? 205  ALA D O   1 
ATOM   7286 C  CB  . ALA D 1 203 ? -43.954 16.124  5.225   1.00 17.92 ? 205  ALA D CB  1 
ATOM   7287 N  N   . GLN D 1 204 ? -44.989 18.368  7.401   1.00 16.00 ? 206  GLN D N   1 
ATOM   7288 C  CA  . GLN D 1 204 ? -44.638 19.487  8.260   1.00 16.60 ? 206  GLN D CA  1 
ATOM   7289 C  C   . GLN D 1 204 ? -43.196 19.375  8.766   1.00 17.12 ? 206  GLN D C   1 
ATOM   7290 O  O   . GLN D 1 204 ? -42.473 18.458  8.370   1.00 17.94 ? 206  GLN D O   1 
ATOM   7291 C  CB  . GLN D 1 204 ? -45.695 19.611  9.385   1.00 17.12 ? 206  GLN D CB  1 
ATOM   7292 C  CG  . GLN D 1 204 ? -46.986 20.164  8.775   1.00 17.46 ? 206  GLN D CG  1 
ATOM   7293 C  CD  . GLN D 1 204 ? -48.199 20.202  9.714   1.00 18.15 ? 206  GLN D CD  1 
ATOM   7294 O  OE1 . GLN D 1 204 ? -49.320 20.516  9.278   1.00 17.67 ? 206  GLN D OE1 1 
ATOM   7295 N  NE2 . GLN D 1 204 ? -47.991 19.878  10.979  1.00 17.69 ? 206  GLN D NE2 1 
ATOM   7296 N  N   . GLY D 1 205 ? -42.763 20.329  9.584   1.00 16.03 ? 207  GLY D N   1 
ATOM   7297 C  CA  . GLY D 1 205 ? -41.397 20.399  10.066  1.00 16.43 ? 207  GLY D CA  1 
ATOM   7298 C  C   . GLY D 1 205 ? -40.454 21.173  9.136   1.00 16.47 ? 207  GLY D C   1 
ATOM   7299 O  O   . GLY D 1 205 ? -39.250 21.192  9.368   1.00 17.41 ? 207  GLY D O   1 
ATOM   7300 N  N   . VAL D 1 206 ? -40.991 21.787  8.084   1.00 16.16 ? 208  VAL D N   1 
ATOM   7301 C  CA  . VAL D 1 206 ? -40.197 22.486  7.088   1.00 16.25 ? 208  VAL D CA  1 
ATOM   7302 C  C   . VAL D 1 206 ? -39.889 23.928  7.545   1.00 16.17 ? 208  VAL D C   1 
ATOM   7303 O  O   . VAL D 1 206 ? -40.793 24.678  7.877   1.00 16.03 ? 208  VAL D O   1 
ATOM   7304 C  CB  . VAL D 1 206 ? -40.911 22.520  5.723   1.00 16.10 ? 208  VAL D CB  1 
ATOM   7305 C  CG1 . VAL D 1 206 ? -40.055 23.231  4.673   1.00 16.14 ? 208  VAL D CG1 1 
ATOM   7306 C  CG2 . VAL D 1 206 ? -41.304 21.117  5.270   1.00 16.55 ? 208  VAL D CG2 1 
ATOM   7307 N  N   . ILE D 1 207 ? -38.621 24.323  7.535   1.00 15.85 ? 209  ILE D N   1 
ATOM   7308 C  CA  . ILE D 1 207 ? -38.268 25.721  7.842   1.00 15.82 ? 209  ILE D CA  1 
ATOM   7309 C  C   . ILE D 1 207 ? -38.281 26.554  6.549   1.00 15.93 ? 209  ILE D C   1 
ATOM   7310 O  O   . ILE D 1 207 ? -37.499 26.306  5.614   1.00 16.14 ? 209  ILE D O   1 
ATOM   7311 C  CB  . ILE D 1 207 ? -36.912 25.853  8.543   1.00 16.17 ? 209  ILE D CB  1 
ATOM   7312 C  CG1 . ILE D 1 207 ? -36.753 24.856  9.692   1.00 17.13 ? 209  ILE D CG1 1 
ATOM   7313 C  CG2 . ILE D 1 207 ? -36.678 27.277  9.018   1.00 16.14 ? 209  ILE D CG2 1 
ATOM   7314 C  CD1 . ILE D 1 207 ? -37.621 25.067  10.902  1.00 17.64 ? 209  ILE D CD1 1 
ATOM   7315 N  N   . TRP D 1 208 ? -39.206 27.504  6.487   1.00 15.62 ? 210  TRP D N   1 
ATOM   7316 C  CA  . TRP D 1 208 ? -39.352 28.420  5.368   1.00 15.73 ? 210  TRP D CA  1 
ATOM   7317 C  C   . TRP D 1 208 ? -38.680 29.723  5.694   1.00 16.16 ? 210  TRP D C   1 
ATOM   7318 O  O   . TRP D 1 208 ? -38.926 30.310  6.760   1.00 16.42 ? 210  TRP D O   1 
ATOM   7319 C  CB  . TRP D 1 208 ? -40.815 28.705  5.079   1.00 15.93 ? 210  TRP D CB  1 
ATOM   7320 C  CG  . TRP D 1 208 ? -41.483 27.604  4.395   1.00 15.14 ? 210  TRP D CG  1 
ATOM   7321 C  CD1 . TRP D 1 208 ? -42.155 26.576  4.964   1.00 15.17 ? 210  TRP D CD1 1 
ATOM   7322 C  CD2 . TRP D 1 208 ? -41.542 27.406  2.987   1.00 14.85 ? 210  TRP D CD2 1 
ATOM   7323 N  NE1 . TRP D 1 208 ? -42.639 25.737  3.987   1.00 15.05 ? 210  TRP D NE1 1 
ATOM   7324 C  CE2 . TRP D 1 208 ? -42.288 26.236  2.762   1.00 14.91 ? 210  TRP D CE2 1 
ATOM   7325 C  CE3 . TRP D 1 208 ? -41.047 28.117  1.886   1.00 15.10 ? 210  TRP D CE3 1 
ATOM   7326 C  CZ2 . TRP D 1 208 ? -42.514 25.727  1.481   1.00 15.66 ? 210  TRP D CZ2 1 
ATOM   7327 C  CZ3 . TRP D 1 208 ? -41.295 27.633  0.613   1.00 15.22 ? 210  TRP D CZ3 1 
ATOM   7328 C  CH2 . TRP D 1 208 ? -42.025 26.446  0.416   1.00 15.39 ? 210  TRP D CH2 1 
ATOM   7329 N  N   . THR D 1 209 ? -37.837 30.174  4.776   1.00 15.73 ? 211  THR D N   1 
ATOM   7330 C  CA  . THR D 1 209 ? -37.174 31.460  4.873   1.00 16.64 ? 211  THR D CA  1 
ATOM   7331 C  C   . THR D 1 209 ? -37.564 32.246  3.627   1.00 17.33 ? 211  THR D C   1 
ATOM   7332 O  O   . THR D 1 209 ? -37.259 31.821  2.509   1.00 17.11 ? 211  THR D O   1 
ATOM   7333 C  CB  . THR D 1 209 ? -35.655 31.308  4.940   1.00 16.55 ? 211  THR D CB  1 
ATOM   7334 O  OG1 . THR D 1 209 ? -35.280 30.613  6.137   1.00 16.86 ? 211  THR D OG1 1 
ATOM   7335 C  CG2 . THR D 1 209 ? -34.953 32.674  4.896   1.00 17.34 ? 211  THR D CG2 1 
ATOM   7336 N  N   . VAL D 1 210 ? -38.266 33.365  3.820   1.00 18.07 ? 212  VAL D N   1 
ATOM   7337 C  CA  . VAL D 1 210 ? -38.803 34.161  2.730   1.00 18.97 ? 212  VAL D CA  1 
ATOM   7338 C  C   . VAL D 1 210 ? -38.043 35.484  2.725   1.00 20.07 ? 212  VAL D C   1 
ATOM   7339 O  O   . VAL D 1 210 ? -38.041 36.212  3.728   1.00 19.15 ? 212  VAL D O   1 
ATOM   7340 C  CB  . VAL D 1 210 ? -40.313 34.399  2.873   1.00 19.28 ? 212  VAL D CB  1 
ATOM   7341 C  CG1 . VAL D 1 210 ? -40.829 35.258  1.730   1.00 20.02 ? 212  VAL D CG1 1 
ATOM   7342 C  CG2 . VAL D 1 210 ? -41.073 33.079  2.927   1.00 19.49 ? 212  VAL D CG2 1 
ATOM   7343 N  N   . PHE D 1 211 ? -37.346 35.771  1.623   1.00 20.48 ? 213  PHE D N   1 
ATOM   7344 C  CA  . PHE D 1 211 ? -36.533 37.004  1.542   1.00 21.96 ? 213  PHE D CA  1 
ATOM   7345 C  C   . PHE D 1 211 ? -37.437 38.239  1.511   1.00 22.18 ? 213  PHE D C   1 
ATOM   7346 O  O   . PHE D 1 211 ? -38.530 38.217  0.925   1.00 19.90 ? 213  PHE D O   1 
ATOM   7347 C  CB  . PHE D 1 211 ? -35.636 37.016  0.296   1.00 24.29 ? 213  PHE D CB  1 
ATOM   7348 C  CG  . PHE D 1 211 ? -34.518 36.022  0.350   1.00 26.92 ? 213  PHE D CG  1 
ATOM   7349 C  CD1 . PHE D 1 211 ? -33.337 36.323  1.020   1.00 29.80 ? 213  PHE D CD1 1 
ATOM   7350 C  CD2 . PHE D 1 211 ? -34.645 34.777  -0.255  1.00 27.45 ? 213  PHE D CD2 1 
ATOM   7351 C  CE1 . PHE D 1 211 ? -32.304 35.393  1.082   1.00 31.95 ? 213  PHE D CE1 1 
ATOM   7352 C  CE2 . PHE D 1 211 ? -33.613 33.855  -0.208  1.00 29.50 ? 213  PHE D CE2 1 
ATOM   7353 C  CZ  . PHE D 1 211 ? -32.440 34.160  0.463   1.00 29.99 ? 213  PHE D CZ  1 
ATOM   7354 N  N   . ASN D 1 212 ? -36.966 39.303  2.146   1.00 25.03 ? 214  ASN D N   1 
ATOM   7355 C  CA  . ASN D 1 212 ? -37.623 40.613  2.072   1.00 28.29 ? 214  ASN D CA  1 
ATOM   7356 C  C   . ASN D 1 212 ? -37.470 41.213  0.659   1.00 26.97 ? 214  ASN D C   1 
ATOM   7357 O  O   . ASN D 1 212 ? -38.441 41.586  0.015   1.00 26.13 ? 214  ASN D O   1 
ATOM   7358 C  CB  . ASN D 1 212 ? -37.003 41.526  3.147   1.00 32.32 ? 214  ASN D CB  1 
ATOM   7359 C  CG  . ASN D 1 212 ? -37.730 42.850  3.312   1.00 37.32 ? 214  ASN D CG  1 
ATOM   7360 O  OD1 . ASN D 1 212 ? -37.154 43.846  3.801   1.00 39.79 ? 214  ASN D OD1 1 
ATOM   7361 N  ND2 . ASN D 1 212 ? -39.004 42.867  2.941   1.00 41.60 ? 214  ASN D ND2 1 
ATOM   7362 N  N   . GLN D 1 213 ? -36.235 41.288  0.190   1.00 27.84 ? 215  GLN D N   1 
ATOM   7363 C  CA  . GLN D 1 213 ? -35.915 41.810  -1.135  1.00 29.68 ? 215  GLN D CA  1 
ATOM   7364 C  C   . GLN D 1 213 ? -36.446 40.856  -2.204  1.00 29.59 ? 215  GLN D C   1 
ATOM   7365 O  O   . GLN D 1 213 ? -36.357 39.644  -2.037  1.00 29.77 ? 215  GLN D O   1 
ATOM   7366 C  CB  . GLN D 1 213 ? -34.390 41.944  -1.248  1.00 32.28 ? 215  GLN D CB  1 
ATOM   7367 C  CG  . GLN D 1 213 ? -33.827 42.470  -2.560  1.00 35.00 ? 215  GLN D CG  1 
ATOM   7368 C  CD  . GLN D 1 213 ? -32.308 42.654  -2.478  1.00 38.26 ? 215  GLN D CD  1 
ATOM   7369 O  OE1 . GLN D 1 213 ? -31.538 41.692  -2.425  1.00 37.87 ? 215  GLN D OE1 1 
ATOM   7370 N  NE2 . GLN D 1 213 ? -31.877 43.908  -2.426  1.00 43.36 ? 215  GLN D NE2 1 
ATOM   7371 N  N   . THR D 1 214 ? -37.002 41.409  -3.284  1.00 28.69 ? 216  THR D N   1 
ATOM   7372 C  CA  . THR D 1 214 ? -37.507 40.626  -4.416  1.00 28.58 ? 216  THR D CA  1 
ATOM   7373 C  C   . THR D 1 214 ? -36.500 40.615  -5.549  1.00 27.76 ? 216  THR D C   1 
ATOM   7374 O  O   . THR D 1 214 ? -35.532 41.349  -5.540  1.00 26.66 ? 216  THR D O   1 
ATOM   7375 C  CB  . THR D 1 214 ? -38.836 41.190  -4.965  1.00 29.12 ? 216  THR D CB  1 
ATOM   7376 O  OG1 . THR D 1 214 ? -38.625 42.490  -5.532  1.00 29.66 ? 216  THR D OG1 1 
ATOM   7377 C  CG2 . THR D 1 214 ? -39.860 41.300  -3.871  1.00 29.41 ? 216  THR D CG2 1 
ATOM   7378 N  N   . VAL D 1 215 ? -36.749 39.755  -6.519  1.00 28.84 ? 217  VAL D N   1 
ATOM   7379 C  CA  . VAL D 1 215 ? -35.931 39.652  -7.715  1.00 30.05 ? 217  VAL D CA  1 
ATOM   7380 C  C   . VAL D 1 215 ? -36.761 40.188  -8.870  1.00 29.51 ? 217  VAL D C   1 
ATOM   7381 O  O   . VAL D 1 215 ? -37.967 39.920  -8.951  1.00 28.28 ? 217  VAL D O   1 
ATOM   7382 C  CB  . VAL D 1 215 ? -35.549 38.176  -7.987  1.00 30.50 ? 217  VAL D CB  1 
ATOM   7383 C  CG1 . VAL D 1 215 ? -34.819 38.031  -9.320  1.00 32.64 ? 217  VAL D CG1 1 
ATOM   7384 C  CG2 . VAL D 1 215 ? -34.712 37.630  -6.845  1.00 29.91 ? 217  VAL D CG2 1 
ATOM   7385 N  N   . MET D 1 216 ? -36.111 40.936  -9.757  1.00 31.05 ? 218  MET D N   1 
ATOM   7386 C  CA  . MET D 1 216 ? -36.770 41.540  -10.927 1.00 33.06 ? 218  MET D CA  1 
ATOM   7387 C  C   . MET D 1 216 ? -36.598 40.708  -12.192 1.00 30.18 ? 218  MET D C   1 
ATOM   7388 O  O   . MET D 1 216 ? -35.484 40.412  -12.565 1.00 28.38 ? 218  MET D O   1 
ATOM   7389 C  CB  . MET D 1 216 ? -36.169 42.919  -11.203 1.00 36.92 ? 218  MET D CB  1 
ATOM   7390 C  CG  . MET D 1 216 ? -36.291 43.903  -10.060 1.00 42.71 ? 218  MET D CG  1 
ATOM   7391 S  SD  . MET D 1 216 ? -38.013 44.276  -9.737  1.00 52.40 ? 218  MET D SD  1 
ATOM   7392 C  CE  . MET D 1 216 ? -37.889 44.884  -8.051  1.00 52.94 ? 218  MET D CE  1 
ATOM   7393 N  N   . LEU D 1 217 ? -37.701 40.343  -12.837 1.00 28.85 ? 219  LEU D N   1 
ATOM   7394 C  CA  . LEU D 1 217 ? -37.681 39.818  -14.206 1.00 30.21 ? 219  LEU D CA  1 
ATOM   7395 C  C   . LEU D 1 217 ? -38.340 40.855  -15.123 1.00 32.42 ? 219  LEU D C   1 
ATOM   7396 O  O   . LEU D 1 217 ? -39.152 41.660  -14.657 1.00 30.03 ? 219  LEU D O   1 
ATOM   7397 C  CB  . LEU D 1 217 ? -38.452 38.508  -14.314 1.00 29.24 ? 219  LEU D CB  1 
ATOM   7398 C  CG  . LEU D 1 217 ? -37.683 37.234  -13.961 1.00 29.72 ? 219  LEU D CG  1 
ATOM   7399 C  CD1 . LEU D 1 217 ? -37.123 37.283  -12.544 1.00 29.73 ? 219  LEU D CD1 1 
ATOM   7400 C  CD2 . LEU D 1 217 ? -38.602 36.031  -14.146 1.00 29.93 ? 219  LEU D CD2 1 
ATOM   7401 N  N   . SER D 1 218 ? -38.016 40.820  -16.420 1.00 32.50 ? 220  SER D N   1 
ATOM   7402 C  CA  . SER D 1 218 ? -38.707 41.680  -17.398 1.00 32.25 ? 220  SER D CA  1 
ATOM   7403 C  C   . SER D 1 218 ? -40.121 41.193  -17.587 1.00 31.04 ? 220  SER D C   1 
ATOM   7404 O  O   . SER D 1 218 ? -40.454 40.050  -17.246 1.00 30.43 ? 220  SER D O   1 
ATOM   7405 C  CB  . SER D 1 218 ? -38.004 41.696  -18.751 1.00 32.22 ? 220  SER D CB  1 
ATOM   7406 O  OG  . SER D 1 218 ? -38.250 40.500  -19.464 1.00 32.87 ? 220  SER D OG  1 
ATOM   7407 N  N   . ALA D 1 219 ? -40.953 42.056  -18.152 1.00 31.07 ? 221  ALA D N   1 
ATOM   7408 C  CA  . ALA D 1 219 ? -42.317 41.680  -18.491 1.00 29.96 ? 221  ALA D CA  1 
ATOM   7409 C  C   . ALA D 1 219 ? -42.324 40.475  -19.436 1.00 30.91 ? 221  ALA D C   1 
ATOM   7410 O  O   . ALA D 1 219 ? -43.126 39.540  -19.263 1.00 31.59 ? 221  ALA D O   1 
ATOM   7411 C  CB  . ALA D 1 219 ? -43.044 42.858  -19.121 1.00 31.14 ? 221  ALA D CB  1 
ATOM   7412 N  N   . LYS D 1 220 ? -41.438 40.487  -20.429 1.00 31.76 ? 222  LYS D N   1 
ATOM   7413 C  CA  . LYS D 1 220 ? -41.358 39.364  -21.372 1.00 34.82 ? 222  LYS D CA  1 
ATOM   7414 C  C   . LYS D 1 220 ? -40.953 38.054  -20.671 1.00 31.32 ? 222  LYS D C   1 
ATOM   7415 O  O   . LYS D 1 220 ? -41.510 37.015  -20.964 1.00 29.08 ? 222  LYS D O   1 
ATOM   7416 C  CB  . LYS D 1 220 ? -40.376 39.628  -22.517 1.00 38.86 ? 222  LYS D CB  1 
ATOM   7417 C  CG  . LYS D 1 220 ? -40.660 38.730  -23.723 1.00 44.59 ? 222  LYS D CG  1 
ATOM   7418 C  CD  . LYS D 1 220 ? -39.413 38.103  -24.315 1.00 51.45 ? 222  LYS D CD  1 
ATOM   7419 C  CE  . LYS D 1 220 ? -38.513 39.126  -24.991 1.00 55.18 ? 222  LYS D CE  1 
ATOM   7420 N  NZ  . LYS D 1 220 ? -37.236 38.481  -25.402 1.00 59.13 ? 222  LYS D NZ  1 
ATOM   7421 N  N   . GLN D 1 221 ? -39.979 38.136  -19.768 1.00 30.14 ? 223  GLN D N   1 
ATOM   7422 C  CA  . GLN D 1 221 ? -39.528 36.974  -18.981 1.00 30.69 ? 223  GLN D CA  1 
ATOM   7423 C  C   . GLN D 1 221 ? -40.650 36.332  -18.180 1.00 30.21 ? 223  GLN D C   1 
ATOM   7424 O  O   . GLN D 1 221 ? -40.848 35.118  -18.256 1.00 31.17 ? 223  GLN D O   1 
ATOM   7425 C  CB  . GLN D 1 221 ? -38.360 37.359  -18.083 1.00 29.49 ? 223  GLN D CB  1 
ATOM   7426 C  CG  . GLN D 1 221 ? -37.064 37.512  -18.863 1.00 29.43 ? 223  GLN D CG  1 
ATOM   7427 C  CD  . GLN D 1 221 ? -35.890 37.865  -17.984 1.00 29.28 ? 223  GLN D CD  1 
ATOM   7428 O  OE1 . GLN D 1 221 ? -35.988 38.734  -17.113 1.00 29.96 ? 223  GLN D OE1 1 
ATOM   7429 N  NE2 . GLN D 1 221 ? -34.765 37.192  -18.197 1.00 29.70 ? 223  GLN D NE2 1 
ATOM   7430 N  N   . LEU D 1 222 ? -41.416 37.153  -17.459 1.00 31.51 ? 224  LEU D N   1 
ATOM   7431 C  CA  . LEU D 1 222 ? -42.595 36.664  -16.735 1.00 29.41 ? 224  LEU D CA  1 
ATOM   7432 C  C   . LEU D 1 222 ? -43.635 36.054  -17.662 1.00 29.73 ? 224  LEU D C   1 
ATOM   7433 O  O   . LEU D 1 222 ? -44.324 35.096  -17.279 1.00 27.47 ? 224  LEU D O   1 
ATOM   7434 C  CB  . LEU D 1 222 ? -43.219 37.783  -15.897 1.00 29.74 ? 224  LEU D CB  1 
ATOM   7435 C  CG  . LEU D 1 222 ? -42.359 38.213  -14.715 1.00 29.53 ? 224  LEU D CG  1 
ATOM   7436 C  CD1 . LEU D 1 222 ? -42.798 39.570  -14.193 1.00 29.67 ? 224  LEU D CD1 1 
ATOM   7437 C  CD2 . LEU D 1 222 ? -42.418 37.164  -13.609 1.00 30.13 ? 224  LEU D CD2 1 
ATOM   7438 N  N   . HIS D 1 223 ? -43.756 36.592  -18.880 1.00 30.38 ? 225  HIS D N   1 
ATOM   7439 C  CA  . HIS D 1 223 ? -44.646 35.992  -19.884 1.00 33.56 ? 225  HIS D CA  1 
ATOM   7440 C  C   . HIS D 1 223 ? -44.140 34.636  -20.396 1.00 30.49 ? 225  HIS D C   1 
ATOM   7441 O  O   . HIS D 1 223 ? -44.928 33.699  -20.545 1.00 29.25 ? 225  HIS D O   1 
ATOM   7442 C  CB  . HIS D 1 223 ? -44.900 36.933  -21.073 1.00 37.12 ? 225  HIS D CB  1 
ATOM   7443 C  CG  . HIS D 1 223 ? -45.904 36.397  -22.048 1.00 40.83 ? 225  HIS D CG  1 
ATOM   7444 N  ND1 . HIS D 1 223 ? -45.548 35.885  -23.281 1.00 44.01 ? 225  HIS D ND1 1 
ATOM   7445 C  CD2 . HIS D 1 223 ? -47.248 36.255  -21.956 1.00 42.76 ? 225  HIS D CD2 1 
ATOM   7446 C  CE1 . HIS D 1 223 ? -46.630 35.471  -23.915 1.00 44.32 ? 225  HIS D CE1 1 
ATOM   7447 N  NE2 . HIS D 1 223 ? -47.675 35.681  -23.132 1.00 44.22 ? 225  HIS D NE2 1 
ATOM   7448 N  N   . THR D 1 224 ? -42.840 34.542  -20.666 1.00 29.92 ? 226  THR D N   1 
ATOM   7449 C  CA  . THR D 1 224 ? -42.230 33.279  -21.065 1.00 30.10 ? 226  THR D CA  1 
ATOM   7450 C  C   . THR D 1 224 ? -42.468 32.238  -19.985 1.00 28.41 ? 226  THR D C   1 
ATOM   7451 O  O   . THR D 1 224 ? -42.934 31.143  -20.290 1.00 27.85 ? 226  THR D O   1 
ATOM   7452 C  CB  . THR D 1 224 ? -40.721 33.426  -21.319 1.00 32.11 ? 226  THR D CB  1 
ATOM   7453 O  OG1 . THR D 1 224 ? -40.508 34.362  -22.379 1.00 32.08 ? 226  THR D OG1 1 
ATOM   7454 C  CG2 . THR D 1 224 ? -40.088 32.087  -21.687 1.00 32.37 ? 226  THR D CG2 1 
ATOM   7455 N  N   . LEU D 1 225 ? -42.197 32.602  -18.732 1.00 27.73 ? 227  LEU D N   1 
ATOM   7456 C  CA  . LEU D 1 225 ? -42.447 31.695  -17.595 1.00 27.69 ? 227  LEU D CA  1 
ATOM   7457 C  C   . LEU D 1 225 ? -43.891 31.160  -17.567 1.00 28.18 ? 227  LEU D C   1 
ATOM   7458 O  O   . LEU D 1 225 ? -44.116 29.949  -17.548 1.00 25.88 ? 227  LEU D O   1 
ATOM   7459 C  CB  . LEU D 1 225 ? -42.099 32.384  -16.271 1.00 27.45 ? 227  LEU D CB  1 
ATOM   7460 C  CG  . LEU D 1 225 ? -42.251 31.567  -14.969 1.00 27.75 ? 227  LEU D CG  1 
ATOM   7461 C  CD1 . LEU D 1 225 ? -41.478 30.255  -15.057 1.00 26.96 ? 227  LEU D CD1 1 
ATOM   7462 C  CD2 . LEU D 1 225 ? -41.785 32.386  -13.780 1.00 27.04 ? 227  LEU D CD2 1 
ATOM   7463 N  N   . SER D 1 226 ? -44.870 32.062  -17.650 1.00 28.61 ? 228  SER D N   1 
ATOM   7464 C  CA  . SER D 1 226 ? -46.279 31.665  -17.529 1.00 29.07 ? 228  SER D CA  1 
ATOM   7465 C  C   . SER D 1 226 ? -46.949 31.140  -18.799 1.00 29.45 ? 228  SER D C   1 
ATOM   7466 O  O   . SER D 1 226 ? -48.027 30.555  -18.725 1.00 29.17 ? 228  SER D O   1 
ATOM   7467 C  CB  . SER D 1 226 ? -47.101 32.828  -16.963 1.00 30.26 ? 228  SER D CB  1 
ATOM   7468 O  OG  . SER D 1 226 ? -46.951 33.980  -17.762 1.00 31.46 ? 228  SER D OG  1 
ATOM   7469 N  N   . ASP D 1 227 ? -46.330 31.317  -19.955 1.00 31.48 ? 229  ASP D N   1 
ATOM   7470 C  CA  . ASP D 1 227 ? -47.019 31.063  -21.212 1.00 34.18 ? 229  ASP D CA  1 
ATOM   7471 C  C   . ASP D 1 227 ? -46.416 29.930  -22.056 1.00 34.11 ? 229  ASP D C   1 
ATOM   7472 O  O   . ASP D 1 227 ? -46.924 29.665  -23.142 1.00 32.42 ? 229  ASP D O   1 
ATOM   7473 C  CB  . ASP D 1 227 ? -47.038 32.363  -22.018 1.00 38.24 ? 229  ASP D CB  1 
ATOM   7474 C  CG  . ASP D 1 227 ? -47.925 32.285  -23.229 1.00 43.25 ? 229  ASP D CG  1 
ATOM   7475 O  OD1 . ASP D 1 227 ? -49.123 31.972  -23.062 1.00 45.13 ? 229  ASP D OD1 1 
ATOM   7476 O  OD2 . ASP D 1 227 ? -47.405 32.509  -24.351 1.00 50.48 ? 229  ASP D OD2 1 
ATOM   7477 N  N   . THR D 1 228 ? -45.361 29.260  -21.574 1.00 30.66 ? 230  THR D N   1 
ATOM   7478 C  CA  . THR D 1 228 ? -44.618 28.288  -22.391 1.00 28.36 ? 230  THR D CA  1 
ATOM   7479 C  C   . THR D 1 228 ? -44.945 26.836  -22.077 1.00 27.48 ? 230  THR D C   1 
ATOM   7480 O  O   . THR D 1 228 ? -45.009 26.012  -22.988 1.00 27.08 ? 230  THR D O   1 
ATOM   7481 C  CB  . THR D 1 228 ? -43.093 28.496  -22.245 1.00 27.83 ? 230  THR D CB  1 
ATOM   7482 O  OG1 . THR D 1 228 ? -42.764 29.855  -22.537 1.00 25.52 ? 230  THR D OG1 1 
ATOM   7483 C  CG2 . THR D 1 228 ? -42.302 27.586  -23.176 1.00 27.77 ? 230  THR D CG2 1 
ATOM   7484 N  N   . LEU D 1 229 ? -45.134 26.511  -20.801 1.00 26.20 ? 231  LEU D N   1 
ATOM   7485 C  CA  . LEU D 1 229 ? -45.249 25.120  -20.385 1.00 26.24 ? 231  LEU D CA  1 
ATOM   7486 C  C   . LEU D 1 229 ? -46.688 24.628  -20.355 1.00 27.13 ? 231  LEU D C   1 
ATOM   7487 O  O   . LEU D 1 229 ? -47.607 25.369  -20.026 1.00 28.47 ? 231  LEU D O   1 
ATOM   7488 C  CB  . LEU D 1 229 ? -44.605 24.923  -19.010 1.00 25.86 ? 231  LEU D CB  1 
ATOM   7489 C  CG  . LEU D 1 229 ? -43.151 25.372  -18.868 1.00 25.56 ? 231  LEU D CG  1 
ATOM   7490 C  CD1 . LEU D 1 229 ? -42.700 25.208  -17.431 1.00 27.10 ? 231  LEU D CD1 1 
ATOM   7491 C  CD2 . LEU D 1 229 ? -42.218 24.597  -19.782 1.00 26.51 ? 231  LEU D CD2 1 
ATOM   7492 N  N   . TRP D 1 230 ? -46.859 23.352  -20.662 1.00 28.39 ? 232  TRP D N   1 
ATOM   7493 C  CA  . TRP D 1 230 ? -48.143 22.693  -20.674 1.00 31.41 ? 232  TRP D CA  1 
ATOM   7494 C  C   . TRP D 1 230 ? -48.180 21.651  -19.570 1.00 32.32 ? 232  TRP D C   1 
ATOM   7495 O  O   . TRP D 1 230 ? -47.163 21.024  -19.264 1.00 30.71 ? 232  TRP D O   1 
ATOM   7496 C  CB  . TRP D 1 230 ? -48.392 22.075  -22.060 1.00 33.19 ? 232  TRP D CB  1 
ATOM   7497 C  CG  . TRP D 1 230 ? -48.664 23.147  -23.083 1.00 37.83 ? 232  TRP D CG  1 
ATOM   7498 C  CD1 . TRP D 1 230 ? -47.746 23.912  -23.726 1.00 40.77 ? 232  TRP D CD1 1 
ATOM   7499 C  CD2 . TRP D 1 230 ? -49.949 23.614  -23.518 1.00 40.51 ? 232  TRP D CD2 1 
ATOM   7500 N  NE1 . TRP D 1 230 ? -48.370 24.813  -24.557 1.00 42.83 ? 232  TRP D NE1 1 
ATOM   7501 C  CE2 . TRP D 1 230 ? -49.724 24.648  -24.449 1.00 42.66 ? 232  TRP D CE2 1 
ATOM   7502 C  CE3 . TRP D 1 230 ? -51.267 23.245  -23.223 1.00 43.05 ? 232  TRP D CE3 1 
ATOM   7503 C  CZ2 . TRP D 1 230 ? -50.765 25.326  -25.085 1.00 43.25 ? 232  TRP D CZ2 1 
ATOM   7504 C  CZ3 . TRP D 1 230 ? -52.307 23.919  -23.861 1.00 44.39 ? 232  TRP D CZ3 1 
ATOM   7505 C  CH2 . TRP D 1 230 ? -52.045 24.950  -24.780 1.00 42.97 ? 232  TRP D CH2 1 
ATOM   7506 N  N   . GLY D 1 231 ? -49.361 21.480  -18.975 1.00 32.40 ? 233  GLY D N   1 
ATOM   7507 C  CA  . GLY D 1 231 ? -49.559 20.610  -17.830 1.00 34.59 ? 233  GLY D CA  1 
ATOM   7508 C  C   . GLY D 1 231 ? -50.544 19.509  -18.148 1.00 38.72 ? 233  GLY D C   1 
ATOM   7509 O  O   . GLY D 1 231 ? -50.796 19.245  -19.317 1.00 40.30 ? 233  GLY D O   1 
ATOM   7510 N  N   . PRO D 1 232 ? -51.117 18.861  -17.110 1.00 41.99 ? 234  PRO D N   1 
ATOM   7511 C  CA  . PRO D 1 232 ? -52.050 17.742  -17.261 1.00 46.08 ? 234  PRO D CA  1 
ATOM   7512 C  C   . PRO D 1 232 ? -53.191 18.040  -18.222 1.00 51.87 ? 234  PRO D C   1 
ATOM   7513 O  O   . PRO D 1 232 ? -53.645 19.184  -18.295 1.00 52.85 ? 234  PRO D O   1 
ATOM   7514 C  CB  . PRO D 1 232 ? -52.610 17.556  -15.852 1.00 45.47 ? 234  PRO D CB  1 
ATOM   7515 C  CG  . PRO D 1 232 ? -51.561 18.078  -14.948 1.00 45.02 ? 234  PRO D CG  1 
ATOM   7516 C  CD  . PRO D 1 232 ? -50.833 19.149  -15.694 1.00 42.93 ? 234  PRO D CD  1 
ATOM   7517 N  N   . GLY D 1 233 ? -53.644 17.015  -18.944 1.00 57.45 ? 235  GLY D N   1 
ATOM   7518 C  CA  . GLY D 1 233 ? -54.611 17.196  -20.027 1.00 63.28 ? 235  GLY D CA  1 
ATOM   7519 C  C   . GLY D 1 233 ? -53.976 17.978  -21.162 1.00 66.26 ? 235  GLY D C   1 
ATOM   7520 O  O   . GLY D 1 233 ? -52.766 17.879  -21.380 1.00 71.38 ? 235  GLY D O   1 
ATOM   7521 N  N   . ASP D 1 234 ? -54.782 18.761  -21.874 1.00 64.67 ? 236  ASP D N   1 
ATOM   7522 C  CA  . ASP D 1 234 ? -54.270 19.678  -22.891 1.00 63.86 ? 236  ASP D CA  1 
ATOM   7523 C  C   . ASP D 1 234 ? -54.383 21.111  -22.376 1.00 59.79 ? 236  ASP D C   1 
ATOM   7524 O  O   . ASP D 1 234 ? -54.801 21.998  -23.111 1.00 64.54 ? 236  ASP D O   1 
ATOM   7525 C  CB  . ASP D 1 234 ? -55.042 19.501  -24.208 1.00 64.54 ? 236  ASP D CB  1 
ATOM   7526 N  N   . SER D 1 235 ? -53.995 21.329  -21.117 1.00 54.40 ? 237  SER D N   1 
ATOM   7527 C  CA  . SER D 1 235 ? -54.126 22.628  -20.447 1.00 49.85 ? 237  SER D CA  1 
ATOM   7528 C  C   . SER D 1 235 ? -52.766 23.261  -20.180 1.00 43.32 ? 237  SER D C   1 
ATOM   7529 O  O   . SER D 1 235 ? -51.782 22.561  -19.997 1.00 40.15 ? 237  SER D O   1 
ATOM   7530 C  CB  . SER D 1 235 ? -54.852 22.450  -19.120 1.00 52.48 ? 237  SER D CB  1 
ATOM   7531 O  OG  . SER D 1 235 ? -54.059 21.706  -18.201 1.00 54.56 ? 237  SER D OG  1 
ATOM   7532 N  N   . ARG D 1 236 ? -52.727 24.588  -20.145 1.00 40.36 ? 238  ARG D N   1 
ATOM   7533 C  CA  . ARG D 1 236 ? -51.493 25.329  -19.881 1.00 39.57 ? 238  ARG D CA  1 
ATOM   7534 C  C   . ARG D 1 236 ? -51.055 25.199  -18.425 1.00 34.67 ? 238  ARG D C   1 
ATOM   7535 O  O   . ARG D 1 236 ? -51.889 25.119  -17.533 1.00 33.36 ? 238  ARG D O   1 
ATOM   7536 C  CB  . ARG D 1 236 ? -51.668 26.800  -20.201 1.00 41.92 ? 238  ARG D CB  1 
ATOM   7537 C  CG  . ARG D 1 236 ? -51.884 27.079  -21.668 1.00 46.79 ? 238  ARG D CG  1 
ATOM   7538 C  CD  . ARG D 1 236 ? -52.300 28.526  -21.855 1.00 48.82 ? 238  ARG D CD  1 
ATOM   7539 N  NE  . ARG D 1 236 ? -52.118 28.934  -23.237 1.00 51.90 ? 238  ARG D NE  1 
ATOM   7540 C  CZ  . ARG D 1 236 ? -50.945 29.209  -23.808 1.00 54.22 ? 238  ARG D CZ  1 
ATOM   7541 N  NH1 . ARG D 1 236 ? -49.798 29.132  -23.127 1.00 54.98 ? 238  ARG D NH1 1 
ATOM   7542 N  NH2 . ARG D 1 236 ? -50.919 29.560  -25.088 1.00 55.84 ? 238  ARG D NH2 1 
ATOM   7543 N  N   . LEU D 1 237 ? -49.743 25.167  -18.198 1.00 30.56 ? 239  LEU D N   1 
ATOM   7544 C  CA  . LEU D 1 237 ? -49.201 25.060  -16.845 1.00 29.24 ? 239  LEU D CA  1 
ATOM   7545 C  C   . LEU D 1 237 ? -49.114 26.481  -16.287 1.00 26.78 ? 239  LEU D C   1 
ATOM   7546 O  O   . LEU D 1 237 ? -48.181 27.224  -16.579 1.00 25.72 ? 239  LEU D O   1 
ATOM   7547 C  CB  . LEU D 1 237 ? -47.855 24.314  -16.843 1.00 29.21 ? 239  LEU D CB  1 
ATOM   7548 C  CG  . LEU D 1 237 ? -47.078 24.115  -15.529 1.00 29.70 ? 239  LEU D CG  1 
ATOM   7549 C  CD1 . LEU D 1 237 ? -47.949 23.909  -14.323 1.00 30.00 ? 239  LEU D CD1 1 
ATOM   7550 C  CD2 . LEU D 1 237 ? -46.040 22.997  -15.631 1.00 29.09 ? 239  LEU D CD2 1 
ATOM   7551 N  N   . GLN D 1 238 ? -50.131 26.855  -15.507 1.00 26.44 ? 240  GLN D N   1 
ATOM   7552 C  CA  . GLN D 1 238 ? -50.309 28.227  -15.006 1.00 25.63 ? 240  GLN D CA  1 
ATOM   7553 C  C   . GLN D 1 238 ? -50.967 28.224  -13.642 1.00 23.16 ? 240  GLN D C   1 
ATOM   7554 O  O   . GLN D 1 238 ? -51.614 27.271  -13.280 1.00 21.98 ? 240  GLN D O   1 
ATOM   7555 C  CB  . GLN D 1 238 ? -51.238 28.995  -15.934 1.00 27.73 ? 240  GLN D CB  1 
ATOM   7556 C  CG  . GLN D 1 238 ? -50.798 29.070  -17.376 1.00 28.88 ? 240  GLN D CG  1 
ATOM   7557 C  CD  . GLN D 1 238 ? -51.597 30.120  -18.127 1.00 30.36 ? 240  GLN D CD  1 
ATOM   7558 O  OE1 . GLN D 1 238 ? -52.827 30.083  -18.115 1.00 30.20 ? 240  GLN D OE1 1 
ATOM   7559 N  NE2 . GLN D 1 238 ? -50.907 31.076  -18.745 1.00 28.98 ? 240  GLN D NE2 1 
ATOM   7560 N  N   . LEU D 1 239 ? -50.817 29.304  -12.889 1.00 23.92 ? 241  LEU D N   1 
ATOM   7561 C  CA  . LEU D 1 239 ? -51.496 29.410  -11.582 1.00 24.59 ? 241  LEU D CA  1 
ATOM   7562 C  C   . LEU D 1 239 ? -51.198 28.174  -10.711 1.00 23.26 ? 241  LEU D C   1 
ATOM   7563 O  O   . LEU D 1 239 ? -52.084 27.619  -10.054 1.00 22.58 ? 241  LEU D O   1 
ATOM   7564 C  CB  . LEU D 1 239 ? -53.020 29.595  -11.782 1.00 25.55 ? 241  LEU D CB  1 
ATOM   7565 C  CG  . LEU D 1 239 ? -53.373 30.742  -12.740 1.00 26.89 ? 241  LEU D CG  1 
ATOM   7566 C  CD1 . LEU D 1 239 ? -54.812 30.632  -13.210 1.00 28.88 ? 241  LEU D CD1 1 
ATOM   7567 C  CD2 . LEU D 1 239 ? -53.105 32.111  -12.131 1.00 27.22 ? 241  LEU D CD2 1 
ATOM   7568 N  N   . ASN D 1 240 ? -49.927 27.765  -10.716 1.00 22.45 ? 242  ASN D N   1 
ATOM   7569 C  CA  . ASN D 1 240 ? -49.491 26.546  -10.060 1.00 21.49 ? 242  ASN D CA  1 
ATOM   7570 C  C   . ASN D 1 240 ? -49.027 26.899  -8.645  1.00 22.00 ? 242  ASN D C   1 
ATOM   7571 O  O   . ASN D 1 240 ? -47.844 26.782  -8.306  1.00 20.49 ? 242  ASN D O   1 
ATOM   7572 C  CB  . ASN D 1 240 ? -48.424 25.816  -10.893 1.00 21.43 ? 242  ASN D CB  1 
ATOM   7573 C  CG  . ASN D 1 240 ? -47.184 26.649  -11.154 1.00 22.31 ? 242  ASN D CG  1 
ATOM   7574 O  OD1 . ASN D 1 240 ? -47.241 27.885  -11.266 1.00 23.96 ? 242  ASN D OD1 1 
ATOM   7575 N  ND2 . ASN D 1 240 ? -46.030 25.970  -11.240 1.00 22.22 ? 242  ASN D ND2 1 
ATOM   7576 N  N   . PHE D 1 241 ? -49.986 27.363  -7.836  1.00 21.53 ? 243  PHE D N   1 
ATOM   7577 C  CA  . PHE D 1 241 ? -49.735 27.752  -6.452  1.00 22.49 ? 243  PHE D CA  1 
ATOM   7578 C  C   . PHE D 1 241 ? -50.847 27.228  -5.566  1.00 22.35 ? 243  PHE D C   1 
ATOM   7579 O  O   . PHE D 1 241 ? -51.987 27.104  -6.005  1.00 22.46 ? 243  PHE D O   1 
ATOM   7580 C  CB  . PHE D 1 241 ? -49.589 29.279  -6.294  1.00 22.88 ? 243  PHE D CB  1 
ATOM   7581 C  CG  . PHE D 1 241 ? -50.822 30.070  -6.680  1.00 24.19 ? 243  PHE D CG  1 
ATOM   7582 C  CD1 . PHE D 1 241 ? -51.849 30.282  -5.773  1.00 24.80 ? 243  PHE D CD1 1 
ATOM   7583 C  CD2 . PHE D 1 241 ? -50.948 30.611  -7.953  1.00 25.12 ? 243  PHE D CD2 1 
ATOM   7584 C  CE1 . PHE D 1 241 ? -52.980 31.018  -6.130  1.00 25.40 ? 243  PHE D CE1 1 
ATOM   7585 C  CE2 . PHE D 1 241 ? -52.072 31.347  -8.312  1.00 25.34 ? 243  PHE D CE2 1 
ATOM   7586 C  CZ  . PHE D 1 241 ? -53.094 31.547  -7.402  1.00 24.98 ? 243  PHE D CZ  1 
ATOM   7587 N  N   . ARG D 1 242 ? -50.496 26.903  -4.325  1.00 21.59 ? 244  ARG D N   1 
ATOM   7588 C  CA  . ARG D 1 242 ? -51.468 26.503  -3.338  1.00 21.40 ? 244  ARG D CA  1 
ATOM   7589 C  C   . ARG D 1 242 ? -52.058 27.747  -2.664  1.00 22.32 ? 244  ARG D C   1 
ATOM   7590 O  O   . ARG D 1 242 ? -51.357 28.740  -2.429  1.00 22.20 ? 244  ARG D O   1 
ATOM   7591 C  CB  . ARG D 1 242 ? -50.814 25.634  -2.278  1.00 19.97 ? 244  ARG D CB  1 
ATOM   7592 C  CG  . ARG D 1 242 ? -51.815 24.937  -1.369  1.00 20.13 ? 244  ARG D CG  1 
ATOM   7593 C  CD  . ARG D 1 242 ? -51.090 24.335  -0.190  1.00 19.63 ? 244  ARG D CD  1 
ATOM   7594 N  NE  . ARG D 1 242 ? -51.879 23.319  0.462   1.00 18.51 ? 244  ARG D NE  1 
ATOM   7595 C  CZ  . ARG D 1 242 ? -51.475 22.636  1.517   1.00 19.25 ? 244  ARG D CZ  1 
ATOM   7596 N  NH1 . ARG D 1 242 ? -50.271 22.866  2.057   1.00 19.74 ? 244  ARG D NH1 1 
ATOM   7597 N  NH2 . ARG D 1 242 ? -52.269 21.692  2.026   1.00 19.52 ? 244  ARG D NH2 1 
ATOM   7598 N  N   . ALA D 1 243 ? -53.336 27.651  -2.324  1.00 23.07 ? 245  ALA D N   1 
ATOM   7599 C  CA  . ALA D 1 243 ? -54.018 28.682  -1.539  1.00 24.50 ? 245  ALA D CA  1 
ATOM   7600 C  C   . ALA D 1 243 ? -53.327 28.872  -0.189  1.00 24.12 ? 245  ALA D C   1 
ATOM   7601 O  O   . ALA D 1 243 ? -52.778 27.922  0.390   1.00 23.45 ? 245  ALA D O   1 
ATOM   7602 C  CB  . ALA D 1 243 ? -55.477 28.302  -1.326  1.00 23.87 ? 245  ALA D CB  1 
ATOM   7603 N  N   . THR D 1 244 ? -53.368 30.111  0.281   1.00 24.39 ? 246  THR D N   1 
ATOM   7604 C  CA  . THR D 1 244 ? -52.846 30.525  1.577   1.00 25.46 ? 246  THR D CA  1 
ATOM   7605 C  C   . THR D 1 244 ? -53.393 29.658  2.679   1.00 23.43 ? 246  THR D C   1 
ATOM   7606 O  O   . THR D 1 244 ? -54.579 29.370  2.687   1.00 24.03 ? 246  THR D O   1 
ATOM   7607 C  CB  . THR D 1 244 ? -53.313 31.964  1.892   1.00 28.85 ? 246  THR D CB  1 
ATOM   7608 O  OG1 . THR D 1 244 ? -53.132 32.784  0.733   1.00 33.84 ? 246  THR D OG1 1 
ATOM   7609 C  CG2 . THR D 1 244 ? -52.574 32.534  3.059   1.00 31.74 ? 246  THR D CG2 1 
ATOM   7610 N  N   . GLN D 1 245 ? -52.542 29.293  3.629   1.00 21.41 ? 247  GLN D N   1 
ATOM   7611 C  CA  . GLN D 1 245 ? -52.943 28.490  4.768   1.00 20.86 ? 247  GLN D CA  1 
ATOM   7612 C  C   . GLN D 1 245 ? -52.876 29.329  6.034   1.00 20.36 ? 247  GLN D C   1 
ATOM   7613 O  O   . GLN D 1 245 ? -51.953 30.145  6.207   1.00 20.01 ? 247  GLN D O   1 
ATOM   7614 C  CB  . GLN D 1 245 ? -52.014 27.276  4.906   1.00 21.21 ? 247  GLN D CB  1 
ATOM   7615 C  CG  . GLN D 1 245 ? -51.892 26.458  3.625   1.00 20.79 ? 247  GLN D CG  1 
ATOM   7616 C  CD  . GLN D 1 245 ? -53.183 25.760  3.289   1.00 21.19 ? 247  GLN D CD  1 
ATOM   7617 O  OE1 . GLN D 1 245 ? -53.688 24.962  4.091   1.00 21.24 ? 247  GLN D OE1 1 
ATOM   7618 N  NE2 . GLN D 1 245 ? -53.725 26.030  2.102   1.00 20.96 ? 247  GLN D NE2 1 
ATOM   7619 N  N   . PRO D 1 246 ? -53.820 29.104  6.963   1.00 20.08 ? 248  PRO D N   1 
ATOM   7620 C  CA  . PRO D 1 246 ? -53.816 29.925  8.190   1.00 19.76 ? 248  PRO D CA  1 
ATOM   7621 C  C   . PRO D 1 246 ? -52.604 29.658  9.053   1.00 18.50 ? 248  PRO D C   1 
ATOM   7622 O  O   . PRO D 1 246 ? -52.161 28.516  9.146   1.00 17.15 ? 248  PRO D O   1 
ATOM   7623 C  CB  . PRO D 1 246 ? -55.096 29.495  8.929   1.00 20.17 ? 248  PRO D CB  1 
ATOM   7624 C  CG  . PRO D 1 246 ? -55.588 28.276  8.259   1.00 20.70 ? 248  PRO D CG  1 
ATOM   7625 C  CD  . PRO D 1 246 ? -54.963 28.181  6.896   1.00 20.05 ? 248  PRO D CD  1 
ATOM   7626 N  N   . LEU D 1 247 ? -52.084 30.700  9.689   1.00 17.03 ? 249  LEU D N   1 
ATOM   7627 C  CA  . LEU D 1 247 ? -50.979 30.542  10.595  1.00 17.54 ? 249  LEU D CA  1 
ATOM   7628 C  C   . LEU D 1 247 ? -51.323 29.665  11.784  1.00 17.52 ? 249  LEU D C   1 
ATOM   7629 O  O   . LEU D 1 247 ? -50.451 28.957  12.286  1.00 16.49 ? 249  LEU D O   1 
ATOM   7630 C  CB  . LEU D 1 247 ? -50.468 31.892  11.089  1.00 18.50 ? 249  LEU D CB  1 
ATOM   7631 C  CG  . LEU D 1 247 ? -49.468 32.624  10.206  1.00 19.93 ? 249  LEU D CG  1 
ATOM   7632 C  CD1 . LEU D 1 247 ? -49.153 33.996  10.844  1.00 20.60 ? 249  LEU D CD1 1 
ATOM   7633 C  CD2 . LEU D 1 247 ? -48.196 31.786  10.056  1.00 19.40 ? 249  LEU D CD2 1 
ATOM   7634 N  N   . ASN D 1 248 ? -52.576 29.748  12.258  1.00 17.50 ? 250  ASN D N   1 
ATOM   7635 C  CA  . ASN D 1 248 ? -53.083 28.864  13.314  1.00 16.56 ? 250  ASN D CA  1 
ATOM   7636 C  C   . ASN D 1 248 ? -52.306 28.967  14.612  1.00 16.54 ? 250  ASN D C   1 
ATOM   7637 O  O   . ASN D 1 248 ? -52.157 27.994  15.354  1.00 16.80 ? 250  ASN D O   1 
ATOM   7638 C  CB  . ASN D 1 248 ? -53.171 27.417  12.812  1.00 16.29 ? 250  ASN D CB  1 
ATOM   7639 C  CG  . ASN D 1 248 ? -54.453 27.132  12.064  1.00 16.12 ? 250  ASN D CG  1 
ATOM   7640 O  OD1 . ASN D 1 248 ? -55.459 27.848  12.176  1.00 16.45 ? 250  ASN D OD1 1 
ATOM   7641 N  ND2 . ASN D 1 248 ? -54.438 26.056  11.306  1.00 16.70 ? 250  ASN D ND2 1 
ATOM   7642 N  N   . GLY D 1 249 ? -51.848 30.182  14.908  1.00 17.11 ? 251  GLY D N   1 
ATOM   7643 C  CA  . GLY D 1 249 ? -51.123 30.442  16.150  1.00 16.79 ? 251  GLY D CA  1 
ATOM   7644 C  C   . GLY D 1 249 ? -49.628 30.497  16.006  1.00 16.59 ? 251  GLY D C   1 
ATOM   7645 O  O   . GLY D 1 249 ? -48.944 30.892  16.934  1.00 15.56 ? 251  GLY D O   1 
ATOM   7646 N  N   . ARG D 1 250 ? -49.095 30.099  14.851  1.00 16.57 ? 252  ARG D N   1 
ATOM   7647 C  CA  . ARG D 1 250 ? -47.653 30.232  14.624  1.00 16.98 ? 252  ARG D CA  1 
ATOM   7648 C  C   . ARG D 1 250 ? -47.282 31.710  14.527  1.00 17.08 ? 252  ARG D C   1 
ATOM   7649 O  O   . ARG D 1 250 ? -48.059 32.509  14.052  1.00 17.01 ? 252  ARG D O   1 
ATOM   7650 C  CB  . ARG D 1 250 ? -47.232 29.539  13.328  1.00 16.45 ? 252  ARG D CB  1 
ATOM   7651 C  CG  . ARG D 1 250 ? -47.357 28.031  13.357  1.00 16.07 ? 252  ARG D CG  1 
ATOM   7652 C  CD  . ARG D 1 250 ? -47.098 27.488  11.970  1.00 15.99 ? 252  ARG D CD  1 
ATOM   7653 N  NE  . ARG D 1 250 ? -48.242 27.661  11.069  1.00 16.18 ? 252  ARG D NE  1 
ATOM   7654 C  CZ  . ARG D 1 250 ? -48.249 27.337  9.774   1.00 16.08 ? 252  ARG D CZ  1 
ATOM   7655 N  NH1 . ARG D 1 250 ? -47.158 26.843  9.198   1.00 16.58 ? 252  ARG D NH1 1 
ATOM   7656 N  NH2 . ARG D 1 250 ? -49.356 27.492  9.055   1.00 15.73 ? 252  ARG D NH2 1 
ATOM   7657 N  N   . VAL D 1 251 ? -46.080 32.044  14.948  1.00 18.12 ? 253  VAL D N   1 
ATOM   7658 C  CA  . VAL D 1 251 ? -45.560 33.394  14.815  1.00 19.66 ? 253  VAL D CA  1 
ATOM   7659 C  C   . VAL D 1 251 ? -44.454 33.381  13.762  1.00 19.93 ? 253  VAL D C   1 
ATOM   7660 O  O   . VAL D 1 251 ? -43.570 32.546  13.804  1.00 20.36 ? 253  VAL D O   1 
ATOM   7661 C  CB  . VAL D 1 251 ? -44.956 33.874  16.144  1.00 21.49 ? 253  VAL D CB  1 
ATOM   7662 C  CG1 . VAL D 1 251 ? -44.480 35.314  16.032  1.00 22.17 ? 253  VAL D CG1 1 
ATOM   7663 C  CG2 . VAL D 1 251 ? -45.979 33.715  17.281  1.00 23.13 ? 253  VAL D CG2 1 
ATOM   7664 N  N   . ILE D 1 252 ? -44.513 34.301  12.813  1.00 19.45 ? 254  ILE D N   1 
ATOM   7665 C  CA  . ILE D 1 252 ? -43.445 34.451  11.845  1.00 18.77 ? 254  ILE D CA  1 
ATOM   7666 C  C   . ILE D 1 252 ? -42.378 35.340  12.460  1.00 19.69 ? 254  ILE D C   1 
ATOM   7667 O  O   . ILE D 1 252 ? -42.699 36.382  13.039  1.00 20.40 ? 254  ILE D O   1 
ATOM   7668 C  CB  . ILE D 1 252 ? -43.963 35.102  10.558  1.00 19.01 ? 254  ILE D CB  1 
ATOM   7669 C  CG1 . ILE D 1 252 ? -45.084 34.242  9.968   1.00 18.08 ? 254  ILE D CG1 1 
ATOM   7670 C  CG2 . ILE D 1 252 ? -42.803 35.286  9.581   1.00 19.14 ? 254  ILE D CG2 1 
ATOM   7671 C  CD1 . ILE D 1 252 ? -45.734 34.824  8.742   1.00 18.43 ? 254  ILE D CD1 1 
ATOM   7672 N  N   . GLU D 1 253 ? -41.119 34.931  12.360  1.00 19.37 ? 255  GLU D N   1 
ATOM   7673 C  CA  . GLU D 1 253 ? -39.996 35.725  12.845  1.00 20.19 ? 255  GLU D CA  1 
ATOM   7674 C  C   . GLU D 1 253 ? -39.433 36.545  11.697  1.00 21.85 ? 255  GLU D C   1 
ATOM   7675 O  O   . GLU D 1 253 ? -39.588 36.186  10.525  1.00 21.28 ? 255  GLU D O   1 
ATOM   7676 C  CB  . GLU D 1 253 ? -38.914 34.857  13.445  1.00 22.19 ? 255  GLU D CB  1 
ATOM   7677 C  CG  . GLU D 1 253 ? -39.345 34.075  14.667  1.00 24.68 ? 255  GLU D CG  1 
ATOM   7678 C  CD  . GLU D 1 253 ? -38.173 33.423  15.379  1.00 28.16 ? 255  GLU D CD  1 
ATOM   7679 O  OE1 . GLU D 1 253 ? -37.347 32.776  14.715  1.00 31.56 ? 255  GLU D OE1 1 
ATOM   7680 O  OE2 . GLU D 1 253 ? -38.043 33.588  16.606  1.00 32.15 ? 255  GLU D OE2 1 
ATOM   7681 N  N   . ALA D 1 254 ? -38.826 37.679  12.042  1.00 21.94 ? 256  ALA D N   1 
ATOM   7682 C  CA  . ALA D 1 254 ? -38.203 38.569  11.071  1.00 21.21 ? 256  ALA D CA  1 
ATOM   7683 C  C   . ALA D 1 254 ? -36.801 38.808  11.549  1.00 21.89 ? 256  ALA D C   1 
ATOM   7684 O  O   . ALA D 1 254 ? -36.566 38.971  12.748  1.00 23.00 ? 256  ALA D O   1 
ATOM   7685 C  CB  . ALA D 1 254 ? -38.956 39.872  10.982  1.00 22.34 ? 256  ALA D CB  1 
ATOM   7686 N  N   . SER D 1 255 ? -35.858 38.819  10.618  1.00 22.28 ? 257  SER D N   1 
ATOM   7687 C  CA  . SER D 1 255 ? -34.449 38.994  10.957  1.00 22.99 ? 257  SER D CA  1 
ATOM   7688 C  C   . SER D 1 255 ? -34.106 40.468  11.119  1.00 23.71 ? 257  SER D C   1 
ATOM   7689 O  O   . SER D 1 255 ? -32.948 40.796  11.347  1.00 25.01 ? 257  SER D O   1 
ATOM   7690 C  CB  . SER D 1 255 ? -33.545 38.384  9.876   1.00 22.02 ? 257  SER D CB  1 
ATOM   7691 O  OG  . SER D 1 255 ? -33.683 39.085  8.654   1.00 21.13 ? 257  SER D OG  1 
ATOM   7692 N  N   . PHE D 1 256 ? -35.091 41.345  10.977  1.00 24.77 ? 258  PHE D N   1 
ATOM   7693 C  CA  . PHE D 1 256 ? -34.873 42.790  11.031  1.00 27.73 ? 258  PHE D CA  1 
ATOM   7694 C  C   . PHE D 1 256 ? -36.013 43.444  11.821  1.00 30.06 ? 258  PHE D C   1 
ATOM   7695 O  O   . PHE D 1 256 ? -37.140 42.941  11.809  1.00 29.62 ? 258  PHE D O   1 
ATOM   7696 C  CB  . PHE D 1 256 ? -34.826 43.375  9.611   1.00 27.05 ? 258  PHE D CB  1 
ATOM   7697 C  CG  . PHE D 1 256 ? -36.026 43.031  8.781   1.00 26.96 ? 258  PHE D CG  1 
ATOM   7698 C  CD1 . PHE D 1 256 ? -36.101 41.805  8.110   1.00 26.59 ? 258  PHE D CD1 1 
ATOM   7699 C  CD2 . PHE D 1 256 ? -37.090 43.917  8.673   1.00 27.02 ? 258  PHE D CD2 1 
ATOM   7700 C  CE1 . PHE D 1 256 ? -37.215 41.481  7.356   1.00 26.45 ? 258  PHE D CE1 1 
ATOM   7701 C  CE2 . PHE D 1 256 ? -38.210 43.593  7.925   1.00 28.06 ? 258  PHE D CE2 1 
ATOM   7702 C  CZ  . PHE D 1 256 ? -38.271 42.370  7.254   1.00 27.65 ? 258  PHE D CZ  1 
ATOM   7703 N  N   . PRO D 1 257 ? -35.729 44.580  12.490  1.00 32.60 ? 259  PRO D N   1 
ATOM   7704 C  CA  . PRO D 1 257 ? -36.759 45.285  13.264  1.00 33.50 ? 259  PRO D CA  1 
ATOM   7705 C  C   . PRO D 1 257 ? -37.791 46.023  12.403  1.00 35.06 ? 259  PRO D C   1 
ATOM   7706 O  O   . PRO D 1 257 ? -38.894 46.323  12.870  1.00 35.62 ? 259  PRO D O   1 
ATOM   7707 C  CB  . PRO D 1 257 ? -35.950 46.282  14.106  1.00 33.51 ? 259  PRO D CB  1 
ATOM   7708 C  CG  . PRO D 1 257 ? -34.702 46.527  13.320  1.00 33.42 ? 259  PRO D CG  1 
ATOM   7709 C  CD  . PRO D 1 257 ? -34.414 45.248  12.572  1.00 32.03 ? 259  PRO D CD  1 
ATOM   7710 O  OXT . PRO D 1 257 ? -37.569 46.349  11.237  1.00 34.74 ? 259  PRO D OXT 1 
HETATM 7711 S  S1  . Y0R E 2 .   ? -27.354 -5.274  -1.665  1.00 24.92 ? 268  Y0R A S1  1 
HETATM 7712 N  N2  . Y0R E 2 .   ? -27.398 -6.503  -0.613  1.00 28.60 ? 268  Y0R A N2  1 
HETATM 7713 O  O5  . Y0R E 2 .   ? -27.529 -5.781  -3.021  1.00 25.87 ? 268  Y0R A O5  1 
HETATM 7714 O  O6  . Y0R E 2 .   ? -26.073 -4.635  -1.618  1.00 25.39 ? 268  Y0R A O6  1 
HETATM 7715 C  C7  . Y0R E 2 .   ? -28.649 -4.238  -1.465  1.00 26.05 ? 268  Y0R A C7  1 
HETATM 7716 S  S8  . Y0R E 2 .   ? -28.452 -2.523  -1.525  1.00 28.01 ? 268  Y0R A S8  1 
HETATM 7717 C  C9  . Y0R E 2 .   ? -30.161 -2.274  -1.363  1.00 28.90 ? 268  Y0R A C9  1 
HETATM 7718 C  C10 . Y0R E 2 .   ? -30.876 -3.478  -1.296  1.00 27.22 ? 268  Y0R A C10 1 
HETATM 7719 C  C11 . Y0R E 2 .   ? -30.007 -4.609  -1.376  1.00 25.73 ? 268  Y0R A C11 1 
HETATM 7720 C  C12 . Y0R E 2 .   ? -30.678 -0.867  -1.350  1.00 30.85 ? 268  Y0R A C12 1 
HETATM 7721 C  C13 . Y0R E 2 .   ? -31.996 -0.481  -1.559  1.00 32.99 ? 268  Y0R A C13 1 
HETATM 7722 N  N14 . Y0R E 2 .   ? -31.900 0.863   -1.492  1.00 35.77 ? 268  Y0R A N14 1 
HETATM 7723 N  N15 . Y0R E 2 .   ? -30.581 1.327   -1.287  1.00 32.78 ? 268  Y0R A N15 1 
HETATM 7724 N  N16 . Y0R E 2 .   ? -29.801 0.169   -1.219  1.00 32.12 ? 268  Y0R A N16 1 
HETATM 7725 C  C23 . Y0R E 2 .   ? -36.034 4.825   -1.938  1.00 37.23 ? 268  Y0R A C23 1 
HETATM 7726 C  C24 . Y0R E 2 .   ? -32.915 1.754   -1.617  1.00 36.14 ? 268  Y0R A C24 1 
HETATM 7727 C  C25 . Y0R E 2 .   ? -34.046 1.574   -2.431  1.00 36.22 ? 268  Y0R A C25 1 
HETATM 7728 C  C26 . Y0R E 2 .   ? -35.058 2.539   -2.549  1.00 38.44 ? 268  Y0R A C26 1 
HETATM 7729 C  C27 . Y0R E 2 .   ? -34.969 3.755   -1.857  1.00 39.28 ? 268  Y0R A C27 1 
HETATM 7730 C  C28 . Y0R E 2 .   ? -33.856 3.960   -1.043  1.00 40.56 ? 268  Y0R A C28 1 
HETATM 7731 C  C29 . Y0R E 2 .   ? -32.865 2.983   -0.935  1.00 38.30 ? 268  Y0R A C29 1 
HETATM 7732 ZN ZN  . ZN  F 3 .   ? -25.752 -6.593  0.521   1.00 14.04 ? 1260 ZN  A ZN  1 
HETATM 7733 C  C1  . GOL G 4 .   ? -29.019 -2.766  2.081   1.00 48.53 ? 1261 GOL A C1  1 
HETATM 7734 O  O1  . GOL G 4 .   ? -30.123 -1.964  2.540   1.00 51.99 ? 1261 GOL A O1  1 
HETATM 7735 C  C2  . GOL G 4 .   ? -29.077 -4.204  2.605   1.00 49.61 ? 1261 GOL A C2  1 
HETATM 7736 O  O2  . GOL G 4 .   ? -30.172 -4.929  2.016   1.00 54.14 ? 1261 GOL A O2  1 
HETATM 7737 C  C3  . GOL G 4 .   ? -29.263 -4.226  4.116   1.00 45.98 ? 1261 GOL A C3  1 
HETATM 7738 O  O3  . GOL G 4 .   ? -28.522 -3.249  4.829   1.00 36.17 ? 1261 GOL A O3  1 
HETATM 7739 S  S1  . Y0R H 2 .   ? -25.754 10.373  -33.600 1.00 22.91 ? 269  Y0R B S1  1 
HETATM 7740 N  N2  . Y0R H 2 .   ? -25.053 10.959  -34.923 1.00 22.66 ? 269  Y0R B N2  1 
HETATM 7741 O  O5  . Y0R H 2 .   ? -24.841 10.428  -32.493 1.00 20.15 ? 269  Y0R B O5  1 
HETATM 7742 O  O6  . Y0R H 2 .   ? -26.201 9.044   -33.835 1.00 19.65 ? 269  Y0R B O6  1 
HETATM 7743 C  C7  . Y0R H 2 .   ? -27.019 11.333  -33.067 1.00 24.43 ? 269  Y0R B C7  1 
HETATM 7744 S  S8  . Y0R H 2 .   ? -28.528 10.656  -32.562 1.00 26.52 ? 269  Y0R B S8  1 
HETATM 7745 C  C9  . Y0R H 2 .   ? -29.168 12.184  -32.140 1.00 26.89 ? 269  Y0R B C9  1 
HETATM 7746 C  C10 . Y0R H 2 .   ? -28.236 13.208  -32.341 1.00 25.65 ? 269  Y0R B C10 1 
HETATM 7747 C  C11 . Y0R H 2 .   ? -27.002 12.724  -32.877 1.00 24.55 ? 269  Y0R B C11 1 
HETATM 7748 C  C12 . Y0R H 2 .   ? -30.550 12.205  -31.542 1.00 31.18 ? 269  Y0R B C12 1 
HETATM 7749 C  C13 . Y0R H 2 .   ? -31.063 13.186  -30.703 1.00 33.00 ? 269  Y0R B C13 1 
HETATM 7750 N  N14 . Y0R H 2 .   ? -32.266 12.670  -30.389 1.00 36.68 ? 269  Y0R B N14 1 
HETATM 7751 N  N15 . Y0R H 2 .   ? -32.517 11.399  -30.947 1.00 37.28 ? 269  Y0R B N15 1 
HETATM 7752 N  N16 . Y0R H 2 .   ? -31.347 11.119  -31.669 1.00 32.92 ? 269  Y0R B N16 1 
HETATM 7753 C  C23 . Y0R H 2 .   ? -36.192 15.135  -26.992 1.00 43.15 ? 269  Y0R B C23 1 
HETATM 7754 C  C24 . Y0R H 2 .   ? -33.195 13.259  -29.596 1.00 40.76 ? 269  Y0R B C24 1 
HETATM 7755 C  C25 . Y0R H 2 .   ? -34.578 12.930  -29.658 1.00 42.93 ? 269  Y0R B C25 1 
HETATM 7756 C  C26 . Y0R H 2 .   ? -35.548 13.522  -28.837 1.00 42.93 ? 269  Y0R B C26 1 
HETATM 7757 C  C27 . Y0R H 2 .   ? -35.175 14.483  -27.896 1.00 43.36 ? 269  Y0R B C27 1 
HETATM 7758 C  C28 . Y0R H 2 .   ? -33.834 14.825  -27.803 1.00 42.45 ? 269  Y0R B C28 1 
HETATM 7759 C  C29 . Y0R H 2 .   ? -32.876 14.225  -28.623 1.00 39.94 ? 269  Y0R B C29 1 
HETATM 7760 ZN ZN  . ZN  I 3 .   ? -25.140 9.953   -36.464 1.00 15.32 ? 1260 ZN  B ZN  1 
HETATM 7761 C  C1  . GOL J 4 .   ? -28.172 13.647  -37.276 1.00 45.98 ? 1261 GOL B C1  1 
HETATM 7762 O  O1  . GOL J 4 .   ? -28.426 15.040  -37.527 1.00 50.55 ? 1261 GOL B O1  1 
HETATM 7763 C  C2  . GOL J 4 .   ? -29.473 12.863  -37.104 1.00 45.26 ? 1261 GOL B C2  1 
HETATM 7764 O  O2  . GOL J 4 .   ? -30.311 12.979  -38.282 1.00 36.11 ? 1261 GOL B O2  1 
HETATM 7765 C  C3  . GOL J 4 .   ? -30.205 13.277  -35.819 1.00 44.49 ? 1261 GOL B C3  1 
HETATM 7766 O  O3  . GOL J 4 .   ? -30.699 12.117  -35.153 1.00 45.34 ? 1261 GOL B O3  1 
HETATM 7767 C  C   . ACY K 5 .   ? -27.774 -12.652 -37.877 1.00 34.42 ? 1263 ACY B C   1 
HETATM 7768 O  O   . ACY K 5 .   ? -26.586 -13.083 -37.680 1.00 29.13 ? 1263 ACY B O   1 
HETATM 7769 O  OXT . ACY K 5 .   ? -28.732 -12.755 -37.022 1.00 35.09 ? 1263 ACY B OXT 1 
HETATM 7770 C  CH3 . ACY K 5 .   ? -28.061 -12.045 -39.221 1.00 28.44 ? 1263 ACY B CH3 1 
HETATM 7771 S  S1  . Y0R L 2 .   ? -49.149 -27.644 -27.162 1.00 24.78 ? 267  Y0R C S1  1 
HETATM 7772 N  N2  . Y0R L 2 .   ? -49.353 -28.672 -25.929 1.00 25.39 ? 267  Y0R C N2  1 
HETATM 7773 O  O5  . Y0R L 2 .   ? -48.192 -26.612 -26.825 1.00 23.64 ? 267  Y0R C O5  1 
HETATM 7774 O  O6  . Y0R L 2 .   ? -48.661 -28.410 -28.253 1.00 24.61 ? 267  Y0R C O6  1 
HETATM 7775 C  C7  . Y0R L 2 .   ? -50.556 -26.986 -27.738 1.00 27.72 ? 267  Y0R C C7  1 
HETATM 7776 S  S8  . Y0R L 2 .   ? -50.602 -25.348 -28.281 1.00 29.42 ? 267  Y0R C S8  1 
HETATM 7777 C  C9  . Y0R L 2 .   ? -52.268 -25.540 -28.683 1.00 34.36 ? 267  Y0R C C9  1 
HETATM 7778 C  C10 . Y0R L 2 .   ? -52.769 -26.828 -28.451 1.00 31.18 ? 267  Y0R C C10 1 
HETATM 7779 C  C11 . Y0R L 2 .   ? -51.779 -27.662 -27.893 1.00 28.09 ? 267  Y0R C C11 1 
HETATM 7780 C  C12 . Y0R L 2 .   ? -52.943 -24.394 -29.357 1.00 41.71 ? 267  Y0R C C12 1 
HETATM 7781 C  C13 . Y0R L 2 .   ? -54.032 -24.494 -30.218 1.00 45.41 ? 267  Y0R C C13 1 
HETATM 7782 N  N14 . Y0R L 2 .   ? -54.162 -23.222 -30.622 1.00 49.58 ? 267  Y0R C N14 1 
HETATM 7783 N  N15 . Y0R L 2 .   ? -53.173 -22.372 -30.117 1.00 48.70 ? 267  Y0R C N15 1 
HETATM 7784 N  N16 . Y0R L 2 .   ? -52.364 -23.175 -29.312 1.00 44.62 ? 267  Y0R C N16 1 
HETATM 7785 C  C23 . Y0R L 2 .   ? -58.059 -20.881 -34.109 1.00 60.41 ? 267  Y0R C C23 1 
HETATM 7786 C  C24 . Y0R L 2 .   ? -55.101 -22.712 -31.452 1.00 54.76 ? 267  Y0R C C24 1 
HETATM 7787 C  C25 . Y0R L 2 .   ? -55.817 -23.465 -32.408 1.00 58.31 ? 267  Y0R C C25 1 
HETATM 7788 C  C26 . Y0R L 2 .   ? -56.775 -22.891 -33.265 1.00 60.74 ? 267  Y0R C C26 1 
HETATM 7789 C  C27 . Y0R L 2 .   ? -57.042 -21.520 -33.203 1.00 60.15 ? 267  Y0R C C27 1 
HETATM 7790 C  C28 . Y0R L 2 .   ? -56.355 -20.743 -32.277 1.00 59.09 ? 267  Y0R C C28 1 
HETATM 7791 C  C29 . Y0R L 2 .   ? -55.411 -21.330 -31.433 1.00 57.09 ? 267  Y0R C C29 1 
HETATM 7792 ZN ZN  . ZN  M 3 .   ? -48.505 -27.925 -24.263 1.00 20.31 ? 1260 ZN  C ZN  1 
HETATM 7793 C  C1  . GOL N 4 .   ? -52.938 -25.465 -24.644 1.00 42.78 ? 1261 GOL C C1  1 
HETATM 7794 O  O1  . GOL N 4 .   ? -52.906 -24.168 -25.255 1.00 45.12 ? 1261 GOL C O1  1 
HETATM 7795 C  C2  . GOL N 4 .   ? -53.956 -25.417 -23.498 1.00 43.30 ? 1261 GOL C C2  1 
HETATM 7796 O  O2  . GOL N 4 .   ? -53.406 -24.661 -22.409 1.00 34.73 ? 1261 GOL C O2  1 
HETATM 7797 C  C3  . GOL N 4 .   ? -54.388 -26.803 -23.015 1.00 44.33 ? 1261 GOL C C3  1 
HETATM 7798 O  O3  . GOL N 4 .   ? -53.580 -27.819 -23.617 1.00 48.46 ? 1261 GOL C O3  1 
HETATM 7799 S  S1  . Y0R O 2 .   ? -42.301 23.120  -2.201  1.00 25.01 ? 266  Y0R D S1  1 
HETATM 7800 N  N2  . Y0R O 2 .   ? -43.338 23.675  -3.329  1.00 26.48 ? 266  Y0R D N2  1 
HETATM 7801 O  O5  . Y0R O 2 .   ? -42.812 23.198  -0.855  1.00 25.49 ? 266  Y0R D O5  1 
HETATM 7802 O  O6  . Y0R O 2 .   ? -41.083 23.863  -2.258  1.00 24.77 ? 266  Y0R D O6  1 
HETATM 7803 C  C7  . Y0R O 2 .   ? -42.147 21.477  -2.393  1.00 27.20 ? 266  Y0R D C7  1 
HETATM 7804 S  S8  . Y0R O 2 .   ? -40.604 20.693  -2.403  1.00 26.80 ? 266  Y0R D S8  1 
HETATM 7805 C  C9  . Y0R O 2 .   ? -41.386 19.151  -2.569  1.00 27.62 ? 266  Y0R D C9  1 
HETATM 7806 C  C10 . Y0R O 2 .   ? -42.788 19.236  -2.571  1.00 27.52 ? 266  Y0R D C10 1 
HETATM 7807 C  C11 . Y0R O 2 .   ? -43.226 20.579  -2.461  1.00 26.18 ? 266  Y0R D C11 1 
HETATM 7808 C  C12 . Y0R O 2 .   ? -40.533 17.921  -2.605  1.00 30.52 ? 266  Y0R D C12 1 
HETATM 7809 C  C13 . Y0R O 2 .   ? -40.963 16.601  -2.434  1.00 30.77 ? 266  Y0R D C13 1 
HETATM 7810 N  N14 . Y0R O 2 .   ? -39.799 15.926  -2.488  1.00 32.99 ? 266  Y0R D N14 1 
HETATM 7811 N  N15 . Y0R O 2 .   ? -38.672 16.771  -2.620  1.00 32.03 ? 266  Y0R D N15 1 
HETATM 7812 N  N16 . Y0R O 2 .   ? -39.186 18.074  -2.682  1.00 30.45 ? 266  Y0R D N16 1 
HETATM 7813 C  C23 . Y0R O 2 .   ? -38.957 10.260  -1.814  1.00 34.02 ? 266  Y0R D C23 1 
HETATM 7814 C  C24 . Y0R O 2 .   ? -39.621 14.585  -2.352  1.00 33.37 ? 266  Y0R D C24 1 
HETATM 7815 C  C25 . Y0R O 2 .   ? -38.541 13.899  -2.946  1.00 34.66 ? 266  Y0R D C25 1 
HETATM 7816 C  C26 . Y0R O 2 .   ? -38.327 12.517  -2.783  1.00 35.50 ? 266  Y0R D C26 1 
HETATM 7817 C  C27 . Y0R O 2 .   ? -39.191 11.745  -1.997  1.00 34.85 ? 266  Y0R D C27 1 
HETATM 7818 C  C28 . Y0R O 2 .   ? -40.260 12.391  -1.382  1.00 34.47 ? 266  Y0R D C28 1 
HETATM 7819 C  C29 . Y0R O 2 .   ? -40.453 13.771  -1.558  1.00 34.44 ? 266  Y0R D C29 1 
HETATM 7820 ZN ZN  . ZN  P 3 .   ? -42.559 25.166  -4.218  1.00 18.28 ? 1260 ZN  D ZN  1 
HETATM 7821 C  C1  . GOL Q 4 .   ? -41.180 19.976  -6.033  1.00 54.79 ? 1261 GOL D C1  1 
HETATM 7822 O  O1  . GOL Q 4 .   ? -40.721 18.614  -5.993  1.00 59.69 ? 1261 GOL D O1  1 
HETATM 7823 C  C2  . GOL Q 4 .   ? -42.195 20.128  -7.178  1.00 57.89 ? 1261 GOL D C2  1 
HETATM 7824 O  O2  . GOL Q 4 .   ? -41.741 21.008  -8.242  1.00 49.63 ? 1261 GOL D O2  1 
HETATM 7825 C  C3  . GOL Q 4 .   ? -43.525 20.588  -6.570  1.00 59.13 ? 1261 GOL D C3  1 
HETATM 7826 O  O3  . GOL Q 4 .   ? -43.416 21.894  -5.986  1.00 60.59 ? 1261 GOL D O3  1 
HETATM 7827 C  C   . ACY R 5 .   ? -54.496 33.192  11.092  1.00 29.00 ? 1262 ACY D C   1 
HETATM 7828 O  O   . ACY R 5 .   ? -55.352 33.480  10.231  1.00 31.85 ? 1262 ACY D O   1 
HETATM 7829 O  OXT . ACY R 5 .   ? -54.345 32.001  11.502  1.00 24.53 ? 1262 ACY D OXT 1 
HETATM 7830 C  CH3 . ACY R 5 .   ? -53.720 34.337  11.673  1.00 27.37 ? 1262 ACY D CH3 1 
HETATM 7831 O  O   . HOH S 6 .   ? -36.512 -8.702  8.173   1.00 39.71 ? 2001 HOH A O   1 
HETATM 7832 O  O   . HOH S 6 .   ? -39.619 -12.810 3.026   1.00 30.78 ? 2002 HOH A O   1 
HETATM 7833 O  O   . HOH S 6 .   ? -38.247 -14.424 10.848  1.00 47.96 ? 2003 HOH A O   1 
HETATM 7834 O  O   . HOH S 6 .   ? -34.940 -11.146 8.009   1.00 37.11 ? 2004 HOH A O   1 
HETATM 7835 O  O   . HOH S 6 .   ? -29.412 -10.717 0.701   1.00 20.52 ? 2005 HOH A O   1 
HETATM 7836 O  O   . HOH S 6 .   ? -29.470 -7.741  4.134   1.00 28.65 ? 2006 HOH A O   1 
HETATM 7837 O  O   . HOH S 6 .   ? -34.477 -16.166 2.187   1.00 35.93 ? 2007 HOH A O   1 
HETATM 7838 O  O   . HOH S 6 .   ? -40.643 -20.719 5.236   1.00 55.27 ? 2008 HOH A O   1 
HETATM 7839 O  O   . HOH S 6 .   ? -40.673 -18.240 1.791   1.00 49.44 ? 2009 HOH A O   1 
HETATM 7840 O  O   . HOH S 6 .   ? -39.125 -15.984 1.046   1.00 50.26 ? 2010 HOH A O   1 
HETATM 7841 O  O   . HOH S 6 .   ? -42.532 -18.715 6.333   1.00 41.09 ? 2011 HOH A O   1 
HETATM 7842 O  O   . HOH S 6 .   ? -46.704 -8.143  -7.360  1.00 42.22 ? 2012 HOH A O   1 
HETATM 7843 O  O   . HOH S 6 .   ? -46.210 -13.154 -7.160  1.00 40.66 ? 2013 HOH A O   1 
HETATM 7844 O  O   . HOH S 6 .   ? -44.737 -3.842  -8.702  1.00 48.26 ? 2014 HOH A O   1 
HETATM 7845 O  O   . HOH S 6 .   ? -39.792 -3.982  -14.705 1.00 43.23 ? 2015 HOH A O   1 
HETATM 7846 O  O   . HOH S 6 .   ? -38.762 -15.969 -1.660  1.00 32.21 ? 2016 HOH A O   1 
HETATM 7847 O  O   . HOH S 6 .   ? -33.550 -19.398 -10.600 1.00 35.18 ? 2017 HOH A O   1 
HETATM 7848 O  O   . HOH S 6 .   ? -45.325 -10.529 -8.183  1.00 31.88 ? 2018 HOH A O   1 
HETATM 7849 O  O   . HOH S 6 .   ? -28.545 -16.284 -22.710 1.00 23.97 ? 2019 HOH A O   1 
HETATM 7850 O  O   . HOH S 6 .   ? -44.141 -4.448  -1.822  1.00 45.49 ? 2020 HOH A O   1 
HETATM 7851 O  O   . HOH S 6 .   ? -40.340 -5.133  -9.496  1.00 45.60 ? 2021 HOH A O   1 
HETATM 7852 O  O   . HOH S 6 .   ? -14.043 -25.460 -15.804 1.00 39.71 ? 2022 HOH A O   1 
HETATM 7853 O  O   . HOH S 6 .   ? -40.694 -11.129 -12.677 1.00 21.52 ? 2023 HOH A O   1 
HETATM 7854 O  O   . HOH S 6 .   ? -39.005 -8.744  -13.296 1.00 42.61 ? 2024 HOH A O   1 
HETATM 7855 O  O   . HOH S 6 .   ? -8.394  -17.018 -12.467 1.00 23.85 ? 2025 HOH A O   1 
HETATM 7856 O  O   . HOH S 6 .   ? -12.911 -16.505 -21.812 1.00 30.14 ? 2026 HOH A O   1 
HETATM 7857 O  O   . HOH S 6 .   ? -40.102 -6.124  -12.362 1.00 44.06 ? 2027 HOH A O   1 
HETATM 7858 O  O   . HOH S 6 .   ? -35.919 -8.134  -12.392 1.00 36.59 ? 2028 HOH A O   1 
HETATM 7859 O  O   . HOH S 6 .   ? -15.685 -16.147 -21.788 1.00 38.83 ? 2029 HOH A O   1 
HETATM 7860 O  O   . HOH S 6 .   ? -34.819 -15.425 -7.668  1.00 28.03 ? 2030 HOH A O   1 
HETATM 7861 O  O   . HOH S 6 .   ? -36.689 -14.346 -4.852  1.00 32.27 ? 2031 HOH A O   1 
HETATM 7862 O  O   . HOH S 6 .   ? -6.930  -9.935  -24.022 1.00 23.01 ? 2032 HOH A O   1 
HETATM 7863 O  O   . HOH S 6 .   ? -40.255 -14.224 -13.533 1.00 22.05 ? 2033 HOH A O   1 
HETATM 7864 O  O   . HOH S 6 .   ? -6.285  -3.164  -23.795 1.00 26.16 ? 2034 HOH A O   1 
HETATM 7865 O  O   . HOH S 6 .   ? -34.867 -16.171 -11.656 1.00 29.98 ? 2035 HOH A O   1 
HETATM 7866 O  O   . HOH S 6 .   ? -4.527  -3.859  -13.652 1.00 24.19 ? 2036 HOH A O   1 
HETATM 7867 O  O   . HOH S 6 .   ? -6.063  2.469   -19.907 1.00 30.69 ? 2037 HOH A O   1 
HETATM 7868 O  O   . HOH S 6 .   ? -3.843  3.377   -18.190 1.00 35.00 ? 2038 HOH A O   1 
HETATM 7869 O  O   . HOH S 6 .   ? -7.714  4.211   -16.904 1.00 18.00 ? 2039 HOH A O   1 
HETATM 7870 O  O   . HOH S 6 .   ? -5.007  2.986   -13.572 1.00 21.88 ? 2040 HOH A O   1 
HETATM 7871 O  O   . HOH S 6 .   ? -30.397 -15.295 -11.835 1.00 15.13 ? 2041 HOH A O   1 
HETATM 7872 O  O   . HOH S 6 .   ? -30.139 -15.348 -21.102 1.00 24.36 ? 2042 HOH A O   1 
HETATM 7873 O  O   . HOH S 6 .   ? -8.624  4.890   -14.376 1.00 20.30 ? 2043 HOH A O   1 
HETATM 7874 O  O   . HOH S 6 .   ? -7.730  7.983   8.540   1.00 26.38 ? 2044 HOH A O   1 
HETATM 7875 O  O   . HOH S 6 .   ? -17.724 13.759  6.305   1.00 34.94 ? 2045 HOH A O   1 
HETATM 7876 O  O   . HOH S 6 .   ? -16.326 16.366  6.426   1.00 40.73 ? 2046 HOH A O   1 
HETATM 7877 O  O   . HOH S 6 .   ? -27.029 10.297  7.899   1.00 45.03 ? 2047 HOH A O   1 
HETATM 7878 O  O   . HOH S 6 .   ? -23.652 10.993  7.475   1.00 40.30 ? 2048 HOH A O   1 
HETATM 7879 O  O   . HOH S 6 .   ? -35.286 -1.510  6.150   1.00 42.99 ? 2049 HOH A O   1 
HETATM 7880 O  O   . HOH S 6 .   ? -24.458 -18.771 -9.731  1.00 15.51 ? 2050 HOH A O   1 
HETATM 7881 O  O   . HOH S 6 .   ? -22.023 -19.919 -11.932 1.00 27.74 ? 2051 HOH A O   1 
HETATM 7882 O  O   . HOH S 6 .   ? -21.958 -22.403 -10.364 1.00 22.80 ? 2052 HOH A O   1 
HETATM 7883 O  O   . HOH S 6 .   ? -22.674 -23.223 -6.485  1.00 39.36 ? 2053 HOH A O   1 
HETATM 7884 O  O   . HOH S 6 .   ? -18.833 -24.124 -8.469  1.00 24.49 ? 2054 HOH A O   1 
HETATM 7885 O  O   . HOH S 6 .   ? -17.646 -17.396 -13.788 1.00 16.39 ? 2055 HOH A O   1 
HETATM 7886 O  O   . HOH S 6 .   ? -16.369 -24.592 -9.903  1.00 51.52 ? 2056 HOH A O   1 
HETATM 7887 O  O   . HOH S 6 .   ? -14.423 -24.539 -13.381 1.00 31.25 ? 2057 HOH A O   1 
HETATM 7888 O  O   . HOH S 6 .   ? -16.363 -28.798 -13.543 1.00 51.58 ? 2058 HOH A O   1 
HETATM 7889 O  O   . HOH S 6 .   ? -14.173 -25.934 -11.128 1.00 39.45 ? 2059 HOH A O   1 
HETATM 7890 O  O   . HOH S 6 .   ? -25.072 11.268  -0.532  1.00 40.42 ? 2060 HOH A O   1 
HETATM 7891 O  O   . HOH S 6 .   ? -25.715 12.031  5.606   1.00 40.25 ? 2061 HOH A O   1 
HETATM 7892 O  O   . HOH S 6 .   ? -13.537 -21.974 -12.320 1.00 18.70 ? 2062 HOH A O   1 
HETATM 7893 O  O   . HOH S 6 .   ? -10.425 -15.993 -13.373 1.00 30.95 ? 2063 HOH A O   1 
HETATM 7894 O  O   . HOH S 6 .   ? -24.158 13.023  -2.630  1.00 39.68 ? 2064 HOH A O   1 
HETATM 7895 O  O   . HOH S 6 .   ? -19.235 15.946  -4.006  1.00 52.32 ? 2065 HOH A O   1 
HETATM 7896 O  O   . HOH S 6 .   ? -20.193 15.082  5.876   1.00 33.82 ? 2066 HOH A O   1 
HETATM 7897 O  O   . HOH S 6 .   ? -12.935 -18.501 -19.915 1.00 38.78 ? 2067 HOH A O   1 
HETATM 7898 O  O   . HOH S 6 .   ? -11.136 -24.400 -11.263 1.00 37.12 ? 2068 HOH A O   1 
HETATM 7899 O  O   . HOH S 6 .   ? -8.287  -19.739 -13.705 1.00 41.18 ? 2069 HOH A O   1 
HETATM 7900 O  O   . HOH S 6 .   ? -18.574 -16.466 -16.422 1.00 13.71 ? 2070 HOH A O   1 
HETATM 7901 O  O   . HOH S 6 .   ? -17.006 -18.298 -20.331 1.00 38.69 ? 2071 HOH A O   1 
HETATM 7902 O  O   . HOH S 6 .   ? -11.796 8.273   -12.964 1.00 25.35 ? 2072 HOH A O   1 
HETATM 7903 O  O   . HOH S 6 .   ? -16.709 3.802   -20.582 1.00 31.92 ? 2073 HOH A O   1 
HETATM 7904 O  O   . HOH S 6 .   ? -14.907 -1.810  -19.240 1.00 35.86 ? 2074 HOH A O   1 
HETATM 7905 O  O   . HOH S 6 .   ? -9.271  -10.989 -23.309 1.00 12.31 ? 2075 HOH A O   1 
HETATM 7906 O  O   . HOH S 6 .   ? -10.696 -14.838 -21.239 1.00 13.18 ? 2076 HOH A O   1 
HETATM 7907 O  O   . HOH S 6 .   ? -15.015 9.666   -9.727  1.00 35.02 ? 2077 HOH A O   1 
HETATM 7908 O  O   . HOH S 6 .   ? -25.294 11.035  -4.830  1.00 49.21 ? 2078 HOH A O   1 
HETATM 7909 O  O   . HOH S 6 .   ? -21.464 20.213  -9.740  1.00 24.72 ? 2079 HOH A O   1 
HETATM 7910 O  O   . HOH S 6 .   ? -11.923 -5.763  -21.718 1.00 24.85 ? 2080 HOH A O   1 
HETATM 7911 O  O   . HOH S 6 .   ? -6.739  -1.956  -21.339 1.00 41.93 ? 2081 HOH A O   1 
HETATM 7912 O  O   . HOH S 6 .   ? -7.306  -5.539  -16.589 1.00 15.47 ? 2082 HOH A O   1 
HETATM 7913 O  O   . HOH S 6 .   ? -11.872 0.297   -15.740 1.00 13.72 ? 2083 HOH A O   1 
HETATM 7914 O  O   . HOH S 6 .   ? -10.883 1.271   -19.284 1.00 23.46 ? 2084 HOH A O   1 
HETATM 7915 O  O   . HOH S 6 .   ? -7.173  -3.564  -13.251 1.00 16.16 ? 2085 HOH A O   1 
HETATM 7916 O  O   . HOH S 6 .   ? -5.546  2.432   -16.353 1.00 29.36 ? 2086 HOH A O   1 
HETATM 7917 O  O   . HOH S 6 .   ? -5.189  -0.006  -20.356 1.00 37.53 ? 2087 HOH A O   1 
HETATM 7918 O  O   . HOH S 6 .   ? -4.764  -5.395  -17.772 1.00 32.13 ? 2088 HOH A O   1 
HETATM 7919 O  O   . HOH S 6 .   ? -3.342  1.043   -14.499 1.00 37.27 ? 2089 HOH A O   1 
HETATM 7920 O  O   . HOH S 6 .   ? -1.739  -2.918  -16.371 1.00 52.38 ? 2090 HOH A O   1 
HETATM 7921 O  O   . HOH S 6 .   ? -17.257 -18.940 8.899   1.00 36.11 ? 2091 HOH A O   1 
HETATM 7922 O  O   . HOH S 6 .   ? -28.803 -20.671 5.915   1.00 47.72 ? 2092 HOH A O   1 
HETATM 7923 O  O   . HOH S 6 .   ? -11.442 3.273   -12.141 1.00 12.44 ? 2093 HOH A O   1 
HETATM 7924 O  O   . HOH S 6 .   ? -7.524  3.277   -12.550 1.00 15.58 ? 2094 HOH A O   1 
HETATM 7925 O  O   . HOH S 6 .   ? -6.509  1.924   -7.544  1.00 28.78 ? 2095 HOH A O   1 
HETATM 7926 O  O   . HOH S 6 .   ? -8.521  7.861   -6.616  1.00 37.78 ? 2096 HOH A O   1 
HETATM 7927 O  O   . HOH S 6 .   ? -8.389  4.831   -5.142  1.00 26.59 ? 2097 HOH A O   1 
HETATM 7928 O  O   . HOH S 6 .   ? -4.460  3.152   -9.315  1.00 45.35 ? 2098 HOH A O   1 
HETATM 7929 O  O   . HOH S 6 .   ? -8.638  -17.785 -9.773  1.00 33.01 ? 2099 HOH A O   1 
HETATM 7930 O  O   . HOH S 6 .   ? -10.340 7.826   -0.710  1.00 17.53 ? 2100 HOH A O   1 
HETATM 7931 O  O   . HOH S 6 .   ? -7.536  9.160   -3.087  1.00 36.42 ? 2101 HOH A O   1 
HETATM 7932 O  O   . HOH S 6 .   ? -12.955 -19.753 6.022   1.00 43.12 ? 2102 HOH A O   1 
HETATM 7933 O  O   . HOH S 6 .   ? -28.163 -21.309 0.091   1.00 41.23 ? 2103 HOH A O   1 
HETATM 7934 O  O   . HOH S 6 .   ? -10.206 10.933  1.080   1.00 18.95 ? 2104 HOH A O   1 
HETATM 7935 O  O   . HOH S 6 .   ? -9.259  10.891  -1.565  1.00 29.95 ? 2105 HOH A O   1 
HETATM 7936 O  O   . HOH S 6 .   ? -14.984 12.890  2.039   1.00 18.04 ? 2106 HOH A O   1 
HETATM 7937 O  O   . HOH S 6 .   ? -12.598 13.654  3.724   1.00 40.05 ? 2107 HOH A O   1 
HETATM 7938 O  O   . HOH S 6 .   ? -6.163  7.482   6.519   1.00 37.35 ? 2108 HOH A O   1 
HETATM 7939 O  O   . HOH S 6 .   ? -9.728  9.179   7.501   1.00 21.45 ? 2109 HOH A O   1 
HETATM 7940 O  O   . HOH S 6 .   ? -17.011 12.539  8.874   1.00 17.31 ? 2110 HOH A O   1 
HETATM 7941 O  O   . HOH S 6 .   ? -29.089 14.498  -11.892 1.00 39.56 ? 2111 HOH A O   1 
HETATM 7942 O  O   . HOH S 6 .   ? -27.155 15.856  -3.617  1.00 41.36 ? 2112 HOH A O   1 
HETATM 7943 O  O   . HOH S 6 .   ? -15.810 17.647  8.897   1.00 28.59 ? 2113 HOH A O   1 
HETATM 7944 O  O   . HOH S 6 .   ? -21.705 14.589  14.208  1.00 24.75 ? 2114 HOH A O   1 
HETATM 7945 O  O   . HOH S 6 .   ? -24.621 10.694  12.000  1.00 32.55 ? 2115 HOH A O   1 
HETATM 7946 O  O   . HOH S 6 .   ? -24.209 13.400  10.871  1.00 46.69 ? 2116 HOH A O   1 
HETATM 7947 O  O   . HOH S 6 .   ? -21.758 14.008  16.764  1.00 25.10 ? 2117 HOH A O   1 
HETATM 7948 O  O   . HOH S 6 .   ? -21.091 8.258   19.245  1.00 34.26 ? 2118 HOH A O   1 
HETATM 7949 O  O   . HOH S 6 .   ? -33.029 -2.326  -19.110 1.00 43.05 ? 2119 HOH A O   1 
HETATM 7950 O  O   . HOH S 6 .   ? -24.691 -0.244  -19.701 1.00 37.34 ? 2120 HOH A O   1 
HETATM 7951 O  O   . HOH S 6 .   ? -24.342 8.752   8.388   1.00 21.16 ? 2121 HOH A O   1 
HETATM 7952 O  O   . HOH S 6 .   ? -27.431 3.473   8.769   1.00 18.68 ? 2122 HOH A O   1 
HETATM 7953 O  O   . HOH S 6 .   ? -27.054 12.028  11.500  1.00 36.50 ? 2123 HOH A O   1 
HETATM 7954 O  O   . HOH S 6 .   ? -33.285 0.802   8.038   1.00 40.28 ? 2124 HOH A O   1 
HETATM 7955 O  O   . HOH S 6 .   ? -12.833 -19.361 8.996   1.00 50.59 ? 2125 HOH A O   1 
HETATM 7956 O  O   . HOH S 6 .   ? -14.812 -18.057 10.376  1.00 49.31 ? 2126 HOH A O   1 
HETATM 7957 O  O   . HOH S 6 .   ? -7.495  -15.018 17.130  1.00 29.80 ? 2127 HOH A O   1 
HETATM 7958 O  O   . HOH S 6 .   ? -5.300  -16.010 17.825  1.00 33.32 ? 2128 HOH A O   1 
HETATM 7959 O  O   . HOH S 6 .   ? -0.824  -14.654 16.045  1.00 18.50 ? 2129 HOH A O   1 
HETATM 7960 O  O   . HOH S 6 .   ? -8.464  -11.243 19.117  1.00 39.96 ? 2130 HOH A O   1 
HETATM 7961 O  O   . HOH S 6 .   ? -5.516  -5.990  10.041  1.00 23.91 ? 2131 HOH A O   1 
HETATM 7962 O  O   . HOH S 6 .   ? -5.119  -6.900  19.442  1.00 49.63 ? 2132 HOH A O   1 
HETATM 7963 O  O   . HOH S 6 .   ? 0.874   -14.883 18.243  1.00 43.16 ? 2133 HOH A O   1 
HETATM 7964 O  O   . HOH S 6 .   ? -30.872 0.399   6.722   1.00 32.23 ? 2134 HOH A O   1 
HETATM 7965 O  O   . HOH S 6 .   ? -32.609 -10.981 9.059   1.00 36.54 ? 2135 HOH A O   1 
HETATM 7966 O  O   . HOH S 6 .   ? -30.604 1.574   2.095   1.00 45.41 ? 2136 HOH A O   1 
HETATM 7967 O  O   . HOH S 6 .   ? -27.974 4.285   4.848   1.00 24.17 ? 2137 HOH A O   1 
HETATM 7968 O  O   . HOH S 6 .   ? -29.756 2.739   7.434   1.00 32.68 ? 2138 HOH A O   1 
HETATM 7969 O  O   . HOH S 6 .   ? -31.919 -0.445  3.455   1.00 46.78 ? 2139 HOH A O   1 
HETATM 7970 O  O   . HOH S 6 .   ? -29.112 7.114   8.012   1.00 22.68 ? 2140 HOH A O   1 
HETATM 7971 O  O   . HOH S 6 .   ? -30.087 6.260   5.476   1.00 35.78 ? 2141 HOH A O   1 
HETATM 7972 O  O   . HOH S 6 .   ? -24.190 9.320   0.651   1.00 23.76 ? 2142 HOH A O   1 
HETATM 7973 O  O   . HOH S 6 .   ? -26.641 7.775   2.092   1.00 25.59 ? 2143 HOH A O   1 
HETATM 7974 O  O   . HOH S 6 .   ? -25.447 10.748  3.256   1.00 34.31 ? 2144 HOH A O   1 
HETATM 7975 O  O   . HOH S 6 .   ? -21.005 9.985   -0.882  1.00 13.07 ? 2145 HOH A O   1 
HETATM 7976 O  O   . HOH S 6 .   ? -17.448 13.496  3.155   1.00 29.95 ? 2146 HOH A O   1 
HETATM 7977 O  O   . HOH S 6 .   ? -21.473 13.504  -2.937  1.00 32.73 ? 2147 HOH A O   1 
HETATM 7978 O  O   . HOH S 6 .   ? -14.667 13.485  -3.189  1.00 35.80 ? 2148 HOH A O   1 
HETATM 7979 O  O   . HOH S 6 .   ? -14.925 14.404  -0.415  1.00 37.81 ? 2149 HOH A O   1 
HETATM 7980 O  O   . HOH S 6 .   ? -3.639  -6.567  -13.832 1.00 43.64 ? 2150 HOH A O   1 
HETATM 7981 O  O   . HOH S 6 .   ? -24.474 -9.312  -18.665 1.00 29.60 ? 2151 HOH A O   1 
HETATM 7982 O  O   . HOH S 6 .   ? -28.977 -2.401  -20.622 1.00 18.73 ? 2152 HOH A O   1 
HETATM 7983 O  O   . HOH S 6 .   ? -14.381 -1.618  -13.546 1.00 9.06  ? 2153 HOH A O   1 
HETATM 7984 O  O   . HOH S 6 .   ? -11.191 5.604   -13.490 1.00 13.37 ? 2154 HOH A O   1 
HETATM 7985 O  O   . HOH S 6 .   ? -14.327 3.543   -18.975 1.00 16.52 ? 2155 HOH A O   1 
HETATM 7986 O  O   . HOH S 6 .   ? -16.641 6.255   -20.554 1.00 33.50 ? 2156 HOH A O   1 
HETATM 7987 O  O   . HOH S 6 .   ? -13.904 9.411   -14.811 1.00 18.30 ? 2157 HOH A O   1 
HETATM 7988 O  O   . HOH S 6 .   ? -18.616 7.700   -20.576 1.00 33.41 ? 2158 HOH A O   1 
HETATM 7989 O  O   . HOH S 6 .   ? -19.770 8.878   -15.205 1.00 39.87 ? 2159 HOH A O   1 
HETATM 7990 O  O   . HOH S 6 .   ? -20.721 5.608   -17.681 1.00 33.00 ? 2160 HOH A O   1 
HETATM 7991 O  O   . HOH S 6 .   ? -18.675 10.698  -16.738 1.00 45.39 ? 2161 HOH A O   1 
HETATM 7992 O  O   . HOH S 6 .   ? -37.153 -3.019  -11.136 1.00 35.90 ? 2162 HOH A O   1 
HETATM 7993 O  O   . HOH S 6 .   ? -20.960 1.762   -15.338 1.00 40.32 ? 2163 HOH A O   1 
HETATM 7994 O  O   . HOH S 6 .   ? -14.070 0.866   -17.710 1.00 28.94 ? 2164 HOH A O   1 
HETATM 7995 O  O   . HOH S 6 .   ? -22.213 6.645   -13.887 1.00 13.69 ? 2165 HOH A O   1 
HETATM 7996 O  O   . HOH S 6 .   ? -20.014 11.998  -13.629 1.00 41.12 ? 2166 HOH A O   1 
HETATM 7997 O  O   . HOH S 6 .   ? -16.392 14.424  -12.694 1.00 43.78 ? 2167 HOH A O   1 
HETATM 7998 O  O   . HOH S 6 .   ? -13.784 12.892  -12.521 1.00 27.94 ? 2168 HOH A O   1 
HETATM 7999 O  O   . HOH S 6 .   ? -9.909  -15.988 -2.882  1.00 46.93 ? 2169 HOH A O   1 
HETATM 8000 O  O   . HOH S 6 .   ? -17.521 10.051  -8.998  1.00 27.42 ? 2170 HOH A O   1 
HETATM 8001 O  O   . HOH S 6 .   ? -21.347 4.620   -15.419 1.00 21.95 ? 2171 HOH A O   1 
HETATM 8002 O  O   . HOH S 6 .   ? -25.272 10.436  -7.555  1.00 31.19 ? 2172 HOH A O   1 
HETATM 8003 O  O   . HOH S 6 .   ? -23.179 16.179  -10.693 1.00 38.18 ? 2173 HOH A O   1 
HETATM 8004 O  O   . HOH S 6 .   ? -21.200 17.724  -9.824  1.00 37.23 ? 2174 HOH A O   1 
HETATM 8005 O  O   . HOH S 6 .   ? -10.910 -15.084 19.932  1.00 44.76 ? 2175 HOH A O   1 
HETATM 8006 O  O   . HOH S 6 .   ? -28.515 -8.217  23.669  1.00 46.38 ? 2176 HOH A O   1 
HETATM 8007 O  O   . HOH S 6 .   ? -29.952 -19.901 1.320   1.00 36.71 ? 2177 HOH A O   1 
HETATM 8008 O  O   . HOH S 6 .   ? -32.572 -19.658 0.311   1.00 48.96 ? 2178 HOH A O   1 
HETATM 8009 O  O   . HOH S 6 .   ? -19.749 -15.292 9.604   1.00 23.83 ? 2179 HOH A O   1 
HETATM 8010 O  O   . HOH S 6 .   ? -18.985 -17.453 10.690  1.00 39.22 ? 2180 HOH A O   1 
HETATM 8011 O  O   . HOH S 6 .   ? -33.994 -20.994 -12.988 1.00 30.68 ? 2181 HOH A O   1 
HETATM 8012 O  O   . HOH S 6 .   ? -31.141 -22.555 -14.276 1.00 32.80 ? 2182 HOH A O   1 
HETATM 8013 O  O   . HOH S 6 .   ? -24.613 -22.279 14.151  1.00 42.11 ? 2183 HOH A O   1 
HETATM 8014 O  O   . HOH S 6 .   ? -26.333 -21.975 6.070   1.00 40.49 ? 2184 HOH A O   1 
HETATM 8015 O  O   . HOH S 6 .   ? -20.014 -5.862  -21.801 1.00 32.02 ? 2185 HOH A O   1 
HETATM 8016 O  O   . HOH S 6 .   ? -2.472  -9.246  -17.804 1.00 28.82 ? 2186 HOH A O   1 
HETATM 8017 O  O   . HOH S 6 .   ? -23.508 -21.580 5.668   1.00 22.91 ? 2187 HOH A O   1 
HETATM 8018 O  O   . HOH S 6 .   ? -25.422 -17.346 -1.749  1.00 22.28 ? 2188 HOH A O   1 
HETATM 8019 O  O   . HOH S 6 .   ? -22.885 -21.263 -4.527  1.00 20.38 ? 2189 HOH A O   1 
HETATM 8020 O  O   . HOH S 6 .   ? -12.659 -21.363 -4.226  1.00 43.10 ? 2190 HOH A O   1 
HETATM 8021 O  O   . HOH S 6 .   ? -13.724 -24.318 -4.034  1.00 46.03 ? 2191 HOH A O   1 
HETATM 8022 O  O   . HOH S 6 .   ? -9.821  -20.482 -9.217  1.00 44.97 ? 2192 HOH A O   1 
HETATM 8023 O  O   . HOH S 6 .   ? -22.888 -23.060 -2.234  1.00 46.51 ? 2193 HOH A O   1 
HETATM 8024 O  O   . HOH S 6 .   ? -18.572 -25.866 0.182   1.00 51.88 ? 2194 HOH A O   1 
HETATM 8025 O  O   . HOH S 6 .   ? -15.728 -24.830 0.317   1.00 47.16 ? 2195 HOH A O   1 
HETATM 8026 O  O   . HOH S 6 .   ? -12.843 -18.653 3.375   1.00 25.24 ? 2196 HOH A O   1 
HETATM 8027 O  O   . HOH S 6 .   ? -10.320 -21.617 -0.052  1.00 56.19 ? 2197 HOH A O   1 
HETATM 8028 O  O   . HOH S 6 .   ? -18.321 -23.320 1.477   1.00 25.29 ? 2198 HOH A O   1 
HETATM 8029 O  O   . HOH S 6 .   ? -15.775 -20.661 4.964   1.00 29.43 ? 2199 HOH A O   1 
HETATM 8030 O  O   . HOH S 6 .   ? -23.001 -22.546 2.889   1.00 38.96 ? 2200 HOH A O   1 
HETATM 8031 O  O   . HOH S 6 .   ? -26.909 -20.830 -2.265  1.00 28.20 ? 2201 HOH A O   1 
HETATM 8032 O  O   . HOH S 6 .   ? -23.258 12.180  -14.824 1.00 49.07 ? 2202 HOH A O   1 
HETATM 8033 O  O   . HOH S 6 .   ? -23.134 14.512  -13.213 1.00 44.06 ? 2203 HOH A O   1 
HETATM 8034 O  O   . HOH S 6 .   ? -22.368 9.569   -14.575 1.00 42.97 ? 2204 HOH A O   1 
HETATM 8035 O  O   . HOH S 6 .   ? -28.001 13.821  -15.549 1.00 25.76 ? 2205 HOH A O   1 
HETATM 8036 O  O   . HOH S 6 .   ? -31.500 12.768  -11.647 1.00 25.12 ? 2206 HOH A O   1 
HETATM 8037 O  O   . HOH S 6 .   ? -27.907 13.968  -5.492  1.00 47.08 ? 2207 HOH A O   1 
HETATM 8038 O  O   . HOH S 6 .   ? -30.731 14.530  -4.308  1.00 42.43 ? 2208 HOH A O   1 
HETATM 8039 O  O   . HOH S 6 .   ? -34.424 14.322  -9.232  1.00 32.29 ? 2209 HOH A O   1 
HETATM 8040 O  O   . HOH S 6 .   ? -33.684 15.677  -6.968  1.00 47.00 ? 2210 HOH A O   1 
HETATM 8041 O  O   . HOH S 6 .   ? -34.673 15.042  -4.499  1.00 46.12 ? 2211 HOH A O   1 
HETATM 8042 O  O   . HOH S 6 .   ? -31.198 8.387   -2.729  1.00 34.94 ? 2212 HOH A O   1 
HETATM 8043 O  O   . HOH S 6 .   ? -36.315 3.680   -11.526 1.00 30.66 ? 2213 HOH A O   1 
HETATM 8044 O  O   . HOH S 6 .   ? -34.503 8.951   -2.071  1.00 40.59 ? 2214 HOH A O   1 
HETATM 8045 O  O   . HOH S 6 .   ? -34.575 10.405  -13.282 1.00 32.98 ? 2215 HOH A O   1 
HETATM 8046 O  O   . HOH S 6 .   ? -29.267 0.160   -11.426 1.00 15.88 ? 2216 HOH A O   1 
HETATM 8047 O  O   . HOH S 6 .   ? -31.096 -1.323  -9.885  1.00 14.16 ? 2217 HOH A O   1 
HETATM 8048 O  O   . HOH S 6 .   ? -35.914 -1.879  -15.844 1.00 36.44 ? 2218 HOH A O   1 
HETATM 8049 O  O   . HOH S 6 .   ? -31.501 -2.347  -16.775 1.00 30.30 ? 2219 HOH A O   1 
HETATM 8050 O  O   . HOH S 6 .   ? -38.635 5.705   -17.841 1.00 33.32 ? 2220 HOH A O   1 
HETATM 8051 O  O   . HOH S 6 .   ? -28.648 4.381   -16.907 1.00 18.63 ? 2221 HOH A O   1 
HETATM 8052 O  O   . HOH S 6 .   ? -24.950 1.585   -18.226 1.00 37.10 ? 2222 HOH A O   1 
HETATM 8053 O  O   . HOH S 6 .   ? -19.357 -2.275  -8.935  1.00 8.75  ? 2223 HOH A O   1 
HETATM 8054 O  O   . HOH S 6 .   ? -12.829 -10.270 -1.698  1.00 11.93 ? 2224 HOH A O   1 
HETATM 8055 O  O   . HOH S 6 .   ? -6.524  -15.665 2.090   1.00 51.45 ? 2225 HOH A O   1 
HETATM 8056 O  O   . HOH S 6 .   ? -10.284 -18.984 -0.592  1.00 48.19 ? 2226 HOH A O   1 
HETATM 8057 O  O   . HOH S 6 .   ? -11.517 -17.604 7.086   1.00 22.55 ? 2227 HOH A O   1 
HETATM 8058 O  O   . HOH S 6 .   ? -8.898  -17.842 7.016   1.00 38.03 ? 2228 HOH A O   1 
HETATM 8059 O  O   . HOH S 6 .   ? -7.036  -15.866 5.988   1.00 36.21 ? 2229 HOH A O   1 
HETATM 8060 O  O   . HOH S 6 .   ? -9.902  -19.997 9.387   1.00 42.39 ? 2230 HOH A O   1 
HETATM 8061 O  O   . HOH S 6 .   ? -11.480 -20.015 13.707  1.00 47.56 ? 2231 HOH A O   1 
HETATM 8062 O  O   . HOH S 6 .   ? -13.468 -17.739 12.717  1.00 46.24 ? 2232 HOH A O   1 
HETATM 8063 O  O   . HOH S 6 .   ? -7.303  -20.004 12.463  1.00 28.15 ? 2233 HOH A O   1 
HETATM 8064 O  O   . HOH S 6 .   ? -8.068  -15.006 14.498  1.00 15.14 ? 2234 HOH A O   1 
HETATM 8065 O  O   . HOH S 6 .   ? -8.210  -19.481 15.400  1.00 37.21 ? 2235 HOH A O   1 
HETATM 8066 O  O   . HOH S 6 .   ? -5.217  -10.452 10.446  1.00 18.28 ? 2236 HOH A O   1 
HETATM 8067 O  O   . HOH S 6 .   ? -3.631  -14.593 16.408  1.00 25.76 ? 2237 HOH A O   1 
HETATM 8068 O  O   . HOH S 6 .   ? -6.047  -11.739 17.447  1.00 42.93 ? 2238 HOH A O   1 
HETATM 8069 O  O   . HOH S 6 .   ? -6.931  -8.190  10.504  1.00 19.59 ? 2239 HOH A O   1 
HETATM 8070 O  O   . HOH S 6 .   ? -4.517  -8.162  17.014  1.00 24.89 ? 2240 HOH A O   1 
HETATM 8071 O  O   . HOH S 6 .   ? 1.186   -8.502  14.709  1.00 44.10 ? 2241 HOH A O   1 
HETATM 8072 O  O   . HOH S 6 .   ? -0.666  -11.902 16.696  1.00 35.57 ? 2242 HOH A O   1 
HETATM 8073 O  O   . HOH S 6 .   ? -2.396  -6.315  10.712  1.00 40.06 ? 2243 HOH A O   1 
HETATM 8074 O  O   . HOH S 6 .   ? -5.961  -3.513  11.164  1.00 22.34 ? 2244 HOH A O   1 
HETATM 8075 O  O   . HOH S 6 .   ? -4.317  -4.950  14.747  1.00 39.89 ? 2245 HOH A O   1 
HETATM 8076 O  O   . HOH S 6 .   ? -10.035 -9.146  17.884  1.00 24.84 ? 2246 HOH A O   1 
HETATM 8077 O  O   . HOH S 6 .   ? -12.452 -7.616  18.704  1.00 26.20 ? 2247 HOH A O   1 
HETATM 8078 O  O   . HOH S 6 .   ? -11.425 -6.716  21.154  1.00 47.00 ? 2248 HOH A O   1 
HETATM 8079 O  O   . HOH S 6 .   ? -8.060  -2.794  16.746  1.00 34.06 ? 2249 HOH A O   1 
HETATM 8080 O  O   . HOH S 6 .   ? -9.112  -2.451  20.684  1.00 45.46 ? 2250 HOH A O   1 
HETATM 8081 O  O   . HOH S 6 .   ? -7.820  -1.804  9.617   1.00 30.46 ? 2251 HOH A O   1 
HETATM 8082 O  O   . HOH S 6 .   ? -9.367  -4.188  6.025   1.00 38.68 ? 2252 HOH A O   1 
HETATM 8083 O  O   . HOH S 6 .   ? -7.621  -2.678  7.159   1.00 33.74 ? 2253 HOH A O   1 
HETATM 8084 O  O   . HOH S 6 .   ? -10.285 0.436   16.156  1.00 29.35 ? 2254 HOH A O   1 
HETATM 8085 O  O   . HOH S 6 .   ? -8.605  2.058   12.339  1.00 41.61 ? 2255 HOH A O   1 
HETATM 8086 O  O   . HOH S 6 .   ? -12.423 0.437   17.778  1.00 38.17 ? 2256 HOH A O   1 
HETATM 8087 O  O   . HOH S 6 .   ? -15.601 -5.606  19.254  1.00 34.04 ? 2257 HOH A O   1 
HETATM 8088 O  O   . HOH S 6 .   ? -12.653 -2.338  20.871  1.00 31.66 ? 2258 HOH A O   1 
HETATM 8089 O  O   . HOH S 6 .   ? -16.668 3.629   16.462  1.00 25.20 ? 2259 HOH A O   1 
HETATM 8090 O  O   . HOH S 6 .   ? -10.116 5.816   12.492  1.00 17.02 ? 2260 HOH A O   1 
HETATM 8091 O  O   . HOH S 6 .   ? -15.710 5.068   14.025  1.00 23.06 ? 2261 HOH A O   1 
HETATM 8092 O  O   . HOH S 6 .   ? -12.546 6.975   13.423  1.00 16.63 ? 2262 HOH A O   1 
HETATM 8093 O  O   . HOH S 6 .   ? -20.151 -4.890  20.202  1.00 20.41 ? 2263 HOH A O   1 
HETATM 8094 O  O   . HOH S 6 .   ? -18.587 -3.943  22.421  1.00 47.49 ? 2264 HOH A O   1 
HETATM 8095 O  O   . HOH S 6 .   ? -21.389 -1.520  21.824  1.00 35.70 ? 2265 HOH A O   1 
HETATM 8096 O  O   . HOH S 6 .   ? -17.541 -1.402  23.189  1.00 50.10 ? 2266 HOH A O   1 
HETATM 8097 O  O   . HOH S 6 .   ? -16.035 1.511   20.406  1.00 40.45 ? 2267 HOH A O   1 
HETATM 8098 O  O   . HOH S 6 .   ? -23.521 7.385   19.741  1.00 46.81 ? 2268 HOH A O   1 
HETATM 8099 O  O   . HOH S 6 .   ? -22.057 -7.915  23.387  1.00 43.19 ? 2269 HOH A O   1 
HETATM 8100 O  O   . HOH S 6 .   ? -20.657 -2.344  24.601  1.00 47.11 ? 2270 HOH A O   1 
HETATM 8101 O  O   . HOH S 6 .   ? -30.197 -2.006  21.074  1.00 33.11 ? 2271 HOH A O   1 
HETATM 8102 O  O   . HOH S 6 .   ? -29.155 2.229   20.224  1.00 37.04 ? 2272 HOH A O   1 
HETATM 8103 O  O   . HOH S 6 .   ? -27.685 1.723   23.672  1.00 53.77 ? 2273 HOH A O   1 
HETATM 8104 O  O   . HOH S 6 .   ? -34.602 -7.150  18.401  1.00 33.22 ? 2274 HOH A O   1 
HETATM 8105 O  O   . HOH S 6 .   ? -40.399 -8.758  15.145  1.00 54.58 ? 2275 HOH A O   1 
HETATM 8106 O  O   . HOH S 6 .   ? -39.981 -7.054  12.918  1.00 48.80 ? 2276 HOH A O   1 
HETATM 8107 O  O   . HOH S 6 .   ? -27.177 4.694   20.979  1.00 51.48 ? 2277 HOH A O   1 
HETATM 8108 O  O   . HOH S 6 .   ? -29.565 5.270   9.912   1.00 28.28 ? 2278 HOH A O   1 
HETATM 8109 O  O   . HOH S 6 .   ? -25.926 7.657   18.968  1.00 45.96 ? 2279 HOH A O   1 
HETATM 8110 O  O   . HOH S 6 .   ? -24.959 10.118  19.340  1.00 27.14 ? 2280 HOH A O   1 
HETATM 8111 O  O   . HOH S 6 .   ? -24.293 13.744  13.639  1.00 33.10 ? 2281 HOH A O   1 
HETATM 8112 O  O   . HOH S 6 .   ? -9.471  5.962   9.902   1.00 26.33 ? 2282 HOH A O   1 
HETATM 8113 O  O   . HOH S 6 .   ? -6.883  2.262   3.684   1.00 46.54 ? 2283 HOH A O   1 
HETATM 8114 O  O   . HOH S 6 .   ? -6.171  4.651   6.759   1.00 33.45 ? 2284 HOH A O   1 
HETATM 8115 O  O   . HOH S 6 .   ? -8.363  -0.549  0.749   1.00 25.07 ? 2285 HOH A O   1 
HETATM 8116 O  O   . HOH S 6 .   ? -7.513  1.937   -0.253  1.00 45.56 ? 2286 HOH A O   1 
HETATM 8117 O  O   . HOH S 6 .   ? -8.606  6.064   -0.084  1.00 39.47 ? 2287 HOH A O   1 
HETATM 8118 O  O   . HOH S 6 .   ? -7.637  -3.958  3.890   1.00 27.31 ? 2288 HOH A O   1 
HETATM 8119 O  O   . HOH S 6 .   ? -5.886  -5.658  2.166   1.00 20.63 ? 2289 HOH A O   1 
HETATM 8120 O  O   . HOH S 6 .   ? -4.568  -1.539  -6.354  1.00 33.70 ? 2290 HOH A O   1 
HETATM 8121 O  O   . HOH S 6 .   ? -2.272  -3.545  -3.402  1.00 45.63 ? 2291 HOH A O   1 
HETATM 8122 O  O   . HOH S 6 .   ? -2.545  -5.781  -1.811  1.00 41.50 ? 2292 HOH A O   1 
HETATM 8123 O  O   . HOH S 6 .   ? -8.525  -7.617  -5.100  1.00 12.27 ? 2293 HOH A O   1 
HETATM 8124 O  O   . HOH S 6 .   ? -2.379  -6.970  -7.600  1.00 28.93 ? 2294 HOH A O   1 
HETATM 8125 O  O   . HOH S 6 .   ? -5.444  -10.317 -5.549  1.00 24.12 ? 2295 HOH A O   1 
HETATM 8126 O  O   . HOH S 6 .   ? -2.756  -8.739  -4.331  1.00 30.83 ? 2296 HOH A O   1 
HETATM 8127 O  O   . HOH S 6 .   ? -2.774  -2.384  -12.158 1.00 37.87 ? 2297 HOH A O   1 
HETATM 8128 O  O   . HOH S 6 .   ? -2.414  -1.352  -9.886  1.00 39.68 ? 2298 HOH A O   1 
HETATM 8129 O  O   . HOH S 6 .   ? -2.344  -10.609 -13.872 1.00 23.52 ? 2299 HOH A O   1 
HETATM 8130 O  O   . HOH S 6 .   ? -2.958  -6.947  -10.985 1.00 25.85 ? 2300 HOH A O   1 
HETATM 8131 O  O   . HOH S 6 .   ? -5.274  -14.799 -10.150 1.00 18.68 ? 2301 HOH A O   1 
HETATM 8132 O  O   . HOH S 6 .   ? -3.461  -13.192 -13.862 1.00 23.45 ? 2302 HOH A O   1 
HETATM 8133 O  O   . HOH S 6 .   ? -1.926  -14.839 -9.676  1.00 34.59 ? 2303 HOH A O   1 
HETATM 8134 O  O   . HOH S 6 .   ? -19.298 -7.484  -16.753 1.00 35.44 ? 2304 HOH A O   1 
HETATM 8135 O  O   . HOH S 6 .   ? -17.819 -5.212  -16.866 1.00 37.03 ? 2305 HOH A O   1 
HETATM 8136 O  O   . HOH S 6 .   ? -22.779 -9.998  -16.472 1.00 15.10 ? 2306 HOH A O   1 
HETATM 8137 O  O   . HOH S 6 .   ? -20.892 -5.768  -15.987 1.00 32.81 ? 2307 HOH A O   1 
HETATM 8138 O  O   . HOH S 6 .   ? -22.955 -5.121  -18.011 1.00 26.54 ? 2308 HOH A O   1 
HETATM 8139 O  O   . HOH S 6 .   ? -25.896 -2.562  -18.798 1.00 35.29 ? 2309 HOH A O   1 
HETATM 8140 O  O   . HOH S 6 .   ? -29.208 -6.940  -15.095 1.00 38.75 ? 2310 HOH A O   1 
HETATM 8141 O  O   . HOH S 6 .   ? -29.271 -3.236  -17.934 1.00 24.41 ? 2311 HOH A O   1 
HETATM 8142 O  O   . HOH S 6 .   ? -34.228 -2.486  -0.216  1.00 33.33 ? 2312 HOH A O   1 
HETATM 8143 O  O   . HOH S 6 .   ? -35.269 -4.657  -12.386 1.00 23.09 ? 2313 HOH A O   1 
HETATM 8144 O  O   . HOH S 6 .   ? -36.746 -8.444  -14.822 1.00 45.48 ? 2314 HOH A O   1 
HETATM 8145 O  O   . HOH S 6 .   ? -34.944 -9.765  -16.427 1.00 36.09 ? 2315 HOH A O   1 
HETATM 8146 O  O   . HOH S 6 .   ? -32.196 -7.072  -16.976 1.00 30.52 ? 2316 HOH A O   1 
HETATM 8147 O  O   . HOH S 6 .   ? -11.760 -13.884 -3.621  1.00 42.66 ? 2317 HOH A O   1 
HETATM 8148 O  O   . HOH S 6 .   ? -9.643  -15.953 -8.081  1.00 28.90 ? 2318 HOH A O   1 
HETATM 8149 O  O   . HOH S 6 .   ? -6.604  -12.187 1.050   1.00 32.97 ? 2319 HOH A O   1 
HETATM 8150 O  O   . HOH S 6 .   ? -6.575  -8.020  3.129   1.00 18.42 ? 2320 HOH A O   1 
HETATM 8151 O  O   . HOH S 6 .   ? -7.304  -7.140  5.763   1.00 21.64 ? 2321 HOH A O   1 
HETATM 8152 O  O   . HOH S 6 .   ? -9.661  -13.594 17.926  1.00 23.58 ? 2322 HOH A O   1 
HETATM 8153 O  O   . HOH S 6 .   ? -14.982 -16.637 14.806  1.00 25.82 ? 2323 HOH A O   1 
HETATM 8154 O  O   . HOH S 6 .   ? -13.724 -15.656 19.570  1.00 49.20 ? 2324 HOH A O   1 
HETATM 8155 O  O   . HOH S 6 .   ? -16.891 -11.942 20.178  1.00 34.49 ? 2325 HOH A O   1 
HETATM 8156 O  O   . HOH S 6 .   ? -20.840 -16.033 23.136  1.00 52.59 ? 2326 HOH A O   1 
HETATM 8157 O  O   . HOH S 6 .   ? -17.905 -8.729  21.295  1.00 46.63 ? 2327 HOH A O   1 
HETATM 8158 O  O   . HOH S 6 .   ? -14.976 -7.979  18.299  1.00 31.05 ? 2328 HOH A O   1 
HETATM 8159 O  O   . HOH S 6 .   ? -25.305 -10.876 14.842  1.00 20.74 ? 2329 HOH A O   1 
HETATM 8160 O  O   . HOH S 6 .   ? -26.786 -13.052 16.645  1.00 26.01 ? 2330 HOH A O   1 
HETATM 8161 O  O   . HOH S 6 .   ? -26.755 -11.558 21.922  1.00 42.68 ? 2331 HOH A O   1 
HETATM 8162 O  O   . HOH S 6 .   ? -21.260 -11.493 21.119  1.00 40.48 ? 2332 HOH A O   1 
HETATM 8163 O  O   . HOH S 6 .   ? -26.310 -8.777  21.981  1.00 26.45 ? 2333 HOH A O   1 
HETATM 8164 O  O   . HOH S 6 .   ? -20.657 -7.674  21.026  1.00 33.07 ? 2334 HOH A O   1 
HETATM 8165 O  O   . HOH S 6 .   ? -35.022 -9.927  17.832  1.00 46.06 ? 2335 HOH A O   1 
HETATM 8166 O  O   . HOH S 6 .   ? -32.339 -17.064 17.714  1.00 49.61 ? 2336 HOH A O   1 
HETATM 8167 O  O   . HOH S 6 .   ? -31.774 -16.742 13.444  1.00 37.61 ? 2337 HOH A O   1 
HETATM 8168 O  O   . HOH S 6 .   ? -31.273 -13.357 10.279  1.00 36.79 ? 2338 HOH A O   1 
HETATM 8169 O  O   . HOH S 6 .   ? -29.757 -18.503 13.838  1.00 43.12 ? 2339 HOH A O   1 
HETATM 8170 O  O   . HOH S 6 .   ? -29.812 -18.216 5.048   1.00 36.78 ? 2340 HOH A O   1 
HETATM 8171 O  O   . HOH S 6 .   ? -30.697 -18.011 2.450   1.00 34.88 ? 2341 HOH A O   1 
HETATM 8172 O  O   . HOH S 6 .   ? -34.109 -15.526 -3.469  1.00 31.70 ? 2342 HOH A O   1 
HETATM 8173 O  O   . HOH S 6 .   ? -32.531 -16.961 -0.770  1.00 26.69 ? 2343 HOH A O   1 
HETATM 8174 O  O   . HOH S 6 .   ? -28.217 -21.715 -4.898  1.00 38.73 ? 2344 HOH A O   1 
HETATM 8175 O  O   . HOH S 6 .   ? -31.224 -20.522 -6.579  1.00 35.32 ? 2345 HOH A O   1 
HETATM 8176 O  O   . HOH S 6 .   ? -25.402 -20.824 -8.184  1.00 38.99 ? 2346 HOH A O   1 
HETATM 8177 O  O   . HOH S 6 .   ? -32.552 -16.405 -10.529 1.00 22.83 ? 2347 HOH A O   1 
HETATM 8178 O  O   . HOH S 6 .   ? -33.620 -17.780 -4.711  1.00 41.72 ? 2348 HOH A O   1 
HETATM 8179 O  O   . HOH S 6 .   ? -27.886 -21.403 -9.145  1.00 40.66 ? 2349 HOH A O   1 
HETATM 8180 O  O   . HOH S 6 .   ? -32.799 -20.810 -15.273 1.00 27.39 ? 2350 HOH A O   1 
HETATM 8181 O  O   . HOH S 6 .   ? -34.308 -17.618 -13.964 1.00 25.12 ? 2351 HOH A O   1 
HETATM 8182 O  O   . HOH S 6 .   ? -25.684 -20.817 -19.424 1.00 38.40 ? 2352 HOH A O   1 
HETATM 8183 O  O   . HOH S 6 .   ? -23.750 -14.045 -22.791 1.00 31.35 ? 2353 HOH A O   1 
HETATM 8184 O  O   . HOH S 6 .   ? -20.620 -18.130 -17.407 1.00 31.90 ? 2354 HOH A O   1 
HETATM 8185 O  O   . HOH S 6 .   ? -22.897 -11.304 -19.949 1.00 15.01 ? 2355 HOH A O   1 
HETATM 8186 O  O   . HOH S 6 .   ? -20.428 -9.404  -18.153 1.00 32.23 ? 2356 HOH A O   1 
HETATM 8187 O  O   . HOH S 6 .   ? -17.216 -6.056  -21.790 1.00 38.21 ? 2357 HOH A O   1 
HETATM 8188 O  O   . HOH S 6 .   ? -17.662 -4.017  -19.164 1.00 40.65 ? 2358 HOH A O   1 
HETATM 8189 O  O   . HOH S 6 .   ? -14.685 -4.776  -19.695 1.00 30.93 ? 2359 HOH A O   1 
HETATM 8190 O  O   . HOH S 6 .   ? -3.961  -8.196  -15.704 1.00 32.93 ? 2360 HOH A O   1 
HETATM 8191 O  O   . HOH S 6 .   ? -9.545  -14.724 -15.547 1.00 17.92 ? 2361 HOH A O   1 
HETATM 8192 O  O   . HOH S 6 .   ? -5.740  -16.041 -12.740 1.00 22.28 ? 2362 HOH A O   1 
HETATM 8193 O  O   . HOH S 6 .   ? -9.190  -15.906 -17.898 1.00 39.53 ? 2363 HOH A O   1 
HETATM 8194 O  O   . HOH S 6 .   ? -29.253 3.259   0.099   1.00 34.93 ? 2364 HOH A O   1 
HETATM 8195 O  O   . HOH T 6 .   ? -22.996 25.615  -34.988 1.00 46.73 ? 2001 HOH B O   1 
HETATM 8196 O  O   . HOH T 6 .   ? -20.397 25.264  -35.688 1.00 48.64 ? 2002 HOH B O   1 
HETATM 8197 O  O   . HOH T 6 .   ? -24.926 22.197  -40.987 1.00 36.96 ? 2003 HOH B O   1 
HETATM 8198 O  O   . HOH T 6 .   ? -25.862 15.033  -38.676 1.00 25.40 ? 2004 HOH B O   1 
HETATM 8199 O  O   . HOH T 6 .   ? -21.982 14.680  -36.490 1.00 17.46 ? 2005 HOH B O   1 
HETATM 8200 O  O   . HOH T 6 .   ? -17.479 33.295  -37.321 1.00 40.17 ? 2006 HOH B O   1 
HETATM 8201 O  O   . HOH T 6 .   ? -13.911 30.433  -38.786 1.00 41.29 ? 2007 HOH B O   1 
HETATM 8202 O  O   . HOH T 6 .   ? -19.987 16.477  -19.322 1.00 32.47 ? 2008 HOH B O   1 
HETATM 8203 O  O   . HOH T 6 .   ? -17.854 22.908  -33.790 1.00 54.30 ? 2009 HOH B O   1 
HETATM 8204 O  O   . HOH T 6 .   ? -11.932 17.911  -21.700 1.00 46.59 ? 2010 HOH B O   1 
HETATM 8205 O  O   . HOH T 6 .   ? -8.455  19.867  -24.510 1.00 33.59 ? 2011 HOH B O   1 
HETATM 8206 O  O   . HOH T 6 .   ? -27.204 21.973  -25.669 1.00 41.39 ? 2012 HOH B O   1 
HETATM 8207 O  O   . HOH T 6 .   ? -6.290  4.328   -28.904 1.00 19.82 ? 2013 HOH B O   1 
HETATM 8208 O  O   . HOH T 6 .   ? -4.286  9.317   -37.678 1.00 40.88 ? 2014 HOH B O   1 
HETATM 8209 O  O   . HOH T 6 .   ? -0.500  6.143   -36.739 1.00 30.38 ? 2015 HOH B O   1 
HETATM 8210 O  O   . HOH T 6 .   ? -3.482  6.653   -26.942 1.00 41.22 ? 2016 HOH B O   1 
HETATM 8211 O  O   . HOH T 6 .   ? -24.858 21.578  -24.019 1.00 44.66 ? 2017 HOH B O   1 
HETATM 8212 O  O   . HOH T 6 .   ? -18.061 23.389  -21.908 1.00 43.90 ? 2018 HOH B O   1 
HETATM 8213 O  O   . HOH T 6 .   ? -5.130  -5.417  -24.749 1.00 32.41 ? 2019 HOH B O   1 
HETATM 8214 O  O   . HOH T 6 .   ? -1.085  -2.543  -25.237 1.00 41.64 ? 2020 HOH B O   1 
HETATM 8215 O  O   . HOH T 6 .   ? -20.794 16.139  -22.029 1.00 22.67 ? 2021 HOH B O   1 
HETATM 8216 O  O   . HOH T 6 .   ? -6.577  3.073   -26.384 1.00 15.89 ? 2022 HOH B O   1 
HETATM 8217 O  O   . HOH T 6 .   ? -4.519  1.809   -25.092 1.00 29.93 ? 2023 HOH B O   1 
HETATM 8218 O  O   . HOH T 6 .   ? -17.434 20.115  -30.016 1.00 27.59 ? 2024 HOH B O   1 
HETATM 8219 O  O   . HOH T 6 .   ? -14.642 17.879  -27.338 1.00 40.28 ? 2025 HOH B O   1 
HETATM 8220 O  O   . HOH T 6 .   ? -12.166 20.043  -23.848 1.00 49.41 ? 2026 HOH B O   1 
HETATM 8221 O  O   . HOH T 6 .   ? -14.544 18.544  -20.081 1.00 39.05 ? 2027 HOH B O   1 
HETATM 8222 O  O   . HOH T 6 .   ? -15.420 -14.993 -27.794 1.00 39.14 ? 2028 HOH B O   1 
HETATM 8223 O  O   . HOH T 6 .   ? -13.400 15.826  -25.470 1.00 26.30 ? 2029 HOH B O   1 
HETATM 8224 O  O   . HOH T 6 .   ? -18.859 -14.348 -30.083 1.00 29.88 ? 2030 HOH B O   1 
HETATM 8225 O  O   . HOH T 6 .   ? -25.445 -15.943 -28.846 1.00 28.26 ? 2031 HOH B O   1 
HETATM 8226 O  O   . HOH T 6 .   ? -26.792 -16.688 -26.542 1.00 26.29 ? 2032 HOH B O   1 
HETATM 8227 O  O   . HOH T 6 .   ? -17.097 14.834  -19.061 1.00 27.82 ? 2033 HOH B O   1 
HETATM 8228 O  O   . HOH T 6 .   ? -13.643 13.001  -26.068 1.00 13.06 ? 2034 HOH B O   1 
HETATM 8229 O  O   . HOH T 6 .   ? -18.040 13.034  -17.081 1.00 40.86 ? 2035 HOH B O   1 
HETATM 8230 O  O   . HOH T 6 .   ? -25.214 -14.380 -34.155 1.00 28.97 ? 2036 HOH B O   1 
HETATM 8231 O  O   . HOH T 6 .   ? -19.697 9.023   -22.451 1.00 26.91 ? 2037 HOH B O   1 
HETATM 8232 O  O   . HOH T 6 .   ? -41.042 -8.788  -38.196 1.00 54.48 ? 2038 HOH B O   1 
HETATM 8233 O  O   . HOH T 6 .   ? -43.278 -0.138  -40.440 1.00 36.51 ? 2039 HOH B O   1 
HETATM 8234 O  O   . HOH T 6 .   ? -47.608 -1.808  -50.658 1.00 44.05 ? 2040 HOH B O   1 
HETATM 8235 O  O   . HOH T 6 .   ? -43.794 -1.616  -51.810 1.00 38.50 ? 2041 HOH B O   1 
HETATM 8236 O  O   . HOH T 6 .   ? -47.648 -7.295  -42.683 1.00 41.19 ? 2042 HOH B O   1 
HETATM 8237 O  O   . HOH T 6 .   ? -45.911 2.562   -38.258 1.00 38.27 ? 2043 HOH B O   1 
HETATM 8238 O  O   . HOH T 6 .   ? -45.909 -0.201  -37.672 1.00 30.89 ? 2044 HOH B O   1 
HETATM 8239 O  O   . HOH T 6 .   ? -48.375 3.482   -39.360 1.00 42.31 ? 2045 HOH B O   1 
HETATM 8240 O  O   . HOH T 6 .   ? -43.212 9.044   -38.482 1.00 36.35 ? 2046 HOH B O   1 
HETATM 8241 O  O   . HOH T 6 .   ? -37.302 12.877  -38.728 1.00 33.02 ? 2047 HOH B O   1 
HETATM 8242 O  O   . HOH T 6 .   ? -41.155 10.760  -34.533 1.00 43.57 ? 2048 HOH B O   1 
HETATM 8243 O  O   . HOH T 6 .   ? -38.158 12.785  -36.274 1.00 38.61 ? 2049 HOH B O   1 
HETATM 8244 O  O   . HOH T 6 .   ? -12.731 9.819   -35.808 1.00 29.29 ? 2050 HOH B O   1 
HETATM 8245 O  O   . HOH T 6 .   ? -9.813  9.426   -31.216 1.00 14.78 ? 2051 HOH B O   1 
HETATM 8246 O  O   . HOH T 6 .   ? -8.270  3.662   -30.563 1.00 25.49 ? 2052 HOH B O   1 
HETATM 8247 O  O   . HOH T 6 .   ? -7.332  6.629   -30.460 1.00 44.04 ? 2053 HOH B O   1 
HETATM 8248 O  O   . HOH T 6 .   ? -6.728  9.791   -35.541 1.00 25.71 ? 2054 HOH B O   1 
HETATM 8249 O  O   . HOH T 6 .   ? -4.549  6.999   -36.401 1.00 21.00 ? 2055 HOH B O   1 
HETATM 8250 O  O   . HOH T 6 .   ? -8.566  1.093   -29.820 1.00 13.38 ? 2056 HOH B O   1 
HETATM 8251 O  O   . HOH T 6 .   ? -2.293  7.102   -34.670 1.00 28.90 ? 2057 HOH B O   1 
HETATM 8252 O  O   . HOH T 6 .   ? -3.743  5.543   -29.440 1.00 21.85 ? 2058 HOH B O   1 
HETATM 8253 O  O   . HOH T 6 .   ? -4.514  11.577  -34.707 1.00 25.31 ? 2059 HOH B O   1 
HETATM 8254 O  O   . HOH T 6 .   ? -6.096  -5.676  -29.463 1.00 22.00 ? 2060 HOH B O   1 
HETATM 8255 O  O   . HOH T 6 .   ? -44.222 -1.941  -38.848 1.00 29.54 ? 2061 HOH B O   1 
HETATM 8256 O  O   . HOH T 6 .   ? -43.634 -9.396  -32.732 1.00 49.50 ? 2062 HOH B O   1 
HETATM 8257 O  O   . HOH T 6 .   ? -3.278  -3.516  -26.590 1.00 34.75 ? 2063 HOH B O   1 
HETATM 8258 O  O   . HOH T 6 .   ? 2.352   -3.449  -34.183 1.00 12.56 ? 2064 HOH B O   1 
HETATM 8259 O  O   . HOH T 6 .   ? -0.882  -0.436  -37.297 1.00 38.98 ? 2065 HOH B O   1 
HETATM 8260 O  O   . HOH T 6 .   ? -8.482  1.209   -27.146 1.00 10.62 ? 2067 HOH B O   1 
HETATM 8261 O  O   . HOH T 6 .   ? -4.870  -0.993  -24.980 1.00 32.15 ? 2068 HOH B O   1 
HETATM 8262 O  O   . HOH T 6 .   ? -6.849  -7.940  -28.547 1.00 28.74 ? 2069 HOH B O   1 
HETATM 8263 O  O   . HOH T 6 .   ? -6.912  -7.461  -25.711 1.00 15.21 ? 2070 HOH B O   1 
HETATM 8264 O  O   . HOH T 6 .   ? -38.241 -5.250  -22.138 1.00 48.98 ? 2071 HOH B O   1 
HETATM 8265 O  O   . HOH T 6 .   ? -17.784 -16.101 -23.593 1.00 49.35 ? 2072 HOH B O   1 
HETATM 8266 O  O   . HOH T 6 .   ? -16.570 -12.288 -27.912 1.00 20.90 ? 2073 HOH B O   1 
HETATM 8267 O  O   . HOH T 6 .   ? -22.461 -8.805  -24.737 1.00 19.46 ? 2074 HOH B O   1 
HETATM 8268 O  O   . HOH T 6 .   ? -22.638 -11.770 -22.780 1.00 35.45 ? 2075 HOH B O   1 
HETATM 8269 O  O   . HOH T 6 .   ? -21.629 -9.458  -21.820 1.00 43.11 ? 2076 HOH B O   1 
HETATM 8270 O  O   . HOH T 6 .   ? -19.339 -11.866 -30.303 1.00 20.76 ? 2077 HOH B O   1 
HETATM 8271 O  O   . HOH T 6 .   ? -26.443 -9.381  -27.696 1.00 17.87 ? 2078 HOH B O   1 
HETATM 8272 O  O   . HOH T 6 .   ? -26.141 -13.302 -28.804 1.00 17.10 ? 2079 HOH B O   1 
HETATM 8273 O  O   . HOH T 6 .   ? -30.053 -14.165 -23.757 1.00 38.20 ? 2080 HOH B O   1 
HETATM 8274 O  O   . HOH T 6 .   ? -26.142 -15.493 -23.900 1.00 23.58 ? 2081 HOH B O   1 
HETATM 8275 O  O   . HOH T 6 .   ? -31.738 -10.615 -23.461 1.00 32.30 ? 2082 HOH B O   1 
HETATM 8276 O  O   . HOH T 6 .   ? -15.679 8.823   -50.572 1.00 35.32 ? 2083 HOH B O   1 
HETATM 8277 O  O   . HOH T 6 .   ? -27.544 -12.715 -33.705 1.00 18.40 ? 2084 HOH B O   1 
HETATM 8278 O  O   . HOH T 6 .   ? -31.717 -13.759 -26.348 1.00 17.53 ? 2085 HOH B O   1 
HETATM 8279 O  O   . HOH T 6 .   ? -29.343 -15.675 -26.924 1.00 19.67 ? 2086 HOH B O   1 
HETATM 8280 O  O   . HOH T 6 .   ? -9.069  0.677   -44.499 1.00 51.19 ? 2087 HOH B O   1 
HETATM 8281 O  O   . HOH T 6 .   ? -8.315  -2.719  -39.409 1.00 35.60 ? 2088 HOH B O   1 
HETATM 8282 O  O   . HOH T 6 .   ? -30.144 -11.310 -34.373 1.00 19.33 ? 2089 HOH B O   1 
HETATM 8283 O  O   . HOH T 6 .   ? -34.701 -8.929  -37.443 1.00 15.08 ? 2090 HOH B O   1 
HETATM 8284 O  O   . HOH T 6 .   ? -31.197 -10.602 -37.155 1.00 34.05 ? 2091 HOH B O   1 
HETATM 8285 O  O   . HOH T 6 .   ? -9.202  11.850  -44.796 1.00 45.48 ? 2092 HOH B O   1 
HETATM 8286 O  O   . HOH T 6 .   ? -13.071 8.132   -50.221 1.00 38.16 ? 2093 HOH B O   1 
HETATM 8287 O  O   . HOH T 6 .   ? -11.880 16.650  -39.324 1.00 40.93 ? 2094 HOH B O   1 
HETATM 8288 O  O   . HOH T 6 .   ? -39.846 -10.686 -35.240 1.00 36.00 ? 2095 HOH B O   1 
HETATM 8289 O  O   . HOH T 6 .   ? -38.085 -9.322  -38.433 1.00 17.14 ? 2096 HOH B O   1 
HETATM 8290 O  O   . HOH T 6 .   ? -41.239 -5.299  -36.499 1.00 25.30 ? 2097 HOH B O   1 
HETATM 8291 O  O   . HOH T 6 .   ? -35.080 -10.292 -44.295 1.00 28.09 ? 2098 HOH B O   1 
HETATM 8292 O  O   . HOH T 6 .   ? -38.281 -7.045  -44.818 1.00 27.06 ? 2099 HOH B O   1 
HETATM 8293 O  O   . HOH T 6 .   ? -40.650 -4.567  -47.076 1.00 23.51 ? 2100 HOH B O   1 
HETATM 8294 O  O   . HOH T 6 .   ? -39.890 -1.893  -25.045 1.00 50.43 ? 2101 HOH B O   1 
HETATM 8295 O  O   . HOH T 6 .   ? -43.530 -1.478  -42.605 1.00 22.23 ? 2102 HOH B O   1 
HETATM 8296 O  O   . HOH T 6 .   ? -47.223 -4.968  -46.332 1.00 27.33 ? 2103 HOH B O   1 
HETATM 8297 O  O   . HOH T 6 .   ? -45.299 -0.341  -49.767 1.00 35.89 ? 2104 HOH B O   1 
HETATM 8298 O  O   . HOH T 6 .   ? -47.822 -4.394  -41.563 1.00 47.10 ? 2105 HOH B O   1 
HETATM 8299 O  O   . HOH T 6 .   ? -48.439 3.421   -44.722 1.00 39.07 ? 2106 HOH B O   1 
HETATM 8300 O  O   . HOH T 6 .   ? -43.858 2.723   -40.207 1.00 31.18 ? 2107 HOH B O   1 
HETATM 8301 O  O   . HOH T 6 .   ? -45.100 6.740   -41.300 1.00 41.82 ? 2108 HOH B O   1 
HETATM 8302 O  O   . HOH T 6 .   ? -47.696 6.788   -45.500 1.00 41.92 ? 2109 HOH B O   1 
HETATM 8303 O  O   . HOH T 6 .   ? -42.528 6.889   -39.915 1.00 27.30 ? 2110 HOH B O   1 
HETATM 8304 O  O   . HOH T 6 .   ? -37.608 10.786  -40.394 1.00 23.32 ? 2111 HOH B O   1 
HETATM 8305 O  O   . HOH T 6 .   ? -40.961 10.756  -37.459 1.00 31.84 ? 2112 HOH B O   1 
HETATM 8306 O  O   . HOH T 6 .   ? -41.520 17.847  -37.591 1.00 52.41 ? 2113 HOH B O   1 
HETATM 8307 O  O   . HOH T 6 .   ? -36.468 17.180  -38.228 1.00 48.63 ? 2114 HOH B O   1 
HETATM 8308 O  O   . HOH T 6 .   ? -35.546 20.848  -41.010 1.00 48.95 ? 2115 HOH B O   1 
HETATM 8309 O  O   . HOH T 6 .   ? -13.783 5.015   -52.068 1.00 38.80 ? 2116 HOH B O   1 
HETATM 8310 O  O   . HOH T 6 .   ? -30.459 -2.175  -56.895 1.00 31.09 ? 2117 HOH B O   1 
HETATM 8311 O  O   . HOH T 6 .   ? -26.201 -7.317  -49.812 1.00 36.98 ? 2118 HOH B O   1 
HETATM 8312 O  O   . HOH T 6 .   ? -24.622 -6.282  -47.739 1.00 29.88 ? 2119 HOH B O   1 
HETATM 8313 O  O   . HOH T 6 .   ? -31.065 17.562  -37.422 1.00 55.89 ? 2120 HOH B O   1 
HETATM 8314 O  O   . HOH T 6 .   ? -34.943 14.335  -38.521 1.00 29.25 ? 2121 HOH B O   1 
HETATM 8315 O  O   . HOH T 6 .   ? -37.855 1.117   -53.309 1.00 46.06 ? 2122 HOH B O   1 
HETATM 8316 O  O   . HOH T 6 .   ? -25.630 20.045  -42.597 1.00 32.19 ? 2123 HOH B O   1 
HETATM 8317 O  O   . HOH T 6 .   ? -41.871 18.647  -50.288 1.00 42.77 ? 2124 HOH B O   1 
HETATM 8318 O  O   . HOH T 6 .   ? -37.239 9.864   -36.610 1.00 23.32 ? 2125 HOH B O   1 
HETATM 8319 O  O   . HOH T 6 .   ? -34.155 12.330  -33.702 1.00 37.87 ? 2126 HOH B O   1 
HETATM 8320 O  O   . HOH T 6 .   ? -44.677 16.441  -46.224 1.00 56.17 ? 2127 HOH B O   1 
HETATM 8321 O  O   . HOH T 6 .   ? -45.164 13.051  -46.517 1.00 39.40 ? 2128 HOH B O   1 
HETATM 8322 O  O   . HOH T 6 .   ? -41.934 4.555   -39.041 1.00 24.98 ? 2129 HOH B O   1 
HETATM 8323 O  O   . HOH T 6 .   ? -42.923 5.024   -36.462 1.00 40.89 ? 2130 HOH B O   1 
HETATM 8324 O  O   . HOH T 6 .   ? -41.917 5.798   -34.301 1.00 44.50 ? 2131 HOH B O   1 
HETATM 8325 O  O   . HOH T 6 .   ? -39.403 3.693   -32.964 1.00 28.92 ? 2132 HOH B O   1 
HETATM 8326 O  O   . HOH T 6 .   ? -39.063 6.608   -33.439 1.00 34.67 ? 2133 HOH B O   1 
HETATM 8327 O  O   . HOH T 6 .   ? -38.630 0.019   -32.532 1.00 15.80 ? 2134 HOH B O   1 
HETATM 8328 O  O   . HOH T 6 .   ? -42.804 -3.023  -36.572 1.00 41.79 ? 2135 HOH B O   1 
HETATM 8329 O  O   . HOH T 6 .   ? -21.887 -8.199  -46.301 1.00 35.97 ? 2136 HOH B O   1 
HETATM 8330 O  O   . HOH T 6 .   ? -40.666 -0.773  -29.875 1.00 38.22 ? 2137 HOH B O   1 
HETATM 8331 O  O   . HOH T 6 .   ? -42.169 -6.647  -34.296 1.00 45.32 ? 2138 HOH B O   1 
HETATM 8332 O  O   . HOH T 6 .   ? -17.951 -8.656  -44.915 1.00 28.51 ? 2139 HOH B O   1 
HETATM 8333 O  O   . HOH T 6 .   ? -41.205 -5.130  -26.363 1.00 43.57 ? 2140 HOH B O   1 
HETATM 8334 O  O   . HOH T 6 .   ? -11.996 -14.904 -34.237 1.00 40.54 ? 2141 HOH B O   1 
HETATM 8335 O  O   . HOH T 6 .   ? -18.004 0.169   -23.473 1.00 32.55 ? 2142 HOH B O   1 
HETATM 8336 O  O   . HOH T 6 .   ? -22.481 -5.877  -26.882 1.00 11.31 ? 2143 HOH B O   1 
HETATM 8337 O  O   . HOH T 6 .   ? -29.160 -7.733  -17.309 1.00 36.73 ? 2144 HOH B O   1 
HETATM 8338 O  O   . HOH T 6 .   ? -26.792 -8.945  -17.916 1.00 24.95 ? 2145 HOH B O   1 
HETATM 8339 O  O   . HOH T 6 .   ? -33.306 -3.943  -20.951 1.00 31.35 ? 2146 HOH B O   1 
HETATM 8340 O  O   . HOH T 6 .   ? -26.583 -1.295  -21.459 1.00 19.78 ? 2147 HOH B O   1 
HETATM 8341 O  O   . HOH T 6 .   ? -23.771 -7.903  -21.295 1.00 33.17 ? 2148 HOH B O   1 
HETATM 8342 O  O   . HOH T 6 .   ? -21.629 -5.189  -24.173 1.00 18.03 ? 2149 HOH B O   1 
HETATM 8343 O  O   . HOH T 6 .   ? -21.235 -3.837  -20.247 1.00 39.71 ? 2150 HOH B O   1 
HETATM 8344 O  O   . HOH T 6 .   ? -21.732 -2.173  -23.096 1.00 33.71 ? 2151 HOH B O   1 
HETATM 8345 O  O   . HOH T 6 .   ? -31.246 -1.446  -21.555 1.00 14.16 ? 2152 HOH B O   1 
HETATM 8346 O  O   . HOH T 6 .   ? -37.346 -7.706  -22.303 1.00 12.73 ? 2153 HOH B O   1 
HETATM 8347 O  O   . HOH T 6 .   ? -36.795 -5.558  -25.857 1.00 32.81 ? 2154 HOH B O   1 
HETATM 8348 O  O   . HOH T 6 .   ? -35.852 -11.023 -23.259 1.00 14.67 ? 2155 HOH B O   1 
HETATM 8349 O  O   . HOH T 6 .   ? -11.334 -1.498  -40.850 1.00 42.85 ? 2156 HOH B O   1 
HETATM 8350 O  O   . HOH T 6 .   ? -38.824 2.483   -23.924 1.00 36.38 ? 2157 HOH B O   1 
HETATM 8351 O  O   . HOH T 6 .   ? -37.027 1.677   -25.411 1.00 29.83 ? 2158 HOH B O   1 
HETATM 8352 O  O   . HOH T 6 .   ? -39.929 1.963   -30.772 1.00 46.88 ? 2159 HOH B O   1 
HETATM 8353 O  O   . HOH T 6 .   ? -39.977 7.145   -27.703 1.00 47.16 ? 2160 HOH B O   1 
HETATM 8354 O  O   . HOH T 6 .   ? -20.271 4.789   -61.562 1.00 41.94 ? 2161 HOH B O   1 
HETATM 8355 O  O   . HOH T 6 .   ? -37.910 8.901   -34.189 1.00 38.61 ? 2162 HOH B O   1 
HETATM 8356 O  O   . HOH T 6 .   ? -29.855 15.338  -58.320 1.00 52.69 ? 2163 HOH B O   1 
HETATM 8357 O  O   . HOH T 6 .   ? -32.891 15.437  -57.146 1.00 42.22 ? 2164 HOH B O   1 
HETATM 8358 O  O   . HOH T 6 .   ? -14.102 18.127  -39.224 1.00 49.97 ? 2165 HOH B O   1 
HETATM 8359 O  O   . HOH T 6 .   ? -13.502 20.485  -35.445 1.00 49.76 ? 2166 HOH B O   1 
HETATM 8360 O  O   . HOH T 6 .   ? -19.145 10.236  -49.008 1.00 25.43 ? 2167 HOH B O   1 
HETATM 8361 O  O   . HOH T 6 .   ? -17.778 10.652  -51.098 1.00 38.48 ? 2168 HOH B O   1 
HETATM 8362 O  O   . HOH T 6 .   ? -4.480  7.632   -22.646 1.00 27.13 ? 2169 HOH B O   1 
HETATM 8363 O  O   . HOH T 6 .   ? -8.605  17.083  -24.883 1.00 16.70 ? 2170 HOH B O   1 
HETATM 8364 O  O   . HOH T 6 .   ? -5.774  4.155   -22.175 1.00 26.38 ? 2171 HOH B O   1 
HETATM 8365 O  O   . HOH T 6 .   ? -9.752  13.207  -49.688 1.00 49.38 ? 2172 HOH B O   1 
HETATM 8366 O  O   . HOH T 6 .   ? -13.038 14.135  -45.925 1.00 23.90 ? 2173 HOH B O   1 
HETATM 8367 O  O   . HOH T 6 .   ? -14.252 12.116  -37.537 1.00 18.74 ? 2174 HOH B O   1 
HETATM 8368 O  O   . HOH T 6 .   ? -9.206  10.130  -37.042 1.00 27.62 ? 2175 HOH B O   1 
HETATM 8369 O  O   . HOH T 6 .   ? -7.811  1.362   -41.761 1.00 39.08 ? 2176 HOH B O   1 
HETATM 8370 O  O   . HOH T 6 .   ? -2.886  4.952   -37.225 1.00 27.68 ? 2177 HOH B O   1 
HETATM 8371 O  O   . HOH T 6 .   ? -6.695  -0.636  -40.447 1.00 42.49 ? 2178 HOH B O   1 
HETATM 8372 O  O   . HOH T 6 .   ? -3.140  1.058   -41.183 1.00 48.49 ? 2179 HOH B O   1 
HETATM 8373 O  O   . HOH T 6 .   ? -8.082  10.977  -40.003 1.00 39.25 ? 2180 HOH B O   1 
HETATM 8374 O  O   . HOH T 6 .   ? -12.825 2.910   -47.265 1.00 22.15 ? 2181 HOH B O   1 
HETATM 8375 O  O   . HOH T 6 .   ? -5.972  5.916   -47.445 1.00 50.77 ? 2182 HOH B O   1 
HETATM 8376 O  O   . HOH T 6 .   ? -5.454  6.240   -44.813 1.00 44.38 ? 2183 HOH B O   1 
HETATM 8377 O  O   . HOH T 6 .   ? -8.842  8.600   -44.810 1.00 24.11 ? 2184 HOH B O   1 
HETATM 8378 O  O   . HOH T 6 .   ? -12.036 6.639   -48.013 1.00 28.14 ? 2185 HOH B O   1 
HETATM 8379 O  O   . HOH T 6 .   ? -9.572  8.281   -47.585 1.00 46.88 ? 2186 HOH B O   1 
HETATM 8380 O  O   . HOH T 6 .   ? -11.078 14.907  -37.396 1.00 35.63 ? 2187 HOH B O   1 
HETATM 8381 O  O   . HOH T 6 .   ? -40.015 0.234   -22.444 1.00 41.38 ? 2188 HOH B O   1 
HETATM 8382 O  O   . HOH T 6 .   ? -35.986 -2.696  -18.842 1.00 50.38 ? 2189 HOH B O   1 
HETATM 8383 O  O   . HOH T 6 .   ? -38.901 13.083  -19.242 1.00 43.62 ? 2190 HOH B O   1 
HETATM 8384 O  O   . HOH T 6 .   ? -40.664 11.238  -25.748 1.00 41.79 ? 2191 HOH B O   1 
HETATM 8385 O  O   . HOH T 6 .   ? -40.850 16.945  -25.433 1.00 33.79 ? 2192 HOH B O   1 
HETATM 8386 O  O   . HOH T 6 .   ? -43.551 8.901   -20.696 1.00 45.26 ? 2193 HOH B O   1 
HETATM 8387 O  O   . HOH T 6 .   ? -38.847 9.468   -26.601 1.00 27.26 ? 2194 HOH B O   1 
HETATM 8388 O  O   . HOH T 6 .   ? -38.006 12.441  -25.246 1.00 23.23 ? 2195 HOH B O   1 
HETATM 8389 O  O   . HOH T 6 .   ? -32.642 15.499  -21.288 1.00 28.56 ? 2196 HOH B O   1 
HETATM 8390 O  O   . HOH T 6 .   ? -38.133 16.470  -24.438 1.00 30.52 ? 2197 HOH B O   1 
HETATM 8391 O  O   . HOH T 6 .   ? -41.749 11.928  -18.026 1.00 40.11 ? 2198 HOH B O   1 
HETATM 8392 O  O   . HOH T 6 .   ? -27.544 7.795   -22.951 1.00 13.36 ? 2199 HOH B O   1 
HETATM 8393 O  O   . HOH T 6 .   ? -27.047 10.313  -23.848 1.00 15.15 ? 2200 HOH B O   1 
HETATM 8394 O  O   . HOH T 6 .   ? -23.137 9.301   -18.443 1.00 43.82 ? 2201 HOH B O   1 
HETATM 8395 O  O   . HOH T 6 .   ? -23.752 12.577  -18.753 1.00 43.16 ? 2202 HOH B O   1 
HETATM 8396 O  O   . HOH T 6 .   ? -35.281 11.482  -15.620 1.00 33.02 ? 2203 HOH B O   1 
HETATM 8397 O  O   . HOH T 6 .   ? -22.944 2.227   -19.563 1.00 40.93 ? 2204 HOH B O   1 
HETATM 8398 O  O   . HOH T 6 .   ? -24.378 0.220   -29.313 1.00 14.36 ? 2205 HOH B O   1 
HETATM 8399 O  O   . HOH T 6 .   ? -18.498 -1.101  -40.079 1.00 11.55 ? 2206 HOH B O   1 
HETATM 8400 O  O   . HOH T 6 .   ? -12.871 -3.402  -45.610 1.00 48.07 ? 2207 HOH B O   1 
HETATM 8401 O  O   . HOH T 6 .   ? -14.102 2.719   -50.283 1.00 22.19 ? 2208 HOH B O   1 
HETATM 8402 O  O   . HOH T 6 .   ? -14.523 -2.759  -52.835 1.00 40.11 ? 2209 HOH B O   1 
HETATM 8403 O  O   . HOH T 6 .   ? -13.417 0.324   -51.251 1.00 39.89 ? 2210 HOH B O   1 
HETATM 8404 O  O   . HOH T 6 .   ? -15.696 6.796   -52.586 1.00 47.19 ? 2211 HOH B O   1 
HETATM 8405 O  O   . HOH T 6 .   ? -15.944 1.199   -58.479 1.00 47.45 ? 2212 HOH B O   1 
HETATM 8406 O  O   . HOH T 6 .   ? -18.657 1.040   -58.023 1.00 28.95 ? 2213 HOH B O   1 
HETATM 8407 O  O   . HOH T 6 .   ? -15.368 -0.978  -56.837 1.00 44.68 ? 2214 HOH B O   1 
HETATM 8408 O  O   . HOH T 6 .   ? -20.087 -4.072  -54.240 1.00 29.64 ? 2215 HOH B O   1 
HETATM 8409 O  O   . HOH T 6 .   ? -18.593 -2.475  -61.334 1.00 44.71 ? 2216 HOH B O   1 
HETATM 8410 O  O   . HOH T 6 .   ? -21.244 -5.486  -60.607 1.00 50.18 ? 2217 HOH B O   1 
HETATM 8411 O  O   . HOH T 6 .   ? -22.666 -3.381  -53.183 1.00 24.35 ? 2218 HOH B O   1 
HETATM 8412 O  O   . HOH T 6 .   ? -24.876 -6.644  -58.852 1.00 48.32 ? 2219 HOH B O   1 
HETATM 8413 O  O   . HOH T 6 .   ? -21.315 -11.044 -55.570 1.00 36.78 ? 2220 HOH B O   1 
HETATM 8414 O  O   . HOH T 6 .   ? -24.634 -3.775  -59.632 1.00 43.61 ? 2221 HOH B O   1 
HETATM 8415 O  O   . HOH T 6 .   ? -28.972 -4.260  -56.260 1.00 39.35 ? 2222 HOH B O   1 
HETATM 8416 O  O   . HOH T 6 .   ? -27.602 3.590   -58.224 1.00 44.09 ? 2223 HOH B O   1 
HETATM 8417 O  O   . HOH T 6 .   ? -29.309 -0.065  -58.271 1.00 42.19 ? 2224 HOH B O   1 
HETATM 8418 O  O   . HOH T 6 .   ? -23.108 1.197   -60.749 1.00 41.98 ? 2225 HOH B O   1 
HETATM 8419 O  O   . HOH T 6 .   ? -28.164 -5.126  -49.838 1.00 30.64 ? 2226 HOH B O   1 
HETATM 8420 O  O   . HOH T 6 .   ? -26.279 -3.979  -47.545 1.00 26.21 ? 2227 HOH B O   1 
HETATM 8421 O  O   . HOH T 6 .   ? -26.810 -5.822  -52.304 1.00 34.81 ? 2228 HOH B O   1 
HETATM 8422 O  O   . HOH T 6 .   ? -29.720 -7.868  -53.197 1.00 33.96 ? 2229 HOH B O   1 
HETATM 8423 O  O   . HOH T 6 .   ? -31.692 -7.075  -55.881 1.00 28.56 ? 2230 HOH B O   1 
HETATM 8424 O  O   . HOH T 6 .   ? -30.429 5.930   -56.206 1.00 45.38 ? 2231 HOH B O   1 
HETATM 8425 O  O   . HOH T 6 .   ? -37.906 3.261   -51.217 1.00 27.17 ? 2232 HOH B O   1 
HETATM 8426 O  O   . HOH T 6 .   ? -33.473 -3.632  -47.098 1.00 17.62 ? 2233 HOH B O   1 
HETATM 8427 O  O   . HOH T 6 .   ? -36.521 -4.598  -47.935 1.00 19.09 ? 2234 HOH B O   1 
HETATM 8428 O  O   . HOH T 6 .   ? -38.652 -1.142  -49.846 1.00 19.39 ? 2235 HOH B O   1 
HETATM 8429 O  O   . HOH T 6 .   ? -32.543 9.990   -55.411 1.00 23.29 ? 2236 HOH B O   1 
HETATM 8430 O  O   . HOH T 6 .   ? -33.913 8.921   -57.983 1.00 45.17 ? 2237 HOH B O   1 
HETATM 8431 O  O   . HOH T 6 .   ? -35.679 6.999   -58.402 1.00 49.81 ? 2238 HOH B O   1 
HETATM 8432 O  O   . HOH T 6 .   ? -36.327 10.666  -55.279 1.00 47.18 ? 2239 HOH B O   1 
HETATM 8433 O  O   . HOH T 6 .   ? -37.599 4.614   -56.167 1.00 46.26 ? 2240 HOH B O   1 
HETATM 8434 O  O   . HOH T 6 .   ? -40.970 15.879  -50.520 1.00 50.04 ? 2241 HOH B O   1 
HETATM 8435 O  O   . HOH T 6 .   ? -37.365 18.875  -51.542 1.00 46.67 ? 2242 HOH B O   1 
HETATM 8436 O  O   . HOH T 6 .   ? -32.542 23.217  -49.285 1.00 47.76 ? 2243 HOH B O   1 
HETATM 8437 O  O   . HOH T 6 .   ? -39.053 21.841  -47.054 1.00 53.20 ? 2244 HOH B O   1 
HETATM 8438 O  O   . HOH T 6 .   ? -42.131 17.601  -47.470 1.00 32.06 ? 2245 HOH B O   1 
HETATM 8439 O  O   . HOH T 6 .   ? -44.465 8.799   -51.192 1.00 36.70 ? 2246 HOH B O   1 
HETATM 8440 O  O   . HOH T 6 .   ? -45.364 11.378  -48.703 1.00 43.31 ? 2247 HOH B O   1 
HETATM 8441 O  O   . HOH T 6 .   ? -44.961 10.307  -41.278 1.00 44.94 ? 2248 HOH B O   1 
HETATM 8442 O  O   . HOH T 6 .   ? -38.269 1.508   -49.318 1.00 21.55 ? 2249 HOH B O   1 
HETATM 8443 O  O   . HOH T 6 .   ? -36.863 -9.179  -46.131 1.00 36.20 ? 2250 HOH B O   1 
HETATM 8444 O  O   . HOH T 6 .   ? -32.841 -9.903  -39.531 1.00 21.42 ? 2251 HOH B O   1 
HETATM 8445 O  O   . HOH T 6 .   ? -24.351 -7.349  -45.211 1.00 19.05 ? 2252 HOH B O   1 
HETATM 8446 O  O   . HOH T 6 .   ? -20.253 -7.222  -44.250 1.00 16.50 ? 2253 HOH B O   1 
HETATM 8447 O  O   . HOH T 6 .   ? -23.922 -12.539 -38.208 1.00 21.40 ? 2254 HOH B O   1 
HETATM 8448 O  O   . HOH T 6 .   ? -20.943 -13.657 -41.175 1.00 39.32 ? 2255 HOH B O   1 
HETATM 8449 O  O   . HOH T 6 .   ? -18.516 -12.866 -42.197 1.00 33.16 ? 2256 HOH B O   1 
HETATM 8450 O  O   . HOH T 6 .   ? -18.695 -6.933  -38.419 1.00 12.38 ? 2257 HOH B O   1 
HETATM 8451 O  O   . HOH T 6 .   ? -22.360 -14.366 -37.916 1.00 34.56 ? 2258 HOH B O   1 
HETATM 8452 O  O   . HOH T 6 .   ? -16.956 -14.873 -36.563 1.00 41.15 ? 2259 HOH B O   1 
HETATM 8453 O  O   . HOH T 6 .   ? -16.820 -13.616 -40.105 1.00 30.80 ? 2260 HOH B O   1 
HETATM 8454 O  O   . HOH T 6 .   ? -22.850 -14.015 -34.974 1.00 28.19 ? 2261 HOH B O   1 
HETATM 8455 O  O   . HOH T 6 .   ? -16.395 -13.592 -33.637 1.00 34.26 ? 2262 HOH B O   1 
HETATM 8456 O  O   . HOH T 6 .   ? -19.868 -16.103 -32.080 1.00 31.67 ? 2263 HOH B O   1 
HETATM 8457 O  O   . HOH T 6 .   ? -13.912 -10.060 -40.827 1.00 28.96 ? 2264 HOH B O   1 
HETATM 8458 O  O   . HOH T 6 .   ? -13.843 -12.772 -40.089 1.00 49.86 ? 2265 HOH B O   1 
HETATM 8459 O  O   . HOH T 6 .   ? -14.523 -13.730 -35.383 1.00 33.15 ? 2266 HOH B O   1 
HETATM 8460 O  O   . HOH T 6 .   ? -10.293 -12.701 -34.682 1.00 35.25 ? 2267 HOH B O   1 
HETATM 8461 O  O   . HOH T 6 .   ? -10.618 -7.537  -38.348 1.00 36.17 ? 2268 HOH B O   1 
HETATM 8462 O  O   . HOH T 6 .   ? -9.371  -10.307 -37.077 1.00 41.71 ? 2269 HOH B O   1 
HETATM 8463 O  O   . HOH T 6 .   ? -18.162 -2.550  -23.933 1.00 31.47 ? 2270 HOH B O   1 
HETATM 8464 O  O   . HOH T 6 .   ? -15.569 3.461   -23.176 1.00 20.29 ? 2271 HOH B O   1 
HETATM 8465 O  O   . HOH T 6 .   ? -20.387 0.457   -22.163 1.00 42.59 ? 2272 HOH B O   1 
HETATM 8466 O  O   . HOH T 6 .   ? -28.316 15.636  -34.835 1.00 37.95 ? 2273 HOH B O   1 
HETATM 8467 O  O   . HOH T 6 .   ? -29.883 16.391  -31.418 1.00 45.42 ? 2274 HOH B O   1 
HETATM 8468 O  O   . HOH T 6 .   ? -26.515 17.839  -23.451 1.00 33.56 ? 2275 HOH B O   1 
HETATM 8469 O  O   . HOH T 6 .   ? -24.223 14.343  -21.030 1.00 25.33 ? 2276 HOH B O   1 
HETATM 8470 O  O   . HOH T 6 .   ? -21.071 11.675  -18.626 1.00 29.91 ? 2277 HOH B O   1 
HETATM 8471 O  O   . HOH T 6 .   ? -12.935 -2.095  -39.214 1.00 30.62 ? 2278 HOH B O   1 
HETATM 8472 O  O   . HOH T 6 .   ? -12.745 -3.102  -41.979 1.00 41.86 ? 2279 HOH B O   1 
HETATM 8473 O  O   . HOH T 6 .   ? -9.853  -5.373  -36.651 1.00 43.56 ? 2280 HOH B O   1 
HETATM 8474 O  O   . HOH T 6 .   ? -10.687 -3.231  -38.108 1.00 42.20 ? 2281 HOH B O   1 
HETATM 8475 O  O   . HOH T 6 .   ? -18.243 -11.993 -44.601 1.00 49.29 ? 2282 HOH B O   1 
HETATM 8476 O  O   . HOH T 6 .   ? -15.531 -5.573  -44.420 1.00 34.57 ? 2283 HOH B O   1 
HETATM 8477 O  O   . HOH T 6 .   ? -17.446 -5.121  -47.132 1.00 35.37 ? 2284 HOH B O   1 
HETATM 8478 O  O   . HOH T 6 .   ? -22.188 -5.110  -48.732 1.00 30.00 ? 2285 HOH B O   1 
HETATM 8479 O  O   . HOH T 6 .   ? -21.124 2.849   -59.849 1.00 34.76 ? 2286 HOH B O   1 
HETATM 8480 O  O   . HOH T 6 .   ? -18.770 8.301   -55.834 1.00 44.54 ? 2287 HOH B O   1 
HETATM 8481 O  O   . HOH T 6 .   ? -25.109 9.164   -58.884 1.00 41.09 ? 2288 HOH B O   1 
HETATM 8482 O  O   . HOH T 6 .   ? -23.880 15.478  -60.787 1.00 48.58 ? 2289 HOH B O   1 
HETATM 8483 O  O   . HOH T 6 .   ? -27.822 5.947   -56.822 1.00 36.39 ? 2290 HOH B O   1 
HETATM 8484 O  O   . HOH T 6 .   ? -26.532 14.992  -50.354 1.00 25.96 ? 2291 HOH B O   1 
HETATM 8485 O  O   . HOH T 6 .   ? -25.199 17.694  -52.001 1.00 33.02 ? 2292 HOH B O   1 
HETATM 8486 O  O   . HOH T 6 .   ? -28.329 18.774  -56.014 1.00 53.63 ? 2293 HOH B O   1 
HETATM 8487 O  O   . HOH T 6 .   ? -21.902 17.852  -58.078 1.00 49.07 ? 2294 HOH B O   1 
HETATM 8488 O  O   . HOH T 6 .   ? -30.755 17.336  -55.786 1.00 29.66 ? 2295 HOH B O   1 
HETATM 8489 O  O   . HOH T 6 .   ? -23.589 20.014  -44.527 1.00 40.65 ? 2296 HOH B O   1 
HETATM 8490 O  O   . HOH T 6 .   ? -16.430 18.025  -41.043 1.00 48.12 ? 2297 HOH B O   1 
HETATM 8491 O  O   . HOH T 6 .   ? -16.528 18.938  -32.601 1.00 26.92 ? 2298 HOH B O   1 
HETATM 8492 O  O   . HOH T 6 .   ? -16.293 18.864  -35.605 1.00 26.66 ? 2299 HOH B O   1 
HETATM 8493 O  O   . HOH T 6 .   ? -9.353  15.192  -34.724 1.00 43.66 ? 2300 HOH B O   1 
HETATM 8494 O  O   . HOH T 6 .   ? -13.840 18.952  -32.050 1.00 39.90 ? 2301 HOH B O   1 
HETATM 8495 O  O   . HOH T 6 .   ? -8.910  17.412  -27.951 1.00 38.65 ? 2302 HOH B O   1 
HETATM 8496 O  O   . HOH T 6 .   ? -8.055  9.014   -28.954 1.00 25.01 ? 2303 HOH B O   1 
HETATM 8497 O  O   . HOH T 6 .   ? -7.143  10.561  -25.803 1.00 24.24 ? 2304 HOH B O   1 
HETATM 8498 O  O   . HOH T 6 .   ? -6.782  7.670   -24.315 1.00 26.89 ? 2305 HOH B O   1 
HETATM 8499 O  O   . HOH T 6 .   ? -7.310  15.100  -23.485 1.00 17.38 ? 2306 HOH B O   1 
HETATM 8500 O  O   . HOH T 6 .   ? -9.977  15.528  -20.312 1.00 40.45 ? 2307 HOH B O   1 
HETATM 8501 O  O   . HOH T 6 .   ? -11.154 16.474  -23.946 1.00 21.34 ? 2308 HOH B O   1 
HETATM 8502 O  O   . HOH T 6 .   ? -8.702  2.956   -19.045 1.00 19.32 ? 2309 HOH B O   1 
HETATM 8503 O  O   . HOH T 6 .   ? -7.264  4.742   -24.371 1.00 15.45 ? 2310 HOH B O   1 
HETATM 8504 O  O   . HOH T 6 .   ? -12.743 2.388   -20.909 1.00 17.29 ? 2311 HOH B O   1 
HETATM 8505 O  O   . HOH T 6 .   ? -14.768 0.810   -22.926 1.00 36.57 ? 2312 HOH B O   1 
HETATM 8506 O  O   . HOH T 6 .   ? -9.119  -7.594  -30.221 1.00 23.82 ? 2313 HOH B O   1 
HETATM 8507 O  O   . HOH T 6 .   ? -5.436  -12.055 -32.845 1.00 33.79 ? 2314 HOH B O   1 
HETATM 8508 O  O   . HOH T 6 .   ? -6.346  -10.691 -28.653 1.00 24.25 ? 2315 HOH B O   1 
HETATM 8509 O  O   . HOH T 6 .   ? -7.703  -8.023  -32.212 1.00 27.60 ? 2316 HOH B O   1 
HETATM 8510 O  O   . HOH T 6 .   ? -35.452 10.018  -32.169 1.00 40.92 ? 2317 HOH B O   1 
HETATM 8511 O  O   . HOH U 6 .   ? -60.686 -37.704 -25.029 1.00 33.92 ? 2001 HOH C O   1 
HETATM 8512 O  O   . HOH U 6 .   ? -59.446 -33.633 -19.787 1.00 44.67 ? 2002 HOH C O   1 
HETATM 8513 O  O   . HOH U 6 .   ? -53.360 -29.686 -21.993 1.00 31.30 ? 2003 HOH C O   1 
HETATM 8514 O  O   . HOH U 6 .   ? -51.347 -33.115 -24.285 1.00 23.94 ? 2004 HOH C O   1 
HETATM 8515 O  O   . HOH U 6 .   ? -54.978 -39.200 -21.824 1.00 45.87 ? 2005 HOH C O   1 
HETATM 8516 O  O   . HOH U 6 .   ? -53.801 -38.966 -18.867 1.00 48.06 ? 2006 HOH C O   1 
HETATM 8517 O  O   . HOH U 6 .   ? -58.972 -40.954 -25.305 1.00 46.57 ? 2007 HOH C O   1 
HETATM 8518 O  O   . HOH U 6 .   ? -57.108 -40.709 -27.369 1.00 38.16 ? 2008 HOH C O   1 
HETATM 8519 O  O   . HOH U 6 .   ? -60.615 -43.562 -35.307 1.00 38.95 ? 2009 HOH C O   1 
HETATM 8520 O  O   . HOH U 6 .   ? -59.852 -43.789 -32.585 1.00 51.30 ? 2010 HOH C O   1 
HETATM 8521 O  O   . HOH U 6 .   ? -65.062 -33.709 -33.316 1.00 48.32 ? 2011 HOH C O   1 
HETATM 8522 O  O   . HOH U 6 .   ? -59.862 -31.037 -35.599 1.00 43.02 ? 2012 HOH C O   1 
HETATM 8523 O  O   . HOH U 6 .   ? -58.860 -33.398 -37.702 1.00 24.90 ? 2013 HOH C O   1 
HETATM 8524 O  O   . HOH U 6 .   ? -57.112 -39.965 -39.669 1.00 33.40 ? 2014 HOH C O   1 
HETATM 8525 O  O   . HOH U 6 .   ? -52.096 -34.502 -38.800 1.00 26.69 ? 2015 HOH C O   1 
HETATM 8526 O  O   . HOH U 6 .   ? -34.294 -41.433 -34.288 1.00 42.22 ? 2016 HOH C O   1 
HETATM 8527 O  O   . HOH U 6 .   ? -54.187 -39.427 -30.625 1.00 31.52 ? 2017 HOH C O   1 
HETATM 8528 O  O   . HOH U 6 .   ? -50.763 -40.605 -33.620 1.00 37.64 ? 2018 HOH C O   1 
HETATM 8529 O  O   . HOH U 6 .   ? -50.485 -43.154 -37.939 1.00 51.22 ? 2019 HOH C O   1 
HETATM 8530 O  O   . HOH U 6 .   ? -30.072 -24.051 -39.941 1.00 47.50 ? 2020 HOH C O   1 
HETATM 8531 O  O   . HOH U 6 .   ? -48.522 -41.072 -35.004 1.00 31.65 ? 2021 HOH C O   1 
HETATM 8532 O  O   . HOH U 6 .   ? -49.230 -37.098 -41.702 1.00 26.43 ? 2022 HOH C O   1 
HETATM 8533 O  O   . HOH U 6 .   ? -46.032 -39.561 -34.702 1.00 20.63 ? 2023 HOH C O   1 
HETATM 8534 O  O   . HOH U 6 .   ? -41.417 -41.594 -42.722 1.00 40.98 ? 2024 HOH C O   1 
HETATM 8535 O  O   . HOH U 6 .   ? -28.101 -17.108 -34.985 1.00 35.44 ? 2025 HOH C O   1 
HETATM 8536 O  O   . HOH U 6 .   ? -25.385 -16.070 -31.430 1.00 29.82 ? 2026 HOH C O   1 
HETATM 8537 O  O   . HOH U 6 .   ? -45.102 -32.203 -38.552 1.00 37.09 ? 2027 HOH C O   1 
HETATM 8538 O  O   . HOH U 6 .   ? -46.729 -6.018  -9.207  1.00 44.04 ? 2028 HOH C O   1 
HETATM 8539 O  O   . HOH U 6 .   ? -43.672 0.055   -19.020 1.00 44.28 ? 2029 HOH C O   1 
HETATM 8540 O  O   . HOH U 6 .   ? -46.245 -5.430  -22.031 1.00 36.15 ? 2030 HOH C O   1 
HETATM 8541 O  O   . HOH U 6 .   ? -48.831 -5.046  -23.208 1.00 40.11 ? 2031 HOH C O   1 
HETATM 8542 O  O   . HOH U 6 .   ? -55.792 -11.111 -22.718 1.00 39.47 ? 2032 HOH C O   1 
HETATM 8543 O  O   . HOH U 6 .   ? -56.741 -18.372 -22.013 1.00 33.49 ? 2033 HOH C O   1 
HETATM 8544 O  O   . HOH U 6 .   ? -56.358 -14.149 -26.257 1.00 42.64 ? 2034 HOH C O   1 
HETATM 8545 O  O   . HOH U 6 .   ? -41.140 -41.289 -29.456 1.00 25.24 ? 2035 HOH C O   1 
HETATM 8546 O  O   . HOH U 6 .   ? -38.251 -42.060 -30.063 1.00 40.50 ? 2036 HOH C O   1 
HETATM 8547 O  O   . HOH U 6 .   ? -35.604 -40.503 -29.935 1.00 42.61 ? 2037 HOH C O   1 
HETATM 8548 O  O   . HOH U 6 .   ? -40.038 -44.270 -24.268 1.00 46.80 ? 2038 HOH C O   1 
HETATM 8549 O  O   . HOH U 6 .   ? -37.815 -44.251 -28.083 1.00 37.26 ? 2039 HOH C O   1 
HETATM 8550 O  O   . HOH U 6 .   ? -36.507 -45.051 -24.533 1.00 34.92 ? 2040 HOH C O   1 
HETATM 8551 O  O   . HOH U 6 .   ? -33.278 -38.993 -30.737 1.00 32.52 ? 2041 HOH C O   1 
HETATM 8552 O  O   . HOH U 6 .   ? -32.373 -44.895 -24.434 1.00 49.89 ? 2042 HOH C O   1 
HETATM 8553 O  O   . HOH U 6 .   ? -52.272 -9.465  -24.351 1.00 34.77 ? 2043 HOH C O   1 
HETATM 8554 O  O   . HOH U 6 .   ? -29.784 -42.017 -25.957 1.00 34.97 ? 2044 HOH C O   1 
HETATM 8555 O  O   . HOH U 6 .   ? -44.460 -4.596  -29.838 1.00 53.37 ? 2045 HOH C O   1 
HETATM 8556 O  O   . HOH U 6 .   ? -33.276 -39.068 -33.550 1.00 25.80 ? 2046 HOH C O   1 
HETATM 8557 O  O   . HOH U 6 .   ? -29.012 -41.319 -35.377 1.00 44.95 ? 2047 HOH C O   1 
HETATM 8558 O  O   . HOH U 6 .   ? -31.753 -25.770 -38.706 1.00 27.81 ? 2048 HOH C O   1 
HETATM 8559 O  O   . HOH U 6 .   ? -39.146 -23.879 -41.033 1.00 36.76 ? 2049 HOH C O   1 
HETATM 8560 O  O   . HOH U 6 .   ? -38.852 -19.127 -40.125 1.00 16.12 ? 2050 HOH C O   1 
HETATM 8561 O  O   . HOH U 6 .   ? -30.855 -20.415 -41.876 1.00 25.27 ? 2051 HOH C O   1 
HETATM 8562 O  O   . HOH U 6 .   ? -37.484 -27.940 -38.202 1.00 44.19 ? 2052 HOH C O   1 
HETATM 8563 O  O   . HOH U 6 .   ? -24.637 -36.762 -34.605 1.00 25.39 ? 2053 HOH C O   1 
HETATM 8564 O  O   . HOH U 6 .   ? -22.482 -33.164 -37.265 1.00 21.37 ? 2054 HOH C O   1 
HETATM 8565 O  O   . HOH U 6 .   ? -28.417 -32.870 -38.971 1.00 26.84 ? 2055 HOH C O   1 
HETATM 8566 O  O   . HOH U 6 .   ? -24.783 -25.955 -32.652 1.00 29.29 ? 2056 HOH C O   1 
HETATM 8567 O  O   . HOH U 6 .   ? -22.141 -25.193 -33.319 1.00 37.13 ? 2057 HOH C O   1 
HETATM 8568 O  O   . HOH U 6 .   ? -30.340 -22.006 -35.740 1.00 20.04 ? 2058 HOH C O   1 
HETATM 8569 O  O   . HOH U 6 .   ? -29.364 -22.508 -38.343 1.00 35.52 ? 2059 HOH C O   1 
HETATM 8570 O  O   . HOH U 6 .   ? -26.489 -23.353 -30.288 1.00 26.14 ? 2060 HOH C O   1 
HETATM 8571 O  O   . HOH U 6 .   ? -23.856 -22.390 -30.516 1.00 45.03 ? 2061 HOH C O   1 
HETATM 8572 O  O   . HOH U 6 .   ? -43.130 -36.132 -10.260 1.00 39.17 ? 2062 HOH C O   1 
HETATM 8573 O  O   . HOH U 6 .   ? -31.552 -18.194 -32.930 1.00 20.23 ? 2063 HOH C O   1 
HETATM 8574 O  O   . HOH U 6 .   ? -28.075 -16.619 -31.868 1.00 18.66 ? 2064 HOH C O   1 
HETATM 8575 O  O   . HOH U 6 .   ? -31.443 -13.994 -35.248 1.00 28.70 ? 2065 HOH C O   1 
HETATM 8576 O  O   . HOH U 6 .   ? -32.916 -13.338 -23.458 1.00 41.37 ? 2066 HOH C O   1 
HETATM 8577 O  O   . HOH U 6 .   ? -48.774 -42.708 -21.862 1.00 40.77 ? 2067 HOH C O   1 
HETATM 8578 O  O   . HOH U 6 .   ? -42.103 -6.693  -24.353 1.00 25.14 ? 2068 HOH C O   1 
HETATM 8579 O  O   . HOH U 6 .   ? -39.182 -8.415  -16.020 1.00 25.05 ? 2069 HOH C O   1 
HETATM 8580 O  O   . HOH U 6 .   ? -39.370 -4.589  -17.311 1.00 43.40 ? 2070 HOH C O   1 
HETATM 8581 O  O   . HOH U 6 .   ? -42.524 -7.490  -13.680 1.00 25.17 ? 2071 HOH C O   1 
HETATM 8582 O  O   . HOH U 6 .   ? -46.493 -6.319  -18.267 1.00 19.68 ? 2072 HOH C O   1 
HETATM 8583 O  O   . HOH U 6 .   ? -45.319 -1.447  -14.438 1.00 37.16 ? 2073 HOH C O   1 
HETATM 8584 O  O   . HOH U 6 .   ? -48.735 -5.143  -11.301 1.00 35.94 ? 2074 HOH C O   1 
HETATM 8585 O  O   . HOH U 6 .   ? -45.995 -1.572  -19.719 1.00 42.80 ? 2075 HOH C O   1 
HETATM 8586 O  O   . HOH U 6 .   ? -47.518 -7.124  -20.448 1.00 36.63 ? 2076 HOH C O   1 
HETATM 8587 O  O   . HOH U 6 .   ? -53.369 -4.049  -16.495 1.00 34.13 ? 2077 HOH C O   1 
HETATM 8588 O  O   . HOH U 6 .   ? -54.491 -8.557  -19.553 1.00 37.77 ? 2078 HOH C O   1 
HETATM 8589 O  O   . HOH U 6 .   ? -50.268 -8.136  -20.682 1.00 41.10 ? 2079 HOH C O   1 
HETATM 8590 O  O   . HOH U 6 .   ? -55.861 -6.534  -15.195 1.00 39.59 ? 2080 HOH C O   1 
HETATM 8591 O  O   . HOH U 6 .   ? -51.182 -5.748  -10.452 1.00 45.46 ? 2081 HOH C O   1 
HETATM 8592 O  O   . HOH U 6 .   ? -53.425 -11.020 -20.942 1.00 27.72 ? 2082 HOH C O   1 
HETATM 8593 O  O   . HOH U 6 .   ? -54.934 -17.035 -20.487 1.00 24.27 ? 2083 HOH C O   1 
HETATM 8594 O  O   . HOH U 6 .   ? -56.436 -14.298 -23.558 1.00 32.23 ? 2084 HOH C O   1 
HETATM 8595 O  O   . HOH U 6 .   ? -56.998 -21.081 -22.422 1.00 33.21 ? 2085 HOH C O   1 
HETATM 8596 O  O   . HOH U 6 .   ? -57.987 -32.014 -18.571 1.00 46.62 ? 2086 HOH C O   1 
HETATM 8597 O  O   . HOH U 6 .   ? -54.522 -20.865 -27.307 1.00 45.85 ? 2087 HOH C O   1 
HETATM 8598 O  O   . HOH U 6 .   ? -53.917 -17.171 -24.300 1.00 28.20 ? 2088 HOH C O   1 
HETATM 8599 O  O   . HOH U 6 .   ? -60.434 -11.718 -13.912 1.00 38.73 ? 2089 HOH C O   1 
HETATM 8600 O  O   . HOH U 6 .   ? -51.094 -10.551 -21.895 1.00 25.68 ? 2090 HOH C O   1 
HETATM 8601 O  O   . HOH U 6 .   ? -51.728 -14.019 -27.347 1.00 28.60 ? 2091 HOH C O   1 
HETATM 8602 O  O   . HOH U 6 .   ? -49.127 -12.494 -28.018 1.00 27.53 ? 2092 HOH C O   1 
HETATM 8603 O  O   . HOH U 6 .   ? -45.562 -11.451 -28.308 1.00 14.89 ? 2093 HOH C O   1 
HETATM 8604 O  O   . HOH U 6 .   ? -44.794 -6.312  -24.230 1.00 38.66 ? 2094 HOH C O   1 
HETATM 8605 O  O   . HOH U 6 .   ? -45.712 -9.309  -31.018 1.00 33.97 ? 2095 HOH C O   1 
HETATM 8606 O  O   . HOH U 6 .   ? -26.158 -24.402 -15.764 1.00 36.64 ? 2096 HOH C O   1 
HETATM 8607 O  O   . HOH U 6 .   ? -43.249 -6.513  -31.654 1.00 45.00 ? 2097 HOH C O   1 
HETATM 8608 O  O   . HOH U 6 .   ? -27.548 -30.729 -17.834 1.00 38.27 ? 2098 HOH C O   1 
HETATM 8609 O  O   . HOH U 6 .   ? -21.212 -32.560 -22.935 1.00 48.67 ? 2099 HOH C O   1 
HETATM 8610 O  O   . HOH U 6 .   ? -20.417 -28.871 -26.037 1.00 44.11 ? 2100 HOH C O   1 
HETATM 8611 O  O   . HOH U 6 .   ? -36.108 -30.293 -37.394 1.00 41.34 ? 2101 HOH C O   1 
HETATM 8612 O  O   . HOH U 6 .   ? -33.174 -23.293 -33.665 1.00 16.25 ? 2102 HOH C O   1 
HETATM 8613 O  O   . HOH U 6 .   ? -33.345 -24.310 -36.333 1.00 19.78 ? 2103 HOH C O   1 
HETATM 8614 O  O   . HOH U 6 .   ? -30.466 -16.723 -35.026 1.00 26.52 ? 2104 HOH C O   1 
HETATM 8615 O  O   . HOH U 6 .   ? -33.154 -12.903 -36.965 1.00 22.71 ? 2105 HOH C O   1 
HETATM 8616 O  O   . HOH U 6 .   ? -39.587 -14.551 -39.736 1.00 30.76 ? 2106 HOH C O   1 
HETATM 8617 O  O   . HOH U 6 .   ? -38.935 -21.756 -39.181 1.00 23.47 ? 2107 HOH C O   1 
HETATM 8618 O  O   . HOH U 6 .   ? -31.582 -21.223 -39.302 1.00 45.08 ? 2108 HOH C O   1 
HETATM 8619 O  O   . HOH U 6 .   ? -36.035 -25.435 -37.407 1.00 28.80 ? 2109 HOH C O   1 
HETATM 8620 O  O   . HOH U 6 .   ? -40.796 -17.362 -39.145 1.00 15.27 ? 2110 HOH C O   1 
HETATM 8621 O  O   . HOH U 6 .   ? -26.293 -35.942 -25.515 1.00 38.73 ? 2111 HOH C O   1 
HETATM 8622 O  O   . HOH U 6 .   ? -41.622 -11.071 -33.481 1.00 39.98 ? 2112 HOH C O   1 
HETATM 8623 O  O   . HOH U 6 .   ? -47.633 -12.468 -36.718 1.00 32.81 ? 2113 HOH C O   1 
HETATM 8624 O  O   . HOH U 6 .   ? -52.336 -13.388 -32.183 1.00 48.59 ? 2114 HOH C O   1 
HETATM 8625 O  O   . HOH U 6 .   ? -47.788 -11.341 -30.306 1.00 41.03 ? 2115 HOH C O   1 
HETATM 8626 O  O   . HOH U 6 .   ? -50.354 -10.669 -29.610 1.00 45.91 ? 2116 HOH C O   1 
HETATM 8627 O  O   . HOH U 6 .   ? -53.228 -16.231 -26.820 1.00 44.68 ? 2117 HOH C O   1 
HETATM 8628 O  O   . HOH U 6 .   ? -52.077 -20.424 -28.720 1.00 34.90 ? 2118 HOH C O   1 
HETATM 8629 O  O   . HOH U 6 .   ? -46.183 -33.096 -11.500 1.00 34.03 ? 2119 HOH C O   1 
HETATM 8630 O  O   . HOH U 6 .   ? -48.689 -45.231 -32.942 1.00 46.00 ? 2120 HOH C O   1 
HETATM 8631 O  O   . HOH U 6 .   ? -45.629 -35.116 -9.935  1.00 46.63 ? 2121 HOH C O   1 
HETATM 8632 O  O   . HOH U 6 .   ? -37.894 -44.403 -34.119 1.00 48.92 ? 2122 HOH C O   1 
HETATM 8633 O  O   . HOH U 6 .   ? -47.026 -40.717 -14.647 1.00 34.65 ? 2123 HOH C O   1 
HETATM 8634 O  O   . HOH U 6 .   ? -45.695 -38.616 -22.948 1.00 26.88 ? 2124 HOH C O   1 
HETATM 8635 O  O   . HOH U 6 .   ? -41.880 -42.242 -23.832 1.00 28.66 ? 2125 HOH C O   1 
HETATM 8636 O  O   . HOH U 6 .   ? -40.283 -41.888 -15.663 1.00 40.44 ? 2126 HOH C O   1 
HETATM 8637 O  O   . HOH U 6 .   ? -36.753 -43.565 -15.624 1.00 42.40 ? 2127 HOH C O   1 
HETATM 8638 O  O   . HOH U 6 .   ? -36.679 -43.165 -12.970 1.00 53.54 ? 2128 HOH C O   1 
HETATM 8639 O  O   . HOH U 6 .   ? -36.558 -35.862 -13.354 1.00 48.74 ? 2129 HOH C O   1 
HETATM 8640 O  O   . HOH U 6 .   ? -39.926 -38.422 -12.611 1.00 45.81 ? 2130 HOH C O   1 
HETATM 8641 O  O   . HOH U 6 .   ? -45.231 -42.158 -16.400 1.00 42.35 ? 2131 HOH C O   1 
HETATM 8642 O  O   . HOH U 6 .   ? -46.084 -42.262 -23.471 1.00 43.43 ? 2132 HOH C O   1 
HETATM 8643 O  O   . HOH U 6 .   ? -46.185 -10.335 -38.175 1.00 36.99 ? 2133 HOH C O   1 
HETATM 8644 O  O   . HOH U 6 .   ? -50.668 -13.866 -42.798 1.00 36.80 ? 2134 HOH C O   1 
HETATM 8645 O  O   . HOH U 6 .   ? -61.129 -16.116 -35.078 1.00 42.36 ? 2135 HOH C O   1 
HETATM 8646 O  O   . HOH U 6 .   ? -56.351 -17.524 -35.651 1.00 37.54 ? 2136 HOH C O   1 
HETATM 8647 O  O   . HOH U 6 .   ? -53.793 -15.218 -34.052 1.00 30.43 ? 2137 HOH C O   1 
HETATM 8648 O  O   . HOH U 6 .   ? -56.361 -23.499 -39.292 1.00 39.71 ? 2138 HOH C O   1 
HETATM 8649 O  O   . HOH U 6 .   ? -54.989 -12.483 -41.454 1.00 54.73 ? 2139 HOH C O   1 
HETATM 8650 O  O   . HOH U 6 .   ? -47.377 -24.852 -37.802 1.00 17.60 ? 2140 HOH C O   1 
HETATM 8651 O  O   . HOH U 6 .   ? -49.471 -26.445 -36.932 1.00 16.06 ? 2141 HOH C O   1 
HETATM 8652 O  O   . HOH U 6 .   ? -46.653 -29.087 -42.495 1.00 37.78 ? 2142 HOH C O   1 
HETATM 8653 O  O   . HOH U 6 .   ? -49.918 -30.211 -41.949 1.00 29.70 ? 2143 HOH C O   1 
HETATM 8654 O  O   . HOH U 6 .   ? -53.935 -19.134 -45.469 1.00 37.11 ? 2144 HOH C O   1 
HETATM 8655 O  O   . HOH U 6 .   ? -39.472 -24.341 -31.379 1.00 14.76 ? 2145 HOH C O   1 
HETATM 8656 O  O   . HOH U 6 .   ? -35.805 -29.049 -20.478 1.00 22.20 ? 2146 HOH C O   1 
HETATM 8657 O  O   . HOH U 6 .   ? -37.284 -34.318 -10.150 1.00 42.49 ? 2147 HOH C O   1 
HETATM 8658 O  O   . HOH U 6 .   ? -37.903 -29.529 -2.661  1.00 33.00 ? 2148 HOH C O   1 
HETATM 8659 O  O   . HOH U 6 .   ? -33.987 -26.003 -6.294  1.00 36.12 ? 2149 HOH C O   1 
HETATM 8660 O  O   . HOH U 6 .   ? -35.724 -24.136 -7.406  1.00 34.29 ? 2150 HOH C O   1 
HETATM 8661 O  O   . HOH U 6 .   ? -36.306 -22.310 -0.801  1.00 42.79 ? 2151 HOH C O   1 
HETATM 8662 O  O   . HOH U 6 .   ? -37.641 -18.199 -4.345  1.00 40.18 ? 2152 HOH C O   1 
HETATM 8663 O  O   . HOH U 6 .   ? -44.142 -23.137 -2.524  1.00 41.54 ? 2153 HOH C O   1 
HETATM 8664 O  O   . HOH U 6 .   ? -41.318 -24.021 -2.013  1.00 43.18 ? 2154 HOH C O   1 
HETATM 8665 O  O   . HOH U 6 .   ? -40.091 -17.425 -3.798  1.00 37.69 ? 2155 HOH C O   1 
HETATM 8666 O  O   . HOH U 6 .   ? -36.648 -20.827 -13.330 1.00 30.65 ? 2156 HOH C O   1 
HETATM 8667 O  O   . HOH U 6 .   ? -36.570 -18.210 -10.732 1.00 26.08 ? 2157 HOH C O   1 
HETATM 8668 O  O   . HOH U 6 .   ? -35.348 -19.348 -8.391  1.00 31.41 ? 2158 HOH C O   1 
HETATM 8669 O  O   . HOH U 6 .   ? -48.327 -13.513 -9.661  1.00 26.84 ? 2159 HOH C O   1 
HETATM 8670 O  O   . HOH U 6 .   ? -44.810 -10.915 -10.964 1.00 25.94 ? 2160 HOH C O   1 
HETATM 8671 O  O   . HOH U 6 .   ? -52.180 -21.289 -5.292  1.00 27.12 ? 2161 HOH C O   1 
HETATM 8672 O  O   . HOH U 6 .   ? -54.459 -17.890 -5.538  1.00 37.04 ? 2162 HOH C O   1 
HETATM 8673 O  O   . HOH U 6 .   ? -62.141 -20.879 -9.224  1.00 51.01 ? 2163 HOH C O   1 
HETATM 8674 O  O   . HOH U 6 .   ? -62.299 -26.737 -6.461  1.00 49.05 ? 2164 HOH C O   1 
HETATM 8675 O  O   . HOH U 6 .   ? -62.224 -18.234 -18.427 1.00 44.91 ? 2165 HOH C O   1 
HETATM 8676 O  O   . HOH U 6 .   ? -63.125 -16.273 -13.710 1.00 31.65 ? 2166 HOH C O   1 
HETATM 8677 O  O   . HOH U 6 .   ? -62.898 -13.446 -13.720 1.00 43.66 ? 2167 HOH C O   1 
HETATM 8678 O  O   . HOH U 6 .   ? -58.924 -12.420 -16.141 1.00 39.71 ? 2168 HOH C O   1 
HETATM 8679 O  O   . HOH U 6 .   ? -47.039 -12.331 -11.758 1.00 28.15 ? 2169 HOH C O   1 
HETATM 8680 O  O   . HOH U 6 .   ? -34.429 -12.100 -21.205 1.00 20.72 ? 2170 HOH C O   1 
HETATM 8681 O  O   . HOH U 6 .   ? -30.897 -24.590 -16.247 1.00 23.69 ? 2171 HOH C O   1 
HETATM 8682 O  O   . HOH U 6 .   ? -27.954 -18.862 -22.359 1.00 26.62 ? 2172 HOH C O   1 
HETATM 8683 O  O   . HOH U 6 .   ? -25.443 -23.429 -18.261 1.00 38.43 ? 2173 HOH C O   1 
HETATM 8684 O  O   . HOH U 6 .   ? -30.560 -26.022 -22.116 1.00 15.74 ? 2174 HOH C O   1 
HETATM 8685 O  O   . HOH U 6 .   ? -22.636 -23.286 -23.586 1.00 48.61 ? 2175 HOH C O   1 
HETATM 8686 O  O   . HOH U 6 .   ? -23.782 -24.707 -20.189 1.00 38.83 ? 2176 HOH C O   1 
HETATM 8687 O  O   . HOH U 6 .   ? -26.140 -19.195 -25.645 1.00 25.31 ? 2177 HOH C O   1 
HETATM 8688 O  O   . HOH U 6 .   ? -23.630 -25.100 -26.753 1.00 34.55 ? 2178 HOH C O   1 
HETATM 8689 O  O   . HOH U 6 .   ? -25.776 -29.109 -19.723 1.00 37.76 ? 2179 HOH C O   1 
HETATM 8690 O  O   . HOH U 6 .   ? -21.833 -31.249 -25.521 1.00 39.04 ? 2180 HOH C O   1 
HETATM 8691 O  O   . HOH U 6 .   ? -22.976 -27.081 -25.011 1.00 39.62 ? 2181 HOH C O   1 
HETATM 8692 O  O   . HOH U 6 .   ? -26.691 -32.921 -22.022 1.00 42.00 ? 2182 HOH C O   1 
HETATM 8693 O  O   . HOH U 6 .   ? -34.010 -28.597 -36.712 1.00 32.68 ? 2183 HOH C O   1 
HETATM 8694 O  O   . HOH U 6 .   ? -38.319 -33.548 -37.359 1.00 30.43 ? 2184 HOH C O   1 
HETATM 8695 O  O   . HOH U 6 .   ? -40.136 -26.397 -41.389 1.00 44.48 ? 2185 HOH C O   1 
HETATM 8696 O  O   . HOH U 6 .   ? -38.814 -31.032 -40.769 1.00 40.24 ? 2186 HOH C O   1 
HETATM 8697 O  O   . HOH U 6 .   ? -55.232 -27.528 -25.892 1.00 42.85 ? 2187 HOH C O   1 
HETATM 8698 O  O   . HOH U 6 .   ? -55.625 -30.302 -37.434 1.00 26.46 ? 2188 HOH C O   1 
HETATM 8699 O  O   . HOH U 6 .   ? -51.979 -30.148 -39.773 1.00 28.63 ? 2189 HOH C O   1 
HETATM 8700 O  O   . HOH U 6 .   ? -51.616 -35.587 -41.332 1.00 36.35 ? 2190 HOH C O   1 
HETATM 8701 O  O   . HOH U 6 .   ? -48.339 -32.325 -42.166 1.00 33.45 ? 2191 HOH C O   1 
HETATM 8702 O  O   . HOH U 6 .   ? -45.978 -32.913 -41.785 1.00 44.85 ? 2192 HOH C O   1 
HETATM 8703 O  O   . HOH U 6 .   ? -32.394 -33.505 -21.393 1.00 43.95 ? 2193 HOH C O   1 
HETATM 8704 O  O   . HOH U 6 .   ? -31.625 -33.881 -18.868 1.00 40.68 ? 2194 HOH C O   1 
HETATM 8705 O  O   . HOH U 6 .   ? -28.439 -34.808 -23.288 1.00 43.28 ? 2195 HOH C O   1 
HETATM 8706 O  O   . HOH U 6 .   ? -28.580 -26.070 -15.888 1.00 38.77 ? 2196 HOH C O   1 
HETATM 8707 O  O   . HOH U 6 .   ? -30.702 -30.267 -16.032 1.00 37.54 ? 2197 HOH C O   1 
HETATM 8708 O  O   . HOH U 6 .   ? -31.735 -27.823 -13.288 1.00 34.31 ? 2198 HOH C O   1 
HETATM 8709 O  O   . HOH U 6 .   ? -33.942 -23.858 -11.835 1.00 29.75 ? 2199 HOH C O   1 
HETATM 8710 O  O   . HOH U 6 .   ? -40.557 -28.267 -0.860  1.00 35.20 ? 2200 HOH C O   1 
HETATM 8711 O  O   . HOH U 6 .   ? -44.190 -32.871 -4.804  1.00 36.58 ? 2201 HOH C O   1 
HETATM 8712 O  O   . HOH U 6 .   ? -46.657 -33.401 -8.294  1.00 47.86 ? 2202 HOH C O   1 
HETATM 8713 O  O   . HOH U 6 .   ? -46.288 -23.543 -4.248  1.00 36.99 ? 2203 HOH C O   1 
HETATM 8714 O  O   . HOH U 6 .   ? -53.812 -29.114 -10.498 1.00 25.73 ? 2204 HOH C O   1 
HETATM 8715 O  O   . HOH U 6 .   ? -57.913 -28.902 -4.674  1.00 47.89 ? 2205 HOH C O   1 
HETATM 8716 O  O   . HOH U 6 .   ? -52.937 -27.566 -3.160  1.00 49.42 ? 2206 HOH C O   1 
HETATM 8717 O  O   . HOH U 6 .   ? -58.129 -26.046 -5.043  1.00 35.11 ? 2207 HOH C O   1 
HETATM 8718 O  O   . HOH U 6 .   ? -52.685 -23.753 -3.938  1.00 46.01 ? 2208 HOH C O   1 
HETATM 8719 O  O   . HOH U 6 .   ? -52.234 -39.765 -21.057 1.00 43.50 ? 2209 HOH C O   1 
HETATM 8720 O  O   . HOH U 6 .   ? -52.762 -39.691 -28.115 1.00 31.57 ? 2210 HOH C O   1 
HETATM 8721 O  O   . HOH U 6 .   ? -52.434 -39.972 -24.898 1.00 27.95 ? 2211 HOH C O   1 
HETATM 8722 O  O   . HOH U 6 .   ? -46.170 -43.956 -25.960 1.00 33.02 ? 2212 HOH C O   1 
HETATM 8723 O  O   . HOH U 6 .   ? -44.323 -44.452 -29.920 1.00 41.79 ? 2213 HOH C O   1 
HETATM 8724 O  O   . HOH U 6 .   ? -42.619 -43.062 -27.832 1.00 41.77 ? 2214 HOH C O   1 
HETATM 8725 O  O   . HOH U 6 .   ? -49.514 -43.298 -31.042 1.00 38.61 ? 2215 HOH C O   1 
HETATM 8726 O  O   . HOH U 6 .   ? -51.435 -42.163 -28.879 1.00 41.62 ? 2216 HOH C O   1 
HETATM 8727 O  O   . HOH U 6 .   ? -40.085 -43.677 -32.473 1.00 43.80 ? 2217 HOH C O   1 
HETATM 8728 O  O   . HOH U 6 .   ? -41.077 -44.522 -35.440 1.00 34.47 ? 2218 HOH C O   1 
HETATM 8729 O  O   . HOH U 6 .   ? -38.304 -43.485 -36.607 1.00 37.73 ? 2219 HOH C O   1 
HETATM 8730 O  O   . HOH U 6 .   ? -45.785 -45.898 -36.554 1.00 44.13 ? 2220 HOH C O   1 
HETATM 8731 O  O   . HOH U 6 .   ? -47.997 -43.197 -36.527 1.00 37.58 ? 2221 HOH C O   1 
HETATM 8732 O  O   . HOH U 6 .   ? -34.860 -39.448 -41.671 1.00 31.31 ? 2222 HOH C O   1 
HETATM 8733 O  O   . HOH U 6 .   ? -36.006 -41.822 -36.502 1.00 35.65 ? 2223 HOH C O   1 
HETATM 8734 O  O   . HOH U 6 .   ? -35.894 -35.753 -39.654 1.00 23.68 ? 2224 HOH C O   1 
HETATM 8735 O  O   . HOH U 6 .   ? -35.089 -33.184 -38.121 1.00 40.54 ? 2225 HOH C O   1 
HETATM 8736 O  O   . HOH U 6 .   ? -30.346 -28.124 -38.785 1.00 39.20 ? 2226 HOH C O   1 
HETATM 8737 O  O   . HOH U 6 .   ? -30.539 -30.835 -40.759 1.00 45.68 ? 2227 HOH C O   1 
HETATM 8738 O  O   . HOH U 6 .   ? -33.183 -32.032 -41.519 1.00 42.18 ? 2228 HOH C O   1 
HETATM 8739 O  O   . HOH U 6 .   ? -23.174 -26.229 -29.036 1.00 38.55 ? 2229 HOH C O   1 
HETATM 8740 O  O   . HOH U 6 .   ? -23.765 -34.940 -24.794 1.00 41.72 ? 2230 HOH C O   1 
HETATM 8741 O  O   . HOH U 6 .   ? -54.915 -23.601 -26.702 1.00 56.84 ? 2231 HOH C O   1 
HETATM 8742 O  O   . HOH V 6 .   ? -45.088 15.325  -6.948  1.00 37.72 ? 2001 HOH D O   1 
HETATM 8743 O  O   . HOH V 6 .   ? -55.247 16.846  -6.810  1.00 30.29 ? 2002 HOH D O   1 
HETATM 8744 O  O   . HOH V 6 .   ? -56.125 21.030  -6.009  1.00 38.78 ? 2003 HOH D O   1 
HETATM 8745 O  O   . HOH V 6 .   ? -48.090 24.306  -4.354  1.00 24.25 ? 2004 HOH D O   1 
HETATM 8746 O  O   . HOH V 6 .   ? -45.585 22.727  -7.778  1.00 32.15 ? 2005 HOH D O   1 
HETATM 8747 O  O   . HOH V 6 .   ? -55.010 23.408  -5.938  1.00 44.41 ? 2006 HOH D O   1 
HETATM 8748 O  O   . HOH V 6 .   ? -60.161 18.198  -4.584  1.00 50.25 ? 2007 HOH D O   1 
HETATM 8749 O  O   . HOH V 6 .   ? -55.169 8.347   3.345   1.00 40.24 ? 2008 HOH D O   1 
HETATM 8750 O  O   . HOH V 6 .   ? -57.465 19.093  -2.080  1.00 29.41 ? 2009 HOH D O   1 
HETATM 8751 O  O   . HOH V 6 .   ? -56.371 10.571  4.293   1.00 34.29 ? 2010 HOH D O   1 
HETATM 8752 O  O   . HOH V 6 .   ? -53.241 8.144   1.338   1.00 41.81 ? 2011 HOH D O   1 
HETATM 8753 O  O   . HOH V 6 .   ? -50.592 8.533   1.704   1.00 47.55 ? 2012 HOH D O   1 
HETATM 8754 O  O   . HOH V 6 .   ? -49.100 11.895  5.328   1.00 43.88 ? 2013 HOH D O   1 
HETATM 8755 O  O   . HOH V 6 .   ? -53.024 41.565  9.621   1.00 50.05 ? 2014 HOH D O   1 
HETATM 8756 O  O   . HOH V 6 .   ? -51.600 14.959  9.448   1.00 39.04 ? 2015 HOH D O   1 
HETATM 8757 O  O   . HOH V 6 .   ? -50.166 12.821  8.745   1.00 36.20 ? 2016 HOH D O   1 
HETATM 8758 O  O   . HOH V 6 .   ? -49.232 17.432  8.404   1.00 31.40 ? 2017 HOH D O   1 
HETATM 8759 O  O   . HOH V 6 .   ? -55.478 22.553  7.970   1.00 33.59 ? 2018 HOH D O   1 
HETATM 8760 O  O   . HOH V 6 .   ? -52.269 25.915  8.177   1.00 12.98 ? 2019 HOH D O   1 
HETATM 8761 O  O   . HOH V 6 .   ? -17.877 26.183  -6.377  1.00 53.78 ? 2020 HOH D O   1 
HETATM 8762 O  O   . HOH V 6 .   ? -18.661 24.123  -8.362  1.00 44.36 ? 2021 HOH D O   1 
HETATM 8763 O  O   . HOH V 6 .   ? -50.651 32.855  0.925   1.00 37.64 ? 2022 HOH D O   1 
HETATM 8764 O  O   . HOH V 6 .   ? -51.663 32.782  6.368   1.00 18.90 ? 2023 HOH D O   1 
HETATM 8765 O  O   . HOH V 6 .   ? -53.668 36.628  6.648   1.00 33.73 ? 2024 HOH D O   1 
HETATM 8766 O  O   . HOH V 6 .   ? -53.323 40.413  5.060   1.00 36.56 ? 2025 HOH D O   1 
HETATM 8767 O  O   . HOH V 6 .   ? -47.093 37.566  10.414  1.00 25.74 ? 2026 HOH D O   1 
HETATM 8768 O  O   . HOH V 6 .   ? -48.540 43.505  8.679   1.00 31.68 ? 2027 HOH D O   1 
HETATM 8769 O  O   . HOH V 6 .   ? -54.175 38.842  10.860  1.00 45.87 ? 2028 HOH D O   1 
HETATM 8770 O  O   . HOH V 6 .   ? -27.258 15.063  -9.854  1.00 40.23 ? 2029 HOH D O   1 
HETATM 8771 O  O   . HOH V 6 .   ? -41.118 43.266  10.179  1.00 41.09 ? 2030 HOH D O   1 
HETATM 8772 O  O   . HOH V 6 .   ? -18.846 16.947  0.107   1.00 42.52 ? 2031 HOH D O   1 
HETATM 8773 O  O   . HOH V 6 .   ? -44.679 42.224  16.549  1.00 43.94 ? 2032 HOH D O   1 
HETATM 8774 O  O   . HOH V 6 .   ? -19.658 18.099  6.833   1.00 45.10 ? 2033 HOH D O   1 
HETATM 8775 O  O   . HOH V 6 .   ? -46.551 36.393  12.870  1.00 19.61 ? 2034 HOH D O   1 
HETATM 8776 O  O   . HOH V 6 .   ? -47.014 38.793  17.030  1.00 51.71 ? 2035 HOH D O   1 
HETATM 8777 O  O   . HOH V 6 .   ? -40.953 42.003  17.587  1.00 25.55 ? 2036 HOH D O   1 
HETATM 8778 O  O   . HOH V 6 .   ? -31.280 39.711  13.116  1.00 29.62 ? 2037 HOH D O   1 
HETATM 8779 O  O   . HOH V 6 .   ? -38.699 35.737  18.238  1.00 30.96 ? 2038 HOH D O   1 
HETATM 8780 O  O   . HOH V 6 .   ? -29.806 41.685  14.749  1.00 43.31 ? 2039 HOH D O   1 
HETATM 8781 O  O   . HOH V 6 .   ? -29.043 32.781  11.902  1.00 20.98 ? 2040 HOH D O   1 
HETATM 8782 O  O   . HOH V 6 .   ? -27.412 32.946  15.516  1.00 35.68 ? 2041 HOH D O   1 
HETATM 8783 O  O   . HOH V 6 .   ? -29.708 38.903  9.501   1.00 26.24 ? 2042 HOH D O   1 
HETATM 8784 O  O   . HOH V 6 .   ? -28.430 41.311  10.193  1.00 38.57 ? 2043 HOH D O   1 
HETATM 8785 O  O   . HOH V 6 .   ? -48.395 38.989  -12.584 1.00 46.91 ? 2044 HOH D O   1 
HETATM 8786 O  O   . HOH V 6 .   ? -24.041 35.075  8.507   1.00 27.53 ? 2045 HOH D O   1 
HETATM 8787 O  O   . HOH V 6 .   ? -26.078 31.510  8.466   1.00 30.34 ? 2046 HOH D O   1 
HETATM 8788 O  O   . HOH V 6 .   ? -23.945 36.115  4.356   1.00 42.01 ? 2047 HOH D O   1 
HETATM 8789 O  O   . HOH V 6 .   ? -22.809 27.536  3.986   1.00 33.84 ? 2048 HOH D O   1 
HETATM 8790 O  O   . HOH V 6 .   ? -21.005 28.857  5.795   1.00 50.78 ? 2049 HOH D O   1 
HETATM 8791 O  O   . HOH V 6 .   ? -23.751 33.721  1.004   1.00 31.70 ? 2050 HOH D O   1 
HETATM 8792 O  O   . HOH V 6 .   ? -21.989 30.091  -3.073  1.00 21.98 ? 2051 HOH D O   1 
HETATM 8793 O  O   . HOH V 6 .   ? -19.415 28.316  -5.399  1.00 22.99 ? 2052 HOH D O   1 
HETATM 8794 O  O   . HOH V 6 .   ? -18.756 29.284  -2.791  1.00 36.33 ? 2053 HOH D O   1 
HETATM 8795 O  O   . HOH V 6 .   ? -20.494 23.453  -6.168  1.00 23.07 ? 2054 HOH D O   1 
HETATM 8796 O  O   . HOH V 6 .   ? -17.346 27.595  -10.927 1.00 32.43 ? 2055 HOH D O   1 
HETATM 8797 O  O   . HOH V 6 .   ? -17.862 30.729  -5.143  1.00 52.59 ? 2056 HOH D O   1 
HETATM 8798 O  O   . HOH V 6 .   ? -21.149 30.231  -11.521 1.00 25.35 ? 2057 HOH D O   1 
HETATM 8799 O  O   . HOH V 6 .   ? -21.394 28.267  -15.274 1.00 21.24 ? 2058 HOH D O   1 
HETATM 8800 O  O   . HOH V 6 .   ? -22.555 14.234  7.129   1.00 35.61 ? 2059 HOH D O   1 
HETATM 8801 O  O   . HOH V 6 .   ? -21.986 22.457  -13.185 1.00 20.09 ? 2060 HOH D O   1 
HETATM 8802 O  O   . HOH V 6 .   ? -17.303 23.381  -16.848 1.00 19.67 ? 2061 HOH D O   1 
HETATM 8803 O  O   . HOH V 6 .   ? -43.328 10.219  5.177   1.00 48.91 ? 2062 HOH D O   1 
HETATM 8804 O  O   . HOH V 6 .   ? -43.692 10.947  0.549   1.00 44.88 ? 2063 HOH D O   1 
HETATM 8805 O  O   . HOH V 6 .   ? -23.269 20.651  -11.538 1.00 33.22 ? 2064 HOH D O   1 
HETATM 8806 O  O   . HOH V 6 .   ? -22.833 17.116  -18.240 1.00 28.74 ? 2065 HOH D O   1 
HETATM 8807 O  O   . HOH V 6 .   ? -27.739 16.511  -15.824 1.00 40.22 ? 2066 HOH D O   1 
HETATM 8808 O  O   . HOH V 6 .   ? -24.775 18.424  -12.346 1.00 40.52 ? 2067 HOH D O   1 
HETATM 8809 O  O   . HOH V 6 .   ? -23.756 16.850  -20.687 1.00 30.64 ? 2068 HOH D O   1 
HETATM 8810 O  O   . HOH V 6 .   ? -27.335 22.867  -23.021 1.00 38.08 ? 2069 HOH D O   1 
HETATM 8811 O  O   . HOH V 6 .   ? -29.221 17.432  -12.617 1.00 24.98 ? 2070 HOH D O   1 
HETATM 8812 O  O   . HOH V 6 .   ? -35.168 18.236  -12.657 1.00 16.78 ? 2071 HOH D O   1 
HETATM 8813 O  O   . HOH V 6 .   ? -32.438 16.304  -18.539 1.00 37.83 ? 2072 HOH D O   1 
HETATM 8814 O  O   . HOH V 6 .   ? -43.062 14.324  -14.339 1.00 40.80 ? 2073 HOH D O   1 
HETATM 8815 O  O   . HOH V 6 .   ? -46.661 40.896  -13.785 1.00 44.33 ? 2074 HOH D O   1 
HETATM 8816 O  O   . HOH V 6 .   ? -45.613 14.621  -15.800 1.00 49.19 ? 2075 HOH D O   1 
HETATM 8817 O  O   . HOH V 6 .   ? -48.098 15.729  -14.175 1.00 44.15 ? 2076 HOH D O   1 
HETATM 8818 O  O   . HOH V 6 .   ? -39.673 16.855  -10.826 1.00 25.47 ? 2077 HOH D O   1 
HETATM 8819 O  O   . HOH V 6 .   ? -22.762 28.103  -20.143 1.00 38.71 ? 2078 HOH D O   1 
HETATM 8820 O  O   . HOH V 6 .   ? -50.210 21.776  -12.585 1.00 38.70 ? 2079 HOH D O   1 
HETATM 8821 O  O   . HOH V 6 .   ? -43.876 14.544  -9.809  1.00 38.42 ? 2080 HOH D O   1 
HETATM 8822 O  O   . HOH V 6 .   ? -36.309 26.135  -28.333 1.00 41.73 ? 2081 HOH D O   1 
HETATM 8823 O  O   . HOH V 6 .   ? -38.486 16.270  -6.063  1.00 41.12 ? 2082 HOH D O   1 
HETATM 8824 O  O   . HOH V 6 .   ? -34.699 17.606  -8.845  1.00 22.11 ? 2083 HOH D O   1 
HETATM 8825 O  O   . HOH V 6 .   ? -37.063 16.830  -11.265 1.00 33.11 ? 2084 HOH D O   1 
HETATM 8826 O  O   . HOH V 6 .   ? -33.076 14.845  -11.879 1.00 25.03 ? 2085 HOH D O   1 
HETATM 8827 O  O   . HOH V 6 .   ? -28.274 15.853  -7.377  1.00 27.38 ? 2086 HOH D O   1 
HETATM 8828 O  O   . HOH V 6 .   ? -28.594 17.770  -4.539  1.00 24.16 ? 2087 HOH D O   1 
HETATM 8829 O  O   . HOH V 6 .   ? -31.140 16.572  -5.972  1.00 22.61 ? 2088 HOH D O   1 
HETATM 8830 O  O   . HOH V 6 .   ? -27.159 17.839  -10.885 1.00 44.74 ? 2089 HOH D O   1 
HETATM 8831 O  O   . HOH V 6 .   ? -26.050 20.043  -2.884  1.00 13.68 ? 2090 HOH D O   1 
HETATM 8832 O  O   . HOH V 6 .   ? -21.365 21.031  -7.076  1.00 33.02 ? 2091 HOH D O   1 
HETATM 8833 O  O   . HOH V 6 .   ? -19.016 17.838  -6.145  1.00 49.91 ? 2092 HOH D O   1 
HETATM 8834 O  O   . HOH V 6 .   ? -23.588 17.621  -0.786  1.00 29.30 ? 2093 HOH D O   1 
HETATM 8835 O  O   . HOH V 6 .   ? -20.883 16.571  -1.904  1.00 43.03 ? 2094 HOH D O   1 
HETATM 8836 O  O   . HOH V 6 .   ? -18.983 22.552  -3.894  1.00 38.58 ? 2095 HOH D O   1 
HETATM 8837 O  O   . HOH V 6 .   ? -22.467 25.428  5.299   1.00 44.87 ? 2096 HOH D O   1 
HETATM 8838 O  O   . HOH V 6 .   ? -22.283 20.894  5.037   1.00 38.77 ? 2097 HOH D O   1 
HETATM 8839 O  O   . HOH V 6 .   ? -38.849 28.449  12.566  1.00 32.77 ? 2098 HOH D O   1 
HETATM 8840 O  O   . HOH V 6 .   ? -31.899 31.833  9.837   1.00 15.11 ? 2099 HOH D O   1 
HETATM 8841 O  O   . HOH V 6 .   ? -24.091 30.583  10.063  1.00 41.46 ? 2100 HOH D O   1 
HETATM 8842 O  O   . HOH V 6 .   ? -27.906 29.262  15.159  1.00 33.63 ? 2101 HOH D O   1 
HETATM 8843 O  O   . HOH V 6 .   ? -22.667 26.068  11.108  1.00 35.20 ? 2102 HOH D O   1 
HETATM 8844 O  O   . HOH V 6 .   ? -26.154 21.625  11.367  1.00 38.82 ? 2103 HOH D O   1 
HETATM 8845 O  O   . HOH V 6 .   ? -45.861 13.554  7.513   1.00 33.77 ? 2104 HOH D O   1 
HETATM 8846 O  O   . HOH V 6 .   ? -32.711 24.172  11.690  1.00 40.74 ? 2105 HOH D O   1 
HETATM 8847 O  O   . HOH V 6 .   ? -29.718 30.799  13.916  1.00 30.96 ? 2106 HOH D O   1 
HETATM 8848 O  O   . HOH V 6 .   ? -29.576 20.609  9.899   1.00 17.11 ? 2107 HOH D O   1 
HETATM 8849 O  O   . HOH V 6 .   ? -24.236 22.800  4.928   1.00 32.24 ? 2108 HOH D O   1 
HETATM 8850 O  O   . HOH V 6 .   ? -20.358 24.864  7.357   1.00 54.17 ? 2109 HOH D O   1 
HETATM 8851 O  O   . HOH V 6 .   ? -19.795 22.521  8.915   1.00 45.04 ? 2110 HOH D O   1 
HETATM 8852 O  O   . HOH V 6 .   ? -30.715 22.381  11.647  1.00 30.75 ? 2111 HOH D O   1 
HETATM 8853 O  O   . HOH V 6 .   ? -25.522 15.651  -1.273  1.00 37.38 ? 2112 HOH D O   1 
HETATM 8854 O  O   . HOH V 6 .   ? -27.072 12.041  1.403   1.00 43.77 ? 2113 HOH D O   1 
HETATM 8855 O  O   . HOH V 6 .   ? -46.901 34.872  -13.277 1.00 35.28 ? 2114 HOH D O   1 
HETATM 8856 O  O   . HOH V 6 .   ? -48.046 36.892  -14.475 1.00 52.48 ? 2115 HOH D O   1 
HETATM 8857 O  O   . HOH V 6 .   ? -49.254 39.649  -16.875 1.00 49.74 ? 2116 HOH D O   1 
HETATM 8858 O  O   . HOH V 6 .   ? -55.824 32.974  -9.524  1.00 48.22 ? 2117 HOH D O   1 
HETATM 8859 O  O   . HOH V 6 .   ? -53.975 35.168  -9.343  1.00 34.17 ? 2118 HOH D O   1 
HETATM 8860 O  O   . HOH V 6 .   ? -51.337 31.256  -1.826  1.00 27.52 ? 2119 HOH D O   1 
HETATM 8861 O  O   . HOH V 6 .   ? -53.132 35.332  0.909   1.00 22.82 ? 2120 HOH D O   1 
HETATM 8862 O  O   . HOH V 6 .   ? -47.655 44.185  0.398   1.00 50.82 ? 2121 HOH D O   1 
HETATM 8863 O  O   . HOH V 6 .   ? -51.167 44.874  0.479   1.00 49.64 ? 2122 HOH D O   1 
HETATM 8864 O  O   . HOH V 6 .   ? -52.298 40.614  -5.062  1.00 34.20 ? 2123 HOH D O   1 
HETATM 8865 O  O   . HOH V 6 .   ? -52.958 43.384  -4.255  1.00 45.61 ? 2124 HOH D O   1 
HETATM 8866 O  O   . HOH V 6 .   ? -51.341 45.006  -3.093  1.00 50.81 ? 2125 HOH D O   1 
HETATM 8867 O  O   . HOH V 6 .   ? -45.857 42.380  -6.872  1.00 39.62 ? 2126 HOH D O   1 
HETATM 8868 O  O   . HOH V 6 .   ? -48.734 41.047  -8.274  1.00 38.31 ? 2127 HOH D O   1 
HETATM 8869 O  O   . HOH V 6 .   ? -55.141 31.997  -1.115  1.00 36.63 ? 2128 HOH D O   1 
HETATM 8870 O  O   . HOH V 6 .   ? -55.123 34.976  -0.939  1.00 46.20 ? 2129 HOH D O   1 
HETATM 8871 O  O   . HOH V 6 .   ? -24.960 14.618  5.664   1.00 22.97 ? 2130 HOH D O   1 
HETATM 8872 O  O   . HOH V 6 .   ? -23.656 15.918  9.291   1.00 40.93 ? 2131 HOH D O   1 
HETATM 8873 O  O   . HOH V 6 .   ? -26.112 12.604  8.693   1.00 38.76 ? 2132 HOH D O   1 
HETATM 8874 O  O   . HOH V 6 .   ? -27.502 19.013  11.090  1.00 47.50 ? 2133 HOH D O   1 
HETATM 8875 O  O   . HOH V 6 .   ? -29.791 9.750   7.657   1.00 25.03 ? 2134 HOH D O   1 
HETATM 8876 O  O   . HOH V 6 .   ? -29.799 13.187  -0.831  1.00 42.14 ? 2135 HOH D O   1 
HETATM 8877 O  O   . HOH V 6 .   ? -29.010 6.037   2.931   1.00 36.52 ? 2136 HOH D O   1 
HETATM 8878 O  O   . HOH V 6 .   ? -33.382 12.222  -1.020  1.00 37.25 ? 2137 HOH D O   1 
HETATM 8879 O  O   . HOH V 6 .   ? -41.070 8.702   4.147   1.00 44.30 ? 2138 HOH D O   1 
HETATM 8880 O  O   . HOH V 6 .   ? -39.817 10.736  7.559   1.00 25.65 ? 2139 HOH D O   1 
HETATM 8881 O  O   . HOH V 6 .   ? -38.805 18.390  7.571   1.00 18.30 ? 2140 HOH D O   1 
HETATM 8882 O  O   . HOH V 6 .   ? -41.040 17.711  5.979   1.00 15.64 ? 2141 HOH D O   1 
HETATM 8883 O  O   . HOH V 6 .   ? -44.159 13.771  12.171  1.00 45.99 ? 2142 HOH D O   1 
HETATM 8884 O  O   . HOH V 6 .   ? -41.922 17.857  13.042  1.00 39.77 ? 2143 HOH D O   1 
HETATM 8885 O  O   . HOH V 6 .   ? -40.351 8.878   9.590   1.00 50.88 ? 2144 HOH D O   1 
HETATM 8886 O  O   . HOH V 6 .   ? -35.694 8.268   11.786  1.00 44.50 ? 2145 HOH D O   1 
HETATM 8887 O  O   . HOH V 6 .   ? -34.863 16.633  13.203  1.00 20.28 ? 2146 HOH D O   1 
HETATM 8888 O  O   . HOH V 6 .   ? -35.374 28.035  5.177   1.00 13.57 ? 2147 HOH D O   1 
HETATM 8889 O  O   . HOH V 6 .   ? -38.481 37.966  -1.902  1.00 17.92 ? 2148 HOH D O   1 
HETATM 8890 O  O   . HOH V 6 .   ? -44.630 45.455  -4.457  1.00 56.97 ? 2149 HOH D O   1 
HETATM 8891 O  O   . HOH V 6 .   ? -44.289 43.296  -10.423 1.00 35.52 ? 2150 HOH D O   1 
HETATM 8892 O  O   . HOH V 6 .   ? -42.801 45.446  -9.502  1.00 54.84 ? 2151 HOH D O   1 
HETATM 8893 O  O   . HOH V 6 .   ? -46.222 42.997  -12.414 1.00 54.93 ? 2152 HOH D O   1 
HETATM 8894 O  O   . HOH V 6 .   ? -40.285 44.728  -18.224 1.00 41.79 ? 2153 HOH D O   1 
HETATM 8895 O  O   . HOH V 6 .   ? -35.436 45.051  -14.000 1.00 41.94 ? 2154 HOH D O   1 
HETATM 8896 O  O   . HOH V 6 .   ? -32.889 47.994  -17.918 1.00 49.31 ? 2155 HOH D O   1 
HETATM 8897 O  O   . HOH V 6 .   ? -34.067 42.405  -14.155 1.00 43.45 ? 2156 HOH D O   1 
HETATM 8898 O  O   . HOH V 6 .   ? -33.009 44.533  -20.424 1.00 41.55 ? 2157 HOH D O   1 
HETATM 8899 O  O   . HOH V 6 .   ? -29.524 40.489  -14.694 1.00 41.68 ? 2158 HOH D O   1 
HETATM 8900 O  O   . HOH V 6 .   ? -28.878 37.084  -21.337 1.00 50.09 ? 2159 HOH D O   1 
HETATM 8901 O  O   . HOH V 6 .   ? -36.737 40.304  -21.666 1.00 38.00 ? 2160 HOH D O   1 
HETATM 8902 O  O   . HOH V 6 .   ? -36.414 37.433  -22.508 1.00 45.20 ? 2161 HOH D O   1 
HETATM 8903 O  O   . HOH V 6 .   ? -34.736 37.155  -24.901 1.00 54.78 ? 2162 HOH D O   1 
HETATM 8904 O  O   . HOH V 6 .   ? -31.749 37.809  -9.996  1.00 40.09 ? 2163 HOH D O   1 
HETATM 8905 O  O   . HOH V 6 .   ? -28.048 34.803  -19.767 1.00 37.90 ? 2164 HOH D O   1 
HETATM 8906 O  O   . HOH V 6 .   ? -26.029 35.073  -16.493 1.00 47.64 ? 2165 HOH D O   1 
HETATM 8907 O  O   . HOH V 6 .   ? -36.218 33.416  -22.818 1.00 40.29 ? 2166 HOH D O   1 
HETATM 8908 O  O   . HOH V 6 .   ? -38.074 35.399  -21.679 1.00 43.81 ? 2167 HOH D O   1 
HETATM 8909 O  O   . HOH V 6 .   ? -31.965 34.353  -24.657 1.00 40.16 ? 2168 HOH D O   1 
HETATM 8910 O  O   . HOH V 6 .   ? -29.112 32.909  -21.126 1.00 41.05 ? 2169 HOH D O   1 
HETATM 8911 O  O   . HOH V 6 .   ? -29.148 27.529  -20.115 1.00 32.77 ? 2170 HOH D O   1 
HETATM 8912 O  O   . HOH V 6 .   ? -24.232 28.841  -17.695 1.00 33.38 ? 2171 HOH D O   1 
HETATM 8913 O  O   . HOH V 6 .   ? -24.192 32.020  -14.351 1.00 35.79 ? 2172 HOH D O   1 
HETATM 8914 O  O   . HOH V 6 .   ? -27.775 27.410  -17.785 1.00 25.69 ? 2173 HOH D O   1 
HETATM 8915 O  O   . HOH V 6 .   ? -38.138 29.287  -23.956 1.00 25.07 ? 2174 HOH D O   1 
HETATM 8916 O  O   . HOH V 6 .   ? -36.253 26.299  -25.441 1.00 42.89 ? 2175 HOH D O   1 
HETATM 8917 O  O   . HOH V 6 .   ? -36.717 29.724  -26.219 1.00 42.68 ? 2176 HOH D O   1 
HETATM 8918 O  O   . HOH V 6 .   ? -30.653 29.629  -24.699 1.00 41.68 ? 2177 HOH D O   1 
HETATM 8919 O  O   . HOH V 6 .   ? -29.356 19.656  -23.606 1.00 34.21 ? 2178 HOH D O   1 
HETATM 8920 O  O   . HOH V 6 .   ? -41.337 19.626  -25.112 1.00 30.46 ? 2179 HOH D O   1 
HETATM 8921 O  O   . HOH V 6 .   ? -38.416 19.697  -27.784 1.00 44.12 ? 2180 HOH D O   1 
HETATM 8922 O  O   . HOH V 6 .   ? -36.596 18.434  -24.261 1.00 44.42 ? 2181 HOH D O   1 
HETATM 8923 O  O   . HOH V 6 .   ? -37.292 23.465  -28.900 1.00 56.16 ? 2182 HOH D O   1 
HETATM 8924 O  O   . HOH V 6 .   ? -41.765 13.763  -26.937 1.00 43.79 ? 2183 HOH D O   1 
HETATM 8925 O  O   . HOH V 6 .   ? -48.083 18.579  -22.782 1.00 37.59 ? 2184 HOH D O   1 
HETATM 8926 O  O   . HOH V 6 .   ? -46.332 13.311  -18.185 1.00 47.63 ? 2185 HOH D O   1 
HETATM 8927 O  O   . HOH V 6 .   ? -51.480 13.800  -17.378 1.00 44.29 ? 2186 HOH D O   1 
HETATM 8928 O  O   . HOH V 6 .   ? -34.816 15.141  -14.175 1.00 42.48 ? 2187 HOH D O   1 
HETATM 8929 O  O   . HOH V 6 .   ? -30.837 17.119  -22.529 1.00 41.15 ? 2188 HOH D O   1 
HETATM 8930 O  O   . HOH V 6 .   ? -28.610 16.229  -23.191 1.00 26.85 ? 2189 HOH D O   1 
HETATM 8931 O  O   . HOH V 6 .   ? -23.253 35.247  -11.331 1.00 45.53 ? 2190 HOH D O   1 
HETATM 8932 O  O   . HOH V 6 .   ? -27.898 36.560  -4.547  1.00 35.53 ? 2191 HOH D O   1 
HETATM 8933 O  O   . HOH V 6 .   ? -23.525 33.139  -2.454  1.00 48.05 ? 2192 HOH D O   1 
HETATM 8934 O  O   . HOH V 6 .   ? -30.671 39.027  -7.572  1.00 46.24 ? 2193 HOH D O   1 
HETATM 8935 O  O   . HOH V 6 .   ? -26.691 40.096  2.455   1.00 35.35 ? 2194 HOH D O   1 
HETATM 8936 O  O   . HOH V 6 .   ? -26.678 42.700  0.954   1.00 48.45 ? 2195 HOH D O   1 
HETATM 8937 O  O   . HOH V 6 .   ? -33.769 40.207  1.455   1.00 17.97 ? 2196 HOH D O   1 
HETATM 8938 O  O   . HOH V 6 .   ? -29.504 44.386  4.282   1.00 41.72 ? 2197 HOH D O   1 
HETATM 8939 O  O   . HOH V 6 .   ? -39.435 31.132  13.010  1.00 46.11 ? 2198 HOH D O   1 
HETATM 8940 O  O   . HOH V 6 .   ? -36.669 30.365  13.437  1.00 42.86 ? 2199 HOH D O   1 
HETATM 8941 O  O   . HOH V 6 .   ? -43.523 29.374  12.760  1.00 19.80 ? 2200 HOH D O   1 
HETATM 8942 O  O   . HOH V 6 .   ? -39.662 26.359  14.339  1.00 33.54 ? 2201 HOH D O   1 
HETATM 8943 O  O   . HOH V 6 .   ? -38.712 22.668  14.993  1.00 29.72 ? 2202 HOH D O   1 
HETATM 8944 O  O   . HOH V 6 .   ? -41.460 20.342  14.281  1.00 26.00 ? 2203 HOH D O   1 
HETATM 8945 O  O   . HOH V 6 .   ? -44.552 22.384  11.405  1.00 30.79 ? 2204 HOH D O   1 
HETATM 8946 O  O   . HOH V 6 .   ? -43.732 15.805  -3.876  1.00 34.40 ? 2205 HOH D O   1 
HETATM 8947 O  O   . HOH V 6 .   ? -46.311 16.102  8.516   1.00 18.74 ? 2206 HOH D O   1 
HETATM 8948 O  O   . HOH V 6 .   ? -46.362 19.890  13.581  1.00 27.13 ? 2207 HOH D O   1 
HETATM 8949 O  O   . HOH V 6 .   ? -45.797 17.938  12.365  1.00 47.22 ? 2208 HOH D O   1 
HETATM 8950 O  O   . HOH V 6 .   ? -34.953 44.164  1.498   1.00 42.59 ? 2209 HOH D O   1 
HETATM 8951 O  O   . HOH V 6 .   ? -41.875 43.586  3.647   1.00 40.86 ? 2210 HOH D O   1 
HETATM 8952 O  O   . HOH V 6 .   ? -35.973 44.284  -5.485  1.00 46.57 ? 2211 HOH D O   1 
HETATM 8953 O  O   . HOH V 6 .   ? -32.712 41.347  -6.491  1.00 45.52 ? 2212 HOH D O   1 
HETATM 8954 O  O   . HOH V 6 .   ? -33.514 41.651  -9.507  1.00 30.65 ? 2213 HOH D O   1 
HETATM 8955 O  O   . HOH V 6 .   ? -40.158 43.106  -21.193 1.00 37.64 ? 2214 HOH D O   1 
HETATM 8956 O  O   . HOH V 6 .   ? -45.968 39.394  -18.750 1.00 45.08 ? 2215 HOH D O   1 
HETATM 8957 O  O   . HOH V 6 .   ? -45.884 28.213  -18.607 1.00 25.85 ? 2216 HOH D O   1 
HETATM 8958 O  O   . HOH V 6 .   ? -44.834 26.446  -25.649 1.00 31.91 ? 2217 HOH D O   1 
HETATM 8959 O  O   . HOH V 6 .   ? -40.657 30.307  -24.561 1.00 33.58 ? 2218 HOH D O   1 
HETATM 8960 O  O   . HOH V 6 .   ? -50.693 19.590  -21.913 1.00 48.36 ? 2219 HOH D O   1 
HETATM 8961 O  O   . HOH V 6 .   ? -51.186 24.214  -14.017 1.00 46.07 ? 2220 HOH D O   1 
HETATM 8962 O  O   . HOH V 6 .   ? -54.150 32.439  -19.220 1.00 47.43 ? 2221 HOH D O   1 
HETATM 8963 O  O   . HOH V 6 .   ? -54.495 28.167  -8.267  1.00 38.82 ? 2222 HOH D O   1 
HETATM 8964 O  O   . HOH V 6 .   ? -54.619 22.958  -0.481  1.00 34.98 ? 2223 HOH D O   1 
HETATM 8965 O  O   . HOH V 6 .   ? -54.943 24.891  -2.800  1.00 30.79 ? 2224 HOH D O   1 
HETATM 8966 O  O   . HOH V 6 .   ? -54.282 24.704  6.860   1.00 26.41 ? 2225 HOH D O   1 
HETATM 8967 O  O   . HOH V 6 .   ? -56.289 24.933  0.698   1.00 42.53 ? 2226 HOH D O   1 
HETATM 8968 O  O   . HOH V 6 .   ? -52.412 32.906  13.994  1.00 24.56 ? 2227 HOH D O   1 
HETATM 8969 O  O   . HOH V 6 .   ? -56.382 24.019  10.205  1.00 21.55 ? 2228 HOH D O   1 
HETATM 8970 O  O   . HOH V 6 .   ? -49.973 34.220  14.454  1.00 36.50 ? 2229 HOH D O   1 
HETATM 8971 O  O   . HOH V 6 .   ? -44.718 29.998  16.376  1.00 22.65 ? 2230 HOH D O   1 
HETATM 8972 O  O   . HOH V 6 .   ? -41.484 31.184  14.757  1.00 40.60 ? 2231 HOH D O   1 
HETATM 8973 O  O   . HOH V 6 .   ? -30.833 42.776  9.665   1.00 42.90 ? 2232 HOH D O   1 
HETATM 8974 O  O   . HOH V 6 .   ? -39.879 43.020  12.294  1.00 32.84 ? 2233 HOH D O   1 
HETATM 8975 O  O   . HOH V 6 .   ? -39.300 47.182  9.362   1.00 39.38 ? 2234 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   3   ?   ?   ?   A . n 
A 1 2   PRO 2   4   ?   ?   ?   A . n 
A 1 3   ASP 3   5   ?   ?   ?   A . n 
A 1 4   GLN 4   6   ?   ?   ?   A . n 
A 1 5   SER 5   7   ?   ?   ?   A . n 
A 1 6   HIS 6   8   ?   ?   ?   A . n 
A 1 7   TRP 7   9   9   TRP TRP A . n 
A 1 8   ARG 8   10  10  ARG ARG A . n 
A 1 9   TYR 9   11  11  TYR TYR A . n 
A 1 10  GLY 10  12  12  GLY GLY A . n 
A 1 11  GLY 11  13  13  GLY GLY A . n 
A 1 12  ASP 12  14  14  ASP ASP A . n 
A 1 13  PRO 13  15  15  PRO PRO A . n 
A 1 14  PRO 14  16  16  PRO PRO A . n 
A 1 15  TRP 15  17  17  TRP TRP A . n 
A 1 16  PRO 16  18  18  PRO PRO A . n 
A 1 17  ARG 17  19  19  ARG ARG A . n 
A 1 18  VAL 18  20  20  VAL VAL A . n 
A 1 19  SER 19  21  21  SER SER A . n 
A 1 20  PRO 20  22  22  PRO PRO A . n 
A 1 21  ALA 21  23  23  ALA ALA A . n 
A 1 22  CYS 22  24  24  CYS CYS A . n 
A 1 23  ALA 23  25  25  ALA ALA A . n 
A 1 24  GLY 24  26  26  GLY GLY A . n 
A 1 25  ARG 25  27  27  ARG ARG A . n 
A 1 26  PHE 26  28  28  PHE PHE A . n 
A 1 27  GLN 27  29  29  GLN GLN A . n 
A 1 28  SER 28  30  30  SER SER A . n 
A 1 29  PRO 29  31  31  PRO PRO A . n 
A 1 30  VAL 30  32  32  VAL VAL A . n 
A 1 31  ASP 31  33  33  ASP ASP A . n 
A 1 32  ILE 32  34  34  ILE ILE A . n 
A 1 33  ARG 33  35  35  ARG ARG A . n 
A 1 34  PRO 34  36  36  PRO PRO A . n 
A 1 35  GLN 35  37  37  GLN GLN A . n 
A 1 36  LEU 36  38  38  LEU LEU A . n 
A 1 37  ALA 37  39  39  ALA ALA A . n 
A 1 38  ALA 38  40  40  ALA ALA A . n 
A 1 39  PHE 39  41  41  PHE PHE A . n 
A 1 40  SER 40  42  42  SER SER A . n 
A 1 41  PRO 41  43  43  PRO PRO A . n 
A 1 42  ALA 42  44  44  ALA ALA A . n 
A 1 43  LEU 43  45  45  LEU LEU A . n 
A 1 44  ARG 44  46  46  ARG ARG A . n 
A 1 45  PRO 45  47  47  PRO PRO A . n 
A 1 46  LEU 46  48  48  LEU LEU A . n 
A 1 47  GLU 47  49  49  GLU GLU A . n 
A 1 48  LEU 48  50  50  LEU LEU A . n 
A 1 49  LEU 49  51  51  LEU LEU A . n 
A 1 50  GLY 50  52  52  GLY GLY A . n 
A 1 51  PHE 51  53  53  PHE PHE A . n 
A 1 52  GLN 52  54  54  GLN GLN A . n 
A 1 53  LEU 53  55  55  LEU LEU A . n 
A 1 54  PRO 54  56  56  PRO PRO A . n 
A 1 55  PRO 55  57  57  PRO PRO A . n 
A 1 56  LEU 56  58  58  LEU LEU A . n 
A 1 57  PRO 57  59  59  PRO PRO A . n 
A 1 58  GLU 58  60  60  GLU GLU A . n 
A 1 59  LEU 59  61  61  LEU LEU A . n 
A 1 60  ARG 60  62  62  ARG ARG A . n 
A 1 61  LEU 61  63  63  LEU LEU A . n 
A 1 62  ARG 62  64  64  ARG ARG A . n 
A 1 63  ASN 63  65  65  ASN ASN A . n 
A 1 64  ASN 64  66  66  ASN ASN A . n 
A 1 65  GLY 65  67  67  GLY GLY A . n 
A 1 66  HIS 66  68  68  HIS HIS A . n 
A 1 67  SER 67  69  69  SER SER A . n 
A 1 68  VAL 68  70  70  VAL VAL A . n 
A 1 69  GLN 69  71  71  GLN GLN A . n 
A 1 70  LEU 70  72  72  LEU LEU A . n 
A 1 71  THR 71  73  73  THR THR A . n 
A 1 72  LEU 72  74  74  LEU LEU A . n 
A 1 73  PRO 73  75  75  PRO PRO A . n 
A 1 74  PRO 74  76  76  PRO PRO A . n 
A 1 75  GLY 75  77  77  GLY GLY A . n 
A 1 76  LEU 76  78  78  LEU LEU A . n 
A 1 77  GLU 77  79  79  GLU GLU A . n 
A 1 78  MET 78  80  80  MET MET A . n 
A 1 79  ALA 79  81  81  ALA ALA A . n 
A 1 80  LEU 80  82  82  LEU LEU A . n 
A 1 81  GLY 81  83  83  GLY GLY A . n 
A 1 82  PRO 82  84  84  PRO PRO A . n 
A 1 83  GLY 83  85  85  GLY GLY A . n 
A 1 84  ARG 84  86  86  ARG ARG A . n 
A 1 85  GLU 85  87  87  GLU GLU A . n 
A 1 86  TYR 86  88  88  TYR TYR A . n 
A 1 87  ARG 87  89  89  ARG ARG A . n 
A 1 88  ALA 88  90  90  ALA ALA A . n 
A 1 89  LEU 89  91  91  LEU LEU A . n 
A 1 90  GLN 90  92  92  GLN GLN A . n 
A 1 91  LEU 91  93  93  LEU LEU A . n 
A 1 92  HIS 92  94  94  HIS HIS A . n 
A 1 93  LEU 93  95  95  LEU LEU A . n 
A 1 94  HIS 94  96  96  HIS HIS A . n 
A 1 95  TRP 95  97  97  TRP TRP A . n 
A 1 96  GLY 96  98  98  GLY GLY A . n 
A 1 97  ALA 97  99  99  ALA ALA A . n 
A 1 98  ALA 98  100 100 ALA ALA A . n 
A 1 99  GLY 99  101 101 GLY GLY A . n 
A 1 100 ARG 100 102 102 ARG ARG A . n 
A 1 101 PRO 101 103 103 PRO PRO A . n 
A 1 102 GLY 102 104 104 GLY GLY A . n 
A 1 103 SER 103 105 105 SER SER A . n 
A 1 104 GLU 104 106 106 GLU GLU A . n 
A 1 105 HIS 105 107 107 HIS HIS A . n 
A 1 106 THR 106 108 108 THR THR A . n 
A 1 107 VAL 107 109 109 VAL VAL A . n 
A 1 108 GLU 108 110 110 GLU GLU A . n 
A 1 109 GLY 109 111 111 GLY GLY A . n 
A 1 110 HIS 110 112 112 HIS HIS A . n 
A 1 111 ARG 111 113 113 ARG ARG A . n 
A 1 112 PHE 112 114 114 PHE PHE A . n 
A 1 113 PRO 113 115 115 PRO PRO A . n 
A 1 114 ALA 114 116 116 ALA ALA A . n 
A 1 115 GLU 115 117 117 GLU GLU A . n 
A 1 116 ILE 116 118 118 ILE ILE A . n 
A 1 117 HIS 117 119 119 HIS HIS A . n 
A 1 118 VAL 118 120 120 VAL VAL A . n 
A 1 119 VAL 119 121 121 VAL VAL A . n 
A 1 120 HIS 120 122 122 HIS HIS A . n 
A 1 121 LEU 121 123 123 LEU LEU A . n 
A 1 122 SER 122 124 124 SER SER A . n 
A 1 123 THR 123 125 125 THR THR A . n 
A 1 124 ALA 124 126 126 ALA ALA A . n 
A 1 125 PHE 125 127 127 PHE PHE A . n 
A 1 126 ALA 126 128 128 ALA ALA A . n 
A 1 127 ARG 127 129 129 ARG ARG A . n 
A 1 128 VAL 128 130 130 VAL VAL A . n 
A 1 129 ASP 129 131 131 ASP ASP A . n 
A 1 130 GLU 130 132 132 GLU GLU A . n 
A 1 131 ALA 131 133 133 ALA ALA A . n 
A 1 132 LEU 132 134 134 LEU LEU A . n 
A 1 133 GLY 133 135 135 GLY GLY A . n 
A 1 134 ARG 134 136 136 ARG ARG A . n 
A 1 135 PRO 135 137 137 PRO PRO A . n 
A 1 136 GLY 136 138 138 GLY GLY A . n 
A 1 137 GLY 137 139 139 GLY GLY A . n 
A 1 138 LEU 138 140 140 LEU LEU A . n 
A 1 139 ALA 139 141 141 ALA ALA A . n 
A 1 140 VAL 140 142 142 VAL VAL A . n 
A 1 141 LEU 141 143 143 LEU LEU A . n 
A 1 142 ALA 142 144 144 ALA ALA A . n 
A 1 143 ALA 143 145 145 ALA ALA A . n 
A 1 144 PHE 144 146 146 PHE PHE A . n 
A 1 145 LEU 145 147 147 LEU LEU A . n 
A 1 146 GLU 146 148 148 GLU GLU A . n 
A 1 147 GLU 147 149 149 GLU GLU A . n 
A 1 148 GLY 148 150 150 GLY GLY A . n 
A 1 149 PRO 149 151 151 PRO PRO A . n 
A 1 150 GLU 150 152 152 GLU GLU A . n 
A 1 151 GLU 151 153 153 GLU GLU A . n 
A 1 152 ASN 152 154 154 ASN ASN A . n 
A 1 153 SER 153 155 155 SER SER A . n 
A 1 154 ALA 154 156 156 ALA ALA A . n 
A 1 155 TYR 155 157 157 TYR TYR A . n 
A 1 156 GLU 156 158 158 GLU GLU A . n 
A 1 157 GLN 157 159 159 GLN GLN A . n 
A 1 158 LEU 158 160 160 LEU LEU A . n 
A 1 159 LEU 159 161 161 LEU LEU A . n 
A 1 160 SER 160 162 162 SER SER A . n 
A 1 161 ARG 161 163 163 ARG ARG A . n 
A 1 162 LEU 162 164 164 LEU LEU A . n 
A 1 163 GLU 163 165 165 GLU GLU A . n 
A 1 164 GLU 164 166 166 GLU GLU A . n 
A 1 165 ILE 165 167 167 ILE ILE A . n 
A 1 166 ALA 166 168 168 ALA ALA A . n 
A 1 167 GLU 167 169 169 GLU GLU A . n 
A 1 168 GLU 168 170 170 GLU GLU A . n 
A 1 169 GLY 169 171 171 GLY GLY A . n 
A 1 170 SER 170 172 172 SER SER A . n 
A 1 171 GLU 171 173 173 GLU GLU A . n 
A 1 172 THR 172 174 174 THR THR A . n 
A 1 173 GLN 173 175 175 GLN GLN A . n 
A 1 174 VAL 174 176 176 VAL VAL A . n 
A 1 175 PRO 175 177 177 PRO PRO A . n 
A 1 176 GLY 176 178 178 GLY GLY A . n 
A 1 177 LEU 177 179 179 LEU LEU A . n 
A 1 178 ASP 178 180 180 ASP ASP A . n 
A 1 179 ILE 179 181 181 ILE ILE A . n 
A 1 180 SER 180 182 182 SER SER A . n 
A 1 181 ALA 181 183 183 ALA ALA A . n 
A 1 182 LEU 182 184 184 LEU LEU A . n 
A 1 183 LEU 183 185 185 LEU LEU A . n 
A 1 184 PRO 184 186 186 PRO PRO A . n 
A 1 185 SER 185 187 187 SER SER A . n 
A 1 186 ASP 186 188 188 ASP ASP A . n 
A 1 187 PHE 187 189 189 PHE PHE A . n 
A 1 188 SER 188 190 190 SER SER A . n 
A 1 189 ARG 189 191 191 ARG ARG A . n 
A 1 190 TYR 190 192 192 TYR TYR A . n 
A 1 191 PHE 191 193 193 PHE PHE A . n 
A 1 192 GLN 192 194 194 GLN GLN A . n 
A 1 193 TYR 193 195 195 TYR TYR A . n 
A 1 194 GLU 194 196 196 GLU GLU A . n 
A 1 195 GLY 195 197 197 GLY GLY A . n 
A 1 196 SER 196 198 198 SER SER A . n 
A 1 197 LEU 197 199 199 LEU LEU A . n 
A 1 198 THR 198 200 200 THR THR A . n 
A 1 199 THR 199 201 201 THR THR A . n 
A 1 200 PRO 200 202 202 PRO PRO A . n 
A 1 201 PRO 201 203 203 PRO PRO A . n 
A 1 202 CYS 202 204 204 CYS CYS A . n 
A 1 203 ALA 203 205 205 ALA ALA A . n 
A 1 204 GLN 204 206 206 GLN GLN A . n 
A 1 205 GLY 205 207 207 GLY GLY A . n 
A 1 206 VAL 206 208 208 VAL VAL A . n 
A 1 207 ILE 207 209 209 ILE ILE A . n 
A 1 208 TRP 208 210 210 TRP TRP A . n 
A 1 209 THR 209 211 211 THR THR A . n 
A 1 210 VAL 210 212 212 VAL VAL A . n 
A 1 211 PHE 211 213 213 PHE PHE A . n 
A 1 212 ASN 212 214 214 ASN ASN A . n 
A 1 213 GLN 213 215 215 GLN GLN A . n 
A 1 214 THR 214 216 216 THR THR A . n 
A 1 215 VAL 215 217 217 VAL VAL A . n 
A 1 216 MET 216 218 218 MET MET A . n 
A 1 217 LEU 217 219 219 LEU LEU A . n 
A 1 218 SER 218 220 220 SER SER A . n 
A 1 219 ALA 219 221 221 ALA ALA A . n 
A 1 220 LYS 220 222 222 LYS LYS A . n 
A 1 221 GLN 221 223 223 GLN GLN A . n 
A 1 222 LEU 222 224 224 LEU LEU A . n 
A 1 223 HIS 223 225 225 HIS HIS A . n 
A 1 224 THR 224 226 226 THR THR A . n 
A 1 225 LEU 225 227 227 LEU LEU A . n 
A 1 226 SER 226 228 228 SER SER A . n 
A 1 227 ASP 227 229 229 ASP ASP A . n 
A 1 228 THR 228 230 230 THR THR A . n 
A 1 229 LEU 229 231 231 LEU LEU A . n 
A 1 230 TRP 230 232 232 TRP TRP A . n 
A 1 231 GLY 231 233 233 GLY GLY A . n 
A 1 232 PRO 232 234 234 PRO PRO A . n 
A 1 233 GLY 233 235 235 GLY GLY A . n 
A 1 234 ASP 234 236 236 ASP ASP A . n 
A 1 235 SER 235 237 237 SER SER A . n 
A 1 236 ARG 236 238 238 ARG ARG A . n 
A 1 237 LEU 237 239 239 LEU LEU A . n 
A 1 238 GLN 238 240 240 GLN GLN A . n 
A 1 239 LEU 239 241 241 LEU LEU A . n 
A 1 240 ASN 240 242 242 ASN ASN A . n 
A 1 241 PHE 241 243 243 PHE PHE A . n 
A 1 242 ARG 242 244 244 ARG ARG A . n 
A 1 243 ALA 243 245 245 ALA ALA A . n 
A 1 244 THR 244 246 246 THR THR A . n 
A 1 245 GLN 245 247 247 GLN GLN A . n 
A 1 246 PRO 246 248 248 PRO PRO A . n 
A 1 247 LEU 247 249 249 LEU LEU A . n 
A 1 248 ASN 248 250 250 ASN ASN A . n 
A 1 249 GLY 249 251 251 GLY GLY A . n 
A 1 250 ARG 250 252 252 ARG ARG A . n 
A 1 251 VAL 251 253 253 VAL VAL A . n 
A 1 252 ILE 252 254 254 ILE ILE A . n 
A 1 253 GLU 253 255 255 GLU GLU A . n 
A 1 254 ALA 254 256 256 ALA ALA A . n 
A 1 255 SER 255 257 257 SER SER A . n 
A 1 256 PHE 256 258 258 PHE PHE A . n 
A 1 257 PRO 257 259 259 PRO PRO A . n 
B 1 1   GLY 1   3   ?   ?   ?   B . n 
B 1 2   PRO 2   4   ?   ?   ?   B . n 
B 1 3   ASP 3   5   ?   ?   ?   B . n 
B 1 4   GLN 4   6   ?   ?   ?   B . n 
B 1 5   SER 5   7   ?   ?   ?   B . n 
B 1 6   HIS 6   8   ?   ?   ?   B . n 
B 1 7   TRP 7   9   9   TRP TRP B . n 
B 1 8   ARG 8   10  10  ARG ARG B . n 
B 1 9   TYR 9   11  11  TYR TYR B . n 
B 1 10  GLY 10  12  12  GLY GLY B . n 
B 1 11  GLY 11  13  13  GLY GLY B . n 
B 1 12  ASP 12  14  14  ASP ASP B . n 
B 1 13  PRO 13  15  15  PRO PRO B . n 
B 1 14  PRO 14  16  16  PRO PRO B . n 
B 1 15  TRP 15  17  17  TRP TRP B . n 
B 1 16  PRO 16  18  18  PRO PRO B . n 
B 1 17  ARG 17  19  19  ARG ARG B . n 
B 1 18  VAL 18  20  20  VAL VAL B . n 
B 1 19  SER 19  21  21  SER SER B . n 
B 1 20  PRO 20  22  22  PRO PRO B . n 
B 1 21  ALA 21  23  23  ALA ALA B . n 
B 1 22  CYS 22  24  24  CYS CYS B . n 
B 1 23  ALA 23  25  25  ALA ALA B . n 
B 1 24  GLY 24  26  26  GLY GLY B . n 
B 1 25  ARG 25  27  27  ARG ARG B . n 
B 1 26  PHE 26  28  28  PHE PHE B . n 
B 1 27  GLN 27  29  29  GLN GLN B . n 
B 1 28  SER 28  30  30  SER SER B . n 
B 1 29  PRO 29  31  31  PRO PRO B . n 
B 1 30  VAL 30  32  32  VAL VAL B . n 
B 1 31  ASP 31  33  33  ASP ASP B . n 
B 1 32  ILE 32  34  34  ILE ILE B . n 
B 1 33  ARG 33  35  35  ARG ARG B . n 
B 1 34  PRO 34  36  36  PRO PRO B . n 
B 1 35  GLN 35  37  37  GLN GLN B . n 
B 1 36  LEU 36  38  38  LEU LEU B . n 
B 1 37  ALA 37  39  39  ALA ALA B . n 
B 1 38  ALA 38  40  40  ALA ALA B . n 
B 1 39  PHE 39  41  41  PHE PHE B . n 
B 1 40  SER 40  42  42  SER SER B . n 
B 1 41  PRO 41  43  43  PRO PRO B . n 
B 1 42  ALA 42  44  44  ALA ALA B . n 
B 1 43  LEU 43  45  45  LEU LEU B . n 
B 1 44  ARG 44  46  46  ARG ARG B . n 
B 1 45  PRO 45  47  47  PRO PRO B . n 
B 1 46  LEU 46  48  48  LEU LEU B . n 
B 1 47  GLU 47  49  49  GLU GLU B . n 
B 1 48  LEU 48  50  50  LEU LEU B . n 
B 1 49  LEU 49  51  51  LEU LEU B . n 
B 1 50  GLY 50  52  52  GLY GLY B . n 
B 1 51  PHE 51  53  53  PHE PHE B . n 
B 1 52  GLN 52  54  54  GLN GLN B . n 
B 1 53  LEU 53  55  55  LEU LEU B . n 
B 1 54  PRO 54  56  56  PRO PRO B . n 
B 1 55  PRO 55  57  57  PRO PRO B . n 
B 1 56  LEU 56  58  58  LEU LEU B . n 
B 1 57  PRO 57  59  59  PRO PRO B . n 
B 1 58  GLU 58  60  60  GLU GLU B . n 
B 1 59  LEU 59  61  61  LEU LEU B . n 
B 1 60  ARG 60  62  62  ARG ARG B . n 
B 1 61  LEU 61  63  63  LEU LEU B . n 
B 1 62  ARG 62  64  64  ARG ARG B . n 
B 1 63  ASN 63  65  65  ASN ASN B . n 
B 1 64  ASN 64  66  66  ASN ASN B . n 
B 1 65  GLY 65  67  67  GLY GLY B . n 
B 1 66  HIS 66  68  68  HIS HIS B . n 
B 1 67  SER 67  69  69  SER SER B . n 
B 1 68  VAL 68  70  70  VAL VAL B . n 
B 1 69  GLN 69  71  71  GLN GLN B . n 
B 1 70  LEU 70  72  72  LEU LEU B . n 
B 1 71  THR 71  73  73  THR THR B . n 
B 1 72  LEU 72  74  74  LEU LEU B . n 
B 1 73  PRO 73  75  75  PRO PRO B . n 
B 1 74  PRO 74  76  76  PRO PRO B . n 
B 1 75  GLY 75  77  77  GLY GLY B . n 
B 1 76  LEU 76  78  78  LEU LEU B . n 
B 1 77  GLU 77  79  79  GLU GLU B . n 
B 1 78  MET 78  80  80  MET MET B . n 
B 1 79  ALA 79  81  81  ALA ALA B . n 
B 1 80  LEU 80  82  82  LEU LEU B . n 
B 1 81  GLY 81  83  83  GLY GLY B . n 
B 1 82  PRO 82  84  84  PRO PRO B . n 
B 1 83  GLY 83  85  85  GLY GLY B . n 
B 1 84  ARG 84  86  86  ARG ARG B . n 
B 1 85  GLU 85  87  87  GLU GLU B . n 
B 1 86  TYR 86  88  88  TYR TYR B . n 
B 1 87  ARG 87  89  89  ARG ARG B . n 
B 1 88  ALA 88  90  90  ALA ALA B . n 
B 1 89  LEU 89  91  91  LEU LEU B . n 
B 1 90  GLN 90  92  92  GLN GLN B . n 
B 1 91  LEU 91  93  93  LEU LEU B . n 
B 1 92  HIS 92  94  94  HIS HIS B . n 
B 1 93  LEU 93  95  95  LEU LEU B . n 
B 1 94  HIS 94  96  96  HIS HIS B . n 
B 1 95  TRP 95  97  97  TRP TRP B . n 
B 1 96  GLY 96  98  98  GLY GLY B . n 
B 1 97  ALA 97  99  99  ALA ALA B . n 
B 1 98  ALA 98  100 100 ALA ALA B . n 
B 1 99  GLY 99  101 101 GLY GLY B . n 
B 1 100 ARG 100 102 102 ARG ARG B . n 
B 1 101 PRO 101 103 103 PRO PRO B . n 
B 1 102 GLY 102 104 104 GLY GLY B . n 
B 1 103 SER 103 105 105 SER SER B . n 
B 1 104 GLU 104 106 106 GLU GLU B . n 
B 1 105 HIS 105 107 107 HIS HIS B . n 
B 1 106 THR 106 108 108 THR THR B . n 
B 1 107 VAL 107 109 109 VAL VAL B . n 
B 1 108 GLU 108 110 110 GLU GLU B . n 
B 1 109 GLY 109 111 111 GLY GLY B . n 
B 1 110 HIS 110 112 112 HIS HIS B . n 
B 1 111 ARG 111 113 113 ARG ARG B . n 
B 1 112 PHE 112 114 114 PHE PHE B . n 
B 1 113 PRO 113 115 115 PRO PRO B . n 
B 1 114 ALA 114 116 116 ALA ALA B . n 
B 1 115 GLU 115 117 117 GLU GLU B . n 
B 1 116 ILE 116 118 118 ILE ILE B . n 
B 1 117 HIS 117 119 119 HIS HIS B . n 
B 1 118 VAL 118 120 120 VAL VAL B . n 
B 1 119 VAL 119 121 121 VAL VAL B . n 
B 1 120 HIS 120 122 122 HIS HIS B . n 
B 1 121 LEU 121 123 123 LEU LEU B . n 
B 1 122 SER 122 124 124 SER SER B . n 
B 1 123 THR 123 125 125 THR THR B . n 
B 1 124 ALA 124 126 126 ALA ALA B . n 
B 1 125 PHE 125 127 127 PHE PHE B . n 
B 1 126 ALA 126 128 128 ALA ALA B . n 
B 1 127 ARG 127 129 129 ARG ARG B . n 
B 1 128 VAL 128 130 130 VAL VAL B . n 
B 1 129 ASP 129 131 131 ASP ASP B . n 
B 1 130 GLU 130 132 132 GLU GLU B . n 
B 1 131 ALA 131 133 133 ALA ALA B . n 
B 1 132 LEU 132 134 134 LEU LEU B . n 
B 1 133 GLY 133 135 135 GLY GLY B . n 
B 1 134 ARG 134 136 136 ARG ARG B . n 
B 1 135 PRO 135 137 137 PRO PRO B . n 
B 1 136 GLY 136 138 138 GLY GLY B . n 
B 1 137 GLY 137 139 139 GLY GLY B . n 
B 1 138 LEU 138 140 140 LEU LEU B . n 
B 1 139 ALA 139 141 141 ALA ALA B . n 
B 1 140 VAL 140 142 142 VAL VAL B . n 
B 1 141 LEU 141 143 143 LEU LEU B . n 
B 1 142 ALA 142 144 144 ALA ALA B . n 
B 1 143 ALA 143 145 145 ALA ALA B . n 
B 1 144 PHE 144 146 146 PHE PHE B . n 
B 1 145 LEU 145 147 147 LEU LEU B . n 
B 1 146 GLU 146 148 148 GLU GLU B . n 
B 1 147 GLU 147 149 149 GLU GLU B . n 
B 1 148 GLY 148 150 150 GLY GLY B . n 
B 1 149 PRO 149 151 151 PRO PRO B . n 
B 1 150 GLU 150 152 152 GLU GLU B . n 
B 1 151 GLU 151 153 153 GLU GLU B . n 
B 1 152 ASN 152 154 154 ASN ASN B . n 
B 1 153 SER 153 155 155 SER SER B . n 
B 1 154 ALA 154 156 156 ALA ALA B . n 
B 1 155 TYR 155 157 157 TYR TYR B . n 
B 1 156 GLU 156 158 158 GLU GLU B . n 
B 1 157 GLN 157 159 159 GLN GLN B . n 
B 1 158 LEU 158 160 160 LEU LEU B . n 
B 1 159 LEU 159 161 161 LEU LEU B . n 
B 1 160 SER 160 162 162 SER SER B . n 
B 1 161 ARG 161 163 163 ARG ARG B . n 
B 1 162 LEU 162 164 164 LEU LEU B . n 
B 1 163 GLU 163 165 165 GLU GLU B . n 
B 1 164 GLU 164 166 166 GLU GLU B . n 
B 1 165 ILE 165 167 167 ILE ILE B . n 
B 1 166 ALA 166 168 168 ALA ALA B . n 
B 1 167 GLU 167 169 169 GLU GLU B . n 
B 1 168 GLU 168 170 170 GLU GLU B . n 
B 1 169 GLY 169 171 171 GLY GLY B . n 
B 1 170 SER 170 172 172 SER SER B . n 
B 1 171 GLU 171 173 173 GLU GLU B . n 
B 1 172 THR 172 174 174 THR THR B . n 
B 1 173 GLN 173 175 175 GLN GLN B . n 
B 1 174 VAL 174 176 176 VAL VAL B . n 
B 1 175 PRO 175 177 177 PRO PRO B . n 
B 1 176 GLY 176 178 178 GLY GLY B . n 
B 1 177 LEU 177 179 179 LEU LEU B . n 
B 1 178 ASP 178 180 180 ASP ASP B . n 
B 1 179 ILE 179 181 181 ILE ILE B . n 
B 1 180 SER 180 182 182 SER SER B . n 
B 1 181 ALA 181 183 183 ALA ALA B . n 
B 1 182 LEU 182 184 184 LEU LEU B . n 
B 1 183 LEU 183 185 185 LEU LEU B . n 
B 1 184 PRO 184 186 186 PRO PRO B . n 
B 1 185 SER 185 187 187 SER SER B . n 
B 1 186 ASP 186 188 188 ASP ASP B . n 
B 1 187 PHE 187 189 189 PHE PHE B . n 
B 1 188 SER 188 190 190 SER SER B . n 
B 1 189 ARG 189 191 191 ARG ARG B . n 
B 1 190 TYR 190 192 192 TYR TYR B . n 
B 1 191 PHE 191 193 193 PHE PHE B . n 
B 1 192 GLN 192 194 194 GLN GLN B . n 
B 1 193 TYR 193 195 195 TYR TYR B . n 
B 1 194 GLU 194 196 196 GLU GLU B . n 
B 1 195 GLY 195 197 197 GLY GLY B . n 
B 1 196 SER 196 198 198 SER SER B . n 
B 1 197 LEU 197 199 199 LEU LEU B . n 
B 1 198 THR 198 200 200 THR THR B . n 
B 1 199 THR 199 201 201 THR THR B . n 
B 1 200 PRO 200 202 202 PRO PRO B . n 
B 1 201 PRO 201 203 203 PRO PRO B . n 
B 1 202 CYS 202 204 204 CYS CYS B . n 
B 1 203 ALA 203 205 205 ALA ALA B . n 
B 1 204 GLN 204 206 206 GLN GLN B . n 
B 1 205 GLY 205 207 207 GLY GLY B . n 
B 1 206 VAL 206 208 208 VAL VAL B . n 
B 1 207 ILE 207 209 209 ILE ILE B . n 
B 1 208 TRP 208 210 210 TRP TRP B . n 
B 1 209 THR 209 211 211 THR THR B . n 
B 1 210 VAL 210 212 212 VAL VAL B . n 
B 1 211 PHE 211 213 213 PHE PHE B . n 
B 1 212 ASN 212 214 214 ASN ASN B . n 
B 1 213 GLN 213 215 215 GLN GLN B . n 
B 1 214 THR 214 216 216 THR THR B . n 
B 1 215 VAL 215 217 217 VAL VAL B . n 
B 1 216 MET 216 218 218 MET MET B . n 
B 1 217 LEU 217 219 219 LEU LEU B . n 
B 1 218 SER 218 220 220 SER SER B . n 
B 1 219 ALA 219 221 221 ALA ALA B . n 
B 1 220 LYS 220 222 222 LYS LYS B . n 
B 1 221 GLN 221 223 223 GLN GLN B . n 
B 1 222 LEU 222 224 224 LEU LEU B . n 
B 1 223 HIS 223 225 225 HIS HIS B . n 
B 1 224 THR 224 226 226 THR THR B . n 
B 1 225 LEU 225 227 227 LEU LEU B . n 
B 1 226 SER 226 228 228 SER SER B . n 
B 1 227 ASP 227 229 229 ASP ASP B . n 
B 1 228 THR 228 230 230 THR THR B . n 
B 1 229 LEU 229 231 231 LEU LEU B . n 
B 1 230 TRP 230 232 232 TRP TRP B . n 
B 1 231 GLY 231 233 233 GLY GLY B . n 
B 1 232 PRO 232 234 234 PRO PRO B . n 
B 1 233 GLY 233 235 235 GLY GLY B . n 
B 1 234 ASP 234 236 236 ASP ASP B . n 
B 1 235 SER 235 237 237 SER SER B . n 
B 1 236 ARG 236 238 238 ARG ARG B . n 
B 1 237 LEU 237 239 239 LEU LEU B . n 
B 1 238 GLN 238 240 240 GLN GLN B . n 
B 1 239 LEU 239 241 241 LEU LEU B . n 
B 1 240 ASN 240 242 242 ASN ASN B . n 
B 1 241 PHE 241 243 243 PHE PHE B . n 
B 1 242 ARG 242 244 244 ARG ARG B . n 
B 1 243 ALA 243 245 245 ALA ALA B . n 
B 1 244 THR 244 246 246 THR THR B . n 
B 1 245 GLN 245 247 247 GLN GLN B . n 
B 1 246 PRO 246 248 248 PRO PRO B . n 
B 1 247 LEU 247 249 249 LEU LEU B . n 
B 1 248 ASN 248 250 250 ASN ASN B . n 
B 1 249 GLY 249 251 251 GLY GLY B . n 
B 1 250 ARG 250 252 252 ARG ARG B . n 
B 1 251 VAL 251 253 253 VAL VAL B . n 
B 1 252 ILE 252 254 254 ILE ILE B . n 
B 1 253 GLU 253 255 255 GLU GLU B . n 
B 1 254 ALA 254 256 256 ALA ALA B . n 
B 1 255 SER 255 257 257 SER SER B . n 
B 1 256 PHE 256 258 258 PHE PHE B . n 
B 1 257 PRO 257 259 259 PRO PRO B . n 
C 1 1   GLY 1   3   ?   ?   ?   C . n 
C 1 2   PRO 2   4   ?   ?   ?   C . n 
C 1 3   ASP 3   5   ?   ?   ?   C . n 
C 1 4   GLN 4   6   ?   ?   ?   C . n 
C 1 5   SER 5   7   ?   ?   ?   C . n 
C 1 6   HIS 6   8   ?   ?   ?   C . n 
C 1 7   TRP 7   9   9   TRP TRP C . n 
C 1 8   ARG 8   10  10  ARG ARG C . n 
C 1 9   TYR 9   11  11  TYR TYR C . n 
C 1 10  GLY 10  12  12  GLY GLY C . n 
C 1 11  GLY 11  13  13  GLY GLY C . n 
C 1 12  ASP 12  14  14  ASP ASP C . n 
C 1 13  PRO 13  15  15  PRO PRO C . n 
C 1 14  PRO 14  16  16  PRO PRO C . n 
C 1 15  TRP 15  17  17  TRP TRP C . n 
C 1 16  PRO 16  18  18  PRO PRO C . n 
C 1 17  ARG 17  19  19  ARG ARG C . n 
C 1 18  VAL 18  20  20  VAL VAL C . n 
C 1 19  SER 19  21  21  SER SER C . n 
C 1 20  PRO 20  22  22  PRO PRO C . n 
C 1 21  ALA 21  23  23  ALA ALA C . n 
C 1 22  CYS 22  24  24  CYS CYS C . n 
C 1 23  ALA 23  25  25  ALA ALA C . n 
C 1 24  GLY 24  26  26  GLY GLY C . n 
C 1 25  ARG 25  27  27  ARG ARG C . n 
C 1 26  PHE 26  28  28  PHE PHE C . n 
C 1 27  GLN 27  29  29  GLN GLN C . n 
C 1 28  SER 28  30  30  SER SER C . n 
C 1 29  PRO 29  31  31  PRO PRO C . n 
C 1 30  VAL 30  32  32  VAL VAL C . n 
C 1 31  ASP 31  33  33  ASP ASP C . n 
C 1 32  ILE 32  34  34  ILE ILE C . n 
C 1 33  ARG 33  35  35  ARG ARG C . n 
C 1 34  PRO 34  36  36  PRO PRO C . n 
C 1 35  GLN 35  37  37  GLN GLN C . n 
C 1 36  LEU 36  38  38  LEU LEU C . n 
C 1 37  ALA 37  39  39  ALA ALA C . n 
C 1 38  ALA 38  40  40  ALA ALA C . n 
C 1 39  PHE 39  41  41  PHE PHE C . n 
C 1 40  SER 40  42  42  SER SER C . n 
C 1 41  PRO 41  43  43  PRO PRO C . n 
C 1 42  ALA 42  44  44  ALA ALA C . n 
C 1 43  LEU 43  45  45  LEU LEU C . n 
C 1 44  ARG 44  46  46  ARG ARG C . n 
C 1 45  PRO 45  47  47  PRO PRO C . n 
C 1 46  LEU 46  48  48  LEU LEU C . n 
C 1 47  GLU 47  49  49  GLU GLU C . n 
C 1 48  LEU 48  50  50  LEU LEU C . n 
C 1 49  LEU 49  51  51  LEU LEU C . n 
C 1 50  GLY 50  52  52  GLY GLY C . n 
C 1 51  PHE 51  53  53  PHE PHE C . n 
C 1 52  GLN 52  54  54  GLN GLN C . n 
C 1 53  LEU 53  55  55  LEU LEU C . n 
C 1 54  PRO 54  56  56  PRO PRO C . n 
C 1 55  PRO 55  57  57  PRO PRO C . n 
C 1 56  LEU 56  58  58  LEU LEU C . n 
C 1 57  PRO 57  59  59  PRO PRO C . n 
C 1 58  GLU 58  60  60  GLU GLU C . n 
C 1 59  LEU 59  61  61  LEU LEU C . n 
C 1 60  ARG 60  62  62  ARG ARG C . n 
C 1 61  LEU 61  63  63  LEU LEU C . n 
C 1 62  ARG 62  64  64  ARG ARG C . n 
C 1 63  ASN 63  65  65  ASN ASN C . n 
C 1 64  ASN 64  66  66  ASN ASN C . n 
C 1 65  GLY 65  67  67  GLY GLY C . n 
C 1 66  HIS 66  68  68  HIS HIS C . n 
C 1 67  SER 67  69  69  SER SER C . n 
C 1 68  VAL 68  70  70  VAL VAL C . n 
C 1 69  GLN 69  71  71  GLN GLN C . n 
C 1 70  LEU 70  72  72  LEU LEU C . n 
C 1 71  THR 71  73  73  THR THR C . n 
C 1 72  LEU 72  74  74  LEU LEU C . n 
C 1 73  PRO 73  75  75  PRO PRO C . n 
C 1 74  PRO 74  76  76  PRO PRO C . n 
C 1 75  GLY 75  77  77  GLY GLY C . n 
C 1 76  LEU 76  78  78  LEU LEU C . n 
C 1 77  GLU 77  79  79  GLU GLU C . n 
C 1 78  MET 78  80  80  MET MET C . n 
C 1 79  ALA 79  81  81  ALA ALA C . n 
C 1 80  LEU 80  82  82  LEU LEU C . n 
C 1 81  GLY 81  83  83  GLY GLY C . n 
C 1 82  PRO 82  84  84  PRO PRO C . n 
C 1 83  GLY 83  85  85  GLY GLY C . n 
C 1 84  ARG 84  86  86  ARG ARG C . n 
C 1 85  GLU 85  87  87  GLU GLU C . n 
C 1 86  TYR 86  88  88  TYR TYR C . n 
C 1 87  ARG 87  89  89  ARG ARG C . n 
C 1 88  ALA 88  90  90  ALA ALA C . n 
C 1 89  LEU 89  91  91  LEU LEU C . n 
C 1 90  GLN 90  92  92  GLN GLN C . n 
C 1 91  LEU 91  93  93  LEU LEU C . n 
C 1 92  HIS 92  94  94  HIS HIS C . n 
C 1 93  LEU 93  95  95  LEU LEU C . n 
C 1 94  HIS 94  96  96  HIS HIS C . n 
C 1 95  TRP 95  97  97  TRP TRP C . n 
C 1 96  GLY 96  98  98  GLY GLY C . n 
C 1 97  ALA 97  99  99  ALA ALA C . n 
C 1 98  ALA 98  100 100 ALA ALA C . n 
C 1 99  GLY 99  101 101 GLY GLY C . n 
C 1 100 ARG 100 102 102 ARG ARG C . n 
C 1 101 PRO 101 103 103 PRO PRO C . n 
C 1 102 GLY 102 104 104 GLY GLY C . n 
C 1 103 SER 103 105 105 SER SER C . n 
C 1 104 GLU 104 106 106 GLU GLU C . n 
C 1 105 HIS 105 107 107 HIS HIS C . n 
C 1 106 THR 106 108 108 THR THR C . n 
C 1 107 VAL 107 109 109 VAL VAL C . n 
C 1 108 GLU 108 110 110 GLU GLU C . n 
C 1 109 GLY 109 111 111 GLY GLY C . n 
C 1 110 HIS 110 112 112 HIS HIS C . n 
C 1 111 ARG 111 113 113 ARG ARG C . n 
C 1 112 PHE 112 114 114 PHE PHE C . n 
C 1 113 PRO 113 115 115 PRO PRO C . n 
C 1 114 ALA 114 116 116 ALA ALA C . n 
C 1 115 GLU 115 117 117 GLU GLU C . n 
C 1 116 ILE 116 118 118 ILE ILE C . n 
C 1 117 HIS 117 119 119 HIS HIS C . n 
C 1 118 VAL 118 120 120 VAL VAL C . n 
C 1 119 VAL 119 121 121 VAL VAL C . n 
C 1 120 HIS 120 122 122 HIS HIS C . n 
C 1 121 LEU 121 123 123 LEU LEU C . n 
C 1 122 SER 122 124 124 SER SER C . n 
C 1 123 THR 123 125 125 THR THR C . n 
C 1 124 ALA 124 126 126 ALA ALA C . n 
C 1 125 PHE 125 127 127 PHE PHE C . n 
C 1 126 ALA 126 128 128 ALA ALA C . n 
C 1 127 ARG 127 129 129 ARG ARG C . n 
C 1 128 VAL 128 130 130 VAL VAL C . n 
C 1 129 ASP 129 131 131 ASP ASP C . n 
C 1 130 GLU 130 132 132 GLU GLU C . n 
C 1 131 ALA 131 133 133 ALA ALA C . n 
C 1 132 LEU 132 134 134 LEU LEU C . n 
C 1 133 GLY 133 135 135 GLY GLY C . n 
C 1 134 ARG 134 136 136 ARG ARG C . n 
C 1 135 PRO 135 137 137 PRO PRO C . n 
C 1 136 GLY 136 138 138 GLY GLY C . n 
C 1 137 GLY 137 139 139 GLY GLY C . n 
C 1 138 LEU 138 140 140 LEU LEU C . n 
C 1 139 ALA 139 141 141 ALA ALA C . n 
C 1 140 VAL 140 142 142 VAL VAL C . n 
C 1 141 LEU 141 143 143 LEU LEU C . n 
C 1 142 ALA 142 144 144 ALA ALA C . n 
C 1 143 ALA 143 145 145 ALA ALA C . n 
C 1 144 PHE 144 146 146 PHE PHE C . n 
C 1 145 LEU 145 147 147 LEU LEU C . n 
C 1 146 GLU 146 148 148 GLU GLU C . n 
C 1 147 GLU 147 149 149 GLU GLU C . n 
C 1 148 GLY 148 150 150 GLY GLY C . n 
C 1 149 PRO 149 151 151 PRO PRO C . n 
C 1 150 GLU 150 152 152 GLU GLU C . n 
C 1 151 GLU 151 153 153 GLU GLU C . n 
C 1 152 ASN 152 154 154 ASN ASN C . n 
C 1 153 SER 153 155 155 SER SER C . n 
C 1 154 ALA 154 156 156 ALA ALA C . n 
C 1 155 TYR 155 157 157 TYR TYR C . n 
C 1 156 GLU 156 158 158 GLU GLU C . n 
C 1 157 GLN 157 159 159 GLN GLN C . n 
C 1 158 LEU 158 160 160 LEU LEU C . n 
C 1 159 LEU 159 161 161 LEU LEU C . n 
C 1 160 SER 160 162 162 SER SER C . n 
C 1 161 ARG 161 163 163 ARG ARG C . n 
C 1 162 LEU 162 164 164 LEU LEU C . n 
C 1 163 GLU 163 165 165 GLU GLU C . n 
C 1 164 GLU 164 166 166 GLU GLU C . n 
C 1 165 ILE 165 167 167 ILE ILE C . n 
C 1 166 ALA 166 168 168 ALA ALA C . n 
C 1 167 GLU 167 169 169 GLU GLU C . n 
C 1 168 GLU 168 170 170 GLU GLU C . n 
C 1 169 GLY 169 171 171 GLY GLY C . n 
C 1 170 SER 170 172 172 SER SER C . n 
C 1 171 GLU 171 173 173 GLU GLU C . n 
C 1 172 THR 172 174 174 THR THR C . n 
C 1 173 GLN 173 175 175 GLN GLN C . n 
C 1 174 VAL 174 176 176 VAL VAL C . n 
C 1 175 PRO 175 177 177 PRO PRO C . n 
C 1 176 GLY 176 178 178 GLY GLY C . n 
C 1 177 LEU 177 179 179 LEU LEU C . n 
C 1 178 ASP 178 180 180 ASP ASP C . n 
C 1 179 ILE 179 181 181 ILE ILE C . n 
C 1 180 SER 180 182 182 SER SER C . n 
C 1 181 ALA 181 183 183 ALA ALA C . n 
C 1 182 LEU 182 184 184 LEU LEU C . n 
C 1 183 LEU 183 185 185 LEU LEU C . n 
C 1 184 PRO 184 186 186 PRO PRO C . n 
C 1 185 SER 185 187 187 SER SER C . n 
C 1 186 ASP 186 188 188 ASP ASP C . n 
C 1 187 PHE 187 189 189 PHE PHE C . n 
C 1 188 SER 188 190 190 SER SER C . n 
C 1 189 ARG 189 191 191 ARG ARG C . n 
C 1 190 TYR 190 192 192 TYR TYR C . n 
C 1 191 PHE 191 193 193 PHE PHE C . n 
C 1 192 GLN 192 194 194 GLN GLN C . n 
C 1 193 TYR 193 195 195 TYR TYR C . n 
C 1 194 GLU 194 196 196 GLU GLU C . n 
C 1 195 GLY 195 197 197 GLY GLY C . n 
C 1 196 SER 196 198 198 SER SER C . n 
C 1 197 LEU 197 199 199 LEU LEU C . n 
C 1 198 THR 198 200 200 THR THR C . n 
C 1 199 THR 199 201 201 THR THR C . n 
C 1 200 PRO 200 202 202 PRO PRO C . n 
C 1 201 PRO 201 203 203 PRO PRO C . n 
C 1 202 CYS 202 204 204 CYS CYS C . n 
C 1 203 ALA 203 205 205 ALA ALA C . n 
C 1 204 GLN 204 206 206 GLN GLN C . n 
C 1 205 GLY 205 207 207 GLY GLY C . n 
C 1 206 VAL 206 208 208 VAL VAL C . n 
C 1 207 ILE 207 209 209 ILE ILE C . n 
C 1 208 TRP 208 210 210 TRP TRP C . n 
C 1 209 THR 209 211 211 THR THR C . n 
C 1 210 VAL 210 212 212 VAL VAL C . n 
C 1 211 PHE 211 213 213 PHE PHE C . n 
C 1 212 ASN 212 214 214 ASN ASN C . n 
C 1 213 GLN 213 215 215 GLN GLN C . n 
C 1 214 THR 214 216 216 THR THR C . n 
C 1 215 VAL 215 217 217 VAL VAL C . n 
C 1 216 MET 216 218 218 MET MET C . n 
C 1 217 LEU 217 219 219 LEU LEU C . n 
C 1 218 SER 218 220 220 SER SER C . n 
C 1 219 ALA 219 221 221 ALA ALA C . n 
C 1 220 LYS 220 222 222 LYS LYS C . n 
C 1 221 GLN 221 223 223 GLN GLN C . n 
C 1 222 LEU 222 224 224 LEU LEU C . n 
C 1 223 HIS 223 225 225 HIS HIS C . n 
C 1 224 THR 224 226 226 THR THR C . n 
C 1 225 LEU 225 227 227 LEU LEU C . n 
C 1 226 SER 226 228 228 SER SER C . n 
C 1 227 ASP 227 229 229 ASP ASP C . n 
C 1 228 THR 228 230 230 THR THR C . n 
C 1 229 LEU 229 231 231 LEU LEU C . n 
C 1 230 TRP 230 232 232 TRP TRP C . n 
C 1 231 GLY 231 233 233 GLY GLY C . n 
C 1 232 PRO 232 234 234 PRO PRO C . n 
C 1 233 GLY 233 235 235 GLY GLY C . n 
C 1 234 ASP 234 236 236 ASP ASP C . n 
C 1 235 SER 235 237 237 SER SER C . n 
C 1 236 ARG 236 238 238 ARG ARG C . n 
C 1 237 LEU 237 239 239 LEU LEU C . n 
C 1 238 GLN 238 240 240 GLN GLN C . n 
C 1 239 LEU 239 241 241 LEU LEU C . n 
C 1 240 ASN 240 242 242 ASN ASN C . n 
C 1 241 PHE 241 243 243 PHE PHE C . n 
C 1 242 ARG 242 244 244 ARG ARG C . n 
C 1 243 ALA 243 245 245 ALA ALA C . n 
C 1 244 THR 244 246 246 THR THR C . n 
C 1 245 GLN 245 247 247 GLN GLN C . n 
C 1 246 PRO 246 248 248 PRO PRO C . n 
C 1 247 LEU 247 249 249 LEU LEU C . n 
C 1 248 ASN 248 250 250 ASN ASN C . n 
C 1 249 GLY 249 251 251 GLY GLY C . n 
C 1 250 ARG 250 252 252 ARG ARG C . n 
C 1 251 VAL 251 253 253 VAL VAL C . n 
C 1 252 ILE 252 254 254 ILE ILE C . n 
C 1 253 GLU 253 255 255 GLU GLU C . n 
C 1 254 ALA 254 256 256 ALA ALA C . n 
C 1 255 SER 255 257 257 SER SER C . n 
C 1 256 PHE 256 258 258 PHE PHE C . n 
C 1 257 PRO 257 259 259 PRO PRO C . n 
D 1 1   GLY 1   3   ?   ?   ?   D . n 
D 1 2   PRO 2   4   ?   ?   ?   D . n 
D 1 3   ASP 3   5   ?   ?   ?   D . n 
D 1 4   GLN 4   6   ?   ?   ?   D . n 
D 1 5   SER 5   7   ?   ?   ?   D . n 
D 1 6   HIS 6   8   ?   ?   ?   D . n 
D 1 7   TRP 7   9   9   TRP TRP D . n 
D 1 8   ARG 8   10  10  ARG ARG D . n 
D 1 9   TYR 9   11  11  TYR TYR D . n 
D 1 10  GLY 10  12  12  GLY GLY D . n 
D 1 11  GLY 11  13  13  GLY GLY D . n 
D 1 12  ASP 12  14  14  ASP ASP D . n 
D 1 13  PRO 13  15  15  PRO PRO D . n 
D 1 14  PRO 14  16  16  PRO PRO D . n 
D 1 15  TRP 15  17  17  TRP TRP D . n 
D 1 16  PRO 16  18  18  PRO PRO D . n 
D 1 17  ARG 17  19  19  ARG ARG D . n 
D 1 18  VAL 18  20  20  VAL VAL D . n 
D 1 19  SER 19  21  21  SER SER D . n 
D 1 20  PRO 20  22  22  PRO PRO D . n 
D 1 21  ALA 21  23  23  ALA ALA D . n 
D 1 22  CYS 22  24  24  CYS CYS D . n 
D 1 23  ALA 23  25  25  ALA ALA D . n 
D 1 24  GLY 24  26  26  GLY GLY D . n 
D 1 25  ARG 25  27  27  ARG ARG D . n 
D 1 26  PHE 26  28  28  PHE PHE D . n 
D 1 27  GLN 27  29  29  GLN GLN D . n 
D 1 28  SER 28  30  30  SER SER D . n 
D 1 29  PRO 29  31  31  PRO PRO D . n 
D 1 30  VAL 30  32  32  VAL VAL D . n 
D 1 31  ASP 31  33  33  ASP ASP D . n 
D 1 32  ILE 32  34  34  ILE ILE D . n 
D 1 33  ARG 33  35  35  ARG ARG D . n 
D 1 34  PRO 34  36  36  PRO PRO D . n 
D 1 35  GLN 35  37  37  GLN GLN D . n 
D 1 36  LEU 36  38  38  LEU LEU D . n 
D 1 37  ALA 37  39  39  ALA ALA D . n 
D 1 38  ALA 38  40  40  ALA ALA D . n 
D 1 39  PHE 39  41  41  PHE PHE D . n 
D 1 40  SER 40  42  42  SER SER D . n 
D 1 41  PRO 41  43  43  PRO PRO D . n 
D 1 42  ALA 42  44  44  ALA ALA D . n 
D 1 43  LEU 43  45  45  LEU LEU D . n 
D 1 44  ARG 44  46  46  ARG ARG D . n 
D 1 45  PRO 45  47  47  PRO PRO D . n 
D 1 46  LEU 46  48  48  LEU LEU D . n 
D 1 47  GLU 47  49  49  GLU GLU D . n 
D 1 48  LEU 48  50  50  LEU LEU D . n 
D 1 49  LEU 49  51  51  LEU LEU D . n 
D 1 50  GLY 50  52  52  GLY GLY D . n 
D 1 51  PHE 51  53  53  PHE PHE D . n 
D 1 52  GLN 52  54  54  GLN GLN D . n 
D 1 53  LEU 53  55  55  LEU LEU D . n 
D 1 54  PRO 54  56  56  PRO PRO D . n 
D 1 55  PRO 55  57  57  PRO PRO D . n 
D 1 56  LEU 56  58  58  LEU LEU D . n 
D 1 57  PRO 57  59  59  PRO PRO D . n 
D 1 58  GLU 58  60  60  GLU GLU D . n 
D 1 59  LEU 59  61  61  LEU LEU D . n 
D 1 60  ARG 60  62  62  ARG ARG D . n 
D 1 61  LEU 61  63  63  LEU LEU D . n 
D 1 62  ARG 62  64  64  ARG ARG D . n 
D 1 63  ASN 63  65  65  ASN ASN D . n 
D 1 64  ASN 64  66  66  ASN ASN D . n 
D 1 65  GLY 65  67  67  GLY GLY D . n 
D 1 66  HIS 66  68  68  HIS HIS D . n 
D 1 67  SER 67  69  69  SER SER D . n 
D 1 68  VAL 68  70  70  VAL VAL D . n 
D 1 69  GLN 69  71  71  GLN GLN D . n 
D 1 70  LEU 70  72  72  LEU LEU D . n 
D 1 71  THR 71  73  73  THR THR D . n 
D 1 72  LEU 72  74  74  LEU LEU D . n 
D 1 73  PRO 73  75  75  PRO PRO D . n 
D 1 74  PRO 74  76  76  PRO PRO D . n 
D 1 75  GLY 75  77  77  GLY GLY D . n 
D 1 76  LEU 76  78  78  LEU LEU D . n 
D 1 77  GLU 77  79  79  GLU GLU D . n 
D 1 78  MET 78  80  80  MET MET D . n 
D 1 79  ALA 79  81  81  ALA ALA D . n 
D 1 80  LEU 80  82  82  LEU LEU D . n 
D 1 81  GLY 81  83  83  GLY GLY D . n 
D 1 82  PRO 82  84  84  PRO PRO D . n 
D 1 83  GLY 83  85  85  GLY GLY D . n 
D 1 84  ARG 84  86  86  ARG ARG D . n 
D 1 85  GLU 85  87  87  GLU GLU D . n 
D 1 86  TYR 86  88  88  TYR TYR D . n 
D 1 87  ARG 87  89  89  ARG ARG D . n 
D 1 88  ALA 88  90  90  ALA ALA D . n 
D 1 89  LEU 89  91  91  LEU LEU D . n 
D 1 90  GLN 90  92  92  GLN GLN D . n 
D 1 91  LEU 91  93  93  LEU LEU D . n 
D 1 92  HIS 92  94  94  HIS HIS D . n 
D 1 93  LEU 93  95  95  LEU LEU D . n 
D 1 94  HIS 94  96  96  HIS HIS D . n 
D 1 95  TRP 95  97  97  TRP TRP D . n 
D 1 96  GLY 96  98  98  GLY GLY D . n 
D 1 97  ALA 97  99  99  ALA ALA D . n 
D 1 98  ALA 98  100 100 ALA ALA D . n 
D 1 99  GLY 99  101 101 GLY GLY D . n 
D 1 100 ARG 100 102 102 ARG ARG D . n 
D 1 101 PRO 101 103 103 PRO PRO D . n 
D 1 102 GLY 102 104 104 GLY GLY D . n 
D 1 103 SER 103 105 105 SER SER D . n 
D 1 104 GLU 104 106 106 GLU GLU D . n 
D 1 105 HIS 105 107 107 HIS HIS D . n 
D 1 106 THR 106 108 108 THR THR D . n 
D 1 107 VAL 107 109 109 VAL VAL D . n 
D 1 108 GLU 108 110 110 GLU GLU D . n 
D 1 109 GLY 109 111 111 GLY GLY D . n 
D 1 110 HIS 110 112 112 HIS HIS D . n 
D 1 111 ARG 111 113 113 ARG ARG D . n 
D 1 112 PHE 112 114 114 PHE PHE D . n 
D 1 113 PRO 113 115 115 PRO PRO D . n 
D 1 114 ALA 114 116 116 ALA ALA D . n 
D 1 115 GLU 115 117 117 GLU GLU D . n 
D 1 116 ILE 116 118 118 ILE ILE D . n 
D 1 117 HIS 117 119 119 HIS HIS D . n 
D 1 118 VAL 118 120 120 VAL VAL D . n 
D 1 119 VAL 119 121 121 VAL VAL D . n 
D 1 120 HIS 120 122 122 HIS HIS D . n 
D 1 121 LEU 121 123 123 LEU LEU D . n 
D 1 122 SER 122 124 124 SER SER D . n 
D 1 123 THR 123 125 125 THR THR D . n 
D 1 124 ALA 124 126 126 ALA ALA D . n 
D 1 125 PHE 125 127 127 PHE PHE D . n 
D 1 126 ALA 126 128 128 ALA ALA D . n 
D 1 127 ARG 127 129 129 ARG ARG D . n 
D 1 128 VAL 128 130 130 VAL VAL D . n 
D 1 129 ASP 129 131 131 ASP ASP D . n 
D 1 130 GLU 130 132 132 GLU GLU D . n 
D 1 131 ALA 131 133 133 ALA ALA D . n 
D 1 132 LEU 132 134 134 LEU LEU D . n 
D 1 133 GLY 133 135 135 GLY GLY D . n 
D 1 134 ARG 134 136 136 ARG ARG D . n 
D 1 135 PRO 135 137 137 PRO PRO D . n 
D 1 136 GLY 136 138 138 GLY GLY D . n 
D 1 137 GLY 137 139 139 GLY GLY D . n 
D 1 138 LEU 138 140 140 LEU LEU D . n 
D 1 139 ALA 139 141 141 ALA ALA D . n 
D 1 140 VAL 140 142 142 VAL VAL D . n 
D 1 141 LEU 141 143 143 LEU LEU D . n 
D 1 142 ALA 142 144 144 ALA ALA D . n 
D 1 143 ALA 143 145 145 ALA ALA D . n 
D 1 144 PHE 144 146 146 PHE PHE D . n 
D 1 145 LEU 145 147 147 LEU LEU D . n 
D 1 146 GLU 146 148 148 GLU GLU D . n 
D 1 147 GLU 147 149 149 GLU GLU D . n 
D 1 148 GLY 148 150 150 GLY GLY D . n 
D 1 149 PRO 149 151 151 PRO PRO D . n 
D 1 150 GLU 150 152 152 GLU GLU D . n 
D 1 151 GLU 151 153 153 GLU GLU D . n 
D 1 152 ASN 152 154 154 ASN ASN D . n 
D 1 153 SER 153 155 155 SER SER D . n 
D 1 154 ALA 154 156 156 ALA ALA D . n 
D 1 155 TYR 155 157 157 TYR TYR D . n 
D 1 156 GLU 156 158 158 GLU GLU D . n 
D 1 157 GLN 157 159 159 GLN GLN D . n 
D 1 158 LEU 158 160 160 LEU LEU D . n 
D 1 159 LEU 159 161 161 LEU LEU D . n 
D 1 160 SER 160 162 162 SER SER D . n 
D 1 161 ARG 161 163 163 ARG ARG D . n 
D 1 162 LEU 162 164 164 LEU LEU D . n 
D 1 163 GLU 163 165 165 GLU GLU D . n 
D 1 164 GLU 164 166 166 GLU GLU D . n 
D 1 165 ILE 165 167 167 ILE ILE D . n 
D 1 166 ALA 166 168 168 ALA ALA D . n 
D 1 167 GLU 167 169 169 GLU GLU D . n 
D 1 168 GLU 168 170 170 GLU GLU D . n 
D 1 169 GLY 169 171 171 GLY GLY D . n 
D 1 170 SER 170 172 172 SER SER D . n 
D 1 171 GLU 171 173 173 GLU GLU D . n 
D 1 172 THR 172 174 174 THR THR D . n 
D 1 173 GLN 173 175 175 GLN GLN D . n 
D 1 174 VAL 174 176 176 VAL VAL D . n 
D 1 175 PRO 175 177 177 PRO PRO D . n 
D 1 176 GLY 176 178 178 GLY GLY D . n 
D 1 177 LEU 177 179 179 LEU LEU D . n 
D 1 178 ASP 178 180 180 ASP ASP D . n 
D 1 179 ILE 179 181 181 ILE ILE D . n 
D 1 180 SER 180 182 182 SER SER D . n 
D 1 181 ALA 181 183 183 ALA ALA D . n 
D 1 182 LEU 182 184 184 LEU LEU D . n 
D 1 183 LEU 183 185 185 LEU LEU D . n 
D 1 184 PRO 184 186 186 PRO PRO D . n 
D 1 185 SER 185 187 187 SER SER D . n 
D 1 186 ASP 186 188 188 ASP ASP D . n 
D 1 187 PHE 187 189 189 PHE PHE D . n 
D 1 188 SER 188 190 190 SER SER D . n 
D 1 189 ARG 189 191 191 ARG ARG D . n 
D 1 190 TYR 190 192 192 TYR TYR D . n 
D 1 191 PHE 191 193 193 PHE PHE D . n 
D 1 192 GLN 192 194 194 GLN GLN D . n 
D 1 193 TYR 193 195 195 TYR TYR D . n 
D 1 194 GLU 194 196 196 GLU GLU D . n 
D 1 195 GLY 195 197 197 GLY GLY D . n 
D 1 196 SER 196 198 198 SER SER D . n 
D 1 197 LEU 197 199 199 LEU LEU D . n 
D 1 198 THR 198 200 200 THR THR D . n 
D 1 199 THR 199 201 201 THR THR D . n 
D 1 200 PRO 200 202 202 PRO PRO D . n 
D 1 201 PRO 201 203 203 PRO PRO D . n 
D 1 202 CYS 202 204 204 CYS CYS D . n 
D 1 203 ALA 203 205 205 ALA ALA D . n 
D 1 204 GLN 204 206 206 GLN GLN D . n 
D 1 205 GLY 205 207 207 GLY GLY D . n 
D 1 206 VAL 206 208 208 VAL VAL D . n 
D 1 207 ILE 207 209 209 ILE ILE D . n 
D 1 208 TRP 208 210 210 TRP TRP D . n 
D 1 209 THR 209 211 211 THR THR D . n 
D 1 210 VAL 210 212 212 VAL VAL D . n 
D 1 211 PHE 211 213 213 PHE PHE D . n 
D 1 212 ASN 212 214 214 ASN ASN D . n 
D 1 213 GLN 213 215 215 GLN GLN D . n 
D 1 214 THR 214 216 216 THR THR D . n 
D 1 215 VAL 215 217 217 VAL VAL D . n 
D 1 216 MET 216 218 218 MET MET D . n 
D 1 217 LEU 217 219 219 LEU LEU D . n 
D 1 218 SER 218 220 220 SER SER D . n 
D 1 219 ALA 219 221 221 ALA ALA D . n 
D 1 220 LYS 220 222 222 LYS LYS D . n 
D 1 221 GLN 221 223 223 GLN GLN D . n 
D 1 222 LEU 222 224 224 LEU LEU D . n 
D 1 223 HIS 223 225 225 HIS HIS D . n 
D 1 224 THR 224 226 226 THR THR D . n 
D 1 225 LEU 225 227 227 LEU LEU D . n 
D 1 226 SER 226 228 228 SER SER D . n 
D 1 227 ASP 227 229 229 ASP ASP D . n 
D 1 228 THR 228 230 230 THR THR D . n 
D 1 229 LEU 229 231 231 LEU LEU D . n 
D 1 230 TRP 230 232 232 TRP TRP D . n 
D 1 231 GLY 231 233 233 GLY GLY D . n 
D 1 232 PRO 232 234 234 PRO PRO D . n 
D 1 233 GLY 233 235 235 GLY GLY D . n 
D 1 234 ASP 234 236 236 ASP ASP D . n 
D 1 235 SER 235 237 237 SER SER D . n 
D 1 236 ARG 236 238 238 ARG ARG D . n 
D 1 237 LEU 237 239 239 LEU LEU D . n 
D 1 238 GLN 238 240 240 GLN GLN D . n 
D 1 239 LEU 239 241 241 LEU LEU D . n 
D 1 240 ASN 240 242 242 ASN ASN D . n 
D 1 241 PHE 241 243 243 PHE PHE D . n 
D 1 242 ARG 242 244 244 ARG ARG D . n 
D 1 243 ALA 243 245 245 ALA ALA D . n 
D 1 244 THR 244 246 246 THR THR D . n 
D 1 245 GLN 245 247 247 GLN GLN D . n 
D 1 246 PRO 246 248 248 PRO PRO D . n 
D 1 247 LEU 247 249 249 LEU LEU D . n 
D 1 248 ASN 248 250 250 ASN ASN D . n 
D 1 249 GLY 249 251 251 GLY GLY D . n 
D 1 250 ARG 250 252 252 ARG ARG D . n 
D 1 251 VAL 251 253 253 VAL VAL D . n 
D 1 252 ILE 252 254 254 ILE ILE D . n 
D 1 253 GLU 253 255 255 GLU GLU D . n 
D 1 254 ALA 254 256 256 ALA ALA D . n 
D 1 255 SER 255 257 257 SER SER D . n 
D 1 256 PHE 256 258 258 PHE PHE D . n 
D 1 257 PRO 257 259 259 PRO PRO D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 Y0R 1   268  268  Y0R Y0R A . 
F 3 ZN  1   1260 1260 ZN  ZN  A . 
G 4 GOL 1   1261 1261 GOL GOL A . 
H 2 Y0R 1   269  269  Y0R Y0R B . 
I 3 ZN  1   1260 1260 ZN  ZN  B . 
J 4 GOL 1   1261 1261 GOL GOL B . 
K 5 ACY 1   1263 1263 ACY ACY B . 
L 2 Y0R 1   267  267  Y0R Y0R C . 
M 3 ZN  1   1260 1260 ZN  ZN  C . 
N 4 GOL 1   1261 1261 GOL GOL C . 
O 2 Y0R 1   266  266  Y0R Y0R D . 
P 3 ZN  1   1260 1260 ZN  ZN  D . 
Q 4 GOL 1   1261 1261 GOL GOL D . 
R 5 ACY 1   1262 1262 ACY ACY D . 
S 6 HOH 1   2001 2001 HOH HOH A . 
S 6 HOH 2   2002 2002 HOH HOH A . 
S 6 HOH 3   2003 2003 HOH HOH A . 
S 6 HOH 4   2004 2004 HOH HOH A . 
S 6 HOH 5   2005 2005 HOH HOH A . 
S 6 HOH 6   2006 2006 HOH HOH A . 
S 6 HOH 7   2007 2007 HOH HOH A . 
S 6 HOH 8   2008 2008 HOH HOH A . 
S 6 HOH 9   2009 2009 HOH HOH A . 
S 6 HOH 10  2010 2010 HOH HOH A . 
S 6 HOH 11  2011 2011 HOH HOH A . 
S 6 HOH 12  2012 2012 HOH HOH A . 
S 6 HOH 13  2013 2013 HOH HOH A . 
S 6 HOH 14  2014 2014 HOH HOH A . 
S 6 HOH 15  2015 2015 HOH HOH A . 
S 6 HOH 16  2016 2016 HOH HOH A . 
S 6 HOH 17  2017 2017 HOH HOH A . 
S 6 HOH 18  2018 2018 HOH HOH A . 
S 6 HOH 19  2019 2019 HOH HOH A . 
S 6 HOH 20  2020 2020 HOH HOH A . 
S 6 HOH 21  2021 2021 HOH HOH A . 
S 6 HOH 22  2022 2022 HOH HOH A . 
S 6 HOH 23  2023 2023 HOH HOH A . 
S 6 HOH 24  2024 2024 HOH HOH A . 
S 6 HOH 25  2025 2025 HOH HOH A . 
S 6 HOH 26  2026 2026 HOH HOH A . 
S 6 HOH 27  2027 2027 HOH HOH A . 
S 6 HOH 28  2028 2028 HOH HOH A . 
S 6 HOH 29  2029 2029 HOH HOH A . 
S 6 HOH 30  2030 2030 HOH HOH A . 
S 6 HOH 31  2031 2031 HOH HOH A . 
S 6 HOH 32  2032 2032 HOH HOH A . 
S 6 HOH 33  2033 2033 HOH HOH A . 
S 6 HOH 34  2034 2034 HOH HOH A . 
S 6 HOH 35  2035 2035 HOH HOH A . 
S 6 HOH 36  2036 2036 HOH HOH A . 
S 6 HOH 37  2037 2037 HOH HOH A . 
S 6 HOH 38  2038 2038 HOH HOH A . 
S 6 HOH 39  2039 2039 HOH HOH A . 
S 6 HOH 40  2040 2040 HOH HOH A . 
S 6 HOH 41  2041 2041 HOH HOH A . 
S 6 HOH 42  2042 2042 HOH HOH A . 
S 6 HOH 43  2043 2043 HOH HOH A . 
S 6 HOH 44  2044 2044 HOH HOH A . 
S 6 HOH 45  2045 2045 HOH HOH A . 
S 6 HOH 46  2046 2046 HOH HOH A . 
S 6 HOH 47  2047 2047 HOH HOH A . 
S 6 HOH 48  2048 2048 HOH HOH A . 
S 6 HOH 49  2049 2049 HOH HOH A . 
S 6 HOH 50  2050 2050 HOH HOH A . 
S 6 HOH 51  2051 2051 HOH HOH A . 
S 6 HOH 52  2052 2052 HOH HOH A . 
S 6 HOH 53  2053 2053 HOH HOH A . 
S 6 HOH 54  2054 2054 HOH HOH A . 
S 6 HOH 55  2055 2055 HOH HOH A . 
S 6 HOH 56  2056 2056 HOH HOH A . 
S 6 HOH 57  2057 2057 HOH HOH A . 
S 6 HOH 58  2058 2058 HOH HOH A . 
S 6 HOH 59  2059 2059 HOH HOH A . 
S 6 HOH 60  2060 2060 HOH HOH A . 
S 6 HOH 61  2061 2061 HOH HOH A . 
S 6 HOH 62  2062 2062 HOH HOH A . 
S 6 HOH 63  2063 2063 HOH HOH A . 
S 6 HOH 64  2064 2064 HOH HOH A . 
S 6 HOH 65  2065 2065 HOH HOH A . 
S 6 HOH 66  2066 2066 HOH HOH A . 
S 6 HOH 67  2067 2067 HOH HOH A . 
S 6 HOH 68  2068 2068 HOH HOH A . 
S 6 HOH 69  2069 2069 HOH HOH A . 
S 6 HOH 70  2070 2070 HOH HOH A . 
S 6 HOH 71  2071 2071 HOH HOH A . 
S 6 HOH 72  2072 2072 HOH HOH A . 
S 6 HOH 73  2073 2073 HOH HOH A . 
S 6 HOH 74  2074 2074 HOH HOH A . 
S 6 HOH 75  2075 2075 HOH HOH A . 
S 6 HOH 76  2076 2076 HOH HOH A . 
S 6 HOH 77  2077 2077 HOH HOH A . 
S 6 HOH 78  2078 2078 HOH HOH A . 
S 6 HOH 79  2079 2079 HOH HOH A . 
S 6 HOH 80  2080 2080 HOH HOH A . 
S 6 HOH 81  2081 2081 HOH HOH A . 
S 6 HOH 82  2082 2082 HOH HOH A . 
S 6 HOH 83  2083 2083 HOH HOH A . 
S 6 HOH 84  2084 2084 HOH HOH A . 
S 6 HOH 85  2085 2085 HOH HOH A . 
S 6 HOH 86  2086 2086 HOH HOH A . 
S 6 HOH 87  2087 2087 HOH HOH A . 
S 6 HOH 88  2088 2088 HOH HOH A . 
S 6 HOH 89  2089 2089 HOH HOH A . 
S 6 HOH 90  2090 2090 HOH HOH A . 
S 6 HOH 91  2091 2091 HOH HOH A . 
S 6 HOH 92  2092 2092 HOH HOH A . 
S 6 HOH 93  2093 2093 HOH HOH A . 
S 6 HOH 94  2094 2094 HOH HOH A . 
S 6 HOH 95  2095 2095 HOH HOH A . 
S 6 HOH 96  2096 2096 HOH HOH A . 
S 6 HOH 97  2097 2097 HOH HOH A . 
S 6 HOH 98  2098 2098 HOH HOH A . 
S 6 HOH 99  2099 2099 HOH HOH A . 
S 6 HOH 100 2100 2100 HOH HOH A . 
S 6 HOH 101 2101 2101 HOH HOH A . 
S 6 HOH 102 2102 2102 HOH HOH A . 
S 6 HOH 103 2103 2103 HOH HOH A . 
S 6 HOH 104 2104 2104 HOH HOH A . 
S 6 HOH 105 2105 2105 HOH HOH A . 
S 6 HOH 106 2106 2106 HOH HOH A . 
S 6 HOH 107 2107 2107 HOH HOH A . 
S 6 HOH 108 2108 2108 HOH HOH A . 
S 6 HOH 109 2109 2109 HOH HOH A . 
S 6 HOH 110 2110 2110 HOH HOH A . 
S 6 HOH 111 2111 2111 HOH HOH A . 
S 6 HOH 112 2112 2112 HOH HOH A . 
S 6 HOH 113 2113 2113 HOH HOH A . 
S 6 HOH 114 2114 2114 HOH HOH A . 
S 6 HOH 115 2115 2115 HOH HOH A . 
S 6 HOH 116 2116 2116 HOH HOH A . 
S 6 HOH 117 2117 2117 HOH HOH A . 
S 6 HOH 118 2118 2118 HOH HOH A . 
S 6 HOH 119 2119 2119 HOH HOH A . 
S 6 HOH 120 2120 2120 HOH HOH A . 
S 6 HOH 121 2121 2121 HOH HOH A . 
S 6 HOH 122 2122 2122 HOH HOH A . 
S 6 HOH 123 2123 2123 HOH HOH A . 
S 6 HOH 124 2124 2124 HOH HOH A . 
S 6 HOH 125 2125 2125 HOH HOH A . 
S 6 HOH 126 2126 2126 HOH HOH A . 
S 6 HOH 127 2127 2127 HOH HOH A . 
S 6 HOH 128 2128 2128 HOH HOH A . 
S 6 HOH 129 2129 2129 HOH HOH A . 
S 6 HOH 130 2130 2130 HOH HOH A . 
S 6 HOH 131 2131 2131 HOH HOH A . 
S 6 HOH 132 2132 2132 HOH HOH A . 
S 6 HOH 133 2133 2133 HOH HOH A . 
S 6 HOH 134 2134 2134 HOH HOH A . 
S 6 HOH 135 2135 2135 HOH HOH A . 
S 6 HOH 136 2136 2136 HOH HOH A . 
S 6 HOH 137 2137 2137 HOH HOH A . 
S 6 HOH 138 2138 2138 HOH HOH A . 
S 6 HOH 139 2139 2139 HOH HOH A . 
S 6 HOH 140 2140 2140 HOH HOH A . 
S 6 HOH 141 2141 2141 HOH HOH A . 
S 6 HOH 142 2142 2142 HOH HOH A . 
S 6 HOH 143 2143 2143 HOH HOH A . 
S 6 HOH 144 2144 2144 HOH HOH A . 
S 6 HOH 145 2145 2145 HOH HOH A . 
S 6 HOH 146 2146 2146 HOH HOH A . 
S 6 HOH 147 2147 2147 HOH HOH A . 
S 6 HOH 148 2148 2148 HOH HOH A . 
S 6 HOH 149 2149 2149 HOH HOH A . 
S 6 HOH 150 2150 2150 HOH HOH A . 
S 6 HOH 151 2151 2151 HOH HOH A . 
S 6 HOH 152 2152 2152 HOH HOH A . 
S 6 HOH 153 2153 2153 HOH HOH A . 
S 6 HOH 154 2154 2154 HOH HOH A . 
S 6 HOH 155 2155 2155 HOH HOH A . 
S 6 HOH 156 2156 2156 HOH HOH A . 
S 6 HOH 157 2157 2157 HOH HOH A . 
S 6 HOH 158 2158 2158 HOH HOH A . 
S 6 HOH 159 2159 2159 HOH HOH A . 
S 6 HOH 160 2160 2160 HOH HOH A . 
S 6 HOH 161 2161 2161 HOH HOH A . 
S 6 HOH 162 2162 2162 HOH HOH A . 
S 6 HOH 163 2163 2163 HOH HOH A . 
S 6 HOH 164 2164 2164 HOH HOH A . 
S 6 HOH 165 2165 2165 HOH HOH A . 
S 6 HOH 166 2166 2166 HOH HOH A . 
S 6 HOH 167 2167 2167 HOH HOH A . 
S 6 HOH 168 2168 2168 HOH HOH A . 
S 6 HOH 169 2169 2169 HOH HOH A . 
S 6 HOH 170 2170 2170 HOH HOH A . 
S 6 HOH 171 2171 2171 HOH HOH A . 
S 6 HOH 172 2172 2172 HOH HOH A . 
S 6 HOH 173 2173 2173 HOH HOH A . 
S 6 HOH 174 2174 2174 HOH HOH A . 
S 6 HOH 175 2175 2175 HOH HOH A . 
S 6 HOH 176 2176 2176 HOH HOH A . 
S 6 HOH 177 2177 2177 HOH HOH A . 
S 6 HOH 178 2178 2178 HOH HOH A . 
S 6 HOH 179 2179 2179 HOH HOH A . 
S 6 HOH 180 2180 2180 HOH HOH A . 
S 6 HOH 181 2181 2181 HOH HOH A . 
S 6 HOH 182 2182 2182 HOH HOH A . 
S 6 HOH 183 2183 2183 HOH HOH A . 
S 6 HOH 184 2184 2184 HOH HOH A . 
S 6 HOH 185 2185 2185 HOH HOH A . 
S 6 HOH 186 2186 2186 HOH HOH A . 
S 6 HOH 187 2187 2187 HOH HOH A . 
S 6 HOH 188 2188 2188 HOH HOH A . 
S 6 HOH 189 2189 2189 HOH HOH A . 
S 6 HOH 190 2190 2190 HOH HOH A . 
S 6 HOH 191 2191 2191 HOH HOH A . 
S 6 HOH 192 2192 2192 HOH HOH A . 
S 6 HOH 193 2193 2193 HOH HOH A . 
S 6 HOH 194 2194 2194 HOH HOH A . 
S 6 HOH 195 2195 2195 HOH HOH A . 
S 6 HOH 196 2196 2196 HOH HOH A . 
S 6 HOH 197 2197 2197 HOH HOH A . 
S 6 HOH 198 2198 2198 HOH HOH A . 
S 6 HOH 199 2199 2199 HOH HOH A . 
S 6 HOH 200 2200 2200 HOH HOH A . 
S 6 HOH 201 2201 2201 HOH HOH A . 
S 6 HOH 202 2202 2202 HOH HOH A . 
S 6 HOH 203 2203 2203 HOH HOH A . 
S 6 HOH 204 2204 2204 HOH HOH A . 
S 6 HOH 205 2205 2205 HOH HOH A . 
S 6 HOH 206 2206 2206 HOH HOH A . 
S 6 HOH 207 2207 2207 HOH HOH A . 
S 6 HOH 208 2208 2208 HOH HOH A . 
S 6 HOH 209 2209 2209 HOH HOH A . 
S 6 HOH 210 2210 2210 HOH HOH A . 
S 6 HOH 211 2211 2211 HOH HOH A . 
S 6 HOH 212 2212 2212 HOH HOH A . 
S 6 HOH 213 2213 2213 HOH HOH A . 
S 6 HOH 214 2214 2214 HOH HOH A . 
S 6 HOH 215 2215 2215 HOH HOH A . 
S 6 HOH 216 2216 2216 HOH HOH A . 
S 6 HOH 217 2217 2217 HOH HOH A . 
S 6 HOH 218 2218 2218 HOH HOH A . 
S 6 HOH 219 2219 2219 HOH HOH A . 
S 6 HOH 220 2220 2220 HOH HOH A . 
S 6 HOH 221 2221 2221 HOH HOH A . 
S 6 HOH 222 2222 2222 HOH HOH A . 
S 6 HOH 223 2223 2223 HOH HOH A . 
S 6 HOH 224 2224 2224 HOH HOH A . 
S 6 HOH 225 2225 2225 HOH HOH A . 
S 6 HOH 226 2226 2226 HOH HOH A . 
S 6 HOH 227 2227 2227 HOH HOH A . 
S 6 HOH 228 2228 2228 HOH HOH A . 
S 6 HOH 229 2229 2229 HOH HOH A . 
S 6 HOH 230 2230 2230 HOH HOH A . 
S 6 HOH 231 2231 2231 HOH HOH A . 
S 6 HOH 232 2232 2232 HOH HOH A . 
S 6 HOH 233 2233 2233 HOH HOH A . 
S 6 HOH 234 2234 2234 HOH HOH A . 
S 6 HOH 235 2235 2235 HOH HOH A . 
S 6 HOH 236 2236 2236 HOH HOH A . 
S 6 HOH 237 2237 2237 HOH HOH A . 
S 6 HOH 238 2238 2238 HOH HOH A . 
S 6 HOH 239 2239 2239 HOH HOH A . 
S 6 HOH 240 2240 2240 HOH HOH A . 
S 6 HOH 241 2241 2241 HOH HOH A . 
S 6 HOH 242 2242 2242 HOH HOH A . 
S 6 HOH 243 2243 2243 HOH HOH A . 
S 6 HOH 244 2244 2244 HOH HOH A . 
S 6 HOH 245 2245 2245 HOH HOH A . 
S 6 HOH 246 2246 2246 HOH HOH A . 
S 6 HOH 247 2247 2247 HOH HOH A . 
S 6 HOH 248 2248 2248 HOH HOH A . 
S 6 HOH 249 2249 2249 HOH HOH A . 
S 6 HOH 250 2250 2250 HOH HOH A . 
S 6 HOH 251 2251 2251 HOH HOH A . 
S 6 HOH 252 2252 2252 HOH HOH A . 
S 6 HOH 253 2253 2253 HOH HOH A . 
S 6 HOH 254 2254 2254 HOH HOH A . 
S 6 HOH 255 2255 2255 HOH HOH A . 
S 6 HOH 256 2256 2256 HOH HOH A . 
S 6 HOH 257 2257 2257 HOH HOH A . 
S 6 HOH 258 2258 2258 HOH HOH A . 
S 6 HOH 259 2259 2259 HOH HOH A . 
S 6 HOH 260 2260 2260 HOH HOH A . 
S 6 HOH 261 2261 2261 HOH HOH A . 
S 6 HOH 262 2262 2262 HOH HOH A . 
S 6 HOH 263 2263 2263 HOH HOH A . 
S 6 HOH 264 2264 2264 HOH HOH A . 
S 6 HOH 265 2265 2265 HOH HOH A . 
S 6 HOH 266 2266 2266 HOH HOH A . 
S 6 HOH 267 2267 2267 HOH HOH A . 
S 6 HOH 268 2268 2268 HOH HOH A . 
S 6 HOH 269 2269 2269 HOH HOH A . 
S 6 HOH 270 2270 2270 HOH HOH A . 
S 6 HOH 271 2271 2271 HOH HOH A . 
S 6 HOH 272 2272 2272 HOH HOH A . 
S 6 HOH 273 2273 2273 HOH HOH A . 
S 6 HOH 274 2274 2274 HOH HOH A . 
S 6 HOH 275 2275 2275 HOH HOH A . 
S 6 HOH 276 2276 2276 HOH HOH A . 
S 6 HOH 277 2277 2277 HOH HOH A . 
S 6 HOH 278 2278 2278 HOH HOH A . 
S 6 HOH 279 2279 2279 HOH HOH A . 
S 6 HOH 280 2280 2280 HOH HOH A . 
S 6 HOH 281 2281 2281 HOH HOH A . 
S 6 HOH 282 2282 2282 HOH HOH A . 
S 6 HOH 283 2283 2283 HOH HOH A . 
S 6 HOH 284 2284 2284 HOH HOH A . 
S 6 HOH 285 2285 2285 HOH HOH A . 
S 6 HOH 286 2286 2286 HOH HOH A . 
S 6 HOH 287 2287 2287 HOH HOH A . 
S 6 HOH 288 2288 2288 HOH HOH A . 
S 6 HOH 289 2289 2289 HOH HOH A . 
S 6 HOH 290 2290 2290 HOH HOH A . 
S 6 HOH 291 2291 2291 HOH HOH A . 
S 6 HOH 292 2292 2292 HOH HOH A . 
S 6 HOH 293 2293 2293 HOH HOH A . 
S 6 HOH 294 2294 2294 HOH HOH A . 
S 6 HOH 295 2295 2295 HOH HOH A . 
S 6 HOH 296 2296 2296 HOH HOH A . 
S 6 HOH 297 2297 2297 HOH HOH A . 
S 6 HOH 298 2298 2298 HOH HOH A . 
S 6 HOH 299 2299 2299 HOH HOH A . 
S 6 HOH 300 2300 2300 HOH HOH A . 
S 6 HOH 301 2301 2301 HOH HOH A . 
S 6 HOH 302 2302 2302 HOH HOH A . 
S 6 HOH 303 2303 2303 HOH HOH A . 
S 6 HOH 304 2304 2304 HOH HOH A . 
S 6 HOH 305 2305 2305 HOH HOH A . 
S 6 HOH 306 2306 2306 HOH HOH A . 
S 6 HOH 307 2307 2307 HOH HOH A . 
S 6 HOH 308 2308 2308 HOH HOH A . 
S 6 HOH 309 2309 2309 HOH HOH A . 
S 6 HOH 310 2310 2310 HOH HOH A . 
S 6 HOH 311 2311 2311 HOH HOH A . 
S 6 HOH 312 2312 2312 HOH HOH A . 
S 6 HOH 313 2313 2313 HOH HOH A . 
S 6 HOH 314 2314 2314 HOH HOH A . 
S 6 HOH 315 2315 2315 HOH HOH A . 
S 6 HOH 316 2316 2316 HOH HOH A . 
S 6 HOH 317 2317 2317 HOH HOH A . 
S 6 HOH 318 2318 2318 HOH HOH A . 
S 6 HOH 319 2319 2319 HOH HOH A . 
S 6 HOH 320 2320 2320 HOH HOH A . 
S 6 HOH 321 2321 2321 HOH HOH A . 
S 6 HOH 322 2322 2322 HOH HOH A . 
S 6 HOH 323 2323 2323 HOH HOH A . 
S 6 HOH 324 2324 2324 HOH HOH A . 
S 6 HOH 325 2325 2325 HOH HOH A . 
S 6 HOH 326 2326 2326 HOH HOH A . 
S 6 HOH 327 2327 2327 HOH HOH A . 
S 6 HOH 328 2328 2328 HOH HOH A . 
S 6 HOH 329 2329 2329 HOH HOH A . 
S 6 HOH 330 2330 2330 HOH HOH A . 
S 6 HOH 331 2331 2331 HOH HOH A . 
S 6 HOH 332 2332 2332 HOH HOH A . 
S 6 HOH 333 2333 2333 HOH HOH A . 
S 6 HOH 334 2334 2334 HOH HOH A . 
S 6 HOH 335 2335 2335 HOH HOH A . 
S 6 HOH 336 2336 2336 HOH HOH A . 
S 6 HOH 337 2337 2337 HOH HOH A . 
S 6 HOH 338 2338 2338 HOH HOH A . 
S 6 HOH 339 2339 2339 HOH HOH A . 
S 6 HOH 340 2340 2340 HOH HOH A . 
S 6 HOH 341 2341 2341 HOH HOH A . 
S 6 HOH 342 2342 2342 HOH HOH A . 
S 6 HOH 343 2343 2343 HOH HOH A . 
S 6 HOH 344 2344 2344 HOH HOH A . 
S 6 HOH 345 2345 2345 HOH HOH A . 
S 6 HOH 346 2346 2346 HOH HOH A . 
S 6 HOH 347 2347 2347 HOH HOH A . 
S 6 HOH 348 2348 2348 HOH HOH A . 
S 6 HOH 349 2349 2349 HOH HOH A . 
S 6 HOH 350 2350 2350 HOH HOH A . 
S 6 HOH 351 2351 2351 HOH HOH A . 
S 6 HOH 352 2352 2352 HOH HOH A . 
S 6 HOH 353 2353 2353 HOH HOH A . 
S 6 HOH 354 2354 2354 HOH HOH A . 
S 6 HOH 355 2355 2355 HOH HOH A . 
S 6 HOH 356 2356 2356 HOH HOH A . 
S 6 HOH 357 2357 2357 HOH HOH A . 
S 6 HOH 358 2358 2358 HOH HOH A . 
S 6 HOH 359 2359 2359 HOH HOH A . 
S 6 HOH 360 2360 2360 HOH HOH A . 
S 6 HOH 361 2361 2361 HOH HOH A . 
S 6 HOH 362 2362 2362 HOH HOH A . 
S 6 HOH 363 2363 2363 HOH HOH A . 
S 6 HOH 364 2364 2364 HOH HOH A . 
T 6 HOH 1   2001 2001 HOH HOH B . 
T 6 HOH 2   2002 2002 HOH HOH B . 
T 6 HOH 3   2003 2003 HOH HOH B . 
T 6 HOH 4   2004 2004 HOH HOH B . 
T 6 HOH 5   2005 2005 HOH HOH B . 
T 6 HOH 6   2006 2006 HOH HOH B . 
T 6 HOH 7   2007 2007 HOH HOH B . 
T 6 HOH 8   2008 2008 HOH HOH B . 
T 6 HOH 9   2009 2009 HOH HOH B . 
T 6 HOH 10  2010 2010 HOH HOH B . 
T 6 HOH 11  2011 2011 HOH HOH B . 
T 6 HOH 12  2012 2012 HOH HOH B . 
T 6 HOH 13  2013 2013 HOH HOH B . 
T 6 HOH 14  2014 2014 HOH HOH B . 
T 6 HOH 15  2015 2015 HOH HOH B . 
T 6 HOH 16  2016 2016 HOH HOH B . 
T 6 HOH 17  2017 2017 HOH HOH B . 
T 6 HOH 18  2018 2018 HOH HOH B . 
T 6 HOH 19  2019 2019 HOH HOH B . 
T 6 HOH 20  2020 2020 HOH HOH B . 
T 6 HOH 21  2021 2021 HOH HOH B . 
T 6 HOH 22  2022 2022 HOH HOH B . 
T 6 HOH 23  2023 2023 HOH HOH B . 
T 6 HOH 24  2024 2024 HOH HOH B . 
T 6 HOH 25  2025 2025 HOH HOH B . 
T 6 HOH 26  2026 2026 HOH HOH B . 
T 6 HOH 27  2027 2027 HOH HOH B . 
T 6 HOH 28  2028 2028 HOH HOH B . 
T 6 HOH 29  2029 2029 HOH HOH B . 
T 6 HOH 30  2030 2030 HOH HOH B . 
T 6 HOH 31  2031 2031 HOH HOH B . 
T 6 HOH 32  2032 2032 HOH HOH B . 
T 6 HOH 33  2033 2033 HOH HOH B . 
T 6 HOH 34  2034 2034 HOH HOH B . 
T 6 HOH 35  2035 2035 HOH HOH B . 
T 6 HOH 36  2036 2036 HOH HOH B . 
T 6 HOH 37  2037 2037 HOH HOH B . 
T 6 HOH 38  2038 2038 HOH HOH B . 
T 6 HOH 39  2039 2039 HOH HOH B . 
T 6 HOH 40  2040 2040 HOH HOH B . 
T 6 HOH 41  2041 2041 HOH HOH B . 
T 6 HOH 42  2042 2042 HOH HOH B . 
T 6 HOH 43  2043 2043 HOH HOH B . 
T 6 HOH 44  2044 2044 HOH HOH B . 
T 6 HOH 45  2045 2045 HOH HOH B . 
T 6 HOH 46  2046 2046 HOH HOH B . 
T 6 HOH 47  2047 2047 HOH HOH B . 
T 6 HOH 48  2048 2048 HOH HOH B . 
T 6 HOH 49  2049 2049 HOH HOH B . 
T 6 HOH 50  2050 2050 HOH HOH B . 
T 6 HOH 51  2051 2051 HOH HOH B . 
T 6 HOH 52  2052 2052 HOH HOH B . 
T 6 HOH 53  2053 2053 HOH HOH B . 
T 6 HOH 54  2054 2054 HOH HOH B . 
T 6 HOH 55  2055 2055 HOH HOH B . 
T 6 HOH 56  2056 2056 HOH HOH B . 
T 6 HOH 57  2057 2057 HOH HOH B . 
T 6 HOH 58  2058 2058 HOH HOH B . 
T 6 HOH 59  2059 2059 HOH HOH B . 
T 6 HOH 60  2060 2060 HOH HOH B . 
T 6 HOH 61  2061 2061 HOH HOH B . 
T 6 HOH 62  2062 2062 HOH HOH B . 
T 6 HOH 63  2063 2063 HOH HOH B . 
T 6 HOH 64  2064 2064 HOH HOH B . 
T 6 HOH 65  2065 2065 HOH HOH B . 
T 6 HOH 66  2067 2067 HOH HOH B . 
T 6 HOH 67  2068 2068 HOH HOH B . 
T 6 HOH 68  2069 2069 HOH HOH B . 
T 6 HOH 69  2070 2070 HOH HOH B . 
T 6 HOH 70  2071 2071 HOH HOH B . 
T 6 HOH 71  2072 2072 HOH HOH B . 
T 6 HOH 72  2073 2073 HOH HOH B . 
T 6 HOH 73  2074 2074 HOH HOH B . 
T 6 HOH 74  2075 2075 HOH HOH B . 
T 6 HOH 75  2076 2076 HOH HOH B . 
T 6 HOH 76  2077 2077 HOH HOH B . 
T 6 HOH 77  2078 2078 HOH HOH B . 
T 6 HOH 78  2079 2079 HOH HOH B . 
T 6 HOH 79  2080 2080 HOH HOH B . 
T 6 HOH 80  2081 2081 HOH HOH B . 
T 6 HOH 81  2082 2082 HOH HOH B . 
T 6 HOH 82  2083 2083 HOH HOH B . 
T 6 HOH 83  2084 2084 HOH HOH B . 
T 6 HOH 84  2085 2085 HOH HOH B . 
T 6 HOH 85  2086 2086 HOH HOH B . 
T 6 HOH 86  2087 2087 HOH HOH B . 
T 6 HOH 87  2088 2088 HOH HOH B . 
T 6 HOH 88  2089 2089 HOH HOH B . 
T 6 HOH 89  2090 2090 HOH HOH B . 
T 6 HOH 90  2091 2091 HOH HOH B . 
T 6 HOH 91  2092 2092 HOH HOH B . 
T 6 HOH 92  2093 2093 HOH HOH B . 
T 6 HOH 93  2094 2094 HOH HOH B . 
T 6 HOH 94  2095 2095 HOH HOH B . 
T 6 HOH 95  2096 2096 HOH HOH B . 
T 6 HOH 96  2097 2097 HOH HOH B . 
T 6 HOH 97  2098 2098 HOH HOH B . 
T 6 HOH 98  2099 2099 HOH HOH B . 
T 6 HOH 99  2100 2100 HOH HOH B . 
T 6 HOH 100 2101 2101 HOH HOH B . 
T 6 HOH 101 2102 2102 HOH HOH B . 
T 6 HOH 102 2103 2103 HOH HOH B . 
T 6 HOH 103 2104 2104 HOH HOH B . 
T 6 HOH 104 2105 2105 HOH HOH B . 
T 6 HOH 105 2106 2106 HOH HOH B . 
T 6 HOH 106 2107 2107 HOH HOH B . 
T 6 HOH 107 2108 2108 HOH HOH B . 
T 6 HOH 108 2109 2109 HOH HOH B . 
T 6 HOH 109 2110 2110 HOH HOH B . 
T 6 HOH 110 2111 2111 HOH HOH B . 
T 6 HOH 111 2112 2112 HOH HOH B . 
T 6 HOH 112 2113 2113 HOH HOH B . 
T 6 HOH 113 2114 2114 HOH HOH B . 
T 6 HOH 114 2115 2115 HOH HOH B . 
T 6 HOH 115 2116 2116 HOH HOH B . 
T 6 HOH 116 2117 2117 HOH HOH B . 
T 6 HOH 117 2118 2118 HOH HOH B . 
T 6 HOH 118 2119 2119 HOH HOH B . 
T 6 HOH 119 2120 2120 HOH HOH B . 
T 6 HOH 120 2121 2121 HOH HOH B . 
T 6 HOH 121 2122 2122 HOH HOH B . 
T 6 HOH 122 2123 2123 HOH HOH B . 
T 6 HOH 123 2124 2124 HOH HOH B . 
T 6 HOH 124 2125 2125 HOH HOH B . 
T 6 HOH 125 2126 2126 HOH HOH B . 
T 6 HOH 126 2127 2127 HOH HOH B . 
T 6 HOH 127 2128 2128 HOH HOH B . 
T 6 HOH 128 2129 2129 HOH HOH B . 
T 6 HOH 129 2130 2130 HOH HOH B . 
T 6 HOH 130 2131 2131 HOH HOH B . 
T 6 HOH 131 2132 2132 HOH HOH B . 
T 6 HOH 132 2133 2133 HOH HOH B . 
T 6 HOH 133 2134 2134 HOH HOH B . 
T 6 HOH 134 2135 2135 HOH HOH B . 
T 6 HOH 135 2136 2136 HOH HOH B . 
T 6 HOH 136 2137 2137 HOH HOH B . 
T 6 HOH 137 2138 2138 HOH HOH B . 
T 6 HOH 138 2139 2139 HOH HOH B . 
T 6 HOH 139 2140 2140 HOH HOH B . 
T 6 HOH 140 2141 2141 HOH HOH B . 
T 6 HOH 141 2142 2142 HOH HOH B . 
T 6 HOH 142 2143 2143 HOH HOH B . 
T 6 HOH 143 2144 2144 HOH HOH B . 
T 6 HOH 144 2145 2145 HOH HOH B . 
T 6 HOH 145 2146 2146 HOH HOH B . 
T 6 HOH 146 2147 2147 HOH HOH B . 
T 6 HOH 147 2148 2148 HOH HOH B . 
T 6 HOH 148 2149 2149 HOH HOH B . 
T 6 HOH 149 2150 2150 HOH HOH B . 
T 6 HOH 150 2151 2151 HOH HOH B . 
T 6 HOH 151 2152 2152 HOH HOH B . 
T 6 HOH 152 2153 2153 HOH HOH B . 
T 6 HOH 153 2154 2154 HOH HOH B . 
T 6 HOH 154 2155 2155 HOH HOH B . 
T 6 HOH 155 2156 2156 HOH HOH B . 
T 6 HOH 156 2157 2157 HOH HOH B . 
T 6 HOH 157 2158 2158 HOH HOH B . 
T 6 HOH 158 2159 2159 HOH HOH B . 
T 6 HOH 159 2160 2160 HOH HOH B . 
T 6 HOH 160 2161 2161 HOH HOH B . 
T 6 HOH 161 2162 2162 HOH HOH B . 
T 6 HOH 162 2163 2163 HOH HOH B . 
T 6 HOH 163 2164 2164 HOH HOH B . 
T 6 HOH 164 2165 2165 HOH HOH B . 
T 6 HOH 165 2166 2166 HOH HOH B . 
T 6 HOH 166 2167 2167 HOH HOH B . 
T 6 HOH 167 2168 2168 HOH HOH B . 
T 6 HOH 168 2169 2169 HOH HOH B . 
T 6 HOH 169 2170 2170 HOH HOH B . 
T 6 HOH 170 2171 2171 HOH HOH B . 
T 6 HOH 171 2172 2172 HOH HOH B . 
T 6 HOH 172 2173 2173 HOH HOH B . 
T 6 HOH 173 2174 2174 HOH HOH B . 
T 6 HOH 174 2175 2175 HOH HOH B . 
T 6 HOH 175 2176 2176 HOH HOH B . 
T 6 HOH 176 2177 2177 HOH HOH B . 
T 6 HOH 177 2178 2178 HOH HOH B . 
T 6 HOH 178 2179 2179 HOH HOH B . 
T 6 HOH 179 2180 2180 HOH HOH B . 
T 6 HOH 180 2181 2181 HOH HOH B . 
T 6 HOH 181 2182 2182 HOH HOH B . 
T 6 HOH 182 2183 2183 HOH HOH B . 
T 6 HOH 183 2184 2184 HOH HOH B . 
T 6 HOH 184 2185 2185 HOH HOH B . 
T 6 HOH 185 2186 2186 HOH HOH B . 
T 6 HOH 186 2187 2187 HOH HOH B . 
T 6 HOH 187 2188 2188 HOH HOH B . 
T 6 HOH 188 2189 2189 HOH HOH B . 
T 6 HOH 189 2190 2190 HOH HOH B . 
T 6 HOH 190 2191 2191 HOH HOH B . 
T 6 HOH 191 2192 2192 HOH HOH B . 
T 6 HOH 192 2193 2193 HOH HOH B . 
T 6 HOH 193 2194 2194 HOH HOH B . 
T 6 HOH 194 2195 2195 HOH HOH B . 
T 6 HOH 195 2196 2196 HOH HOH B . 
T 6 HOH 196 2197 2197 HOH HOH B . 
T 6 HOH 197 2198 2198 HOH HOH B . 
T 6 HOH 198 2199 2199 HOH HOH B . 
T 6 HOH 199 2200 2200 HOH HOH B . 
T 6 HOH 200 2201 2201 HOH HOH B . 
T 6 HOH 201 2202 2202 HOH HOH B . 
T 6 HOH 202 2203 2203 HOH HOH B . 
T 6 HOH 203 2204 2204 HOH HOH B . 
T 6 HOH 204 2205 2205 HOH HOH B . 
T 6 HOH 205 2206 2206 HOH HOH B . 
T 6 HOH 206 2207 2207 HOH HOH B . 
T 6 HOH 207 2208 2208 HOH HOH B . 
T 6 HOH 208 2209 2209 HOH HOH B . 
T 6 HOH 209 2210 2210 HOH HOH B . 
T 6 HOH 210 2211 2211 HOH HOH B . 
T 6 HOH 211 2212 2212 HOH HOH B . 
T 6 HOH 212 2213 2213 HOH HOH B . 
T 6 HOH 213 2214 2214 HOH HOH B . 
T 6 HOH 214 2215 2215 HOH HOH B . 
T 6 HOH 215 2216 2216 HOH HOH B . 
T 6 HOH 216 2217 2217 HOH HOH B . 
T 6 HOH 217 2218 2218 HOH HOH B . 
T 6 HOH 218 2219 2219 HOH HOH B . 
T 6 HOH 219 2220 2220 HOH HOH B . 
T 6 HOH 220 2221 2221 HOH HOH B . 
T 6 HOH 221 2222 2222 HOH HOH B . 
T 6 HOH 222 2223 2223 HOH HOH B . 
T 6 HOH 223 2224 2224 HOH HOH B . 
T 6 HOH 224 2225 2225 HOH HOH B . 
T 6 HOH 225 2226 2226 HOH HOH B . 
T 6 HOH 226 2227 2227 HOH HOH B . 
T 6 HOH 227 2228 2228 HOH HOH B . 
T 6 HOH 228 2229 2229 HOH HOH B . 
T 6 HOH 229 2230 2230 HOH HOH B . 
T 6 HOH 230 2231 2231 HOH HOH B . 
T 6 HOH 231 2232 2232 HOH HOH B . 
T 6 HOH 232 2233 2233 HOH HOH B . 
T 6 HOH 233 2234 2234 HOH HOH B . 
T 6 HOH 234 2235 2235 HOH HOH B . 
T 6 HOH 235 2236 2236 HOH HOH B . 
T 6 HOH 236 2237 2237 HOH HOH B . 
T 6 HOH 237 2238 2238 HOH HOH B . 
T 6 HOH 238 2239 2239 HOH HOH B . 
T 6 HOH 239 2240 2240 HOH HOH B . 
T 6 HOH 240 2241 2241 HOH HOH B . 
T 6 HOH 241 2242 2242 HOH HOH B . 
T 6 HOH 242 2243 2243 HOH HOH B . 
T 6 HOH 243 2244 2244 HOH HOH B . 
T 6 HOH 244 2245 2245 HOH HOH B . 
T 6 HOH 245 2246 2246 HOH HOH B . 
T 6 HOH 246 2247 2247 HOH HOH B . 
T 6 HOH 247 2248 2248 HOH HOH B . 
T 6 HOH 248 2249 2249 HOH HOH B . 
T 6 HOH 249 2250 2250 HOH HOH B . 
T 6 HOH 250 2251 2251 HOH HOH B . 
T 6 HOH 251 2252 2252 HOH HOH B . 
T 6 HOH 252 2253 2253 HOH HOH B . 
T 6 HOH 253 2254 2254 HOH HOH B . 
T 6 HOH 254 2255 2255 HOH HOH B . 
T 6 HOH 255 2256 2256 HOH HOH B . 
T 6 HOH 256 2257 2257 HOH HOH B . 
T 6 HOH 257 2258 2258 HOH HOH B . 
T 6 HOH 258 2259 2259 HOH HOH B . 
T 6 HOH 259 2260 2260 HOH HOH B . 
T 6 HOH 260 2261 2261 HOH HOH B . 
T 6 HOH 261 2262 2262 HOH HOH B . 
T 6 HOH 262 2263 2263 HOH HOH B . 
T 6 HOH 263 2264 2264 HOH HOH B . 
T 6 HOH 264 2265 2265 HOH HOH B . 
T 6 HOH 265 2266 2266 HOH HOH B . 
T 6 HOH 266 2267 2267 HOH HOH B . 
T 6 HOH 267 2268 2268 HOH HOH B . 
T 6 HOH 268 2269 2269 HOH HOH B . 
T 6 HOH 269 2270 2270 HOH HOH B . 
T 6 HOH 270 2271 2271 HOH HOH B . 
T 6 HOH 271 2272 2272 HOH HOH B . 
T 6 HOH 272 2273 2273 HOH HOH B . 
T 6 HOH 273 2274 2274 HOH HOH B . 
T 6 HOH 274 2275 2275 HOH HOH B . 
T 6 HOH 275 2276 2276 HOH HOH B . 
T 6 HOH 276 2277 2277 HOH HOH B . 
T 6 HOH 277 2278 2278 HOH HOH B . 
T 6 HOH 278 2279 2279 HOH HOH B . 
T 6 HOH 279 2280 2280 HOH HOH B . 
T 6 HOH 280 2281 2281 HOH HOH B . 
T 6 HOH 281 2282 2282 HOH HOH B . 
T 6 HOH 282 2283 2283 HOH HOH B . 
T 6 HOH 283 2284 2284 HOH HOH B . 
T 6 HOH 284 2285 2285 HOH HOH B . 
T 6 HOH 285 2286 2286 HOH HOH B . 
T 6 HOH 286 2287 2287 HOH HOH B . 
T 6 HOH 287 2288 2288 HOH HOH B . 
T 6 HOH 288 2289 2289 HOH HOH B . 
T 6 HOH 289 2290 2290 HOH HOH B . 
T 6 HOH 290 2291 2291 HOH HOH B . 
T 6 HOH 291 2292 2292 HOH HOH B . 
T 6 HOH 292 2293 2293 HOH HOH B . 
T 6 HOH 293 2294 2294 HOH HOH B . 
T 6 HOH 294 2295 2295 HOH HOH B . 
T 6 HOH 295 2296 2296 HOH HOH B . 
T 6 HOH 296 2297 2297 HOH HOH B . 
T 6 HOH 297 2298 2298 HOH HOH B . 
T 6 HOH 298 2299 2299 HOH HOH B . 
T 6 HOH 299 2300 2300 HOH HOH B . 
T 6 HOH 300 2301 2301 HOH HOH B . 
T 6 HOH 301 2302 2302 HOH HOH B . 
T 6 HOH 302 2303 2303 HOH HOH B . 
T 6 HOH 303 2304 2304 HOH HOH B . 
T 6 HOH 304 2305 2305 HOH HOH B . 
T 6 HOH 305 2306 2306 HOH HOH B . 
T 6 HOH 306 2307 2307 HOH HOH B . 
T 6 HOH 307 2308 2308 HOH HOH B . 
T 6 HOH 308 2309 2309 HOH HOH B . 
T 6 HOH 309 2310 2310 HOH HOH B . 
T 6 HOH 310 2311 2311 HOH HOH B . 
T 6 HOH 311 2312 2312 HOH HOH B . 
T 6 HOH 312 2313 2313 HOH HOH B . 
T 6 HOH 313 2314 2314 HOH HOH B . 
T 6 HOH 314 2315 2315 HOH HOH B . 
T 6 HOH 315 2316 2316 HOH HOH B . 
T 6 HOH 316 2317 2317 HOH HOH B . 
U 6 HOH 1   2001 2001 HOH HOH C . 
U 6 HOH 2   2002 2002 HOH HOH C . 
U 6 HOH 3   2003 2003 HOH HOH C . 
U 6 HOH 4   2004 2004 HOH HOH C . 
U 6 HOH 5   2005 2005 HOH HOH C . 
U 6 HOH 6   2006 2006 HOH HOH C . 
U 6 HOH 7   2007 2007 HOH HOH C . 
U 6 HOH 8   2008 2008 HOH HOH C . 
U 6 HOH 9   2009 2009 HOH HOH C . 
U 6 HOH 10  2010 2010 HOH HOH C . 
U 6 HOH 11  2011 2011 HOH HOH C . 
U 6 HOH 12  2012 2012 HOH HOH C . 
U 6 HOH 13  2013 2013 HOH HOH C . 
U 6 HOH 14  2014 2014 HOH HOH C . 
U 6 HOH 15  2015 2015 HOH HOH C . 
U 6 HOH 16  2016 2016 HOH HOH C . 
U 6 HOH 17  2017 2017 HOH HOH C . 
U 6 HOH 18  2018 2018 HOH HOH C . 
U 6 HOH 19  2019 2019 HOH HOH C . 
U 6 HOH 20  2020 2020 HOH HOH C . 
U 6 HOH 21  2021 2021 HOH HOH C . 
U 6 HOH 22  2022 2022 HOH HOH C . 
U 6 HOH 23  2023 2023 HOH HOH C . 
U 6 HOH 24  2024 2024 HOH HOH C . 
U 6 HOH 25  2025 2025 HOH HOH C . 
U 6 HOH 26  2026 2026 HOH HOH C . 
U 6 HOH 27  2027 2027 HOH HOH C . 
U 6 HOH 28  2028 2028 HOH HOH C . 
U 6 HOH 29  2029 2029 HOH HOH C . 
U 6 HOH 30  2030 2030 HOH HOH C . 
U 6 HOH 31  2031 2031 HOH HOH C . 
U 6 HOH 32  2032 2032 HOH HOH C . 
U 6 HOH 33  2033 2033 HOH HOH C . 
U 6 HOH 34  2034 2034 HOH HOH C . 
U 6 HOH 35  2035 2035 HOH HOH C . 
U 6 HOH 36  2036 2036 HOH HOH C . 
U 6 HOH 37  2037 2037 HOH HOH C . 
U 6 HOH 38  2038 2038 HOH HOH C . 
U 6 HOH 39  2039 2039 HOH HOH C . 
U 6 HOH 40  2040 2040 HOH HOH C . 
U 6 HOH 41  2041 2041 HOH HOH C . 
U 6 HOH 42  2042 2042 HOH HOH C . 
U 6 HOH 43  2043 2043 HOH HOH C . 
U 6 HOH 44  2044 2044 HOH HOH C . 
U 6 HOH 45  2045 2045 HOH HOH C . 
U 6 HOH 46  2046 2046 HOH HOH C . 
U 6 HOH 47  2047 2047 HOH HOH C . 
U 6 HOH 48  2048 2048 HOH HOH C . 
U 6 HOH 49  2049 2049 HOH HOH C . 
U 6 HOH 50  2050 2050 HOH HOH C . 
U 6 HOH 51  2051 2051 HOH HOH C . 
U 6 HOH 52  2052 2052 HOH HOH C . 
U 6 HOH 53  2053 2053 HOH HOH C . 
U 6 HOH 54  2054 2054 HOH HOH C . 
U 6 HOH 55  2055 2055 HOH HOH C . 
U 6 HOH 56  2056 2056 HOH HOH C . 
U 6 HOH 57  2057 2057 HOH HOH C . 
U 6 HOH 58  2058 2058 HOH HOH C . 
U 6 HOH 59  2059 2059 HOH HOH C . 
U 6 HOH 60  2060 2060 HOH HOH C . 
U 6 HOH 61  2061 2061 HOH HOH C . 
U 6 HOH 62  2062 2062 HOH HOH C . 
U 6 HOH 63  2063 2063 HOH HOH C . 
U 6 HOH 64  2064 2064 HOH HOH C . 
U 6 HOH 65  2065 2065 HOH HOH C . 
U 6 HOH 66  2066 2066 HOH HOH C . 
U 6 HOH 67  2067 2067 HOH HOH C . 
U 6 HOH 68  2068 2068 HOH HOH C . 
U 6 HOH 69  2069 2069 HOH HOH C . 
U 6 HOH 70  2070 2070 HOH HOH C . 
U 6 HOH 71  2071 2071 HOH HOH C . 
U 6 HOH 72  2072 2072 HOH HOH C . 
U 6 HOH 73  2073 2073 HOH HOH C . 
U 6 HOH 74  2074 2074 HOH HOH C . 
U 6 HOH 75  2075 2075 HOH HOH C . 
U 6 HOH 76  2076 2076 HOH HOH C . 
U 6 HOH 77  2077 2077 HOH HOH C . 
U 6 HOH 78  2078 2078 HOH HOH C . 
U 6 HOH 79  2079 2079 HOH HOH C . 
U 6 HOH 80  2080 2080 HOH HOH C . 
U 6 HOH 81  2081 2081 HOH HOH C . 
U 6 HOH 82  2082 2082 HOH HOH C . 
U 6 HOH 83  2083 2083 HOH HOH C . 
U 6 HOH 84  2084 2084 HOH HOH C . 
U 6 HOH 85  2085 2085 HOH HOH C . 
U 6 HOH 86  2086 2086 HOH HOH C . 
U 6 HOH 87  2087 2087 HOH HOH C . 
U 6 HOH 88  2088 2088 HOH HOH C . 
U 6 HOH 89  2089 2089 HOH HOH C . 
U 6 HOH 90  2090 2090 HOH HOH C . 
U 6 HOH 91  2091 2091 HOH HOH C . 
U 6 HOH 92  2092 2092 HOH HOH C . 
U 6 HOH 93  2093 2093 HOH HOH C . 
U 6 HOH 94  2094 2094 HOH HOH C . 
U 6 HOH 95  2095 2095 HOH HOH C . 
U 6 HOH 96  2096 2096 HOH HOH C . 
U 6 HOH 97  2097 2097 HOH HOH C . 
U 6 HOH 98  2098 2098 HOH HOH C . 
U 6 HOH 99  2099 2099 HOH HOH C . 
U 6 HOH 100 2100 2100 HOH HOH C . 
U 6 HOH 101 2101 2101 HOH HOH C . 
U 6 HOH 102 2102 2102 HOH HOH C . 
U 6 HOH 103 2103 2103 HOH HOH C . 
U 6 HOH 104 2104 2104 HOH HOH C . 
U 6 HOH 105 2105 2105 HOH HOH C . 
U 6 HOH 106 2106 2106 HOH HOH C . 
U 6 HOH 107 2107 2107 HOH HOH C . 
U 6 HOH 108 2108 2108 HOH HOH C . 
U 6 HOH 109 2109 2109 HOH HOH C . 
U 6 HOH 110 2110 2110 HOH HOH C . 
U 6 HOH 111 2111 2111 HOH HOH C . 
U 6 HOH 112 2112 2112 HOH HOH C . 
U 6 HOH 113 2113 2113 HOH HOH C . 
U 6 HOH 114 2114 2114 HOH HOH C . 
U 6 HOH 115 2115 2115 HOH HOH C . 
U 6 HOH 116 2116 2116 HOH HOH C . 
U 6 HOH 117 2117 2117 HOH HOH C . 
U 6 HOH 118 2118 2118 HOH HOH C . 
U 6 HOH 119 2119 2119 HOH HOH C . 
U 6 HOH 120 2120 2120 HOH HOH C . 
U 6 HOH 121 2121 2121 HOH HOH C . 
U 6 HOH 122 2122 2122 HOH HOH C . 
U 6 HOH 123 2123 2123 HOH HOH C . 
U 6 HOH 124 2124 2124 HOH HOH C . 
U 6 HOH 125 2125 2125 HOH HOH C . 
U 6 HOH 126 2126 2126 HOH HOH C . 
U 6 HOH 127 2127 2127 HOH HOH C . 
U 6 HOH 128 2128 2128 HOH HOH C . 
U 6 HOH 129 2129 2129 HOH HOH C . 
U 6 HOH 130 2130 2130 HOH HOH C . 
U 6 HOH 131 2131 2131 HOH HOH C . 
U 6 HOH 132 2132 2132 HOH HOH C . 
U 6 HOH 133 2133 2133 HOH HOH C . 
U 6 HOH 134 2134 2134 HOH HOH C . 
U 6 HOH 135 2135 2135 HOH HOH C . 
U 6 HOH 136 2136 2136 HOH HOH C . 
U 6 HOH 137 2137 2137 HOH HOH C . 
U 6 HOH 138 2138 2138 HOH HOH C . 
U 6 HOH 139 2139 2139 HOH HOH C . 
U 6 HOH 140 2140 2140 HOH HOH C . 
U 6 HOH 141 2141 2141 HOH HOH C . 
U 6 HOH 142 2142 2142 HOH HOH C . 
U 6 HOH 143 2143 2143 HOH HOH C . 
U 6 HOH 144 2144 2144 HOH HOH C . 
U 6 HOH 145 2145 2145 HOH HOH C . 
U 6 HOH 146 2146 2146 HOH HOH C . 
U 6 HOH 147 2147 2147 HOH HOH C . 
U 6 HOH 148 2148 2148 HOH HOH C . 
U 6 HOH 149 2149 2149 HOH HOH C . 
U 6 HOH 150 2150 2150 HOH HOH C . 
U 6 HOH 151 2151 2151 HOH HOH C . 
U 6 HOH 152 2152 2152 HOH HOH C . 
U 6 HOH 153 2153 2153 HOH HOH C . 
U 6 HOH 154 2154 2154 HOH HOH C . 
U 6 HOH 155 2155 2155 HOH HOH C . 
U 6 HOH 156 2156 2156 HOH HOH C . 
U 6 HOH 157 2157 2157 HOH HOH C . 
U 6 HOH 158 2158 2158 HOH HOH C . 
U 6 HOH 159 2159 2159 HOH HOH C . 
U 6 HOH 160 2160 2160 HOH HOH C . 
U 6 HOH 161 2161 2161 HOH HOH C . 
U 6 HOH 162 2162 2162 HOH HOH C . 
U 6 HOH 163 2163 2163 HOH HOH C . 
U 6 HOH 164 2164 2164 HOH HOH C . 
U 6 HOH 165 2165 2165 HOH HOH C . 
U 6 HOH 166 2166 2166 HOH HOH C . 
U 6 HOH 167 2167 2167 HOH HOH C . 
U 6 HOH 168 2168 2168 HOH HOH C . 
U 6 HOH 169 2169 2169 HOH HOH C . 
U 6 HOH 170 2170 2170 HOH HOH C . 
U 6 HOH 171 2171 2171 HOH HOH C . 
U 6 HOH 172 2172 2172 HOH HOH C . 
U 6 HOH 173 2173 2173 HOH HOH C . 
U 6 HOH 174 2174 2174 HOH HOH C . 
U 6 HOH 175 2175 2175 HOH HOH C . 
U 6 HOH 176 2176 2176 HOH HOH C . 
U 6 HOH 177 2177 2177 HOH HOH C . 
U 6 HOH 178 2178 2178 HOH HOH C . 
U 6 HOH 179 2179 2179 HOH HOH C . 
U 6 HOH 180 2180 2180 HOH HOH C . 
U 6 HOH 181 2181 2181 HOH HOH C . 
U 6 HOH 182 2182 2182 HOH HOH C . 
U 6 HOH 183 2183 2183 HOH HOH C . 
U 6 HOH 184 2184 2184 HOH HOH C . 
U 6 HOH 185 2185 2185 HOH HOH C . 
U 6 HOH 186 2186 2186 HOH HOH C . 
U 6 HOH 187 2187 2187 HOH HOH C . 
U 6 HOH 188 2188 2188 HOH HOH C . 
U 6 HOH 189 2189 2189 HOH HOH C . 
U 6 HOH 190 2190 2190 HOH HOH C . 
U 6 HOH 191 2191 2191 HOH HOH C . 
U 6 HOH 192 2192 2192 HOH HOH C . 
U 6 HOH 193 2193 2193 HOH HOH C . 
U 6 HOH 194 2194 2194 HOH HOH C . 
U 6 HOH 195 2195 2195 HOH HOH C . 
U 6 HOH 196 2196 2196 HOH HOH C . 
U 6 HOH 197 2197 2197 HOH HOH C . 
U 6 HOH 198 2198 2198 HOH HOH C . 
U 6 HOH 199 2199 2199 HOH HOH C . 
U 6 HOH 200 2200 2200 HOH HOH C . 
U 6 HOH 201 2201 2201 HOH HOH C . 
U 6 HOH 202 2202 2202 HOH HOH C . 
U 6 HOH 203 2203 2203 HOH HOH C . 
U 6 HOH 204 2204 2204 HOH HOH C . 
U 6 HOH 205 2205 2205 HOH HOH C . 
U 6 HOH 206 2206 2206 HOH HOH C . 
U 6 HOH 207 2207 2207 HOH HOH C . 
U 6 HOH 208 2208 2208 HOH HOH C . 
U 6 HOH 209 2209 2209 HOH HOH C . 
U 6 HOH 210 2210 2210 HOH HOH C . 
U 6 HOH 211 2211 2211 HOH HOH C . 
U 6 HOH 212 2212 2212 HOH HOH C . 
U 6 HOH 213 2213 2213 HOH HOH C . 
U 6 HOH 214 2214 2214 HOH HOH C . 
U 6 HOH 215 2215 2215 HOH HOH C . 
U 6 HOH 216 2216 2216 HOH HOH C . 
U 6 HOH 217 2217 2217 HOH HOH C . 
U 6 HOH 218 2218 2218 HOH HOH C . 
U 6 HOH 219 2219 2219 HOH HOH C . 
U 6 HOH 220 2220 2220 HOH HOH C . 
U 6 HOH 221 2221 2221 HOH HOH C . 
U 6 HOH 222 2222 2222 HOH HOH C . 
U 6 HOH 223 2223 2223 HOH HOH C . 
U 6 HOH 224 2224 2224 HOH HOH C . 
U 6 HOH 225 2225 2225 HOH HOH C . 
U 6 HOH 226 2226 2226 HOH HOH C . 
U 6 HOH 227 2227 2227 HOH HOH C . 
U 6 HOH 228 2228 2228 HOH HOH C . 
U 6 HOH 229 2229 2229 HOH HOH C . 
U 6 HOH 230 2230 2230 HOH HOH C . 
U 6 HOH 231 2231 2231 HOH HOH C . 
V 6 HOH 1   2001 2001 HOH HOH D . 
V 6 HOH 2   2002 2002 HOH HOH D . 
V 6 HOH 3   2003 2003 HOH HOH D . 
V 6 HOH 4   2004 2004 HOH HOH D . 
V 6 HOH 5   2005 2005 HOH HOH D . 
V 6 HOH 6   2006 2006 HOH HOH D . 
V 6 HOH 7   2007 2007 HOH HOH D . 
V 6 HOH 8   2008 2008 HOH HOH D . 
V 6 HOH 9   2009 2009 HOH HOH D . 
V 6 HOH 10  2010 2010 HOH HOH D . 
V 6 HOH 11  2011 2011 HOH HOH D . 
V 6 HOH 12  2012 2012 HOH HOH D . 
V 6 HOH 13  2013 2013 HOH HOH D . 
V 6 HOH 14  2014 2014 HOH HOH D . 
V 6 HOH 15  2015 2015 HOH HOH D . 
V 6 HOH 16  2016 2016 HOH HOH D . 
V 6 HOH 17  2017 2017 HOH HOH D . 
V 6 HOH 18  2018 2018 HOH HOH D . 
V 6 HOH 19  2019 2019 HOH HOH D . 
V 6 HOH 20  2020 2020 HOH HOH D . 
V 6 HOH 21  2021 2021 HOH HOH D . 
V 6 HOH 22  2022 2022 HOH HOH D . 
V 6 HOH 23  2023 2023 HOH HOH D . 
V 6 HOH 24  2024 2024 HOH HOH D . 
V 6 HOH 25  2025 2025 HOH HOH D . 
V 6 HOH 26  2026 2026 HOH HOH D . 
V 6 HOH 27  2027 2027 HOH HOH D . 
V 6 HOH 28  2028 2028 HOH HOH D . 
V 6 HOH 29  2029 2029 HOH HOH D . 
V 6 HOH 30  2030 2030 HOH HOH D . 
V 6 HOH 31  2031 2031 HOH HOH D . 
V 6 HOH 32  2032 2032 HOH HOH D . 
V 6 HOH 33  2033 2033 HOH HOH D . 
V 6 HOH 34  2034 2034 HOH HOH D . 
V 6 HOH 35  2035 2035 HOH HOH D . 
V 6 HOH 36  2036 2036 HOH HOH D . 
V 6 HOH 37  2037 2037 HOH HOH D . 
V 6 HOH 38  2038 2038 HOH HOH D . 
V 6 HOH 39  2039 2039 HOH HOH D . 
V 6 HOH 40  2040 2040 HOH HOH D . 
V 6 HOH 41  2041 2041 HOH HOH D . 
V 6 HOH 42  2042 2042 HOH HOH D . 
V 6 HOH 43  2043 2043 HOH HOH D . 
V 6 HOH 44  2044 2044 HOH HOH D . 
V 6 HOH 45  2045 2045 HOH HOH D . 
V 6 HOH 46  2046 2046 HOH HOH D . 
V 6 HOH 47  2047 2047 HOH HOH D . 
V 6 HOH 48  2048 2048 HOH HOH D . 
V 6 HOH 49  2049 2049 HOH HOH D . 
V 6 HOH 50  2050 2050 HOH HOH D . 
V 6 HOH 51  2051 2051 HOH HOH D . 
V 6 HOH 52  2052 2052 HOH HOH D . 
V 6 HOH 53  2053 2053 HOH HOH D . 
V 6 HOH 54  2054 2054 HOH HOH D . 
V 6 HOH 55  2055 2055 HOH HOH D . 
V 6 HOH 56  2056 2056 HOH HOH D . 
V 6 HOH 57  2057 2057 HOH HOH D . 
V 6 HOH 58  2058 2058 HOH HOH D . 
V 6 HOH 59  2059 2059 HOH HOH D . 
V 6 HOH 60  2060 2060 HOH HOH D . 
V 6 HOH 61  2061 2061 HOH HOH D . 
V 6 HOH 62  2062 2062 HOH HOH D . 
V 6 HOH 63  2063 2063 HOH HOH D . 
V 6 HOH 64  2064 2064 HOH HOH D . 
V 6 HOH 65  2065 2065 HOH HOH D . 
V 6 HOH 66  2066 2066 HOH HOH D . 
V 6 HOH 67  2067 2067 HOH HOH D . 
V 6 HOH 68  2068 2068 HOH HOH D . 
V 6 HOH 69  2069 2069 HOH HOH D . 
V 6 HOH 70  2070 2070 HOH HOH D . 
V 6 HOH 71  2071 2071 HOH HOH D . 
V 6 HOH 72  2072 2072 HOH HOH D . 
V 6 HOH 73  2073 2073 HOH HOH D . 
V 6 HOH 74  2074 2074 HOH HOH D . 
V 6 HOH 75  2075 2075 HOH HOH D . 
V 6 HOH 76  2076 2076 HOH HOH D . 
V 6 HOH 77  2077 2077 HOH HOH D . 
V 6 HOH 78  2078 2078 HOH HOH D . 
V 6 HOH 79  2079 2079 HOH HOH D . 
V 6 HOH 80  2080 2080 HOH HOH D . 
V 6 HOH 81  2081 2081 HOH HOH D . 
V 6 HOH 82  2082 2082 HOH HOH D . 
V 6 HOH 83  2083 2083 HOH HOH D . 
V 6 HOH 84  2084 2084 HOH HOH D . 
V 6 HOH 85  2085 2085 HOH HOH D . 
V 6 HOH 86  2086 2086 HOH HOH D . 
V 6 HOH 87  2087 2087 HOH HOH D . 
V 6 HOH 88  2088 2088 HOH HOH D . 
V 6 HOH 89  2089 2089 HOH HOH D . 
V 6 HOH 90  2090 2090 HOH HOH D . 
V 6 HOH 91  2091 2091 HOH HOH D . 
V 6 HOH 92  2092 2092 HOH HOH D . 
V 6 HOH 93  2093 2093 HOH HOH D . 
V 6 HOH 94  2094 2094 HOH HOH D . 
V 6 HOH 95  2095 2095 HOH HOH D . 
V 6 HOH 96  2096 2096 HOH HOH D . 
V 6 HOH 97  2097 2097 HOH HOH D . 
V 6 HOH 98  2098 2098 HOH HOH D . 
V 6 HOH 99  2099 2099 HOH HOH D . 
V 6 HOH 100 2100 2100 HOH HOH D . 
V 6 HOH 101 2101 2101 HOH HOH D . 
V 6 HOH 102 2102 2102 HOH HOH D . 
V 6 HOH 103 2103 2103 HOH HOH D . 
V 6 HOH 104 2104 2104 HOH HOH D . 
V 6 HOH 105 2105 2105 HOH HOH D . 
V 6 HOH 106 2106 2106 HOH HOH D . 
V 6 HOH 107 2107 2107 HOH HOH D . 
V 6 HOH 108 2108 2108 HOH HOH D . 
V 6 HOH 109 2109 2109 HOH HOH D . 
V 6 HOH 110 2110 2110 HOH HOH D . 
V 6 HOH 111 2111 2111 HOH HOH D . 
V 6 HOH 112 2112 2112 HOH HOH D . 
V 6 HOH 113 2113 2113 HOH HOH D . 
V 6 HOH 114 2114 2114 HOH HOH D . 
V 6 HOH 115 2115 2115 HOH HOH D . 
V 6 HOH 116 2116 2116 HOH HOH D . 
V 6 HOH 117 2117 2117 HOH HOH D . 
V 6 HOH 118 2118 2118 HOH HOH D . 
V 6 HOH 119 2119 2119 HOH HOH D . 
V 6 HOH 120 2120 2120 HOH HOH D . 
V 6 HOH 121 2121 2121 HOH HOH D . 
V 6 HOH 122 2122 2122 HOH HOH D . 
V 6 HOH 123 2123 2123 HOH HOH D . 
V 6 HOH 124 2124 2124 HOH HOH D . 
V 6 HOH 125 2125 2125 HOH HOH D . 
V 6 HOH 126 2126 2126 HOH HOH D . 
V 6 HOH 127 2127 2127 HOH HOH D . 
V 6 HOH 128 2128 2128 HOH HOH D . 
V 6 HOH 129 2129 2129 HOH HOH D . 
V 6 HOH 130 2130 2130 HOH HOH D . 
V 6 HOH 131 2131 2131 HOH HOH D . 
V 6 HOH 132 2132 2132 HOH HOH D . 
V 6 HOH 133 2133 2133 HOH HOH D . 
V 6 HOH 134 2134 2134 HOH HOH D . 
V 6 HOH 135 2135 2135 HOH HOH D . 
V 6 HOH 136 2136 2136 HOH HOH D . 
V 6 HOH 137 2137 2137 HOH HOH D . 
V 6 HOH 138 2138 2138 HOH HOH D . 
V 6 HOH 139 2139 2139 HOH HOH D . 
V 6 HOH 140 2140 2140 HOH HOH D . 
V 6 HOH 141 2141 2141 HOH HOH D . 
V 6 HOH 142 2142 2142 HOH HOH D . 
V 6 HOH 143 2143 2143 HOH HOH D . 
V 6 HOH 144 2144 2144 HOH HOH D . 
V 6 HOH 145 2145 2145 HOH HOH D . 
V 6 HOH 146 2146 2146 HOH HOH D . 
V 6 HOH 147 2147 2147 HOH HOH D . 
V 6 HOH 148 2148 2148 HOH HOH D . 
V 6 HOH 149 2149 2149 HOH HOH D . 
V 6 HOH 150 2150 2150 HOH HOH D . 
V 6 HOH 151 2151 2151 HOH HOH D . 
V 6 HOH 152 2152 2152 HOH HOH D . 
V 6 HOH 153 2153 2153 HOH HOH D . 
V 6 HOH 154 2154 2154 HOH HOH D . 
V 6 HOH 155 2155 2155 HOH HOH D . 
V 6 HOH 156 2156 2156 HOH HOH D . 
V 6 HOH 157 2157 2157 HOH HOH D . 
V 6 HOH 158 2158 2158 HOH HOH D . 
V 6 HOH 159 2159 2159 HOH HOH D . 
V 6 HOH 160 2160 2160 HOH HOH D . 
V 6 HOH 161 2161 2161 HOH HOH D . 
V 6 HOH 162 2162 2162 HOH HOH D . 
V 6 HOH 163 2163 2163 HOH HOH D . 
V 6 HOH 164 2164 2164 HOH HOH D . 
V 6 HOH 165 2165 2165 HOH HOH D . 
V 6 HOH 166 2166 2166 HOH HOH D . 
V 6 HOH 167 2167 2167 HOH HOH D . 
V 6 HOH 168 2168 2168 HOH HOH D . 
V 6 HOH 169 2169 2169 HOH HOH D . 
V 6 HOH 170 2170 2170 HOH HOH D . 
V 6 HOH 171 2171 2171 HOH HOH D . 
V 6 HOH 172 2172 2172 HOH HOH D . 
V 6 HOH 173 2173 2173 HOH HOH D . 
V 6 HOH 174 2174 2174 HOH HOH D . 
V 6 HOH 175 2175 2175 HOH HOH D . 
V 6 HOH 176 2176 2176 HOH HOH D . 
V 6 HOH 177 2177 2177 HOH HOH D . 
V 6 HOH 178 2178 2178 HOH HOH D . 
V 6 HOH 179 2179 2179 HOH HOH D . 
V 6 HOH 180 2180 2180 HOH HOH D . 
V 6 HOH 181 2181 2181 HOH HOH D . 
V 6 HOH 182 2182 2182 HOH HOH D . 
V 6 HOH 183 2183 2183 HOH HOH D . 
V 6 HOH 184 2184 2184 HOH HOH D . 
V 6 HOH 185 2185 2185 HOH HOH D . 
V 6 HOH 186 2186 2186 HOH HOH D . 
V 6 HOH 187 2187 2187 HOH HOH D . 
V 6 HOH 188 2188 2188 HOH HOH D . 
V 6 HOH 189 2189 2189 HOH HOH D . 
V 6 HOH 190 2190 2190 HOH HOH D . 
V 6 HOH 191 2191 2191 HOH HOH D . 
V 6 HOH 192 2192 2192 HOH HOH D . 
V 6 HOH 193 2193 2193 HOH HOH D . 
V 6 HOH 194 2194 2194 HOH HOH D . 
V 6 HOH 195 2195 2195 HOH HOH D . 
V 6 HOH 196 2196 2196 HOH HOH D . 
V 6 HOH 197 2197 2197 HOH HOH D . 
V 6 HOH 198 2198 2198 HOH HOH D . 
V 6 HOH 199 2199 2199 HOH HOH D . 
V 6 HOH 200 2200 2200 HOH HOH D . 
V 6 HOH 201 2201 2201 HOH HOH D . 
V 6 HOH 202 2202 2202 HOH HOH D . 
V 6 HOH 203 2203 2203 HOH HOH D . 
V 6 HOH 204 2204 2204 HOH HOH D . 
V 6 HOH 205 2205 2205 HOH HOH D . 
V 6 HOH 206 2206 2206 HOH HOH D . 
V 6 HOH 207 2207 2207 HOH HOH D . 
V 6 HOH 208 2208 2208 HOH HOH D . 
V 6 HOH 209 2209 2209 HOH HOH D . 
V 6 HOH 210 2210 2210 HOH HOH D . 
V 6 HOH 211 2211 2211 HOH HOH D . 
V 6 HOH 212 2212 2212 HOH HOH D . 
V 6 HOH 213 2213 2213 HOH HOH D . 
V 6 HOH 214 2214 2214 HOH HOH D . 
V 6 HOH 215 2215 2215 HOH HOH D . 
V 6 HOH 216 2216 2216 HOH HOH D . 
V 6 HOH 217 2217 2217 HOH HOH D . 
V 6 HOH 218 2218 2218 HOH HOH D . 
V 6 HOH 219 2219 2219 HOH HOH D . 
V 6 HOH 220 2220 2220 HOH HOH D . 
V 6 HOH 221 2221 2221 HOH HOH D . 
V 6 HOH 222 2222 2222 HOH HOH D . 
V 6 HOH 223 2223 2223 HOH HOH D . 
V 6 HOH 224 2224 2224 HOH HOH D . 
V 6 HOH 225 2225 2225 HOH HOH D . 
V 6 HOH 226 2226 2226 HOH HOH D . 
V 6 HOH 227 2227 2227 HOH HOH D . 
V 6 HOH 228 2228 2228 HOH HOH D . 
V 6 HOH 229 2229 2229 HOH HOH D . 
V 6 HOH 230 2230 2230 HOH HOH D . 
V 6 HOH 231 2231 2231 HOH HOH D . 
V 6 HOH 232 2232 2232 HOH HOH D . 
V 6 HOH 233 2233 2233 HOH HOH D . 
V 6 HOH 234 2234 2234 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
4 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,F,G,S   
2 1 B,H,I,J,K,T 
3 1 C,L,M,N,U   
4 1 D,O,P,Q,R,V 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  N2  ? E Y0R .   ? A Y0R 268 ? 1_555 ZN ? F ZN . ? A ZN 1260 ? 1_555 NE2 ? A HIS 94  ? A HIS 96  ? 1_555 117.2 ? 
2  N2  ? E Y0R .   ? A Y0R 268 ? 1_555 ZN ? F ZN . ? A ZN 1260 ? 1_555 ND1 ? A HIS 117 ? A HIS 119 ? 1_555 119.8 ? 
3  NE2 ? A HIS 94  ? A HIS 96  ? 1_555 ZN ? F ZN . ? A ZN 1260 ? 1_555 ND1 ? A HIS 117 ? A HIS 119 ? 1_555 95.0  ? 
4  N2  ? E Y0R .   ? A Y0R 268 ? 1_555 ZN ? F ZN . ? A ZN 1260 ? 1_555 NE2 ? A HIS 92  ? A HIS 94  ? 1_555 106.4 ? 
5  NE2 ? A HIS 94  ? A HIS 96  ? 1_555 ZN ? F ZN . ? A ZN 1260 ? 1_555 NE2 ? A HIS 92  ? A HIS 94  ? 1_555 107.9 ? 
6  ND1 ? A HIS 117 ? A HIS 119 ? 1_555 ZN ? F ZN . ? A ZN 1260 ? 1_555 NE2 ? A HIS 92  ? A HIS 94  ? 1_555 109.9 ? 
7  S1  ? H Y0R .   ? B Y0R 269 ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 N2  ? H Y0R .   ? B Y0R 269 ? 1_555 28.7  ? 
8  S1  ? H Y0R .   ? B Y0R 269 ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 NE2 ? B HIS 92  ? B HIS 94  ? 1_555 92.1  ? 
9  N2  ? H Y0R .   ? B Y0R 269 ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 NE2 ? B HIS 92  ? B HIS 94  ? 1_555 107.2 ? 
10 S1  ? H Y0R .   ? B Y0R 269 ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 NE2 ? B HIS 94  ? B HIS 96  ? 1_555 144.3 ? 
11 N2  ? H Y0R .   ? B Y0R 269 ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 NE2 ? B HIS 94  ? B HIS 96  ? 1_555 115.6 ? 
12 NE2 ? B HIS 92  ? B HIS 94  ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 NE2 ? B HIS 94  ? B HIS 96  ? 1_555 105.2 ? 
13 S1  ? H Y0R .   ? B Y0R 269 ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 ND1 ? B HIS 117 ? B HIS 119 ? 1_555 104.9 ? 
14 N2  ? H Y0R .   ? B Y0R 269 ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 ND1 ? B HIS 117 ? B HIS 119 ? 1_555 118.4 ? 
15 NE2 ? B HIS 92  ? B HIS 94  ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 ND1 ? B HIS 117 ? B HIS 119 ? 1_555 112.4 ? 
16 NE2 ? B HIS 94  ? B HIS 96  ? 1_555 ZN ? I ZN . ? B ZN 1260 ? 1_555 ND1 ? B HIS 117 ? B HIS 119 ? 1_555 97.2  ? 
17 N2  ? L Y0R .   ? C Y0R 267 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 S1  ? L Y0R .   ? C Y0R 267 ? 1_555 30.7  ? 
18 N2  ? L Y0R .   ? C Y0R 267 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 NE2 ? C HIS 92  ? C HIS 94  ? 1_555 112.0 ? 
19 S1  ? L Y0R .   ? C Y0R 267 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 NE2 ? C HIS 92  ? C HIS 94  ? 1_555 93.8  ? 
20 N2  ? L Y0R .   ? C Y0R 267 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 ND1 ? C HIS 117 ? C HIS 119 ? 1_555 115.2 ? 
21 S1  ? L Y0R .   ? C Y0R 267 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 ND1 ? C HIS 117 ? C HIS 119 ? 1_555 105.1 ? 
22 NE2 ? C HIS 92  ? C HIS 94  ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 ND1 ? C HIS 117 ? C HIS 119 ? 1_555 115.1 ? 
23 N2  ? L Y0R .   ? C Y0R 267 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 NE2 ? C HIS 94  ? C HIS 96  ? 1_555 108.7 ? 
24 S1  ? L Y0R .   ? C Y0R 267 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 NE2 ? C HIS 94  ? C HIS 96  ? 1_555 139.2 ? 
25 NE2 ? C HIS 92  ? C HIS 94  ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 NE2 ? C HIS 94  ? C HIS 96  ? 1_555 106.6 ? 
26 ND1 ? C HIS 117 ? C HIS 119 ? 1_555 ZN ? M ZN . ? C ZN 1260 ? 1_555 NE2 ? C HIS 94  ? C HIS 96  ? 1_555 97.7  ? 
27 N2  ? O Y0R .   ? D Y0R 266 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 S1  ? O Y0R .   ? D Y0R 266 ? 1_555 32.2  ? 
28 N2  ? O Y0R .   ? D Y0R 266 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 109.4 ? 
29 S1  ? O Y0R .   ? D Y0R 266 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 141.6 ? 
30 N2  ? O Y0R .   ? D Y0R 266 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 130.0 ? 
31 S1  ? O Y0R .   ? D Y0R 266 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 106.8 ? 
32 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 102.5 ? 
33 N2  ? O Y0R .   ? D Y0R 266 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 99.8  ? 
34 S1  ? O Y0R .   ? D Y0R 266 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 89.9  ? 
35 NE2 ? D HIS 94  ? D HIS 96  ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 103.5 ? 
36 ND1 ? D HIS 117 ? D HIS 119 ? 1_555 ZN ? P ZN . ? D ZN 1260 ? 1_555 NE2 ? D HIS 92  ? D HIS 94  ? 1_555 108.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-11 
2 'Structure model' 1 1 2015-12-09 
3 'Structure model' 1 2 2018-01-17 
4 'Structure model' 1 3 2019-01-30 
5 'Structure model' 1 4 2019-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Data collection'          
3 4 'Structure model' 'Data collection'          
4 4 'Structure model' 'Experimental preparation' 
5 5 'Structure model' 'Data collection'          
6 5 'Structure model' 'Experimental preparation' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' diffrn_source      
2 4 'Structure model' exptl_crystal_grow 
3 5 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 4 'Structure model' '_exptl_crystal_grow.method'           
3 5 'Structure model' '_exptl_crystal_grow.temp'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.8.0103 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
MOLREP phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2065 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2065 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              1.70 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 86  ? ? -114.40 77.06   
2 1 PRO B 16  ? ? -69.66  -179.12 
3 1 ASP B 236 ? ? -106.57 47.90   
4 1 ASN B 242 ? ? -95.86  59.63   
5 1 ASP C 236 ? ? -106.09 51.40   
6 1 ASN C 242 ? ? -92.48  58.04   
7 1 ASP D 236 ? ? -107.65 44.74   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2133 ? 6.26 . 
2 1 O ? B HOH 2011 ? 6.87 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 19  ? CG  ? A ARG 17  CG  
2  1 Y 1 A ARG 19  ? CD  ? A ARG 17  CD  
3  1 Y 1 A ARG 19  ? NE  ? A ARG 17  NE  
4  1 Y 1 A ARG 19  ? CZ  ? A ARG 17  CZ  
5  1 Y 1 A ARG 19  ? NH1 ? A ARG 17  NH1 
6  1 Y 1 A ARG 19  ? NH2 ? A ARG 17  NH2 
7  1 Y 1 A ASP 236 ? CG  ? A ASP 234 CG  
8  1 Y 1 A ASP 236 ? OD1 ? A ASP 234 OD1 
9  1 Y 1 A ASP 236 ? OD2 ? A ASP 234 OD2 
10 1 Y 1 B ARG 10  ? CG  ? B ARG 8   CG  
11 1 Y 1 B ARG 10  ? CD  ? B ARG 8   CD  
12 1 Y 1 B ARG 10  ? NE  ? B ARG 8   NE  
13 1 Y 1 B ARG 10  ? CZ  ? B ARG 8   CZ  
14 1 Y 1 B ARG 10  ? NH1 ? B ARG 8   NH1 
15 1 Y 1 B ARG 10  ? NH2 ? B ARG 8   NH2 
16 1 Y 1 B ARG 102 ? CG  ? B ARG 100 CG  
17 1 Y 1 B ARG 102 ? CD  ? B ARG 100 CD  
18 1 Y 1 B ARG 102 ? NE  ? B ARG 100 NE  
19 1 Y 1 B ARG 102 ? CZ  ? B ARG 100 CZ  
20 1 Y 1 B ARG 102 ? NH1 ? B ARG 100 NH1 
21 1 Y 1 B ARG 102 ? NH2 ? B ARG 100 NH2 
22 1 Y 1 B GLU 165 ? CG  ? B GLU 163 CG  
23 1 Y 1 B GLU 165 ? CD  ? B GLU 163 CD  
24 1 Y 1 B GLU 165 ? OE1 ? B GLU 163 OE1 
25 1 Y 1 B GLU 165 ? OE2 ? B GLU 163 OE2 
26 1 Y 1 B GLU 169 ? CG  ? B GLU 167 CG  
27 1 Y 1 B GLU 169 ? CD  ? B GLU 167 CD  
28 1 Y 1 B GLU 169 ? OE1 ? B GLU 167 OE1 
29 1 Y 1 B GLU 169 ? OE2 ? B GLU 167 OE2 
30 1 Y 1 B LYS 222 ? CG  ? B LYS 220 CG  
31 1 Y 1 B LYS 222 ? CD  ? B LYS 220 CD  
32 1 Y 1 B LYS 222 ? CE  ? B LYS 220 CE  
33 1 Y 1 B LYS 222 ? NZ  ? B LYS 220 NZ  
34 1 Y 1 B ASP 236 ? CG  ? B ASP 234 CG  
35 1 Y 1 B ASP 236 ? OD1 ? B ASP 234 OD1 
36 1 Y 1 B ASP 236 ? OD2 ? B ASP 234 OD2 
37 1 Y 1 C ARG 10  ? CG  ? C ARG 8   CG  
38 1 Y 1 C ARG 10  ? CD  ? C ARG 8   CD  
39 1 Y 1 C ARG 10  ? NE  ? C ARG 8   NE  
40 1 Y 1 C ARG 10  ? CZ  ? C ARG 8   CZ  
41 1 Y 1 C ARG 10  ? NH1 ? C ARG 8   NH1 
42 1 Y 1 C ARG 10  ? NH2 ? C ARG 8   NH2 
43 1 Y 1 C ARG 19  ? CG  ? C ARG 17  CG  
44 1 Y 1 C ARG 19  ? CD  ? C ARG 17  CD  
45 1 Y 1 C ARG 19  ? NE  ? C ARG 17  NE  
46 1 Y 1 C ARG 19  ? CZ  ? C ARG 17  CZ  
47 1 Y 1 C ARG 19  ? NH1 ? C ARG 17  NH1 
48 1 Y 1 C ARG 19  ? NH2 ? C ARG 17  NH2 
49 1 Y 1 C ARG 64  ? CG  ? C ARG 62  CG  
50 1 Y 1 C ARG 64  ? CD  ? C ARG 62  CD  
51 1 Y 1 C ARG 64  ? NE  ? C ARG 62  NE  
52 1 Y 1 C ARG 64  ? CZ  ? C ARG 62  CZ  
53 1 Y 1 C ARG 64  ? NH1 ? C ARG 62  NH1 
54 1 Y 1 C ARG 64  ? NH2 ? C ARG 62  NH2 
55 1 Y 1 C GLU 165 ? CG  ? C GLU 163 CG  
56 1 Y 1 C GLU 165 ? CD  ? C GLU 163 CD  
57 1 Y 1 C GLU 165 ? OE1 ? C GLU 163 OE1 
58 1 Y 1 C GLU 165 ? OE2 ? C GLU 163 OE2 
59 1 Y 1 C LYS 222 ? CG  ? C LYS 220 CG  
60 1 Y 1 C LYS 222 ? CD  ? C LYS 220 CD  
61 1 Y 1 C LYS 222 ? CE  ? C LYS 220 CE  
62 1 Y 1 C LYS 222 ? NZ  ? C LYS 220 NZ  
63 1 Y 1 C ASP 236 ? CG  ? C ASP 234 CG  
64 1 Y 1 C ASP 236 ? OD1 ? C ASP 234 OD1 
65 1 Y 1 C ASP 236 ? OD2 ? C ASP 234 OD2 
66 1 Y 1 D ARG 19  ? CG  ? D ARG 17  CG  
67 1 Y 1 D ARG 19  ? CD  ? D ARG 17  CD  
68 1 Y 1 D ARG 19  ? NE  ? D ARG 17  NE  
69 1 Y 1 D ARG 19  ? CZ  ? D ARG 17  CZ  
70 1 Y 1 D ARG 19  ? NH1 ? D ARG 17  NH1 
71 1 Y 1 D ARG 19  ? NH2 ? D ARG 17  NH2 
72 1 Y 1 D GLU 152 ? CG  ? D GLU 150 CG  
73 1 Y 1 D GLU 152 ? CD  ? D GLU 150 CD  
74 1 Y 1 D GLU 152 ? OE1 ? D GLU 150 OE1 
75 1 Y 1 D GLU 152 ? OE2 ? D GLU 150 OE2 
76 1 Y 1 D GLU 165 ? CG  ? D GLU 163 CG  
77 1 Y 1 D GLU 165 ? CD  ? D GLU 163 CD  
78 1 Y 1 D GLU 165 ? OE1 ? D GLU 163 OE1 
79 1 Y 1 D GLU 165 ? OE2 ? D GLU 163 OE2 
80 1 Y 1 D ASP 236 ? CG  ? D ASP 234 CG  
81 1 Y 1 D ASP 236 ? OD1 ? D ASP 234 OD1 
82 1 Y 1 D ASP 236 ? OD2 ? D ASP 234 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 3 ? A GLY 1 
2  1 Y 1 A PRO 4 ? A PRO 2 
3  1 Y 1 A ASP 5 ? A ASP 3 
4  1 Y 1 A GLN 6 ? A GLN 4 
5  1 Y 1 A SER 7 ? A SER 5 
6  1 Y 1 A HIS 8 ? A HIS 6 
7  1 Y 1 B GLY 3 ? B GLY 1 
8  1 Y 1 B PRO 4 ? B PRO 2 
9  1 Y 1 B ASP 5 ? B ASP 3 
10 1 Y 1 B GLN 6 ? B GLN 4 
11 1 Y 1 B SER 7 ? B SER 5 
12 1 Y 1 B HIS 8 ? B HIS 6 
13 1 Y 1 C GLY 3 ? C GLY 1 
14 1 Y 1 C PRO 4 ? C PRO 2 
15 1 Y 1 C ASP 5 ? C ASP 3 
16 1 Y 1 C GLN 6 ? C GLN 4 
17 1 Y 1 C SER 7 ? C SER 5 
18 1 Y 1 C HIS 8 ? C HIS 6 
19 1 Y 1 D GLY 3 ? D GLY 1 
20 1 Y 1 D PRO 4 ? D PRO 2 
21 1 Y 1 D ASP 5 ? D ASP 3 
22 1 Y 1 D GLN 6 ? D GLN 4 
23 1 Y 1 D SER 7 ? D SER 5 
24 1 Y 1 D HIS 8 ? D HIS 6 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '5-[1-(4-methylphenyl)-1,2,3-triazol-4-yl]thiophene-2-sulfonamide' Y0R 
3 'ZINC ION'                                                         ZN  
4 GLYCEROL                                                           GOL 
5 'ACETIC ACID'                                                      ACY 
6 water                                                              HOH 
#