data_5H5Q
# 
_entry.id   5H5Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5H5Q         
WWPDB D_1300002087 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5H5R PDB . 
unspecified 5H5S PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5H5Q 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sogabe, S.'   1 
'Kadotani, A.' 2 
'Lane, W.'     3 
'Snell, G.'    4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Biochem. Biophys. Res. Commun.' 
_citation.journal_id_ASTM           BBRCA9 
_citation.journal_id_CSD            0146 
_citation.journal_id_ISSN           1090-2104 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            482 
_citation.language                  ? 
_citation.page_first                195 
_citation.page_last                 201 
_citation.title                     
'Discovery of GPX4 inhibitory peptides from random peptide T7 phage display and subsequent structural analysis' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bbrc.2016.11.035 
_citation.pdbx_database_id_PubMed   27836545 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sakamoto, K.'    1 
primary 'Sogabe, S.'      2 
primary 'Kamada, Y.'      3 
primary 'Matsumoto, S.I.' 4 
primary 'Kadotani, A.'    5 
primary 'Sakamoto, J.I.'  6 
primary 'Tani, A.'        7 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   108.41 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5H5Q 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     32.746 
_cell.length_a_esd                 ? 
_cell.length_b                     72.242 
_cell.length_b_esd                 ? 
_cell.length_c                     39.616 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5H5Q 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Phospholipid hydroperoxide glutathione peroxidase, mitochondrial' 19419.070 1   1.11.1.12 
'C29S, C37A, C64S, U73C, C93R, C102S, C134E, C175V' ? ? 
2 polymer     syn GXpep-1                                                            1733.082  1   ?         ? ? ? 
3 non-polymer syn GLYCEROL                                                           92.094    2   ?         ? ? ? 
4 water       nat water                                                              18.015    140 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PHGPx,Glutathione peroxidase 4,GSHPx-4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SASRDDWRAARSMHEFSAKDIDGHMVNLDKYRGFVSIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAERGLRILAFPSNQ
FGKQEPGSNEEIKEFAAGYNVKFDMFSKIEVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGVVVKRYGPME
EPLVIEKDLPHYF
;
;SASRDDWRAARSMHEFSAKDIDGHMVNLDKYRGFVSIVTNVASQCGKTEVNYTQLVDLHARYAERGLRILAFPSNQFGKQ
EPGSNEEIKEFAAGYNVKFDMFSKIEVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGVVVKRYGPMEEPLV
IEKDLPHYF
;
A ? 
2 'polypeptide(L)' no yes '(ACE)CRVDLQGWRRCRR(NH2)' XCRVDLQGWRRCRRX B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   SER n 
1 4   ARG n 
1 5   ASP n 
1 6   ASP n 
1 7   TRP n 
1 8   ARG n 
1 9   ALA n 
1 10  ALA n 
1 11  ARG n 
1 12  SER n 
1 13  MET n 
1 14  HIS n 
1 15  GLU n 
1 16  PHE n 
1 17  SER n 
1 18  ALA n 
1 19  LYS n 
1 20  ASP n 
1 21  ILE n 
1 22  ASP n 
1 23  GLY n 
1 24  HIS n 
1 25  MET n 
1 26  VAL n 
1 27  ASN n 
1 28  LEU n 
1 29  ASP n 
1 30  LYS n 
1 31  TYR n 
1 32  ARG n 
1 33  GLY n 
1 34  PHE n 
1 35  VAL n 
1 36  SER n 
1 37  ILE n 
1 38  VAL n 
1 39  THR n 
1 40  ASN n 
1 41  VAL n 
1 42  ALA n 
1 43  SER n 
1 44  GLN n 
1 45  OCS n 
1 46  GLY n 
1 47  LYS n 
1 48  THR n 
1 49  GLU n 
1 50  VAL n 
1 51  ASN n 
1 52  TYR n 
1 53  THR n 
1 54  GLN n 
1 55  LEU n 
1 56  VAL n 
1 57  ASP n 
1 58  LEU n 
1 59  HIS n 
1 60  ALA n 
1 61  ARG n 
1 62  TYR n 
1 63  ALA n 
1 64  GLU n 
1 65  ARG n 
1 66  GLY n 
1 67  LEU n 
1 68  ARG n 
1 69  ILE n 
1 70  LEU n 
1 71  ALA n 
1 72  PHE n 
1 73  PRO n 
1 74  SER n 
1 75  ASN n 
1 76  GLN n 
1 77  PHE n 
1 78  GLY n 
1 79  LYS n 
1 80  GLN n 
1 81  GLU n 
1 82  PRO n 
1 83  GLY n 
1 84  SER n 
1 85  ASN n 
1 86  GLU n 
1 87  GLU n 
1 88  ILE n 
1 89  LYS n 
1 90  GLU n 
1 91  PHE n 
1 92  ALA n 
1 93  ALA n 
1 94  GLY n 
1 95  TYR n 
1 96  ASN n 
1 97  VAL n 
1 98  LYS n 
1 99  PHE n 
1 100 ASP n 
1 101 MET n 
1 102 PHE n 
1 103 SER n 
1 104 LYS n 
1 105 ILE n 
1 106 GLU n 
1 107 VAL n 
1 108 ASN n 
1 109 GLY n 
1 110 ASP n 
1 111 ASP n 
1 112 ALA n 
1 113 HIS n 
1 114 PRO n 
1 115 LEU n 
1 116 TRP n 
1 117 LYS n 
1 118 TRP n 
1 119 MET n 
1 120 LYS n 
1 121 ILE n 
1 122 GLN n 
1 123 PRO n 
1 124 LYS n 
1 125 GLY n 
1 126 LYS n 
1 127 GLY n 
1 128 ILE n 
1 129 LEU n 
1 130 GLY n 
1 131 ASN n 
1 132 ALA n 
1 133 ILE n 
1 134 LYS n 
1 135 TRP n 
1 136 ASN n 
1 137 PHE n 
1 138 THR n 
1 139 LYS n 
1 140 PHE n 
1 141 LEU n 
1 142 ILE n 
1 143 ASP n 
1 144 LYS n 
1 145 ASN n 
1 146 GLY n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 LYS n 
1 151 ARG n 
1 152 TYR n 
1 153 GLY n 
1 154 PRO n 
1 155 MET n 
1 156 GLU n 
1 157 GLU n 
1 158 PRO n 
1 159 LEU n 
1 160 VAL n 
1 161 ILE n 
1 162 GLU n 
1 163 LYS n 
1 164 ASP n 
1 165 LEU n 
1 166 PRO n 
1 167 HIS n 
1 168 TYR n 
1 169 PHE n 
2 1   ACE n 
2 2   CYS n 
2 3   ARG n 
2 4   VAL n 
2 5   ASP n 
2 6   LEU n 
2 7   GLN n 
2 8   GLY n 
2 9   TRP n 
2 10  ARG n 
2 11  ARG n 
2 12  CYS n 
2 13  ARG n 
2 14  ARG n 
2 15  NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   169 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GPX4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       15 
_pdbx_entity_src_syn.organism_scientific    'Enterobacteria phage T7' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       10760 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GPX4_HUMAN P36969 ? 1 
;CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQ
EPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLV
IEKDLPHYF
;
29 
2 PDB 5H5Q       5H5Q   ? 2 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5H5Q A 1 ? 169 ? P36969 29  ? 197 ? 29  197 
2 2 5H5Q B 1 ? 15  ? 5H5Q   900 ? 914 ? 900 914 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5H5Q SER A 1   ? UNP P36969 CYS 29  'engineered mutation' 29  1 
1 5H5Q ALA A 9   ? UNP P36969 CYS 37  'engineered mutation' 37  2 
1 5H5Q SER A 36  ? UNP P36969 CYS 64  'engineered mutation' 64  3 
1 5H5Q OCS A 45  ? UNP P36969 SEC 73  'engineered mutation' 73  4 
1 5H5Q ARG A 65  ? UNP P36969 CYS 93  'engineered mutation' 93  5 
1 5H5Q SER A 74  ? UNP P36969 CYS 102 'engineered mutation' 102 6 
1 5H5Q GLU A 106 ? UNP P36969 CYS 134 'engineered mutation' 134 7 
1 5H5Q VAL A 147 ? UNP P36969 CYS 175 'engineered mutation' 175 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'          ?                               'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE                 ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE               ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ?                               'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'           ?                               'H2 N'           16.023  
OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ?                               'C3 H7 N O5 S'   169.156 
PHE 'L-peptide linking' y PHENYLALANINE           ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                               'C5 H9 N O2'     115.130 
SEC 'L-peptide linking' y SELENOCYSTEINE          ?                               'C3 H7 N O2 Se'  168.053 
SER 'L-peptide linking' y SERINE                  ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5H5Q 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.10 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.48 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Tris pH 8.5, 0.1M potassium formate, 25% PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-10-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5H5Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.1 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       65137 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.4 
_reflns.pdbx_Rmerge_I_obs                0.044 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.10 
_reflns_shell.d_res_low                   1.12 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        81.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.572 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.33 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.31 
_refine.aniso_B[2][2]                            -0.18 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            0.25 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               13.236 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.972 
_refine.correlation_coeff_Fo_to_Fc_free          0.961 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5H5Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.10 
_refine.ls_d_res_low                             37.59 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     61861 
_refine.ls_number_reflns_R_free                  3245 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.99 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.16440 
_refine.ls_R_factor_R_free                       0.18368 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.16341 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2OBI 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.032 
_refine.pdbx_overall_ESU_R_Free                  0.034 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             0.890 
_refine.overall_SU_ML                            0.021 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5H5Q 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1462 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             140 
_refine_hist.number_atoms_total               1614 
_refine_hist.d_res_high                       1.10 
_refine_hist.d_res_low                        37.59 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.019  1538 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  1459 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.576  1.948  2076 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.018  3.000  3356 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.722  5.000  186  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 29.018 23.519 81   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 12.531 15.000 273  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.481 15.000 12   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.353  0.200  210  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  2435 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  379  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 0.610  0.888  723  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 0.610  0.885  721  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 1.022  1.330  902  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 1.022  1.330  902  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 0.887  1.044  815  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 0.886  1.044  815  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 1.438  1.510  1170 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 3.683  10.431 2235 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 3.526  9.728  2177 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.100 
_refine_ls_shell.d_res_low                        1.129 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             180 
_refine_ls_shell.number_reflns_R_work             3628 
_refine_ls_shell.percent_reflns_obs               72.46 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.364 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.358 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5H5Q 
_struct.title                        'Crystal structure of human GPX4 in complex with GXpep-1' 
_struct.pdbx_descriptor              'Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (E.C.1.11.1.12), GXpep-1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5H5Q 
_struct_keywords.text            
;PHOSPHOLIPID HYDROPEROXIDE GLUTATHIONE PEROXIDASE 4, SELENOCYSTEINE, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
;
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASP A 6   ? ALA A 10  ? ASP A 34  ALA A 38  5 ? 5  
HELX_P HELX_P2 AA2 SER A 12  ? GLU A 15  ? SER A 40  GLU A 43  5 ? 4  
HELX_P HELX_P3 AA3 ASP A 29  ? ARG A 32  ? ASP A 57  ARG A 60  5 ? 4  
HELX_P HELX_P4 AA4 LYS A 47  ? ALA A 63  ? LYS A 75  ALA A 91  1 ? 17 
HELX_P HELX_P5 AA5 GLU A 64  ? GLY A 66  ? GLU A 92  GLY A 94  5 ? 3  
HELX_P HELX_P6 AA6 SER A 84  ? TYR A 95  ? SER A 112 TYR A 123 1 ? 12 
HELX_P HELX_P7 AA7 HIS A 113 ? ILE A 121 ? HIS A 141 ILE A 149 1 ? 9  
HELX_P HELX_P8 AA8 GLU A 157 ? LYS A 163 ? GLU A 185 LYS A 191 5 ? 7  
HELX_P HELX_P9 AA9 ASP A 164 ? PHE A 169 ? ASP A 192 PHE A 197 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? B CYS 2  SG ? ? ? 1_555 B CYS 12 SG ? ? B CYS 901 B CYS 911 1_555 ? ? ? ? ? ? ? 2.075 ? 
covale1 covale both ? A GLN 44 C  ? ? ? 1_555 A OCS 45 N  ? ? A GLN 72  A OCS 73  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale both ? A OCS 45 C  ? ? ? 1_555 A GLY 46 N  ? ? A OCS 73  A GLY 74  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale3 covale both ? B ACE 1  C  ? ? ? 1_555 B CYS 2  N  ? ? B ACE 900 B CYS 901 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4 covale both ? B ARG 14 C  ? ? ? 1_555 B NH2 15 N  ? ? B ARG 913 B NH2 914 1_555 ? ? ? ? ? ? ? 1.336 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 17  ? LYS A 19  ? SER A 45  LYS A 47  
AA1 2 MET A 25  ? ASN A 27  ? MET A 53  ASN A 55  
AA2 1 ASP A 100 ? MET A 101 ? ASP A 128 MET A 129 
AA2 2 ARG A 68  ? PRO A 73  ? ARG A 96  PRO A 101 
AA2 3 SER A 36  ? VAL A 41  ? SER A 64  VAL A 69  
AA2 4 LYS A 139 ? ILE A 142 ? LYS A 167 ILE A 170 
AA2 5 VAL A 148 ? TYR A 152 ? VAL A 176 TYR A 180 
AA3 1 ARG B 3   ? VAL B 4   ? ARG B 902 VAL B 903 
AA3 2 ARG B 10  ? ARG B 11  ? ARG B 909 ARG B 910 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 18  ? N ALA A 46  O VAL A 26  ? O VAL A 54  
AA2 1 2 O ASP A 100 ? O ASP A 128 N ALA A 71  ? N ALA A 99  
AA2 2 3 O PHE A 72  ? O PHE A 100 N THR A 39  ? N THR A 67  
AA2 3 4 N SER A 36  ? N SER A 64  O ILE A 142 ? O ILE A 170 
AA2 4 5 N LEU A 141 ? N LEU A 169 O VAL A 149 ? O VAL A 177 
AA3 1 2 N ARG B 3   ? N ARG B 902 O ARG B 11  ? O ARG B 910 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 201 ? 7 'binding site for residue GOL A 201' 
AC2 Software A GOL 202 ? 7 'binding site for residue GOL A 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 LYS A 30  ? LYS A 58  . ? 1_555 ? 
2  AC1 7 PHE A 34  ? PHE A 62  . ? 1_555 ? 
3  AC1 7 ARG A 68  ? ARG A 96  . ? 1_555 ? 
4  AC1 7 GLN A 76  ? GLN A 104 . ? 1_455 ? 
5  AC1 7 ASN A 108 ? ASN A 136 . ? 1_455 ? 
6  AC1 7 HOH E .   ? HOH A 309 . ? 1_555 ? 
7  AC1 7 HOH E .   ? HOH A 316 . ? 1_555 ? 
8  AC2 7 SER A 12  ? SER A 40  . ? 1_555 ? 
9  AC2 7 GLU A 15  ? GLU A 43  . ? 1_555 ? 
10 AC2 7 HOH E .   ? HOH A 308 . ? 1_555 ? 
11 AC2 7 HOH E .   ? HOH A 318 . ? 1_555 ? 
12 AC2 7 HOH E .   ? HOH A 321 . ? 1_555 ? 
13 AC2 7 ACE B 1   ? ACE B 900 . ? 1_555 ? 
14 AC2 7 CYS B 2   ? CYS B 901 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5H5Q 
_atom_sites.fract_transf_matrix[1][1]   0.030538 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.010165 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013842 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026604 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 5   ? -0.774  35.198 -32.384 1.00 20.55 ? 33   ASP A N   1 
ATOM   2    C CA  . ASP A 1 5   ? -1.428  34.919 -31.077 1.00 19.54 ? 33   ASP A CA  1 
ATOM   3    C C   . ASP A 1 5   ? -1.115  33.475 -30.656 1.00 17.27 ? 33   ASP A C   1 
ATOM   4    O O   . ASP A 1 5   ? -1.293  32.553 -31.438 1.00 16.46 ? 33   ASP A O   1 
ATOM   5    C CB  . ASP A 1 5   ? -2.957  35.157 -31.176 1.00 21.01 ? 33   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 5   ? -3.613  35.464 -29.816 1.00 21.81 ? 33   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 5   ? -2.880  35.665 -28.833 1.00 24.09 ? 33   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 5   ? -4.864  35.515 -29.715 1.00 22.77 ? 33   ASP A OD2 1 
ATOM   9    N N   . ASP A 1 6   ? -0.632  33.301 -29.431 1.00 15.75 ? 34   ASP A N   1 
ATOM   10   C CA  . ASP A 1 6   ? -0.319  31.972 -28.914 1.00 14.83 ? 34   ASP A CA  1 
ATOM   11   C C   . ASP A 1 6   ? -0.715  31.858 -27.442 1.00 12.93 ? 34   ASP A C   1 
ATOM   12   O O   . ASP A 1 6   ? -1.387  32.740 -26.882 1.00 12.75 ? 34   ASP A O   1 
ATOM   13   C CB  . ASP A 1 6   ? 1.161   31.617 -29.216 1.00 15.87 ? 34   ASP A CB  1 
ATOM   14   C CG  . ASP A 1 6   ? 2.179   32.283 -28.307 1.00 16.68 ? 34   ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 6   ? 1.854   32.958 -27.309 1.00 17.40 ? 34   ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 6   ? 3.379   32.132 -28.644 1.00 19.49 ? 34   ASP A OD2 1 
ATOM   17   N N   . TRP A 1 7   ? -0.299  30.749 -26.843 1.00 11.72 ? 35   TRP A N   1 
ATOM   18   C CA  . TRP A 1 7   ? -0.695  30.379 -25.503 1.00 10.87 ? 35   TRP A CA  1 
ATOM   19   C C   . TRP A 1 7   ? -0.403  31.439 -24.441 1.00 10.96 ? 35   TRP A C   1 
ATOM   20   O O   . TRP A 1 7   ? -1.094  31.471 -23.424 1.00 10.77 ? 35   TRP A O   1 
ATOM   21   C CB  . TRP A 1 7   ? -0.029  29.046 -25.131 1.00 10.25 ? 35   TRP A CB  1 
ATOM   22   C CG  . TRP A 1 7   ? 1.453   29.099 -25.147 1.00 10.23 ? 35   TRP A CG  1 
ATOM   23   C CD1 . TRP A 1 7   ? 2.268   28.793 -26.197 1.00 10.42 ? 35   TRP A CD1 1 
ATOM   24   C CD2 . TRP A 1 7   ? 2.312   29.510 -24.082 1.00 10.02 ? 35   TRP A CD2 1 
ATOM   25   N NE1 . TRP A 1 7   ? 3.572   28.993 -25.860 1.00 10.53 ? 35   TRP A NE1 1 
ATOM   26   C CE2 . TRP A 1 7   ? 3.633   29.438 -24.569 1.00 10.44 ? 35   TRP A CE2 1 
ATOM   27   C CE3 . TRP A 1 7   ? 2.102   29.926 -22.759 1.00 10.17 ? 35   TRP A CE3 1 
ATOM   28   C CZ2 . TRP A 1 7   ? 4.729   29.757 -23.785 1.00 10.75 ? 35   TRP A CZ2 1 
ATOM   29   C CZ3 . TRP A 1 7   ? 3.202   30.273 -22.000 1.00 10.39 ? 35   TRP A CZ3 1 
ATOM   30   C CH2 . TRP A 1 7   ? 4.494   30.179 -22.510 1.00 10.62 ? 35   TRP A CH2 1 
ATOM   31   N N   . ARG A 1 8   ? 0.586   32.300 -24.674 1.00 11.93 ? 36   ARG A N   1 
ATOM   32   C CA  . ARG A 1 8   ? 0.902   33.355 -23.707 1.00 12.84 ? 36   ARG A CA  1 
ATOM   33   C C   . ARG A 1 8   ? -0.238  34.326 -23.509 1.00 13.36 ? 36   ARG A C   1 
ATOM   34   O O   . ARG A 1 8   ? -0.331  34.965 -22.450 1.00 15.50 ? 36   ARG A O   1 
ATOM   35   C CB  . ARG A 1 8   ? 2.172   34.120 -24.112 1.00 13.83 ? 36   ARG A CB  1 
ATOM   36   C CG  . ARG A 1 8   ? 3.440   33.283 -24.046 1.00 14.37 ? 36   ARG A CG  1 
ATOM   37   C CD  . ARG A 1 8   ? 4.668   34.096 -24.439 1.00 15.64 ? 36   ARG A CD  1 
ATOM   38   N NE  . ARG A 1 8   ? 5.862   33.265 -24.383 1.00 16.76 ? 36   ARG A NE  1 
ATOM   39   C CZ  . ARG A 1 8   ? 6.559   32.960 -23.283 1.00 17.31 ? 36   ARG A CZ  1 
ATOM   40   N NH1 . ARG A 1 8   ? 6.242   33.449 -22.080 1.00 17.94 ? 36   ARG A NH1 1 
ATOM   41   N NH2 . ARG A 1 8   ? 7.615   32.153 -23.401 1.00 18.32 ? 36   ARG A NH2 1 
ATOM   42   N N   . ALA A 1 9   ? -1.093  34.458 -24.526 1.00 12.87 ? 37   ALA A N   1 
ATOM   43   C CA  . ALA A 1 9   ? -2.248  35.345 -24.487 1.00 12.96 ? 37   ALA A CA  1 
ATOM   44   C C   . ALA A 1 9   ? -3.489  34.699 -23.886 1.00 12.27 ? 37   ALA A C   1 
ATOM   45   O O   . ALA A 1 9   ? -4.495  35.384 -23.699 1.00 13.06 ? 37   ALA A O   1 
ATOM   46   C CB  . ALA A 1 9   ? -2.568  35.852 -25.876 1.00 13.57 ? 37   ALA A CB  1 
ATOM   47   N N   . ALA A 1 10  ? -3.455  33.413 -23.555 1.00 11.28 ? 38   ALA A N   1 
ATOM   48   C CA  . ALA A 1 10  ? -4.657  32.773 -23.054 1.00 10.88 ? 38   ALA A CA  1 
ATOM   49   C C   . ALA A 1 10  ? -5.044  33.329 -21.694 1.00 11.03 ? 38   ALA A C   1 
ATOM   50   O O   . ALA A 1 10  ? -4.184  33.711 -20.895 1.00 11.31 ? 38   ALA A O   1 
ATOM   51   C CB  . ALA A 1 10  ? -4.458  31.269 -22.975 1.00 10.27 ? 38   ALA A CB  1 
ATOM   52   N N   . ARG A 1 11  ? -6.338  33.367 -21.442 1.00 11.37 ? 39   ARG A N   1 
ATOM   53   C CA  . ARG A 1 11  ? -6.876  33.921 -20.203 1.00 12.31 ? 39   ARG A CA  1 
ATOM   54   C C   . ARG A 1 11  ? -7.407  32.854 -19.254 1.00 11.32 ? 39   ARG A C   1 
ATOM   55   O O   . ARG A 1 11  ? -7.788  33.182 -18.121 1.00 12.27 ? 39   ARG A O   1 
ATOM   56   C CB  . ARG A 1 11  ? -8.035  34.857 -20.530 1.00 14.74 ? 39   ARG A CB  1 
ATOM   57   C CG  . ARG A 1 11  ? -7.745  35.897 -21.565 1.00 17.41 ? 39   ARG A CG  1 
ATOM   58   C CD  . ARG A 1 11  ? -6.790  36.938 -21.063 1.00 19.80 ? 39   ARG A CD  1 
ATOM   59   N NE  . ARG A 1 11  ? -7.427  38.218 -21.327 1.00 22.42 ? 39   ARG A NE  1 
ATOM   60   C CZ  . ARG A 1 11  ? -6.836  39.369 -21.641 1.00 24.34 ? 39   ARG A CZ  1 
ATOM   61   N NH1 . ARG A 1 11  ? -5.508  39.489 -21.751 1.00 25.45 ? 39   ARG A NH1 1 
ATOM   62   N NH2 . ARG A 1 11  ? -7.610  40.427 -21.854 1.00 25.49 ? 39   ARG A NH2 1 
ATOM   63   N N   . SER A 1 12  ? -7.477  31.596 -19.686 1.00 10.18 ? 40   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -8.146  30.566 -18.916 1.00 9.71  ? 40   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -7.685  29.201 -19.364 1.00 9.05  ? 40   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -7.420  28.990 -20.554 1.00 8.85  ? 40   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -9.671  30.649 -19.181 1.00 9.99  ? 40   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -10.394 29.645 -18.527 1.00 10.28 ? 40   SER A OG  1 
ATOM   69   N N   . MET A 1 13  ? -7.665  28.262 -18.425 1.00 8.87  ? 41   MET A N   1 
ATOM   70   C CA  A MET A 1 13  ? -7.467  26.859 -18.754 0.50 8.54  ? 41   MET A CA  1 
ATOM   71   C CA  B MET A 1 13  ? -7.476  26.845 -18.765 0.50 9.33  ? 41   MET A CA  1 
ATOM   72   C C   . MET A 1 13  ? -8.489  26.377 -19.789 1.00 8.86  ? 41   MET A C   1 
ATOM   73   O O   . MET A 1 13  ? -8.215  25.468 -20.579 1.00 9.03  ? 41   MET A O   1 
ATOM   74   C CB  A MET A 1 13  ? -7.535  26.045 -17.464 0.50 8.31  ? 41   MET A CB  1 
ATOM   75   C CB  B MET A 1 13  ? -7.598  25.947 -17.537 0.50 10.27 ? 41   MET A CB  1 
ATOM   76   C CG  A MET A 1 13  ? -7.427  24.536 -17.619 0.50 8.05  ? 41   MET A CG  1 
ATOM   77   C CG  B MET A 1 13  ? -7.650  24.453 -17.874 0.50 11.02 ? 41   MET A CG  1 
ATOM   78   S SD  A MET A 1 13  ? -9.009  23.676 -17.743 0.50 7.71  ? 41   MET A SD  1 
ATOM   79   S SD  B MET A 1 13  ? -7.837  23.370 -16.469 0.50 13.05 ? 41   MET A SD  1 
ATOM   80   C CE  A MET A 1 13  ? -9.315  23.332 -16.028 0.50 8.06  ? 41   MET A CE  1 
ATOM   81   C CE  B MET A 1 13  ? -9.605  23.516 -16.227 0.50 12.81 ? 41   MET A CE  1 
ATOM   82   N N   . HIS A 1 14  ? -9.656  27.003 -19.796 1.00 8.89  ? 42   HIS A N   1 
ATOM   83   C CA  . HIS A 1 14  ? -10.741 26.572 -20.652 1.00 9.23  ? 42   HIS A CA  1 
ATOM   84   C C   . HIS A 1 14  ? -10.471 26.774 -22.125 1.00 9.09  ? 42   HIS A C   1 
ATOM   85   O O   . HIS A 1 14  ? -11.217 26.220 -22.940 1.00 10.05 ? 42   HIS A O   1 
ATOM   86   C CB  . HIS A 1 14  ? -12.015 27.313 -20.289 1.00 9.72  ? 42   HIS A CB  1 
ATOM   87   C CG  . HIS A 1 14  ? -12.411 27.154 -18.864 1.00 10.25 ? 42   HIS A CG  1 
ATOM   88   N ND1 . HIS A 1 14  ? -13.193 28.078 -18.214 1.00 11.02 ? 42   HIS A ND1 1 
ATOM   89   C CD2 . HIS A 1 14  ? -12.111 26.206 -17.962 1.00 10.35 ? 42   HIS A CD2 1 
ATOM   90   C CE1 . HIS A 1 14  ? -13.368 27.695 -16.971 1.00 11.31 ? 42   HIS A CE1 1 
ATOM   91   N NE2 . HIS A 1 14  ? -12.715 26.574 -16.779 1.00 11.16 ? 42   HIS A NE2 1 
ATOM   92   N N   . GLU A 1 15  ? -9.467  27.572 -22.485 1.00 8.82  ? 43   GLU A N   1 
ATOM   93   C CA  . GLU A 1 15  ? -9.141  27.790 -23.893 1.00 8.81  ? 43   GLU A CA  1 
ATOM   94   C C   . GLU A 1 15  ? -8.429  26.599 -24.523 1.00 8.72  ? 43   GLU A C   1 
ATOM   95   O O   . GLU A 1 15  ? -8.344  26.516 -25.743 1.00 9.07  ? 43   GLU A O   1 
ATOM   96   C CB  . GLU A 1 15  ? -8.214  28.993 -24.054 1.00 9.01  ? 43   GLU A CB  1 
ATOM   97   C CG  . GLU A 1 15  ? -8.822  30.290 -23.600 1.00 9.27  ? 43   GLU A CG  1 
ATOM   98   C CD  . GLU A 1 15  ? -8.019  31.492 -24.023 1.00 9.57  ? 43   GLU A CD  1 
ATOM   99   O OE1 . GLU A 1 15  ? -7.190  31.394 -24.948 1.00 10.00 ? 43   GLU A OE1 1 
ATOM   100  O OE2 . GLU A 1 15  ? -8.230  32.579 -23.412 1.00 10.26 ? 43   GLU A OE2 1 
ATOM   101  N N   . PHE A 1 16  ? -7.856  25.721 -23.702 1.00 8.30  ? 44   PHE A N   1 
ATOM   102  C CA  . PHE A 1 16  ? -6.930  24.727 -24.187 1.00 8.48  ? 44   PHE A CA  1 
ATOM   103  C C   . PHE A 1 16  ? -7.631  23.450 -24.596 1.00 8.74  ? 44   PHE A C   1 
ATOM   104  O O   . PHE A 1 16  ? -8.809  23.208 -24.304 1.00 9.08  ? 44   PHE A O   1 
ATOM   105  C CB  . PHE A 1 16  ? -5.835  24.482 -23.128 1.00 8.27  ? 44   PHE A CB  1 
ATOM   106  C CG  . PHE A 1 16  ? -4.936  25.666 -22.919 1.00 8.22  ? 44   PHE A CG  1 
ATOM   107  C CD1 . PHE A 1 16  ? -5.278  26.668 -22.031 1.00 8.32  ? 44   PHE A CD1 1 
ATOM   108  C CD2 . PHE A 1 16  ? -3.742  25.783 -23.602 1.00 8.17  ? 44   PHE A CD2 1 
ATOM   109  C CE1 . PHE A 1 16  ? -4.470  27.761 -21.846 1.00 8.46  ? 44   PHE A CE1 1 
ATOM   110  C CE2 . PHE A 1 16  ? -2.923  26.880 -23.413 1.00 8.18  ? 44   PHE A CE2 1 
ATOM   111  C CZ  . PHE A 1 16  ? -3.289  27.882 -22.528 1.00 8.27  ? 44   PHE A CZ  1 
ATOM   112  N N   . SER A 1 17  ? -6.863  22.635 -25.310 1.00 9.64  ? 45   SER A N   1 
ATOM   113  C CA  A SER A 1 17  ? -7.307  21.310 -25.734 0.50 10.18 ? 45   SER A CA  1 
ATOM   114  C CA  B SER A 1 17  ? -7.298  21.330 -25.778 0.50 10.06 ? 45   SER A CA  1 
ATOM   115  C C   . SER A 1 17  ? -6.224  20.303 -25.446 1.00 9.88  ? 45   SER A C   1 
ATOM   116  O O   . SER A 1 17  ? -5.026  20.629 -25.407 1.00 10.24 ? 45   SER A O   1 
ATOM   117  C CB  A SER A 1 17  ? -7.601  21.270 -27.219 0.50 11.29 ? 45   SER A CB  1 
ATOM   118  C CB  B SER A 1 17  ? -7.586  21.371 -27.283 0.50 11.03 ? 45   SER A CB  1 
ATOM   119  O OG  A SER A 1 17  ? -6.501  21.799 -27.918 0.50 11.86 ? 45   SER A OG  1 
ATOM   120  O OG  B SER A 1 17  ? -8.932  21.801 -27.493 0.50 11.34 ? 45   SER A OG  1 
ATOM   121  N N   . ALA A 1 18  ? -6.629  19.069 -25.221 1.00 9.60  ? 46   ALA A N   1 
ATOM   122  C CA  . ALA A 1 18  ? -5.667  18.003 -24.944 1.00 9.38  ? 46   ALA A CA  1 
ATOM   123  C C   . ALA A 1 18  ? -6.247  16.681 -25.343 1.00 9.70  ? 46   ALA A C   1 
ATOM   124  O O   . ALA A 1 18  ? -7.464  16.482 -25.255 1.00 10.41 ? 46   ALA A O   1 
ATOM   125  C CB  . ALA A 1 18  ? -5.297  17.979 -23.464 1.00 9.44  ? 46   ALA A CB  1 
ATOM   126  N N   . LYS A 1 19  ? -5.389  15.756 -25.745 1.00 9.91  ? 47   LYS A N   1 
ATOM   127  C CA  . LYS A 1 19  ? -5.847  14.402 -26.026 1.00 10.59 ? 47   LYS A CA  1 
ATOM   128  C C   . LYS A 1 19  ? -6.069  13.652 -24.736 1.00 9.97  ? 47   LYS A C   1 
ATOM   129  O O   . LYS A 1 19  ? -5.194  13.626 -23.841 1.00 9.27  ? 47   LYS A O   1 
ATOM   130  C CB  . LYS A 1 19  ? -4.850  13.635 -26.886 1.00 12.22 ? 47   LYS A CB  1 
ATOM   131  C CG  . LYS A 1 19  ? -4.659  14.269 -28.254 1.00 14.11 ? 47   LYS A CG  1 
ATOM   132  C CD  . LYS A 1 19  ? -3.723  13.460 -29.139 1.00 16.20 ? 47   LYS A CD  1 
ATOM   133  C CE  . LYS A 1 19  ? -2.275  13.563 -28.694 1.00 17.61 ? 47   LYS A CE  1 
ATOM   134  N NZ  . LYS A 1 19  ? -1.395  13.994 -29.814 1.00 19.48 ? 47   LYS A NZ  1 
ATOM   135  N N   . ASP A 1 20  ? -7.220  13.014 -24.624 1.00 10.13 ? 48   ASP A N   1 
ATOM   136  C CA  . ASP A 1 20  ? -7.472  12.143 -23.492 1.00 10.25 ? 48   ASP A CA  1 
ATOM   137  C C   . ASP A 1 20  ? -6.635  10.884 -23.633 1.00 10.12 ? 48   ASP A C   1 
ATOM   138  O O   . ASP A 1 20  ? -5.973  10.671 -24.661 1.00 9.96  ? 48   ASP A O   1 
ATOM   139  C CB  . ASP A 1 20  ? -8.976  11.896 -23.270 1.00 11.38 ? 48   ASP A CB  1 
ATOM   140  C CG  . ASP A 1 20  ? -9.619  10.949 -24.261 1.00 12.72 ? 48   ASP A CG  1 
ATOM   141  O OD1 . ASP A 1 20  ? -8.949  10.228 -25.008 1.00 13.21 ? 48   ASP A OD1 1 
ATOM   142  O OD2 . ASP A 1 20  ? -10.876 10.958 -24.308 1.00 15.11 ? 48   ASP A OD2 1 
ATOM   143  N N   . ILE A 1 21  ? -6.651  10.040 -22.617 1.00 9.85  ? 49   ILE A N   1 
ATOM   144  C CA  . ILE A 1 21  ? -5.747  8.891  -22.613 1.00 10.45 ? 49   ILE A CA  1 
ATOM   145  C C   . ILE A 1 21  ? -6.073  7.861  -23.695 1.00 11.56 ? 49   ILE A C   1 
ATOM   146  O O   . ILE A 1 21  ? -5.238  7.035  -24.007 1.00 12.28 ? 49   ILE A O   1 
ATOM   147  C CB  . ILE A 1 21  ? -5.646  8.273  -21.206 1.00 10.20 ? 49   ILE A CB  1 
ATOM   148  C CG1 . ILE A 1 21  ? -4.340  7.488  -21.031 1.00 10.49 ? 49   ILE A CG1 1 
ATOM   149  C CG2 . ILE A 1 21  ? -6.891  7.485  -20.852 1.00 10.53 ? 49   ILE A CG2 1 
ATOM   150  C CD1 . ILE A 1 21  ? -3.872  7.410  -19.601 1.00 10.47 ? 49   ILE A CD1 1 
ATOM   151  N N   . ASP A 1 22  ? -7.280  7.924  -24.254 1.00 12.56 ? 50   ASP A N   1 
ATOM   152  C CA  . ASP A 1 22  ? -7.666  7.114  -25.415 1.00 14.70 ? 50   ASP A CA  1 
ATOM   153  C C   . ASP A 1 22  ? -7.317  7.760  -26.769 1.00 14.97 ? 50   ASP A C   1 
ATOM   154  O O   . ASP A 1 22  ? -7.600  7.162  -27.825 1.00 16.07 ? 50   ASP A O   1 
ATOM   155  C CB  . ASP A 1 22  ? -9.166  6.831  -25.352 1.00 16.68 ? 50   ASP A CB  1 
ATOM   156  C CG  . ASP A 1 22  ? -9.560  6.097  -24.102 1.00 18.29 ? 50   ASP A CG  1 
ATOM   157  O OD1 . ASP A 1 22  ? -8.933  5.064  -23.828 1.00 20.13 ? 50   ASP A OD1 1 
ATOM   158  O OD2 . ASP A 1 22  ? -10.481 6.555  -23.381 1.00 21.54 ? 50   ASP A OD2 1 
ATOM   159  N N   . GLY A 1 23  ? -6.711  8.940  -26.768 1.00 14.84 ? 51   GLY A N   1 
ATOM   160  C CA  . GLY A 1 23  ? -6.288  9.593  -28.011 1.00 15.58 ? 51   GLY A CA  1 
ATOM   161  C C   . GLY A 1 23  ? -7.273  10.591 -28.565 1.00 16.19 ? 51   GLY A C   1 
ATOM   162  O O   . GLY A 1 23  ? -7.042  11.153 -29.640 1.00 17.80 ? 51   GLY A O   1 
ATOM   163  N N   . HIS A 1 24  ? -8.367  10.830 -27.849 1.00 15.96 ? 52   HIS A N   1 
ATOM   164  C CA  . HIS A 1 24  ? -9.473  11.632 -28.382 1.00 16.38 ? 52   HIS A CA  1 
ATOM   165  C C   . HIS A 1 24  ? -9.305  13.064 -27.906 1.00 14.96 ? 52   HIS A C   1 
ATOM   166  O O   . HIS A 1 24  ? -9.007  13.291 -26.733 1.00 13.53 ? 52   HIS A O   1 
ATOM   167  C CB  . HIS A 1 24  ? -10.823 11.127 -27.880 1.00 18.19 ? 52   HIS A CB  1 
ATOM   168  C CG  . HIS A 1 24  ? -11.139 9.719  -28.274 1.00 20.68 ? 52   HIS A CG  1 
ATOM   169  N ND1 . HIS A 1 24  ? -11.564 8.773  -27.367 1.00 22.05 ? 52   HIS A ND1 1 
ATOM   170  C CD2 . HIS A 1 24  ? -11.096 9.100  -29.474 1.00 22.45 ? 52   HIS A CD2 1 
ATOM   171  C CE1 . HIS A 1 24  ? -11.772 7.629  -27.993 1.00 22.97 ? 52   HIS A CE1 1 
ATOM   172  N NE2 . HIS A 1 24  ? -11.492 7.799  -29.272 1.00 23.30 ? 52   HIS A NE2 1 
ATOM   173  N N   . MET A 1 25  ? -9.505  14.033 -28.790 1.00 14.81 ? 53   MET A N   1 
ATOM   174  C CA  . MET A 1 25  ? -9.329  15.436 -28.424 1.00 14.99 ? 53   MET A CA  1 
ATOM   175  C C   . MET A 1 25  ? -10.430 15.896 -27.473 1.00 14.02 ? 53   MET A C   1 
ATOM   176  O O   . MET A 1 25  ? -11.619 15.610 -27.676 1.00 15.67 ? 53   MET A O   1 
ATOM   177  C CB  . MET A 1 25  ? -9.319  16.310 -29.672 1.00 17.03 ? 53   MET A CB  1 
ATOM   178  C CG  . MET A 1 25  ? -8.800  17.711 -29.428 1.00 18.59 ? 53   MET A CG  1 
ATOM   179  S SD  . MET A 1 25  ? -7.062  17.771 -28.943 1.00 21.71 ? 53   MET A SD  1 
ATOM   180  C CE  . MET A 1 25  ? -6.292  17.327 -30.503 1.00 22.02 ? 53   MET A CE  1 
ATOM   181  N N   . VAL A 1 26  ? -10.015 16.586 -26.416 1.00 12.47 ? 54   VAL A N   1 
ATOM   182  C CA  . VAL A 1 26  ? -10.907 17.149 -25.412 1.00 12.13 ? 54   VAL A CA  1 
ATOM   183  C C   . VAL A 1 26  ? -10.711 18.650 -25.423 1.00 11.16 ? 54   VAL A C   1 
ATOM   184  O O   . VAL A 1 26  ? -9.597  19.150 -25.323 1.00 11.11 ? 54   VAL A O   1 
ATOM   185  C CB  . VAL A 1 26  ? -10.625 16.630 -23.979 1.00 12.55 ? 54   VAL A CB  1 
ATOM   186  C CG1 . VAL A 1 26  ? -11.617 17.217 -22.975 1.00 12.62 ? 54   VAL A CG1 1 
ATOM   187  C CG2 . VAL A 1 26  ? -10.718 15.119 -23.933 1.00 13.44 ? 54   VAL A CG2 1 
ATOM   188  N N   . ASN A 1 27  ? -11.812 19.375 -25.536 1.00 11.31 ? 55   ASN A N   1 
ATOM   189  C CA  . ASN A 1 27  ? -11.857 20.811 -25.326 1.00 11.28 ? 55   ASN A CA  1 
ATOM   190  C C   . ASN A 1 27  ? -12.010 21.054 -23.836 1.00 10.57 ? 55   ASN A C   1 
ATOM   191  O O   . ASN A 1 27  ? -13.007 20.637 -23.241 1.00 10.88 ? 55   ASN A O   1 
ATOM   192  C CB  . ASN A 1 27  ? -13.064 21.344 -26.126 1.00 12.55 ? 55   ASN A CB  1 
ATOM   193  C CG  . ASN A 1 27  ? -13.247 22.827 -26.032 1.00 13.70 ? 55   ASN A CG  1 
ATOM   194  O OD1 . ASN A 1 27  ? -12.804 23.451 -25.081 1.00 14.38 ? 55   ASN A OD1 1 
ATOM   195  N ND2 . ASN A 1 27  ? -13.914 23.407 -27.018 1.00 15.26 ? 55   ASN A ND2 1 
ATOM   196  N N   . LEU A 1 28  ? -11.024 21.720 -23.221 1.00 9.80  ? 56   LEU A N   1 
ATOM   197  C CA  . LEU A 1 28  ? -11.054 21.931 -21.771 1.00 9.63  ? 56   LEU A CA  1 
ATOM   198  C C   . LEU A 1 28  ? -12.082 22.929 -21.306 1.00 9.64  ? 56   LEU A C   1 
ATOM   199  O O   . LEU A 1 28  ? -12.259 23.105 -20.106 1.00 9.12  ? 56   LEU A O   1 
ATOM   200  C CB  . LEU A 1 28  ? -9.656  22.234 -21.242 1.00 9.58  ? 56   LEU A CB  1 
ATOM   201  C CG  . LEU A 1 28  ? -8.586  21.188 -21.581 1.00 10.12 ? 56   LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 28  ? -7.279  21.542 -20.893 1.00 10.06 ? 56   LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 28  ? -8.968  19.752 -21.272 1.00 10.47 ? 56   LEU A CD2 1 
ATOM   204  N N   . ASP A 1 29  ? -12.834 23.529 -22.232 1.00 10.14 ? 57   ASP A N   1 
ATOM   205  C CA  A ASP A 1 29  ? -13.978 24.331 -21.820 0.50 10.64 ? 57   ASP A CA  1 
ATOM   206  C CA  B ASP A 1 29  ? -13.983 24.327 -21.842 0.50 10.68 ? 57   ASP A CA  1 
ATOM   207  C C   . ASP A 1 29  ? -15.077 23.477 -21.184 1.00 10.67 ? 57   ASP A C   1 
ATOM   208  O O   . ASP A 1 29  ? -16.009 24.023 -20.589 1.00 10.84 ? 57   ASP A O   1 
ATOM   209  C CB  A ASP A 1 29  ? -14.478 25.259 -22.932 0.50 11.47 ? 57   ASP A CB  1 
ATOM   210  C CB  B ASP A 1 29  ? -14.522 25.110 -23.025 0.50 11.57 ? 57   ASP A CB  1 
ATOM   211  C CG  A ASP A 1 29  ? -15.229 24.545 -24.045 0.50 12.07 ? 57   ASP A CG  1 
ATOM   212  C CG  B ASP A 1 29  ? -15.452 26.218 -22.599 0.50 12.19 ? 57   ASP A CG  1 
ATOM   213  O OD1 A ASP A 1 29  ? -15.437 23.318 -24.007 0.50 13.02 ? 57   ASP A OD1 1 
ATOM   214  O OD1 B ASP A 1 29  ? -15.093 27.020 -21.702 0.50 12.77 ? 57   ASP A OD1 1 
ATOM   215  O OD2 A ASP A 1 29  ? -15.624 25.243 -25.006 0.50 13.03 ? 57   ASP A OD2 1 
ATOM   216  O OD2 B ASP A 1 29  ? -16.570 26.269 -23.152 0.50 13.30 ? 57   ASP A OD2 1 
ATOM   217  N N   . LYS A 1 30  ? -14.967 22.151 -21.270 1.00 10.56 ? 58   LYS A N   1 
ATOM   218  C CA  . LYS A 1 30  ? -15.856 21.297 -20.474 1.00 11.34 ? 58   LYS A CA  1 
ATOM   219  C C   . LYS A 1 30  ? -15.759 21.561 -18.973 1.00 10.43 ? 58   LYS A C   1 
ATOM   220  O O   . LYS A 1 30  ? -16.670 21.211 -18.214 1.00 10.96 ? 58   LYS A O   1 
ATOM   221  C CB  . LYS A 1 30  ? -15.621 19.839 -20.781 1.00 12.48 ? 58   LYS A CB  1 
ATOM   222  C CG  . LYS A 1 30  ? -14.326 19.306 -20.250 1.00 13.13 ? 58   LYS A CG  1 
ATOM   223  C CD  . LYS A 1 30  ? -14.098 17.867 -20.665 1.00 14.59 ? 58   LYS A CD  1 
ATOM   224  C CE  . LYS A 1 30  ? -14.893 16.893 -19.831 1.00 15.88 ? 58   LYS A CE  1 
ATOM   225  N NZ  . LYS A 1 30  ? -14.608 15.483 -20.245 1.00 17.02 ? 58   LYS A NZ  1 
ATOM   226  N N   . TYR A 1 31  ? -14.646 22.147 -18.529 1.00 9.63  ? 59   TYR A N   1 
ATOM   227  C CA  . TYR A 1 31  ? -14.456 22.434 -17.113 1.00 9.31  ? 59   TYR A CA  1 
ATOM   228  C C   . TYR A 1 31  ? -14.950 23.806 -16.704 1.00 9.36  ? 59   TYR A C   1 
ATOM   229  O O   . TYR A 1 31  ? -14.763 24.201 -15.561 1.00 9.36  ? 59   TYR A O   1 
ATOM   230  C CB  . TYR A 1 31  ? -12.977 22.232 -16.760 1.00 8.97  ? 59   TYR A CB  1 
ATOM   231  C CG  . TYR A 1 31  ? -12.557 20.806 -17.011 1.00 9.06  ? 59   TYR A CG  1 
ATOM   232  C CD1 . TYR A 1 31  ? -13.023 19.783 -16.204 1.00 9.57  ? 59   TYR A CD1 1 
ATOM   233  C CD2 . TYR A 1 31  ? -11.743 20.466 -18.079 1.00 9.23  ? 59   TYR A CD2 1 
ATOM   234  C CE1 . TYR A 1 31  ? -12.671 18.464 -16.443 1.00 9.79  ? 59   TYR A CE1 1 
ATOM   235  C CE2 . TYR A 1 31  ? -11.379 19.152 -18.326 1.00 9.63  ? 59   TYR A CE2 1 
ATOM   236  C CZ  . TYR A 1 31  ? -11.842 18.164 -17.516 1.00 9.57  ? 59   TYR A CZ  1 
ATOM   237  O OH  . TYR A 1 31  ? -11.454 16.872 -17.786 1.00 10.43 ? 59   TYR A OH  1 
ATOM   238  N N   . ARG A 1 32  ? -15.614 24.535 -17.599 1.00 10.24 ? 60   ARG A N   1 
ATOM   239  C CA  . ARG A 1 32  ? -16.242 25.803 -17.227 1.00 11.30 ? 60   ARG A CA  1 
ATOM   240  C C   . ARG A 1 32  ? -17.251 25.582 -16.110 1.00 10.63 ? 60   ARG A C   1 
ATOM   241  O O   . ARG A 1 32  ? -18.190 24.785 -16.240 1.00 10.77 ? 60   ARG A O   1 
ATOM   242  C CB  . ARG A 1 32  ? -16.950 26.430 -18.412 1.00 13.51 ? 60   ARG A CB  1 
ATOM   243  C CG  . ARG A 1 32  ? -17.298 27.899 -18.210 1.00 16.37 ? 60   ARG A CG  1 
ATOM   244  C CD  . ARG A 1 32  ? -17.627 28.545 -19.553 1.00 18.68 ? 60   ARG A CD  1 
ATOM   245  N NE  . ARG A 1 32  ? -18.657 27.752 -20.228 1.00 21.46 ? 60   ARG A NE  1 
ATOM   246  C CZ  . ARG A 1 32  ? -18.865 27.631 -21.544 1.00 23.50 ? 60   ARG A CZ  1 
ATOM   247  N NH1 . ARG A 1 32  ? -18.109 28.256 -22.450 1.00 24.96 ? 60   ARG A NH1 1 
ATOM   248  N NH2 . ARG A 1 32  ? -19.849 26.834 -21.958 1.00 24.95 ? 60   ARG A NH2 1 
ATOM   249  N N   . GLY A 1 33  ? -17.062 26.285 -14.999 1.00 10.02 ? 61   GLY A N   1 
ATOM   250  C CA  . GLY A 1 33  ? -17.918 26.141 -13.848 1.00 10.31 ? 61   GLY A CA  1 
ATOM   251  C C   . GLY A 1 33  ? -17.432 25.152 -12.806 1.00 10.05 ? 61   GLY A C   1 
ATOM   252  O O   . GLY A 1 33  ? -18.092 24.989 -11.779 1.00 10.76 ? 61   GLY A O   1 
ATOM   253  N N   . PHE A 1 34  ? -16.289 24.500 -13.041 1.00 9.26  ? 62   PHE A N   1 
ATOM   254  C CA  . PHE A 1 34  ? -15.801 23.417 -12.165 1.00 9.34  ? 62   PHE A CA  1 
ATOM   255  C C   . PHE A 1 34  ? -14.435 23.740 -11.615 1.00 9.32  ? 62   PHE A C   1 
ATOM   256  O O   . PHE A 1 34  ? -13.491 23.947 -12.384 1.00 10.53 ? 62   PHE A O   1 
ATOM   257  C CB  . PHE A 1 34  ? -15.715 22.088 -12.929 1.00 9.10  ? 62   PHE A CB  1 
ATOM   258  C CG  . PHE A 1 34  ? -17.063 21.626 -13.362 1.00 9.49  ? 62   PHE A CG  1 
ATOM   259  C CD1 . PHE A 1 34  ? -17.874 20.975 -12.450 1.00 10.11 ? 62   PHE A CD1 1 
ATOM   260  C CD2 . PHE A 1 34  ? -17.583 21.933 -14.610 1.00 9.85  ? 62   PHE A CD2 1 
ATOM   261  C CE1 . PHE A 1 34  ? -19.169 20.622 -12.769 1.00 10.63 ? 62   PHE A CE1 1 
ATOM   262  C CE2 . PHE A 1 34  ? -18.876 21.572 -14.935 1.00 10.65 ? 62   PHE A CE2 1 
ATOM   263  C CZ  . PHE A 1 34  ? -19.662 20.910 -14.006 1.00 10.84 ? 62   PHE A CZ  1 
ATOM   264  N N   . VAL A 1 35  ? -14.320 23.722 -10.301 1.00 9.36  ? 63   VAL A N   1 
ATOM   265  C CA  . VAL A 1 35  ? -13.011 23.820 -9.677  1.00 9.25  ? 63   VAL A CA  1 
ATOM   266  C C   . VAL A 1 35  ? -12.214 22.591 -10.062 1.00 8.89  ? 63   VAL A C   1 
ATOM   267  O O   . VAL A 1 35  ? -12.707 21.459 -9.942  1.00 9.17  ? 63   VAL A O   1 
ATOM   268  C CB  . VAL A 1 35  ? -13.133 23.939 -8.153  1.00 9.94  ? 63   VAL A CB  1 
ATOM   269  C CG1 . VAL A 1 35  ? -11.776 23.942 -7.479  1.00 10.14 ? 63   VAL A CG1 1 
ATOM   270  C CG2 . VAL A 1 35  ? -13.902 25.204 -7.786  1.00 10.85 ? 63   VAL A CG2 1 
ATOM   271  N N   . SER A 1 36  ? -10.994 22.797 -10.543 1.00 8.45  ? 64   SER A N   1 
ATOM   272  C CA  . SER A 1 36  ? -10.218 21.709 -11.105 1.00 8.57  ? 64   SER A CA  1 
ATOM   273  C C   . SER A 1 36  ? -8.829  21.622 -10.510 1.00 8.45  ? 64   SER A C   1 
ATOM   274  O O   . SER A 1 36  ? -8.170  22.646 -10.249 1.00 9.25  ? 64   SER A O   1 
ATOM   275  C CB  . SER A 1 36  ? -10.115 21.872 -12.613 1.00 8.97  ? 64   SER A CB  1 
ATOM   276  O OG  . SER A 1 36  ? -11.405 21.857 -13.186 1.00 9.83  ? 64   SER A OG  1 
ATOM   277  N N   . ILE A 1 37  ? -8.343  20.397 -10.341 1.00 7.97  ? 65   ILE A N   1 
ATOM   278  C CA  . ILE A 1 37  ? -6.934  20.157 -10.015 1.00 8.13  ? 65   ILE A CA  1 
ATOM   279  C C   . ILE A 1 37  ? -6.288  19.587 -11.266 1.00 7.83  ? 65   ILE A C   1 
ATOM   280  O O   . ILE A 1 37  ? -6.778  18.586 -11.820 1.00 8.52  ? 65   ILE A O   1 
ATOM   281  C CB  . ILE A 1 37  ? -6.783  19.187 -8.849  1.00 8.74  ? 65   ILE A CB  1 
ATOM   282  C CG1 . ILE A 1 37  ? -7.375  19.780 -7.571  1.00 9.40  ? 65   ILE A CG1 1 
ATOM   283  C CG2 . ILE A 1 37  ? -5.319  18.805 -8.639  1.00 8.96  ? 65   ILE A CG2 1 
ATOM   284  C CD1 . ILE A 1 37  ? -7.615  18.759 -6.483  1.00 10.02 ? 65   ILE A CD1 1 
ATOM   285  N N   . VAL A 1 38  ? -5.200  20.214 -11.711 1.00 7.47  ? 66   VAL A N   1 
ATOM   286  C CA  . VAL A 1 38  ? -4.419  19.733 -12.842 1.00 7.33  ? 66   VAL A CA  1 
ATOM   287  C C   . VAL A 1 38  ? -3.110  19.216 -12.290 1.00 7.16  ? 66   VAL A C   1 
ATOM   288  O O   . VAL A 1 38  ? -2.413  19.957 -11.592 1.00 7.67  ? 66   VAL A O   1 
ATOM   289  C CB  . VAL A 1 38  ? -4.193  20.828 -13.881 1.00 7.62  ? 66   VAL A CB  1 
ATOM   290  C CG1 . VAL A 1 38  ? -3.401  20.272 -15.042 1.00 7.84  ? 66   VAL A CG1 1 
ATOM   291  C CG2 . VAL A 1 38  ? -5.510  21.404 -14.380 1.00 7.98  ? 66   VAL A CG2 1 
ATOM   292  N N   . THR A 1 39  ? -2.752  17.978 -12.594 1.00 7.00  ? 67   THR A N   1 
ATOM   293  C CA  . THR A 1 39  ? -1.556  17.378 -12.020 1.00 7.24  ? 67   THR A CA  1 
ATOM   294  C C   . THR A 1 39  ? -0.835  16.524 -13.035 1.00 7.14  ? 67   THR A C   1 
ATOM   295  O O   . THR A 1 39  ? -1.476  15.923 -13.924 1.00 7.36  ? 67   THR A O   1 
ATOM   296  C CB  . THR A 1 39  ? -1.932  16.597 -10.756 1.00 7.68  ? 67   THR A CB  1 
ATOM   297  O OG1 . THR A 1 39  ? -0.759  16.110 -10.105 1.00 8.15  ? 67   THR A OG1 1 
ATOM   298  C CG2 . THR A 1 39  ? -2.849  15.443 -11.011 1.00 8.09  ? 67   THR A CG2 1 
ATOM   299  N N   . ASN A 1 40  ? 0.486   16.458 -12.916 1.00 7.04  ? 68   ASN A N   1 
ATOM   300  C CA  . ASN A 1 40  ? 1.282   15.562 -13.744 1.00 7.22  ? 68   ASN A CA  1 
ATOM   301  C C   . ASN A 1 40  ? 1.558   14.301 -12.948 1.00 7.68  ? 68   ASN A C   1 
ATOM   302  O O   . ASN A 1 40  ? 1.979   14.374 -11.788 1.00 8.51  ? 68   ASN A O   1 
ATOM   303  C CB  . ASN A 1 40  ? 2.579   16.205 -14.245 1.00 7.25  ? 68   ASN A CB  1 
ATOM   304  C CG  . ASN A 1 40  ? 3.488   16.681 -13.137 1.00 7.49  ? 68   ASN A CG  1 
ATOM   305  O OD1 . ASN A 1 40  ? 3.085   17.459 -12.268 1.00 7.34  ? 68   ASN A OD1 1 
ATOM   306  N ND2 . ASN A 1 40  ? 4.743   16.268 -13.182 1.00 7.84  ? 68   ASN A ND2 1 
ATOM   307  N N   . VAL A 1 41  ? 1.326   13.144 -13.554 1.00 7.64  ? 69   VAL A N   1 
ATOM   308  C CA  . VAL A 1 41  ? 1.384   11.889 -12.844 1.00 7.92  ? 69   VAL A CA  1 
ATOM   309  C C   . VAL A 1 41  ? 2.461   10.973 -13.424 1.00 7.94  ? 69   VAL A C   1 
ATOM   310  O O   . VAL A 1 41  ? 2.975   11.178 -14.533 1.00 8.00  ? 69   VAL A O   1 
ATOM   311  C CB  . VAL A 1 41  ? 0.023   11.178 -12.809 1.00 8.34  ? 69   VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 41  ? -1.032  12.079 -12.181 1.00 8.49  ? 69   VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 41  ? -0.451  10.711 -14.191 1.00 8.67  ? 69   VAL A CG2 1 
ATOM   314  N N   . ALA A 1 42  ? 2.797   9.955  -12.635 1.00 8.15  ? 70   ALA A N   1 
ATOM   315  C CA  . ALA A 1 42  ? 3.740   8.919  -13.055 1.00 8.74  ? 70   ALA A CA  1 
ATOM   316  C C   . ALA A 1 42  ? 3.429   7.681  -12.233 1.00 9.13  ? 70   ALA A C   1 
ATOM   317  O O   . ALA A 1 42  ? 2.984   7.770  -11.081 1.00 9.69  ? 70   ALA A O   1 
ATOM   318  C CB  . ALA A 1 42  ? 5.176   9.367  -12.839 1.00 9.15  ? 70   ALA A CB  1 
ATOM   319  N N   . SER A 1 43  ? 3.707   6.512  -12.805 1.00 9.70  ? 71   SER A N   1 
ATOM   320  C CA  . SER A 1 43  ? 3.292   5.254  -12.177 1.00 10.48 ? 71   SER A CA  1 
ATOM   321  C C   . SER A 1 43  ? 4.390   4.615  -11.316 1.00 11.25 ? 71   SER A C   1 
ATOM   322  O O   . SER A 1 43  ? 4.078   3.725  -10.523 1.00 12.00 ? 71   SER A O   1 
ATOM   323  C CB  . SER A 1 43  ? 2.886   4.231  -13.240 1.00 11.12 ? 71   SER A CB  1 
ATOM   324  O OG  . SER A 1 43  ? 1.857   4.690  -14.062 1.00 11.43 ? 71   SER A OG  1 
ATOM   325  N N   . GLN A 1 44  ? 5.642   5.043  -11.465 1.00 11.54 ? 72   GLN A N   1 
ATOM   326  C CA  . GLN A 1 44  ? 6.799   4.365  -10.832 1.00 12.71 ? 72   GLN A CA  1 
ATOM   327  C C   . GLN A 1 44  ? 7.595   5.304  -9.919  1.00 12.98 ? 72   GLN A C   1 
ATOM   328  O O   . GLN A 1 44  ? 8.834   5.263  -9.862  1.00 14.46 ? 72   GLN A O   1 
ATOM   329  C CB  . GLN A 1 44  ? 7.712   3.743  -11.910 1.00 13.38 ? 72   GLN A CB  1 
ATOM   330  C CG  . GLN A 1 44  ? 6.970   2.786  -12.822 1.00 14.25 ? 72   GLN A CG  1 
ATOM   331  C CD  . GLN A 1 44  ? 7.847   2.094  -13.851 1.00 15.12 ? 72   GLN A CD  1 
ATOM   332  O OE1 . GLN A 1 44  ? 9.093   2.185  -13.837 1.00 17.87 ? 72   GLN A OE1 1 
ATOM   333  N NE2 . GLN A 1 44  ? 7.202   1.422  -14.772 1.00 14.94 ? 72   GLN A NE2 1 
HETATM 334  N N   . OCS A 1 45  ? 6.887   6.168  -9.193  1.00 12.77 ? 73   OCS A N   1 
HETATM 335  C CA  . OCS A 1 45  ? 7.515   7.055  -8.184  1.00 13.02 ? 73   OCS A CA  1 
HETATM 336  C CB  . OCS A 1 45  ? 7.014   8.495  -8.430  1.00 13.08 ? 73   OCS A CB  1 
HETATM 337  S SG  . OCS A 1 45  ? 7.570   9.766  -7.524  1.00 13.39 ? 73   OCS A SG  1 
HETATM 338  C C   . OCS A 1 45  ? 7.176   6.489  -6.823  1.00 13.23 ? 73   OCS A C   1 
HETATM 339  O O   . OCS A 1 45  ? 6.130   5.851  -6.627  1.00 12.72 ? 73   OCS A O   1 
HETATM 340  O OD1 . OCS A 1 45  ? 7.412   10.958 -8.215  1.00 13.47 ? 73   OCS A OD1 1 
HETATM 341  O OD2 . OCS A 1 45  ? 7.221   9.580  -6.050  1.00 16.48 ? 73   OCS A OD2 1 
HETATM 342  O OD3 . OCS A 1 45  ? 8.979   9.611  -7.407  1.00 15.52 ? 73   OCS A OD3 1 
ATOM   343  N N   . GLY A 1 46  ? 8.049   6.723  -5.844  1.00 13.68 ? 74   GLY A N   1 
ATOM   344  C CA  . GLY A 1 46  ? 7.783   6.326  -4.459  1.00 14.53 ? 74   GLY A CA  1 
ATOM   345  C C   . GLY A 1 46  ? 6.466   6.823  -3.879  1.00 14.83 ? 74   GLY A C   1 
ATOM   346  O O   . GLY A 1 46  ? 5.866   6.145  -3.036  1.00 16.36 ? 74   GLY A O   1 
ATOM   347  N N   . LYS A 1 47  ? 6.010   7.989  -4.320  1.00 14.44 ? 75   LYS A N   1 
ATOM   348  C CA  . LYS A 1 47  ? 4.763   8.572  -3.852  1.00 14.53 ? 75   LYS A CA  1 
ATOM   349  C C   . LYS A 1 47  ? 3.592   8.376  -4.833  1.00 12.66 ? 75   LYS A C   1 
ATOM   350  O O   . LYS A 1 47  ? 2.566   9.023  -4.689  1.00 12.31 ? 75   LYS A O   1 
ATOM   351  C CB  . LYS A 1 47  ? 4.965   10.066 -3.562  1.00 16.21 ? 75   LYS A CB  1 
ATOM   352  C CG  . LYS A 1 47  ? 6.037   10.405 -2.533  1.00 18.23 ? 75   LYS A CG  1 
ATOM   353  C CD  . LYS A 1 47  ? 6.355   11.897 -2.578  1.00 19.72 ? 75   LYS A CD  1 
ATOM   354  C CE  . LYS A 1 47  ? 7.466   12.274 -1.618  1.00 21.38 ? 75   LYS A CE  1 
ATOM   355  N NZ  . LYS A 1 47  ? 8.804   11.754 -2.003  1.00 22.62 ? 75   LYS A NZ  1 
ATOM   356  N N   . THR A 1 48  ? 3.734   7.497  -5.822  1.00 11.69 ? 76   THR A N   1 
ATOM   357  C CA  . THR A 1 48  ? 2.634   7.228  -6.755  1.00 10.87 ? 76   THR A CA  1 
ATOM   358  C C   . THR A 1 48  ? 1.388   6.754  -6.008  1.00 11.04 ? 76   THR A C   1 
ATOM   359  O O   . THR A 1 48  ? 0.291   7.264  -6.255  1.00 10.34 ? 76   THR A O   1 
ATOM   360  C CB  . THR A 1 48  ? 3.070   6.192  -7.808  1.00 10.69 ? 76   THR A CB  1 
ATOM   361  O OG1 . THR A 1 48  ? 4.001   6.807  -8.709  1.00 10.49 ? 76   THR A OG1 1 
ATOM   362  C CG2 . THR A 1 48  ? 1.870   5.642  -8.591  1.00 10.69 ? 76   THR A CG2 1 
ATOM   363  N N   . GLU A 1 49  ? 1.547   5.806  -5.080  1.00 11.80 ? 77   GLU A N   1 
ATOM   364  C CA  . GLU A 1 49  ? 0.391   5.276  -4.363  1.00 12.94 ? 77   GLU A CA  1 
ATOM   365  C C   . GLU A 1 49  ? -0.306  6.341  -3.525  1.00 12.50 ? 77   GLU A C   1 
ATOM   366  O O   . GLU A 1 49  ? -1.521  6.458  -3.581  1.00 12.38 ? 77   GLU A O   1 
ATOM   367  C CB  . GLU A 1 49  ? 0.790   4.092  -3.482  1.00 14.87 ? 77   GLU A CB  1 
ATOM   368  C CG  . GLU A 1 49  ? -0.381  3.441  -2.740  1.00 16.84 ? 77   GLU A CG  1 
ATOM   369  C CD  . GLU A 1 49  ? 0.030   2.283  -1.841  1.00 19.15 ? 77   GLU A CD  1 
ATOM   370  O OE1 . GLU A 1 49  ? 1.218   1.904  -1.827  1.00 21.68 ? 77   GLU A OE1 1 
ATOM   371  O OE2 . GLU A 1 49  ? -0.856  1.742  -1.144  1.00 21.97 ? 77   GLU A OE2 1 
ATOM   372  N N   . VAL A 1 50  ? 0.447   7.117  -2.747  1.00 12.49 ? 78   VAL A N   1 
ATOM   373  C CA  . VAL A 1 50  ? -0.182  8.155  -1.922  1.00 12.95 ? 78   VAL A CA  1 
ATOM   374  C C   . VAL A 1 50  ? -0.893  9.180  -2.800  1.00 11.68 ? 78   VAL A C   1 
ATOM   375  O O   . VAL A 1 50  ? -2.000  9.621  -2.487  1.00 11.60 ? 78   VAL A O   1 
ATOM   376  C CB  . VAL A 1 50  ? 0.801   8.819  -0.942  1.00 14.38 ? 78   VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 50  ? 1.907   9.607  -1.604  1.00 14.73 ? 78   VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 50  ? 0.053   9.690  0.043   1.00 15.33 ? 78   VAL A CG2 1 
ATOM   379  N N   . ASN A 1 51  ? -0.271  9.580  -3.907  1.00 11.11 ? 79   ASN A N   1 
ATOM   380  C CA  . ASN A 1 51  ? -0.908  10.590 -4.751  1.00 10.77 ? 79   ASN A CA  1 
ATOM   381  C C   . ASN A 1 51  ? -2.178  10.073 -5.404  1.00 10.30 ? 79   ASN A C   1 
ATOM   382  O O   . ASN A 1 51  ? -3.203  10.732 -5.348  1.00 10.10 ? 79   ASN A O   1 
ATOM   383  C CB  . ASN A 1 51  ? 0.058   11.156 -5.794  1.00 10.97 ? 79   ASN A CB  1 
ATOM   384  C CG  . ASN A 1 51  ? 0.904   12.261 -5.223  1.00 11.53 ? 79   ASN A CG  1 
ATOM   385  O OD1 . ASN A 1 51  ? 0.502   13.426 -5.238  1.00 12.08 ? 79   ASN A OD1 1 
ATOM   386  N ND2 . ASN A 1 51  ? 2.062   11.917 -4.713  1.00 12.43 ? 79   ASN A ND2 1 
ATOM   387  N N   . TYR A 1 52  ? -2.126  8.897  -6.020  1.00 10.22 ? 80   TYR A N   1 
ATOM   388  C CA  . TYR A 1 52  ? -3.342  8.392  -6.644  1.00 10.26 ? 80   TYR A CA  1 
ATOM   389  C C   . TYR A 1 52  ? -4.429  8.138  -5.615  1.00 10.54 ? 80   TYR A C   1 
ATOM   390  O O   . TYR A 1 52  ? -5.581  8.489  -5.855  1.00 10.51 ? 80   TYR A O   1 
ATOM   391  C CB  . TYR A 1 52  ? -3.085  7.110  -7.421  1.00 10.45 ? 80   TYR A CB  1 
ATOM   392  C CG  . TYR A 1 52  ? -2.734  7.339  -8.877  1.00 10.67 ? 80   TYR A CG  1 
ATOM   393  C CD1 . TYR A 1 52  ? -3.740  7.595  -9.813  1.00 11.15 ? 80   TYR A CD1 1 
ATOM   394  C CD2 . TYR A 1 52  ? -1.420  7.329  -9.332  1.00 10.89 ? 80   TYR A CD2 1 
ATOM   395  C CE1 . TYR A 1 52  ? -3.456  7.799  -11.153 1.00 11.32 ? 80   TYR A CE1 1 
ATOM   396  C CE2 . TYR A 1 52  ? -1.113  7.541  -10.672 1.00 10.79 ? 80   TYR A CE2 1 
ATOM   397  C CZ  . TYR A 1 52  ? -2.144  7.753  -11.582 1.00 10.71 ? 80   TYR A CZ  1 
ATOM   398  O OH  . TYR A 1 52  ? -1.869  7.929  -12.926 1.00 11.01 ? 80   TYR A OH  1 
ATOM   399  N N   . THR A 1 53  ? -4.093  7.534  -4.471  1.00 10.92 ? 81   THR A N   1 
ATOM   400  C CA  . THR A 1 53  ? -5.160  7.225  -3.526  1.00 11.72 ? 81   THR A CA  1 
ATOM   401  C C   . THR A 1 53  ? -5.795  8.503  -2.966  1.00 11.10 ? 81   THR A C   1 
ATOM   402  O O   . THR A 1 53  ? -7.018  8.557  -2.794  1.00 10.90 ? 81   THR A O   1 
ATOM   403  C CB  . THR A 1 53  ? -4.711  6.298  -2.420  1.00 13.06 ? 81   THR A CB  1 
ATOM   404  O OG1 . THR A 1 53  ? -3.672  6.924  -1.742  1.00 13.99 ? 81   THR A OG1 1 
ATOM   405  C CG2 . THR A 1 53  ? -4.193  4.986  -2.947  1.00 13.58 ? 81   THR A CG2 1 
ATOM   406  N N   . GLN A 1 54  ? -4.989  9.535  -2.712  1.00 10.69 ? 82   GLN A N   1 
ATOM   407  C CA  . GLN A 1 54  ? -5.547  10.787 -2.194  1.00 10.84 ? 82   GLN A CA  1 
ATOM   408  C C   . GLN A 1 54  ? -6.285  11.593 -3.260  1.00 10.35 ? 82   GLN A C   1 
ATOM   409  O O   . GLN A 1 54  ? -7.274  12.253 -2.937  1.00 10.52 ? 82   GLN A O   1 
ATOM   410  C CB  . GLN A 1 54  ? -4.496  11.636 -1.503  1.00 11.31 ? 82   GLN A CB  1 
ATOM   411  C CG  . GLN A 1 54  ? -3.984  10.994 -0.234  1.00 12.15 ? 82   GLN A CG  1 
ATOM   412  C CD  . GLN A 1 54  ? -3.050  11.892 0.550   1.00 12.84 ? 82   GLN A CD  1 
ATOM   413  O OE1 . GLN A 1 54  ? -2.862  13.055 0.233   1.00 12.85 ? 82   GLN A OE1 1 
ATOM   414  N NE2 . GLN A 1 54  ? -2.478  11.347 1.598   1.00 14.19 ? 82   GLN A NE2 1 
ATOM   415  N N   . LEU A 1 55  ? -5.845  11.544 -4.518  1.00 9.88  ? 83   LEU A N   1 
ATOM   416  C CA  . LEU A 1 55  ? -6.637  12.175 -5.575  1.00 9.81  ? 83   LEU A CA  1 
ATOM   417  C C   . LEU A 1 55  ? -7.998  11.486 -5.731  1.00 9.84  ? 83   LEU A C   1 
ATOM   418  O O   . LEU A 1 55  ? -9.036  12.154 -5.906  1.00 9.74  ? 83   LEU A O   1 
ATOM   419  C CB  . LEU A 1 55  ? -5.873  12.144 -6.900  1.00 9.93  ? 83   LEU A CB  1 
ATOM   420  C CG  . LEU A 1 55  ? -4.654  13.057 -6.951  1.00 10.35 ? 83   LEU A CG  1 
ATOM   421  C CD1 . LEU A 1 55  ? -3.803  12.702 -8.150  1.00 10.78 ? 83   LEU A CD1 1 
ATOM   422  C CD2 . LEU A 1 55  ? -5.034  14.529 -7.004  1.00 10.41 ? 83   LEU A CD2 1 
ATOM   423  N N   . VAL A 1 56  ? -8.014  10.154 -5.657  1.00 9.98  ? 84   VAL A N   1 
ATOM   424  C CA  . VAL A 1 56  ? -9.259  9.408  -5.696  1.00 10.51 ? 84   VAL A CA  1 
ATOM   425  C C   . VAL A 1 56  ? -10.146 9.825  -4.508  1.00 11.21 ? 84   VAL A C   1 
ATOM   426  O O   . VAL A 1 56  ? -11.353 10.035 -4.683  1.00 11.50 ? 84   VAL A O   1 
ATOM   427  C CB  . VAL A 1 56  ? -8.975  7.893  -5.721  1.00 10.87 ? 84   VAL A CB  1 
ATOM   428  C CG1 . VAL A 1 56  ? -10.233 7.062  -5.453  1.00 11.48 ? 84   VAL A CG1 1 
ATOM   429  C CG2 . VAL A 1 56  ? -8.402  7.520  -7.076  1.00 10.63 ? 84   VAL A CG2 1 
ATOM   430  N N   . ASP A 1 57  ? -9.559  9.960  -3.310  1.00 11.73 ? 85   ASP A N   1 
ATOM   431  C CA  A ASP A 1 57  ? -10.304 10.394 -2.096  0.50 12.51 ? 85   ASP A CA  1 
ATOM   432  C CA  B ASP A 1 57  ? -10.334 10.356 -2.133  0.50 12.39 ? 85   ASP A CA  1 
ATOM   433  C C   . ASP A 1 57  ? -10.958 11.751 -2.323  1.00 12.20 ? 85   ASP A C   1 
ATOM   434  O O   . ASP A 1 57  ? -12.131 11.958 -2.017  1.00 12.49 ? 85   ASP A O   1 
ATOM   435  C CB  A ASP A 1 57  ? -9.382  10.552 -0.867  0.50 13.25 ? 85   ASP A CB  1 
ATOM   436  C CB  B ASP A 1 57  ? -9.433  10.287 -0.900  0.50 12.96 ? 85   ASP A CB  1 
ATOM   437  C CG  A ASP A 1 57  ? -8.806  9.244  -0.357  0.50 13.94 ? 85   ASP A CG  1 
ATOM   438  C CG  B ASP A 1 57  ? -10.153 10.637 0.370   0.50 13.68 ? 85   ASP A CG  1 
ATOM   439  O OD1 A ASP A 1 57  ? -9.382  8.177  -0.633  0.50 14.47 ? 85   ASP A OD1 1 
ATOM   440  O OD1 B ASP A 1 57  ? -11.317 10.224 0.529   0.50 14.36 ? 85   ASP A OD1 1 
ATOM   441  O OD2 A ASP A 1 57  ? -7.756  9.310  0.330   0.50 14.65 ? 85   ASP A OD2 1 
ATOM   442  O OD2 B ASP A 1 57  ? -9.554  11.325 1.219   0.50 14.22 ? 85   ASP A OD2 1 
ATOM   443  N N   . LEU A 1 58  ? -10.169 12.690 -2.834  1.00 11.75 ? 86   LEU A N   1 
ATOM   444  C CA  . LEU A 1 58  ? -10.678 14.040 -3.087  1.00 12.10 ? 86   LEU A CA  1 
ATOM   445  C C   . LEU A 1 58  ? -11.831 13.999 -4.068  1.00 11.37 ? 86   LEU A C   1 
ATOM   446  O O   . LEU A 1 58  ? -12.858 14.644 -3.859  1.00 11.35 ? 86   LEU A O   1 
ATOM   447  C CB  . LEU A 1 58  ? -9.589  14.940 -3.662  1.00 12.48 ? 86   LEU A CB  1 
ATOM   448  C CG  . LEU A 1 58  ? -8.520  15.415 -2.675  1.00 13.43 ? 86   LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 58  ? -7.473  16.200 -3.436  1.00 13.69 ? 86   LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 58  ? -9.078  16.259 -1.544  1.00 14.33 ? 86   LEU A CD2 1 
ATOM   451  N N   . HIS A 1 59  ? -11.665 13.250 -5.152  1.00 10.90 ? 87   HIS A N   1 
ATOM   452  C CA  . HIS A 1 59  ? -12.727 13.171 -6.140  1.00 11.26 ? 87   HIS A CA  1 
ATOM   453  C C   . HIS A 1 59  ? -13.979 12.523 -5.555  1.00 11.83 ? 87   HIS A C   1 
ATOM   454  O O   . HIS A 1 59  ? -15.091 12.994 -5.780  1.00 11.98 ? 87   HIS A O   1 
ATOM   455  C CB  . HIS A 1 59  ? -12.211 12.434 -7.371  1.00 11.41 ? 87   HIS A CB  1 
ATOM   456  C CG  . HIS A 1 59  ? -13.180 12.434 -8.503  1.00 12.05 ? 87   HIS A CG  1 
ATOM   457  N ND1 . HIS A 1 59  ? -14.073 11.407 -8.711  1.00 12.98 ? 87   HIS A ND1 1 
ATOM   458  C CD2 . HIS A 1 59  ? -13.438 13.359 -9.451  1.00 12.39 ? 87   HIS A CD2 1 
ATOM   459  C CE1 . HIS A 1 59  ? -14.795 11.673 -9.785  1.00 13.18 ? 87   HIS A CE1 1 
ATOM   460  N NE2 . HIS A 1 59  ? -14.448 12.862 -10.237 1.00 12.76 ? 87   HIS A NE2 1 
ATOM   461  N N   . ALA A 1 60  ? -13.809 11.455 -4.783  1.00 12.37 ? 88   ALA A N   1 
ATOM   462  C CA  . ALA A 1 60  ? -14.946 10.787 -4.174  1.00 13.32 ? 88   ALA A CA  1 
ATOM   463  C C   . ALA A 1 60  ? -15.730 11.735 -3.282  1.00 13.78 ? 88   ALA A C   1 
ATOM   464  O O   . ALA A 1 60  ? -16.973 11.723 -3.270  1.00 14.65 ? 88   ALA A O   1 
ATOM   465  C CB  . ALA A 1 60  ? -14.491 9.563  -3.384  1.00 13.70 ? 88   ALA A CB  1 
ATOM   466  N N   . ARG A 1 61  ? -15.013 12.555 -2.530  1.00 13.77 ? 89   ARG A N   1 
ATOM   467  C CA  . ARG A 1 61  ? -15.635 13.410 -1.551  1.00 14.61 ? 89   ARG A CA  1 
ATOM   468  C C   . ARG A 1 61  ? -16.137 14.745 -2.087  1.00 13.60 ? 89   ARG A C   1 
ATOM   469  O O   . ARG A 1 61  ? -17.075 15.321 -1.502  1.00 14.23 ? 89   ARG A O   1 
ATOM   470  C CB  . ARG A 1 61  ? -14.726 13.532 -0.338  1.00 16.10 ? 89   ARG A CB  1 
ATOM   471  C CG  . ARG A 1 61  ? -14.750 12.203 0.433   1.00 17.69 ? 89   ARG A CG  1 
ATOM   472  C CD  . ARG A 1 61  ? -14.125 12.233 1.806   1.00 19.05 ? 89   ARG A CD  1 
ATOM   473  N NE  . ARG A 1 61  ? -12.714 12.584 1.720   1.00 19.72 ? 89   ARG A NE  1 
ATOM   474  C CZ  . ARG A 1 61  ? -12.206 13.792 1.958   1.00 20.26 ? 89   ARG A CZ  1 
ATOM   475  N NH1 . ARG A 1 61  ? -12.975 14.802 2.366   1.00 21.18 ? 89   ARG A NH1 1 
ATOM   476  N NH2 . ARG A 1 61  ? -10.898 13.974 1.838   1.00 20.52 ? 89   ARG A NH2 1 
ATOM   477  N N   . TYR A 1 62  ? -15.580 15.226 -3.201  1.00 12.22 ? 90   TYR A N   1 
ATOM   478  C CA  . TYR A 1 62  ? -15.914 16.554 -3.684  1.00 11.91 ? 90   TYR A CA  1 
ATOM   479  C C   . TYR A 1 62  ? -16.450 16.630 -5.113  1.00 11.32 ? 90   TYR A C   1 
ATOM   480  O O   . TYR A 1 62  ? -16.839 17.717 -5.533  1.00 10.77 ? 90   TYR A O   1 
ATOM   481  C CB  . TYR A 1 62  ? -14.706 17.488 -3.544  1.00 12.03 ? 90   TYR A CB  1 
ATOM   482  C CG  . TYR A 1 62  ? -14.304 17.735 -2.101  1.00 13.03 ? 90   TYR A CG  1 
ATOM   483  C CD1 . TYR A 1 62  ? -15.046 18.575 -1.280  1.00 14.22 ? 90   TYR A CD1 1 
ATOM   484  C CD2 . TYR A 1 62  ? -13.198 17.100 -1.548  1.00 13.47 ? 90   TYR A CD2 1 
ATOM   485  C CE1 . TYR A 1 62  ? -14.688 18.799 0.037   1.00 15.39 ? 90   TYR A CE1 1 
ATOM   486  C CE2 . TYR A 1 62  ? -12.840 17.310 -0.216  1.00 14.63 ? 90   TYR A CE2 1 
ATOM   487  C CZ  . TYR A 1 62  ? -13.599 18.167 0.554   1.00 15.41 ? 90   TYR A CZ  1 
ATOM   488  O OH  . TYR A 1 62  ? -13.350 18.440 1.884   1.00 17.52 ? 90   TYR A OH  1 
ATOM   489  N N   . ALA A 1 63  ? -16.488 15.531 -5.867  1.00 11.12 ? 91   ALA A N   1 
ATOM   490  C CA  . ALA A 1 63  ? -17.033 15.606 -7.225  1.00 11.09 ? 91   ALA A CA  1 
ATOM   491  C C   . ALA A 1 63  ? -18.438 16.179 -7.251  1.00 11.58 ? 91   ALA A C   1 
ATOM   492  O O   . ALA A 1 63  ? -18.776 16.931 -8.159  1.00 10.86 ? 91   ALA A O   1 
ATOM   493  C CB  . ALA A 1 63  ? -17.034 14.238 -7.870  1.00 11.46 ? 91   ALA A CB  1 
ATOM   494  N N   . GLU A 1 64  ? -19.253 15.852 -6.259  1.00 12.61 ? 92   GLU A N   1 
ATOM   495  C CA  . GLU A 1 64  ? -20.629 16.331 -6.253  1.00 13.98 ? 92   GLU A CA  1 
ATOM   496  C C   . GLU A 1 64  ? -20.745 17.817 -5.983  1.00 13.51 ? 92   GLU A C   1 
ATOM   497  O O   . GLU A 1 64  ? -21.800 18.382 -6.213  1.00 13.89 ? 92   GLU A O   1 
ATOM   498  C CB  . GLU A 1 64  ? -21.458 15.542 -5.253  1.00 16.01 ? 92   GLU A CB  1 
ATOM   499  C CG  . GLU A 1 64  ? -21.497 14.082 -5.648  1.00 17.98 ? 92   GLU A CG  1 
ATOM   500  C CD  . GLU A 1 64  ? -22.672 13.298 -5.126  1.00 20.31 ? 92   GLU A CD  1 
ATOM   501  O OE1 . GLU A 1 64  ? -22.561 12.047 -5.169  1.00 22.84 ? 92   GLU A OE1 1 
ATOM   502  O OE2 . GLU A 1 64  ? -23.688 13.894 -4.693  1.00 22.60 ? 92   GLU A OE2 1 
ATOM   503  N N   . ARG A 1 65  ? -19.671 18.441 -5.491  1.00 13.31 ? 93   ARG A N   1 
ATOM   504  C CA  . ARG A 1 65  ? -19.587 19.883 -5.308  1.00 13.96 ? 93   ARG A CA  1 
ATOM   505  C C   . ARG A 1 65  ? -18.940 20.560 -6.504  1.00 13.05 ? 93   ARG A C   1 
ATOM   506  O O   . ARG A 1 65  ? -18.856 21.779 -6.552  1.00 14.49 ? 93   ARG A O   1 
ATOM   507  C CB  . ARG A 1 65  ? -18.825 20.186 -4.003  1.00 15.34 ? 93   ARG A CB  1 
ATOM   508  C CG  . ARG A 1 65  ? -19.692 19.872 -2.796  1.00 17.42 ? 93   ARG A CG  1 
ATOM   509  C CD  . ARG A 1 65  ? -18.978 19.841 -1.462  1.00 19.03 ? 93   ARG A CD  1 
ATOM   510  N NE  . ARG A 1 65  ? -18.579 21.182 -1.065  1.00 20.37 ? 93   ARG A NE  1 
ATOM   511  C CZ  . ARG A 1 65  ? -17.969 21.483 0.083   1.00 21.40 ? 93   ARG A CZ  1 
ATOM   512  N NH1 . ARG A 1 65  ? -17.637 20.535 0.958   1.00 22.19 ? 93   ARG A NH1 1 
ATOM   513  N NH2 . ARG A 1 65  ? -17.668 22.754 0.332   1.00 22.00 ? 93   ARG A NH2 1 
ATOM   514  N N   . GLY A 1 66  ? -18.498 19.784 -7.483  1.00 11.82 ? 94   GLY A N   1 
ATOM   515  C CA  . GLY A 1 66  ? -17.914 20.344 -8.689  1.00 11.31 ? 94   GLY A CA  1 
ATOM   516  C C   . GLY A 1 66  ? -16.429 20.106 -8.876  1.00 10.54 ? 94   GLY A C   1 
ATOM   517  O O   . GLY A 1 66  ? -15.875 20.577 -9.873  1.00 11.46 ? 94   GLY A O   1 
ATOM   518  N N   . LEU A 1 67  ? -15.753 19.383 -7.976  1.00 9.95  ? 95   LEU A N   1 
ATOM   519  C CA  . LEU A 1 67  ? -14.317 19.131 -8.176  1.00 9.29  ? 95   LEU A CA  1 
ATOM   520  C C   . LEU A 1 67  ? -14.092 18.218 -9.363  1.00 8.78  ? 95   LEU A C   1 
ATOM   521  O O   . LEU A 1 67  ? -14.726 17.157 -9.456  1.00 8.88  ? 95   LEU A O   1 
ATOM   522  C CB  . LEU A 1 67  ? -13.691 18.520 -6.927  1.00 9.68  ? 95   LEU A CB  1 
ATOM   523  C CG  . LEU A 1 67  ? -12.184 18.278 -7.061  1.00 9.62  ? 95   LEU A CG  1 
ATOM   524  C CD1 . LEU A 1 67  ? -11.412 19.584 -7.141  1.00 9.91  ? 95   LEU A CD1 1 
ATOM   525  C CD2 . LEU A 1 67  ? -11.667 17.444 -5.915  1.00 9.91  ? 95   LEU A CD2 1 
ATOM   526  N N   . ARG A 1 68  ? -13.176 18.629 -10.236 1.00 8.16  ? 96   ARG A N   1 
ATOM   527  C CA  . ARG A 1 68  ? -12.705 17.796 -11.334 1.00 7.76  ? 96   ARG A CA  1 
ATOM   528  C C   . ARG A 1 68  ? -11.202 17.688 -11.241 1.00 7.48  ? 96   ARG A C   1 
ATOM   529  O O   . ARG A 1 68  ? -10.543 18.596 -10.731 1.00 7.71  ? 96   ARG A O   1 
ATOM   530  C CB  . ARG A 1 68  ? -13.156 18.399 -12.659 1.00 7.75  ? 96   ARG A CB  1 
ATOM   531  C CG  . ARG A 1 68  ? -14.670 18.528 -12.786 1.00 8.08  ? 96   ARG A CG  1 
ATOM   532  C CD  . ARG A 1 68  ? -15.398 17.195 -12.818 1.00 8.31  ? 96   ARG A CD  1 
ATOM   533  N NE  . ARG A 1 68  ? -16.849 17.322 -12.939 1.00 8.65  ? 96   ARG A NE  1 
ATOM   534  C CZ  . ARG A 1 68  ? -17.703 17.284 -11.923 1.00 9.02  ? 96   ARG A CZ  1 
ATOM   535  N NH1 . ARG A 1 68  ? -17.311 17.182 -10.664 1.00 9.10  ? 96   ARG A NH1 1 
ATOM   536  N NH2 . ARG A 1 68  ? -18.990 17.344 -12.190 1.00 9.61  ? 96   ARG A NH2 1 
ATOM   537  N N   . ILE A 1 69  ? -10.645 16.581 -11.729 1.00 7.50  ? 97   ILE A N   1 
ATOM   538  C CA  . ILE A 1 69  ? -9.204  16.363 -11.680 1.00 7.69  ? 97   ILE A CA  1 
ATOM   539  C C   . ILE A 1 69  ? -8.767  15.930 -13.065 1.00 7.49  ? 97   ILE A C   1 
ATOM   540  O O   . ILE A 1 69  ? -9.336  15.009 -13.662 1.00 8.08  ? 97   ILE A O   1 
ATOM   541  C CB  . ILE A 1 69  ? -8.805  15.320 -10.613 1.00 8.20  ? 97   ILE A CB  1 
ATOM   542  C CG1 . ILE A 1 69  ? -9.338  15.743 -9.227  1.00 8.69  ? 97   ILE A CG1 1 
ATOM   543  C CG2 . ILE A 1 69  ? -7.288  15.116 -10.600 1.00 8.34  ? 97   ILE A CG2 1 
ATOM   544  C CD1 . ILE A 1 69  ? -8.999  14.784 -8.084  1.00 9.34  ? 97   ILE A CD1 1 
ATOM   545  N N   . LEU A 1 70  ? -7.754  16.632 -13.570 1.00 7.25  ? 98   LEU A N   1 
ATOM   546  C CA  . LEU A 1 70  ? -7.140  16.376 -14.869 1.00 7.31  ? 98   LEU A CA  1 
ATOM   547  C C   . LEU A 1 70  ? -5.749  15.845 -14.619 1.00 7.09  ? 98   LEU A C   1 
ATOM   548  O O   . LEU A 1 70  ? -4.890  16.571 -14.120 1.00 7.57  ? 98   LEU A O   1 
ATOM   549  C CB  . LEU A 1 70  ? -7.038  17.626 -15.728 1.00 7.60  ? 98   LEU A CB  1 
ATOM   550  C CG  . LEU A 1 70  ? -8.304  18.321 -16.218 1.00 8.21  ? 98   LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 70  ? -9.084  19.041 -15.127 1.00 8.50  ? 98   LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 70  ? -7.902  19.312 -17.298 1.00 8.60  ? 98   LEU A CD2 1 
ATOM   553  N N   . ALA A 1 71  ? -5.490  14.582 -14.961 1.00 7.01  ? 99   ALA A N   1 
ATOM   554  C CA  . ALA A 1 71  ? -4.216  13.936 -14.713 1.00 7.02  ? 99   ALA A CA  1 
ATOM   555  C C   . ALA A 1 71  ? -3.483  13.732 -16.037 1.00 6.91  ? 99   ALA A C   1 
ATOM   556  O O   . ALA A 1 71  ? -3.958  13.027 -16.945 1.00 7.38  ? 99   ALA A O   1 
ATOM   557  C CB  . ALA A 1 71  ? -4.438  12.614 -14.007 1.00 7.46  ? 99   ALA A CB  1 
ATOM   558  N N   . PHE A 1 72  ? -2.307  14.351 -16.129 1.00 6.68  ? 100  PHE A N   1 
ATOM   559  C CA  . PHE A 1 72  ? -1.444  14.287 -17.308 1.00 6.92  ? 100  PHE A CA  1 
ATOM   560  C C   . PHE A 1 72  ? -0.223  13.439 -17.015 1.00 6.93  ? 100  PHE A C   1 
ATOM   561  O O   . PHE A 1 72  ? 0.652   13.881 -16.268 1.00 7.15  ? 100  PHE A O   1 
ATOM   562  C CB  . PHE A 1 72  ? -0.999  15.689 -17.709 1.00 7.01  ? 100  PHE A CB  1 
ATOM   563  C CG  . PHE A 1 72  ? -2.092  16.514 -18.327 1.00 7.20  ? 100  PHE A CG  1 
ATOM   564  C CD1 . PHE A 1 72  ? -2.929  17.314 -17.565 1.00 7.36  ? 100  PHE A CD1 1 
ATOM   565  C CD2 . PHE A 1 72  ? -2.280  16.479 -19.693 1.00 7.78  ? 100  PHE A CD2 1 
ATOM   566  C CE1 . PHE A 1 72  ? -3.939  18.070 -18.157 1.00 7.79  ? 100  PHE A CE1 1 
ATOM   567  C CE2 . PHE A 1 72  ? -3.275  17.229 -20.287 1.00 8.20  ? 100  PHE A CE2 1 
ATOM   568  C CZ  . PHE A 1 72  ? -4.109  18.020 -19.526 1.00 8.07  ? 100  PHE A CZ  1 
ATOM   569  N N   . PRO A 1 73  ? -0.134  12.234 -17.554 1.00 7.12  ? 101  PRO A N   1 
ATOM   570  C CA  . PRO A 1 73  ? 1.084   11.473 -17.366 1.00 7.50  ? 101  PRO A CA  1 
ATOM   571  C C   . PRO A 1 73  ? 2.267   12.168 -18.029 1.00 7.43  ? 101  PRO A C   1 
ATOM   572  O O   . PRO A 1 73  ? 2.099   12.823 -19.074 1.00 7.61  ? 101  PRO A O   1 
ATOM   573  C CB  . PRO A 1 73  ? 0.783   10.143 -18.077 1.00 7.76  ? 101  PRO A CB  1 
ATOM   574  C CG  . PRO A 1 73  ? -0.704  10.102 -18.235 1.00 7.92  ? 101  PRO A CG  1 
ATOM   575  C CD  . PRO A 1 73  ? -1.106  11.524 -18.390 1.00 7.55  ? 101  PRO A CD  1 
ATOM   576  N N   . SER A 1 74  ? 3.459   12.022 -17.459 1.00 7.85  ? 102  SER A N   1 
ATOM   577  C CA  . SER A 1 74  ? 4.669   12.521 -18.094 1.00 8.20  ? 102  SER A CA  1 
ATOM   578  C C   . SER A 1 74  ? 5.820   11.638 -17.688 1.00 8.30  ? 102  SER A C   1 
ATOM   579  O O   . SER A 1 74  ? 5.890   11.230 -16.532 1.00 8.66  ? 102  SER A O   1 
ATOM   580  C CB  . SER A 1 74  ? 4.951   13.966 -17.695 1.00 8.48  ? 102  SER A CB  1 
ATOM   581  O OG  . SER A 1 74  ? 6.087   14.467 -18.378 1.00 9.54  ? 102  SER A OG  1 
ATOM   582  N N   . ASN A 1 75  ? 6.714   11.369 -18.643 1.00 8.56  ? 103  ASN A N   1 
ATOM   583  C CA  . ASN A 1 75  ? 7.908   10.567 -18.415 1.00 8.96  ? 103  ASN A CA  1 
ATOM   584  C C   . ASN A 1 75  ? 9.158   11.417 -18.228 1.00 9.35  ? 103  ASN A C   1 
ATOM   585  O O   . ASN A 1 75  ? 10.262  10.873 -18.309 1.00 10.23 ? 103  ASN A O   1 
ATOM   586  C CB  . ASN A 1 75  ? 8.104   9.594  -19.582 1.00 9.36  ? 103  ASN A CB  1 
ATOM   587  C CG  . ASN A 1 75  ? 8.988   8.414  -19.237 1.00 9.81  ? 103  ASN A CG  1 
ATOM   588  O OD1 . ASN A 1 75  ? 8.963   7.921  -18.127 1.00 10.18 ? 103  ASN A OD1 1 
ATOM   589  N ND2 . ASN A 1 75  ? 9.733   7.926  -20.214 1.00 10.47 ? 103  ASN A ND2 1 
ATOM   590  N N   . GLN A 1 76  ? 9.004   12.719 -17.947 1.00 9.33  ? 104  GLN A N   1 
ATOM   591  C CA  . GLN A 1 76  ? 10.170  13.598 -17.862 1.00 9.91  ? 104  GLN A CA  1 
ATOM   592  C C   . GLN A 1 76  ? 10.935  13.531 -16.552 1.00 10.15 ? 104  GLN A C   1 
ATOM   593  O O   . GLN A 1 76  ? 11.993  14.176 -16.458 1.00 11.16 ? 104  GLN A O   1 
ATOM   594  C CB  . GLN A 1 76  ? 9.766   15.039 -18.125 1.00 10.14 ? 104  GLN A CB  1 
ATOM   595  C CG  . GLN A 1 76  ? 9.536   15.319 -19.581 1.00 10.59 ? 104  GLN A CG  1 
ATOM   596  C CD  . GLN A 1 76  ? 9.365   16.808 -19.835 1.00 10.62 ? 104  GLN A CD  1 
ATOM   597  O OE1 . GLN A 1 76  ? 8.443   17.429 -19.324 1.00 9.99  ? 104  GLN A OE1 1 
ATOM   598  N NE2 . GLN A 1 76  ? 10.244  17.390 -20.608 1.00 11.51 ? 104  GLN A NE2 1 
ATOM   599  N N   . PHE A 1 77  ? 10.455  12.804 -15.550 1.00 9.93  ? 105  PHE A N   1 
ATOM   600  C CA  . PHE A 1 77  ? 11.061  12.823 -14.218 1.00 10.27 ? 105  PHE A CA  1 
ATOM   601  C C   . PHE A 1 77  ? 11.458  11.418 -13.796 1.00 10.77 ? 105  PHE A C   1 
ATOM   602  O O   . PHE A 1 77  ? 10.650  10.641 -13.278 1.00 11.22 ? 105  PHE A O   1 
ATOM   603  C CB  . PHE A 1 77  ? 10.117  13.477 -13.231 1.00 9.98  ? 105  PHE A CB  1 
ATOM   604  C CG  . PHE A 1 77  ? 9.679   14.833 -13.674 1.00 9.61  ? 105  PHE A CG  1 
ATOM   605  C CD1 . PHE A 1 77  ? 10.548  15.922 -13.625 1.00 9.99  ? 105  PHE A CD1 1 
ATOM   606  C CD2 . PHE A 1 77  ? 8.425   15.018 -14.219 1.00 9.41  ? 105  PHE A CD2 1 
ATOM   607  C CE1 . PHE A 1 77  ? 10.149  17.158 -14.082 1.00 10.08 ? 105  PHE A CE1 1 
ATOM   608  C CE2 . PHE A 1 77  ? 8.035   16.262 -14.657 1.00 9.44  ? 105  PHE A CE2 1 
ATOM   609  C CZ  . PHE A 1 77  ? 8.906   17.320 -14.604 1.00 9.72  ? 105  PHE A CZ  1 
ATOM   610  N N   . GLY A 1 78  ? 12.729  11.110 -14.013 1.00 11.30 ? 106  GLY A N   1 
ATOM   611  C CA  . GLY A 1 78  ? 13.285  9.808  -13.673 1.00 11.85 ? 106  GLY A CA  1 
ATOM   612  C C   . GLY A 1 78  ? 12.785  8.659  -14.532 1.00 12.15 ? 106  GLY A C   1 
ATOM   613  O O   . GLY A 1 78  ? 12.877  7.498  -14.134 1.00 12.34 ? 106  GLY A O   1 
ATOM   614  N N   . LYS A 1 79  ? 12.230  8.970  -15.701 1.00 12.44 ? 107  LYS A N   1 
ATOM   615  C CA  . LYS A 1 79  ? 11.607  7.956  -16.553 1.00 13.01 ? 107  LYS A CA  1 
ATOM   616  C C   . LYS A 1 79  ? 10.625  7.104  -15.744 1.00 11.98 ? 107  LYS A C   1 
ATOM   617  O O   . LYS A 1 79  ? 10.598  5.879  -15.850 1.00 12.43 ? 107  LYS A O   1 
ATOM   618  C CB  . LYS A 1 79  ? 12.665  7.112  -17.262 1.00 15.25 ? 107  LYS A CB  1 
ATOM   619  C CG  . LYS A 1 79  ? 13.517  7.957  -18.175 1.00 16.98 ? 107  LYS A CG  1 
ATOM   620  C CD  . LYS A 1 79  ? 14.413  7.134  -19.067 1.00 18.89 ? 107  LYS A CD  1 
ATOM   621  C CE  . LYS A 1 79  ? 15.303  8.033  -19.909 1.00 20.34 ? 107  LYS A CE  1 
ATOM   622  N NZ  . LYS A 1 79  ? 14.556  9.069  -20.673 1.00 21.28 ? 107  LYS A NZ  1 
ATOM   623  N N   . GLN A 1 80  ? 9.791   7.774  -14.946 1.00 11.09 ? 108  GLN A N   1 
ATOM   624  C CA  . GLN A 1 80  ? 8.901   7.049  -14.057 1.00 10.86 ? 108  GLN A CA  1 
ATOM   625  C C   . GLN A 1 80  ? 7.510   6.823  -14.650 1.00 10.31 ? 108  GLN A C   1 
ATOM   626  O O   . GLN A 1 80  ? 6.613   6.325  -13.940 1.00 10.34 ? 108  GLN A O   1 
ATOM   627  C CB  . GLN A 1 80  ? 8.851   7.745  -12.702 1.00 11.07 ? 108  GLN A CB  1 
ATOM   628  C CG  . GLN A 1 80  ? 10.169  7.598  -11.961 1.00 12.08 ? 108  GLN A CG  1 
ATOM   629  C CD  . GLN A 1 80  ? 10.225  8.354  -10.659 1.00 12.78 ? 108  GLN A CD  1 
ATOM   630  O OE1 . GLN A 1 80  ? 9.367   9.178  -10.374 1.00 13.68 ? 108  GLN A OE1 1 
ATOM   631  N NE2 . GLN A 1 80  ? 11.246  8.093  -9.865  1.00 13.90 ? 108  GLN A NE2 1 
ATOM   632  N N   . GLU A 1 81  ? 7.333   7.157  -15.933 1.00 9.97  ? 109  GLU A N   1 
ATOM   633  C CA  . GLU A 1 81  ? 6.108   6.853  -16.648 1.00 9.90  ? 109  GLU A CA  1 
ATOM   634  C C   . GLU A 1 81  ? 6.462   6.303  -18.024 1.00 10.08 ? 109  GLU A C   1 
ATOM   635  O O   . GLU A 1 81  ? 6.147   6.904  -19.057 1.00 9.97  ? 109  GLU A O   1 
ATOM   636  C CB  . GLU A 1 81  ? 5.212   8.091  -16.765 1.00 9.86  ? 109  GLU A CB  1 
ATOM   637  C CG  . GLU A 1 81  ? 3.812   7.817  -17.277 1.00 10.19 ? 109  GLU A CG  1 
ATOM   638  C CD  . GLU A 1 81  ? 2.934   7.222  -16.216 1.00 10.48 ? 109  GLU A CD  1 
ATOM   639  O OE1 . GLU A 1 81  ? 3.220   6.077  -15.782 1.00 10.93 ? 109  GLU A OE1 1 
ATOM   640  O OE2 . GLU A 1 81  ? 1.987   7.908  -15.791 1.00 10.65 ? 109  GLU A OE2 1 
ATOM   641  N N   . PRO A 1 82  ? 7.128   5.143  -18.065 1.00 10.76 ? 110  PRO A N   1 
ATOM   642  C CA  . PRO A 1 82  ? 7.645   4.653  -19.342 1.00 11.42 ? 110  PRO A CA  1 
ATOM   643  C C   . PRO A 1 82  ? 6.611   3.980  -20.231 1.00 11.87 ? 110  PRO A C   1 
ATOM   644  O O   . PRO A 1 82  ? 6.906   3.727  -21.396 1.00 13.02 ? 110  PRO A O   1 
ATOM   645  C CB  . PRO A 1 82  ? 8.692   3.632  -18.902 1.00 11.96 ? 110  PRO A CB  1 
ATOM   646  C CG  . PRO A 1 82  ? 8.170   3.099  -17.614 1.00 11.83 ? 110  PRO A CG  1 
ATOM   647  C CD  . PRO A 1 82  ? 7.581   4.309  -16.935 1.00 11.10 ? 110  PRO A CD  1 
ATOM   648  N N   . GLY A 1 83  ? 5.441   3.664  -19.699 1.00 11.60 ? 111  GLY A N   1 
ATOM   649  C CA  . GLY A 1 83  ? 4.469   2.848  -20.409 1.00 11.82 ? 111  GLY A CA  1 
ATOM   650  C C   . GLY A 1 83  ? 3.693   3.567  -21.478 1.00 11.55 ? 111  GLY A C   1 
ATOM   651  O O   . GLY A 1 83  ? 3.736   4.799  -21.620 1.00 11.71 ? 111  GLY A O   1 
ATOM   652  N N   . SER A 1 84  ? 2.944   2.771  -22.236 1.00 11.52 ? 112  SER A N   1 
ATOM   653  C CA  . SER A 1 84  ? 2.033   3.320  -23.230 1.00 11.45 ? 112  SER A CA  1 
ATOM   654  C C   . SER A 1 84  ? 0.825   3.958  -22.545 1.00 10.67 ? 112  SER A C   1 
ATOM   655  O O   . SER A 1 84  ? 0.540   3.692  -21.370 1.00 10.35 ? 112  SER A O   1 
ATOM   656  C CB  . SER A 1 84  ? 1.514   2.205  -24.137 1.00 12.27 ? 112  SER A CB  1 
ATOM   657  O OG  . SER A 1 84  ? 0.712   1.314  -23.382 1.00 12.80 ? 112  SER A OG  1 
ATOM   658  N N   . ASN A 1 85  ? 0.072   4.755  -23.287 1.00 10.36 ? 113  ASN A N   1 
ATOM   659  C CA  . ASN A 1 85  ? -1.152  5.347  -22.747 1.00 10.21 ? 113  ASN A CA  1 
ATOM   660  C C   . ASN A 1 85  ? -2.124  4.277  -22.285 1.00 10.26 ? 113  ASN A C   1 
ATOM   661  O O   . ASN A 1 85  ? -2.746  4.430  -21.235 1.00 9.87  ? 113  ASN A O   1 
ATOM   662  C CB  . ASN A 1 85  ? -1.792  6.283  -23.764 1.00 10.47 ? 113  ASN A CB  1 
ATOM   663  C CG  . ASN A 1 85  ? -1.001  7.575  -23.914 1.00 10.62 ? 113  ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 85  ? -0.557  8.149  -22.930 1.00 11.10 ? 113  ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 85  ? -0.849  8.051  -25.135 1.00 11.67 ? 113  ASN A ND2 1 
ATOM   666  N N   . GLU A 1 86  ? -2.248  3.180  -23.027 1.00 10.93 ? 114  GLU A N   1 
ATOM   667  C CA  . GLU A 1 86  ? -3.107  2.099  -22.573 1.00 11.81 ? 114  GLU A CA  1 
ATOM   668  C C   . GLU A 1 86  ? -2.665  1.500  -21.249 1.00 11.36 ? 114  GLU A C   1 
ATOM   669  O O   . GLU A 1 86  ? -3.505  1.237  -20.376 1.00 11.15 ? 114  GLU A O   1 
ATOM   670  C CB  . GLU A 1 86  ? -3.179  1.018  -23.637 1.00 13.45 ? 114  GLU A CB  1 
ATOM   671  C CG  . GLU A 1 86  ? -3.950  -0.247 -23.243 1.00 15.13 ? 114  GLU A CG  1 
ATOM   672  C CD  . GLU A 1 86  ? -5.409  -0.020 -22.911 1.00 16.16 ? 114  GLU A CD  1 
ATOM   673  O OE1 . GLU A 1 86  ? -5.959  -0.797 -22.085 1.00 17.62 ? 114  GLU A OE1 1 
ATOM   674  O OE2 . GLU A 1 86  ? -6.020  0.876  -23.499 1.00 17.89 ? 114  GLU A OE2 1 
ATOM   675  N N   . GLU A 1 87  ? -1.358  1.279  -21.081 1.00 11.21 ? 115  GLU A N   1 
ATOM   676  C CA  . GLU A 1 87  ? -0.837  0.747  -19.841 1.00 11.50 ? 115  GLU A CA  1 
ATOM   677  C C   . GLU A 1 87  ? -1.086  1.705  -18.673 1.00 10.60 ? 115  GLU A C   1 
ATOM   678  O O   . GLU A 1 87  ? -1.431  1.280  -17.565 1.00 10.63 ? 115  GLU A O   1 
ATOM   679  C CB  . GLU A 1 87  ? 0.652   0.438  -19.968 1.00 12.29 ? 115  GLU A CB  1 
ATOM   680  C CG  . GLU A 1 87  ? 0.901   -0.794 -20.831 1.00 13.59 ? 115  GLU A CG  1 
ATOM   681  C CD  . GLU A 1 87  ? 2.328   -0.938 -21.353 1.00 14.59 ? 115  GLU A CD  1 
ATOM   682  O OE1 . GLU A 1 87  ? 3.126   0.022  -21.379 1.00 15.61 ? 115  GLU A OE1 1 
ATOM   683  O OE2 . GLU A 1 87  ? 2.661   -2.061 -21.780 1.00 16.49 ? 115  GLU A OE2 1 
ATOM   684  N N   . ILE A 1 88  ? -0.906  2.994  -18.930 1.00 10.00 ? 116  ILE A N   1 
ATOM   685  C CA  . ILE A 1 88  ? -1.126  3.997  -17.891 1.00 9.74  ? 116  ILE A CA  1 
ATOM   686  C C   . ILE A 1 88  ? -2.604  4.044  -17.503 1.00 9.80  ? 116  ILE A C   1 
ATOM   687  O O   . ILE A 1 88  ? -2.954  4.149  -16.321 1.00 9.96  ? 116  ILE A O   1 
ATOM   688  C CB  . ILE A 1 88  ? -0.619  5.382  -18.352 1.00 9.52  ? 116  ILE A CB  1 
ATOM   689  C CG1 . ILE A 1 88  ? 0.891   5.335  -18.601 1.00 9.84  ? 116  ILE A CG1 1 
ATOM   690  C CG2 . ILE A 1 88  ? -0.967  6.445  -17.327 1.00 9.28  ? 116  ILE A CG2 1 
ATOM   691  C CD1 . ILE A 1 88  ? 1.376   6.440  -19.497 1.00 9.96  ? 116  ILE A CD1 1 
ATOM   692  N N   . LYS A 1 89  ? -3.466  3.981  -18.515 1.00 9.96  ? 117  LYS A N   1 
ATOM   693  C CA  . LYS A 1 89  ? -4.909  3.942  -18.301 1.00 10.49 ? 117  LYS A CA  1 
ATOM   694  C C   . LYS A 1 89  ? -5.286  2.777  -17.386 1.00 10.65 ? 117  LYS A C   1 
ATOM   695  O O   . LYS A 1 89  ? -6.032  2.941  -16.406 1.00 10.59 ? 117  LYS A O   1 
ATOM   696  C CB  . LYS A 1 89  ? -5.641  3.822  -19.646 1.00 11.27 ? 117  LYS A CB  1 
ATOM   697  C CG  . LYS A 1 89  ? -7.168  3.781  -19.532 1.00 12.17 ? 117  LYS A CG  1 
ATOM   698  C CD  . LYS A 1 89  ? -7.827  3.558  -20.876 1.00 13.33 ? 117  LYS A CD  1 
ATOM   699  C CE  . LYS A 1 89  ? -9.339  3.519  -20.762 1.00 14.47 ? 117  LYS A CE  1 
ATOM   700  N NZ  . LYS A 1 89  ? -9.941  3.209  -22.079 1.00 15.48 ? 117  LYS A NZ  1 
ATOM   701  N N   . GLU A 1 90  ? -4.746  1.599  -17.678 1.00 11.15 ? 118  GLU A N   1 
ATOM   702  C CA  . GLU A 1 90  ? -5.033  0.431  -16.847 1.00 12.29 ? 118  GLU A CA  1 
ATOM   703  C C   . GLU A 1 90  ? -4.488  0.598  -15.442 1.00 11.81 ? 118  GLU A C   1 
ATOM   704  O O   . GLU A 1 90  ? -5.122  0.179  -14.475 1.00 11.91 ? 118  GLU A O   1 
ATOM   705  C CB  . GLU A 1 90  ? -4.455  -0.824 -17.489 1.00 13.88 ? 118  GLU A CB  1 
ATOM   706  C CG  . GLU A 1 90  ? -5.170  -1.196 -18.782 1.00 15.58 ? 118  GLU A CG  1 
ATOM   707  C CD  . GLU A 1 90  ? -4.759  -2.536 -19.354 1.00 18.20 ? 118  GLU A CD  1 
ATOM   708  O OE1 . GLU A 1 90  ? -4.181  -3.367 -18.633 1.00 20.51 ? 118  GLU A OE1 1 
ATOM   709  O OE2 . GLU A 1 90  ? -5.036  -2.790 -20.540 1.00 20.25 ? 118  GLU A OE2 1 
ATOM   710  N N   . PHE A 1 91  ? -3.302  1.178  -15.319 1.00 11.52 ? 119  PHE A N   1 
ATOM   711  C CA  . PHE A 1 91  ? -2.704  1.422  -14.001 1.00 11.70 ? 119  PHE A CA  1 
ATOM   712  C C   . PHE A 1 91  ? -3.607  2.312  -13.143 1.00 11.12 ? 119  PHE A C   1 
ATOM   713  O O   . PHE A 1 91  ? -3.937  1.990  -11.995 1.00 11.28 ? 119  PHE A O   1 
ATOM   714  C CB  . PHE A 1 91  ? -1.315  2.047  -14.157 1.00 11.94 ? 119  PHE A CB  1 
ATOM   715  C CG  . PHE A 1 91  ? -0.625  2.303  -12.853 1.00 12.52 ? 119  PHE A CG  1 
ATOM   716  C CD1 . PHE A 1 91  ? 0.078   1.296  -12.224 1.00 13.27 ? 119  PHE A CD1 1 
ATOM   717  C CD2 . PHE A 1 91  ? -0.728  3.519  -12.214 1.00 12.64 ? 119  PHE A CD2 1 
ATOM   718  C CE1 . PHE A 1 91  ? 0.686   1.498  -10.991 1.00 13.76 ? 119  PHE A CE1 1 
ATOM   719  C CE2 . PHE A 1 91  ? -0.107  3.733  -10.977 1.00 13.07 ? 119  PHE A CE2 1 
ATOM   720  C CZ  . PHE A 1 91  ? 0.586   2.716  -10.372 1.00 13.73 ? 119  PHE A CZ  1 
ATOM   721  N N   . ALA A 1 92  ? -4.021  3.427  -13.708 1.00 10.81 ? 120  ALA A N   1 
ATOM   722  C CA  . ALA A 1 92  ? -4.926  4.336  -12.998 1.00 10.62 ? 120  ALA A CA  1 
ATOM   723  C C   . ALA A 1 92  ? -6.249  3.680  -12.640 1.00 10.73 ? 120  ALA A C   1 
ATOM   724  O O   . ALA A 1 92  ? -6.763  3.856  -11.523 1.00 10.83 ? 120  ALA A O   1 
ATOM   725  C CB  . ALA A 1 92  ? -5.148  5.582  -13.826 1.00 10.45 ? 120  ALA A CB  1 
ATOM   726  N N   . ALA A 1 93  ? -6.790  2.893  -13.568 1.00 10.99 ? 121  ALA A N   1 
ATOM   727  C CA  . ALA A 1 93  ? -8.050  2.207  -13.303 1.00 11.36 ? 121  ALA A CA  1 
ATOM   728  C C   . ALA A 1 93  ? -7.941  1.297  -12.089 1.00 11.66 ? 121  ALA A C   1 
ATOM   729  O O   . ALA A 1 93  ? -8.912  1.113  -11.345 1.00 12.06 ? 121  ALA A O   1 
ATOM   730  C CB  . ALA A 1 93  ? -8.517  1.434  -14.523 1.00 11.97 ? 121  ALA A CB  1 
ATOM   731  N N   . GLY A 1 94  ? -6.763  0.720  -11.854 1.00 11.52 ? 122  GLY A N   1 
ATOM   732  C CA  . GLY A 1 94  ? -6.563  -0.137 -10.694 1.00 11.99 ? 122  GLY A CA  1 
ATOM   733  C C   . GLY A 1 94  ? -6.705  0.527  -9.342  1.00 12.01 ? 122  GLY A C   1 
ATOM   734  O O   . GLY A 1 94  ? -6.948  -0.152 -8.345  1.00 12.47 ? 122  GLY A O   1 
ATOM   735  N N   . TYR A 1 95  ? -6.557  1.855  -9.305  1.00 11.87 ? 123  TYR A N   1 
ATOM   736  C CA  . TYR A 1 95  ? -6.812  2.660  -8.112  1.00 12.59 ? 123  TYR A CA  1 
ATOM   737  C C   . TYR A 1 95  ? -8.250  3.186  -8.051  1.00 12.59 ? 123  TYR A C   1 
ATOM   738  O O   . TYR A 1 95  ? -8.563  4.033  -7.218  1.00 13.15 ? 123  TYR A O   1 
ATOM   739  C CB  . TYR A 1 95  ? -5.807  3.824  -8.054  1.00 13.03 ? 123  TYR A CB  1 
ATOM   740  C CG  . TYR A 1 95  ? -4.453  3.407  -7.547  1.00 14.30 ? 123  TYR A CG  1 
ATOM   741  C CD1 . TYR A 1 95  ? -4.294  3.035  -6.224  1.00 15.69 ? 123  TYR A CD1 1 
ATOM   742  C CD2 . TYR A 1 95  ? -3.322  3.384  -8.374  1.00 15.41 ? 123  TYR A CD2 1 
ATOM   743  C CE1 . TYR A 1 95  ? -3.071  2.639  -5.722  1.00 16.90 ? 123  TYR A CE1 1 
ATOM   744  C CE2 . TYR A 1 95  ? -2.075  3.010  -7.867  1.00 16.31 ? 123  TYR A CE2 1 
ATOM   745  C CZ  . TYR A 1 95  ? -1.967  2.640  -6.534  1.00 17.07 ? 123  TYR A CZ  1 
ATOM   746  O OH  . TYR A 1 95  ? -0.758  2.263  -5.985  1.00 19.34 ? 123  TYR A OH  1 
ATOM   747  N N   . ASN A 1 96  ? -9.127  2.709  -8.929  1.00 12.43 ? 124  ASN A N   1 
ATOM   748  C CA  . ASN A 1 96  ? -10.529 3.174  -9.015  1.00 12.78 ? 124  ASN A CA  1 
ATOM   749  C C   . ASN A 1 96  ? -10.588 4.660  -9.364  1.00 11.64 ? 124  ASN A C   1 
ATOM   750  O O   . ASN A 1 96  ? -11.471 5.391  -8.896  1.00 11.70 ? 124  ASN A O   1 
ATOM   751  C CB  . ASN A 1 96  ? -11.362 2.874  -7.742  1.00 14.41 ? 124  ASN A CB  1 
ATOM   752  C CG  . ASN A 1 96  ? -12.844 2.584  -8.058  1.00 16.11 ? 124  ASN A CG  1 
ATOM   753  O OD1 . ASN A 1 96  ? -13.241 2.476  -9.206  1.00 17.61 ? 124  ASN A OD1 1 
ATOM   754  N ND2 . ASN A 1 96  ? -13.646 2.401  -7.025  1.00 18.00 ? 124  ASN A ND2 1 
ATOM   755  N N   . VAL A 1 97  ? -9.670  5.113  -10.213 1.00 10.72 ? 125  VAL A N   1 
ATOM   756  C CA  . VAL A 1 97  ? -9.721  6.491  -10.696 1.00 10.22 ? 125  VAL A CA  1 
ATOM   757  C C   . VAL A 1 97  ? -10.985 6.708  -11.507 1.00 10.29 ? 125  VAL A C   1 
ATOM   758  O O   . VAL A 1 97  ? -11.223 5.984  -12.484 1.00 11.09 ? 125  VAL A O   1 
ATOM   759  C CB  . VAL A 1 97  ? -8.464  6.803  -11.538 1.00 9.85  ? 125  VAL A CB  1 
ATOM   760  C CG1 . VAL A 1 97  ? -8.619  8.092  -12.334 1.00 9.58  ? 125  VAL A CG1 1 
ATOM   761  C CG2 . VAL A 1 97  ? -7.255  6.880  -10.618 1.00 9.72  ? 125  VAL A CG2 1 
ATOM   762  N N   . LYS A 1 98  ? -11.762 7.728  -11.144 1.00 10.47 ? 126  LYS A N   1 
ATOM   763  C CA  . LYS A 1 98  ? -12.952 8.120  -11.902 1.00 10.89 ? 126  LYS A CA  1 
ATOM   764  C C   . LYS A 1 98  ? -12.862 9.525  -12.459 1.00 10.35 ? 126  LYS A C   1 
ATOM   765  O O   . LYS A 1 98  ? -13.813 10.013 -13.074 1.00 11.13 ? 126  LYS A O   1 
ATOM   766  C CB  . LYS A 1 98  ? -14.203 7.964  -11.024 1.00 11.87 ? 126  LYS A CB  1 
ATOM   767  C CG  . LYS A 1 98  ? -14.407 6.551  -10.502 1.00 13.18 ? 126  LYS A CG  1 
ATOM   768  C CD  . LYS A 1 98  ? -15.625 6.422  -9.594  1.00 14.64 ? 126  LYS A CD  1 
ATOM   769  C CE  . LYS A 1 98  ? -15.754 5.043  -8.984  1.00 16.19 ? 126  LYS A CE  1 
ATOM   770  N NZ  . LYS A 1 98  ? -16.900 5.005  -8.049  1.00 18.01 ? 126  LYS A NZ  1 
ATOM   771  N N   . PHE A 1 99  ? -11.735 10.176 -12.237 1.00 9.70  ? 127  PHE A N   1 
ATOM   772  C CA  . PHE A 1 99  ? -11.452 11.486 -12.788 1.00 9.29  ? 127  PHE A CA  1 
ATOM   773  C C   . PHE A 1 99  ? -10.818 11.338 -14.164 1.00 9.04  ? 127  PHE A C   1 
ATOM   774  O O   . PHE A 1 99  ? -10.801 10.233 -14.717 1.00 9.92  ? 127  PHE A O   1 
ATOM   775  C CB  . PHE A 1 99  ? -10.659 12.354 -11.802 1.00 9.00  ? 127  PHE A CB  1 
ATOM   776  C CG  . PHE A 1 99  ? -9.394  11.736 -11.277 1.00 8.99  ? 127  PHE A CG  1 
ATOM   777  C CD1 . PHE A 1 99  ? -8.219  11.777 -12.010 1.00 8.84  ? 127  PHE A CD1 1 
ATOM   778  C CD2 . PHE A 1 99  ? -9.359  11.170 -10.015 1.00 9.37  ? 127  PHE A CD2 1 
ATOM   779  C CE1 . PHE A 1 99  ? -7.043  11.241 -11.515 1.00 8.92  ? 127  PHE A CE1 1 
ATOM   780  C CE2 . PHE A 1 99  ? -8.191  10.652 -9.504  1.00 9.30  ? 127  PHE A CE2 1 
ATOM   781  C CZ  . PHE A 1 99  ? -7.036  10.681 -10.249 1.00 9.03  ? 127  PHE A CZ  1 
ATOM   782  N N   . ASP A 1 100 ? -10.366 12.432 -14.753 1.00 8.88  ? 128  ASP A N   1 
ATOM   783  C CA  . ASP A 1 100 ? -10.042 12.434 -16.177 1.00 8.99  ? 128  ASP A CA  1 
ATOM   784  C C   . ASP A 1 100 ? -8.568  12.226 -16.429 1.00 8.49  ? 128  ASP A C   1 
ATOM   785  O O   . ASP A 1 100 ? -7.737  12.986 -15.945 1.00 8.89  ? 128  ASP A O   1 
ATOM   786  C CB  . ASP A 1 100 ? -10.542 13.750 -16.785 1.00 9.55  ? 128  ASP A CB  1 
ATOM   787  C CG  . ASP A 1 100 ? -12.051 13.891 -16.668 1.00 10.54 ? 128  ASP A CG  1 
ATOM   788  O OD1 . ASP A 1 100 ? -12.767 12.893 -16.876 1.00 11.98 ? 128  ASP A OD1 1 
ATOM   789  O OD2 . ASP A 1 100 ? -12.524 14.996 -16.302 1.00 11.52 ? 128  ASP A OD2 1 
ATOM   790  N N   . MET A 1 101 ? -8.264  11.188 -17.193 1.00 8.50  ? 129  MET A N   1 
ATOM   791  C CA  . MET A 1 101 ? -6.891  10.823 -17.561 1.00 8.62  ? 129  MET A CA  1 
ATOM   792  C C   . MET A 1 101 ? -6.616  11.275 -18.980 1.00 8.48  ? 129  MET A C   1 
ATOM   793  O O   . MET A 1 101 ? -7.431  11.077 -19.891 1.00 9.12  ? 129  MET A O   1 
ATOM   794  C CB  . MET A 1 101 ? -6.711  9.300  -17.479 1.00 9.37  ? 129  MET A CB  1 
ATOM   795  C CG  . MET A 1 101 ? -6.846  8.703  -16.114 1.00 10.00 ? 129  MET A CG  1 
ATOM   796  S SD  . MET A 1 101 ? -5.617  9.208  -14.909 1.00 10.58 ? 129  MET A SD  1 
ATOM   797  C CE  . MET A 1 101 ? -4.110  8.606  -15.667 1.00 11.02 ? 129  MET A CE  1 
ATOM   798  N N   . PHE A 1 102 ? -5.442  11.858 -19.170 1.00 7.91  ? 130  PHE A N   1 
ATOM   799  C CA  . PHE A 1 102 ? -5.008  12.384 -20.457 1.00 7.93  ? 130  PHE A CA  1 
ATOM   800  C C   . PHE A 1 102 ? -3.851  11.571 -20.996 1.00 8.10  ? 130  PHE A C   1 
ATOM   801  O O   . PHE A 1 102 ? -3.188  10.817 -20.269 1.00 8.31  ? 130  PHE A O   1 
ATOM   802  C CB  . PHE A 1 102 ? -4.686  13.878 -20.306 1.00 7.83  ? 130  PHE A CB  1 
ATOM   803  C CG  . PHE A 1 102 ? -5.925  14.696 -20.112 1.00 8.03  ? 130  PHE A CG  1 
ATOM   804  C CD1 . PHE A 1 102 ? -6.485  14.857 -18.849 1.00 8.13  ? 130  PHE A CD1 1 
ATOM   805  C CD2 . PHE A 1 102 ? -6.606  15.239 -21.201 1.00 8.54  ? 130  PHE A CD2 1 
ATOM   806  C CE1 . PHE A 1 102 ? -7.670  15.539 -18.686 1.00 8.70  ? 130  PHE A CE1 1 
ATOM   807  C CE2 . PHE A 1 102 ? -7.781  15.938 -21.013 1.00 9.11  ? 130  PHE A CE2 1 
ATOM   808  C CZ  . PHE A 1 102 ? -8.302  16.090 -19.763 1.00 8.99  ? 130  PHE A CZ  1 
ATOM   809  N N   . SER A 1 103 ? -3.602  11.715 -22.300 1.00 8.54  ? 131  SER A N   1 
ATOM   810  C CA  . SER A 1 103 ? -2.430  11.142 -22.939 1.00 9.29  ? 131  SER A CA  1 
ATOM   811  C C   . SER A 1 103 ? -1.148  11.759 -22.378 1.00 8.70  ? 131  SER A C   1 
ATOM   812  O O   . SER A 1 103 ? -1.117  12.928 -21.998 1.00 8.42  ? 131  SER A O   1 
ATOM   813  C CB  . SER A 1 103 ? -2.486  11.344 -24.443 1.00 10.64 ? 131  SER A CB  1 
ATOM   814  O OG  . SER A 1 103 ? -3.398  10.439 -25.038 1.00 12.34 ? 131  SER A OG  1 
ATOM   815  N N   . LYS A 1 104 ? -0.104  10.943 -22.346 1.00 8.79  ? 132  LYS A N   1 
ATOM   816  C CA  . LYS A 1 104 ? 1.198   11.370 -21.858 1.00 8.85  ? 132  LYS A CA  1 
ATOM   817  C C   . LYS A 1 104 ? 1.729   12.564 -22.648 1.00 8.72  ? 132  LYS A C   1 
ATOM   818  O O   . LYS A 1 104 ? 1.624   12.627 -23.873 1.00 9.15  ? 132  LYS A O   1 
ATOM   819  C CB  . LYS A 1 104 ? 2.182   10.214 -21.974 1.00 9.84  ? 132  LYS A CB  1 
ATOM   820  C CG  . LYS A 1 104 ? 3.523   10.424 -21.286 1.00 10.40 ? 132  LYS A CG  1 
ATOM   821  C CD  . LYS A 1 104 ? 4.584   9.417  -21.684 1.00 11.95 ? 132  LYS A CD  1 
ATOM   822  C CE  . LYS A 1 104 ? 4.183   7.989  -21.514 1.00 12.46 ? 132  LYS A CE  1 
ATOM   823  N NZ  . LYS A 1 104 ? 5.314   7.033  -21.698 1.00 12.21 ? 132  LYS A NZ  1 
ATOM   824  N N   . ILE A 1 105 ? 2.315   13.511 -21.917 1.00 8.26  ? 133  ILE A N   1 
ATOM   825  C CA  . ILE A 1 105 ? 2.832   14.759 -22.463 1.00 8.44  ? 133  ILE A CA  1 
ATOM   826  C C   . ILE A 1 105 ? 4.177   15.088 -21.819 1.00 8.41  ? 133  ILE A C   1 
ATOM   827  O O   . ILE A 1 105 ? 4.599   14.452 -20.839 1.00 8.91  ? 133  ILE A O   1 
ATOM   828  C CB  . ILE A 1 105 ? 1.885   15.940 -22.177 1.00 8.52  ? 133  ILE A CB  1 
ATOM   829  C CG1 . ILE A 1 105 ? 1.603   16.102 -20.675 1.00 8.48  ? 133  ILE A CG1 1 
ATOM   830  C CG2 . ILE A 1 105 ? 0.606   15.781 -22.968 1.00 8.96  ? 133  ILE A CG2 1 
ATOM   831  C CD1 . ILE A 1 105 ? 1.059   17.470 -20.310 1.00 8.51  ? 133  ILE A CD1 1 
ATOM   832  N N   . GLU A 1 106 ? 4.836   16.112 -22.357 1.00 8.64  ? 134  GLU A N   1 
ATOM   833  C CA  . GLU A 1 106 ? 5.906   16.808 -21.653 1.00 9.01  ? 134  GLU A CA  1 
ATOM   834  C C   . GLU A 1 106 ? 5.306   18.032 -20.965 1.00 8.33  ? 134  GLU A C   1 
ATOM   835  O O   . GLU A 1 106 ? 4.353   18.633 -21.451 1.00 8.22  ? 134  GLU A O   1 
ATOM   836  C CB  . GLU A 1 106 ? 6.996   17.209 -22.643 1.00 10.36 ? 134  GLU A CB  1 
ATOM   837  C CG  . GLU A 1 106 ? 7.695   15.960 -23.193 1.00 12.45 ? 134  GLU A CG  1 
ATOM   838  C CD  . GLU A 1 106 ? 8.887   16.170 -24.077 1.00 14.84 ? 134  GLU A CD  1 
ATOM   839  O OE1 . GLU A 1 106 ? 9.106   17.279 -24.557 1.00 17.14 ? 134  GLU A OE1 1 
ATOM   840  O OE2 . GLU A 1 106 ? 9.588   15.164 -24.285 1.00 18.56 ? 134  GLU A OE2 1 
ATOM   841  N N   . VAL A 1 107 ? 5.883   18.390 -19.826 1.00 8.19  ? 135  VAL A N   1 
ATOM   842  C CA  . VAL A 1 107 ? 5.461   19.533 -19.048 1.00 8.12  ? 135  VAL A CA  1 
ATOM   843  C C   . VAL A 1 107 ? 6.499   20.646 -18.958 1.00 8.24  ? 135  VAL A C   1 
ATOM   844  O O   . VAL A 1 107 ? 6.132   21.758 -18.591 1.00 8.23  ? 135  VAL A O   1 
ATOM   845  C CB  . VAL A 1 107 ? 4.998   19.112 -17.633 1.00 8.24  ? 135  VAL A CB  1 
ATOM   846  C CG1 . VAL A 1 107 ? 3.826   18.156 -17.712 1.00 8.55  ? 135  VAL A CG1 1 
ATOM   847  C CG2 . VAL A 1 107 ? 6.128   18.540 -16.789 1.00 8.49  ? 135  VAL A CG2 1 
ATOM   848  N N   . ASN A 1 108 ? 7.765   20.341 -19.280 1.00 8.33  ? 136  ASN A N   1 
ATOM   849  C CA  . ASN A 1 108 ? 8.823   21.332 -19.358 1.00 8.70  ? 136  ASN A CA  1 
ATOM   850  C C   . ASN A 1 108 ? 9.458   21.301 -20.745 1.00 9.16  ? 136  ASN A C   1 
ATOM   851  O O   . ASN A 1 108 ? 9.391   20.311 -21.444 1.00 9.73  ? 136  ASN A O   1 
ATOM   852  C CB  . ASN A 1 108 ? 9.936   21.068 -18.338 1.00 8.97  ? 136  ASN A CB  1 
ATOM   853  C CG  . ASN A 1 108 ? 9.481   21.231 -16.912 1.00 8.79  ? 136  ASN A CG  1 
ATOM   854  O OD1 . ASN A 1 108 ? 8.692   22.122 -16.579 1.00 8.92  ? 136  ASN A OD1 1 
ATOM   855  N ND2 . ASN A 1 108 ? 10.056  20.411 -16.030 1.00 8.92  ? 136  ASN A ND2 1 
ATOM   856  N N   . GLY A 1 109 ? 10.078  22.420 -21.080 1.00 9.78  ? 137  GLY A N   1 
ATOM   857  C CA  . GLY A 1 109 ? 10.768  22.579 -22.360 1.00 10.63 ? 137  GLY A CA  1 
ATOM   858  C C   . GLY A 1 109 ? 9.853   23.021 -23.482 1.00 10.97 ? 137  GLY A C   1 
ATOM   859  O O   . GLY A 1 109 ? 8.646   23.229 -23.328 1.00 10.61 ? 137  GLY A O   1 
ATOM   860  N N   . ASP A 1 110 ? 10.458  23.167 -24.654 1.00 12.21 ? 138  ASP A N   1 
ATOM   861  C CA  . ASP A 1 110 ? 9.771   23.742 -25.809 1.00 13.17 ? 138  ASP A CA  1 
ATOM   862  C C   . ASP A 1 110 ? 8.651   22.870 -26.351 1.00 12.53 ? 138  ASP A C   1 
ATOM   863  O O   . ASP A 1 110 ? 7.746   23.389 -27.016 1.00 12.75 ? 138  ASP A O   1 
ATOM   864  C CB  . ASP A 1 110 ? 10.782  24.016 -26.940 1.00 15.47 ? 138  ASP A CB  1 
ATOM   865  C CG  . ASP A 1 110 ? 11.864  25.052 -26.565 1.00 17.72 ? 138  ASP A CG  1 
ATOM   866  O OD1 . ASP A 1 110 ? 11.696  25.806 -25.588 1.00 20.47 ? 138  ASP A OD1 1 
ATOM   867  O OD2 . ASP A 1 110 ? 12.905  25.126 -27.263 1.00 20.80 ? 138  ASP A OD2 1 
ATOM   868  N N   . ASP A 1 111 ? 8.700   21.572 -26.086 1.00 12.23 ? 139  ASP A N   1 
ATOM   869  C CA  . ASP A 1 111 ? 7.648   20.651 -26.534 1.00 12.34 ? 139  ASP A CA  1 
ATOM   870  C C   . ASP A 1 111 ? 6.608   20.366 -25.455 1.00 10.79 ? 139  ASP A C   1 
ATOM   871  O O   . ASP A 1 111 ? 5.768   19.489 -25.630 1.00 10.82 ? 139  ASP A O   1 
ATOM   872  C CB  . ASP A 1 111 ? 8.267   19.344 -27.074 1.00 14.33 ? 139  ASP A CB  1 
ATOM   873  C CG  . ASP A 1 111 ? 8.998   19.536 -28.393 1.00 16.57 ? 139  ASP A CG  1 
ATOM   874  O OD1 . ASP A 1 111 ? 8.970   20.647 -28.960 1.00 19.09 ? 139  ASP A OD1 1 
ATOM   875  O OD2 . ASP A 1 111 ? 9.580   18.542 -28.873 1.00 19.86 ? 139  ASP A OD2 1 
ATOM   876  N N   . ALA A 1 112 ? 6.629   21.102 -24.348 1.00 9.80  ? 140  ALA A N   1 
ATOM   877  C CA  . ALA A 1 112 ? 5.602   20.952 -23.325 1.00 9.14  ? 140  ALA A CA  1 
ATOM   878  C C   . ALA A 1 112 ? 4.225   21.278 -23.880 1.00 8.71  ? 140  ALA A C   1 
ATOM   879  O O   . ALA A 1 112 ? 4.071   22.148 -24.754 1.00 9.12  ? 140  ALA A O   1 
ATOM   880  C CB  . ALA A 1 112 ? 5.900   21.859 -22.165 1.00 9.12  ? 140  ALA A CB  1 
ATOM   881  N N   . HIS A 1 113 ? 3.215   20.592 -23.362 1.00 8.15  ? 141  HIS A N   1 
ATOM   882  C CA  . HIS A 1 113 ? 1.846   20.892 -23.728 1.00 8.11  ? 141  HIS A CA  1 
ATOM   883  C C   . HIS A 1 113 ? 1.583   22.373 -23.399 1.00 7.93  ? 141  HIS A C   1 
ATOM   884  O O   . HIS A 1 113 ? 1.964   22.845 -22.328 1.00 7.72  ? 141  HIS A O   1 
ATOM   885  C CB  . HIS A 1 113 ? 0.885   19.981 -22.956 1.00 8.11  ? 141  HIS A CB  1 
ATOM   886  C CG  . HIS A 1 113 ? -0.528  20.132 -23.388 1.00 8.14  ? 141  HIS A CG  1 
ATOM   887  N ND1 . HIS A 1 113 ? -1.294  21.211 -23.018 1.00 8.47  ? 141  HIS A ND1 1 
ATOM   888  C CD2 . HIS A 1 113 ? -1.294  19.369 -24.203 1.00 8.56  ? 141  HIS A CD2 1 
ATOM   889  C CE1 . HIS A 1 113 ? -2.478  21.097 -23.586 1.00 8.45  ? 141  HIS A CE1 1 
ATOM   890  N NE2 . HIS A 1 113 ? -2.501  20.001 -24.320 1.00 8.72  ? 141  HIS A NE2 1 
ATOM   891  N N   . PRO A 1 114 ? 0.884   23.105 -24.284 1.00 8.06  ? 142  PRO A N   1 
ATOM   892  C CA  . PRO A 1 114 ? 0.714   24.541 -24.034 1.00 8.27  ? 142  PRO A CA  1 
ATOM   893  C C   . PRO A 1 114 ? -0.021  24.920 -22.751 1.00 7.86  ? 142  PRO A C   1 
ATOM   894  O O   . PRO A 1 114 ? 0.221   26.002 -22.221 1.00 7.90  ? 142  PRO A O   1 
ATOM   895  C CB  . PRO A 1 114 ? -0.024  25.049 -25.266 1.00 9.10  ? 142  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 114 ? -0.228  23.914 -26.149 1.00 9.68  ? 142  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 114 ? 0.369   22.682 -25.606 1.00 8.72  ? 142  PRO A CD  1 
ATOM   898  N N   . LEU A 1 115 ? -0.940  24.089 -22.288 1.00 7.69  ? 143  LEU A N   1 
ATOM   899  C CA  . LEU A 1 115 ? -1.576  24.357 -20.995 1.00 7.57  ? 143  LEU A CA  1 
ATOM   900  C C   . LEU A 1 115 ? -0.528  24.440 -19.893 1.00 7.40  ? 143  LEU A C   1 
ATOM   901  O O   . LEU A 1 115 ? -0.645  25.283 -19.004 1.00 7.43  ? 143  LEU A O   1 
ATOM   902  C CB  . LEU A 1 115 ? -2.591  23.284 -20.649 1.00 7.68  ? 143  LEU A CB  1 
ATOM   903  C CG  . LEU A 1 115 ? -3.210  23.395 -19.247 1.00 7.98  ? 143  LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 115 ? -4.031  24.653 -19.076 1.00 8.45  ? 143  LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 115 ? -4.049  22.179 -18.945 1.00 8.24  ? 143  LEU A CD2 1 
ATOM   906  N N   . TRP A 1 116 ? 0.432   23.523 -19.912 1.00 7.27  ? 144  TRP A N   1 
ATOM   907  C CA  . TRP A 1 116 ? 1.496   23.522 -18.896 1.00 7.60  ? 144  TRP A CA  1 
ATOM   908  C C   . TRP A 1 116 ? 2.425   24.720 -19.049 1.00 7.81  ? 144  TRP A C   1 
ATOM   909  O O   . TRP A 1 116 ? 2.807   25.340 -18.042 1.00 8.62  ? 144  TRP A O   1 
ATOM   910  C CB  . TRP A 1 116 ? 2.203   22.161 -18.936 1.00 7.45  ? 144  TRP A CB  1 
ATOM   911  C CG  . TRP A 1 116 ? 1.344   21.103 -18.303 1.00 7.45  ? 144  TRP A CG  1 
ATOM   912  C CD1 . TRP A 1 116 ? 0.261   20.471 -18.836 1.00 7.48  ? 144  TRP A CD1 1 
ATOM   913  C CD2 . TRP A 1 116 ? 1.423   20.675 -16.945 1.00 7.23  ? 144  TRP A CD2 1 
ATOM   914  N NE1 . TRP A 1 116 ? -0.315  19.653 -17.894 1.00 7.75  ? 144  TRP A NE1 1 
ATOM   915  C CE2 . TRP A 1 116 ? 0.390   19.755 -16.723 1.00 7.33  ? 144  TRP A CE2 1 
ATOM   916  C CE3 . TRP A 1 116 ? 2.297   20.970 -15.902 1.00 7.40  ? 144  TRP A CE3 1 
ATOM   917  C CZ2 . TRP A 1 116 ? 0.212   19.119 -15.487 1.00 7.44  ? 144  TRP A CZ2 1 
ATOM   918  C CZ3 . TRP A 1 116 ? 2.121   20.344 -14.665 1.00 7.60  ? 144  TRP A CZ3 1 
ATOM   919  C CH2 . TRP A 1 116 ? 1.077   19.444 -14.478 1.00 7.51  ? 144  TRP A CH2 1 
ATOM   920  N N   . LYS A 1 117 ? 2.759   25.092 -20.287 1.00 7.74  ? 145  LYS A N   1 
ATOM   921  C CA  . LYS A 1 117 ? 3.515   26.327 -20.499 1.00 8.08  ? 145  LYS A CA  1 
ATOM   922  C C   . LYS A 1 117 ? 2.788   27.498 -19.851 1.00 8.00  ? 145  LYS A C   1 
ATOM   923  O O   . LYS A 1 117 ? 3.373   28.346 -19.189 1.00 8.42  ? 145  LYS A O   1 
ATOM   924  C CB  . LYS A 1 117 ? 3.716   26.590 -21.984 1.00 8.40  ? 145  LYS A CB  1 
ATOM   925  C CG  . LYS A 1 117 ? 4.549   25.542 -22.702 1.00 8.85  ? 145  LYS A CG  1 
ATOM   926  C CD  . LYS A 1 117 ? 4.892   25.995 -24.106 1.00 9.60  ? 145  LYS A CD  1 
ATOM   927  C CE  . LYS A 1 117 ? 5.844   25.024 -24.807 1.00 10.07 ? 145  LYS A CE  1 
ATOM   928  N NZ  . LYS A 1 117 ? 6.157   25.526 -26.170 1.00 10.85 ? 145  LYS A NZ  1 
ATOM   929  N N   . TRP A 1 118 ? 1.477   27.555 -20.070 1.00 7.76  ? 146  TRP A N   1 
ATOM   930  C CA  . TRP A 1 118 ? 0.655   28.658 -19.574 1.00 8.09  ? 146  TRP A CA  1 
ATOM   931  C C   . TRP A 1 118 ? 0.523   28.647 -18.054 1.00 7.87  ? 146  TRP A C   1 
ATOM   932  O O   . TRP A 1 118 ? 0.662   29.688 -17.413 1.00 8.15  ? 146  TRP A O   1 
ATOM   933  C CB  . TRP A 1 118 ? -0.723  28.603 -20.244 1.00 8.31  ? 146  TRP A CB  1 
ATOM   934  C CG  . TRP A 1 118 ? -1.691  29.617 -19.795 1.00 8.68  ? 146  TRP A CG  1 
ATOM   935  C CD1 . TRP A 1 118 ? -1.820  30.891 -20.265 1.00 9.02  ? 146  TRP A CD1 1 
ATOM   936  C CD2 . TRP A 1 118 ? -2.696  29.461 -18.795 1.00 8.83  ? 146  TRP A CD2 1 
ATOM   937  N NE1 . TRP A 1 118 ? -2.846  31.528 -19.622 1.00 9.29  ? 146  TRP A NE1 1 
ATOM   938  C CE2 . TRP A 1 118 ? -3.402  30.668 -18.724 1.00 9.21  ? 146  TRP A CE2 1 
ATOM   939  C CE3 . TRP A 1 118 ? -3.084  28.405 -17.974 1.00 8.93  ? 146  TRP A CE3 1 
ATOM   940  C CZ2 . TRP A 1 118 ? -4.455  30.863 -17.831 1.00 9.65  ? 146  TRP A CZ2 1 
ATOM   941  C CZ3 . TRP A 1 118 ? -4.159  28.599 -17.114 1.00 9.46  ? 146  TRP A CZ3 1 
ATOM   942  C CH2 . TRP A 1 118 ? -4.808  29.818 -17.039 1.00 9.86  ? 146  TRP A CH2 1 
ATOM   943  N N   . MET A 1 119 ? 0.242   27.484 -17.467 1.00 7.69  ? 147  MET A N   1 
ATOM   944  C CA  . MET A 1 119 ? 0.017   27.455 -16.020 1.00 8.04  ? 147  MET A CA  1 
ATOM   945  C C   . MET A 1 119 ? 1.227   27.953 -15.266 1.00 8.45  ? 147  MET A C   1 
ATOM   946  O O   . MET A 1 119 ? 1.102   28.672 -14.271 1.00 8.89  ? 147  MET A O   1 
ATOM   947  C CB  . MET A 1 119 ? -0.338  26.050 -15.513 1.00 7.86  ? 147  MET A CB  1 
ATOM   948  C CG  . MET A 1 119 ? -1.719  25.552 -15.924 1.00 7.86  ? 147  MET A CG  1 
ATOM   949  S SD  . MET A 1 119 ? -2.207  24.003 -15.160 1.00 8.45  ? 147  MET A SD  1 
ATOM   950  C CE  . MET A 1 119 ? -0.891  22.917 -15.710 1.00 8.49  ? 147  MET A CE  1 
ATOM   951  N N   . LYS A 1 120 ? 2.415   27.575 -15.754 1.00 8.81  ? 148  LYS A N   1 
ATOM   952  C CA  . LYS A 1 120 ? 3.681   27.910 -15.104 1.00 9.66  ? 148  LYS A CA  1 
ATOM   953  C C   . LYS A 1 120 ? 3.986   29.389 -15.050 1.00 10.50 ? 148  LYS A C   1 
ATOM   954  O O   . LYS A 1 120 ? 4.789   29.801 -14.208 1.00 11.54 ? 148  LYS A O   1 
ATOM   955  C CB  . LYS A 1 120 ? 4.827   27.184 -15.814 1.00 9.94  ? 148  LYS A CB  1 
ATOM   956  C CG  . LYS A 1 120 ? 4.877   25.701 -15.529 1.00 10.09 ? 148  LYS A CG  1 
ATOM   957  C CD  . LYS A 1 120 ? 6.132   25.048 -16.104 1.00 10.41 ? 148  LYS A CD  1 
ATOM   958  C CE  . LYS A 1 120 ? 6.129   24.960 -17.613 1.00 10.62 ? 148  LYS A CE  1 
ATOM   959  N NZ  . LYS A 1 120 ? 7.421   24.393 -18.094 1.00 10.70 ? 148  LYS A NZ  1 
ATOM   960  N N   . ILE A 1 121 ? 3.409   30.192 -15.932 1.00 10.68 ? 149  ILE A N   1 
ATOM   961  C CA  . ILE A 1 121 ? 3.652   31.636 -15.916 1.00 11.63 ? 149  ILE A CA  1 
ATOM   962  C C   . ILE A 1 121 ? 2.499   32.427 -15.296 1.00 11.07 ? 149  ILE A C   1 
ATOM   963  O O   . ILE A 1 121 ? 2.555   33.675 -15.286 1.00 11.62 ? 149  ILE A O   1 
ATOM   964  C CB  . ILE A 1 121 ? 3.965   32.204 -17.328 1.00 12.74 ? 149  ILE A CB  1 
ATOM   965  C CG1 . ILE A 1 121 ? 2.767   32.119 -18.277 1.00 13.15 ? 149  ILE A CG1 1 
ATOM   966  C CG2 . ILE A 1 121 ? 5.174   31.509 -17.928 1.00 13.19 ? 149  ILE A CG2 1 
ATOM   967  C CD1 . ILE A 1 121 ? 2.838   33.033 -19.488 1.00 13.75 ? 149  ILE A CD1 1 
ATOM   968  N N   . GLN A 1 122 ? 1.459   31.760 -14.784 1.00 10.42 ? 150  GLN A N   1 
ATOM   969  C CA  . GLN A 1 122 ? 0.364   32.506 -14.154 1.00 10.80 ? 150  GLN A CA  1 
ATOM   970  C C   . GLN A 1 122 ? 0.808   33.064 -12.821 1.00 11.52 ? 150  GLN A C   1 
ATOM   971  O O   . GLN A 1 122 ? 1.650   32.477 -12.162 1.00 11.70 ? 150  GLN A O   1 
ATOM   972  C CB  . GLN A 1 122 ? -0.842  31.594 -13.977 1.00 10.36 ? 150  GLN A CB  1 
ATOM   973  C CG  . GLN A 1 122 ? -1.391  31.075 -15.293 1.00 10.27 ? 150  GLN A CG  1 
ATOM   974  C CD  . GLN A 1 122 ? -1.619  32.205 -16.252 1.00 10.59 ? 150  GLN A CD  1 
ATOM   975  O OE1 . GLN A 1 122 ? -2.462  33.063 -15.979 1.00 11.48 ? 150  GLN A OE1 1 
ATOM   976  N NE2 . GLN A 1 122 ? -0.867  32.255 -17.338 1.00 10.67 ? 150  GLN A NE2 1 
ATOM   977  N N   . PRO A 1 123 ? 0.225   34.186 -12.389 1.00 12.51 ? 151  PRO A N   1 
ATOM   978  C CA  . PRO A 1 123 ? 0.628   34.774 -11.116 1.00 13.46 ? 151  PRO A CA  1 
ATOM   979  C C   . PRO A 1 123 ? 0.657   33.810 -9.929  1.00 13.89 ? 151  PRO A C   1 
ATOM   980  O O   . PRO A 1 123 ? 1.573   33.872 -9.119  1.00 15.34 ? 151  PRO A O   1 
ATOM   981  C CB  . PRO A 1 123 ? -0.426  35.865 -10.896 1.00 13.97 ? 151  PRO A CB  1 
ATOM   982  C CG  . PRO A 1 123 ? -0.792  36.295 -12.265 1.00 13.70 ? 151  PRO A CG  1 
ATOM   983  C CD  . PRO A 1 123 ? -0.722  35.066 -13.107 1.00 12.88 ? 151  PRO A CD  1 
ATOM   984  N N   . LYS A 1 124 ? -0.325  32.912 -9.834  1.00 13.69 ? 152  LYS A N   1 
ATOM   985  C CA  . LYS A 1 124 ? -0.358  31.903 -8.746  1.00 14.16 ? 152  LYS A CA  1 
ATOM   986  C C   . LYS A 1 124 ? 0.173   30.548 -9.191  1.00 13.61 ? 152  LYS A C   1 
ATOM   987  O O   . LYS A 1 124 ? 0.151   29.583 -8.418  1.00 14.15 ? 152  LYS A O   1 
ATOM   988  C CB  . LYS A 1 124 ? -1.776  31.747 -8.204  1.00 14.83 ? 152  LYS A CB  1 
ATOM   989  C CG  . LYS A 1 124 ? -2.383  33.049 -7.690  1.00 16.41 ? 152  LYS A CG  1 
ATOM   990  C CD  . LYS A 1 124 ? -1.564  33.683 -6.572  1.00 18.36 ? 152  LYS A CD  1 
ATOM   991  C CE  . LYS A 1 124 ? -2.239  34.913 -5.996  1.00 20.26 ? 152  LYS A CE  1 
ATOM   992  N NZ  . LYS A 1 124 ? -1.531  35.433 -4.799  1.00 21.87 ? 152  LYS A NZ  1 
ATOM   993  N N   . GLY A 1 125 ? 0.641   30.439 -10.439 1.00 13.45 ? 153  GLY A N   1 
ATOM   994  C CA  . GLY A 1 125 ? 1.257   29.205 -10.952 1.00 13.64 ? 153  GLY A CA  1 
ATOM   995  C C   . GLY A 1 125 ? 2.769   29.214 -11.007 1.00 14.86 ? 153  GLY A C   1 
ATOM   996  O O   . GLY A 1 125 ? 3.399   28.167 -11.183 1.00 14.32 ? 153  GLY A O   1 
ATOM   997  N N   . LYS A 1 126 ? 3.353   30.409 -10.897 1.00 17.63 ? 154  LYS A N   1 
ATOM   998  C CA  . LYS A 1 126 ? 4.795   30.556 -10.880 1.00 20.70 ? 154  LYS A CA  1 
ATOM   999  C C   . LYS A 1 126 ? 5.274   29.934 -9.586  1.00 22.34 ? 154  LYS A C   1 
ATOM   1000 O O   . LYS A 1 126 ? 4.614   30.039 -8.551  1.00 24.39 ? 154  LYS A O   1 
ATOM   1001 C CB  . LYS A 1 126 ? 5.203   32.031 -10.971 1.00 22.59 ? 154  LYS A CB  1 
ATOM   1002 C CG  . LYS A 1 126 ? 5.069   32.634 -12.359 1.00 23.64 ? 154  LYS A CG  1 
ATOM   1003 C CD  . LYS A 1 126 ? 5.512   34.101 -12.374 1.00 25.41 ? 154  LYS A CD  1 
ATOM   1004 C CE  . LYS A 1 126 ? 6.508   34.387 -13.491 1.00 26.41 ? 154  LYS A CE  1 
ATOM   1005 N NZ  . LYS A 1 126 ? 6.668   35.831 -13.822 1.00 27.51 ? 154  LYS A NZ  1 
ATOM   1006 N N   . GLY A 1 127 ? 6.424   29.282 -9.633  1.00 24.73 ? 155  GLY A N   1 
ATOM   1007 C CA  . GLY A 1 127 ? 6.908   28.584 -8.456  1.00 27.00 ? 155  GLY A CA  1 
ATOM   1008 C C   . GLY A 1 127 ? 7.474   29.579 -7.465  1.00 29.51 ? 155  GLY A C   1 
ATOM   1009 O O   . GLY A 1 127 ? 8.027   30.615 -7.849  1.00 31.38 ? 155  GLY A O   1 
ATOM   1010 N N   . ILE A 1 128 ? 7.318   29.261 -6.183  1.00 31.22 ? 156  ILE A N   1 
ATOM   1011 C CA  . ILE A 1 128 ? 8.017   29.963 -5.103  1.00 32.37 ? 156  ILE A CA  1 
ATOM   1012 C C   . ILE A 1 128 ? 9.515   29.856 -5.383  1.00 32.14 ? 156  ILE A C   1 
ATOM   1013 O O   . ILE A 1 128 ? 10.286  30.806 -5.183  1.00 34.36 ? 156  ILE A O   1 
ATOM   1014 C CB  . ILE A 1 128 ? 7.668   29.345 -3.712  1.00 33.57 ? 156  ILE A CB  1 
ATOM   1015 C CG1 . ILE A 1 128 ? 6.333   29.906 -3.184  1.00 34.00 ? 156  ILE A CG1 1 
ATOM   1016 C CG2 . ILE A 1 128 ? 8.756   29.602 -2.670  1.00 34.70 ? 156  ILE A CG2 1 
ATOM   1017 C CD1 . ILE A 1 128 ? 5.109   29.099 -3.555  1.00 33.59 ? 156  ILE A CD1 1 
ATOM   1018 N N   . LEU A 1 129 ? 9.886   28.667 -5.849  1.00 30.14 ? 157  LEU A N   1 
ATOM   1019 C CA  . LEU A 1 129 ? 11.232  28.302 -6.202  1.00 28.31 ? 157  LEU A CA  1 
ATOM   1020 C C   . LEU A 1 129 ? 11.346  28.032 -7.706  1.00 25.60 ? 157  LEU A C   1 
ATOM   1021 O O   . LEU A 1 129 ? 11.874  26.996 -8.112  1.00 24.50 ? 157  LEU A O   1 
ATOM   1022 C CB  . LEU A 1 129 ? 11.607  27.055 -5.391  1.00 29.50 ? 157  LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 129 ? 11.467  27.167 -3.868  1.00 30.29 ? 157  LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 129 ? 11.994  25.901 -3.217  1.00 30.62 ? 157  LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 129 ? 12.197  28.383 -3.315  1.00 31.34 ? 157  LEU A CD2 1 
ATOM   1026 N N   . GLY A 1 130 ? 10.876  28.980 -8.525  1.00 23.45 ? 158  GLY A N   1 
ATOM   1027 C CA  . GLY A 1 130 ? 11.026  28.931 -9.989  1.00 21.32 ? 158  GLY A CA  1 
ATOM   1028 C C   . GLY A 1 130 ? 9.899   28.191 -10.660 1.00 18.96 ? 158  GLY A C   1 
ATOM   1029 O O   . GLY A 1 130 ? 9.239   27.365 -10.041 1.00 19.63 ? 158  GLY A O   1 
ATOM   1030 N N   . ASN A 1 131 ? 9.674   28.470 -11.941 1.00 16.13 ? 159  ASN A N   1 
ATOM   1031 C CA  . ASN A 1 131 ? 8.455   27.993 -12.590 1.00 13.91 ? 159  ASN A CA  1 
ATOM   1032 C C   . ASN A 1 131 ? 8.483   26.554 -13.080 1.00 11.55 ? 159  ASN A C   1 
ATOM   1033 O O   . ASN A 1 131 ? 7.431   25.946 -13.210 1.00 10.18 ? 159  ASN A O   1 
ATOM   1034 C CB  . ASN A 1 131 ? 8.107   28.899 -13.766 1.00 15.35 ? 159  ASN A CB  1 
ATOM   1035 C CG  . ASN A 1 131 ? 7.866   30.325 -13.360 1.00 17.40 ? 159  ASN A CG  1 
ATOM   1036 O OD1 . ASN A 1 131 ? 7.708   30.642 -12.186 1.00 18.80 ? 159  ASN A OD1 1 
ATOM   1037 N ND2 . ASN A 1 131 ? 7.778   31.186 -14.350 1.00 18.87 ? 159  ASN A ND2 1 
ATOM   1038 N N   . ALA A 1 132 ? 9.655   26.001 -13.370 1.00 10.84 ? 160  ALA A N   1 
ATOM   1039 C CA  . ALA A 1 132 ? 9.715   24.685 -13.992 1.00 10.01 ? 160  ALA A CA  1 
ATOM   1040 C C   . ALA A 1 132 ? 9.040   23.659 -13.095 1.00 9.07  ? 160  ALA A C   1 
ATOM   1041 O O   . ALA A 1 132 ? 9.112   23.751 -11.867 1.00 9.26  ? 160  ALA A O   1 
ATOM   1042 C CB  . ALA A 1 132 ? 11.157  24.279 -14.266 1.00 10.52 ? 160  ALA A CB  1 
ATOM   1043 N N   . ILE A 1 133 ? 8.402   22.674 -13.696 1.00 8.29  ? 161  ILE A N   1 
ATOM   1044 C CA  . ILE A 1 133 ? 7.861   21.570 -12.919 1.00 8.10  ? 161  ILE A CA  1 
ATOM   1045 C C   . ILE A 1 133 ? 9.039   20.760 -12.392 1.00 8.24  ? 161  ILE A C   1 
ATOM   1046 O O   . ILE A 1 133 ? 9.901   20.333 -13.182 1.00 8.57  ? 161  ILE A O   1 
ATOM   1047 C CB  . ILE A 1 133 ? 6.929   20.691 -13.782 1.00 8.00  ? 161  ILE A CB  1 
ATOM   1048 C CG1 . ILE A 1 133 ? 5.814   21.515 -14.473 1.00 7.93  ? 161  ILE A CG1 1 
ATOM   1049 C CG2 . ILE A 1 133 ? 6.357   19.559 -12.941 1.00 7.90  ? 161  ILE A CG2 1 
ATOM   1050 C CD1 . ILE A 1 133 ? 5.030   22.441 -13.554 1.00 8.12  ? 161  ILE A CD1 1 
ATOM   1051 N N   . LYS A 1 134 ? 9.090   20.542 -11.080 1.00 8.35  ? 162  LYS A N   1 
ATOM   1052 C CA  . LYS A 1 134 ? 10.302  19.961 -10.482 1.00 8.91  ? 162  LYS A CA  1 
ATOM   1053 C C   . LYS A 1 134 ? 10.332  18.458 -10.458 1.00 8.71  ? 162  LYS A C   1 
ATOM   1054 O O   . LYS A 1 134 ? 11.412  17.866 -10.484 1.00 9.18  ? 162  LYS A O   1 
ATOM   1055 C CB  . LYS A 1 134 ? 10.501  20.504 -9.073  1.00 9.67  ? 162  LYS A CB  1 
ATOM   1056 C CG  . LYS A 1 134 ? 10.660  22.005 -8.997  1.00 10.38 ? 162  LYS A CG  1 
ATOM   1057 C CD  . LYS A 1 134 ? 11.729  22.561 -9.946  1.00 11.11 ? 162  LYS A CD  1 
ATOM   1058 C CE  . LYS A 1 134 ? 12.014  24.013 -9.664  1.00 11.92 ? 162  LYS A CE  1 
ATOM   1059 N NZ  . LYS A 1 134 ? 10.853  24.896 -9.862  1.00 11.83 ? 162  LYS A NZ  1 
ATOM   1060 N N   . TRP A 1 135 ? 9.156   17.822 -10.390 1.00 8.46  ? 163  TRP A N   1 
ATOM   1061 C CA  . TRP A 1 135 ? 9.088   16.372 -10.319 1.00 8.72  ? 163  TRP A CA  1 
ATOM   1062 C C   . TRP A 1 135 ? 7.643   15.972 -10.628 1.00 8.29  ? 163  TRP A C   1 
ATOM   1063 O O   . TRP A 1 135 ? 6.775   16.819 -10.879 1.00 8.19  ? 163  TRP A O   1 
ATOM   1064 C CB  . TRP A 1 135 ? 9.560   15.826 -8.945  1.00 9.37  ? 163  TRP A CB  1 
ATOM   1065 C CG  . TRP A 1 135 ? 10.063  14.418 -9.021  1.00 9.84  ? 163  TRP A CG  1 
ATOM   1066 C CD1 . TRP A 1 135 ? 9.479   13.296 -8.486  1.00 10.27 ? 163  TRP A CD1 1 
ATOM   1067 C CD2 . TRP A 1 135 ? 11.245  13.966 -9.694  1.00 10.15 ? 163  TRP A CD2 1 
ATOM   1068 N NE1 . TRP A 1 135 ? 10.222  12.182 -8.794  1.00 10.68 ? 163  TRP A NE1 1 
ATOM   1069 C CE2 . TRP A 1 135 ? 11.310  12.565 -9.531  1.00 10.58 ? 163  TRP A CE2 1 
ATOM   1070 C CE3 . TRP A 1 135 ? 12.264  14.604 -10.408 1.00 10.29 ? 163  TRP A CE3 1 
ATOM   1071 C CZ2 . TRP A 1 135 ? 12.339  11.796 -10.084 1.00 10.97 ? 163  TRP A CZ2 1 
ATOM   1072 C CZ3 . TRP A 1 135 ? 13.285  13.842 -10.949 1.00 10.65 ? 163  TRP A CZ3 1 
ATOM   1073 C CH2 . TRP A 1 135 ? 13.309  12.449 -10.788 1.00 10.83 ? 163  TRP A CH2 1 
ATOM   1074 N N   . ASN A 1 136 ? 7.389   14.674 -10.603 1.00 8.34  ? 164  ASN A N   1 
ATOM   1075 C CA  . ASN A 1 136 ? 6.046   14.159 -10.726 1.00 8.29  ? 164  ASN A CA  1 
ATOM   1076 C C   . ASN A 1 136 ? 5.155   14.684 -9.601  1.00 8.20  ? 164  ASN A C   1 
ATOM   1077 O O   . ASN A 1 136 ? 5.611   14.999 -8.511  1.00 8.64  ? 164  ASN A O   1 
ATOM   1078 C CB  . ASN A 1 136 ? 6.034   12.637 -10.682 1.00 8.75  ? 164  ASN A CB  1 
ATOM   1079 C CG  . ASN A 1 136 ? 7.028   12.030 -11.647 1.00 9.09  ? 164  ASN A CG  1 
ATOM   1080 O OD1 . ASN A 1 136 ? 6.938   12.224 -12.846 1.00 8.81  ? 164  ASN A OD1 1 
ATOM   1081 N ND2 . ASN A 1 136 ? 8.010   11.335 -11.116 1.00 9.75  ? 164  ASN A ND2 1 
ATOM   1082 N N   . PHE A 1 137 ? 3.875   14.796 -9.913  1.00 7.96  ? 165  PHE A N   1 
ATOM   1083 C CA  . PHE A 1 137 ? 2.828   15.135 -8.936  1.00 8.20  ? 165  PHE A CA  1 
ATOM   1084 C C   . PHE A 1 137 ? 2.930   16.564 -8.442  1.00 7.99  ? 165  PHE A C   1 
ATOM   1085 O O   . PHE A 1 137 ? 2.675   16.847 -7.265  1.00 8.84  ? 165  PHE A O   1 
ATOM   1086 C CB  . PHE A 1 137 ? 2.726   14.107 -7.797  1.00 8.80  ? 165  PHE A CB  1 
ATOM   1087 C CG  . PHE A 1 137 ? 2.397   12.718 -8.294  1.00 9.10  ? 165  PHE A CG  1 
ATOM   1088 C CD1 . PHE A 1 137 ? 1.153   12.429 -8.792  1.00 8.96  ? 165  PHE A CD1 1 
ATOM   1089 C CD2 . PHE A 1 137 ? 3.350   11.723 -8.312  1.00 9.55  ? 165  PHE A CD2 1 
ATOM   1090 C CE1 . PHE A 1 137 ? 0.841   11.155 -9.244  1.00 9.30  ? 165  PHE A CE1 1 
ATOM   1091 C CE2 . PHE A 1 137 ? 3.041   10.458 -8.770  1.00 9.85  ? 165  PHE A CE2 1 
ATOM   1092 C CZ  . PHE A 1 137 ? 1.797   10.173 -9.242  1.00 9.70  ? 165  PHE A CZ  1 
ATOM   1093 N N   . THR A 1 138 ? 3.266   17.490 -9.336  1.00 7.78  ? 166  THR A N   1 
ATOM   1094 C CA  . THR A 1 138 ? 2.929   18.880 -9.083  1.00 7.89  ? 166  THR A CA  1 
ATOM   1095 C C   . THR A 1 138 ? 1.430   19.049 -9.305  1.00 7.66  ? 166  THR A C   1 
ATOM   1096 O O   . THR A 1 138 ? 0.860   18.363 -10.157 1.00 7.95  ? 166  THR A O   1 
ATOM   1097 C CB  . THR A 1 138 ? 3.777   19.790 -9.980  1.00 8.02  ? 166  THR A CB  1 
ATOM   1098 O OG1 . THR A 1 138 ? 5.149   19.524 -9.701  1.00 8.62  ? 166  THR A OG1 1 
ATOM   1099 C CG2 . THR A 1 138 ? 3.502   21.233 -9.732  1.00 8.16  ? 166  THR A CG2 1 
ATOM   1100 N N   . LYS A 1 139 ? 0.784   19.930 -8.536  1.00 7.93  ? 167  LYS A N   1 
ATOM   1101 C CA  . LYS A 1 139 ? -0.656  20.141 -8.640  1.00 8.20  ? 167  LYS A CA  1 
ATOM   1102 C C   . LYS A 1 139 ? -0.937  21.612 -8.797  1.00 8.28  ? 167  LYS A C   1 
ATOM   1103 O O   . LYS A 1 139 ? -0.375  22.452 -8.058  1.00 9.01  ? 167  LYS A O   1 
ATOM   1104 C CB  . LYS A 1 139 ? -1.389  19.624 -7.408  1.00 9.04  ? 167  LYS A CB  1 
ATOM   1105 C CG  . LYS A 1 139 ? -1.165  18.162 -7.072  1.00 9.83  ? 167  LYS A CG  1 
ATOM   1106 C CD  . LYS A 1 139 ? -0.107  17.971 -5.985  1.00 10.77 ? 167  LYS A CD  1 
ATOM   1107 C CE  . LYS A 1 139 ? 0.021   16.496 -5.644  1.00 11.30 ? 167  LYS A CE  1 
ATOM   1108 N NZ  . LYS A 1 139 ? 1.309   16.190 -5.001  1.00 11.45 ? 167  LYS A NZ  1 
ATOM   1109 N N   . PHE A 1 140 ? -1.826  21.954 -9.720  1.00 7.93  ? 168  PHE A N   1 
ATOM   1110 C CA  . PHE A 1 140 ? -2.354  23.305 -9.853  1.00 8.00  ? 168  PHE A CA  1 
ATOM   1111 C C   . PHE A 1 140 ? -3.837  23.296 -9.529  1.00 7.94  ? 168  PHE A C   1 
ATOM   1112 O O   . PHE A 1 140 ? -4.596  22.481 -10.065 1.00 8.57  ? 168  PHE A O   1 
ATOM   1113 C CB  . PHE A 1 140 ? -2.161  23.829 -11.272 1.00 7.98  ? 168  PHE A CB  1 
ATOM   1114 C CG  . PHE A 1 140 ? -0.726  24.056 -11.647 1.00 8.25  ? 168  PHE A CG  1 
ATOM   1115 C CD1 . PHE A 1 140 ? 0.045   23.018 -12.130 1.00 8.43  ? 168  PHE A CD1 1 
ATOM   1116 C CD2 . PHE A 1 140 ? -0.135  25.310 -11.512 1.00 8.60  ? 168  PHE A CD2 1 
ATOM   1117 C CE1 . PHE A 1 140 ? 1.381   23.253 -12.479 1.00 8.88  ? 168  PHE A CE1 1 
ATOM   1118 C CE2 . PHE A 1 140 ? 1.189   25.536 -11.858 1.00 8.92  ? 168  PHE A CE2 1 
ATOM   1119 C CZ  . PHE A 1 140 ? 1.934   24.501 -12.349 1.00 9.12  ? 168  PHE A CZ  1 
ATOM   1120 N N   . LEU A 1 141 ? -4.264  24.189 -8.654  1.00 8.02  ? 169  LEU A N   1 
ATOM   1121 C CA  . LEU A 1 141 ? -5.684  24.383 -8.380  1.00 8.18  ? 169  LEU A CA  1 
ATOM   1122 C C   . LEU A 1 141 ? -6.170  25.518 -9.266  1.00 8.19  ? 169  LEU A C   1 
ATOM   1123 O O   . LEU A 1 141 ? -5.552  26.594 -9.303  1.00 8.35  ? 169  LEU A O   1 
ATOM   1124 C CB  . LEU A 1 141 ? -5.903  24.685 -6.902  1.00 8.78  ? 169  LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 141 ? -7.353  24.857 -6.439  1.00 9.31  ? 169  LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 141 ? -8.170  23.601 -6.669  1.00 9.39  ? 169  LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 141 ? -7.415  25.246 -4.978  1.00 10.02 ? 169  LEU A CD2 1 
ATOM   1128 N N   . ILE A 1 142 ? -7.277  25.248 -9.953  1.00 8.30  ? 170  ILE A N   1 
ATOM   1129 C CA  . ILE A 1 142 ? -7.860  26.120 -10.976 1.00 8.68  ? 170  ILE A CA  1 
ATOM   1130 C C   . ILE A 1 142 ? -9.273  26.440 -10.556 1.00 8.51  ? 170  ILE A C   1 
ATOM   1131 O O   . ILE A 1 142 ? -10.042 25.534 -10.227 1.00 8.64  ? 170  ILE A O   1 
ATOM   1132 C CB  . ILE A 1 142 ? -7.897  25.407 -12.357 1.00 9.47  ? 170  ILE A CB  1 
ATOM   1133 C CG1 . ILE A 1 142 ? -6.631  24.664 -12.696 1.00 10.84 ? 170  ILE A CG1 1 
ATOM   1134 C CG2 . ILE A 1 142 ? -8.384  26.362 -13.425 1.00 9.55  ? 170  ILE A CG2 1 
ATOM   1135 C CD1 . ILE A 1 142 ? -5.548  25.615 -12.820 1.00 11.35 ? 170  ILE A CD1 1 
ATOM   1136 N N   . ASP A 1 143 ? -9.641  27.724 -10.564 1.00 8.74  ? 171  ASP A N   1 
ATOM   1137 C CA  . ASP A 1 143 ? -10.985 28.097 -10.160 1.00 9.28  ? 171  ASP A CA  1 
ATOM   1138 C C   . ASP A 1 143 ? -12.005 27.831 -11.267 1.00 8.98  ? 171  ASP A C   1 
ATOM   1139 O O   . ASP A 1 143 ? -11.683 27.343 -12.349 1.00 8.73  ? 171  ASP A O   1 
ATOM   1140 C CB  . ASP A 1 143 ? -11.010 29.531 -9.609  1.00 10.01 ? 171  ASP A CB  1 
ATOM   1141 C CG  . ASP A 1 143 ? -10.922 30.611 -10.665 1.00 10.46 ? 171  ASP A CG  1 
ATOM   1142 O OD1 . ASP A 1 143 ? -11.062 30.351 -11.867 1.00 10.47 ? 171  ASP A OD1 1 
ATOM   1143 O OD2 . ASP A 1 143 ? -10.749 31.777 -10.231 1.00 12.02 ? 171  ASP A OD2 1 
ATOM   1144 N N   . LYS A 1 144 ? -13.262 28.146 -10.986 1.00 9.50  ? 172  LYS A N   1 
ATOM   1145 C CA  . LYS A 1 144 ? -14.344 27.814 -11.925 1.00 10.19 ? 172  LYS A CA  1 
ATOM   1146 C C   . LYS A 1 144 ? -14.254 28.581 -13.239 1.00 9.75  ? 172  LYS A C   1 
ATOM   1147 O O   . LYS A 1 144 ? -14.874 28.178 -14.225 1.00 9.77  ? 172  LYS A O   1 
ATOM   1148 C CB  . LYS A 1 144 ? -15.693 28.107 -11.286 1.00 11.97 ? 172  LYS A CB  1 
ATOM   1149 C CG  . LYS A 1 144 ? -15.985 27.282 -10.059 1.00 13.78 ? 172  LYS A CG  1 
ATOM   1150 C CD  . LYS A 1 144 ? -17.395 27.460 -9.577  1.00 15.78 ? 172  LYS A CD  1 
ATOM   1151 C CE  . LYS A 1 144 ? -17.538 28.749 -8.829  1.00 17.37 ? 172  LYS A CE  1 
ATOM   1152 N NZ  . LYS A 1 144 ? -18.937 28.868 -8.437  1.00 19.32 ? 172  LYS A NZ  1 
ATOM   1153 N N   . ASN A 1 145 ? -13.528 29.691 -13.241 1.00 9.63  ? 173  ASN A N   1 
ATOM   1154 C CA  . ASN A 1 145 ? -13.283 30.484 -14.445 1.00 10.08 ? 173  ASN A CA  1 
ATOM   1155 C C   . ASN A 1 145 ? -12.040 30.055 -15.199 1.00 9.53  ? 173  ASN A C   1 
ATOM   1156 O O   . ASN A 1 145 ? -11.706 30.642 -16.241 1.00 9.99  ? 173  ASN A O   1 
ATOM   1157 C CB  . ASN A 1 145 ? -13.167 31.960 -14.073 1.00 11.02 ? 173  ASN A CB  1 
ATOM   1158 C CG  . ASN A 1 145 ? -14.415 32.476 -13.400 1.00 12.06 ? 173  ASN A CG  1 
ATOM   1159 O OD1 . ASN A 1 145 ? -15.525 32.104 -13.764 1.00 13.19 ? 173  ASN A OD1 1 
ATOM   1160 N ND2 . ASN A 1 145 ? -14.235 33.325 -12.422 1.00 12.87 ? 173  ASN A ND2 1 
ATOM   1161 N N   . GLY A 1 146 ? -11.359 29.032 -14.716 1.00 9.05  ? 174  GLY A N   1 
ATOM   1162 C CA  . GLY A 1 146 ? -10.174 28.546 -15.375 1.00 8.90  ? 174  GLY A CA  1 
ATOM   1163 C C   . GLY A 1 146 ? -8.905  29.299 -15.024 1.00 8.82  ? 174  GLY A C   1 
ATOM   1164 O O   . GLY A 1 146 ? -7.903  29.147 -15.729 1.00 9.13  ? 174  GLY A O   1 
ATOM   1165 N N   . VAL A 1 147 ? -8.920  30.059 -13.936 1.00 9.08  ? 175  VAL A N   1 
ATOM   1166 C CA  . VAL A 1 147 ? -7.761  30.828 -13.484 1.00 9.37  ? 175  VAL A CA  1 
ATOM   1167 C C   . VAL A 1 147 ? -6.965  30.026 -12.450 1.00 9.03  ? 175  VAL A C   1 
ATOM   1168 O O   . VAL A 1 147 ? -7.551  29.416 -11.543 1.00 9.19  ? 175  VAL A O   1 
ATOM   1169 C CB  . VAL A 1 147 ? -8.263  32.154 -12.898 1.00 10.35 ? 175  VAL A CB  1 
ATOM   1170 C CG1 . VAL A 1 147 ? -7.144  32.972 -12.257 1.00 10.81 ? 175  VAL A CG1 1 
ATOM   1171 C CG2 . VAL A 1 147 ? -8.949  32.970 -13.982 1.00 11.08 ? 175  VAL A CG2 1 
ATOM   1172 N N   . VAL A 1 148 ? -5.633  30.000 -12.589 1.00 8.95  ? 176  VAL A N   1 
ATOM   1173 C CA  . VAL A 1 148 ? -4.810  29.314 -11.597 1.00 8.95  ? 176  VAL A CA  1 
ATOM   1174 C C   . VAL A 1 148 ? -4.862  30.089 -10.292 1.00 9.09  ? 176  VAL A C   1 
ATOM   1175 O O   . VAL A 1 148 ? -4.595  31.296 -10.270 1.00 9.74  ? 176  VAL A O   1 
ATOM   1176 C CB  . VAL A 1 148 ? -3.353  29.189 -12.058 1.00 9.23  ? 176  VAL A CB  1 
ATOM   1177 C CG1 . VAL A 1 148 ? -2.513  28.551 -10.958 1.00 9.38  ? 176  VAL A CG1 1 
ATOM   1178 C CG2 . VAL A 1 148 ? -3.256  28.369 -13.334 1.00 9.26  ? 176  VAL A CG2 1 
ATOM   1179 N N   . VAL A 1 149 ? -5.197  29.395 -9.212  1.00 9.04  ? 177  VAL A N   1 
ATOM   1180 C CA  . VAL A 1 149 ? -5.253  30.021 -7.896  1.00 9.64  ? 177  VAL A CA  1 
ATOM   1181 C C   . VAL A 1 149 ? -4.209  29.533 -6.923  1.00 9.72  ? 177  VAL A C   1 
ATOM   1182 O O   . VAL A 1 149 ? -3.905  30.261 -5.974  1.00 10.35 ? 177  VAL A O   1 
ATOM   1183 C CB  . VAL A 1 149 ? -6.680  29.976 -7.293  1.00 10.14 ? 177  VAL A CB  1 
ATOM   1184 C CG1 . VAL A 1 149 ? -7.616  30.799 -8.164  1.00 10.56 ? 177  VAL A CG1 1 
ATOM   1185 C CG2 . VAL A 1 149 ? -7.190  28.558 -7.131  1.00 10.10 ? 177  VAL A CG2 1 
ATOM   1186 N N   . LYS A 1 150 ? -3.631  28.343 -7.127  1.00 9.55  ? 178  LYS A N   1 
ATOM   1187 C CA  . LYS A 1 150 ? -2.579  27.884 -6.244  1.00 10.05 ? 178  LYS A CA  1 
ATOM   1188 C C   . LYS A 1 150 ? -1.809  26.766 -6.906  1.00 9.35  ? 178  LYS A C   1 
ATOM   1189 O O   . LYS A 1 150 ? -2.349  26.052 -7.753  1.00 9.29  ? 178  LYS A O   1 
ATOM   1190 C CB  . LYS A 1 150 ? -3.165  27.418 -4.900  1.00 11.04 ? 178  LYS A CB  1 
ATOM   1191 C CG  . LYS A 1 150 ? -2.109  27.312 -3.804  1.00 12.21 ? 178  LYS A CG  1 
ATOM   1192 C CD  . LYS A 1 150 ? -2.731  27.330 -2.419  1.00 13.62 ? 178  LYS A CD  1 
ATOM   1193 C CE  . LYS A 1 150 ? -1.771  26.906 -1.326  1.00 14.78 ? 178  LYS A CE  1 
ATOM   1194 N NZ  . LYS A 1 150 ? -2.403  27.051 0.007   1.00 15.91 ? 178  LYS A NZ  1 
ATOM   1195 N N   . ARG A 1 151 ? -0.545  26.610 -6.498  1.00 9.25  ? 179  ARG A N   1 
ATOM   1196 C CA  . ARG A 1 151 ? 0.339   25.541 -6.949  1.00 9.07  ? 179  ARG A CA  1 
ATOM   1197 C C   . ARG A 1 151 ? 0.879   24.815 -5.736  1.00 9.21  ? 179  ARG A C   1 
ATOM   1198 O O   . ARG A 1 151 ? 1.239   25.460 -4.743  1.00 10.39 ? 179  ARG A O   1 
ATOM   1199 C CB  . ARG A 1 151 ? 1.477   26.120 -7.782  1.00 9.39  ? 179  ARG A CB  1 
ATOM   1200 C CG  . ARG A 1 151 ? 2.501   25.099 -8.226  1.00 9.46  ? 179  ARG A CG  1 
ATOM   1201 C CD  . ARG A 1 151 ? 3.537   25.764 -9.093  1.00 9.77  ? 179  ARG A CD  1 
ATOM   1202 N NE  . ARG A 1 151 ? 4.668   24.901 -9.389  1.00 9.82  ? 179  ARG A NE  1 
ATOM   1203 C CZ  . ARG A 1 151 ? 5.520   25.104 -10.391 1.00 9.70  ? 179  ARG A CZ  1 
ATOM   1204 N NH1 . ARG A 1 151 ? 5.370   26.094 -11.257 1.00 9.81  ? 179  ARG A NH1 1 
ATOM   1205 N NH2 . ARG A 1 151 ? 6.527   24.268 -10.544 1.00 9.99  ? 179  ARG A NH2 1 
ATOM   1206 N N   . TYR A 1 152 ? 0.917   23.494 -5.824  1.00 8.99  ? 180  TYR A N   1 
ATOM   1207 C CA  . TYR A 1 152 ? 1.372   22.622 -4.738  1.00 9.63  ? 180  TYR A CA  1 
ATOM   1208 C C   . TYR A 1 152 ? 2.453   21.721 -5.323  1.00 9.67  ? 180  TYR A C   1 
ATOM   1209 O O   . TYR A 1 152 ? 2.274   21.121 -6.383  1.00 9.74  ? 180  TYR A O   1 
ATOM   1210 C CB  . TYR A 1 152 ? 0.246   21.743 -4.216  1.00 9.78  ? 180  TYR A CB  1 
ATOM   1211 C CG  . TYR A 1 152 ? -0.999  22.479 -3.796  1.00 10.19 ? 180  TYR A CG  1 
ATOM   1212 C CD1 . TYR A 1 152 ? -1.928  22.887 -4.736  1.00 10.13 ? 180  TYR A CD1 1 
ATOM   1213 C CD2 . TYR A 1 152 ? -1.267  22.761 -2.462  1.00 10.86 ? 180  TYR A CD2 1 
ATOM   1214 C CE1 . TYR A 1 152 ? -3.083  23.546 -4.373  1.00 10.70 ? 180  TYR A CE1 1 
ATOM   1215 C CE2 . TYR A 1 152 ? -2.440  23.427 -2.090  1.00 11.34 ? 180  TYR A CE2 1 
ATOM   1216 C CZ  . TYR A 1 152 ? -3.339  23.805 -3.059  1.00 11.28 ? 180  TYR A CZ  1 
ATOM   1217 O OH  . TYR A 1 152 ? -4.525  24.442 -2.753  1.00 12.56 ? 180  TYR A OH  1 
ATOM   1218 N N   . GLY A 1 153 ? 3.604   21.617 -4.661  1.00 10.59 ? 181  GLY A N   1 
ATOM   1219 C CA  . GLY A 1 153 ? 4.714   20.849 -5.187  1.00 11.11 ? 181  GLY A CA  1 
ATOM   1220 C C   . GLY A 1 153 ? 4.586   19.360 -4.972  1.00 11.61 ? 181  GLY A C   1 
ATOM   1221 O O   . GLY A 1 153 ? 3.680   18.866 -4.278  1.00 11.61 ? 181  GLY A O   1 
ATOM   1222 N N   . PRO A 1 154 ? 5.533   18.605 -5.556  1.00 12.26 ? 182  PRO A N   1 
ATOM   1223 C CA  . PRO A 1 154 ? 5.584   17.146 -5.447  1.00 13.51 ? 182  PRO A CA  1 
ATOM   1224 C C   . PRO A 1 154 ? 5.527   16.614 -4.030  1.00 15.83 ? 182  PRO A C   1 
ATOM   1225 O O   . PRO A 1 154 ? 4.986   15.524 -3.827  1.00 18.33 ? 182  PRO A O   1 
ATOM   1226 C CB  . PRO A 1 154 ? 6.943   16.795 -6.074  1.00 13.30 ? 182  PRO A CB  1 
ATOM   1227 C CG  . PRO A 1 154 ? 7.179   17.889 -7.051  1.00 13.18 ? 182  PRO A CG  1 
ATOM   1228 C CD  . PRO A 1 154 ? 6.601   19.120 -6.440  1.00 12.58 ? 182  PRO A CD  1 
ATOM   1229 N N   . MET A 1 155 ? 6.081   17.351 -3.077  1.00 17.27 ? 183  MET A N   1 
ATOM   1230 C CA  . MET A 1 155 ? 6.148   16.884 -1.690  1.00 19.47 ? 183  MET A CA  1 
ATOM   1231 C C   . MET A 1 155 ? 4.849   17.153 -0.914  1.00 18.68 ? 183  MET A C   1 
ATOM   1232 O O   . MET A 1 155 ? 4.697   16.692 0.222   1.00 20.41 ? 183  MET A O   1 
ATOM   1233 C CB  . MET A 1 155 ? 7.360   17.514 -0.983  1.00 22.23 ? 183  MET A CB  1 
ATOM   1234 C CG  . MET A 1 155 ? 8.694   17.305 -1.716  1.00 24.16 ? 183  MET A CG  1 
ATOM   1235 S SD  . MET A 1 155 ? 10.202  17.858 -0.883  1.00 28.99 ? 183  MET A SD  1 
ATOM   1236 C CE  . MET A 1 155 ? 9.952   19.630 -0.854  1.00 27.94 ? 183  MET A CE  1 
ATOM   1237 N N   . GLU A 1 156 ? 3.911   17.895 -1.507  1.00 16.75 ? 184  GLU A N   1 
ATOM   1238 C CA  . GLU A 1 156 ? 2.639   18.216 -0.852  1.00 16.57 ? 184  GLU A CA  1 
ATOM   1239 C C   . GLU A 1 156 ? 1.596   17.188 -1.259  1.00 15.30 ? 184  GLU A C   1 
ATOM   1240 O O   . GLU A 1 156 ? 1.146   17.155 -2.426  1.00 14.72 ? 184  GLU A O   1 
ATOM   1241 C CB  . GLU A 1 156 ? 2.193   19.628 -1.210  1.00 17.36 ? 184  GLU A CB  1 
ATOM   1242 C CG  . GLU A 1 156 ? 3.203   20.680 -0.778  1.00 19.06 ? 184  GLU A CG  1 
ATOM   1243 C CD  . GLU A 1 156 ? 2.729   22.081 -1.040  1.00 20.23 ? 184  GLU A CD  1 
ATOM   1244 O OE1 . GLU A 1 156 ? 1.814   22.521 -0.314  1.00 22.78 ? 184  GLU A OE1 1 
ATOM   1245 O OE2 . GLU A 1 156 ? 3.284   22.741 -1.946  1.00 21.52 ? 184  GLU A OE2 1 
ATOM   1246 N N   . GLU A 1 157 ? 1.194   16.344 -0.315  1.00 14.98 ? 185  GLU A N   1 
ATOM   1247 C CA  A GLU A 1 157 ? 0.239   15.276 -0.602  0.50 14.58 ? 185  GLU A CA  1 
ATOM   1248 C CA  B GLU A 1 157 ? 0.246   15.278 -0.612  0.50 14.62 ? 185  GLU A CA  1 
ATOM   1249 C C   . GLU A 1 157 ? -1.097  15.909 -1.035  1.00 13.54 ? 185  GLU A C   1 
ATOM   1250 O O   . GLU A 1 157 ? -1.453  17.006 -0.574  1.00 13.14 ? 185  GLU A O   1 
ATOM   1251 C CB  A GLU A 1 157 ? 0.052   14.361 0.617   0.50 15.70 ? 185  GLU A CB  1 
ATOM   1252 C CB  B GLU A 1 157 ? 0.088   14.342 0.591   0.50 15.80 ? 185  GLU A CB  1 
ATOM   1253 C CG  A GLU A 1 157 ? -0.737  14.984 1.760   0.50 16.49 ? 185  GLU A CG  1 
ATOM   1254 C CG  B GLU A 1 157 ? 1.363   13.588 0.951   0.50 16.55 ? 185  GLU A CG  1 
ATOM   1255 C CD  A GLU A 1 157 ? -0.988  14.040 2.916   0.50 17.38 ? 185  GLU A CD  1 
ATOM   1256 C CD  B GLU A 1 157 ? 1.188   12.600 2.091   0.50 17.46 ? 185  GLU A CD  1 
ATOM   1257 O OE1 A GLU A 1 157 ? -0.248  13.052 3.063   0.50 18.15 ? 185  GLU A OE1 1 
ATOM   1258 O OE1 B GLU A 1 157 ? 0.073   12.511 2.644   0.50 18.26 ? 185  GLU A OE1 1 
ATOM   1259 O OE2 A GLU A 1 157 ? -1.954  14.278 3.669   0.50 18.43 ? 185  GLU A OE2 1 
ATOM   1260 O OE2 B GLU A 1 157 ? 2.177   11.915 2.439   0.50 18.41 ? 185  GLU A OE2 1 
ATOM   1261 N N   . PRO A 1 158 ? -1.863  15.234 -1.915  1.00 12.19 ? 186  PRO A N   1 
ATOM   1262 C CA  . PRO A 1 158 ? -3.080  15.884 -2.404  1.00 11.81 ? 186  PRO A CA  1 
ATOM   1263 C C   . PRO A 1 158 ? -4.060  16.333 -1.341  1.00 11.99 ? 186  PRO A C   1 
ATOM   1264 O O   . PRO A 1 158 ? -4.751  17.327 -1.559  1.00 11.70 ? 186  PRO A O   1 
ATOM   1265 C CB  . PRO A 1 158 ? -3.701  14.826 -3.322  1.00 11.45 ? 186  PRO A CB  1 
ATOM   1266 C CG  . PRO A 1 158 ? -2.528  14.025 -3.802  1.00 11.47 ? 186  PRO A CG  1 
ATOM   1267 C CD  . PRO A 1 158 ? -1.582  13.980 -2.642  1.00 12.01 ? 186  PRO A CD  1 
ATOM   1268 N N   . LEU A 1 159 ? -4.138  15.641 -0.212  1.00 12.44 ? 187  LEU A N   1 
ATOM   1269 C CA  . LEU A 1 159 ? -5.097  16.060 0.808   1.00 13.43 ? 187  LEU A CA  1 
ATOM   1270 C C   . LEU A 1 159 ? -4.815  17.441 1.350   1.00 13.45 ? 187  LEU A C   1 
ATOM   1271 O O   . LEU A 1 159 ? -5.732  18.057 1.909   1.00 14.00 ? 187  LEU A O   1 
ATOM   1272 C CB  . LEU A 1 159 ? -5.199  15.062 1.964   1.00 14.59 ? 187  LEU A CB  1 
ATOM   1273 C CG  . LEU A 1 159 ? -5.911  13.758 1.608   1.00 15.31 ? 187  LEU A CG  1 
ATOM   1274 C CD1 . LEU A 1 159 ? -5.844  12.774 2.769   1.00 16.34 ? 187  LEU A CD1 1 
ATOM   1275 C CD2 . LEU A 1 159 ? -7.353  13.978 1.175   1.00 15.91 ? 187  LEU A CD2 1 
ATOM   1276 N N   . VAL A 1 160 ? -3.608  17.970 1.200   1.00 13.22 ? 188  VAL A N   1 
ATOM   1277 C CA  . VAL A 1 160 ? -3.399  19.351 1.648   1.00 14.05 ? 188  VAL A CA  1 
ATOM   1278 C C   . VAL A 1 160 ? -4.258  20.351 0.855   1.00 13.19 ? 188  VAL A C   1 
ATOM   1279 O O   . VAL A 1 160 ? -4.576  21.437 1.356   1.00 13.93 ? 188  VAL A O   1 
ATOM   1280 C CB  . VAL A 1 160 ? -1.920  19.799 1.621   1.00 15.04 ? 188  VAL A CB  1 
ATOM   1281 C CG1 . VAL A 1 160 ? -0.991  18.812 2.323   1.00 15.35 ? 188  VAL A CG1 1 
ATOM   1282 C CG2 . VAL A 1 160 ? -1.420  20.121 0.248   1.00 15.14 ? 188  VAL A CG2 1 
ATOM   1283 N N   . ILE A 1 161 ? -4.644  19.988 -0.371  1.00 12.03 ? 189  ILE A N   1 
ATOM   1284 C CA  . ILE A 1 161 ? -5.455  20.870 -1.217  1.00 11.63 ? 189  ILE A CA  1 
ATOM   1285 C C   . ILE A 1 161 ? -6.868  21.059 -0.632  1.00 12.21 ? 189  ILE A C   1 
ATOM   1286 O O   . ILE A 1 161 ? -7.515  22.069 -0.868  1.00 12.14 ? 189  ILE A O   1 
ATOM   1287 C CB  . ILE A 1 161 ? -5.533  20.307 -2.648  1.00 10.88 ? 189  ILE A CB  1 
ATOM   1288 C CG1 . ILE A 1 161 ? -4.117  20.123 -3.231  1.00 10.67 ? 189  ILE A CG1 1 
ATOM   1289 C CG2 . ILE A 1 161 ? -6.350  21.235 -3.550  1.00 10.83 ? 189  ILE A CG2 1 
ATOM   1290 C CD1 . ILE A 1 161 ? -4.090  19.400 -4.555  1.00 10.35 ? 189  ILE A CD1 1 
ATOM   1291 N N   . GLU A 1 162 ? -7.331  20.062 0.114   1.00 13.27 ? 190  GLU A N   1 
ATOM   1292 C CA  . GLU A 1 162 ? -8.650  20.101 0.710   1.00 14.93 ? 190  GLU A CA  1 
ATOM   1293 C C   . GLU A 1 162 ? -8.906  21.348 1.552   1.00 15.33 ? 190  GLU A C   1 
ATOM   1294 O O   . GLU A 1 162 ? -10.024 21.869 1.578   1.00 16.48 ? 190  GLU A O   1 
ATOM   1295 C CB  . GLU A 1 162 ? -8.855  18.835 1.527   1.00 16.47 ? 190  GLU A CB  1 
ATOM   1296 C CG  . GLU A 1 162 ? -10.269 18.665 2.025   1.00 17.80 ? 190  GLU A CG  1 
ATOM   1297 C CD  . GLU A 1 162 ? -10.557 17.295 2.583   1.00 18.97 ? 190  GLU A CD  1 
ATOM   1298 O OE1 . GLU A 1 162 ? -9.661  16.455 2.629   1.00 20.68 ? 190  GLU A OE1 1 
ATOM   1299 O OE2 . GLU A 1 162 ? -11.709 17.053 2.958   1.00 20.39 ? 190  GLU A OE2 1 
ATOM   1300 N N   . LYS A 1 163 ? -7.866  21.840 2.208   1.00 15.25 ? 191  LYS A N   1 
ATOM   1301 C CA  . LYS A 1 163 ? -7.961  23.050 3.037   1.00 16.40 ? 191  LYS A CA  1 
ATOM   1302 C C   . LYS A 1 163 ? -8.426  24.240 2.237   1.00 15.71 ? 191  LYS A C   1 
ATOM   1303 O O   . LYS A 1 163 ? -9.134  25.100 2.781   1.00 16.35 ? 191  LYS A O   1 
ATOM   1304 C CB  . LYS A 1 163 ? -6.591  23.387 3.655   1.00 17.86 ? 191  LYS A CB  1 
ATOM   1305 C CG  . LYS A 1 163 ? -5.984  22.341 4.574   1.00 19.47 ? 191  LYS A CG  1 
ATOM   1306 C CD  . LYS A 1 163 ? -4.506  22.648 4.817   1.00 20.93 ? 191  LYS A CD  1 
ATOM   1307 C CE  . LYS A 1 163 ? -3.976  21.967 6.059   1.00 22.52 ? 191  LYS A CE  1 
ATOM   1308 N NZ  . LYS A 1 163 ? -4.275  22.710 7.315   1.00 23.87 ? 191  LYS A NZ  1 
ATOM   1309 N N   . ASP A 1 164 ? -8.021  24.305 0.963   1.00 14.69 ? 192  ASP A N   1 
ATOM   1310 C CA  . ASP A 1 164 ? -8.306  25.447 0.105   1.00 14.77 ? 192  ASP A CA  1 
ATOM   1311 C C   . ASP A 1 164 ? -9.570  25.325 -0.732  1.00 14.60 ? 192  ASP A C   1 
ATOM   1312 O O   . ASP A 1 164 ? -10.118 26.344 -1.136  1.00 15.10 ? 192  ASP A O   1 
ATOM   1313 C CB  . ASP A 1 164 ? -7.101  25.707 -0.815  1.00 14.77 ? 192  ASP A CB  1 
ATOM   1314 C CG  . ASP A 1 164 ? -5.835  25.979 -0.036  1.00 15.57 ? 192  ASP A CG  1 
ATOM   1315 O OD1 . ASP A 1 164 ? -5.880  26.778 0.918   1.00 17.52 ? 192  ASP A OD1 1 
ATOM   1316 O OD2 . ASP A 1 164 ? -4.782  25.376 -0.357  1.00 16.00 ? 192  ASP A OD2 1 
ATOM   1317 N N   . LEU A 1 165 ? -10.042 24.106 -1.002  1.00 14.66 ? 193  LEU A N   1 
ATOM   1318 C CA  . LEU A 1 165 ? -11.162 23.908 -1.937  1.00 14.72 ? 193  LEU A CA  1 
ATOM   1319 C C   . LEU A 1 165 ? -12.416 24.714 -1.670  1.00 15.18 ? 193  LEU A C   1 
ATOM   1320 O O   . LEU A 1 165 ? -12.966 25.306 -2.604  1.00 14.87 ? 193  LEU A O   1 
ATOM   1321 C CB  . LEU A 1 165 ? -11.560 22.436 -2.052  1.00 14.95 ? 193  LEU A CB  1 
ATOM   1322 C CG  . LEU A 1 165 ? -10.554 21.514 -2.705  1.00 14.73 ? 193  LEU A CG  1 
ATOM   1323 C CD1 . LEU A 1 165 ? -11.105 20.097 -2.720  1.00 14.84 ? 193  LEU A CD1 1 
ATOM   1324 C CD2 . LEU A 1 165 ? -10.213 21.959 -4.120  1.00 14.36 ? 193  LEU A CD2 1 
ATOM   1325 N N   . PRO A 1 166 ? -12.902 24.751 -0.405  1.00 16.12 ? 194  PRO A N   1 
ATOM   1326 C CA  . PRO A 1 166 ? -14.169 25.449 -0.193  1.00 17.14 ? 194  PRO A CA  1 
ATOM   1327 C C   . PRO A 1 166 ? -14.114 26.933 -0.492  1.00 17.99 ? 194  PRO A C   1 
ATOM   1328 O O   . PRO A 1 166 ? -15.157 27.557 -0.724  1.00 19.42 ? 194  PRO A O   1 
ATOM   1329 C CB  . PRO A 1 166 ? -14.463 25.189 1.291   1.00 17.57 ? 194  PRO A CB  1 
ATOM   1330 C CG  . PRO A 1 166 ? -13.718 23.939 1.604   1.00 17.40 ? 194  PRO A CG  1 
ATOM   1331 C CD  . PRO A 1 166 ? -12.445 24.089 0.834   1.00 16.50 ? 194  PRO A CD  1 
ATOM   1332 N N   . HIS A 1 167 ? -12.922 27.511 -0.482  1.00 18.92 ? 195  HIS A N   1 
ATOM   1333 C CA  . HIS A 1 167 ? -12.773 28.902 -0.815  1.00 20.24 ? 195  HIS A CA  1 
ATOM   1334 C C   . HIS A 1 167 ? -13.134 29.155 -2.287  1.00 19.91 ? 195  HIS A C   1 
ATOM   1335 O O   . HIS A 1 167 ? -13.554 30.254 -2.646  1.00 21.62 ? 195  HIS A O   1 
ATOM   1336 C CB  . HIS A 1 167 ? -11.366 29.385 -0.474  1.00 21.27 ? 195  HIS A CB  1 
ATOM   1337 C CG  . HIS A 1 167 ? -11.185 30.857 -0.644  1.00 22.89 ? 195  HIS A CG  1 
ATOM   1338 N ND1 . HIS A 1 167 ? -11.935 31.781 0.049   1.00 24.18 ? 195  HIS A ND1 1 
ATOM   1339 C CD2 . HIS A 1 167 ? -10.365 31.567 -1.452  1.00 23.55 ? 195  HIS A CD2 1 
ATOM   1340 C CE1 . HIS A 1 167 ? -11.577 32.999 -0.319  1.00 24.74 ? 195  HIS A CE1 1 
ATOM   1341 N NE2 . HIS A 1 167 ? -10.625 32.895 -1.229  1.00 24.50 ? 195  HIS A NE2 1 
ATOM   1342 N N   . TYR A 1 168 ? -12.993 28.134 -3.140  1.00 18.71 ? 196  TYR A N   1 
ATOM   1343 C CA  . TYR A 1 168 ? -13.226 28.284 -4.581  1.00 18.38 ? 196  TYR A CA  1 
ATOM   1344 C C   . TYR A 1 168 ? -14.500 27.678 -5.104  1.00 18.78 ? 196  TYR A C   1 
ATOM   1345 O O   . TYR A 1 168 ? -14.934 28.030 -6.210  1.00 19.07 ? 196  TYR A O   1 
ATOM   1346 C CB  . TYR A 1 168 ? -12.023 27.747 -5.348  1.00 17.33 ? 196  TYR A CB  1 
ATOM   1347 C CG  . TYR A 1 168 ? -10.815 28.501 -4.954  1.00 17.89 ? 196  TYR A CG  1 
ATOM   1348 C CD1 . TYR A 1 168 ? -10.612 29.803 -5.422  1.00 18.07 ? 196  TYR A CD1 1 
ATOM   1349 C CD2 . TYR A 1 168 ? -9.914  27.982 -4.025  1.00 18.21 ? 196  TYR A CD2 1 
ATOM   1350 C CE1 . TYR A 1 168 ? -9.525  30.530 -5.022  1.00 18.83 ? 196  TYR A CE1 1 
ATOM   1351 C CE2 . TYR A 1 168 ? -8.824  28.706 -3.626  1.00 18.92 ? 196  TYR A CE2 1 
ATOM   1352 C CZ  . TYR A 1 168 ? -8.638  29.986 -4.126  1.00 19.23 ? 196  TYR A CZ  1 
ATOM   1353 O OH  . TYR A 1 168 ? -7.561  30.710 -3.720  1.00 20.95 ? 196  TYR A OH  1 
ATOM   1354 N N   . PHE A 1 169 ? -15.130 26.780 -4.354  1.00 19.95 ? 197  PHE A N   1 
ATOM   1355 C CA  . PHE A 1 169 ? -16.432 26.296 -4.772  1.00 21.10 ? 197  PHE A CA  1 
ATOM   1356 C C   . PHE A 1 169 ? -17.346 27.517 -4.858  1.00 22.81 ? 197  PHE A C   1 
ATOM   1357 O O   . PHE A 1 169 ? -18.055 27.726 -5.841  1.00 23.85 ? 197  PHE A O   1 
ATOM   1358 C CB  . PHE A 1 169 ? -16.983 25.204 -3.840  1.00 21.29 ? 197  PHE A CB  1 
ATOM   1359 C CG  . PHE A 1 169 ? -16.244 23.880 -3.929  1.00 20.62 ? 197  PHE A CG  1 
ATOM   1360 C CD1 . PHE A 1 169 ? -15.949 23.299 -5.166  1.00 20.28 ? 197  PHE A CD1 1 
ATOM   1361 C CD2 . PHE A 1 169 ? -15.892 23.189 -2.774  1.00 21.05 ? 197  PHE A CD2 1 
ATOM   1362 C CE1 . PHE A 1 169 ? -15.287 22.082 -5.240  1.00 19.87 ? 197  PHE A CE1 1 
ATOM   1363 C CE2 . PHE A 1 169 ? -15.227 21.974 -2.843  1.00 20.78 ? 197  PHE A CE2 1 
ATOM   1364 C CZ  . PHE A 1 169 ? -14.930 21.419 -4.076  1.00 20.42 ? 197  PHE A CZ  1 
ATOM   1365 O OXT . PHE A 1 169 ? -17.318 28.383 -3.985  1.00 25.13 ? 197  PHE A OXT 1 
HETATM 1366 C C   . ACE B 2 1   ? -13.097 32.080 -28.240 1.00 16.11 ? 900  ACE B C   1 
HETATM 1367 O O   . ACE B 2 1   ? -12.919 31.843 -29.434 1.00 18.50 ? 900  ACE B O   1 
HETATM 1368 C CH3 . ACE B 2 1   ? -14.479 32.290 -27.648 1.00 16.82 ? 900  ACE B CH3 1 
ATOM   1369 N N   . CYS B 2 2   ? -12.080 32.208 -27.395 1.00 14.09 ? 901  CYS B N   1 
ATOM   1370 C CA  . CYS B 2 2   ? -10.690 31.922 -27.871 1.00 13.23 ? 901  CYS B CA  1 
ATOM   1371 C C   . CYS B 2 2   ? -10.288 30.485 -27.558 1.00 11.95 ? 901  CYS B C   1 
ATOM   1372 O O   . CYS B 2 2   ? -10.647 29.917 -26.520 1.00 11.71 ? 901  CYS B O   1 
ATOM   1373 C CB  . CYS B 2 2   ? -9.676  32.900 -27.280 1.00 13.63 ? 901  CYS B CB  1 
ATOM   1374 S SG  . CYS B 2 2   ? -10.017 34.630 -27.588 1.00 14.88 ? 901  CYS B SG  1 
ATOM   1375 N N   . ARG B 2 3   ? -9.535  29.896 -28.481 1.00 11.61 ? 902  ARG B N   1 
ATOM   1376 C CA  . ARG B 2 3   ? -9.068  28.516 -28.399 1.00 11.79 ? 902  ARG B CA  1 
ATOM   1377 C C   . ARG B 2 3   ? -7.577  28.481 -28.635 1.00 10.91 ? 902  ARG B C   1 
ATOM   1378 O O   . ARG B 2 3   ? -7.093  29.124 -29.572 1.00 11.28 ? 902  ARG B O   1 
ATOM   1379 C CB  . ARG B 2 3   ? -9.702  27.671 -29.520 1.00 13.71 ? 902  ARG B CB  1 
ATOM   1380 C CG  . ARG B 2 3   ? -11.196 27.778 -29.703 1.00 15.59 ? 902  ARG B CG  1 
ATOM   1381 C CD  . ARG B 2 3   ? -11.884 27.266 -28.474 1.00 16.39 ? 902  ARG B CD  1 
ATOM   1382 N NE  . ARG B 2 3   ? -11.263 26.017 -28.054 1.00 17.38 ? 902  ARG B NE  1 
ATOM   1383 C CZ  . ARG B 2 3   ? -11.199 25.548 -26.813 1.00 17.74 ? 902  ARG B CZ  1 
ATOM   1384 N NH1 . ARG B 2 3   ? -10.550 24.411 -26.601 1.00 18.10 ? 902  ARG B NH1 1 
ATOM   1385 N NH2 . ARG B 2 3   ? -11.770 26.186 -25.791 1.00 17.78 ? 902  ARG B NH2 1 
ATOM   1386 N N   . VAL B 2 4   ? -6.869  27.684 -27.836 1.00 9.89  ? 903  VAL B N   1 
ATOM   1387 C CA  . VAL B 2 4   ? -5.461  27.395 -28.065 1.00 10.02 ? 903  VAL B CA  1 
ATOM   1388 C C   . VAL B 2 4   ? -5.381  25.948 -28.515 1.00 9.98  ? 903  VAL B C   1 
ATOM   1389 O O   . VAL B 2 4   ? -5.878  25.048 -27.845 1.00 10.16 ? 903  VAL B O   1 
ATOM   1390 C CB  . VAL B 2 4   ? -4.618  27.608 -26.788 1.00 9.58  ? 903  VAL B CB  1 
ATOM   1391 C CG1 . VAL B 2 4   ? -3.166  27.222 -27.047 1.00 9.58  ? 903  VAL B CG1 1 
ATOM   1392 C CG2 . VAL B 2 4   ? -4.708  29.063 -26.328 1.00 9.94  ? 903  VAL B CG2 1 
ATOM   1393 N N   . ASP B 2 5   ? -4.756  25.717 -29.661 1.00 10.49 ? 904  ASP B N   1 
ATOM   1394 C CA  . ASP B 2 5   ? -4.664  24.360 -30.201 1.00 11.08 ? 904  ASP B CA  1 
ATOM   1395 C C   . ASP B 2 5   ? -3.544  23.589 -29.526 1.00 11.12 ? 904  ASP B C   1 
ATOM   1396 O O   . ASP B 2 5   ? -2.838  24.089 -28.654 1.00 10.67 ? 904  ASP B O   1 
ATOM   1397 C CB  . ASP B 2 5   ? -4.563  24.368 -31.741 1.00 11.70 ? 904  ASP B CB  1 
ATOM   1398 C CG  . ASP B 2 5   ? -3.275  24.979 -32.276 1.00 12.10 ? 904  ASP B CG  1 
ATOM   1399 O OD1 . ASP B 2 5   ? -2.260  25.072 -31.573 1.00 11.75 ? 904  ASP B OD1 1 
ATOM   1400 O OD2 . ASP B 2 5   ? -3.262  25.354 -33.491 1.00 13.49 ? 904  ASP B OD2 1 
ATOM   1401 N N   . LEU B 2 6   ? -3.374  22.341 -29.940 1.00 12.04 ? 905  LEU B N   1 
ATOM   1402 C CA  . LEU B 2 6   ? -2.360  21.495 -29.342 1.00 12.75 ? 905  LEU B CA  1 
ATOM   1403 C C   . LEU B 2 6   ? -0.941  22.007 -29.506 1.00 12.57 ? 905  LEU B C   1 
ATOM   1404 O O   . LEU B 2 6   ? -0.059  21.695 -28.710 1.00 12.99 ? 905  LEU B O   1 
ATOM   1405 C CB  . LEU B 2 6   ? -2.437  20.090 -29.925 1.00 14.58 ? 905  LEU B CB  1 
ATOM   1406 C CG  . LEU B 2 6   ? -2.925  18.961 -29.072 1.00 16.36 ? 905  LEU B CG  1 
ATOM   1407 C CD1 . LEU B 2 6   ? -2.672  17.653 -29.789 1.00 17.11 ? 905  LEU B CD1 1 
ATOM   1408 C CD2 . LEU B 2 6   ? -2.219  18.943 -27.734 1.00 16.09 ? 905  LEU B CD2 1 
ATOM   1409 N N   . GLN B 2 7   ? -0.709  22.780 -30.569 1.00 12.71 ? 906  GLN B N   1 
ATOM   1410 C CA  . GLN B 2 7   ? 0.602   23.308 -30.856 1.00 13.30 ? 906  GLN B CA  1 
ATOM   1411 C C   . GLN B 2 7   ? 0.853   24.656 -30.214 1.00 13.10 ? 906  GLN B C   1 
ATOM   1412 O O   . GLN B 2 7   ? 1.948   25.173 -30.309 1.00 14.98 ? 906  GLN B O   1 
ATOM   1413 C CB  . GLN B 2 7   ? 0.807   23.401 -32.371 1.00 14.27 ? 906  GLN B CB  1 
ATOM   1414 C CG  . GLN B 2 7   ? 0.659   22.068 -33.101 1.00 15.12 ? 906  GLN B CG  1 
ATOM   1415 C CD  . GLN B 2 7   ? 1.512   20.978 -32.504 1.00 15.64 ? 906  GLN B CD  1 
ATOM   1416 O OE1 . GLN B 2 7   ? 2.659   21.217 -32.106 1.00 15.97 ? 906  GLN B OE1 1 
ATOM   1417 N NE2 . GLN B 2 7   ? 0.953   19.781 -32.406 1.00 16.39 ? 906  GLN B NE2 1 
ATOM   1418 N N   . GLY B 2 8   ? -0.163  25.235 -29.569 1.00 11.84 ? 907  GLY B N   1 
ATOM   1419 C CA  . GLY B 2 8   ? -0.010  26.476 -28.824 1.00 11.57 ? 907  GLY B CA  1 
ATOM   1420 C C   . GLY B 2 8   ? -0.441  27.738 -29.550 1.00 11.43 ? 907  GLY B C   1 
ATOM   1421 O O   . GLY B 2 8   ? -0.272  28.818 -29.014 1.00 11.94 ? 907  GLY B O   1 
ATOM   1422 N N   . TRP B 2 9   ? -0.994  27.616 -30.757 1.00 11.33 ? 908  TRP B N   1 
ATOM   1423 C CA  . TRP B 2 9   ? -1.506  28.788 -31.490 1.00 11.67 ? 908  TRP B CA  1 
ATOM   1424 C C   . TRP B 2 9   ? -2.905  29.128 -30.998 1.00 11.24 ? 908  TRP B C   1 
ATOM   1425 O O   . TRP B 2 9   ? -3.680  28.222 -30.684 1.00 11.35 ? 908  TRP B O   1 
ATOM   1426 C CB  . TRP B 2 9   ? -1.564  28.506 -32.997 1.00 12.54 ? 908  TRP B CB  1 
ATOM   1427 C CG  . TRP B 2 9   ? -0.234  28.202 -33.585 1.00 13.51 ? 908  TRP B CG  1 
ATOM   1428 C CD1 . TRP B 2 9   ? 0.285   26.984 -33.849 1.00 13.76 ? 908  TRP B CD1 1 
ATOM   1429 C CD2 . TRP B 2 9   ? 0.765   29.148 -33.943 1.00 14.81 ? 908  TRP B CD2 1 
ATOM   1430 N NE1 . TRP B 2 9   ? 1.549   27.100 -34.369 1.00 14.51 ? 908  TRP B NE1 1 
ATOM   1431 C CE2 . TRP B 2 9   ? 1.872   28.420 -34.433 1.00 15.34 ? 908  TRP B CE2 1 
ATOM   1432 C CE3 . TRP B 2 9   ? 0.844   30.547 -33.889 1.00 15.85 ? 908  TRP B CE3 1 
ATOM   1433 C CZ2 . TRP B 2 9   ? 3.039   29.040 -34.879 1.00 16.46 ? 908  TRP B CZ2 1 
ATOM   1434 C CZ3 . TRP B 2 9   ? 2.012   31.162 -34.317 1.00 16.77 ? 908  TRP B CZ3 1 
ATOM   1435 C CH2 . TRP B 2 9   ? 3.091   30.406 -34.822 1.00 16.96 ? 908  TRP B CH2 1 
ATOM   1436 N N   . ARG B 2 10  ? -3.232  30.420 -30.968 1.00 11.48 ? 909  ARG B N   1 
ATOM   1437 C CA  . ARG B 2 10  ? -4.497  30.895 -30.410 1.00 11.62 ? 909  ARG B CA  1 
ATOM   1438 C C   . ARG B 2 10  ? -5.339  31.564 -31.479 1.00 12.23 ? 909  ARG B C   1 
ATOM   1439 O O   . ARG B 2 10  ? -4.827  32.333 -32.284 1.00 13.10 ? 909  ARG B O   1 
ATOM   1440 C CB  . ARG B 2 10  ? -4.210  31.873 -29.281 1.00 11.53 ? 909  ARG B CB  1 
ATOM   1441 C CG  . ARG B 2 10  ? -5.432  32.339 -28.498 1.00 11.34 ? 909  ARG B CG  1 
ATOM   1442 C CD  . ARG B 2 10  ? -4.976  33.116 -27.279 1.00 11.42 ? 909  ARG B CD  1 
ATOM   1443 N NE  . ARG B 2 10  ? -6.045  33.462 -26.347 1.00 11.13 ? 909  ARG B NE  1 
ATOM   1444 C CZ  . ARG B 2 10  ? -6.618  34.654 -26.190 1.00 11.55 ? 909  ARG B CZ  1 
ATOM   1445 N NH1 . ARG B 2 10  ? -6.294  35.700 -26.952 1.00 12.45 ? 909  ARG B NH1 1 
ATOM   1446 N NH2 . ARG B 2 10  ? -7.518  34.799 -25.232 1.00 11.30 ? 909  ARG B NH2 1 
ATOM   1447 N N   . ARG B 2 11  ? -6.637  31.265 -31.492 1.00 12.51 ? 910  ARG B N   1 
ATOM   1448 C CA  . ARG B 2 11  ? -7.587  31.898 -32.408 1.00 14.03 ? 910  ARG B CA  1 
ATOM   1449 C C   . ARG B 2 11  ? -8.837  32.294 -31.640 1.00 13.62 ? 910  ARG B C   1 
ATOM   1450 O O   . ARG B 2 11  ? -9.322  31.558 -30.780 1.00 12.89 ? 910  ARG B O   1 
ATOM   1451 C CB  . ARG B 2 11  ? -7.989  30.939 -33.520 1.00 16.05 ? 910  ARG B CB  1 
ATOM   1452 C CG  . ARG B 2 11  ? -6.915  30.629 -34.564 1.00 18.52 ? 910  ARG B CG  1 
ATOM   1453 C CD  . ARG B 2 11  ? -7.136  29.232 -35.125 1.00 20.48 ? 910  ARG B CD  1 
ATOM   1454 N NE  . ARG B 2 11  ? -7.132  28.451 -33.923 1.00 22.24 ? 910  ARG B NE  1 
ATOM   1455 C CZ  . ARG B 2 11  ? -6.103  27.820 -33.383 1.00 22.77 ? 910  ARG B CZ  1 
ATOM   1456 N NH1 . ARG B 2 11  ? -4.949  27.611 -34.032 1.00 23.31 ? 910  ARG B NH1 1 
ATOM   1457 N NH2 . ARG B 2 11  ? -6.317  27.303 -32.192 1.00 22.65 ? 910  ARG B NH2 1 
ATOM   1458 N N   . CYS B 2 12  ? -9.366  33.468 -31.971 1.00 14.34 ? 911  CYS B N   1 
ATOM   1459 C CA  . CYS B 2 12  ? -10.534 34.034 -31.296 1.00 15.43 ? 911  CYS B CA  1 
ATOM   1460 C C   . CYS B 2 12  ? -11.639 34.276 -32.299 1.00 16.68 ? 911  CYS B C   1 
ATOM   1461 O O   . CYS B 2 12  ? -11.453 34.068 -33.510 1.00 17.16 ? 911  CYS B O   1 
ATOM   1462 C CB  . CYS B 2 12  ? -10.162 35.339 -30.595 1.00 15.81 ? 911  CYS B CB  1 
ATOM   1463 S SG  . CYS B 2 12  ? -8.946  35.168 -29.282 1.00 15.98 ? 911  CYS B SG  1 
ATOM   1464 N N   . ARG B 2 13  ? -12.788 34.735 -31.804 1.00 18.24 ? 912  ARG B N   1 
ATOM   1465 C CA  . ARG B 2 13  ? -13.934 35.061 -32.655 1.00 20.69 ? 912  ARG B CA  1 
ATOM   1466 C C   . ARG B 2 13  ? -13.596 36.247 -33.552 1.00 22.05 ? 912  ARG B C   1 
ATOM   1467 O O   . ARG B 2 13  ? -12.988 37.220 -33.103 1.00 22.53 ? 912  ARG B O   1 
ATOM   1468 C CB  . ARG B 2 13  ? -15.155 35.406 -31.804 1.00 21.76 ? 912  ARG B CB  1 
ATOM   1469 C CG  . ARG B 2 13  ? -15.649 34.270 -30.930 1.00 22.43 ? 912  ARG B CG  1 
ATOM   1470 C CD  . ARG B 2 13  ? -16.753 34.720 -29.984 1.00 23.72 ? 912  ARG B CD  1 
ATOM   1471 N NE  . ARG B 2 13  ? -18.060 34.760 -30.638 1.00 25.48 ? 912  ARG B NE  1 
ATOM   1472 C CZ  . ARG B 2 13  ? -19.218 35.034 -30.029 1.00 26.31 ? 912  ARG B CZ  1 
ATOM   1473 N NH1 . ARG B 2 13  ? -19.268 35.327 -28.729 1.00 26.57 ? 912  ARG B NH1 1 
ATOM   1474 N NH2 . ARG B 2 13  ? -20.347 35.023 -30.736 1.00 27.55 ? 912  ARG B NH2 1 
ATOM   1475 N N   . ARG B 2 14  ? -13.998 36.147 -34.822 1.00 24.16 ? 913  ARG B N   1 
ATOM   1476 C CA  . ARG B 2 14  ? -13.786 37.179 -35.839 1.00 26.07 ? 913  ARG B CA  1 
ATOM   1477 C C   . ARG B 2 14  ? -15.089 37.940 -36.124 1.00 26.77 ? 913  ARG B C   1 
ATOM   1478 O O   . ARG B 2 14  ? -16.138 37.631 -35.528 1.00 27.42 ? 913  ARG B O   1 
ATOM   1479 C CB  . ARG B 2 14  ? -13.280 36.530 -37.132 1.00 27.68 ? 913  ARG B CB  1 
ATOM   1480 C CG  . ARG B 2 14  ? -11.899 35.903 -37.035 1.00 28.50 ? 913  ARG B CG  1 
ATOM   1481 C CD  . ARG B 2 14  ? -11.456 35.354 -38.384 1.00 30.17 ? 913  ARG B CD  1 
ATOM   1482 N NE  . ARG B 2 14  ? -12.322 34.258 -38.843 1.00 31.47 ? 913  ARG B NE  1 
ATOM   1483 C CZ  . ARG B 2 14  ? -13.283 34.333 -39.772 1.00 32.46 ? 913  ARG B CZ  1 
ATOM   1484 N NH1 . ARG B 2 14  ? -13.560 35.466 -40.421 1.00 33.75 ? 913  ARG B NH1 1 
ATOM   1485 N NH2 . ARG B 2 14  ? -13.981 33.238 -40.068 1.00 32.95 ? 913  ARG B NH2 1 
HETATM 1486 N N   . NH2 B 2 15  ? -15.022 38.975 -36.966 1.00 27.22 ? 914  NH2 B N   1 
HETATM 1487 C C1  . GOL C 3 .   ? -19.984 17.667 -17.094 1.00 13.39 ? 201  GOL A C1  1 
HETATM 1488 O O1  . GOL C 3 .   ? -20.404 19.029 -17.029 1.00 12.42 ? 201  GOL A O1  1 
HETATM 1489 C C2  . GOL C 3 .   ? -18.822 17.400 -16.137 1.00 13.65 ? 201  GOL A C2  1 
HETATM 1490 O O2  . GOL C 3 .   ? -19.062 17.985 -14.856 1.00 13.65 ? 201  GOL A O2  1 
HETATM 1491 C C3  . GOL C 3 .   ? -17.524 17.957 -16.704 1.00 14.05 ? 201  GOL A C3  1 
HETATM 1492 O O3  . GOL C 3 .   ? -16.444 17.689 -15.795 1.00 14.51 ? 201  GOL A O3  1 
HETATM 1493 C C1  . GOL D 3 .   ? -12.107 32.734 -23.925 1.00 19.45 ? 202  GOL A C1  1 
HETATM 1494 O O1  . GOL D 3 .   ? -12.444 33.589 -25.003 1.00 20.49 ? 202  GOL A O1  1 
HETATM 1495 C C2  . GOL D 3 .   ? -11.468 33.538 -22.797 1.00 19.12 ? 202  GOL A C2  1 
HETATM 1496 O O2  . GOL D 3 .   ? -10.559 32.665 -22.142 1.00 16.40 ? 202  GOL A O2  1 
HETATM 1497 C C3  . GOL D 3 .   ? -12.525 34.029 -21.810 1.00 19.19 ? 202  GOL A C3  1 
HETATM 1498 O O3  . GOL D 3 .   ? -11.954 34.563 -20.609 1.00 20.31 ? 202  GOL A O3  1 
HETATM 1499 O O   . HOH E 4 .   ? -14.362 19.376 4.019   1.00 28.00 ? 301  HOH A O   1 
HETATM 1500 O O   . HOH E 4 .   ? 0.520   7.145  -13.610 1.00 12.21 ? 302  HOH A O   1 
HETATM 1501 O O   . HOH E 4 .   ? -22.173 26.070 -22.881 1.00 27.79 ? 303  HOH A O   1 
HETATM 1502 O O   . HOH E 4 .   ? -14.946 13.845 -12.620 1.00 16.16 ? 304  HOH A O   1 
HETATM 1503 O O   . HOH E 4 .   ? 1.451   1.476  -7.175  1.00 35.25 ? 305  HOH A O   1 
HETATM 1504 O O   . HOH E 4 .   ? -17.786 24.069 2.626   1.00 33.42 ? 306  HOH A O   1 
HETATM 1505 O O   . HOH E 4 .   ? -14.081 29.326 -8.361  1.00 15.85 ? 307  HOH A O   1 
HETATM 1506 O O   . HOH E 4 .   ? -11.164 36.856 -19.474 1.00 26.14 ? 308  HOH A O   1 
HETATM 1507 O O   . HOH E 4 .   ? -19.279 20.818 -18.675 1.00 14.89 ? 309  HOH A O   1 
HETATM 1508 O O   . HOH E 4 .   ? 0.393   -0.964 -24.757 1.00 27.11 ? 310  HOH A O   1 
HETATM 1509 O O   . HOH E 4 .   ? -9.914  5.014  -14.622 1.00 24.35 ? 311  HOH A O   1 
HETATM 1510 O O   . HOH E 4 .   ? 9.925   19.801 -24.113 1.00 13.44 ? 312  HOH A O   1 
HETATM 1511 O O   . HOH E 4 .   ? 8.016   -0.524 -16.447 1.00 17.91 ? 313  HOH A O   1 
HETATM 1512 O O   . HOH E 4 .   ? 4.578   1.832  -15.231 1.00 26.33 ? 314  HOH A O   1 
HETATM 1513 O O   . HOH E 4 .   ? -13.791 9.121  -7.308  1.00 18.01 ? 315  HOH A O   1 
HETATM 1514 O O   . HOH E 4 .   ? -15.240 15.344 -16.370 1.00 15.98 ? 316  HOH A O   1 
HETATM 1515 O O   . HOH E 4 .   ? -18.727 25.366 -6.970  1.00 24.71 ? 317  HOH A O   1 
HETATM 1516 O O   . HOH E 4 .   ? -12.002 30.391 -21.819 1.00 16.91 ? 318  HOH A O   1 
HETATM 1517 O O   . HOH E 4 .   ? -12.181 25.414 -14.384 1.00 11.60 ? 319  HOH A O   1 
HETATM 1518 O O   . HOH E 4 .   ? 14.138  6.776  -11.840 1.00 22.89 ? 320  HOH A O   1 
HETATM 1519 O O   . HOH E 4 .   ? -15.087 33.927 -24.470 1.00 18.51 ? 321  HOH A O   1 
HETATM 1520 O O   . HOH E 4 .   ? -2.731  9.859  -27.608 1.00 26.82 ? 322  HOH A O   1 
HETATM 1521 O O   . HOH E 4 .   ? 4.140   3.949  -17.208 1.00 13.30 ? 323  HOH A O   1 
HETATM 1522 O O   . HOH E 4 .   ? -2.881  33.073 -11.445 1.00 12.80 ? 324  HOH A O   1 
HETATM 1523 O O   . HOH E 4 .   ? 3.770   25.766 -27.487 1.00 22.90 ? 325  HOH A O   1 
HETATM 1524 O O   . HOH E 4 .   ? -5.115  38.117 -24.101 1.00 32.34 ? 326  HOH A O   1 
HETATM 1525 O O   . HOH E 4 .   ? -11.584 33.953 -11.695 1.00 18.65 ? 327  HOH A O   1 
HETATM 1526 O O   . HOH E 4 .   ? -14.629 11.703 -15.234 1.00 26.93 ? 328  HOH A O   1 
HETATM 1527 O O   . HOH E 4 .   ? -11.881 15.182 -19.919 1.00 18.39 ? 329  HOH A O   1 
HETATM 1528 O O   . HOH E 4 .   ? -11.482 1.264  -12.332 1.00 13.59 ? 330  HOH A O   1 
HETATM 1529 O O   . HOH E 4 .   ? 6.134   28.417 -19.385 1.00 14.83 ? 331  HOH A O   1 
HETATM 1530 O O   . HOH E 4 .   ? 9.399   4.299  -22.462 1.00 19.82 ? 332  HOH A O   1 
HETATM 1531 O O   . HOH E 4 .   ? -11.813 8.987  -8.669  1.00 18.52 ? 333  HOH A O   1 
HETATM 1532 O O   . HOH E 4 .   ? 4.837   13.495 -14.145 1.00 9.54  ? 334  HOH A O   1 
HETATM 1533 O O   . HOH E 4 .   ? 0.591   29.248 -5.695  1.00 15.89 ? 335  HOH A O   1 
HETATM 1534 O O   . HOH E 4 .   ? -0.160  13.295 -25.896 1.00 24.80 ? 336  HOH A O   1 
HETATM 1535 O O   . HOH E 4 .   ? 12.072  3.646  -16.602 1.00 22.80 ? 337  HOH A O   1 
HETATM 1536 O O   . HOH E 4 .   ? -7.684  5.179  -16.305 1.00 22.22 ? 338  HOH A O   1 
HETATM 1537 O O   . HOH E 4 .   ? -7.614  4.212  -4.607  1.00 22.26 ? 339  HOH A O   1 
HETATM 1538 O O   . HOH E 4 .   ? 8.258   10.917 -15.089 1.00 9.89  ? 340  HOH A O   1 
HETATM 1539 O O   . HOH E 4 .   ? 6.779   12.499 -21.196 1.00 15.50 ? 341  HOH A O   1 
HETATM 1540 O O   . HOH E 4 .   ? -14.069 30.173 -19.852 1.00 24.26 ? 342  HOH A O   1 
HETATM 1541 O O   . HOH E 4 .   ? -12.306 8.564  -24.671 1.00 31.58 ? 343  HOH A O   1 
HETATM 1542 O O   . HOH E 4 .   ? -19.818 23.499 -18.130 1.00 16.04 ? 344  HOH A O   1 
HETATM 1543 O O   . HOH E 4 .   ? 12.920  11.143 -17.442 1.00 20.27 ? 345  HOH A O   1 
HETATM 1544 O O   . HOH E 4 .   ? 2.911   13.946 -2.766  1.00 23.76 ? 346  HOH A O   1 
HETATM 1545 O O   . HOH E 4 .   ? -20.393 26.612 -11.769 1.00 16.27 ? 347  HOH A O   1 
HETATM 1546 O O   . HOH E 4 .   ? 7.047   21.577 -9.347  1.00 9.28  ? 348  HOH A O   1 
HETATM 1547 O O   . HOH E 4 .   ? -0.722  -1.320 -16.735 1.00 19.20 ? 349  HOH A O   1 
HETATM 1548 O O   . HOH E 4 .   ? -10.871 7.598  -15.720 1.00 30.55 ? 350  HOH A O   1 
HETATM 1549 O O   . HOH E 4 .   ? 0.969   10.446 -25.537 1.00 14.29 ? 351  HOH A O   1 
HETATM 1550 O O   . HOH E 4 .   ? -2.453  32.570 -34.014 1.00 30.52 ? 352  HOH A O   1 
HETATM 1551 O O   . HOH E 4 .   ? 14.491  12.808 -15.429 1.00 26.31 ? 353  HOH A O   1 
HETATM 1552 O O   . HOH E 4 .   ? 3.980   17.448 -24.830 1.00 11.42 ? 354  HOH A O   1 
HETATM 1553 O O   . HOH E 4 .   ? -2.797  14.978 -23.172 1.00 8.89  ? 355  HOH A O   1 
HETATM 1554 O O   . HOH E 4 .   ? -16.438 14.045 -18.629 1.00 26.74 ? 356  HOH A O   1 
HETATM 1555 O O   . HOH E 4 .   ? 7.649   24.573 -20.915 1.00 12.48 ? 357  HOH A O   1 
HETATM 1556 O O   . HOH E 4 .   ? -4.423  32.166 -14.131 1.00 14.41 ? 358  HOH A O   1 
HETATM 1557 O O   . HOH E 4 .   ? -10.829 32.621 -7.518  1.00 32.00 ? 359  HOH A O   1 
HETATM 1558 O O   . HOH E 4 .   ? 13.652  14.795 -18.682 1.00 19.63 ? 360  HOH A O   1 
HETATM 1559 O O   . HOH E 4 .   ? -16.486 10.763 -12.458 1.00 16.54 ? 361  HOH A O   1 
HETATM 1560 O O   . HOH E 4 .   ? -10.198 9.369  -18.222 1.00 22.97 ? 362  HOH A O   1 
HETATM 1561 O O   . HOH E 4 .   ? 9.164   24.808 -7.561  1.00 22.24 ? 363  HOH A O   1 
HETATM 1562 O O   . HOH E 4 .   ? -2.632  16.475 -25.482 1.00 10.54 ? 364  HOH A O   1 
HETATM 1563 O O   . HOH E 4 .   ? -4.042  23.258 -25.967 1.00 11.16 ? 365  HOH A O   1 
HETATM 1564 O O   . HOH E 4 .   ? -18.854 23.956 -20.899 1.00 23.69 ? 366  HOH A O   1 
HETATM 1565 O O   . HOH E 4 .   ? -23.201 20.667 -5.184  1.00 20.51 ? 367  HOH A O   1 
HETATM 1566 O O   . HOH E 4 .   ? -2.474  36.016 -20.812 1.00 29.84 ? 368  HOH A O   1 
HETATM 1567 O O   . HOH E 4 .   ? 10.832  7.412  -6.073  1.00 25.68 ? 369  HOH A O   1 
HETATM 1568 O O   . HOH E 4 .   ? 1.364   25.186 -1.882  1.00 26.22 ? 370  HOH A O   1 
HETATM 1569 O O   . HOH E 4 .   ? 13.241  22.546 -25.054 1.00 27.71 ? 371  HOH A O   1 
HETATM 1570 O O   . HOH E 4 .   ? 6.360   13.139 -6.443  1.00 18.67 ? 372  HOH A O   1 
HETATM 1571 O O   . HOH E 4 .   ? 7.931   27.703 -25.518 1.00 28.02 ? 373  HOH A O   1 
HETATM 1572 O O   . HOH E 4 .   ? -5.492  4.161  -24.014 1.00 25.10 ? 374  HOH A O   1 
HETATM 1573 O O   . HOH E 4 .   ? -6.700  35.458 -16.719 1.00 36.95 ? 375  HOH A O   1 
HETATM 1574 O O   . HOH E 4 .   ? -3.203  23.961 1.636   1.00 27.81 ? 376  HOH A O   1 
HETATM 1575 O O   . HOH E 4 .   ? -12.972 12.342 -22.862 1.00 35.75 ? 377  HOH A O   1 
HETATM 1576 O O   . HOH E 4 .   ? 9.290   26.351 -17.049 1.00 15.97 ? 378  HOH A O   1 
HETATM 1577 O O   . HOH E 4 .   ? -0.636  34.430 -19.245 1.00 25.98 ? 379  HOH A O   1 
HETATM 1578 O O   . HOH E 4 .   ? 2.187   16.689 2.390   1.00 22.98 ? 380  HOH A O   1 
HETATM 1579 O O   . HOH E 4 .   ? 3.126   6.222  -2.069  1.00 18.43 ? 381  HOH A O   1 
HETATM 1580 O O   . HOH E 4 .   ? 3.999   22.770 -27.591 1.00 32.22 ? 382  HOH A O   1 
HETATM 1581 O O   . HOH E 4 .   ? 5.558   23.470 -7.020  1.00 17.05 ? 383  HOH A O   1 
HETATM 1582 O O   . HOH E 4 .   ? -4.863  -5.689 -20.395 1.00 27.03 ? 384  HOH A O   1 
HETATM 1583 O O   . HOH E 4 .   ? 10.413  24.390 -18.967 1.00 14.98 ? 385  HOH A O   1 
HETATM 1584 O O   . HOH E 4 .   ? 7.309   19.983 -3.256  1.00 19.13 ? 386  HOH A O   1 
HETATM 1585 O O   . HOH E 4 .   ? -16.336 34.650 -10.903 1.00 27.57 ? 387  HOH A O   1 
HETATM 1586 O O   . HOH E 4 .   ? -3.650  35.512 -17.033 1.00 39.82 ? 388  HOH A O   1 
HETATM 1587 O O   . HOH E 4 .   ? -14.395 18.058 -25.885 1.00 25.09 ? 389  HOH A O   1 
HETATM 1588 O O   . HOH E 4 .   ? 5.903   28.566 -27.578 1.00 25.22 ? 390  HOH A O   1 
HETATM 1589 O O   . HOH E 4 .   ? -5.700  33.716 -9.046  1.00 28.77 ? 391  HOH A O   1 
HETATM 1590 O O   . HOH E 4 .   ? 11.262  5.477  -20.714 1.00 16.02 ? 392  HOH A O   1 
HETATM 1591 O O   . HOH E 4 .   ? -8.479  6.025  -2.578  1.00 20.70 ? 393  HOH A O   1 
HETATM 1592 O O   . HOH E 4 .   ? -18.681 13.981 -4.038  1.00 20.34 ? 394  HOH A O   1 
HETATM 1593 O O   . HOH E 4 .   ? 4.039   4.261  -4.869  1.00 19.87 ? 395  HOH A O   1 
HETATM 1594 O O   . HOH E 4 .   ? -12.557 14.884 -13.207 1.00 12.95 ? 396  HOH A O   1 
HETATM 1595 O O   . HOH E 4 .   ? 1.262   5.406  -25.926 1.00 24.89 ? 397  HOH A O   1 
HETATM 1596 O O   . HOH E 4 .   ? -1.505  3.067  -25.905 1.00 16.10 ? 398  HOH A O   1 
HETATM 1597 O O   . HOH E 4 .   ? 1.884   36.668 -21.412 1.00 26.00 ? 399  HOH A O   1 
HETATM 1598 O O   . HOH E 4 .   ? 0.686   35.661 -27.794 1.00 30.05 ? 400  HOH A O   1 
HETATM 1599 O O   . HOH E 4 .   ? -2.907  8.473  2.300   1.00 28.08 ? 401  HOH A O   1 
HETATM 1600 O O   . HOH E 4 .   ? -9.741  13.403 -31.704 1.00 28.15 ? 402  HOH A O   1 
HETATM 1601 O O   . HOH E 4 .   ? -17.140 23.969 -9.088  1.00 17.98 ? 403  HOH A O   1 
HETATM 1602 O O   . HOH E 4 .   ? 9.512   9.394  -22.879 1.00 32.45 ? 404  HOH A O   1 
HETATM 1603 O O   . HOH E 4 .   ? 12.028  9.790  -7.394  1.00 32.86 ? 405  HOH A O   1 
HETATM 1604 O O   . HOH E 4 .   ? 7.017   26.191 -29.050 1.00 28.87 ? 406  HOH A O   1 
HETATM 1605 O O   . HOH E 4 .   ? -3.762  6.946  -26.709 1.00 37.49 ? 407  HOH A O   1 
HETATM 1606 O O   . HOH E 4 .   ? -9.887  12.941 -20.203 1.00 21.60 ? 408  HOH A O   1 
HETATM 1607 O O   . HOH E 4 .   ? 1.673   2.491  -16.264 1.00 31.15 ? 409  HOH A O   1 
HETATM 1608 O O   . HOH E 4 .   ? 11.931  27.935 -14.621 1.00 26.59 ? 410  HOH A O   1 
HETATM 1609 O O   . HOH E 4 .   ? -16.008 21.775 3.570   1.00 33.51 ? 411  HOH A O   1 
HETATM 1610 O O   . HOH E 4 .   ? -14.820 30.733 1.388   1.00 36.85 ? 412  HOH A O   1 
HETATM 1611 O O   . HOH E 4 .   ? -9.226  -0.543 -21.100 1.00 31.12 ? 413  HOH A O   1 
HETATM 1612 O O   . HOH E 4 .   ? 5.319   12.946 -23.943 1.00 25.69 ? 414  HOH A O   1 
HETATM 1613 O O   . HOH E 4 .   ? 9.814   12.590 -21.727 1.00 37.11 ? 415  HOH A O   1 
HETATM 1614 O O   . HOH E 4 .   ? -15.946 8.043  -6.217  1.00 27.94 ? 416  HOH A O   1 
HETATM 1615 O O   . HOH E 4 .   ? 7.932   28.848 -17.202 1.00 19.07 ? 417  HOH A O   1 
HETATM 1616 O O   . HOH E 4 .   ? -0.182  15.996 -26.890 1.00 16.24 ? 418  HOH A O   1 
HETATM 1617 O O   . HOH E 4 .   ? 13.153  20.095 -21.356 1.00 25.68 ? 419  HOH A O   1 
HETATM 1618 O O   . HOH E 4 .   ? 4.724   15.000 -26.007 1.00 26.29 ? 420  HOH A O   1 
HETATM 1619 O O   . HOH E 4 .   ? 14.979  9.158  -10.658 1.00 16.84 ? 421  HOH A O   1 
HETATM 1620 O O   . HOH E 4 .   ? -17.763 10.401 -7.667  1.00 31.07 ? 422  HOH A O   1 
HETATM 1621 O O   . HOH E 4 .   ? 1.440   17.999 -25.805 1.00 14.20 ? 423  HOH A O   1 
HETATM 1622 O O   . HOH E 4 .   ? 16.032  10.116 -16.183 1.00 30.56 ? 424  HOH A O   1 
HETATM 1623 O O   . HOH E 4 .   ? 6.916   -0.057 -19.193 1.00 31.65 ? 425  HOH A O   1 
HETATM 1624 O O   . HOH E 4 .   ? -4.192  3.986  -26.661 1.00 33.39 ? 426  HOH A O   1 
HETATM 1625 O O   . HOH E 4 .   ? -4.173  35.573 -10.743 1.00 28.67 ? 427  HOH A O   1 
HETATM 1626 O O   . HOH E 4 .   ? 7.929   22.373 -6.750  1.00 15.52 ? 428  HOH A O   1 
HETATM 1627 O O   . HOH E 4 .   ? 7.534   27.379 -21.637 1.00 18.94 ? 429  HOH A O   1 
HETATM 1628 O O   . HOH E 4 .   ? 12.550  3.455  -19.393 1.00 23.40 ? 430  HOH A O   1 
HETATM 1629 O O   . HOH E 4 .   ? -10.986 42.702 -19.310 1.00 26.31 ? 431  HOH A O   1 
HETATM 1630 O O   . HOH F 4 .   ? -8.509  24.362 -28.251 1.00 24.12 ? 1001 HOH B O   1 
HETATM 1631 O O   . HOH F 4 .   ? 1.754   19.876 -27.861 1.00 21.13 ? 1002 HOH B O   1 
HETATM 1632 O O   . HOH F 4 .   ? -17.166 35.832 -26.961 1.00 19.26 ? 1003 HOH B O   1 
HETATM 1633 O O   . HOH F 4 .   ? -8.065  35.320 -33.774 1.00 31.19 ? 1004 HOH B O   1 
HETATM 1634 O O   . HOH F 4 .   ? -12.612 29.447 -24.433 1.00 25.41 ? 1005 HOH B O   1 
HETATM 1635 O O   . HOH F 4 .   ? 3.340   27.675 -29.781 1.00 33.50 ? 1006 HOH B O   1 
HETATM 1636 O O   . HOH F 4 .   ? -5.416  21.061 -31.701 1.00 21.23 ? 1007 HOH B O   1 
HETATM 1637 O O   . HOH F 4 .   ? -9.895  37.672 -33.347 1.00 35.61 ? 1008 HOH B O   1 
HETATM 1638 O O   . HOH F 4 .   ? -7.958  24.425 -31.163 1.00 37.33 ? 1009 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 5   ? 0.2678 0.2476 0.2652 0.0169  0.0324  0.0475  33  ASP A N   
2    C CA  . ASP A 5   ? 0.2533 0.2341 0.2551 0.0152  0.0278  0.0417  33  ASP A CA  
3    C C   . ASP A 5   ? 0.2239 0.2086 0.2235 0.0136  0.0261  0.0363  33  ASP A C   
4    O O   . ASP A 5   ? 0.2158 0.2028 0.2068 0.0150  0.0256  0.0360  33  ASP A O   
5    C CB  . ASP A 5   ? 0.2730 0.2544 0.2707 0.0178  0.0239  0.0421  33  ASP A CB  
6    C CG  . ASP A 5   ? 0.2811 0.2619 0.2856 0.0166  0.0209  0.0380  33  ASP A CG  
7    O OD1 . ASP A 5   ? 0.3082 0.2872 0.3200 0.0140  0.0217  0.0353  33  ASP A OD1 
8    O OD2 . ASP A 5   ? 0.2934 0.2757 0.2960 0.0186  0.0177  0.0376  33  ASP A OD2 
9    N N   . ASP A 6   ? 0.2021 0.1871 0.2092 0.0108  0.0251  0.0322  34  ASP A N   
10   C CA  . ASP A 6   ? 0.1897 0.1779 0.1956 0.0094  0.0235  0.0274  34  ASP A CA  
11   C C   . ASP A 6   ? 0.1639 0.1525 0.1749 0.0076  0.0200  0.0227  34  ASP A C   
12   O O   . ASP A 6   ? 0.1612 0.1478 0.1753 0.0079  0.0186  0.0227  34  ASP A O   
13   C CB  . ASP A 6   ? 0.2017 0.1907 0.2103 0.0082  0.0274  0.0283  34  ASP A CB  
14   C CG  . ASP A 6   ? 0.2086 0.1965 0.2286 0.0054  0.0286  0.0278  34  ASP A CG  
15   O OD1 . ASP A 6   ? 0.2165 0.2025 0.2419 0.0040  0.0262  0.0259  34  ASP A OD1 
16   O OD2 . ASP A 6   ? 0.2425 0.2316 0.2661 0.0046  0.0321  0.0295  34  ASP A OD2 
17   N N   . TRP A 7   ? 0.1476 0.1387 0.1588 0.0062  0.0188  0.0189  35  TRP A N   
18   C CA  . TRP A 7   ? 0.1356 0.1277 0.1495 0.0050  0.0156  0.0146  35  TRP A CA  
19   C C   . TRP A 7   ? 0.1351 0.1246 0.1566 0.0035  0.0153  0.0135  35  TRP A C   
20   O O   . TRP A 7   ? 0.1325 0.1220 0.1547 0.0035  0.0127  0.0105  35  TRP A O   
21   C CB  . TRP A 7   ? 0.1271 0.1218 0.1404 0.0038  0.0151  0.0116  35  TRP A CB  
22   C CG  . TRP A 7   ? 0.1251 0.1199 0.1437 0.0025  0.0177  0.0123  35  TRP A CG  
23   C CD1 . TRP A 7   ? 0.1277 0.1233 0.1447 0.0032  0.0212  0.0148  35  TRP A CD1 
24   C CD2 . TRP A 7   ? 0.1197 0.1145 0.1466 0.0003  0.0172  0.0107  35  TRP A CD2 
25   N NE1 . TRP A 7   ? 0.1262 0.1227 0.1512 0.0016  0.0231  0.0152  35  TRP A NE1 
26   C CE2 . TRP A 7   ? 0.1231 0.1192 0.1544 -0.0003 0.0203  0.0126  35  TRP A CE2 
27   C CE3 . TRP A 7   ? 0.1205 0.1145 0.1513 -0.0008 0.0143  0.0076  35  TRP A CE3 
28   C CZ2 . TRP A 7   ? 0.1236 0.1207 0.1641 -0.0025 0.0201  0.0116  35  TRP A CZ2 
29   C CZ3 . TRP A 7   ? 0.1207 0.1148 0.1591 -0.0029 0.0139  0.0063  35  TRP A CZ3 
30   C CH2 . TRP A 7   ? 0.1213 0.1172 0.1650 -0.0039 0.0165  0.0083  35  TRP A CH2 
31   N N   . ARG A 8   ? 0.1463 0.1335 0.1734 0.0024  0.0178  0.0157  36  ARG A N   
32   C CA  . ARG A 8   ? 0.1564 0.1404 0.1909 0.0008  0.0171  0.0143  36  ARG A CA  
33   C C   . ARG A 8   ? 0.1643 0.1448 0.1981 0.0024  0.0162  0.0146  36  ARG A C   
34   O O   . ARG A 8   ? 0.1912 0.1689 0.2288 0.0017  0.0146  0.0117  36  ARG A O   
35   C CB  . ARG A 8   ? 0.1671 0.1493 0.2091 -0.0010 0.0202  0.0171  36  ARG A CB  
36   C CG  . ARG A 8   ? 0.1715 0.1575 0.2170 -0.0028 0.0210  0.0163  36  ARG A CG  
37   C CD  . ARG A 8   ? 0.1848 0.1698 0.2394 -0.0048 0.0243  0.0196  36  ARG A CD  
38   N NE  . ARG A 8   ? 0.1961 0.1857 0.2548 -0.0061 0.0252  0.0191  36  ARG A NE  
39   C CZ  . ARG A 8   ? 0.2003 0.1921 0.2651 -0.0083 0.0223  0.0153  36  ARG A CZ  
40   N NH1 . ARG A 8   ? 0.2084 0.1978 0.2754 -0.0097 0.0182  0.0112  36  ARG A NH1 
41   N NH2 . ARG A 8   ? 0.2102 0.2068 0.2788 -0.0089 0.0236  0.0157  36  ARG A NH2 
42   N N   . ALA A 9   ? 0.1599 0.1404 0.1885 0.0050  0.0170  0.0182  37  ALA A N   
43   C CA  . ALA A 9   ? 0.1621 0.1400 0.1902 0.0072  0.0163  0.0193  37  ALA A CA  
44   C C   . ALA A 9   ? 0.1536 0.1347 0.1779 0.0087  0.0133  0.0164  37  ALA A C   
45   O O   . ALA A 9   ? 0.1640 0.1435 0.1885 0.0108  0.0127  0.0170  37  ALA A O   
46   C CB  . ALA A 9   ? 0.1713 0.1482 0.1961 0.0095  0.0184  0.0251  37  ALA A CB  
47   N N   . ALA A 10  ? 0.1406 0.1258 0.1619 0.0077  0.0117  0.0136  38  ALA A N   
48   C CA  . ALA A 10  ? 0.1354 0.1239 0.1539 0.0089  0.0093  0.0115  38  ALA A CA  
49   C C   . ALA A 10  ? 0.1368 0.1234 0.1586 0.0091  0.0085  0.0084  38  ALA A C   
50   O O   . ALA A 10  ? 0.1402 0.1240 0.1654 0.0075  0.0087  0.0060  38  ALA A O   
51   C CB  . ALA A 10  ? 0.1275 0.1200 0.1427 0.0075  0.0081  0.0094  38  ALA A CB  
52   N N   . ARG A 11  ? 0.1408 0.1293 0.1616 0.0112  0.0074  0.0083  39  ARG A N   
53   C CA  . ARG A 11  ? 0.1526 0.1394 0.1756 0.0123  0.0072  0.0055  39  ARG A CA  
54   C C   . ARG A 11  ? 0.1392 0.1302 0.1603 0.0121  0.0059  0.0026  39  ARG A C   
55   O O   . ARG A 11  ? 0.1515 0.1414 0.1733 0.0131  0.0060  0.0000  39  ARG A O   
56   C CB  . ARG A 11  ? 0.1833 0.1691 0.2075 0.0156  0.0077  0.0080  39  ARG A CB  
57   C CG  . ARG A 11  ? 0.2180 0.1997 0.2436 0.0165  0.0091  0.0120  39  ARG A CG  
58   C CD  . ARG A 11  ? 0.2493 0.2241 0.2788 0.0153  0.0105  0.0106  39  ARG A CD  
59   N NE  . ARG A 11  ? 0.2832 0.2534 0.3152 0.0182  0.0118  0.0132  39  ARG A NE  
60   C CZ  . ARG A 11  ? 0.3085 0.2721 0.3441 0.0180  0.0135  0.0152  39  ARG A CZ  
61   N NH1 . ARG A 11  ? 0.3227 0.2835 0.3608 0.0147  0.0144  0.0149  39  ARG A NH1 
62   N NH2 . ARG A 11  ? 0.3236 0.2834 0.3612 0.0213  0.0146  0.0177  39  ARG A NH2 
63   N N   . SER A 12  ? 0.1241 0.1197 0.1427 0.0109  0.0049  0.0030  40  SER A N   
64   C CA  . SER A 12  ? 0.1172 0.1169 0.1347 0.0108  0.0039  0.0013  40  SER A CA  
65   C C   . SER A 12  ? 0.1088 0.1111 0.1238 0.0087  0.0029  0.0011  40  SER A C   
66   O O   . SER A 12  ? 0.1067 0.1092 0.1201 0.0082  0.0027  0.0031  40  SER A O   
67   C CB  . SER A 12  ? 0.1191 0.1225 0.1377 0.0130  0.0035  0.0033  40  SER A CB  
68   O OG  . SER A 12  ? 0.1213 0.1292 0.1400 0.0127  0.0028  0.0023  40  SER A OG  
69   N N   . MET A 13  ? 0.1060 0.1102 0.1204 0.0077  0.0024  -0.0009 41  MET A N   
70   C CA  A MET A 13  ? 0.1017 0.1083 0.1143 0.0060  0.0015  -0.0010 41  MET A CA  
71   C CA  B MET A 13  ? 0.1117 0.1183 0.1242 0.0060  0.0014  -0.0010 41  MET A CA  
72   C C   . MET A 13  ? 0.1051 0.1148 0.1168 0.0062  0.0002  0.0008  41  MET A C   
73   O O   . MET A 13  ? 0.1078 0.1180 0.1172 0.0050  -0.0006 0.0008  41  MET A O   
74   C CB  A MET A 13  ? 0.0984 0.1064 0.1108 0.0054  0.0013  -0.0029 41  MET A CB  
75   C CB  B MET A 13  ? 0.1232 0.1315 0.1355 0.0054  0.0012  -0.0028 41  MET A CB  
76   C CG  A MET A 13  ? 0.0949 0.1048 0.1060 0.0038  0.0005  -0.0031 41  MET A CG  
77   C CG  B MET A 13  ? 0.1323 0.1427 0.1433 0.0038  0.0003  -0.0027 41  MET A CG  
78   S SD  A MET A 13  ? 0.0887 0.1030 0.1011 0.0036  -0.0004 -0.0018 41  MET A SD  
79   S SD  B MET A 13  ? 0.1576 0.1697 0.1686 0.0032  0.0005  -0.0037 41  MET A SD  
80   C CE  A MET A 13  ? 0.0924 0.1080 0.1056 0.0041  0.0008  -0.0026 41  MET A CE  
81   C CE  B MET A 13  ? 0.1522 0.1683 0.1660 0.0043  0.0008  -0.0022 41  MET A CE  
82   N N   . HIS A 14  ? 0.1040 0.1157 0.1178 0.0079  0.0000  0.0021  42  HIS A N   
83   C CA  . HIS A 14  ? 0.1069 0.1226 0.1212 0.0081  -0.0019 0.0039  42  HIS A CA  
84   C C   . HIS A 14  ? 0.1065 0.1211 0.1175 0.0084  -0.0029 0.0056  42  HIS A C   
85   O O   . HIS A 14  ? 0.1181 0.1357 0.1281 0.0082  -0.0053 0.0064  42  HIS A O   
86   C CB  . HIS A 14  ? 0.1107 0.1293 0.1290 0.0104  -0.0017 0.0053  42  HIS A CB  
87   C CG  . HIS A 14  ? 0.1162 0.1362 0.1370 0.0108  -0.0002 0.0040  42  HIS A CG  
88   N ND1 . HIS A 14  ? 0.1245 0.1454 0.1485 0.0135  0.0013  0.0046  42  HIS A ND1 
89   C CD2 . HIS A 14  ? 0.1175 0.1379 0.1376 0.0092  0.0003  0.0023  42  HIS A CD2 
90   C CE1 . HIS A 14  ? 0.1277 0.1496 0.1522 0.0135  0.0029  0.0031  42  HIS A CE1 
91   N NE2 . HIS A 14  ? 0.1267 0.1483 0.1489 0.0109  0.0022  0.0019  42  HIS A NE2 
92   N N   . GLU A 15  ? 0.1050 0.1155 0.1144 0.0089  -0.0012 0.0062  43  GLU A N   
93   C CA  . GLU A 15  ? 0.1067 0.1159 0.1122 0.0095  -0.0014 0.0084  43  GLU A CA  
94   C C   . GLU A 15  ? 0.1071 0.1160 0.1080 0.0078  -0.0019 0.0070  43  GLU A C   
95   O O   . GLU A 15  ? 0.1134 0.1218 0.1095 0.0085  -0.0024 0.0084  43  GLU A O   
96   C CB  . GLU A 15  ? 0.1105 0.1153 0.1166 0.0103  0.0011  0.0100  43  GLU A CB  
97   C CG  . GLU A 15  ? 0.1128 0.1164 0.1229 0.0124  0.0018  0.0113  43  GLU A CG  
98   C CD  . GLU A 15  ? 0.1180 0.1167 0.1289 0.0131  0.0042  0.0136  43  GLU A CD  
99   O OE1 . GLU A 15  ? 0.1248 0.1221 0.1328 0.0126  0.0053  0.0152  43  GLU A OE1 
100  O OE2 . GLU A 15  ? 0.1264 0.1223 0.1412 0.0144  0.0052  0.0138  43  GLU A OE2 
101  N N   . PHE A 16  ? 0.1016 0.1102 0.1034 0.0060  -0.0014 0.0044  44  PHE A N   
102  C CA  . PHE A 16  ? 0.1056 0.1127 0.1037 0.0049  -0.0010 0.0031  44  PHE A CA  
103  C C   . PHE A 16  ? 0.1092 0.1181 0.1047 0.0039  -0.0036 0.0016  44  PHE A C   
104  O O   . PHE A 16  ? 0.1116 0.1236 0.1095 0.0035  -0.0059 0.0015  44  PHE A O   
105  C CB  . PHE A 16  ? 0.1026 0.1082 0.1034 0.0037  0.0006  0.0013  44  PHE A CB  
106  C CG  . PHE A 16  ? 0.1018 0.1052 0.1053 0.0042  0.0028  0.0024  44  PHE A CG  
107  C CD1 . PHE A 16  ? 0.1020 0.1049 0.1092 0.0047  0.0029  0.0024  44  PHE A CD1 
108  C CD2 . PHE A 16  ? 0.1021 0.1036 0.1047 0.0041  0.0049  0.0033  44  PHE A CD2 
109  C CE1 . PHE A 16  ? 0.1037 0.1038 0.1138 0.0047  0.0045  0.0029  44  PHE A CE1 
110  C CE2 . PHE A 16  ? 0.1015 0.1011 0.1079 0.0040  0.0068  0.0044  44  PHE A CE2 
111  C CZ  . PHE A 16  ? 0.1017 0.1003 0.1121 0.0041  0.0064  0.0041  44  PHE A CZ  
112  N N   . SER A 17  ? 0.1228 0.1297 0.1138 0.0034  -0.0032 0.0005  45  SER A N   
113  C CA  A SER A 17  ? 0.1306 0.1376 0.1185 0.0023  -0.0056 -0.0015 45  SER A CA  
114  C CA  B SER A 17  ? 0.1292 0.1361 0.1169 0.0023  -0.0056 -0.0015 45  SER A CA  
115  C C   . SER A 17  ? 0.1280 0.1322 0.1150 0.0014  -0.0040 -0.0036 45  SER A C   
116  O O   . SER A 17  ? 0.1331 0.1357 0.1201 0.0022  -0.0010 -0.0031 45  SER A O   
117  C CB  A SER A 17  ? 0.1471 0.1535 0.1281 0.0033  -0.0073 -0.0012 45  SER A CB  
118  C CB  B SER A 17  ? 0.1439 0.1504 0.1247 0.0035  -0.0072 -0.0010 45  SER A CB  
119  O OG  A SER A 17  ? 0.1566 0.1605 0.1335 0.0050  -0.0042 0.0001  45  SER A OG  
120  O OG  B SER A 17  ? 0.1461 0.1560 0.1284 0.0038  -0.0104 0.0002  45  SER A OG  
121  N N   . ALA A 18  ? 0.1246 0.1285 0.1117 0.0000  -0.0058 -0.0057 46  ALA A N   
122  C CA  . ALA A 18  ? 0.1230 0.1240 0.1094 -0.0006 -0.0043 -0.0076 46  ALA A CA  
123  C C   . ALA A 18  ? 0.1283 0.1276 0.1125 -0.0020 -0.0068 -0.0100 46  ALA A C   
124  O O   . ALA A 18  ? 0.1358 0.1373 0.1222 -0.0034 -0.0098 -0.0101 46  ALA A O   
125  C CB  . ALA A 18  ? 0.1215 0.1234 0.1137 -0.0012 -0.0030 -0.0072 46  ALA A CB  
126  N N   . LYS A 19  ? 0.1335 0.1288 0.1141 -0.0016 -0.0056 -0.0120 47  LYS A N   
127  C CA  . LYS A 19  ? 0.1437 0.1360 0.1225 -0.0031 -0.0079 -0.0148 47  LYS A CA  
128  C C   . LYS A 19  ? 0.1336 0.1262 0.1190 -0.0049 -0.0080 -0.0146 47  LYS A C   
129  O O   . LYS A 19  ? 0.1239 0.1162 0.1121 -0.0042 -0.0055 -0.0136 47  LYS A O   
130  C CB  . LYS A 19  ? 0.1682 0.1554 0.1407 -0.0016 -0.0062 -0.0172 47  LYS A CB  
131  C CG  . LYS A 19  ? 0.1950 0.1816 0.1595 0.0004  -0.0058 -0.0172 47  LYS A CG  
132  C CD  . LYS A 19  ? 0.2255 0.2069 0.1829 0.0024  -0.0037 -0.0198 47  LYS A CD  
133  C CE  . LYS A 19  ? 0.2426 0.2236 0.2027 0.0042  0.0012  -0.0184 47  LYS A CE  
134  N NZ  . LYS A 19  ? 0.2689 0.2487 0.2223 0.0073  0.0047  -0.0178 47  LYS A NZ  
135  N N   . ASP A 20  ? 0.1346 0.1277 0.1225 -0.0073 -0.0111 -0.0154 48  ASP A N   
136  C CA  . ASP A 20  ? 0.1342 0.1270 0.1279 -0.0091 -0.0109 -0.0149 48  ASP A CA  
137  C C   . ASP A 20  ? 0.1354 0.1220 0.1268 -0.0089 -0.0099 -0.0171 48  ASP A C   
138  O O   . ASP A 20  ? 0.1368 0.1197 0.1220 -0.0075 -0.0095 -0.0194 48  ASP A O   
139  C CB  . ASP A 20  ? 0.1458 0.1417 0.1447 -0.0118 -0.0139 -0.0144 48  ASP A CB  
140  C CG  . ASP A 20  ? 0.1644 0.1574 0.1614 -0.0139 -0.0177 -0.0174 48  ASP A CG  
141  O OD1 . ASP A 20  ? 0.1744 0.1616 0.1657 -0.0134 -0.0178 -0.0204 48  ASP A OD1 
142  O OD2 . ASP A 20  ? 0.1918 0.1886 0.1934 -0.0162 -0.0208 -0.0169 48  ASP A OD2 
143  N N   . ILE A 21  ? 0.1310 0.1163 0.1270 -0.0101 -0.0091 -0.0162 49  ILE A N   
144  C CA  . ILE A 21  ? 0.1410 0.1203 0.1356 -0.0093 -0.0077 -0.0177 49  ILE A CA  
145  C C   . ILE A 21  ? 0.1583 0.1317 0.1492 -0.0106 -0.0100 -0.0215 49  ILE A C   
146  O O   . ILE A 21  ? 0.1703 0.1379 0.1582 -0.0092 -0.0086 -0.0235 49  ILE A O   
147  C CB  . ILE A 21  ? 0.1360 0.1151 0.1362 -0.0098 -0.0062 -0.0151 49  ILE A CB  
148  C CG1 . ILE A 21  ? 0.1417 0.1160 0.1406 -0.0077 -0.0038 -0.0155 49  ILE A CG1 
149  C CG2 . ILE A 21  ? 0.1387 0.1174 0.1438 -0.0132 -0.0082 -0.0146 49  ILE A CG2 
150  C CD1 . ILE A 21  ? 0.1394 0.1157 0.1424 -0.0067 -0.0020 -0.0121 49  ILE A CD1 
151  N N   . ASP A 22  ? 0.1703 0.1453 0.1615 -0.0130 -0.0137 -0.0227 50  ASP A N   
152  C CA  . ASP A 22  ? 0.2007 0.1704 0.1873 -0.0143 -0.0169 -0.0271 50  ASP A CA  
153  C C   . ASP A 22  ? 0.2075 0.1766 0.1846 -0.0120 -0.0175 -0.0294 50  ASP A C   
154  O O   . ASP A 22  ? 0.2248 0.1894 0.1961 -0.0126 -0.0204 -0.0336 50  ASP A O   
155  C CB  . ASP A 22  ? 0.2230 0.1952 0.2154 -0.0184 -0.0212 -0.0272 50  ASP A CB  
156  C CG  . ASP A 22  ? 0.2403 0.2125 0.2418 -0.0208 -0.0202 -0.0246 50  ASP A CG  
157  O OD1 . ASP A 22  ? 0.2658 0.2316 0.2673 -0.0206 -0.0185 -0.0255 50  ASP A OD1 
158  O OD2 . ASP A 22  ? 0.2770 0.2557 0.2855 -0.0225 -0.0207 -0.0214 50  ASP A OD2 
159  N N   . GLY A 23  ? 0.2051 0.1784 0.1803 -0.0093 -0.0148 -0.0270 51  GLY A N   
160  C CA  . GLY A 23  ? 0.2176 0.1904 0.1839 -0.0067 -0.0145 -0.0282 51  GLY A CA  
161  C C   . GLY A 23  ? 0.2241 0.2021 0.1890 -0.0072 -0.0177 -0.0271 51  GLY A C   
162  O O   . GLY A 23  ? 0.2471 0.2248 0.2041 -0.0050 -0.0177 -0.0277 51  GLY A O   
163  N N   . HIS A 24  ? 0.2168 0.1997 0.1895 -0.0098 -0.0201 -0.0251 52  HIS A N   
164  C CA  . HIS A 24  ? 0.2204 0.2085 0.1932 -0.0103 -0.0239 -0.0242 52  HIS A CA  
165  C C   . HIS A 24  ? 0.1998 0.1933 0.1752 -0.0084 -0.0212 -0.0200 52  HIS A C   
166  O O   . HIS A 24  ? 0.1791 0.1743 0.1606 -0.0084 -0.0183 -0.0177 52  HIS A O   
167  C CB  . HIS A 24  ? 0.2395 0.2308 0.2207 -0.0141 -0.0278 -0.0241 52  HIS A CB  
168  C CG  . HIS A 24  ? 0.2731 0.2590 0.2536 -0.0168 -0.0311 -0.0283 52  HIS A CG  
169  N ND1 . HIS A 24  ? 0.2880 0.2729 0.2770 -0.0200 -0.0313 -0.0281 52  HIS A ND1 
170  C CD2 . HIS A 24  ? 0.3001 0.2807 0.2722 -0.0168 -0.0342 -0.0329 52  HIS A CD2 
171  C CE1 . HIS A 24  ? 0.3023 0.2813 0.2891 -0.0222 -0.0346 -0.0325 52  HIS A CE1 
172  N NE2 . HIS A 24  ? 0.3110 0.2872 0.2871 -0.0202 -0.0365 -0.0358 52  HIS A NE2 
173  N N   . MET A 25  ? 0.1988 0.1946 0.1693 -0.0065 -0.0222 -0.0189 53  MET A N   
174  C CA  . MET A 25  ? 0.1989 0.1987 0.1717 -0.0045 -0.0196 -0.0150 53  MET A CA  
175  C C   . MET A 25  ? 0.1816 0.1872 0.1638 -0.0060 -0.0210 -0.0126 53  MET A C   
176  O O   . MET A 25  ? 0.2005 0.2091 0.1857 -0.0078 -0.0252 -0.0130 53  MET A O   
177  C CB  . MET A 25  ? 0.2271 0.2274 0.1923 -0.0020 -0.0204 -0.0139 53  MET A CB  
178  C CG  . MET A 25  ? 0.2458 0.2481 0.2124 0.0002  -0.0167 -0.0100 53  MET A CG  
179  S SD  . MET A 25  ? 0.2866 0.2853 0.2530 0.0015  -0.0106 -0.0096 53  MET A SD  
180  C CE  . MET A 25  ? 0.2960 0.2901 0.2504 0.0037  -0.0096 -0.0115 53  MET A CE  
181  N N   . VAL A 26  ? 0.1599 0.1670 0.1468 -0.0052 -0.0175 -0.0102 54  VAL A N   
182  C CA  . VAL A 26  ? 0.1513 0.1634 0.1461 -0.0057 -0.0176 -0.0079 54  VAL A CA  
183  C C   . VAL A 26  ? 0.1385 0.1524 0.1331 -0.0031 -0.0156 -0.0052 54  VAL A C   
184  O O   . VAL A 26  ? 0.1396 0.1508 0.1317 -0.0017 -0.0125 -0.0048 54  VAL A O   
185  C CB  . VAL A 26  ? 0.1549 0.1666 0.1551 -0.0068 -0.0150 -0.0076 54  VAL A CB  
186  C CG1 . VAL A 26  ? 0.1516 0.1686 0.1591 -0.0069 -0.0147 -0.0052 54  VAL A CG1 
187  C CG2 . VAL A 26  ? 0.1669 0.1759 0.1678 -0.0093 -0.0164 -0.0099 54  VAL A CG2 
188  N N   . ASN A 27  ? 0.1378 0.1562 0.1357 -0.0025 -0.0176 -0.0033 55  ASN A N   
189  C CA  . ASN A 27  ? 0.1363 0.1564 0.1358 -0.0001 -0.0157 -0.0005 55  ASN A CA  
190  C C   . ASN A 27  ? 0.1245 0.1462 0.1306 -0.0003 -0.0133 0.0001  55  ASN A C   
191  O O   . ASN A 27  ? 0.1253 0.1508 0.1370 -0.0014 -0.0144 0.0004  55  ASN A O   
192  C CB  . ASN A 27  ? 0.1506 0.1750 0.1511 0.0008  -0.0193 0.0012  55  ASN A CB  
193  C CG  . ASN A 27  ? 0.1641 0.1899 0.1664 0.0036  -0.0176 0.0043  55  ASN A CG  
194  O OD1 . ASN A 27  ? 0.1722 0.1966 0.1773 0.0044  -0.0142 0.0049  55  ASN A OD1 
195  N ND2 . ASN A 27  ? 0.1836 0.2118 0.1843 0.0054  -0.0203 0.0063  55  ASN A ND2 
196  N N   . LEU A 28  ? 0.1160 0.1349 0.1214 0.0008  -0.0099 0.0003  56  LEU A N   
197  C CA  . LEU A 28  ? 0.1121 0.1318 0.1219 0.0009  -0.0077 0.0004  56  LEU A CA  
198  C C   . LEU A 28  ? 0.1095 0.1327 0.1239 0.0027  -0.0074 0.0022  56  LEU A C   
199  O O   . LEU A 28  ? 0.1016 0.1257 0.1190 0.0032  -0.0055 0.0022  56  LEU A O   
200  C CB  . LEU A 28  ? 0.1135 0.1292 0.1213 0.0013  -0.0051 -0.0004 56  LEU A CB  
201  C CG  . LEU A 28  ? 0.1224 0.1351 0.1268 0.0000  -0.0049 -0.0021 56  LEU A CG  
202  C CD1 . LEU A 28  ? 0.1226 0.1327 0.1269 0.0004  -0.0026 -0.0026 56  LEU A CD1 
203  C CD2 . LEU A 28  ? 0.1264 0.1396 0.1317 -0.0018 -0.0062 -0.0033 56  LEU A CD2 
204  N N   . ASP A 29  ? 0.1150 0.1405 0.1298 0.0039  -0.0093 0.0039  57  ASP A N   
205  C CA  A ASP A 29  ? 0.1180 0.1477 0.1383 0.0058  -0.0091 0.0059  57  ASP A CA  
206  C CA  B ASP A 29  ? 0.1186 0.1482 0.1388 0.0058  -0.0092 0.0059  57  ASP A CA  
207  C C   . ASP A 29  ? 0.1147 0.1496 0.1409 0.0044  -0.0100 0.0061  57  ASP A C   
208  O O   . ASP A 29  ? 0.1137 0.1526 0.1454 0.0060  -0.0089 0.0077  57  ASP A O   
209  C CB  A ASP A 29  ? 0.1283 0.1592 0.1480 0.0080  -0.0109 0.0083  57  ASP A CB  
210  C CB  B ASP A 29  ? 0.1296 0.1608 0.1491 0.0077  -0.0113 0.0082  57  ASP A CB  
211  C CG  A ASP A 29  ? 0.1349 0.1695 0.1540 0.0068  -0.0153 0.0086  57  ASP A CG  
212  C CG  B ASP A 29  ? 0.1345 0.1688 0.1595 0.0106  -0.0103 0.0105  57  ASP A CG  
213  O OD1 A ASP A 29  ? 0.1463 0.1823 0.1661 0.0040  -0.0171 0.0069  57  ASP A OD1 
214  O OD1 B ASP A 29  ? 0.1426 0.1741 0.1684 0.0122  -0.0071 0.0102  57  ASP A OD1 
215  O OD2 A ASP A 29  ? 0.1471 0.1830 0.1648 0.0088  -0.0172 0.0107  57  ASP A OD2 
216  O OD2 B ASP A 29  ? 0.1457 0.1853 0.1743 0.0113  -0.0130 0.0124  57  ASP A OD2 
217  N N   . LYS A 30  ? 0.1135 0.1483 0.1391 0.0014  -0.0115 0.0046  58  LYS A N   
218  C CA  . LYS A 30  ? 0.1199 0.1589 0.1519 -0.0002 -0.0114 0.0051  58  LYS A CA  
219  C C   . LYS A 30  ? 0.1077 0.1467 0.1416 0.0010  -0.0072 0.0055  58  LYS A C   
220  O O   . LYS A 30  ? 0.1110 0.1545 0.1509 0.0006  -0.0061 0.0069  58  LYS A O   
221  C CB  . LYS A 30  ? 0.1353 0.1726 0.1661 -0.0036 -0.0134 0.0033  58  LYS A CB  
222  C CG  . LYS A 30  ? 0.1470 0.1786 0.1730 -0.0042 -0.0111 0.0015  58  LYS A CG  
223  C CD  . LYS A 30  ? 0.1669 0.1959 0.1916 -0.0072 -0.0130 -0.0002 58  LYS A CD  
224  C CE  . LYS A 30  ? 0.1800 0.2118 0.2114 -0.0095 -0.0127 0.0007  58  LYS A CE  
225  N NZ  . LYS A 30  ? 0.1961 0.2241 0.2264 -0.0124 -0.0146 -0.0011 58  LYS A NZ  
226  N N   . TYR A 31  ? 0.1009 0.1349 0.1298 0.0024  -0.0050 0.0043  59  TYR A N   
227  C CA  . TYR A 31  ? 0.0970 0.1303 0.1260 0.0038  -0.0016 0.0041  59  TYR A CA  
228  C C   . TYR A 31  ? 0.0969 0.1312 0.1275 0.0071  0.0002  0.0049  59  TYR A C   
229  O O   . TYR A 31  ? 0.0977 0.1306 0.1271 0.0088  0.0030  0.0042  59  TYR A O   
230  C CB  . TYR A 31  ? 0.0966 0.1243 0.1199 0.0032  -0.0008 0.0020  59  TYR A CB  
231  C CG  . TYR A 31  ? 0.0984 0.1250 0.1206 0.0004  -0.0021 0.0013  59  TYR A CG  
232  C CD1 . TYR A 31  ? 0.1034 0.1318 0.1282 -0.0008 -0.0012 0.0021  59  TYR A CD1 
233  C CD2 . TYR A 31  ? 0.1028 0.1262 0.1214 -0.0006 -0.0038 0.0001  59  TYR A CD2 
234  C CE1 . TYR A 31  ? 0.1070 0.1336 0.1313 -0.0033 -0.0023 0.0016  59  TYR A CE1 
235  C CE2 . TYR A 31  ? 0.1088 0.1305 0.1264 -0.0029 -0.0048 -0.0008 59  TYR A CE2 
236  C CZ  . TYR A 31  ? 0.1066 0.1296 0.1271 -0.0042 -0.0043 -0.0001 59  TYR A CZ  
237  O OH  . TYR A 31  ? 0.1188 0.1390 0.1384 -0.0063 -0.0052 -0.0010 59  TYR A OH  
238  N N   . ARG A 32  ? 0.1064 0.1429 0.1395 0.0085  -0.0012 0.0064  60  ARG A N   
239  C CA  . ARG A 32  ? 0.1186 0.1562 0.1544 0.0120  0.0007  0.0075  60  ARG A CA  
240  C C   . ARG A 32  ? 0.1069 0.1493 0.1476 0.0132  0.0033  0.0086  60  ARG A C   
241  O O   . ARG A 32  ? 0.1047 0.1532 0.1512 0.0117  0.0024  0.0104  60  ARG A O   
242  C CB  . ARG A 32  ? 0.1447 0.1851 0.1833 0.0133  -0.0016 0.0097  60  ARG A CB  
243  C CG  . ARG A 32  ? 0.1808 0.2200 0.2210 0.0174  0.0003  0.0108  60  ARG A CG  
244  C CD  . ARG A 32  ? 0.2095 0.2497 0.2505 0.0187  -0.0023 0.0131  60  ARG A CD  
245  N NE  . ARG A 32  ? 0.2407 0.2882 0.2863 0.0173  -0.0056 0.0149  60  ARG A NE  
246  C CZ  . ARG A 32  ? 0.2663 0.3156 0.3109 0.0167  -0.0097 0.0163  60  ARG A CZ  
247  N NH1 . ARG A 32  ? 0.2884 0.3328 0.3271 0.0176  -0.0105 0.0167  60  ARG A NH1 
248  N NH2 . ARG A 32  ? 0.2806 0.3370 0.3304 0.0151  -0.0131 0.0173  60  ARG A NH2 
249  N N   . GLY A 33  ? 0.1006 0.1405 0.1393 0.0158  0.0067  0.0075  61  GLY A N   
250  C CA  . GLY A 33  ? 0.1019 0.1458 0.1438 0.0176  0.0101  0.0085  61  GLY A CA  
251  C C   . GLY A 33  ? 0.1002 0.1430 0.1386 0.0160  0.0118  0.0075  61  GLY A C   
252  O O   . GLY A 33  ? 0.1075 0.1534 0.1476 0.0177  0.0152  0.0087  61  GLY A O   
253  N N   . PHE A 34  ? 0.0931 0.1317 0.1267 0.0132  0.0098  0.0058  62  PHE A N   
254  C CA  . PHE A 34  ? 0.0955 0.1332 0.1260 0.0116  0.0108  0.0055  62  PHE A CA  
255  C C   . PHE A 34  ? 0.0999 0.1313 0.1229 0.0121  0.0107  0.0025  62  PHE A C   
256  O O   . PHE A 34  ? 0.1172 0.1449 0.1380 0.0108  0.0083  0.0009  62  PHE A O   
257  C CB  . PHE A 34  ? 0.0913 0.1302 0.1241 0.0076  0.0081  0.0064  62  PHE A CB  
258  C CG  . PHE A 34  ? 0.0913 0.1367 0.1323 0.0065  0.0077  0.0091  62  PHE A CG  
259  C CD1 . PHE A 34  ? 0.0963 0.1461 0.1417 0.0064  0.0105  0.0115  62  PHE A CD1 
260  C CD2 . PHE A 34  ? 0.0937 0.1416 0.1386 0.0059  0.0045  0.0096  62  PHE A CD2 
261  C CE1 . PHE A 34  ? 0.0975 0.1542 0.1522 0.0053  0.0103  0.0143  62  PHE A CE1 
262  C CE2 . PHE A 34  ? 0.0987 0.1535 0.1522 0.0049  0.0037  0.0121  62  PHE A CE2 
263  C CZ  . PHE A 34  ? 0.0978 0.1572 0.1568 0.0045  0.0065  0.0144  62  PHE A CZ  
264  N N   . VAL A 35  ? 0.1019 0.1325 0.1211 0.0139  0.0133  0.0019  63  VAL A N   
265  C CA  . VAL A 35  ? 0.1046 0.1300 0.1168 0.0139  0.0125  -0.0008 63  VAL A CA  
266  C C   . VAL A 35  ? 0.1005 0.1251 0.1122 0.0107  0.0104  -0.0004 63  VAL A C   
267  O O   . VAL A 35  ? 0.1022 0.1297 0.1163 0.0093  0.0111  0.0019  63  VAL A O   
268  C CB  . VAL A 35  ? 0.1151 0.1401 0.1223 0.0168  0.0154  -0.0014 63  VAL A CB  
269  C CG1 . VAL A 35  ? 0.1216 0.1419 0.1217 0.0167  0.0138  -0.0043 63  VAL A CG1 
270  C CG2 . VAL A 35  ? 0.1267 0.1517 0.1339 0.0205  0.0179  -0.0023 63  VAL A CG2 
271  N N   . SER A 36  ? 0.0970 0.1176 0.1062 0.0096  0.0080  -0.0025 64  SER A N   
272  C CA  . SER A 36  ? 0.0989 0.1185 0.1081 0.0069  0.0062  -0.0022 64  SER A CA  
273  C C   . SER A 36  ? 0.0999 0.1162 0.1047 0.0069  0.0051  -0.0041 64  SER A C   
274  O O   . SER A 36  ? 0.1117 0.1254 0.1144 0.0080  0.0045  -0.0064 64  SER A O   
275  C CB  . SER A 36  ? 0.1031 0.1223 0.1150 0.0053  0.0043  -0.0022 64  SER A CB  
276  O OG  . SER A 36  ? 0.1114 0.1343 0.1276 0.0052  0.0045  -0.0003 64  SER A OG  
277  N N   . ILE A 37  ? 0.0941 0.1103 0.0984 0.0056  0.0046  -0.0031 65  ILE A N   
278  C CA  . ILE A 37  ? 0.0979 0.1116 0.0993 0.0054  0.0030  -0.0045 65  ILE A CA  
279  C C   . ILE A 37  ? 0.0936 0.1062 0.0975 0.0033  0.0017  -0.0045 65  ILE A C   
280  O O   . ILE A 37  ? 0.1015 0.1147 0.1073 0.0019  0.0019  -0.0030 65  ILE A O   
281  C CB  . ILE A 37  ? 0.1064 0.1206 0.1049 0.0061  0.0037  -0.0032 65  ILE A CB  
282  C CG1 . ILE A 37  ? 0.1159 0.1309 0.1102 0.0087  0.0054  -0.0033 65  ILE A CG1 
283  C CG2 . ILE A 37  ? 0.1104 0.1227 0.1071 0.0059  0.0015  -0.0042 65  ILE A CG2 
284  C CD1 . ILE A 37  ? 0.1243 0.1405 0.1157 0.0097  0.0070  -0.0007 65  ILE A CD1 
285  N N   . VAL A 38  ? 0.0896 0.1004 0.0936 0.0031  0.0004  -0.0062 66  VAL A N   
286  C CA  . VAL A 38  ? 0.0877 0.0973 0.0933 0.0017  -0.0002 -0.0062 66  VAL A CA  
287  C C   . VAL A 38  ? 0.0859 0.0948 0.0910 0.0019  -0.0011 -0.0067 66  VAL A C   
288  O O   . VAL A 38  ? 0.0926 0.1014 0.0972 0.0026  -0.0021 -0.0081 66  VAL A O   
289  C CB  . VAL A 38  ? 0.0912 0.1000 0.0983 0.0015  -0.0003 -0.0069 66  VAL A CB  
290  C CG1 . VAL A 38  ? 0.0941 0.1018 0.1020 0.0005  -0.0003 -0.0067 66  VAL A CG1 
291  C CG2 . VAL A 38  ? 0.0951 0.1049 0.1029 0.0018  0.0002  -0.0061 66  VAL A CG2 
292  N N   . THR A 39  ? 0.0839 0.0923 0.0895 0.0014  -0.0010 -0.0057 67  THR A N   
293  C CA  . THR A 39  ? 0.0870 0.0951 0.0926 0.0020  -0.0019 -0.0056 67  THR A CA  
294  C C   . THR A 39  ? 0.0856 0.0924 0.0931 0.0015  -0.0015 -0.0054 67  THR A C   
295  O O   . THR A 39  ? 0.0889 0.0943 0.0963 0.0006  -0.0007 -0.0050 67  THR A O   
296  C CB  . THR A 39  ? 0.0933 0.1019 0.0965 0.0030  -0.0019 -0.0041 67  THR A CB  
297  O OG1 . THR A 39  ? 0.0992 0.1080 0.1022 0.0040  -0.0032 -0.0038 67  THR A OG1 
298  C CG2 . THR A 39  ? 0.0986 0.1064 0.1021 0.0022  -0.0005 -0.0022 67  THR A CG2 
299  N N   . ASN A 40  ? 0.0836 0.0908 0.0930 0.0021  -0.0022 -0.0056 68  ASN A N   
300  C CA  . ASN A 40  ? 0.0857 0.0916 0.0969 0.0024  -0.0014 -0.0053 68  ASN A CA  
301  C C   . ASN A 40  ? 0.0918 0.0971 0.1026 0.0034  -0.0017 -0.0038 68  ASN A C   
302  O O   . ASN A 40  ? 0.1019 0.1089 0.1124 0.0044  -0.0032 -0.0033 68  ASN A O   
303  C CB  . ASN A 40  ? 0.0844 0.0917 0.0993 0.0026  -0.0013 -0.0059 68  ASN A CB  
304  C CG  . ASN A 40  ? 0.0857 0.0957 0.1030 0.0031  -0.0034 -0.0061 68  ASN A CG  
305  O OD1 . ASN A 40  ? 0.0841 0.0948 0.0998 0.0029  -0.0050 -0.0070 68  ASN A OD1 
306  N ND2 . ASN A 40  ? 0.0883 0.0998 0.1097 0.0040  -0.0037 -0.0056 68  ASN A ND2 
307  N N   . VAL A 41  ? 0.0924 0.0949 0.1029 0.0033  -0.0006 -0.0033 69  VAL A N   
308  C CA  . VAL A 41  ? 0.0966 0.0974 0.1069 0.0043  -0.0005 -0.0015 69  VAL A CA  
309  C C   . VAL A 41  ? 0.0967 0.0956 0.1092 0.0056  0.0002  -0.0014 69  VAL A C   
310  O O   . VAL A 41  ? 0.0974 0.0956 0.1110 0.0057  0.0013  -0.0028 69  VAL A O   
311  C CB  . VAL A 41  ? 0.1032 0.1017 0.1118 0.0029  0.0001  -0.0006 69  VAL A CB  
312  C CG1 . VAL A 41  ? 0.1048 0.1059 0.1119 0.0021  -0.0001 -0.0003 69  VAL A CG1 
313  C CG2 . VAL A 41  ? 0.1085 0.1037 0.1171 0.0015  0.0009  -0.0021 69  VAL A CG2 
314  N N   . ALA A 42  ? 0.0996 0.0973 0.1126 0.0071  0.0000  0.0006  70  ALA A N   
315  C CA  . ALA A 42  ? 0.1072 0.1024 0.1225 0.0089  0.0010  0.0010  70  ALA A CA  
316  C C   . ALA A 42  ? 0.1133 0.1054 0.1280 0.0098  0.0011  0.0037  70  ALA A C   
317  O O   . ALA A 42  ? 0.1205 0.1142 0.1334 0.0098  0.0000  0.0057  70  ALA A O   
318  C CB  . ALA A 42  ? 0.1097 0.1090 0.1289 0.0109  0.0002  0.0013  70  ALA A CB  
319  N N   . SER A 43  ? 0.1218 0.1090 0.1376 0.0108  0.0025  0.0038  71  SER A N   
320  C CA  . SER A 43  ? 0.1332 0.1161 0.1489 0.0112  0.0030  0.0065  71  SER A CA  
321  C C   . SER A 43  ? 0.1420 0.1255 0.1598 0.0147  0.0026  0.0095  71  SER A C   
322  O O   . SER A 43  ? 0.1526 0.1333 0.1699 0.0154  0.0028  0.0128  71  SER A O   
323  C CB  . SER A 43  ? 0.1437 0.1194 0.1594 0.0103  0.0047  0.0047  71  SER A CB  
324  O OG  . SER A 43  ? 0.1484 0.1234 0.1622 0.0072  0.0045  0.0021  71  SER A OG  
325  N N   . GLN A 44  ? 0.1435 0.1308 0.1642 0.0168  0.0020  0.0090  72  GLN A N   
326  C CA  . GLN A 44  ? 0.1568 0.1452 0.1808 0.0204  0.0013  0.0118  72  GLN A CA  
327  C C   . GLN A 44  ? 0.1572 0.1534 0.1826 0.0215  -0.0016 0.0127  72  GLN A C   
328  O O   . GLN A 44  ? 0.1732 0.1729 0.2034 0.0241  -0.0025 0.0135  72  GLN A O   
329  C CB  . GLN A 44  ? 0.1649 0.1505 0.1927 0.0225  0.0036  0.0104  72  GLN A CB  
330  C CG  . GLN A 44  ? 0.1794 0.1566 0.2052 0.0215  0.0062  0.0088  72  GLN A CG  
331  C CD  . GLN A 44  ? 0.1909 0.1643 0.2192 0.0242  0.0088  0.0071  72  GLN A CD  
332  O OE1 . GLN A 44  ? 0.2228 0.2003 0.2557 0.0274  0.0092  0.0081  72  GLN A OE1 
333  N NE2 . GLN A 44  ? 0.1921 0.1579 0.2176 0.0231  0.0106  0.0045  72  GLN A NE2 
334  N N   . OCS A 45  ? 0.1549 0.1539 0.1764 0.0197  -0.0034 0.0125  73  OCS A N   
335  C CA  . OCS A 45  ? 0.1559 0.1613 0.1774 0.0206  -0.0070 0.0129  73  OCS A CA  
336  C CB  . OCS A 45  ? 0.1564 0.1644 0.1761 0.0177  -0.0077 0.0095  73  OCS A CB  
337  S SG  . OCS A 45  ? 0.1583 0.1725 0.1778 0.0176  -0.0118 0.0082  73  OCS A SG  
338  C C   . OCS A 45  ? 0.1602 0.1652 0.1771 0.0223  -0.0084 0.0165  73  OCS A C   
339  O O   . OCS A 45  ? 0.1564 0.1570 0.1697 0.0216  -0.0063 0.0183  73  OCS A O   
340  O OD1 . OCS A 45  ? 0.1585 0.1739 0.1793 0.0151  -0.0115 0.0050  73  OCS A OD1 
341  O OD2 . OCS A 45  ? 0.1992 0.2141 0.2127 0.0192  -0.0140 0.0104  73  OCS A OD2 
342  O OD3 . OCS A 45  ? 0.1819 0.2001 0.2075 0.0196  -0.0138 0.0091  73  OCS A OD3 
343  N N   . GLY A 46  ? 0.1641 0.1740 0.1813 0.0246  -0.0119 0.0179  74  GLY A N   
344  C CA  . GLY A 46  ? 0.1769 0.1870 0.1882 0.0266  -0.0136 0.0215  74  GLY A CA  
345  C C   . GLY A 46  ? 0.1835 0.1925 0.1873 0.0249  -0.0127 0.0212  74  GLY A C   
346  O O   . GLY A 46  ? 0.2052 0.2121 0.2041 0.0262  -0.0117 0.0250  74  GLY A O   
347  N N   . LYS A 47  ? 0.1783 0.1887 0.1815 0.0221  -0.0127 0.0172  75  LYS A N   
348  C CA  . LYS A 47  ? 0.1818 0.1915 0.1787 0.0207  -0.0116 0.0166  75  LYS A CA  
349  C C   . LYS A 47  ? 0.1589 0.1648 0.1572 0.0179  -0.0076 0.0158  75  LYS A C   
350  O O   . LYS A 47  ? 0.1555 0.1616 0.1505 0.0164  -0.0065 0.0148  75  LYS A O   
351  C CB  . LYS A 47  ? 0.2023 0.2160 0.1973 0.0199  -0.0145 0.0126  75  LYS A CB  
352  C CG  . LYS A 47  ? 0.2271 0.2450 0.2203 0.0222  -0.0193 0.0125  75  LYS A CG  
353  C CD  . LYS A 47  ? 0.2448 0.2656 0.2387 0.0205  -0.0222 0.0076  75  LYS A CD  
354  C CE  . LYS A 47  ? 0.2646 0.2898 0.2578 0.0223  -0.0279 0.0069  75  LYS A CE  
355  N NZ  . LYS A 47  ? 0.2764 0.3048 0.2783 0.0232  -0.0300 0.0081  75  LYS A NZ  
356  N N   . THR A 48  ? 0.1462 0.1486 0.1493 0.0173  -0.0057 0.0162  76  THR A N   
357  C CA  . THR A 48  ? 0.1368 0.1353 0.1410 0.0145  -0.0028 0.0153  76  THR A CA  
358  C C   . THR A 48  ? 0.1405 0.1373 0.1413 0.0139  -0.0008 0.0185  76  THR A C   
359  O O   . THR A 48  ? 0.1319 0.1290 0.1319 0.0117  0.0004  0.0173  76  THR A O   
360  C CB  . THR A 48  ? 0.1344 0.1284 0.1431 0.0145  -0.0013 0.0152  76  THR A CB  
361  O OG1 . THR A 48  ? 0.1301 0.1262 0.1422 0.0145  -0.0021 0.0119  76  THR A OG1 
362  C CG2 . THR A 48  ? 0.1358 0.1251 0.1452 0.0117  0.0010  0.0146  76  THR A CG2 
363  N N   . GLU A 49  ? 0.1512 0.1465 0.1504 0.0162  -0.0004 0.0229  77  GLU A N   
364  C CA  . GLU A 49  ? 0.1671 0.1607 0.1637 0.0157  0.0020  0.0267  77  GLU A CA  
365  C C   . GLU A 49  ? 0.1619 0.1598 0.1530 0.0159  0.0021  0.0263  77  GLU A C   
366  O O   . GLU A 49  ? 0.1604 0.1582 0.1516 0.0140  0.0046  0.0269  77  GLU A O   
367  C CB  . GLU A 49  ? 0.1927 0.1839 0.1881 0.0186  0.0026  0.0321  77  GLU A CB  
368  C CG  . GLU A 49  ? 0.2191 0.2082 0.2126 0.0181  0.0059  0.0371  77  GLU A CG  
369  C CD  . GLU A 49  ? 0.2498 0.2361 0.2418 0.0212  0.0067  0.0432  77  GLU A CD  
370  O OE1 . GLU A 49  ? 0.2817 0.2674 0.2745 0.0238  0.0044  0.0436  77  GLU A OE1 
371  O OE2 . GLU A 49  ? 0.2865 0.2714 0.2769 0.0211  0.0098  0.0480  77  GLU A OE2 
372  N N   . VAL A 50  ? 0.1622 0.1638 0.1486 0.0183  -0.0007 0.0252  78  VAL A N   
373  C CA  . VAL A 50  ? 0.1690 0.1738 0.1491 0.0189  -0.0006 0.0243  78  VAL A CA  
374  C C   . VAL A 50  ? 0.1517 0.1575 0.1344 0.0160  0.0000  0.0200  78  VAL A C   
375  O O   . VAL A 50  ? 0.1512 0.1580 0.1315 0.0155  0.0023  0.0203  78  VAL A O   
376  C CB  . VAL A 50  ? 0.1880 0.1960 0.1623 0.0218  -0.0045 0.0231  78  VAL A CB  
377  C CG1 . VAL A 50  ? 0.1904 0.2005 0.1687 0.0211  -0.0083 0.0184  78  VAL A CG1 
378  C CG2 . VAL A 50  ? 0.2020 0.2121 0.1683 0.0231  -0.0039 0.0225  78  VAL A CG2 
379  N N   . ASN A 51  ? 0.1429 0.1485 0.1304 0.0144  -0.0016 0.0163  79  ASN A N   
380  C CA  . ASN A 51  ? 0.1377 0.1442 0.1272 0.0121  -0.0010 0.0127  79  ASN A CA  
381  C C   . ASN A 51  ? 0.1312 0.1359 0.1239 0.0097  0.0020  0.0140  79  ASN A C   
382  O O   . ASN A 51  ? 0.1284 0.1348 0.1204 0.0089  0.0034  0.0134  79  ASN A O   
383  C CB  . ASN A 51  ? 0.1388 0.1456 0.1325 0.0110  -0.0031 0.0091  79  ASN A CB  
384  C CG  . ASN A 51  ? 0.1456 0.1553 0.1370 0.0123  -0.0062 0.0065  79  ASN A CG  
385  O OD1 . ASN A 51  ? 0.1527 0.1635 0.1427 0.0115  -0.0065 0.0038  79  ASN A OD1 
386  N ND2 . ASN A 51  ? 0.1566 0.1674 0.1481 0.0141  -0.0087 0.0073  79  ASN A ND2 
387  N N   . TYR A 52  ? 0.1300 0.1313 0.1267 0.0086  0.0028  0.0156  80  TYR A N   
388  C CA  . TYR A 52  ? 0.1299 0.1296 0.1303 0.0059  0.0050  0.0165  80  TYR A CA  
389  C C   . TYR A 52  ? 0.1336 0.1345 0.1323 0.0062  0.0077  0.0204  80  TYR A C   
390  O O   . TYR A 52  ? 0.1319 0.1346 0.1328 0.0044  0.0092  0.0203  80  TYR A O   
391  C CB  . TYR A 52  ? 0.1325 0.1273 0.1370 0.0047  0.0053  0.0172  80  TYR A CB  
392  C CG  . TYR A 52  ? 0.1350 0.1282 0.1422 0.0031  0.0041  0.0130  80  TYR A CG  
393  C CD1 . TYR A 52  ? 0.1402 0.1335 0.1497 0.0003  0.0043  0.0111  80  TYR A CD1 
394  C CD2 . TYR A 52  ? 0.1380 0.1303 0.1453 0.0046  0.0027  0.0112  80  TYR A CD2 
395  C CE1 . TYR A 52  ? 0.1425 0.1343 0.1531 -0.0007 0.0032  0.0075  80  TYR A CE1 
396  C CE2 . TYR A 52  ? 0.1366 0.1275 0.1456 0.0035  0.0022  0.0077  80  TYR A CE2 
397  C CZ  . TYR A 52  ? 0.1356 0.1259 0.1455 0.0009  0.0025  0.0059  80  TYR A CZ  
398  O OH  . TYR A 52  ? 0.1397 0.1285 0.1500 0.0001  0.0020  0.0026  80  TYR A OH  
399  N N   . THR A 53  ? 0.1397 0.1401 0.1348 0.0086  0.0084  0.0243  81  THR A N   
400  C CA  . THR A 53  ? 0.1500 0.1516 0.1436 0.0090  0.0118  0.0287  81  THR A CA  
401  C C   . THR A 53  ? 0.1420 0.1481 0.1314 0.0102  0.0126  0.0272  81  THR A C   
402  O O   . THR A 53  ? 0.1382 0.1463 0.1295 0.0092  0.0158  0.0292  81  THR A O   
403  C CB  . THR A 53  ? 0.1688 0.1687 0.1587 0.0118  0.0128  0.0337  81  THR A CB  
404  O OG1 . THR A 53  ? 0.1821 0.1839 0.1653 0.0150  0.0100  0.0323  81  THR A OG1 
405  C CG2 . THR A 53  ? 0.1755 0.1703 0.1702 0.0109  0.0125  0.0355  81  THR A CG2 
406  N N   . GLN A 54  ? 0.1380 0.1457 0.1223 0.0121  0.0099  0.0236  82  GLN A N   
407  C CA  . GLN A 54  ? 0.1403 0.1512 0.1202 0.0134  0.0106  0.0216  82  GLN A CA  
408  C C   . GLN A 54  ? 0.1319 0.1441 0.1170 0.0109  0.0109  0.0184  82  GLN A C   
409  O O   . GLN A 54  ? 0.1336 0.1482 0.1178 0.0115  0.0132  0.0185  82  GLN A O   
410  C CB  . GLN A 54  ? 0.1484 0.1600 0.1212 0.0162  0.0074  0.0186  82  GLN A CB  
411  C CG  . GLN A 54  ? 0.1613 0.1727 0.1272 0.0194  0.0071  0.0222  82  GLN A CG  
412  C CD  . GLN A 54  ? 0.1722 0.1848 0.1306 0.0220  0.0033  0.0189  82  GLN A CD  
413  O OE1 . GLN A 54  ? 0.1721 0.1854 0.1305 0.0214  0.0013  0.0140  82  GLN A OE1 
414  N NE2 . GLN A 54  ? 0.1915 0.2041 0.1434 0.0250  0.0022  0.0217  82  GLN A NE2 
415  N N   . LEU A 55  ? 0.1248 0.1354 0.1151 0.0086  0.0087  0.0158  83  LEU A N   
416  C CA  . LEU A 55  ? 0.1219 0.1337 0.1170 0.0063  0.0090  0.0135  83  LEU A CA  
417  C C   . LEU A 55  ? 0.1202 0.1330 0.1204 0.0044  0.0118  0.0167  83  LEU A C   
418  O O   . LEU A 55  ? 0.1171 0.1330 0.1197 0.0039  0.0132  0.0164  83  LEU A O   
419  C CB  . LEU A 55  ? 0.1230 0.1326 0.1215 0.0044  0.0064  0.0106  83  LEU A CB  
420  C CG  . LEU A 55  ? 0.1292 0.1388 0.1250 0.0057  0.0037  0.0072  83  LEU A CG  
421  C CD1 . LEU A 55  ? 0.1342 0.1416 0.1335 0.0043  0.0021  0.0056  83  LEU A CD1 
422  C CD2 . LEU A 55  ? 0.1297 0.1412 0.1243 0.0061  0.0035  0.0045  83  LEU A CD2 
423  N N   . VAL A 56  ? 0.1220 0.1325 0.1247 0.0032  0.0127  0.0200  84  VAL A N   
424  C CA  . VAL A 56  ? 0.1264 0.1378 0.1350 0.0010  0.0154  0.0234  84  VAL A CA  
425  C C   . VAL A 56  ? 0.1347 0.1501 0.1409 0.0031  0.0192  0.0266  84  VAL A C   
426  O O   . VAL A 56  ? 0.1355 0.1545 0.1470 0.0018  0.0212  0.0278  84  VAL A O   
427  C CB  . VAL A 56  ? 0.1314 0.1384 0.1429 -0.0002 0.0157  0.0264  84  VAL A CB  
428  C CG1 . VAL A 56  ? 0.1369 0.1447 0.1546 -0.0025 0.0190  0.0310  84  VAL A CG1 
429  C CG2 . VAL A 56  ? 0.1286 0.1317 0.1432 -0.0025 0.0127  0.0228  84  VAL A CG2 
430  N N   . ASP A 57  ? 0.1440 0.1593 0.1422 0.0067  0.0200  0.0280  85  ASP A N   
431  C CA  A ASP A 57  ? 0.1543 0.1730 0.1480 0.0095  0.0239  0.0308  85  ASP A CA  
432  C CA  B ASP A 57  ? 0.1525 0.1713 0.1467 0.0094  0.0240  0.0309  85  ASP A CA  
433  C C   . ASP A 57  ? 0.1491 0.1713 0.1430 0.0102  0.0243  0.0274  85  ASP A C   
434  O O   . ASP A 57  ? 0.1505 0.1765 0.1472 0.0106  0.0281  0.0298  85  ASP A O   
435  C CB  A ASP A 57  ? 0.1676 0.1852 0.1504 0.0137  0.0235  0.0312  85  ASP A CB  
436  C CB  B ASP A 57  ? 0.1637 0.1810 0.1476 0.0133  0.0238  0.0321  85  ASP A CB  
437  C CG  A ASP A 57  ? 0.1778 0.1924 0.1593 0.0142  0.0238  0.0357  85  ASP A CG  
438  C CG  B ASP A 57  ? 0.1739 0.1941 0.1516 0.0167  0.0281  0.0350  85  ASP A CG  
439  O OD1 A ASP A 57  ? 0.1826 0.1960 0.1709 0.0117  0.0260  0.0397  85  ASP A OD1 
440  O OD1 B ASP A 57  ? 0.1800 0.2027 0.1628 0.0158  0.0326  0.0393  85  ASP A OD1 
441  O OD2 A ASP A 57  ? 0.1898 0.2032 0.1635 0.0171  0.0215  0.0352  85  ASP A OD2 
442  O OD2 B ASP A 57  ? 0.1840 0.2042 0.1518 0.0203  0.0270  0.0331  85  ASP A OD2 
443  N N   . LEU A 58  ? 0.1446 0.1657 0.1358 0.0106  0.0206  0.0223  86  LEU A N   
444  C CA  . LEU A 58  ? 0.1483 0.1717 0.1396 0.0115  0.0208  0.0190  86  LEU A CA  
445  C C   . LEU A 58  ? 0.1350 0.1611 0.1358 0.0087  0.0218  0.0198  86  LEU A C   
446  O O   . LEU A 58  ? 0.1328 0.1627 0.1356 0.0099  0.0245  0.0204  86  LEU A O   
447  C CB  . LEU A 58  ? 0.1547 0.1757 0.1434 0.0115  0.0165  0.0137  86  LEU A CB  
448  C CG  . LEU A 58  ? 0.1705 0.1896 0.1500 0.0145  0.0147  0.0116  86  LEU A CG  
449  C CD1 . LEU A 58  ? 0.1743 0.1914 0.1543 0.0135  0.0105  0.0070  86  LEU A CD1 
450  C CD2 . LEU A 58  ? 0.1837 0.2042 0.1563 0.0181  0.0173  0.0112  86  LEU A CD2 
451  N N   . HIS A 59  ? 0.1276 0.1521 0.1344 0.0052  0.0194  0.0196  87  HIS A N   
452  C CA  . HIS A 59  ? 0.1282 0.1555 0.1439 0.0023  0.0194  0.0200  87  HIS A CA  
453  C C   . HIS A 59  ? 0.1323 0.1635 0.1537 0.0017  0.0235  0.0250  87  HIS A C   
454  O O   . HIS A 59  ? 0.1306 0.1665 0.1578 0.0014  0.0249  0.0258  87  HIS A O   
455  C CB  . HIS A 59  ? 0.1301 0.1539 0.1493 -0.0010 0.0158  0.0183  87  HIS A CB  
456  C CG  . HIS A 59  ? 0.1347 0.1610 0.1619 -0.0039 0.0145  0.0178  87  HIS A CG  
457  N ND1 . HIS A 59  ? 0.1435 0.1711 0.1784 -0.0070 0.0152  0.0206  87  HIS A ND1 
458  C CD2 . HIS A 59  ? 0.1379 0.1659 0.1667 -0.0041 0.0124  0.0150  87  HIS A CD2 
459  C CE1 . HIS A 59  ? 0.1433 0.1734 0.1840 -0.0091 0.0129  0.0191  87  HIS A CE1 
460  N NE2 . HIS A 59  ? 0.1391 0.1696 0.1759 -0.0072 0.0113  0.0160  87  HIS A NE2 
461  N N   . ALA A 60  ? 0.1401 0.1695 0.1602 0.0017  0.0255  0.0288  88  ALA A N   
462  C CA  . ALA A 60  ? 0.1490 0.1819 0.1750 0.0010  0.0300  0.0342  88  ALA A CA  
463  C C   . ALA A 60  ? 0.1539 0.1919 0.1775 0.0046  0.0343  0.0356  88  ALA A C   
464  O O   . ALA A 60  ? 0.1604 0.2038 0.1922 0.0037  0.0374  0.0386  88  ALA A O   
465  C CB  . ALA A 60  ? 0.1558 0.1852 0.1794 0.0011  0.0318  0.0384  88  ALA A CB  
466  N N   . ARG A 61  ? 0.1580 0.1944 0.1708 0.0087  0.0344  0.0332  89  ARG A N   
467  C CA  . ARG A 61  ? 0.1689 0.2088 0.1772 0.0128  0.0387  0.0341  89  ARG A CA  
468  C C   . ARG A 61  ? 0.1545 0.1971 0.1649 0.0140  0.0380  0.0303  89  ARG A C   
469  O O   . ARG A 61  ? 0.1609 0.2077 0.1719 0.0168  0.0425  0.0319  89  ARG A O   
470  C CB  . ARG A 61  ? 0.1932 0.2299 0.1883 0.0169  0.0393  0.0338  89  ARG A CB  
471  C CG  . ARG A 61  ? 0.2139 0.2499 0.2083 0.0167  0.0423  0.0399  89  ARG A CG  
472  C CD  . ARG A 61  ? 0.2362 0.2703 0.2173 0.0213  0.0440  0.0411  89  ARG A CD  
473  N NE  . ARG A 61  ? 0.2487 0.2783 0.2220 0.0221  0.0383  0.0362  89  ARG A NE  
474  C CZ  . ARG A 61  ? 0.2584 0.2872 0.2240 0.0248  0.0360  0.0308  89  ARG A CZ  
475  N NH1 . ARG A 61  ? 0.2702 0.3013 0.2330 0.0276  0.0391  0.0293  89  ARG A NH1 
476  N NH2 . ARG A 61  ? 0.2646 0.2898 0.2252 0.0248  0.0306  0.0269  89  ARG A NH2 
477  N N   . TYR A 62  ? 0.1372 0.1776 0.1492 0.0120  0.0330  0.0259  90  TYR A N   
478  C CA  . TYR A 62  ? 0.1326 0.1744 0.1454 0.0135  0.0322  0.0224  90  TYR A CA  
479  C C   . TYR A 62  ? 0.1210 0.1651 0.1438 0.0101  0.0293  0.0216  90  TYR A C   
480  O O   . TYR A 62  ? 0.1130 0.1588 0.1374 0.0116  0.0289  0.0196  90  TYR A O   
481  C CB  . TYR A 62  ? 0.1390 0.1758 0.1423 0.0156  0.0292  0.0173  90  TYR A CB  
482  C CG  . TYR A 62  ? 0.1559 0.1909 0.1482 0.0197  0.0316  0.0170  90  TYR A CG  
483  C CD1 . TYR A 62  ? 0.1714 0.2085 0.1602 0.0238  0.0357  0.0170  90  TYR A CD1 
484  C CD2 . TYR A 62  ? 0.1650 0.1964 0.1503 0.0198  0.0297  0.0170  90  TYR A CD2 
485  C CE1 . TYR A 62  ? 0.1907 0.2258 0.1681 0.0279  0.0376  0.0163  90  TYR A CE1 
486  C CE2 . TYR A 62  ? 0.1837 0.2138 0.1582 0.0238  0.0313  0.0167  90  TYR A CE2 
487  C CZ  . TYR A 62  ? 0.1946 0.2263 0.1647 0.0277  0.0352  0.0162  90  TYR A CZ  
488  O OH  . TYR A 62  ? 0.2258 0.2559 0.1839 0.0321  0.0370  0.0156  90  TYR A OH  
489  N N   . ALA A 63  ? 0.1164 0.1603 0.1455 0.0059  0.0272  0.0231  91  ALA A N   
490  C CA  . ALA A 63  ? 0.1125 0.1586 0.1501 0.0029  0.0240  0.0221  91  ALA A CA  
491  C C   . ALA A 63  ? 0.1137 0.1669 0.1593 0.0039  0.0265  0.0242  91  ALA A C   
492  O O   . ALA A 63  ? 0.1028 0.1579 0.1519 0.0038  0.0240  0.0224  91  ALA A O   
493  C CB  . ALA A 63  ? 0.1158 0.1606 0.1590 -0.0015 0.0218  0.0235  91  ALA A CB  
494  N N   . GLU A 64  ? 0.1244 0.1818 0.1730 0.0052  0.0315  0.0284  92  GLU A N   
495  C CA  . GLU A 64  ? 0.1360 0.2011 0.1937 0.0063  0.0344  0.0310  92  GLU A CA  
496  C C   . GLU A 64  ? 0.1314 0.1972 0.1845 0.0112  0.0360  0.0287  92  GLU A C   
497  O O   . GLU A 64  ? 0.1316 0.2035 0.1926 0.0125  0.0375  0.0301  92  GLU A O   
498  C CB  . GLU A 64  ? 0.1585 0.2282 0.2213 0.0064  0.0401  0.0367  92  GLU A CB  
499  C CG  . GLU A 64  ? 0.1815 0.2504 0.2511 0.0010  0.0383  0.0392  92  GLU A CG  
500  C CD  . GLU A 64  ? 0.2050 0.2805 0.2858 -0.0004 0.0430  0.0454  92  GLU A CD  
501  O OE1 . GLU A 64  ? 0.2365 0.3097 0.3212 -0.0044 0.0424  0.0478  92  GLU A OE1 
502  O OE2 . GLU A 64  ? 0.2299 0.3125 0.3162 0.0021  0.0474  0.0480  92  GLU A OE2 
503  N N   . ARG A 65  ? 0.1349 0.1944 0.1760 0.0140  0.0356  0.0251  93  ARG A N   
504  C CA  . ARG A 65  ? 0.1455 0.2035 0.1814 0.0183  0.0363  0.0218  93  ARG A CA  
505  C C   . ARG A 65  ? 0.1353 0.1897 0.1707 0.0169  0.0309  0.0178  93  ARG A C   
506  O O   . ARG A 65  ? 0.1552 0.2077 0.1875 0.0199  0.0308  0.0152  93  ARG A O   
507  C CB  . ARG A 65  ? 0.1687 0.2220 0.1919 0.0220  0.0388  0.0201  93  ARG A CB  
508  C CG  . ARG A 65  ? 0.1936 0.2513 0.2167 0.0249  0.0454  0.0242  93  ARG A CG  
509  C CD  . ARG A 65  ? 0.2199 0.2733 0.2298 0.0282  0.0478  0.0233  93  ARG A CD  
510  N NE  . ARG A 65  ? 0.2412 0.2904 0.2422 0.0325  0.0476  0.0183  93  ARG A NE  
511  C CZ  . ARG A 65  ? 0.2599 0.3049 0.2480 0.0361  0.0489  0.0161  93  ARG A CZ  
512  N NH1 . ARG A 65  ? 0.2722 0.3167 0.2542 0.0363  0.0506  0.0188  93  ARG A NH1 
513  N NH2 . ARG A 65  ? 0.2713 0.3120 0.2525 0.0395  0.0483  0.0109  93  ARG A NH2 
514  N N   . GLY A 66  ? 0.1193 0.1723 0.1574 0.0126  0.0265  0.0175  94  GLY A N   
515  C CA  . GLY A 66  ? 0.1140 0.1640 0.1515 0.0113  0.0218  0.0144  94  GLY A CA  
516  C C   . GLY A 66  ? 0.1092 0.1523 0.1390 0.0099  0.0188  0.0114  94  GLY A C   
517  O O   . GLY A 66  ? 0.1220 0.1624 0.1510 0.0089  0.0154  0.0090  94  GLY A O   
518  N N   . LEU A 67  ? 0.1043 0.1447 0.1287 0.0098  0.0200  0.0117  95  LEU A N   
519  C CA  . LEU A 67  ? 0.0998 0.1346 0.1183 0.0086  0.0169  0.0091  95  LEU A CA  
520  C C   . LEU A 67  ? 0.0923 0.1263 0.1148 0.0047  0.0137  0.0092  95  LEU A C   
521  O O   . LEU A 67  ? 0.0910 0.1273 0.1188 0.0024  0.0142  0.0119  95  LEU A O   
522  C CB  . LEU A 67  ? 0.1077 0.1404 0.1197 0.0098  0.0186  0.0098  95  LEU A CB  
523  C CG  . LEU A 67  ? 0.1104 0.1380 0.1171 0.0089  0.0154  0.0073  95  LEU A CG  
524  C CD1 . LEU A 67  ? 0.1165 0.1411 0.1188 0.0105  0.0137  0.0033  95  LEU A CD1 
525  C CD2 . LEU A 67  ? 0.1161 0.1425 0.1177 0.0098  0.0167  0.0090  95  LEU A CD2 
526  N N   . ARG A 68  ? 0.0864 0.1168 0.1065 0.0040  0.0106  0.0064  96  ARG A N   
527  C CA  . ARG A 68  ? 0.0816 0.1100 0.1032 0.0009  0.0077  0.0058  96  ARG A CA  
528  C C   . ARG A 68  ? 0.0814 0.1051 0.0974 0.0011  0.0065  0.0037  96  ARG A C   
529  O O   . ARG A 68  ? 0.0863 0.1083 0.0981 0.0032  0.0067  0.0020  96  ARG A O   
530  C CB  . ARG A 68  ? 0.0799 0.1097 0.1048 0.0002  0.0054  0.0049  96  ARG A CB  
531  C CG  . ARG A 68  ? 0.0798 0.1154 0.1115 0.0001  0.0061  0.0072  96  ARG A CG  
532  C CD  . ARG A 68  ? 0.0800 0.1181 0.1175 -0.0028 0.0059  0.0094  96  ARG A CD  
533  N NE  . ARG A 68  ? 0.0794 0.1241 0.1252 -0.0031 0.0064  0.0118  96  ARG A NE  
534  C CZ  . ARG A 68  ? 0.0811 0.1302 0.1311 -0.0019 0.0101  0.0147  96  ARG A CZ  
535  N NH1 . ARG A 68  ? 0.0843 0.1317 0.1297 0.0000  0.0138  0.0155  96  ARG A NH1 
536  N NH2 . ARG A 68  ? 0.0835 0.1392 0.1424 -0.0025 0.0102  0.0170  96  ARG A NH2 
537  N N   . ILE A 69  ? 0.0824 0.1036 0.0986 -0.0009 0.0051  0.0036  97  ILE A N   
538  C CA  . ILE A 69  ? 0.0876 0.1049 0.0996 -0.0006 0.0040  0.0021  97  ILE A CA  
539  C C   . ILE A 69  ? 0.0855 0.1006 0.0985 -0.0025 0.0020  0.0007  97  ILE A C   
540  O O   . ILE A 69  ? 0.0921 0.1070 0.1079 -0.0045 0.0013  0.0013  97  ILE A O   
541  C CB  . ILE A 69  ? 0.0950 0.1111 0.1052 -0.0003 0.0052  0.0038  97  ILE A CB  
542  C CG1 . ILE A 69  ? 0.1011 0.1196 0.1092 0.0019  0.0076  0.0054  97  ILE A CG1 
543  C CG2 . ILE A 69  ? 0.0989 0.1117 0.1059 0.0002  0.0037  0.0023  97  ILE A CG2 
544  C CD1 . ILE A 69  ? 0.1106 0.1282 0.1159 0.0028  0.0089  0.0078  97  ILE A CD1 
545  N N   . LEU A 70  ? 0.0839 0.0971 0.0945 -0.0017 0.0010  -0.0012 98  LEU A N   
546  C CA  . LEU A 70  ? 0.0855 0.0963 0.0956 -0.0027 -0.0002 -0.0026 98  LEU A CA  
547  C C   . LEU A 70  ? 0.0843 0.0924 0.0925 -0.0022 -0.0001 -0.0032 98  LEU A C   
548  O O   . LEU A 70  ? 0.0908 0.0989 0.0979 -0.0009 0.0000  -0.0038 98  LEU A O   
549  C CB  . LEU A 70  ? 0.0893 0.1005 0.0987 -0.0021 -0.0007 -0.0036 98  LEU A CB  
550  C CG  . LEU A 70  ? 0.0955 0.1094 0.1068 -0.0021 -0.0011 -0.0029 98  LEU A CG  
551  C CD1 . LEU A 70  ? 0.0977 0.1144 0.1106 -0.0007 0.0001  -0.0019 98  LEU A CD1 
552  C CD2 . LEU A 70  ? 0.1013 0.1142 0.1112 -0.0014 -0.0017 -0.0035 98  LEU A CD2 
553  N N   . ALA A 71  ? 0.0840 0.0897 0.0924 -0.0031 -0.0003 -0.0031 99  ALA A N   
554  C CA  . ALA A 71  ? 0.0853 0.0886 0.0928 -0.0023 -0.0001 -0.0033 99  ALA A CA  
555  C C   . ALA A 71  ? 0.0849 0.0858 0.0916 -0.0024 -0.0003 -0.0050 99  ALA A C   
556  O O   . ALA A 71  ? 0.0918 0.0905 0.0980 -0.0035 -0.0007 -0.0058 99  ALA A O   
557  C CB  . ALA A 71  ? 0.0910 0.0928 0.0994 -0.0027 0.0003  -0.0016 99  ALA A CB  
558  N N   . PHE A 72  ? 0.0820 0.0831 0.0885 -0.0011 0.0000  -0.0056 100 PHE A N   
559  C CA  . PHE A 72  ? 0.0859 0.0853 0.0916 -0.0006 0.0007  -0.0067 100 PHE A CA  
560  C C   . PHE A 72  ? 0.0861 0.0841 0.0931 0.0005  0.0014  -0.0065 100 PHE A C   
561  O O   . PHE A 72  ? 0.0874 0.0875 0.0964 0.0015  0.0013  -0.0059 100 PHE A O   
562  C CB  . PHE A 72  ? 0.0863 0.0876 0.0924 -0.0002 0.0011  -0.0069 100 PHE A CB  
563  C CG  . PHE A 72  ? 0.0889 0.0910 0.0937 -0.0009 0.0006  -0.0070 100 PHE A CG  
564  C CD1 . PHE A 72  ? 0.0898 0.0940 0.0956 -0.0011 0.0000  -0.0064 100 PHE A CD1 
565  C CD2 . PHE A 72  ? 0.0976 0.0982 0.0997 -0.0010 0.0008  -0.0075 100 PHE A CD2 
566  C CE1 . PHE A 72  ? 0.0951 0.1003 0.1003 -0.0013 -0.0004 -0.0061 100 PHE A CE1 
567  C CE2 . PHE A 72  ? 0.1029 0.1046 0.1038 -0.0013 0.0000  -0.0072 100 PHE A CE2 
568  C CZ  . PHE A 72  ? 0.0997 0.1040 0.1028 -0.0015 -0.0006 -0.0064 100 PHE A CZ  
569  N N   . PRO A 73  ? 0.0900 0.0844 0.0959 0.0007  0.0020  -0.0071 101 PRO A N   
570  C CA  . PRO A 73  ? 0.0947 0.0879 0.1023 0.0024  0.0030  -0.0067 101 PRO A CA  
571  C C   . PRO A 73  ? 0.0928 0.0876 0.1016 0.0038  0.0044  -0.0071 101 PRO A C   
572  O O   . PRO A 73  ? 0.0958 0.0905 0.1026 0.0035  0.0052  -0.0080 101 PRO A O   
573  C CB  . PRO A 73  ? 0.1004 0.0883 0.1061 0.0023  0.0035  -0.0079 101 PRO A CB  
574  C CG  . PRO A 73  ? 0.1031 0.0903 0.1072 0.0000  0.0020  -0.0084 101 PRO A CG  
575  C CD  . PRO A 73  ? 0.0972 0.0885 0.1009 -0.0006 0.0015  -0.0083 101 PRO A CD  
576  N N   . SER A 74  ? 0.0964 0.0930 0.1089 0.0054  0.0047  -0.0061 102 SER A N   
577  C CA  . SER A 74  ? 0.0991 0.0977 0.1145 0.0067  0.0065  -0.0061 102 SER A CA  
578  C C   . SER A 74  ? 0.0990 0.0980 0.1183 0.0089  0.0071  -0.0051 102 SER A C   
579  O O   . SER A 74  ? 0.1028 0.1027 0.1236 0.0093  0.0053  -0.0039 102 SER A O   
580  C CB  . SER A 74  ? 0.1002 0.1032 0.1186 0.0057  0.0055  -0.0056 102 SER A CB  
581  O OG  . SER A 74  ? 0.1116 0.1167 0.1339 0.0066  0.0076  -0.0051 102 SER A OG  
582  N N   . ASN A 75  ? 0.1021 0.1005 0.1227 0.0107  0.0100  -0.0054 103 ASN A N   
583  C CA  . ASN A 75  ? 0.1052 0.1044 0.1305 0.0134  0.0111  -0.0043 103 ASN A CA  
584  C C   . ASN A 75  ? 0.1055 0.1111 0.1383 0.0140  0.0115  -0.0028 103 ASN A C   
585  O O   . ASN A 75  ? 0.1145 0.1217 0.1523 0.0165  0.0131  -0.0018 103 ASN A O   
586  C CB  . ASN A 75  ? 0.1130 0.1072 0.1352 0.0155  0.0145  -0.0056 103 ASN A CB  
587  C CG  . ASN A 75  ? 0.1179 0.1109 0.1437 0.0186  0.0155  -0.0046 103 ASN A CG  
588  O OD1 . ASN A 75  ? 0.1218 0.1152 0.1498 0.0187  0.0132  -0.0031 103 ASN A OD1 
589  N ND2 . ASN A 75  ? 0.1268 0.1180 0.1529 0.0213  0.0193  -0.0053 103 ASN A ND2 
590  N N   . GLN A 76  ? 0.1037 0.1128 0.1380 0.0118  0.0099  -0.0027 104 GLN A N   
591  C CA  . GLN A 76  ? 0.1064 0.1212 0.1488 0.0117  0.0101  -0.0015 104 GLN A CA  
592  C C   . GLN A 76  ? 0.1058 0.1252 0.1544 0.0122  0.0066  -0.0005 104 GLN A C   
593  O O   . GLN A 76  ? 0.1141 0.1388 0.1710 0.0120  0.0064  0.0004  104 GLN A O   
594  C CB  . GLN A 76  ? 0.1090 0.1250 0.1511 0.0092  0.0098  -0.0020 104 GLN A CB  
595  C CG  . GLN A 76  ? 0.1167 0.1303 0.1553 0.0094  0.0137  -0.0020 104 GLN A CG  
596  C CD  . GLN A 76  ? 0.1161 0.1312 0.1562 0.0072  0.0137  -0.0016 104 GLN A CD  
597  O OE1 . GLN A 76  ? 0.1094 0.1234 0.1466 0.0054  0.0111  -0.0025 104 GLN A OE1 
598  N NE2 . GLN A 76  ? 0.1249 0.1424 0.1700 0.0075  0.0169  0.0000  104 GLN A NE2 
599  N N   . PHE A 77  ? 0.1047 0.1225 0.1501 0.0127  0.0039  -0.0004 105 PHE A N   
600  C CA  . PHE A 77  ? 0.1062 0.1283 0.1557 0.0132  0.0000  0.0005  105 PHE A CA  
601  C C   . PHE A 77  ? 0.1127 0.1337 0.1627 0.0162  0.0000  0.0023  105 PHE A C   
602  O O   . PHE A 77  ? 0.1216 0.1386 0.1659 0.0167  -0.0007 0.0027  105 PHE A O   
603  C CB  . PHE A 77  ? 0.1044 0.1259 0.1487 0.0112  -0.0034 -0.0004 105 PHE A CB  
604  C CG  . PHE A 77  ? 0.0999 0.1215 0.1437 0.0086  -0.0031 -0.0021 105 PHE A CG  
605  C CD1 . PHE A 77  ? 0.1010 0.1269 0.1517 0.0073  -0.0044 -0.0024 105 PHE A CD1 
606  C CD2 . PHE A 77  ? 0.1009 0.1183 0.1382 0.0073  -0.0015 -0.0031 105 PHE A CD2 
607  C CE1 . PHE A 77  ? 0.1024 0.1275 0.1530 0.0050  -0.0038 -0.0036 105 PHE A CE1 
608  C CE2 . PHE A 77  ? 0.1015 0.1187 0.1384 0.0054  -0.0012 -0.0041 105 PHE A CE2 
609  C CZ  . PHE A 77  ? 0.1016 0.1224 0.1451 0.0043  -0.0021 -0.0043 105 PHE A CZ  
610  N N   . GLY A 78  ? 0.1155 0.1404 0.1734 0.0184  0.0009  0.0037  106 GLY A N   
611  C CA  . GLY A 78  ? 0.1220 0.1462 0.1820 0.0219  0.0011  0.0057  106 GLY A CA  
612  C C   . GLY A 78  ? 0.1299 0.1468 0.1849 0.0236  0.0052  0.0053  106 GLY A C   
613  O O   . GLY A 78  ? 0.1334 0.1475 0.1880 0.0261  0.0052  0.0068  106 GLY A O   
614  N N   . LYS A 79  ? 0.1360 0.1494 0.1870 0.0222  0.0084  0.0032  107 LYS A N   
615  C CA  . LYS A 79  ? 0.1479 0.1535 0.1928 0.0233  0.0115  0.0019  107 LYS A CA  
616  C C   . LYS A 79  ? 0.1383 0.1388 0.1780 0.0227  0.0094  0.0023  107 LYS A C   
617  O O   . LYS A 79  ? 0.1462 0.1414 0.1847 0.0248  0.0108  0.0026  107 LYS A O   
618  C CB  . LYS A 79  ? 0.1751 0.1800 0.2242 0.0272  0.0154  0.0024  107 LYS A CB  
619  C CG  . LYS A 79  ? 0.1938 0.2035 0.2477 0.0276  0.0185  0.0023  107 LYS A CG  
620  C CD  . LYS A 79  ? 0.2176 0.2258 0.2742 0.0318  0.0234  0.0025  107 LYS A CD  
621  C CE  . LYS A 79  ? 0.2321 0.2462 0.2943 0.0322  0.0270  0.0032  107 LYS A CE  
622  N NZ  . LYS A 79  ? 0.2464 0.2592 0.3026 0.0291  0.0278  0.0016  107 LYS A NZ  
623  N N   . GLN A 80  ? 0.1275 0.1295 0.1642 0.0200  0.0063  0.0023  108 GLN A N   
624  C CA  . GLN A 80  ? 0.1272 0.1255 0.1598 0.0196  0.0046  0.0035  108 GLN A CA  
625  C C   . GLN A 80  ? 0.1243 0.1167 0.1507 0.0171  0.0056  0.0016  108 GLN A C   
626  O O   . GLN A 80  ? 0.1265 0.1162 0.1500 0.0161  0.0045  0.0027  108 GLN A O   
627  C CB  . GLN A 80  ? 0.1281 0.1315 0.1609 0.0188  0.0008  0.0050  108 GLN A CB  
628  C CG  . GLN A 80  ? 0.1372 0.1456 0.1760 0.0216  -0.0010 0.0072  108 GLN A CG  
629  C CD  . GLN A 80  ? 0.1445 0.1581 0.1828 0.0209  -0.0053 0.0080  108 GLN A CD  
630  O OE1 . GLN A 80  ? 0.1574 0.1710 0.1912 0.0185  -0.0064 0.0066  108 GLN A OE1 
631  N NE2 . GLN A 80  ? 0.1559 0.1737 0.1985 0.0234  -0.0079 0.0102  108 GLN A NE2 
632  N N   . GLU A 81  ? 0.1212 0.1118 0.1457 0.0162  0.0077  -0.0009 109 GLU A N   
633  C CA  . GLU A 81  ? 0.1239 0.1091 0.1430 0.0141  0.0082  -0.0030 109 GLU A CA  
634  C C   . GLU A 81  ? 0.1284 0.1090 0.1456 0.0156  0.0112  -0.0053 109 GLU A C   
635  O O   . GLU A 81  ? 0.1282 0.1084 0.1421 0.0145  0.0121  -0.0075 109 GLU A O   
636  C CB  . GLU A 81  ? 0.1233 0.1113 0.1399 0.0111  0.0069  -0.0040 109 GLU A CB  
637  C CG  . GLU A 81  ? 0.1305 0.1142 0.1424 0.0087  0.0065  -0.0056 109 GLU A CG  
638  C CD  . GLU A 81  ? 0.1345 0.1169 0.1464 0.0075  0.0050  -0.0038 109 GLU A CD  
639  O OE1 . GLU A 81  ? 0.1409 0.1199 0.1542 0.0088  0.0055  -0.0024 109 GLU A OE1 
640  O OE2 . GLU A 81  ? 0.1362 0.1211 0.1471 0.0054  0.0037  -0.0034 109 GLU A OE2 
641  N N   . PRO A 82  ? 0.1377 0.1144 0.1566 0.0184  0.0128  -0.0049 110 PRO A N   
642  C CA  . PRO A 82  ? 0.1481 0.1206 0.1652 0.0206  0.0161  -0.0074 110 PRO A CA  
643  C C   . PRO A 82  ? 0.1587 0.1232 0.1691 0.0191  0.0162  -0.0108 110 PRO A C   
644  O O   . PRO A 82  ? 0.1757 0.1365 0.1824 0.0208  0.0187  -0.0136 110 PRO A O   
645  C CB  . PRO A 82  ? 0.1538 0.1249 0.1756 0.0245  0.0175  -0.0055 110 PRO A CB  
646  C CG  . PRO A 82  ? 0.1519 0.1221 0.1751 0.0235  0.0147  -0.0029 110 PRO A CG  
647  C CD  . PRO A 82  ? 0.1407 0.1172 0.1636 0.0203  0.0119  -0.0020 110 PRO A CD  
648  N N   . GLY A 83  ? 0.1566 0.1185 0.1655 0.0161  0.0136  -0.0107 111 GLY A N   
649  C CA  . GLY A 83  ? 0.1636 0.1176 0.1678 0.0144  0.0130  -0.0138 111 GLY A CA  
650  C C   . GLY A 83  ? 0.1620 0.1162 0.1605 0.0122  0.0122  -0.0169 111 GLY A C   
651  O O   . GLY A 83  ? 0.1621 0.1225 0.1602 0.0116  0.0120  -0.0162 111 GLY A O   
652  N N   . SER A 84  ? 0.1655 0.1124 0.1596 0.0108  0.0113  -0.0204 112 SER A N   
653  C CA  . SER A 84  ? 0.1667 0.1134 0.1550 0.0085  0.0095  -0.0234 112 SER A CA  
654  C C   . SER A 84  ? 0.1543 0.1057 0.1451 0.0046  0.0063  -0.0215 112 SER A C   
655  O O   . SER A 84  ? 0.1480 0.1008 0.1440 0.0034  0.0055  -0.0185 112 SER A O   
656  C CB  . SER A 84  ? 0.1818 0.1192 0.1651 0.0079  0.0085  -0.0280 112 SER A CB  
657  O OG  . SER A 84  ? 0.1884 0.1219 0.1758 0.0051  0.0064  -0.0273 112 SER A OG  
658  N N   . ASN A 85  ? 0.1508 0.1047 0.1379 0.0029  0.0045  -0.0231 113 ASN A N   
659  C CA  . ASN A 85  ? 0.1467 0.1050 0.1363 -0.0005 0.0016  -0.0215 113 ASN A CA  
660  C C   . ASN A 85  ? 0.1476 0.1018 0.1404 -0.0034 -0.0004 -0.0217 113 ASN A C   
661  O O   . ASN A 85  ? 0.1397 0.0975 0.1375 -0.0053 -0.0011 -0.0186 113 ASN A O   
662  C CB  . ASN A 85  ? 0.1506 0.1115 0.1355 -0.0014 0.0000  -0.0232 113 ASN A CB  
663  C CG  . ASN A 85  ? 0.1510 0.1175 0.1349 0.0007  0.0021  -0.0214 113 ASN A CG  
664  O OD1 . ASN A 85  ? 0.1539 0.1249 0.1426 0.0012  0.0032  -0.0184 113 ASN A OD1 
665  N ND2 . ASN A 85  ? 0.1666 0.1325 0.1443 0.0019  0.0026  -0.0232 113 ASN A ND2 
666  N N   . GLU A 86  ? 0.1596 0.1059 0.1496 -0.0038 -0.0011 -0.0253 114 GLU A N   
667  C CA  . GLU A 86  ? 0.1709 0.1126 0.1652 -0.0069 -0.0029 -0.0253 114 GLU A CA  
668  C C   . GLU A 86  ? 0.1635 0.1045 0.1636 -0.0061 -0.0008 -0.0211 114 GLU A C   
669  O O   . GLU A 86  ? 0.1585 0.1009 0.1641 -0.0088 -0.0017 -0.0183 114 GLU A O   
670  C CB  . GLU A 86  ? 0.1963 0.1284 0.1862 -0.0073 -0.0041 -0.0305 114 GLU A CB  
671  C CG  . GLU A 86  ? 0.2181 0.1436 0.2131 -0.0106 -0.0058 -0.0309 114 GLU A CG  
672  C CD  . GLU A 86  ? 0.2279 0.1578 0.2282 -0.0155 -0.0092 -0.0295 114 GLU A CD  
673  O OE1 . GLU A 86  ? 0.2446 0.1724 0.2521 -0.0181 -0.0094 -0.0270 114 GLU A OE1 
674  O OE2 . GLU A 86  ? 0.2487 0.1841 0.2467 -0.0167 -0.0116 -0.0307 114 GLU A OE2 
675  N N   . GLU A 87  ? 0.1623 0.1018 0.1618 -0.0021 0.0020  -0.0204 115 GLU A N   
676  C CA  . GLU A 87  ? 0.1643 0.1036 0.1687 -0.0007 0.0037  -0.0162 115 GLU A CA  
677  C C   . GLU A 87  ? 0.1490 0.0971 0.1566 -0.0013 0.0035  -0.0117 115 GLU A C   
678  O O   . GLU A 87  ? 0.1479 0.0963 0.1594 -0.0021 0.0036  -0.0080 115 GLU A O   
679  C CB  . GLU A 87  ? 0.1753 0.1125 0.1788 0.0039  0.0066  -0.0162 115 GLU A CB  
680  C CG  . GLU A 87  ? 0.1961 0.1230 0.1972 0.0051  0.0074  -0.0201 115 GLU A CG  
681  C CD  . GLU A 87  ? 0.2100 0.1352 0.2089 0.0102  0.0107  -0.0213 115 GLU A CD  
682  O OE1 . GLU A 87  ? 0.2206 0.1529 0.2195 0.0124  0.0121  -0.0200 115 GLU A OE1 
683  O OE2 . GLU A 87  ? 0.2374 0.1536 0.2353 0.0120  0.0120  -0.0236 115 GLU A OE2 
684  N N   . ILE A 88  ? 0.1398 0.0945 0.1453 -0.0007 0.0033  -0.0121 116 ILE A N   
685  C CA  . ILE A 88  ? 0.1333 0.0957 0.1410 -0.0011 0.0029  -0.0087 116 ILE A CA  
686  C C   . ILE A 88  ? 0.1328 0.0968 0.1426 -0.0047 0.0013  -0.0075 116 ILE A C   
687  O O   . ILE A 88  ? 0.1328 0.1001 0.1453 -0.0051 0.0017  -0.0039 116 ILE A O   
688  C CB  . ILE A 88  ? 0.1293 0.0974 0.1346 0.0000  0.0031  -0.0096 116 ILE A CB  
689  C CG1 . ILE A 88  ? 0.1336 0.1013 0.1387 0.0036  0.0051  -0.0099 116 ILE A CG1 
690  C CG2 . ILE A 88  ? 0.1234 0.0985 0.1305 -0.0005 0.0025  -0.0069 116 ILE A CG2 
691  C CD1 . ILE A 88  ? 0.1349 0.1060 0.1375 0.0045  0.0059  -0.0115 116 ILE A CD1 
692  N N   . LYS A 89  ? 0.1358 0.0980 0.1443 -0.0072 -0.0004 -0.0106 117 LYS A N   
693  C CA  . LYS A 89  ? 0.1409 0.1048 0.1528 -0.0109 -0.0022 -0.0097 117 LYS A CA  
694  C C   . LYS A 89  ? 0.1425 0.1028 0.1593 -0.0122 -0.0014 -0.0068 117 LYS A C   
695  O O   . LYS A 89  ? 0.1390 0.1034 0.1598 -0.0136 -0.0008 -0.0031 117 LYS A O   
696  C CB  . LYS A 89  ? 0.1523 0.1138 0.1622 -0.0132 -0.0049 -0.0140 117 LYS A CB  
697  C CG  . LYS A 89  ? 0.1611 0.1253 0.1759 -0.0172 -0.0073 -0.0132 117 LYS A CG  
698  C CD  . LYS A 89  ? 0.1774 0.1388 0.1900 -0.0195 -0.0108 -0.0177 117 LYS A CD  
699  C CE  . LYS A 89  ? 0.1884 0.1536 0.2076 -0.0237 -0.0136 -0.0167 117 LYS A CE  
700  N NZ  . LYS A 89  ? 0.2029 0.1652 0.2199 -0.0261 -0.0179 -0.0216 117 LYS A NZ  
701  N N   . GLU A 90  ? 0.1515 0.1039 0.1681 -0.0116 -0.0008 -0.0081 118 GLU A N   
702  C CA  . GLU A 90  ? 0.1658 0.1136 0.1873 -0.0128 0.0001  -0.0049 118 GLU A CA  
703  C C   . GLU A 90  ? 0.1582 0.1097 0.1807 -0.0102 0.0025  0.0003  118 GLU A C   
704  O O   . GLU A 90  ? 0.1579 0.1099 0.1845 -0.0115 0.0035  0.0045  118 GLU A O   
705  C CB  . GLU A 90  ? 0.1896 0.1273 0.2102 -0.0121 0.0004  -0.0077 118 GLU A CB  
706  C CG  . GLU A 90  ? 0.2133 0.1460 0.2326 -0.0152 -0.0024 -0.0132 118 GLU A CG  
707  C CD  . GLU A 90  ? 0.2505 0.1718 0.2691 -0.0149 -0.0023 -0.0163 118 GLU A CD  
708  O OE1 . GLU A 90  ? 0.2804 0.1971 0.3016 -0.0130 0.0000  -0.0134 118 GLU A OE1 
709  O OE2 . GLU A 90  ? 0.2793 0.1958 0.2944 -0.0163 -0.0046 -0.0219 118 GLU A OE2 
710  N N   . PHE A 91  ? 0.1549 0.1089 0.1740 -0.0064 0.0033  0.0002  119 PHE A N   
711  C CA  . PHE A 91  ? 0.1557 0.1137 0.1750 -0.0037 0.0047  0.0047  119 PHE A CA  
712  C C   . PHE A 91  ? 0.1457 0.1109 0.1656 -0.0050 0.0047  0.0074  119 PHE A C   
713  O O   . PHE A 91  ? 0.1470 0.1132 0.1684 -0.0048 0.0059  0.0119  119 PHE A O   
714  C CB  . PHE A 91  ? 0.1588 0.1195 0.1753 0.0000  0.0049  0.0035  119 PHE A CB  
715  C CG  . PHE A 91  ? 0.1647 0.1295 0.1812 0.0027  0.0054  0.0076  119 PHE A CG  
716  C CD1 . PHE A 91  ? 0.1750 0.1362 0.1929 0.0053  0.0064  0.0106  119 PHE A CD1 
717  C CD2 . PHE A 91  ? 0.1644 0.1365 0.1793 0.0030  0.0047  0.0084  119 PHE A CD2 
718  C CE1 . PHE A 91  ? 0.1800 0.1453 0.1973 0.0080  0.0063  0.0145  119 PHE A CE1 
719  C CE2 . PHE A 91  ? 0.1690 0.1447 0.1829 0.0056  0.0046  0.0117  119 PHE A CE2 
720  C CZ  . PHE A 91  ? 0.1780 0.1506 0.1930 0.0081  0.0052  0.0148  119 PHE A CZ  
721  N N   . ALA A 92  ? 0.1407 0.1106 0.1591 -0.0061 0.0034  0.0048  120 ALA A N   
722  C CA  . ALA A 92  ? 0.1359 0.1124 0.1550 -0.0071 0.0036  0.0069  120 ALA A CA  
723  C C   . ALA A 92  ? 0.1360 0.1119 0.1598 -0.0102 0.0042  0.0094  120 ALA A C   
724  O O   . ALA A 92  ? 0.1357 0.1153 0.1605 -0.0099 0.0059  0.0134  120 ALA A O   
725  C CB  . ALA A 92  ? 0.1330 0.1137 0.1502 -0.0076 0.0022  0.0036  120 ALA A CB  
726  N N   . ALA A 93  ? 0.1399 0.1111 0.1666 -0.0131 0.0030  0.0072  121 ALA A N   
727  C CA  . ALA A 93  ? 0.1426 0.1133 0.1756 -0.0167 0.0033  0.0097  121 ALA A CA  
728  C C   . ALA A 93  ? 0.1465 0.1146 0.1817 -0.0159 0.0061  0.0150  121 ALA A C   
729  O O   . ALA A 93  ? 0.1492 0.1200 0.1890 -0.0176 0.0078  0.0191  121 ALA A O   
730  C CB  . ALA A 93  ? 0.1512 0.1163 0.1870 -0.0201 0.0008  0.0058  121 ALA A CB  
731  N N   . GLY A 94  ? 0.1473 0.1106 0.1795 -0.0129 0.0069  0.0156  122 GLY A N   
732  C CA  . GLY A 94  ? 0.1538 0.1145 0.1873 -0.0115 0.0094  0.0212  122 GLY A CA  
733  C C   . GLY A 94  ? 0.1525 0.1199 0.1837 -0.0093 0.0114  0.0259  122 GLY A C   
734  O O   . GLY A 94  ? 0.1583 0.1245 0.1910 -0.0088 0.0139  0.0313  122 GLY A O   
735  N N   . TYR A 95  ? 0.1500 0.1240 0.1771 -0.0078 0.0105  0.0238  123 TYR A N   
736  C CA  . TYR A 95  ? 0.1579 0.1383 0.1818 -0.0058 0.0121  0.0271  123 TYR A CA  
737  C C   . TYR A 95  ? 0.1550 0.1405 0.1826 -0.0084 0.0133  0.0279  123 TYR A C   
738  O O   . TYR A 95  ? 0.1613 0.1523 0.1859 -0.0067 0.0147  0.0296  123 TYR A O   
739  C CB  . TYR A 95  ? 0.1644 0.1485 0.1822 -0.0027 0.0104  0.0241  123 TYR A CB  
740  C CG  . TYR A 95  ? 0.1824 0.1641 0.1968 0.0007  0.0099  0.0253  123 TYR A CG  
741  C CD1 . TYR A 95  ? 0.2007 0.1830 0.2124 0.0033  0.0114  0.0304  123 TYR A CD1 
742  C CD2 . TYR A 95  ? 0.1973 0.1767 0.2113 0.0018  0.0080  0.0218  123 TYR A CD2 
743  C CE1 . TYR A 95  ? 0.2174 0.1982 0.2264 0.0067  0.0105  0.0319  123 TYR A CE1 
744  C CE2 . TYR A 95  ? 0.2097 0.1880 0.2219 0.0053  0.0075  0.0233  123 TYR A CE2 
745  C CZ  . TYR A 95  ? 0.2199 0.1990 0.2297 0.0077  0.0084  0.0284  123 TYR A CZ  
746  O OH  . TYR A 95  ? 0.2494 0.2279 0.2575 0.0113  0.0074  0.0303  123 TYR A OH  
747  N N   . ASN A 96  ? 0.1515 0.1351 0.1856 -0.0125 0.0125  0.0266  124 ASN A N   
748  C CA  . ASN A 96  ? 0.1523 0.1415 0.1917 -0.0152 0.0131  0.0273  124 ASN A CA  
749  C C   . ASN A 96  ? 0.1370 0.1321 0.1730 -0.0139 0.0117  0.0238  124 ASN A C   
750  O O   . ASN A 96  ? 0.1352 0.1364 0.1727 -0.0138 0.0133  0.0255  124 ASN A O   
751  C CB  . ASN A 96  ? 0.1709 0.1632 0.2133 -0.0151 0.0173  0.0338  124 ASN A CB  
752  C CG  . ASN A 96  ? 0.1881 0.1832 0.2406 -0.0195 0.0180  0.0354  124 ASN A CG  
753  O OD1 . ASN A 96  ? 0.2058 0.2000 0.2631 -0.0229 0.0148  0.0316  124 ASN A OD1 
754  N ND2 . ASN A 96  ? 0.2097 0.2085 0.2657 -0.0195 0.0222  0.0413  124 ASN A ND2 
755  N N   . VAL A 97  ? 0.1274 0.1206 0.1591 -0.0129 0.0090  0.0192  125 VAL A N   
756  C CA  . VAL A 97  ? 0.1204 0.1183 0.1495 -0.0120 0.0075  0.0159  125 VAL A CA  
757  C C   . VAL A 97  ? 0.1183 0.1193 0.1532 -0.0152 0.0062  0.0148  125 VAL A C   
758  O O   . VAL A 97  ? 0.1285 0.1260 0.1667 -0.0181 0.0040  0.0128  125 VAL A O   
759  C CB  . VAL A 97  ? 0.1184 0.1132 0.1426 -0.0105 0.0052  0.0117  125 VAL A CB  
760  C CG1 . VAL A 97  ? 0.1142 0.1126 0.1369 -0.0104 0.0036  0.0084  125 VAL A CG1 
761  C CG2 . VAL A 97  ? 0.1186 0.1126 0.1379 -0.0071 0.0062  0.0130  125 VAL A CG2 
762  N N   . LYS A 98  ? 0.1181 0.1255 0.1540 -0.0144 0.0072  0.0158  126 LYS A N   
763  C CA  . LYS A 98  ? 0.1201 0.1318 0.1619 -0.0169 0.0057  0.0149  126 LYS A CA  
764  C C   . LYS A 98  ? 0.1132 0.1282 0.1516 -0.0151 0.0042  0.0120  126 LYS A C   
765  O O   . LYS A 98  ? 0.1203 0.1395 0.1630 -0.0164 0.0028  0.0115  126 LYS A O   
766  C CB  . LYS A 98  ? 0.1285 0.1454 0.1771 -0.0178 0.0088  0.0195  126 LYS A CB  
767  C CG  . LYS A 98  ? 0.1447 0.1582 0.1980 -0.0201 0.0106  0.0232  126 LYS A CG  
768  C CD  . LYS A 98  ? 0.1588 0.1780 0.2193 -0.0208 0.0144  0.0285  126 LYS A CD  
769  C CE  . LYS A 98  ? 0.1782 0.1936 0.2432 -0.0228 0.0169  0.0329  126 LYS A CE  
770  N NZ  . LYS A 98  ? 0.1969 0.2185 0.2687 -0.0232 0.0214  0.0386  126 LYS A NZ  
771  N N   . PHE A 99  ? 0.1080 0.1213 0.1393 -0.0121 0.0044  0.0104  127 PHE A N   
772  C CA  . PHE A 99  ? 0.1032 0.1183 0.1311 -0.0104 0.0031  0.0077  127 PHE A CA  
773  C C   . PHE A 99  ? 0.1021 0.1135 0.1279 -0.0114 0.0002  0.0042  127 PHE A C   
774  O O   . PHE A 99  ? 0.1139 0.1216 0.1413 -0.0136 -0.0010 0.0035  127 PHE A O   
775  C CB  . PHE A 99  ? 0.1014 0.1169 0.1237 -0.0070 0.0048  0.0078  127 PHE A CB  
776  C CG  . PHE A 99  ? 0.1040 0.1154 0.1221 -0.0058 0.0051  0.0079  127 PHE A CG  
777  C CD1 . PHE A 99  ? 0.1042 0.1123 0.1195 -0.0054 0.0033  0.0052  127 PHE A CD1 
778  C CD2 . PHE A 99  ? 0.1091 0.1205 0.1262 -0.0047 0.0073  0.0110  127 PHE A CD2 
779  C CE1 . PHE A 99  ? 0.1071 0.1122 0.1196 -0.0041 0.0034  0.0055  127 PHE A CE1 
780  C CE2 . PHE A 99  ? 0.1106 0.1188 0.1239 -0.0032 0.0071  0.0113  127 PHE A CE2 
781  C CZ  . PHE A 99  ? 0.1088 0.1140 0.1203 -0.0029 0.0051  0.0085  127 PHE A CZ  
782  N N   . ASP A 100 ? 0.1010 0.1130 0.1233 -0.0099 -0.0007 0.0021  128 ASP A N   
783  C CA  . ASP A 100 ? 0.1039 0.1135 0.1242 -0.0107 -0.0032 -0.0006 128 ASP A CA  
784  C C   . ASP A 100 ? 0.1006 0.1056 0.1161 -0.0094 -0.0029 -0.0024 128 ASP A C   
785  O O   . ASP A 100 ? 0.1063 0.1118 0.1194 -0.0073 -0.0018 -0.0023 128 ASP A O   
786  C CB  . ASP A 100 ? 0.1098 0.1231 0.1299 -0.0098 -0.0042 -0.0012 128 ASP A CB  
787  C CG  . ASP A 100 ? 0.1186 0.1371 0.1447 -0.0110 -0.0047 0.0005  128 ASP A CG  
788  O OD1 . ASP A 100 ? 0.1354 0.1540 0.1658 -0.0137 -0.0059 0.0009  128 ASP A OD1 
789  O OD2 . ASP A 100 ? 0.1293 0.1517 0.1564 -0.0092 -0.0036 0.0016  128 ASP A OD2 
790  N N   . MET A 101 ? 0.1024 0.1031 0.1171 -0.0106 -0.0040 -0.0040 129 MET A N   
791  C CA  . MET A 101 ? 0.1068 0.1030 0.1176 -0.0092 -0.0034 -0.0056 129 MET A CA  
792  C C   . MET A 101 ? 0.1066 0.1016 0.1136 -0.0088 -0.0047 -0.0082 129 MET A C   
793  O O   . MET A 101 ? 0.1150 0.1097 0.1217 -0.0104 -0.0068 -0.0096 129 MET A O   
794  C CB  . MET A 101 ? 0.1176 0.1087 0.1295 -0.0102 -0.0033 -0.0057 129 MET A CB  
795  C CG  . MET A 101 ? 0.1245 0.1160 0.1395 -0.0103 -0.0018 -0.0025 129 MET A CG  
796  S SD  . MET A 101 ? 0.1320 0.1250 0.1448 -0.0070 0.0000  -0.0007 129 MET A SD  
797  C CE  . MET A 101 ? 0.1401 0.1281 0.1504 -0.0053 0.0002  -0.0029 129 MET A CE  
798  N N   . PHE A 102 ? 0.1006 0.0951 0.1048 -0.0067 -0.0034 -0.0087 130 PHE A N   
799  C CA  . PHE A 102 ? 0.1025 0.0961 0.1026 -0.0058 -0.0036 -0.0105 130 PHE A CA  
800  C C   . PHE A 102 ? 0.1071 0.0961 0.1044 -0.0045 -0.0023 -0.0121 130 PHE A C   
801  O O   . PHE A 102 ? 0.1098 0.0970 0.1089 -0.0039 -0.0011 -0.0115 130 PHE A O   
802  C CB  . PHE A 102 ? 0.1001 0.0972 0.1002 -0.0044 -0.0026 -0.0093 130 PHE A CB  
803  C CG  . PHE A 102 ? 0.1006 0.1016 0.1027 -0.0051 -0.0039 -0.0082 130 PHE A CG  
804  C CD1 . PHE A 102 ? 0.0997 0.1034 0.1055 -0.0054 -0.0035 -0.0065 130 PHE A CD1 
805  C CD2 . PHE A 102 ? 0.1074 0.1094 0.1075 -0.0053 -0.0054 -0.0086 130 PHE A CD2 
806  C CE1 . PHE A 102 ? 0.1050 0.1124 0.1131 -0.0058 -0.0042 -0.0055 130 PHE A CE1 
807  C CE2 . PHE A 102 ? 0.1123 0.1183 0.1152 -0.0057 -0.0066 -0.0073 130 PHE A CE2 
808  C CZ  . PHE A 102 ? 0.1086 0.1172 0.1157 -0.0059 -0.0058 -0.0058 130 PHE A CZ  
809  N N   . SER A 103 ? 0.1149 0.1020 0.1075 -0.0037 -0.0023 -0.0139 131 SER A N   
810  C CA  . SER A 103 ? 0.1268 0.1100 0.1162 -0.0018 -0.0002 -0.0154 131 SER A CA  
811  C C   . SER A 103 ? 0.1176 0.1032 0.1096 0.0001  0.0023  -0.0136 131 SER A C   
812  O O   . SER A 103 ? 0.1121 0.1017 0.1061 0.0001  0.0025  -0.0119 131 SER A O   
813  C CB  . SER A 103 ? 0.1467 0.1279 0.1293 -0.0009 -0.0005 -0.0174 131 SER A CB  
814  O OG  . SER A 103 ? 0.1704 0.1481 0.1502 -0.0026 -0.0032 -0.0201 131 SER A OG  
815  N N   . LYS A 104 ? 0.1195 0.1023 0.1119 0.0018  0.0042  -0.0140 132 LYS A N   
816  C CA  . LYS A 104 ? 0.1182 0.1036 0.1142 0.0036  0.0064  -0.0124 132 LYS A CA  
817  C C   . LYS A 104 ? 0.1160 0.1041 0.1110 0.0046  0.0082  -0.0118 132 LYS A C   
818  O O   . LYS A 104 ? 0.1239 0.1099 0.1136 0.0053  0.0091  -0.0130 132 LYS A O   
819  C CB  . LYS A 104 ? 0.1318 0.1137 0.1282 0.0057  0.0084  -0.0131 132 LYS A CB  
820  C CG  . LYS A 104 ? 0.1360 0.1212 0.1379 0.0076  0.0100  -0.0111 132 LYS A CG  
821  C CD  . LYS A 104 ? 0.1564 0.1386 0.1588 0.0104  0.0126  -0.0117 132 LYS A CD  
822  C CE  . LYS A 104 ? 0.1653 0.1416 0.1662 0.0105  0.0120  -0.0130 132 LYS A CE  
823  N NZ  . LYS A 104 ? 0.1626 0.1360 0.1651 0.0138  0.0147  -0.0132 132 LYS A NZ  
824  N N   . ILE A 105 ? 0.1072 0.0995 0.1070 0.0046  0.0085  -0.0099 133 ILE A N   
825  C CA  . ILE A 105 ? 0.1083 0.1032 0.1090 0.0051  0.0102  -0.0086 133 ILE A CA  
826  C C   . ILE A 105 ? 0.1046 0.1027 0.1121 0.0059  0.0115  -0.0072 133 ILE A C   
827  O O   . ILE A 105 ? 0.1096 0.1084 0.1205 0.0062  0.0106  -0.0070 133 ILE A O   
828  C CB  . ILE A 105 ? 0.1086 0.1056 0.1095 0.0034  0.0083  -0.0079 133 ILE A CB  
829  C CG1 . ILE A 105 ? 0.1060 0.1051 0.1110 0.0023  0.0062  -0.0075 133 ILE A CG1 
830  C CG2 . ILE A 105 ? 0.1167 0.1117 0.1119 0.0027  0.0068  -0.0089 133 ILE A CG2 
831  C CD1 . ILE A 105 ? 0.1052 0.1065 0.1115 0.0014  0.0052  -0.0067 133 ILE A CD1 
832  N N   . GLU A 106 ? 0.1061 0.1064 0.1158 0.0062  0.0136  -0.0058 134 GLU A N   
833  C CA  . GLU A 106 ? 0.1068 0.1111 0.1244 0.0060  0.0139  -0.0044 134 GLU A CA  
834  C C   . GLU A 106 ? 0.0971 0.1028 0.1163 0.0040  0.0115  -0.0041 134 GLU A C   
835  O O   . GLU A 106 ? 0.0976 0.1019 0.1128 0.0033  0.0112  -0.0041 134 GLU A O   
836  C CB  . GLU A 106 ? 0.1225 0.1283 0.1428 0.0073  0.0179  -0.0027 134 GLU A CB  
837  C CG  . GLU A 106 ? 0.1499 0.1542 0.1689 0.0098  0.0206  -0.0032 134 GLU A CG  
838  C CD  . GLU A 106 ? 0.1784 0.1847 0.2007 0.0118  0.0254  -0.0014 134 GLU A CD  
839  O OE1 . GLU A 106 ? 0.2061 0.2144 0.2305 0.0110  0.0272  0.0005  134 GLU A OE1 
840  O OE2 . GLU A 106 ? 0.2253 0.2312 0.2484 0.0142  0.0276  -0.0018 134 GLU A OE2 
841  N N   . VAL A 107 ? 0.0925 0.1009 0.1176 0.0032  0.0096  -0.0040 135 VAL A N   
842  C CA  . VAL A 107 ? 0.0907 0.1000 0.1175 0.0016  0.0073  -0.0043 135 VAL A CA  
843  C C   . VAL A 107 ? 0.0890 0.1008 0.1232 0.0006  0.0077  -0.0034 135 VAL A C   
844  O O   . VAL A 107 ? 0.0886 0.1000 0.1239 -0.0006 0.0064  -0.0038 135 VAL A O   
845  C CB  . VAL A 107 ? 0.0925 0.1022 0.1183 0.0014  0.0040  -0.0055 135 VAL A CB  
846  C CG1 . VAL A 107 ? 0.0993 0.1065 0.1189 0.0017  0.0038  -0.0060 135 VAL A CG1 
847  C CG2 . VAL A 107 ? 0.0933 0.1055 0.1238 0.0020  0.0027  -0.0054 135 VAL A CG2 
848  N N   . ASN A 108 ? 0.0874 0.1018 0.1273 0.0013  0.0096  -0.0022 136 ASN A N   
849  C CA  . ASN A 108 ? 0.0883 0.1055 0.1368 0.0001  0.0105  -0.0009 136 ASN A CA  
850  C C   . ASN A 108 ? 0.0934 0.1112 0.1433 0.0013  0.0155  0.0014  136 ASN A C   
851  O O   . ASN A 108 ? 0.1026 0.1192 0.1477 0.0034  0.0179  0.0016  136 ASN A O   
852  C CB  . ASN A 108 ? 0.0876 0.1091 0.1441 -0.0001 0.0079  -0.0012 136 ASN A CB  
853  C CG  . ASN A 108 ? 0.0859 0.1072 0.1408 -0.0010 0.0029  -0.0035 136 ASN A CG  
854  O OD1 . ASN A 108 ? 0.0893 0.1082 0.1414 -0.0023 0.0014  -0.0048 136 ASN A OD1 
855  N ND2 . ASN A 108 ? 0.0859 0.1099 0.1429 0.0000  0.0005  -0.0039 136 ASN A ND2 
856  N N   . GLY A 109 ? 0.0985 0.1178 0.1552 0.0000  0.0172  0.0033  137 GLY A N   
857  C CA  . GLY A 109 ? 0.1081 0.1284 0.1670 0.0009  0.0226  0.0064  137 GLY A CA  
858  C C   . GLY A 109 ? 0.1167 0.1329 0.1670 0.0017  0.0252  0.0076  137 GLY A C   
859  O O   . GLY A 109 ? 0.1155 0.1284 0.1589 0.0013  0.0228  0.0062  137 GLY A O   
860  N N   . ASP A 110 ? 0.1319 0.1489 0.1830 0.0030  0.0305  0.0106  138 ASP A N   
861  C CA  . ASP A 110 ? 0.1477 0.1614 0.1912 0.0039  0.0333  0.0127  138 ASP A CA  
862  C C   . ASP A 110 ? 0.1452 0.1552 0.1757 0.0060  0.0324  0.0106  138 ASP A C   
863  O O   . ASP A 110 ? 0.1513 0.1584 0.1747 0.0063  0.0325  0.0115  138 ASP A O   
864  C CB  . ASP A 110 ? 0.1751 0.1907 0.2218 0.0053  0.0398  0.0168  138 ASP A CB  
865  C CG  . ASP A 110 ? 0.1976 0.2169 0.2587 0.0028  0.0411  0.0196  138 ASP A CG  
866  O OD1 . ASP A 110 ? 0.2305 0.2497 0.2975 -0.0001 0.0368  0.0183  138 ASP A OD1 
867  O OD2 . ASP A 110 ? 0.2336 0.2561 0.3006 0.0037  0.0464  0.0231  138 ASP A OD2 
868  N N   . ASP A 111 ? 0.1423 0.1523 0.1700 0.0072  0.0314  0.0080  139 ASP A N   
869  C CA  . ASP A 111 ? 0.1488 0.1549 0.1651 0.0087  0.0300  0.0056  139 ASP A CA  
870  C C   . ASP A 111 ? 0.1300 0.1350 0.1449 0.0070  0.0246  0.0027  139 ASP A C   
871  O O   . ASP A 111 ? 0.1336 0.1360 0.1413 0.0076  0.0229  0.0005  139 ASP A O   
872  C CB  . ASP A 111 ? 0.1752 0.1807 0.1884 0.0114  0.0328  0.0044  139 ASP A CB  
873  C CG  . ASP A 111 ? 0.2044 0.2101 0.2152 0.0139  0.0388  0.0071  139 ASP A CG  
874  O OD1 . ASP A 111 ? 0.2361 0.2422 0.2470 0.0135  0.0408  0.0101  139 ASP A OD1 
875  O OD2 . ASP A 111 ? 0.2471 0.2520 0.2553 0.0166  0.0418  0.0062  139 ASP A OD2 
876  N N   . ALA A 112 ? 0.1145 0.1214 0.1362 0.0048  0.0219  0.0027  140 ALA A N   
877  C CA  . ALA A 112 ? 0.1070 0.1130 0.1270 0.0036  0.0174  0.0005  140 ALA A CA  
878  C C   . ALA A 112 ? 0.1049 0.1083 0.1175 0.0036  0.0163  0.0003  140 ALA A C   
879  O O   . ALA A 112 ? 0.1109 0.1136 0.1218 0.0040  0.0181  0.0024  140 ALA A O   
880  C CB  . ALA A 112 ? 0.1037 0.1116 0.1310 0.0017  0.0152  0.0004  140 ALA A CB  
881  N N   . HIS A 113 ? 0.0994 0.1018 0.1084 0.0032  0.0133  -0.0016 141 HIS A N   
882  C CA  . HIS A 113 ? 0.1010 0.1021 0.1048 0.0030  0.0116  -0.0018 141 HIS A CA  
883  C C   . HIS A 113 ? 0.0974 0.0991 0.1047 0.0023  0.0112  -0.0003 141 HIS A C   
884  O O   . HIS A 113 ? 0.0926 0.0953 0.1054 0.0013  0.0103  -0.0008 141 HIS A O   
885  C CB  . HIS A 113 ? 0.1016 0.1025 0.1037 0.0023  0.0086  -0.0038 141 HIS A CB  
886  C CG  . HIS A 113 ? 0.1037 0.1041 0.1016 0.0021  0.0067  -0.0039 141 HIS A CG  
887  N ND1 . HIS A 113 ? 0.1069 0.1083 0.1065 0.0017  0.0055  -0.0030 141 HIS A ND1 
888  C CD2 . HIS A 113 ? 0.1112 0.1103 0.1036 0.0023  0.0055  -0.0049 141 HIS A CD2 
889  C CE1 . HIS A 113 ? 0.1078 0.1093 0.1037 0.0019  0.0039  -0.0030 141 HIS A CE1 
890  N NE2 . HIS A 113 ? 0.1132 0.1134 0.1047 0.0020  0.0035  -0.0042 141 HIS A NE2 
891  N N   . PRO A 114 ? 0.1005 0.1012 0.1042 0.0029  0.0117  0.0013  142 PRO A N   
892  C CA  . PRO A 114 ? 0.1021 0.1025 0.1096 0.0025  0.0117  0.0029  142 PRO A CA  
893  C C   . PRO A 114 ? 0.0958 0.0966 0.1060 0.0017  0.0090  0.0013  142 PRO A C   
894  O O   . PRO A 114 ? 0.0952 0.0951 0.1099 0.0011  0.0091  0.0017  142 PRO A O   
895  C CB  . PRO A 114 ? 0.1147 0.1140 0.1168 0.0039  0.0124  0.0052  142 PRO A CB  
896  C CG  . PRO A 114 ? 0.1244 0.1236 0.1196 0.0049  0.0124  0.0044  142 PRO A CG  
897  C CD  . PRO A 114 ? 0.1118 0.1114 0.1079 0.0043  0.0122  0.0018  142 PRO A CD  
898  N N   . LEU A 115 ? 0.0943 0.0959 0.1019 0.0016  0.0068  -0.0003 143 LEU A N   
899  C CA  . LEU A 115 ? 0.0919 0.0941 0.1016 0.0012  0.0049  -0.0018 143 LEU A CA  
900  C C   . LEU A 115 ? 0.0882 0.0905 0.1022 0.0003  0.0047  -0.0031 143 LEU A C   
901  O O   . LEU A 115 ? 0.0880 0.0898 0.1044 0.0001  0.0038  -0.0040 143 LEU A O   
902  C CB  . LEU A 115 ? 0.0936 0.0972 0.1008 0.0011  0.0031  -0.0029 143 LEU A CB  
903  C CG  . LEU A 115 ? 0.0965 0.1010 0.1054 0.0010  0.0019  -0.0041 143 LEU A CG  
904  C CD1 . LEU A 115 ? 0.1022 0.1065 0.1122 0.0019  0.0018  -0.0035 143 LEU A CD1 
905  C CD2 . LEU A 115 ? 0.0998 0.1058 0.1071 0.0006  0.0008  -0.0046 143 LEU A CD2 
906  N N   . TRP A 116 ? 0.0860 0.0892 0.1008 0.0000  0.0052  -0.0036 144 TRP A N   
907  C CA  . TRP A 116 ? 0.0884 0.0926 0.1077 -0.0006 0.0044  -0.0047 144 TRP A CA  
908  C C   . TRP A 116 ? 0.0894 0.0931 0.1142 -0.0014 0.0053  -0.0039 144 TRP A C   
909  O O   . TRP A 116 ? 0.0984 0.1022 0.1269 -0.0023 0.0036  -0.0054 144 TRP A O   
910  C CB  . TRP A 116 ? 0.0861 0.0915 0.1052 -0.0002 0.0047  -0.0049 144 TRP A CB  
911  C CG  . TRP A 116 ? 0.0874 0.0927 0.1028 0.0000  0.0032  -0.0059 144 TRP A CG  
912  C CD1 . TRP A 116 ? 0.0894 0.0939 0.1006 0.0001  0.0031  -0.0059 144 TRP A CD1 
913  C CD2 . TRP A 116 ? 0.0841 0.0904 0.1002 0.0000  0.0013  -0.0070 144 TRP A CD2 
914  N NE1 . TRP A 116 ? 0.0931 0.0980 0.1032 0.0000  0.0017  -0.0065 144 TRP A NE1 
915  C CE2 . TRP A 116 ? 0.0866 0.0925 0.0991 0.0001  0.0008  -0.0070 144 TRP A CE2 
916  C CE3 . TRP A 116 ? 0.0847 0.0923 0.1040 -0.0001 -0.0001 -0.0077 144 TRP A CE3 
917  C CZ2 . TRP A 116 ? 0.0881 0.0946 0.0999 0.0004  -0.0004 -0.0073 144 TRP A CZ2 
918  C CZ3 . TRP A 116 ? 0.0875 0.0959 0.1051 0.0003  -0.0019 -0.0084 144 TRP A CZ3 
919  C CH2 . TRP A 116 ? 0.0879 0.0956 0.1017 0.0007  -0.0017 -0.0079 144 TRP A CH2 
920  N N   . LYS A 117 ? 0.0886 0.0917 0.1138 -0.0011 0.0080  -0.0016 145 LYS A N   
921  C CA  . LYS A 117 ? 0.0912 0.0935 0.1223 -0.0022 0.0094  -0.0002 145 LYS A CA  
922  C C   . LYS A 117 ? 0.0907 0.0906 0.1226 -0.0026 0.0077  -0.0011 145 LYS A C   
923  O O   . LYS A 117 ? 0.0945 0.0934 0.1320 -0.0040 0.0067  -0.0021 145 LYS A O   
924  C CB  . LYS A 117 ? 0.0958 0.0975 0.1257 -0.0013 0.0130  0.0031  145 LYS A CB  
925  C CG  . LYS A 117 ? 0.1011 0.1047 0.1302 -0.0005 0.0154  0.0040  145 LYS A CG  
926  C CD  . LYS A 117 ? 0.1112 0.1142 0.1392 0.0004  0.0196  0.0075  145 LYS A CD  
927  C CE  . LYS A 117 ? 0.1168 0.1216 0.1442 0.0017  0.0227  0.0083  145 LYS A CE  
928  N NZ  . LYS A 117 ? 0.1276 0.1317 0.1529 0.0030  0.0273  0.0121  145 LYS A NZ  
929  N N   . TRP A 118 ? 0.0898 0.0885 0.1164 -0.0013 0.0074  -0.0009 146 TRP A N   
930  C CA  . TRP A 118 ? 0.0947 0.0909 0.1216 -0.0010 0.0064  -0.0015 146 TRP A CA  
931  C C   . TRP A 118 ? 0.0919 0.0880 0.1192 -0.0013 0.0038  -0.0050 146 TRP A C   
932  O O   . TRP A 118 ? 0.0953 0.0887 0.1255 -0.0018 0.0029  -0.0065 146 TRP A O   
933  C CB  . TRP A 118 ? 0.0992 0.0953 0.1209 0.0007  0.0067  -0.0001 146 TRP A CB  
934  C CG  . TRP A 118 ? 0.1046 0.0985 0.1265 0.0017  0.0060  -0.0004 146 TRP A CG  
935  C CD1 . TRP A 118 ? 0.1092 0.1000 0.1334 0.0023  0.0073  0.0015  146 TRP A CD1 
936  C CD2 . TRP A 118 ? 0.1069 0.1015 0.1270 0.0027  0.0045  -0.0025 146 TRP A CD2 
937  N NE1 . TRP A 118 ? 0.1133 0.1026 0.1371 0.0038  0.0064  0.0004  146 TRP A NE1 
938  C CE2 . TRP A 118 ? 0.1122 0.1041 0.1334 0.0041  0.0049  -0.0020 146 TRP A CE2 
939  C CE3 . TRP A 118 ? 0.1081 0.1054 0.1257 0.0027  0.0031  -0.0044 146 TRP A CE3 
940  C CZ2 . TRP A 118 ? 0.1181 0.1102 0.1382 0.0057  0.0042  -0.0036 146 TRP A CZ2 
941  C CZ3 . TRP A 118 ? 0.1151 0.1127 0.1316 0.0041  0.0026  -0.0056 146 TRP A CZ3 
942  C CH2 . TRP A 118 ? 0.1205 0.1157 0.1382 0.0056  0.0032  -0.0054 146 TRP A CH2 
943  N N   . MET A 119 ? 0.0899 0.0884 0.1139 -0.0009 0.0025  -0.0064 147 MET A N   
944  C CA  . MET A 119 ? 0.0946 0.0931 0.1175 -0.0007 0.0003  -0.0093 147 MET A CA  
945  C C   . MET A 119 ? 0.0985 0.0964 0.1258 -0.0021 -0.0013 -0.0113 147 MET A C   
946  O O   . MET A 119 ? 0.1050 0.1008 0.1320 -0.0020 -0.0030 -0.0139 147 MET A O   
947  C CB  . MET A 119 ? 0.0927 0.0939 0.1118 -0.0001 -0.0004 -0.0097 147 MET A CB  
948  C CG  . MET A 119 ? 0.0936 0.0957 0.1090 0.0008  0.0003  -0.0085 147 MET A CG  
949  S SD  . MET A 119 ? 0.1014 0.1060 0.1136 0.0011  -0.0003 -0.0088 147 MET A SD  
950  C CE  . MET A 119 ? 0.1012 0.1064 0.1147 0.0002  -0.0002 -0.0082 147 MET A CE  
951  N N   . LYS A 120 ? 0.1012 0.1009 0.1327 -0.0034 -0.0008 -0.0102 148 LYS A N   
952  C CA  . LYS A 120 ? 0.1098 0.1102 0.1471 -0.0050 -0.0028 -0.0118 148 LYS A CA  
953  C C   . LYS A 120 ? 0.1199 0.1169 0.1622 -0.0065 -0.0032 -0.0126 148 LYS A C   
954  O O   . LYS A 120 ? 0.1316 0.1285 0.1780 -0.0080 -0.0061 -0.0151 148 LYS A O   
955  C CB  . LYS A 120 ? 0.1106 0.1144 0.1524 -0.0057 -0.0015 -0.0096 148 LYS A CB  
956  C CG  . LYS A 120 ? 0.1127 0.1194 0.1512 -0.0045 -0.0020 -0.0096 148 LYS A CG  
957  C CD  . LYS A 120 ? 0.1139 0.1239 0.1577 -0.0048 -0.0007 -0.0079 148 LYS A CD  
958  C CE  . LYS A 120 ? 0.1167 0.1263 0.1603 -0.0043 0.0034  -0.0050 148 LYS A CE  
959  N NZ  . LYS A 120 ? 0.1148 0.1276 0.1641 -0.0042 0.0052  -0.0034 148 LYS A NZ  
960  N N   . ILE A 121 ? 0.1231 0.1171 0.1655 -0.0061 -0.0007 -0.0106 149 ILE A N   
961  C CA  . ILE A 121 ? 0.1348 0.1245 0.1823 -0.0075 -0.0008 -0.0111 149 ILE A CA  
962  C C   . ILE A 121 ? 0.1307 0.1159 0.1739 -0.0059 -0.0016 -0.0134 149 ILE A C   
963  O O   . ILE A 121 ? 0.1381 0.1185 0.1850 -0.0067 -0.0015 -0.0140 149 ILE A O   
964  C CB  . ILE A 121 ? 0.1478 0.1364 0.1997 -0.0081 0.0028  -0.0067 149 ILE A CB  
965  C CG1 . ILE A 121 ? 0.1554 0.1432 0.2010 -0.0056 0.0053  -0.0038 149 ILE A CG1 
966  C CG2 . ILE A 121 ? 0.1504 0.1434 0.2071 -0.0093 0.0043  -0.0044 149 ILE A CG2 
967  C CD1 . ILE A 121 ? 0.1629 0.1480 0.2114 -0.0056 0.0087  0.0003  149 ILE A CD1 
968  N N   . GLN A 122 ? 0.1244 0.1109 0.1605 -0.0037 -0.0021 -0.0145 150 GLN A N   
969  C CA  . GLN A 122 ? 0.1317 0.1145 0.1640 -0.0018 -0.0023 -0.0165 150 GLN A CA  
970  C C   . GLN A 122 ? 0.1418 0.1217 0.1742 -0.0024 -0.0054 -0.0214 150 GLN A C   
971  O O   . GLN A 122 ? 0.1430 0.1255 0.1758 -0.0036 -0.0079 -0.0232 150 GLN A O   
972  C CB  . GLN A 122 ? 0.1273 0.1131 0.1531 0.0005  -0.0016 -0.0159 150 GLN A CB  
973  C CG  . GLN A 122 ? 0.1255 0.1138 0.1507 0.0011  0.0006  -0.0117 150 GLN A CG  
974  C CD  . GLN A 122 ? 0.1298 0.1147 0.1578 0.0015  0.0024  -0.0093 150 GLN A CD  
975  O OE1 . GLN A 122 ? 0.1422 0.1241 0.1696 0.0033  0.0028  -0.0099 150 GLN A OE1 
976  N NE2 . GLN A 122 ? 0.1297 0.1149 0.1609 0.0002  0.0039  -0.0064 150 GLN A NE2 
977  N N   . PRO A 123 ? 0.1565 0.1309 0.1880 -0.0012 -0.0054 -0.0236 151 PRO A N   
978  C CA  . PRO A 123 ? 0.1700 0.1408 0.2005 -0.0017 -0.0086 -0.0290 151 PRO A CA  
979  C C   . PRO A 123 ? 0.1765 0.1507 0.2004 -0.0007 -0.0111 -0.0318 151 PRO A C   
980  O O   . PRO A 123 ? 0.1947 0.1686 0.2194 -0.0022 -0.0147 -0.0352 151 PRO A O   
981  C CB  . PRO A 123 ? 0.1794 0.1440 0.2073 0.0008  -0.0071 -0.0306 151 PRO A CB  
982  C CG  . PRO A 123 ? 0.1748 0.1386 0.2071 0.0009  -0.0038 -0.0257 151 PRO A CG  
983  C CD  . PRO A 123 ? 0.1622 0.1329 0.1942 0.0005  -0.0026 -0.0214 151 PRO A CD  
984  N N   . LYS A 124 ? 0.1747 0.1525 0.1927 0.0017  -0.0092 -0.0300 152 LYS A N   
985  C CA  . LYS A 124 ? 0.1817 0.1629 0.1933 0.0030  -0.0109 -0.0316 152 LYS A CA  
986  C C   . LYS A 124 ? 0.1723 0.1594 0.1854 0.0018  -0.0109 -0.0284 152 LYS A C   
987  O O   . LYS A 124 ? 0.1797 0.1698 0.1880 0.0028  -0.0120 -0.0287 152 LYS A O   
988  C CB  . LYS A 124 ? 0.1925 0.1737 0.1971 0.0065  -0.0085 -0.0317 152 LYS A CB  
989  C CG  . LYS A 124 ? 0.2153 0.1903 0.2176 0.0085  -0.0079 -0.0351 152 LYS A CG  
990  C CD  . LYS A 124 ? 0.2423 0.2131 0.2421 0.0080  -0.0118 -0.0408 152 LYS A CD  
991  C CE  . LYS A 124 ? 0.2698 0.2336 0.2661 0.0105  -0.0110 -0.0447 152 LYS A CE  
992  N NZ  . LYS A 124 ? 0.2932 0.2525 0.2850 0.0103  -0.0152 -0.0510 152 LYS A NZ  
993  N N   . GLY A 125 ? 0.1677 0.1562 0.1869 0.0000  -0.0096 -0.0252 153 GLY A N   
994  C CA  . GLY A 125 ? 0.1679 0.1612 0.1889 -0.0010 -0.0094 -0.0225 153 GLY A CA  
995  C C   . GLY A 125 ? 0.1808 0.1756 0.2082 -0.0034 -0.0116 -0.0229 153 GLY A C   
996  O O   . GLY A 125 ? 0.1720 0.1709 0.2009 -0.0038 -0.0118 -0.0213 153 GLY A O   
997  N N   . LYS A 126 ? 0.2154 0.2069 0.2477 -0.0051 -0.0131 -0.0250 154 LYS A N   
998  C CA  . LYS A 126 ? 0.2510 0.2443 0.2912 -0.0078 -0.0155 -0.0256 154 LYS A CA  
999  C C   . LYS A 126 ? 0.2719 0.2678 0.3088 -0.0073 -0.0198 -0.0285 154 LYS A C   
1000 O O   . LYS A 126 ? 0.3012 0.2949 0.3305 -0.0055 -0.0214 -0.0315 154 LYS A O   
1001 C CB  . LYS A 126 ? 0.2744 0.2629 0.3209 -0.0100 -0.0164 -0.0274 154 LYS A CB  
1002 C CG  . LYS A 126 ? 0.2866 0.2732 0.3382 -0.0107 -0.0122 -0.0235 154 LYS A CG  
1003 C CD  . LYS A 126 ? 0.3086 0.2897 0.3671 -0.0131 -0.0130 -0.0250 154 LYS A CD  
1004 C CE  . LYS A 126 ? 0.3171 0.2999 0.3862 -0.0158 -0.0107 -0.0210 154 LYS A CE  
1005 N NZ  . LYS A 126 ? 0.3308 0.3074 0.4067 -0.0178 -0.0099 -0.0208 154 LYS A NZ  
1006 N N   . GLY A 127 ? 0.2987 0.2994 0.3412 -0.0086 -0.0215 -0.0274 155 GLY A N   
1007 C CA  . GLY A 127 ? 0.3276 0.3313 0.3670 -0.0078 -0.0257 -0.0294 155 GLY A CA  
1008 C C   . GLY A 127 ? 0.3596 0.3610 0.4004 -0.0093 -0.0309 -0.0342 155 GLY A C   
1009 O O   . GLY A 127 ? 0.3813 0.3806 0.4302 -0.0121 -0.0316 -0.0353 155 GLY A O   
1010 N N   . ILE A 128 ? 0.3839 0.3855 0.4166 -0.0075 -0.0345 -0.0372 156 ILE A N   
1011 C CA  . ILE A 128 ? 0.3989 0.3993 0.4318 -0.0087 -0.0407 -0.0423 156 ILE A CA  
1012 C C   . ILE A 128 ? 0.3900 0.3957 0.4353 -0.0118 -0.0439 -0.0413 156 ILE A C   
1013 O O   . ILE A 128 ? 0.4161 0.4206 0.4687 -0.0148 -0.0479 -0.0445 156 ILE A O   
1014 C CB  . ILE A 128 ? 0.4179 0.4188 0.4385 -0.0055 -0.0439 -0.0446 156 ILE A CB  
1015 C CG1 . ILE A 128 ? 0.4291 0.4239 0.4386 -0.0029 -0.0417 -0.0473 156 ILE A CG1 
1016 C CG2 . ILE A 128 ? 0.4312 0.4339 0.4531 -0.0067 -0.0515 -0.0488 156 ILE A CG2 
1017 C CD1 . ILE A 128 ? 0.4258 0.4212 0.4292 0.0000  -0.0359 -0.0432 156 ILE A CD1 
1018 N N   . LEU A 129 ? 0.3619 0.3734 0.4099 -0.0108 -0.0421 -0.0369 157 LEU A N   
1019 C CA  . LEU A 129 ? 0.3326 0.3505 0.3923 -0.0128 -0.0439 -0.0348 157 LEU A CA  
1020 C C   . LEU A 129 ? 0.2952 0.3148 0.3625 -0.0135 -0.0376 -0.0298 157 LEU A C   
1021 O O   . LEU A 129 ? 0.2785 0.3032 0.3492 -0.0124 -0.0361 -0.0263 157 LEU A O   
1022 C CB  . LEU A 129 ? 0.3473 0.3705 0.4028 -0.0102 -0.0469 -0.0338 157 LEU A CB  
1023 C CG  . LEU A 129 ? 0.3610 0.3830 0.4068 -0.0087 -0.0529 -0.0382 157 LEU A CG  
1024 C CD1 . LEU A 129 ? 0.3640 0.3919 0.4075 -0.0062 -0.0557 -0.0360 157 LEU A CD1 
1025 C CD2 . LEU A 129 ? 0.3729 0.3935 0.4241 -0.0118 -0.0591 -0.0434 157 LEU A CD2 
1026 N N   . GLY A 130 ? 0.2689 0.2837 0.3384 -0.0150 -0.0341 -0.0295 158 GLY A N   
1027 C CA  . GLY A 130 ? 0.2393 0.2552 0.3155 -0.0157 -0.0283 -0.0249 158 GLY A CA  
1028 C C   . GLY A 130 ? 0.2129 0.2271 0.2803 -0.0129 -0.0232 -0.0222 158 GLY A C   
1029 O O   . GLY A 130 ? 0.2243 0.2386 0.2826 -0.0104 -0.0239 -0.0228 158 GLY A O   
1030 N N   . ASN A 131 ? 0.1767 0.1894 0.2467 -0.0133 -0.0182 -0.0190 159 ASN A N   
1031 C CA  . ASN A 131 ? 0.1523 0.1626 0.2137 -0.0110 -0.0141 -0.0172 159 ASN A CA  
1032 C C   . ASN A 131 ? 0.1220 0.1359 0.1808 -0.0090 -0.0118 -0.0144 159 ASN A C   
1033 O O   . ASN A 131 ? 0.1079 0.1202 0.1586 -0.0071 -0.0101 -0.0139 159 ASN A O   
1034 C CB  . ASN A 131 ? 0.1708 0.1777 0.2347 -0.0118 -0.0101 -0.0149 159 ASN A CB  
1035 C CG  . ASN A 131 ? 0.1979 0.1997 0.2634 -0.0134 -0.0117 -0.0175 159 ASN A CG  
1036 O OD1 . ASN A 131 ? 0.2172 0.2173 0.2798 -0.0134 -0.0157 -0.0215 159 ASN A OD1 
1037 N ND2 . ASN A 131 ? 0.2162 0.2152 0.2856 -0.0143 -0.0084 -0.0150 159 ASN A ND2 
1038 N N   . ALA A 132 ? 0.1091 0.1276 0.1752 -0.0093 -0.0115 -0.0126 160 ALA A N   
1039 C CA  . ALA A 132 ? 0.0985 0.1193 0.1624 -0.0072 -0.0086 -0.0101 160 ALA A CA  
1040 C C   . ALA A 132 ? 0.0895 0.1100 0.1450 -0.0052 -0.0107 -0.0112 160 ALA A C   
1041 O O   . ALA A 132 ? 0.0922 0.1133 0.1462 -0.0052 -0.0149 -0.0135 160 ALA A O   
1042 C CB  . ALA A 132 ? 0.0998 0.1261 0.1737 -0.0075 -0.0082 -0.0082 160 ALA A CB  
1043 N N   . ILE A 133 ? 0.0818 0.1013 0.1318 -0.0034 -0.0078 -0.0096 161 ILE A N   
1044 C CA  . ILE A 133 ? 0.0816 0.1009 0.1251 -0.0015 -0.0091 -0.0099 161 ILE A CA  
1045 C C   . ILE A 133 ? 0.0804 0.1039 0.1287 -0.0006 -0.0111 -0.0092 161 ILE A C   
1046 O O   . ILE A 133 ? 0.0818 0.1076 0.1360 -0.0002 -0.0089 -0.0073 161 ILE A O   
1047 C CB  . ILE A 133 ? 0.0831 0.0999 0.1208 -0.0003 -0.0057 -0.0085 161 ILE A CB  
1048 C CG1 . ILE A 133 ? 0.0845 0.0981 0.1186 -0.0011 -0.0038 -0.0087 161 ILE A CG1 
1049 C CG2 . ILE A 133 ? 0.0839 0.1003 0.1160 0.0011  -0.0069 -0.0084 161 ILE A CG2 
1050 C CD1 . ILE A 133 ? 0.0885 0.1004 0.1194 -0.0015 -0.0060 -0.0107 161 ILE A CD1 
1051 N N   . LYS A 134 ? 0.0822 0.1068 0.1279 0.0000  -0.0152 -0.0104 162 LYS A N   
1052 C CA  . LYS A 134 ? 0.0860 0.1153 0.1373 0.0009  -0.0180 -0.0097 162 LYS A CA  
1053 C C   . LYS A 134 ? 0.0840 0.1138 0.1329 0.0035  -0.0168 -0.0074 162 LYS A C   
1054 O O   . LYS A 134 ? 0.0866 0.1202 0.1419 0.0046  -0.0173 -0.0058 162 LYS A O   
1055 C CB  . LYS A 134 ? 0.0956 0.1262 0.1453 0.0005  -0.0237 -0.0122 162 LYS A CB  
1056 C CG  . LYS A 134 ? 0.1037 0.1335 0.1570 -0.0021 -0.0257 -0.0150 162 LYS A CG  
1057 C CD  . LYS A 134 ? 0.1079 0.1406 0.1734 -0.0043 -0.0243 -0.0139 162 LYS A CD  
1058 C CE  . LYS A 134 ? 0.1169 0.1487 0.1871 -0.0073 -0.0272 -0.0168 162 LYS A CE  
1059 N NZ  . LYS A 134 ? 0.1200 0.1456 0.1838 -0.0080 -0.0253 -0.0185 162 LYS A NZ  
1060 N N   . TRP A 135 ? 0.0851 0.1109 0.1254 0.0045  -0.0151 -0.0070 163 TRP A N   
1061 C CA  . TRP A 135 ? 0.0893 0.1144 0.1273 0.0068  -0.0138 -0.0048 163 TRP A CA  
1062 C C   . TRP A 135 ? 0.0881 0.1084 0.1184 0.0067  -0.0111 -0.0046 163 TRP A C   
1063 O O   . TRP A 135 ? 0.0884 0.1068 0.1157 0.0052  -0.0104 -0.0060 163 TRP A O   
1064 C CB  . TRP A 135 ? 0.0972 0.1248 0.1339 0.0087  -0.0179 -0.0040 163 TRP A CB  
1065 C CG  . TRP A 135 ? 0.1024 0.1304 0.1408 0.0113  -0.0168 -0.0011 163 TRP A CG  
1066 C CD1 . TRP A 135 ? 0.1107 0.1360 0.1435 0.0132  -0.0163 0.0008  163 TRP A CD1 
1067 C CD2 . TRP A 135 ? 0.1025 0.1335 0.1495 0.0124  -0.0156 0.0002  163 TRP A CD2 
1068 N NE1 . TRP A 135 ? 0.1143 0.1400 0.1513 0.0154  -0.0150 0.0031  163 TRP A NE1 
1069 C CE2 . TRP A 135 ? 0.1090 0.1383 0.1546 0.0152  -0.0145 0.0027  163 TRP A CE2 
1070 C CE3 . TRP A 135 ? 0.0999 0.1348 0.1561 0.0114  -0.0150 -0.0001 163 TRP A CE3 
1071 C CZ2 . TRP A 135 ? 0.1110 0.1421 0.1636 0.0174  -0.0128 0.0045  163 TRP A CZ2 
1072 C CZ3 . TRP A 135 ? 0.1012 0.1386 0.1645 0.0135  -0.0131 0.0019  163 TRP A CZ3 
1073 C CH2 . TRP A 135 ? 0.1048 0.1403 0.1662 0.0166  -0.0120 0.0040  163 TRP A CH2 
1074 N N   . ASN A 136 ? 0.0902 0.1085 0.1180 0.0084  -0.0098 -0.0027 164 ASN A N   
1075 C CA  . ASN A 136 ? 0.0929 0.1072 0.1146 0.0081  -0.0079 -0.0023 164 ASN A CA  
1076 C C   . ASN A 136 ? 0.0936 0.1079 0.1098 0.0078  -0.0096 -0.0029 164 ASN A C   
1077 O O   . ASN A 136 ? 0.0988 0.1154 0.1140 0.0087  -0.0126 -0.0031 164 ASN A O   
1078 C CB  . ASN A 136 ? 0.0998 0.1118 0.1206 0.0098  -0.0067 -0.0001 164 ASN A CB  
1079 C CG  . ASN A 136 ? 0.1025 0.1144 0.1285 0.0109  -0.0048 0.0002  164 ASN A CG  
1080 O OD1 . ASN A 136 ? 0.0992 0.1095 0.1259 0.0100  -0.0024 -0.0008 164 ASN A OD1 
1081 N ND2 . ASN A 136 ? 0.1091 0.1228 0.1384 0.0131  -0.0060 0.0019  164 ASN A ND2 
1082 N N   . PHE A 137 ? 0.0927 0.1046 0.1052 0.0068  -0.0077 -0.0031 165 PHE A N   
1083 C CA  . PHE A 137 ? 0.0976 0.1092 0.1047 0.0069  -0.0081 -0.0032 165 PHE A CA  
1084 C C   . PHE A 137 ? 0.0948 0.1078 0.1010 0.0065  -0.0101 -0.0057 165 PHE A C   
1085 O O   . PHE A 137 ? 0.1068 0.1204 0.1085 0.0077  -0.0116 -0.0061 165 PHE A O   
1086 C CB  . PHE A 137 ? 0.1063 0.1178 0.1099 0.0088  -0.0086 -0.0006 165 PHE A CB  
1087 C CG  . PHE A 137 ? 0.1108 0.1196 0.1153 0.0089  -0.0064 0.0017  165 PHE A CG  
1088 C CD1 . PHE A 137 ? 0.1101 0.1166 0.1136 0.0074  -0.0040 0.0022  165 PHE A CD1 
1089 C CD2 . PHE A 137 ? 0.1158 0.1241 0.1229 0.0103  -0.0067 0.0034  165 PHE A CD2 
1090 C CE1 . PHE A 137 ? 0.1150 0.1184 0.1197 0.0071  -0.0023 0.0040  165 PHE A CE1 
1091 C CE2 . PHE A 137 ? 0.1205 0.1252 0.1284 0.0104  -0.0047 0.0053  165 PHE A CE2 
1092 C CZ  . PHE A 137 ? 0.1199 0.1219 0.1266 0.0086  -0.0026 0.0054  165 PHE A CZ  
1093 N N   . THR A 138 ? 0.0907 0.1038 0.1009 0.0051  -0.0099 -0.0074 166 THR A N   
1094 C CA  . THR A 138 ? 0.0926 0.1054 0.1017 0.0044  -0.0108 -0.0098 166 THR A CA  
1095 C C   . THR A 138 ? 0.0915 0.1025 0.0970 0.0043  -0.0083 -0.0095 166 THR A C   
1096 O O   . THR A 138 ? 0.0952 0.1054 0.1013 0.0037  -0.0062 -0.0080 166 THR A O   
1097 C CB  . THR A 138 ? 0.0920 0.1053 0.1074 0.0028  -0.0110 -0.0110 166 THR A CB  
1098 O OG1 . THR A 138 ? 0.0972 0.1131 0.1171 0.0030  -0.0132 -0.0109 166 THR A OG1 
1099 C CG2 . THR A 138 ? 0.0943 0.1063 0.1093 0.0020  -0.0119 -0.0135 166 THR A CG2 
1100 N N   . LYS A 139 ? 0.0962 0.1067 0.0981 0.0049  -0.0088 -0.0111 167 LYS A N   
1101 C CA  . LYS A 139 ? 0.1009 0.1105 0.1002 0.0051  -0.0064 -0.0106 167 LYS A CA  
1102 C C   . LYS A 139 ? 0.1022 0.1104 0.1019 0.0049  -0.0065 -0.0129 167 LYS A C   
1103 O O   . LYS A 139 ? 0.1120 0.1194 0.1107 0.0053  -0.0086 -0.0155 167 LYS A O   
1104 C CB  . LYS A 139 ? 0.1132 0.1234 0.1069 0.0070  -0.0058 -0.0095 167 LYS A CB  
1105 C CG  . LYS A 139 ? 0.1231 0.1340 0.1160 0.0075  -0.0056 -0.0067 167 LYS A CG  
1106 C CD  . LYS A 139 ? 0.1358 0.1475 0.1259 0.0089  -0.0084 -0.0071 167 LYS A CD  
1107 C CE  . LYS A 139 ? 0.1426 0.1547 0.1319 0.0098  -0.0079 -0.0036 167 LYS A CE  
1108 N NZ  . LYS A 139 ? 0.1443 0.1576 0.1332 0.0110  -0.0111 -0.0036 167 LYS A NZ  
1109 N N   . PHE A 140 ? 0.0974 0.1051 0.0988 0.0044  -0.0045 -0.0122 168 PHE A N   
1110 C CA  . PHE A 140 ? 0.0987 0.1047 0.1003 0.0048  -0.0040 -0.0137 168 PHE A CA  
1111 C C   . PHE A 140 ? 0.0985 0.1053 0.0976 0.0063  -0.0018 -0.0127 168 PHE A C   
1112 O O   . PHE A 140 ? 0.1055 0.1141 0.1057 0.0058  -0.0004 -0.0104 168 PHE A O   
1113 C CB  . PHE A 140 ? 0.0973 0.1024 0.1034 0.0034  -0.0033 -0.0131 168 PHE A CB  
1114 C CG  . PHE A 140 ? 0.0996 0.1043 0.1094 0.0020  -0.0047 -0.0138 168 PHE A CG  
1115 C CD1 . PHE A 140 ? 0.1007 0.1070 0.1124 0.0013  -0.0047 -0.0124 168 PHE A CD1 
1116 C CD2 . PHE A 140 ? 0.1039 0.1066 0.1163 0.0014  -0.0058 -0.0157 168 PHE A CD2 
1117 C CE1 . PHE A 140 ? 0.1047 0.1114 0.1210 0.0002  -0.0055 -0.0127 168 PHE A CE1 
1118 C CE2 . PHE A 140 ? 0.1062 0.1091 0.1236 -0.0001 -0.0069 -0.0160 168 PHE A CE2 
1119 C CZ  . PHE A 140 ? 0.1072 0.1125 0.1267 -0.0006 -0.0066 -0.0143 168 PHE A CZ  
1120 N N   . LEU A 141 ? 0.1011 0.1066 0.0971 0.0080  -0.0016 -0.0146 169 LEU A N   
1121 C CA  . LEU A 141 ? 0.1031 0.1097 0.0978 0.0098  0.0009  -0.0137 169 LEU A CA  
1122 C C   . LEU A 141 ? 0.1026 0.1077 0.1007 0.0100  0.0017  -0.0140 169 LEU A C   
1123 O O   . LEU A 141 ? 0.1055 0.1073 0.1042 0.0099  0.0005  -0.0164 169 LEU A O   
1124 C CB  . LEU A 141 ? 0.1130 0.1188 0.1015 0.0124  0.0013  -0.0155 169 LEU A CB  
1125 C CG  . LEU A 141 ? 0.1198 0.1271 0.1067 0.0149  0.0048  -0.0143 169 LEU A CG  
1126 C CD1 . LEU A 141 ? 0.1186 0.1302 0.1078 0.0142  0.0068  -0.0102 169 LEU A CD1 
1127 C CD2 . LEU A 141 ? 0.1318 0.1376 0.1111 0.0179  0.0054  -0.0167 169 LEU A CD2 
1128 N N   . ILE A 142 ? 0.1022 0.1099 0.1029 0.0101  0.0034  -0.0114 170 ILE A N   
1129 C CA  . ILE A 142 ? 0.1060 0.1132 0.1104 0.0103  0.0040  -0.0107 170 ILE A CA  
1130 C C   . ILE A 142 ? 0.1031 0.1124 0.1078 0.0128  0.0063  -0.0097 170 ILE A C   
1131 O O   . ILE A 142 ? 0.1033 0.1165 0.1083 0.0129  0.0076  -0.0077 170 ILE A O   
1132 C CB  . ILE A 142 ? 0.1143 0.1235 0.1219 0.0082  0.0033  -0.0083 170 ILE A CB  
1133 C CG1 . ILE A 142 ? 0.1321 0.1403 0.1392 0.0061  0.0018  -0.0086 170 ILE A CG1 
1134 C CG2 . ILE A 142 ? 0.1146 0.1232 0.1250 0.0088  0.0035  -0.0072 170 ILE A CG2 
1135 C CD1 . ILE A 142 ? 0.1395 0.1444 0.1472 0.0058  0.0009  -0.0104 170 ILE A CD1 
1136 N N   . ASP A 143 ? 0.1066 0.1136 0.1120 0.0148  0.0071  -0.0108 171 ASP A N   
1137 C CA  . ASP A 143 ? 0.1123 0.1216 0.1187 0.0178  0.0098  -0.0097 171 ASP A CA  
1138 C C   . ASP A 143 ? 0.1050 0.1189 0.1172 0.0174  0.0100  -0.0062 171 ASP A C   
1139 O O   . ASP A 143 ? 0.1009 0.1156 0.1150 0.0149  0.0080  -0.0048 171 ASP A O   
1140 C CB  . ASP A 143 ? 0.1237 0.1282 0.1283 0.0206  0.0108  -0.0126 171 ASP A CB  
1141 C CG  . ASP A 143 ? 0.1291 0.1304 0.1376 0.0206  0.0101  -0.0122 171 ASP A CG  
1142 O OD1 . ASP A 143 ? 0.1273 0.1309 0.1395 0.0191  0.0092  -0.0094 171 ASP A OD1 
1143 O OD2 . ASP A 143 ? 0.1512 0.1472 0.1583 0.0225  0.0106  -0.0149 171 ASP A OD2 
1144 N N   . LYS A 144 ? 0.1096 0.1267 0.1244 0.0200  0.0123  -0.0047 172 LYS A N   
1145 C CA  . LYS A 144 ? 0.1144 0.1372 0.1354 0.0196  0.0121  -0.0012 172 LYS A CA  
1146 C C   . LYS A 144 ? 0.1086 0.1298 0.1321 0.0195  0.0102  -0.0004 172 LYS A C   
1147 O O   . LYS A 144 ? 0.1061 0.1315 0.1336 0.0185  0.0086  0.0021  172 LYS A O   
1148 C CB  . LYS A 144 ? 0.1344 0.1615 0.1588 0.0230  0.0153  0.0002  172 LYS A CB  
1149 C CG  . LYS A 144 ? 0.1571 0.1868 0.1795 0.0234  0.0179  0.0005  172 LYS A CG  
1150 C CD  . LYS A 144 ? 0.1789 0.2143 0.2062 0.0265  0.0216  0.0029  172 LYS A CD  
1151 C CE  . LYS A 144 ? 0.2015 0.2330 0.2255 0.0312  0.0244  0.0006  172 LYS A CE  
1152 N NZ  . LYS A 144 ? 0.2222 0.2600 0.2518 0.0345  0.0284  0.0033  172 LYS A NZ  
1153 N N   . ASN A 145 ? 0.1099 0.1250 0.1311 0.0206  0.0102  -0.0024 173 ASN A N   
1154 C CA  . ASN A 145 ? 0.1158 0.1284 0.1387 0.0205  0.0088  -0.0011 173 ASN A CA  
1155 C C   . ASN A 145 ? 0.1104 0.1205 0.1311 0.0172  0.0066  -0.0015 173 ASN A C   
1156 O O   . ASN A 145 ? 0.1168 0.1246 0.1381 0.0170  0.0058  -0.0001 173 ASN A O   
1157 C CB  . ASN A 145 ? 0.1297 0.1365 0.1524 0.0233  0.0103  -0.0027 173 ASN A CB  
1158 C CG  . ASN A 145 ? 0.1414 0.1503 0.1663 0.0273  0.0129  -0.0023 173 ASN A CG  
1159 O OD1 . ASN A 145 ? 0.1521 0.1674 0.1813 0.0283  0.0132  0.0007  173 ASN A OD1 
1160 N ND2 . ASN A 145 ? 0.1543 0.1580 0.1766 0.0297  0.0147  -0.0054 173 ASN A ND2 
1161 N N   . GLY A 146 ? 0.1051 0.1156 0.1232 0.0149  0.0060  -0.0030 174 GLY A N   
1162 C CA  . GLY A 146 ? 0.1043 0.1130 0.1207 0.0122  0.0045  -0.0033 174 GLY A CA  
1163 C C   . GLY A 146 ? 0.1055 0.1087 0.1206 0.0116  0.0044  -0.0057 174 GLY A C   
1164 O O   . GLY A 146 ? 0.1101 0.1118 0.1251 0.0097  0.0036  -0.0054 174 GLY A O   
1165 N N   . VAL A 147 ? 0.1102 0.1105 0.1242 0.0133  0.0053  -0.0081 175 VAL A N   
1166 C CA  . VAL A 147 ? 0.1158 0.1108 0.1292 0.0126  0.0046  -0.0109 175 VAL A CA  
1167 C C   . VAL A 147 ? 0.1124 0.1079 0.1226 0.0113  0.0034  -0.0134 175 VAL A C   
1168 O O   . VAL A 147 ? 0.1146 0.1125 0.1219 0.0125  0.0041  -0.0140 175 VAL A O   
1169 C CB  . VAL A 147 ? 0.1296 0.1204 0.1432 0.0153  0.0058  -0.0127 175 VAL A CB  
1170 C CG1 . VAL A 147 ? 0.1377 0.1224 0.1506 0.0144  0.0047  -0.0165 175 VAL A CG1 
1171 C CG2 . VAL A 147 ? 0.1379 0.1279 0.1550 0.0168  0.0069  -0.0096 175 VAL A CG2 
1172 N N   . VAL A 148 ? 0.1117 0.1053 0.1228 0.0090  0.0018  -0.0145 176 VAL A N   
1173 C CA  . VAL A 148 ? 0.1124 0.1066 0.1209 0.0080  0.0002  -0.0168 176 VAL A CA  
1174 C C   . VAL A 148 ? 0.1165 0.1074 0.1216 0.0098  -0.0002 -0.0206 176 VAL A C   
1175 O O   . VAL A 148 ? 0.1257 0.1119 0.1324 0.0099  -0.0006 -0.0226 176 VAL A O   
1176 C CB  . VAL A 148 ? 0.1152 0.1088 0.1267 0.0054  -0.0014 -0.0170 176 VAL A CB  
1177 C CG1 . VAL A 148 ? 0.1175 0.1121 0.1267 0.0048  -0.0036 -0.0193 176 VAL A CG1 
1178 C CG2 . VAL A 148 ? 0.1139 0.1103 0.1273 0.0041  -0.0005 -0.0137 176 VAL A CG2 
1179 N N   . VAL A 149 ? 0.1167 0.1096 0.1169 0.0111  -0.0002 -0.0215 177 VAL A N   
1180 C CA  . VAL A 149 ? 0.1270 0.1168 0.1221 0.0132  -0.0006 -0.0254 177 VAL A CA  
1181 C C   . VAL A 149 ? 0.1294 0.1193 0.1206 0.0124  -0.0036 -0.0278 177 VAL A C   
1182 O O   . VAL A 149 ? 0.1399 0.1260 0.1271 0.0135  -0.0052 -0.0320 177 VAL A O   
1183 C CB  . VAL A 149 ? 0.1342 0.1256 0.1255 0.0167  0.0025  -0.0246 177 VAL A CB  
1184 C CG1 . VAL A 149 ? 0.1382 0.1287 0.1340 0.0179  0.0047  -0.0229 177 VAL A CG1 
1185 C CG2 . VAL A 149 ? 0.1322 0.1293 0.1223 0.0167  0.0038  -0.0214 177 VAL A CG2 
1186 N N   . LYS A 150 ? 0.1256 0.1193 0.1177 0.0107  -0.0046 -0.0256 178 LYS A N   
1187 C CA  . LYS A 150 ? 0.1328 0.1270 0.1219 0.0102  -0.0078 -0.0275 178 LYS A CA  
1188 C C   . LYS A 150 ? 0.1214 0.1192 0.1146 0.0080  -0.0087 -0.0246 178 LYS A C   
1189 O O   . LYS A 150 ? 0.1191 0.1192 0.1146 0.0076  -0.0064 -0.0212 178 LYS A O   
1190 C CB  . LYS A 150 ? 0.1479 0.1430 0.1286 0.0131  -0.0072 -0.0282 178 LYS A CB  
1191 C CG  . LYS A 150 ? 0.1645 0.1590 0.1404 0.0132  -0.0112 -0.0312 178 LYS A CG  
1192 C CD  . LYS A 150 ? 0.1860 0.1796 0.1517 0.0168  -0.0105 -0.0330 178 LYS A CD  
1193 C CE  . LYS A 150 ? 0.2025 0.1967 0.1622 0.0174  -0.0147 -0.0349 178 LYS A CE  
1194 N NZ  . LYS A 150 ? 0.2211 0.2139 0.1695 0.0213  -0.0137 -0.0369 178 LYS A NZ  
1195 N N   . ARG A 151 ? 0.1197 0.1179 0.1138 0.0068  -0.0121 -0.0261 179 ARG A N   
1196 C CA  . ARG A 151 ? 0.1150 0.1167 0.1128 0.0053  -0.0131 -0.0237 179 ARG A CA  
1197 C C   . ARG A 151 ? 0.1178 0.1212 0.1108 0.0065  -0.0158 -0.0244 179 ARG A C   
1198 O O   . ARG A 151 ? 0.1345 0.1364 0.1238 0.0072  -0.0187 -0.0279 179 ARG A O   
1199 C CB  . ARG A 151 ? 0.1165 0.1178 0.1222 0.0027  -0.0145 -0.0242 179 ARG A CB  
1200 C CG  . ARG A 151 ? 0.1148 0.1197 0.1250 0.0015  -0.0153 -0.0220 179 ARG A CG  
1201 C CD  . ARG A 151 ? 0.1158 0.1207 0.1344 -0.0008 -0.0158 -0.0221 179 ARG A CD  
1202 N NE  . ARG A 151 ? 0.1136 0.1222 0.1371 -0.0015 -0.0166 -0.0203 179 ARG A NE  
1203 C CZ  . ARG A 151 ? 0.1091 0.1189 0.1404 -0.0032 -0.0156 -0.0189 179 ARG A CZ  
1204 N NH1 . ARG A 151 ? 0.1101 0.1175 0.1449 -0.0045 -0.0136 -0.0186 179 ARG A NH1 
1205 N NH2 . ARG A 151 ? 0.1100 0.1236 0.1457 -0.0033 -0.0161 -0.0173 179 ARG A NH2 
1206 N N   . TYR A 152 ? 0.1142 0.1205 0.1069 0.0068  -0.0149 -0.0211 180 TYR A N   
1207 C CA  . TYR A 152 ? 0.1231 0.1313 0.1112 0.0084  -0.0170 -0.0205 180 TYR A CA  
1208 C C   . TYR A 152 ? 0.1207 0.1316 0.1149 0.0071  -0.0182 -0.0183 180 TYR A C   
1209 O O   . TYR A 152 ? 0.1201 0.1314 0.1183 0.0062  -0.0155 -0.0158 180 TYR A O   
1210 C CB  . TYR A 152 ? 0.1269 0.1357 0.1089 0.0105  -0.0140 -0.0177 180 TYR A CB  
1211 C CG  . TYR A 152 ? 0.1344 0.1413 0.1114 0.0121  -0.0115 -0.0190 180 TYR A CG  
1212 C CD1 . TYR A 152 ? 0.1327 0.1389 0.1133 0.0113  -0.0084 -0.0182 180 TYR A CD1 
1213 C CD2 . TYR A 152 ? 0.1460 0.1521 0.1144 0.0148  -0.0121 -0.0207 180 TYR A CD2 
1214 C CE1 . TYR A 152 ? 0.1413 0.1464 0.1185 0.0131  -0.0059 -0.0190 180 TYR A CE1 
1215 C CE2 . TYR A 152 ? 0.1541 0.1586 0.1181 0.0168  -0.0091 -0.0218 180 TYR A CE2 
1216 C CZ  . TYR A 152 ? 0.1517 0.1559 0.1207 0.0159  -0.0059 -0.0207 180 TYR A CZ  
1217 O OH  . TYR A 152 ? 0.1693 0.1725 0.1354 0.0181  -0.0027 -0.0213 180 TYR A OH  
1218 N N   . GLY A 153 ? 0.1315 0.1443 0.1264 0.0073  -0.0222 -0.0193 181 GLY A N   
1219 C CA  . GLY A 153 ? 0.1349 0.1506 0.1366 0.0065  -0.0233 -0.0173 181 GLY A CA  
1220 C C   . GLY A 153 ? 0.1416 0.1586 0.1408 0.0083  -0.0220 -0.0135 181 GLY A C   
1221 O O   . GLY A 153 ? 0.1443 0.1603 0.1364 0.0101  -0.0205 -0.0122 181 GLY A O   
1222 N N   . PRO A 154 ? 0.1470 0.1662 0.1526 0.0080  -0.0222 -0.0116 182 PRO A N   
1223 C CA  . PRO A 154 ? 0.1629 0.1827 0.1676 0.0098  -0.0210 -0.0079 182 PRO A CA  
1224 C C   . PRO A 154 ? 0.1944 0.2150 0.1920 0.0124  -0.0233 -0.0067 182 PRO A C   
1225 O O   . PRO A 154 ? 0.2275 0.2469 0.2218 0.0138  -0.0210 -0.0034 182 PRO A O   
1226 C CB  . PRO A 154 ? 0.1563 0.1790 0.1698 0.0094  -0.0222 -0.0071 182 PRO A CB  
1227 C CG  . PRO A 154 ? 0.1529 0.1755 0.1722 0.0069  -0.0214 -0.0093 182 PRO A CG  
1228 C CD  . PRO A 154 ? 0.1473 0.1683 0.1622 0.0061  -0.0230 -0.0125 182 PRO A CD  
1229 N N   . MET A 155 ? 0.2129 0.2351 0.2079 0.0129  -0.0277 -0.0092 183 MET A N   
1230 C CA  . MET A 155 ? 0.2431 0.2663 0.2301 0.0158  -0.0304 -0.0081 183 MET A CA  
1231 C C   . MET A 155 ? 0.2374 0.2579 0.2141 0.0172  -0.0283 -0.0085 183 MET A C   
1232 O O   . MET A 155 ? 0.2621 0.2829 0.2305 0.0200  -0.0293 -0.0069 183 MET A O   
1233 C CB  . MET A 155 ? 0.2765 0.3030 0.2650 0.0159  -0.0369 -0.0109 183 MET A CB  
1234 C CG  . MET A 155 ? 0.2958 0.3261 0.2961 0.0146  -0.0389 -0.0103 183 MET A CG  
1235 S SD  . MET A 155 ? 0.3537 0.3894 0.3582 0.0146  -0.0471 -0.0129 183 MET A SD  
1236 C CE  . MET A 155 ? 0.3416 0.3746 0.3454 0.0115  -0.0491 -0.0192 183 MET A CE  
1237 N N   . GLU A 156 ? 0.2138 0.2318 0.1907 0.0156  -0.0251 -0.0103 184 GLU A N   
1238 C CA  . GLU A 156 ? 0.2151 0.2309 0.1834 0.0171  -0.0224 -0.0107 184 GLU A CA  
1239 C C   . GLU A 156 ? 0.1992 0.2143 0.1677 0.0173  -0.0172 -0.0062 184 GLU A C   
1240 O O   . GLU A 156 ? 0.1901 0.2044 0.1648 0.0151  -0.0144 -0.0058 184 GLU A O   
1241 C CB  . GLU A 156 ? 0.2255 0.2393 0.1945 0.0156  -0.0220 -0.0150 184 GLU A CB  
1242 C CG  . GLU A 156 ? 0.2470 0.2608 0.2164 0.0150  -0.0273 -0.0197 184 GLU A CG  
1243 C CD  . GLU A 156 ? 0.2627 0.2733 0.2323 0.0138  -0.0268 -0.0240 184 GLU A CD  
1244 O OE1 . GLU A 156 ? 0.2986 0.3069 0.2599 0.0159  -0.0252 -0.0254 184 GLU A OE1 
1245 O OE2 . GLU A 156 ? 0.2764 0.2866 0.2544 0.0111  -0.0277 -0.0256 184 GLU A OE2 
1246 N N   . GLU A 157 ? 0.1973 0.2125 0.1592 0.0198  -0.0159 -0.0028 185 GLU A N   
1247 C CA  A GLU A 157 ? 0.1921 0.2065 0.1551 0.0197  -0.0112 0.0017  185 GLU A CA  
1248 C CA  B GLU A 157 ? 0.1926 0.2070 0.1557 0.0197  -0.0112 0.0017  185 GLU A CA  
1249 C C   . GLU A 157 ? 0.1790 0.1926 0.1425 0.0186  -0.0073 0.0007  185 GLU A C   
1250 O O   . GLU A 157 ? 0.1756 0.1889 0.1346 0.0195  -0.0075 -0.0023 185 GLU A O   
1251 C CB  A GLU A 157 ? 0.2087 0.2235 0.1642 0.0228  -0.0103 0.0059  185 GLU A CB  
1252 C CB  B GLU A 157 ? 0.2099 0.2247 0.1657 0.0227  -0.0104 0.0060  185 GLU A CB  
1253 C CG  A GLU A 157 ? 0.2221 0.2369 0.1675 0.0254  -0.0089 0.0053  185 GLU A CG  
1254 C CG  B GLU A 157 ? 0.2189 0.2348 0.1751 0.0241  -0.0142 0.0078  185 GLU A CG  
1255 C CD  A GLU A 157 ? 0.2359 0.2510 0.1734 0.0287  -0.0072 0.0103  185 GLU A CD  
1256 C CD  B GLU A 157 ? 0.2328 0.2487 0.1816 0.0274  -0.0132 0.0129  185 GLU A CD  
1257 O OE1 A GLU A 157 ? 0.2451 0.2604 0.1837 0.0294  -0.0089 0.0136  185 GLU A OE1 
1258 O OE1 B GLU A 157 ? 0.2452 0.2602 0.1883 0.0286  -0.0091 0.0151  185 GLU A OE1 
1259 O OE2 A GLU A 157 ? 0.2516 0.2666 0.1818 0.0307  -0.0038 0.0113  185 GLU A OE2 
1260 O OE2 B GLU A 157 ? 0.2445 0.2614 0.1935 0.0291  -0.0162 0.0150  185 GLU A OE2 
1261 N N   . PRO A 158 ? 0.1603 0.1733 0.1293 0.0167  -0.0039 0.0033  186 PRO A N   
1262 C CA  . PRO A 158 ? 0.1550 0.1680 0.1257 0.0157  -0.0009 0.0024  186 PRO A CA  
1263 C C   . PRO A 158 ? 0.1593 0.1731 0.1231 0.0182  0.0016  0.0029  186 PRO A C   
1264 O O   . PRO A 158 ? 0.1555 0.1694 0.1197 0.0181  0.0029  0.0006  186 PRO A O   
1265 C CB  . PRO A 158 ? 0.1483 0.1610 0.1255 0.0135  0.0016  0.0057  186 PRO A CB  
1266 C CG  . PRO A 158 ? 0.1478 0.1594 0.1283 0.0127  -0.0006 0.0062  186 PRO A CG  
1267 C CD  . PRO A 158 ? 0.1563 0.1686 0.1311 0.0153  -0.0033 0.0064  186 PRO A CD  
1268 N N   . LEU A 159 ? 0.1669 0.1812 0.1244 0.0206  0.0028  0.0061  187 LEU A N   
1269 C CA  . LEU A 159 ? 0.1816 0.1966 0.1318 0.0235  0.0060  0.0068  187 LEU A CA  
1270 C C   . LEU A 159 ? 0.1844 0.1984 0.1281 0.0254  0.0038  0.0014  187 LEU A C   
1271 O O   . LEU A 159 ? 0.1929 0.2072 0.1319 0.0276  0.0069  0.0008  187 LEU A O   
1272 C CB  . LEU A 159 ? 0.1984 0.2140 0.1419 0.0262  0.0080  0.0117  187 LEU A CB  
1273 C CG  . LEU A 159 ? 0.2052 0.2212 0.1550 0.0246  0.0119  0.0176  187 LEU A CG  
1274 C CD1 . LEU A 159 ? 0.2206 0.2366 0.1636 0.0274  0.0136  0.0230  187 LEU A CD1 
1275 C CD2 . LEU A 159 ? 0.2105 0.2283 0.1656 0.0233  0.0165  0.0188  187 LEU A CD2 
1276 N N   . VAL A 160 ? 0.1818 0.1948 0.1257 0.0246  -0.0013 -0.0025 188 VAL A N   
1277 C CA  . VAL A 160 ? 0.1945 0.2058 0.1333 0.0259  -0.0036 -0.0081 188 VAL A CA  
1278 C C   . VAL A 160 ? 0.1824 0.1926 0.1260 0.0247  -0.0011 -0.0104 188 VAL A C   
1279 O O   . VAL A 160 ? 0.1941 0.2024 0.1325 0.0266  -0.0009 -0.0142 188 VAL A O   
1280 C CB  . VAL A 160 ? 0.2070 0.2175 0.1467 0.0247  -0.0100 -0.0121 188 VAL A CB  
1281 C CG1 . VAL A 160 ? 0.2117 0.2237 0.1477 0.0260  -0.0131 -0.0096 188 VAL A CG1 
1282 C CG2 . VAL A 160 ? 0.2048 0.2150 0.1553 0.0210  -0.0114 -0.0135 188 VAL A CG2 
1283 N N   . ILE A 161 ? 0.1641 0.1754 0.1172 0.0219  0.0005  -0.0083 189 ILE A N   
1284 C CA  . ILE A 161 ? 0.1576 0.1684 0.1158 0.0209  0.0026  -0.0098 189 ILE A CA  
1285 C C   . ILE A 161 ? 0.1655 0.1776 0.1205 0.0235  0.0075  -0.0082 189 ILE A C   
1286 O O   . ILE A 161 ? 0.1646 0.1759 0.1207 0.0243  0.0090  -0.0103 189 ILE A O   
1287 C CB  . ILE A 161 ? 0.1444 0.1564 0.1124 0.0174  0.0029  -0.0076 189 ILE A CB  
1288 C CG1 . ILE A 161 ? 0.1409 0.1519 0.1123 0.0153  -0.0011 -0.0089 189 ILE A CG1 
1289 C CG2 . ILE A 161 ? 0.1422 0.1540 0.1152 0.0167  0.0045  -0.0088 189 ILE A CG2 
1290 C CD1 . ILE A 161 ? 0.1341 0.1457 0.1132 0.0125  -0.0007 -0.0068 189 ILE A CD1 
1291 N N   . GLU A 162 ? 0.1796 0.1937 0.1310 0.0250  0.0103  -0.0040 190 GLU A N   
1292 C CA  . GLU A 162 ? 0.2007 0.2168 0.1497 0.0277  0.0157  -0.0016 190 GLU A CA  
1293 C C   . GLU A 162 ? 0.2091 0.2232 0.1500 0.0314  0.0166  -0.0057 190 GLU A C   
1294 O O   . GLU A 162 ? 0.2229 0.2383 0.1650 0.0332  0.0209  -0.0053 190 GLU A O   
1295 C CB  . GLU A 162 ? 0.2207 0.2388 0.1661 0.0289  0.0183  0.0036  190 GLU A CB  
1296 C CG  . GLU A 162 ? 0.2365 0.2577 0.1819 0.0310  0.0247  0.0075  190 GLU A CG  
1297 C CD  . GLU A 162 ? 0.2509 0.2740 0.1957 0.0312  0.0278  0.0140  190 GLU A CD  
1298 O OE1 . GLU A 162 ? 0.2734 0.2951 0.2172 0.0300  0.0249  0.0154  190 GLU A OE1 
1299 O OE2 . GLU A 162 ? 0.2673 0.2936 0.2137 0.0326  0.0334  0.0179  190 GLU A OE2 
1300 N N   . LYS A 163 ? 0.2118 0.2227 0.1447 0.0326  0.0125  -0.0100 191 LYS A N   
1301 C CA  . LYS A 163 ? 0.2305 0.2381 0.1545 0.0361  0.0125  -0.0151 191 LYS A CA  
1302 C C   . LYS A 163 ? 0.2204 0.2260 0.1504 0.0355  0.0131  -0.0183 191 LYS A C   
1303 O O   . LYS A 163 ? 0.2307 0.2346 0.1557 0.0390  0.0160  -0.0207 191 LYS A O   
1304 C CB  . LYS A 163 ? 0.2525 0.2568 0.1692 0.0363  0.0062  -0.0198 191 LYS A CB  
1305 C CG  . LYS A 163 ? 0.2750 0.2808 0.1841 0.0377  0.0046  -0.0170 191 LYS A CG  
1306 C CD  . LYS A 163 ? 0.2950 0.2987 0.2013 0.0366  -0.0028 -0.0215 191 LYS A CD  
1307 C CE  . LYS A 163 ? 0.3186 0.3231 0.2136 0.0396  -0.0049 -0.0201 191 LYS A CE  
1308 N NZ  . LYS A 163 ? 0.3415 0.3432 0.2220 0.0442  -0.0045 -0.0241 191 LYS A NZ  
1309 N N   . ASP A 164 ? 0.2041 0.2098 0.1443 0.0314  0.0106  -0.0184 192 ASP A N   
1310 C CA  . ASP A 164 ? 0.2038 0.2073 0.1500 0.0306  0.0106  -0.0211 192 ASP A CA  
1311 C C   . ASP A 164 ? 0.1977 0.2048 0.1522 0.0303  0.0149  -0.0173 192 ASP A C   
1312 O O   . ASP A 164 ? 0.2036 0.2091 0.1609 0.0313  0.0161  -0.0190 192 ASP A O   
1313 C CB  . ASP A 164 ? 0.2026 0.2040 0.1546 0.0267  0.0054  -0.0233 192 ASP A CB  
1314 C CG  . ASP A 164 ? 0.2158 0.2141 0.1615 0.0268  0.0005  -0.0275 192 ASP A CG  
1315 O OD1 . ASP A 164 ? 0.2444 0.2393 0.1819 0.0296  0.0001  -0.0317 192 ASP A OD1 
1316 O OD2 . ASP A 164 ? 0.2199 0.2194 0.1687 0.0241  -0.0030 -0.0268 192 ASP A OD2 
1317 N N   . LEU A 165 ? 0.1955 0.2072 0.1542 0.0289  0.0169  -0.0120 193 LEU A N   
1318 C CA  . LEU A 165 ? 0.1918 0.2074 0.1599 0.0277  0.0197  -0.0085 193 LEU A CA  
1319 C C   . LEU A 165 ? 0.1969 0.2140 0.1657 0.0311  0.0242  -0.0084 193 LEU A C   
1320 O O   . LEU A 165 ? 0.1903 0.2083 0.1664 0.0305  0.0244  -0.0082 193 LEU A O   
1321 C CB  . LEU A 165 ? 0.1919 0.2120 0.1640 0.0258  0.0214  -0.0031 193 LEU A CB  
1322 C CG  . LEU A 165 ? 0.1884 0.2078 0.1632 0.0221  0.0176  -0.0023 193 LEU A CG  
1323 C CD1 . LEU A 165 ? 0.1874 0.2102 0.1660 0.0205  0.0198  0.0028  193 LEU A CD1 
1324 C CD2 . LEU A 165 ? 0.1819 0.2001 0.1635 0.0192  0.0147  -0.0040 193 LEU A CD2 
1325 N N   . PRO A 166 ? 0.2113 0.2288 0.1724 0.0352  0.0280  -0.0082 194 PRO A N   
1326 C CA  . PRO A 166 ? 0.2229 0.2425 0.1858 0.0388  0.0330  -0.0075 194 PRO A CA  
1327 C C   . PRO A 166 ? 0.2353 0.2501 0.1979 0.0406  0.0319  -0.0124 194 PRO A C   
1328 O O   . PRO A 166 ? 0.2512 0.2680 0.2186 0.0430  0.0353  -0.0115 194 PRO A O   
1329 C CB  . PRO A 166 ? 0.2316 0.2516 0.1841 0.0431  0.0371  -0.0068 194 PRO A CB  
1330 C CG  . PRO A 166 ? 0.2303 0.2511 0.1797 0.0408  0.0351  -0.0043 194 PRO A CG  
1331 C CD  . PRO A 166 ? 0.2196 0.2365 0.1707 0.0370  0.0284  -0.0077 194 PRO A CD  
1332 N N   . HIS A 167 ? 0.2507 0.2594 0.2086 0.0395  0.0271  -0.0173 195 HIS A N   
1333 C CA  . HIS A 167 ? 0.2690 0.2723 0.2275 0.0405  0.0258  -0.0218 195 HIS A CA  
1334 C C   . HIS A 167 ? 0.2603 0.2655 0.2304 0.0380  0.0250  -0.0195 195 HIS A C   
1335 O O   . HIS A 167 ? 0.2819 0.2844 0.2549 0.0398  0.0260  -0.0211 195 HIS A O   
1336 C CB  . HIS A 167 ? 0.2865 0.2832 0.2385 0.0392  0.0206  -0.0273 195 HIS A CB  
1337 C CG  . HIS A 167 ? 0.3092 0.2991 0.2612 0.0404  0.0193  -0.0323 195 HIS A CG  
1338 N ND1 . HIS A 167 ? 0.3283 0.3149 0.2754 0.0453  0.0229  -0.0351 195 HIS A ND1 
1339 C CD2 . HIS A 167 ? 0.3175 0.3030 0.2743 0.0374  0.0154  -0.0347 195 HIS A CD2 
1340 C CE1 . HIS A 167 ? 0.3371 0.3169 0.2859 0.0452  0.0208  -0.0393 195 HIS A CE1 
1341 N NE2 . HIS A 167 ? 0.3322 0.3115 0.2872 0.0403  0.0163  -0.0389 195 HIS A NE2 
1342 N N   . TYR A 168 ? 0.2416 0.2511 0.2180 0.0340  0.0234  -0.0156 196 TYR A N   
1343 C CA  . TYR A 168 ? 0.2337 0.2449 0.2197 0.0314  0.0220  -0.0136 196 TYR A CA  
1344 C C   . TYR A 168 ? 0.2337 0.2520 0.2276 0.0313  0.0247  -0.0086 196 TYR A C   
1345 O O   . TYR A 168 ? 0.2345 0.2544 0.2357 0.0304  0.0239  -0.0071 196 TYR A O   
1346 C CB  . TYR A 168 ? 0.2203 0.2301 0.2078 0.0269  0.0174  -0.0138 196 TYR A CB  
1347 C CG  . TYR A 168 ? 0.2312 0.2347 0.2135 0.0267  0.0145  -0.0186 196 TYR A CG  
1348 C CD1 . TYR A 168 ? 0.2345 0.2330 0.2187 0.0272  0.0135  -0.0213 196 TYR A CD1 
1349 C CD2 . TYR A 168 ? 0.2380 0.2401 0.2135 0.0264  0.0126  -0.0205 196 TYR A CD2 
1350 C CE1 . TYR A 168 ? 0.2475 0.2399 0.2278 0.0267  0.0106  -0.0259 196 TYR A CE1 
1351 C CE2 . TYR A 168 ? 0.2503 0.2469 0.2216 0.0261  0.0093  -0.0251 196 TYR A CE2 
1352 C CZ  . TYR A 168 ? 0.2548 0.2466 0.2289 0.0260  0.0083  -0.0280 196 TYR A CZ  
1353 O OH  . TYR A 168 ? 0.2795 0.2659 0.2506 0.0252  0.0048  -0.0327 196 TYR A OH  
1354 N N   . PHE A 169 ? 0.2472 0.2702 0.2403 0.0322  0.0279  -0.0057 197 PHE A N   
1355 C CA  . PHE A 169 ? 0.2564 0.2867 0.2583 0.0322  0.0307  -0.0010 197 PHE A CA  
1356 C C   . PHE A 169 ? 0.2769 0.3076 0.2819 0.0362  0.0333  -0.0016 197 PHE A C   
1357 O O   . PHE A 169 ? 0.2860 0.3204 0.2998 0.0356  0.0328  0.0006  197 PHE A O   
1358 C CB  . PHE A 169 ? 0.2577 0.2926 0.2585 0.0327  0.0345  0.0024  197 PHE A CB  
1359 C CG  . PHE A 169 ? 0.2494 0.2844 0.2494 0.0287  0.0320  0.0040  197 PHE A CG  
1360 C CD1 . PHE A 169 ? 0.2429 0.2785 0.2492 0.0242  0.0280  0.0049  197 PHE A CD1 
1361 C CD2 . PHE A 169 ? 0.2576 0.2918 0.2501 0.0298  0.0337  0.0048  197 PHE A CD2 
1362 C CE1 . PHE A 169 ? 0.2380 0.2731 0.2436 0.0210  0.0261  0.0062  197 PHE A CE1 
1363 C CE2 . PHE A 169 ? 0.2545 0.2884 0.2465 0.0264  0.0316  0.0066  197 PHE A CE2 
1364 C CZ  . PHE A 169 ? 0.2476 0.2817 0.2465 0.0221  0.0279  0.0072  197 PHE A CZ  
1365 O OXT . PHE A 169 ? 0.3098 0.3365 0.3083 0.0402  0.0356  -0.0046 197 PHE A OXT 
1366 C C   . ACE B 1   ? 0.1979 0.2126 0.2012 0.0237  -0.0071 0.0274  900 ACE B C   
1367 O O   . ACE B 1   ? 0.2304 0.2452 0.2269 0.0242  -0.0085 0.0292  900 ACE B O   
1368 C CH3 . ACE B 1   ? 0.2031 0.2228 0.2132 0.0253  -0.0090 0.0278  900 ACE B CH3 
1369 N N   . CYS B 2   ? 0.1733 0.1835 0.1783 0.0219  -0.0037 0.0252  901 CYS B N   
1370 C CA  . CYS B 2   ? 0.1654 0.1716 0.1654 0.0202  -0.0015 0.0247  901 CYS B CA  
1371 C C   . CYS B 2   ? 0.1494 0.1574 0.1473 0.0171  -0.0025 0.0205  901 CYS B C   
1372 O O   . CYS B 2   ? 0.1443 0.1544 0.1461 0.0156  -0.0033 0.0175  901 CYS B O   
1373 C CB  . CYS B 2   ? 0.1712 0.1715 0.1748 0.0198  0.0024  0.0250  901 CYS B CB  
1374 S SG  . CYS B 2   ? 0.1874 0.1837 0.1942 0.0232  0.0042  0.0299  901 CYS B SG  
1375 N N   . ARG B 3   ? 0.1475 0.1544 0.1389 0.0164  -0.0021 0.0206  902 ARG B N   
1376 C CA  . ARG B 3   ? 0.1506 0.1581 0.1390 0.0140  -0.0029 0.0169  902 ARG B CA  
1377 C C   . ARG B 3   ? 0.1415 0.1452 0.1276 0.0133  0.0007  0.0169  902 ARG B C   
1378 O O   . ARG B 3   ? 0.1481 0.1497 0.1307 0.0149  0.0027  0.0202  902 ARG B O   
1379 C CB  . ARG B 3   ? 0.1763 0.1864 0.1579 0.0144  -0.0065 0.0167  902 ARG B CB  
1380 C CG  . ARG B 3   ? 0.1980 0.2129 0.1815 0.0155  -0.0107 0.0177  902 ARG B CG  
1381 C CD  . ARG B 3   ? 0.2045 0.2226 0.1955 0.0137  -0.0120 0.0151  902 ARG B CD  
1382 N NE  . ARG B 3   ? 0.2178 0.2347 0.2075 0.0108  -0.0117 0.0113  902 ARG B NE  
1383 C CZ  . ARG B 3   ? 0.2206 0.2379 0.2156 0.0090  -0.0107 0.0090  902 ARG B CZ  
1384 N NH1 . ARG B 3   ? 0.2262 0.2420 0.2193 0.0068  -0.0104 0.0061  902 ARG B NH1 
1385 N NH2 . ARG B 3   ? 0.2182 0.2373 0.2198 0.0096  -0.0098 0.0097  902 ARG B NH2 
1386 N N   . VAL B 4   ? 0.1281 0.1313 0.1163 0.0110  0.0015  0.0135  903 VAL B N   
1387 C CA  . VAL B 4   ? 0.1311 0.1319 0.1177 0.0103  0.0047  0.0132  903 VAL B CA  
1388 C C   . VAL B 4   ? 0.1320 0.1337 0.1132 0.0096  0.0033  0.0104  903 VAL B C   
1389 O O   . VAL B 4   ? 0.1334 0.1366 0.1160 0.0081  0.0009  0.0075  903 VAL B O   
1390 C CB  . VAL B 4   ? 0.1235 0.1232 0.1172 0.0085  0.0065  0.0115  903 VAL B CB  
1391 C CG1 . VAL B 4   ? 0.1240 0.1223 0.1174 0.0078  0.0095  0.0113  903 VAL B CG1 
1392 C CG2 . VAL B 4   ? 0.1270 0.1248 0.1260 0.0091  0.0076  0.0135  903 VAL B CG2 
1393 N N   . ASP B 5   ? 0.1413 0.1414 0.1157 0.0108  0.0050  0.0115  904 ASP B N   
1394 C CA  . ASP B 5   ? 0.1510 0.1508 0.1191 0.0105  0.0038  0.0085  904 ASP B CA  
1395 C C   . ASP B 5   ? 0.1508 0.1495 0.1221 0.0091  0.0062  0.0061  904 ASP B C   
1396 O O   . ASP B 5   ? 0.1428 0.1414 0.1210 0.0082  0.0083  0.0067  904 ASP B O   
1397 C CB  . ASP B 5   ? 0.1627 0.1611 0.1207 0.0129  0.0045  0.0102  904 ASP B CB  
1398 C CG  . ASP B 5   ? 0.1688 0.1651 0.1256 0.0144  0.0101  0.0134  904 ASP B CG  
1399 O OD1 . ASP B 5   ? 0.1624 0.1583 0.1258 0.0132  0.0133  0.0133  904 ASP B OD1 
1400 O OD2 . ASP B 5   ? 0.1894 0.1847 0.1382 0.0169  0.0114  0.0162  904 ASP B OD2 
1401 N N   . LEU B 6   ? 0.1645 0.1620 0.1306 0.0090  0.0056  0.0032  905 LEU B N   
1402 C CA  . LEU B 6   ? 0.1730 0.1694 0.1420 0.0081  0.0076  0.0011  905 LEU B CA  
1403 C C   . LEU B 6   ? 0.1701 0.1659 0.1414 0.0091  0.0126  0.0033  905 LEU B C   
1404 O O   . LEU B 6   ? 0.1734 0.1695 0.1504 0.0082  0.0141  0.0024  905 LEU B O   
1405 C CB  . LEU B 6   ? 0.1991 0.1933 0.1613 0.0084  0.0063  -0.0023 905 LEU B CB  
1406 C CG  . LEU B 6   ? 0.2207 0.2147 0.1859 0.0063  0.0034  -0.0056 905 LEU B CG  
1407 C CD1 . LEU B 6   ? 0.2337 0.2241 0.1922 0.0069  0.0033  -0.0089 905 LEU B CD1 
1408 C CD2 . LEU B 6   ? 0.2142 0.2092 0.1879 0.0051  0.0050  -0.0054 905 LEU B CD2 
1409 N N   . GLN B 7   ? 0.1735 0.1687 0.1404 0.0110  0.0151  0.0065  906 GLN B N   
1410 C CA  . GLN B 7   ? 0.1802 0.1752 0.1498 0.0119  0.0203  0.0093  906 GLN B CA  
1411 C C   . GLN B 7   ? 0.1744 0.1703 0.1528 0.0108  0.0214  0.0123  906 GLN B C   
1412 O O   . GLN B 7   ? 0.1967 0.1928 0.1797 0.0108  0.0255  0.0148  906 GLN B O   
1413 C CB  . GLN B 7   ? 0.1963 0.1897 0.1561 0.0148  0.0232  0.0116  906 GLN B CB  
1414 C CG  . GLN B 7   ? 0.2110 0.2024 0.1608 0.0163  0.0222  0.0079  906 GLN B CG  
1415 C CD  . GLN B 7   ? 0.2165 0.2075 0.1701 0.0157  0.0236  0.0048  906 GLN B CD  
1416 O OE1 . GLN B 7   ? 0.2178 0.2101 0.1787 0.0155  0.0275  0.0064  906 GLN B OE1 
1417 N NE2 . GLN B 7   ? 0.2279 0.2171 0.1775 0.0151  0.0202  0.0003  906 GLN B NE2 
1418 N N   . GLY B 8   ? 0.1574 0.1538 0.1385 0.0098  0.0180  0.0121  907 GLY B N   
1419 C CA  . GLY B 8   ? 0.1513 0.1476 0.1406 0.0086  0.0185  0.0141  907 GLY B CA  
1420 C C   . GLY B 8   ? 0.1504 0.1454 0.1384 0.0101  0.0196  0.0184  907 GLY B C   
1421 O O   . GLY B 8   ? 0.1549 0.1488 0.1497 0.0092  0.0204  0.0200  907 GLY B O   
1422 N N   . TRP B 9   ? 0.1523 0.1469 0.1312 0.0123  0.0195  0.0201  908 TRP B N   
1423 C CA  . TRP B 9   ? 0.1577 0.1510 0.1344 0.0142  0.0202  0.0248  908 TRP B CA  
1424 C C   . TRP B 9   ? 0.1515 0.1459 0.1295 0.0143  0.0156  0.0240  908 TRP B C   
1425 O O   . TRP B 9   ? 0.1530 0.1493 0.1288 0.0137  0.0118  0.0204  908 TRP B O   
1426 C CB  . TRP B 9   ? 0.1726 0.1655 0.1381 0.0171  0.0214  0.0271  908 TRP B CB  
1427 C CG  . TRP B 9   ? 0.1858 0.1779 0.1494 0.0177  0.0267  0.0284  908 TRP B CG  
1428 C CD1 . TRP B 9   ? 0.1905 0.1830 0.1493 0.0180  0.0275  0.0252  908 TRP B CD1 
1429 C CD2 . TRP B 9   ? 0.2013 0.1922 0.1690 0.0181  0.0323  0.0334  908 TRP B CD2 
1430 N NE1 . TRP B 9   ? 0.1998 0.1919 0.1593 0.0190  0.0335  0.0280  908 TRP B NE1 
1431 C CE2 . TRP B 9   ? 0.2086 0.2001 0.1739 0.0188  0.0365  0.0332  908 TRP B CE2 
1432 C CE3 . TRP B 9   ? 0.2129 0.2023 0.1869 0.0179  0.0343  0.0382  908 TRP B CE3 
1433 C CZ2 . TRP B 9   ? 0.2215 0.2128 0.1909 0.0193  0.0429  0.0379  908 TRP B CZ2 
1434 C CZ3 . TRP B 9   ? 0.2235 0.2120 0.2016 0.0180  0.0403  0.0427  908 TRP B CZ3 
1435 C CH2 . TRP B 9   ? 0.2261 0.2160 0.2021 0.0187  0.0447  0.0427  908 TRP B CH2 
1436 N N   . ARG B 10  ? 0.1539 0.1467 0.1355 0.0152  0.0163  0.0275  909 ARG B N   
1437 C CA  . ARG B 10  ? 0.1544 0.1482 0.1388 0.0157  0.0128  0.0271  909 ARG B CA  
1438 C C   . ARG B 10  ? 0.1639 0.1576 0.1429 0.0188  0.0118  0.0315  909 ARG B C   
1439 O O   . ARG B 10  ? 0.1764 0.1676 0.1535 0.0203  0.0151  0.0362  909 ARG B O   
1440 C CB  . ARG B 10  ? 0.1509 0.1423 0.1448 0.0143  0.0140  0.0269  909 ARG B CB  
1441 C CG  . ARG B 10  ? 0.1470 0.1392 0.1445 0.0150  0.0111  0.0259  909 ARG B CG  
1442 C CD  . ARG B 10  ? 0.1463 0.1355 0.1521 0.0135  0.0123  0.0242  909 ARG B CD  
1443 N NE  . ARG B 10  ? 0.1413 0.1311 0.1504 0.0143  0.0101  0.0224  909 ARG B NE  
1444 C CZ  . ARG B 10  ? 0.1464 0.1334 0.1589 0.0162  0.0105  0.0244  909 ARG B CZ  
1445 N NH1 . ARG B 10  ? 0.1589 0.1420 0.1721 0.0175  0.0129  0.0289  909 ARG B NH1 
1446 N NH2 . ARG B 10  ? 0.1420 0.1299 0.1573 0.0171  0.0090  0.0220  909 ARG B NH2 
1447 N N   . ARG B 11  ? 0.1671 0.1639 0.1441 0.0197  0.0074  0.0305  910 ARG B N   
1448 C CA  . ARG B 11  ? 0.1874 0.1852 0.1603 0.0229  0.0055  0.0346  910 ARG B CA  
1449 C C   . ARG B 11  ? 0.1793 0.1795 0.1585 0.0234  0.0022  0.0340  910 ARG B C   
1450 O O   . ARG B 11  ? 0.1679 0.1710 0.1506 0.0216  -0.0001 0.0299  910 ARG B O   
1451 C CB  . ARG B 11  ? 0.2157 0.2160 0.1781 0.0240  0.0024  0.0340  910 ARG B CB  
1452 C CG  . ARG B 11  ? 0.2506 0.2485 0.2043 0.0248  0.0058  0.0354  910 ARG B CG  
1453 C CD  . ARG B 11  ? 0.2777 0.2775 0.2227 0.0244  0.0026  0.0312  910 ARG B CD  
1454 N NE  . ARG B 11  ? 0.2972 0.2982 0.2494 0.0211  0.0013  0.0261  910 ARG B NE  
1455 C CZ  . ARG B 11  ? 0.3037 0.3031 0.2582 0.0191  0.0042  0.0232  910 ARG B CZ  
1456 N NH1 . ARG B 11  ? 0.3130 0.3099 0.2625 0.0198  0.0084  0.0241  910 ARG B NH1 
1457 N NH2 . ARG B 11  ? 0.2994 0.3002 0.2610 0.0165  0.0025  0.0195  910 ARG B NH2 
1458 N N   . CYS B 12  ? 0.1883 0.1874 0.1690 0.0263  0.0025  0.0387  911 CYS B N   
1459 C CA  . CYS B 12  ? 0.1992 0.2003 0.1865 0.0276  0.0003  0.0389  911 CYS B CA  
1460 C C   . CYS B 12  ? 0.2153 0.2199 0.1985 0.0311  -0.0032 0.0428  911 CYS B C   
1461 O O   . CYS B 12  ? 0.2242 0.2290 0.1986 0.0324  -0.0039 0.0453  911 CYS B O   
1462 C CB  . CYS B 12  ? 0.2033 0.1992 0.1979 0.0282  0.0039  0.0407  911 CYS B CB  
1463 S SG  . CYS B 12  ? 0.2049 0.1971 0.2052 0.0242  0.0070  0.0358  911 CYS B SG  
1464 N N   . ARG B 13  ? 0.2318 0.2395 0.2214 0.0328  -0.0054 0.0435  912 ARG B N   
1465 C CA  . ARG B 13  ? 0.2621 0.2740 0.2498 0.0364  -0.0093 0.0475  912 ARG B CA  
1466 C C   . ARG B 13  ? 0.2821 0.2893 0.2663 0.0398  -0.0067 0.0540  912 ARG B C   
1467 O O   . ARG B 13  ? 0.2886 0.2898 0.2774 0.0401  -0.0022 0.0557  912 ARG B O   
1468 C CB  . ARG B 13  ? 0.2712 0.2872 0.2683 0.0378  -0.0112 0.0471  912 ARG B CB  
1469 C CG  . ARG B 13  ? 0.2765 0.2978 0.2777 0.0347  -0.0135 0.0417  912 ARG B CG  
1470 C CD  . ARG B 13  ? 0.2883 0.3133 0.2995 0.0364  -0.0139 0.0417  912 ARG B CD  
1471 N NE  . ARG B 13  ? 0.3076 0.3398 0.3207 0.0391  -0.0187 0.0448  912 ARG B NE  
1472 C CZ  . ARG B 13  ? 0.3131 0.3508 0.3354 0.0411  -0.0198 0.0455  912 ARG B CZ  
1473 N NH1 . ARG B 13  ? 0.3146 0.3508 0.3439 0.0410  -0.0161 0.0433  912 ARG B NH1 
1474 N NH2 . ARG B 13  ? 0.3257 0.3708 0.3501 0.0435  -0.0246 0.0486  912 ARG B NH2 
1475 N N   . ARG B 14  ? 0.3107 0.3206 0.2867 0.0424  -0.0098 0.0576  913 ARG B N   
1476 C CA  . ARG B 14  ? 0.3377 0.3438 0.3086 0.0462  -0.0078 0.0647  913 ARG B CA  
1477 C C   . ARG B 14  ? 0.3443 0.3541 0.3185 0.0507  -0.0113 0.0693  913 ARG B C   
1478 O O   . ARG B 14  ? 0.3483 0.3640 0.3292 0.0506  -0.0152 0.0667  913 ARG B O   
1479 C CB  . ARG B 14  ? 0.3626 0.3690 0.3201 0.0467  -0.0086 0.0658  913 ARG B CB  
1480 C CG  . ARG B 14  ? 0.3754 0.3779 0.3293 0.0432  -0.0042 0.0626  913 ARG B CG  
1481 C CD  . ARG B 14  ? 0.4013 0.4038 0.3410 0.0446  -0.0045 0.0641  913 ARG B CD  
1482 N NE  . ARG B 14  ? 0.4180 0.4263 0.3512 0.0445  -0.0114 0.0604  913 ARG B NE  
1483 C CZ  . ARG B 14  ? 0.4315 0.4437 0.3580 0.0479  -0.0167 0.0632  913 ARG B CZ  
1484 N NH1 . ARG B 14  ? 0.4489 0.4600 0.3734 0.0523  -0.0160 0.0706  913 ARG B NH1 
1485 N NH2 . ARG B 14  ? 0.4374 0.4548 0.3594 0.0468  -0.0232 0.0586  913 ARG B NH2 
1486 N N   . NH2 B 15  ? 0.3523 0.3586 0.3230 0.0548  -0.0096 0.0765  914 NH2 B N   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   29  ?   ?   ?   A . n 
A 1 2   ALA 2   30  ?   ?   ?   A . n 
A 1 3   SER 3   31  ?   ?   ?   A . n 
A 1 4   ARG 4   32  ?   ?   ?   A . n 
A 1 5   ASP 5   33  33  ASP ASP A . n 
A 1 6   ASP 6   34  34  ASP ASP A . n 
A 1 7   TRP 7   35  35  TRP TRP A . n 
A 1 8   ARG 8   36  36  ARG ARG A . n 
A 1 9   ALA 9   37  37  ALA ALA A . n 
A 1 10  ALA 10  38  38  ALA ALA A . n 
A 1 11  ARG 11  39  39  ARG ARG A . n 
A 1 12  SER 12  40  40  SER SER A . n 
A 1 13  MET 13  41  41  MET MET A . n 
A 1 14  HIS 14  42  42  HIS HIS A . n 
A 1 15  GLU 15  43  43  GLU GLU A . n 
A 1 16  PHE 16  44  44  PHE PHE A . n 
A 1 17  SER 17  45  45  SER SER A . n 
A 1 18  ALA 18  46  46  ALA ALA A . n 
A 1 19  LYS 19  47  47  LYS LYS A . n 
A 1 20  ASP 20  48  48  ASP ASP A . n 
A 1 21  ILE 21  49  49  ILE ILE A . n 
A 1 22  ASP 22  50  50  ASP ASP A . n 
A 1 23  GLY 23  51  51  GLY GLY A . n 
A 1 24  HIS 24  52  52  HIS HIS A . n 
A 1 25  MET 25  53  53  MET MET A . n 
A 1 26  VAL 26  54  54  VAL VAL A . n 
A 1 27  ASN 27  55  55  ASN ASN A . n 
A 1 28  LEU 28  56  56  LEU LEU A . n 
A 1 29  ASP 29  57  57  ASP ASP A . n 
A 1 30  LYS 30  58  58  LYS LYS A . n 
A 1 31  TYR 31  59  59  TYR TYR A . n 
A 1 32  ARG 32  60  60  ARG ARG A . n 
A 1 33  GLY 33  61  61  GLY GLY A . n 
A 1 34  PHE 34  62  62  PHE PHE A . n 
A 1 35  VAL 35  63  63  VAL VAL A . n 
A 1 36  SER 36  64  64  SER SER A . n 
A 1 37  ILE 37  65  65  ILE ILE A . n 
A 1 38  VAL 38  66  66  VAL VAL A . n 
A 1 39  THR 39  67  67  THR THR A . n 
A 1 40  ASN 40  68  68  ASN ASN A . n 
A 1 41  VAL 41  69  69  VAL VAL A . n 
A 1 42  ALA 42  70  70  ALA ALA A . n 
A 1 43  SER 43  71  71  SER SER A . n 
A 1 44  GLN 44  72  72  GLN GLN A . n 
A 1 45  OCS 45  73  73  OCS OCS A . n 
A 1 46  GLY 46  74  74  GLY GLY A . n 
A 1 47  LYS 47  75  75  LYS LYS A . n 
A 1 48  THR 48  76  76  THR THR A . n 
A 1 49  GLU 49  77  77  GLU GLU A . n 
A 1 50  VAL 50  78  78  VAL VAL A . n 
A 1 51  ASN 51  79  79  ASN ASN A . n 
A 1 52  TYR 52  80  80  TYR TYR A . n 
A 1 53  THR 53  81  81  THR THR A . n 
A 1 54  GLN 54  82  82  GLN GLN A . n 
A 1 55  LEU 55  83  83  LEU LEU A . n 
A 1 56  VAL 56  84  84  VAL VAL A . n 
A 1 57  ASP 57  85  85  ASP ASP A . n 
A 1 58  LEU 58  86  86  LEU LEU A . n 
A 1 59  HIS 59  87  87  HIS HIS A . n 
A 1 60  ALA 60  88  88  ALA ALA A . n 
A 1 61  ARG 61  89  89  ARG ARG A . n 
A 1 62  TYR 62  90  90  TYR TYR A . n 
A 1 63  ALA 63  91  91  ALA ALA A . n 
A 1 64  GLU 64  92  92  GLU GLU A . n 
A 1 65  ARG 65  93  93  ARG ARG A . n 
A 1 66  GLY 66  94  94  GLY GLY A . n 
A 1 67  LEU 67  95  95  LEU LEU A . n 
A 1 68  ARG 68  96  96  ARG ARG A . n 
A 1 69  ILE 69  97  97  ILE ILE A . n 
A 1 70  LEU 70  98  98  LEU LEU A . n 
A 1 71  ALA 71  99  99  ALA ALA A . n 
A 1 72  PHE 72  100 100 PHE PHE A . n 
A 1 73  PRO 73  101 101 PRO PRO A . n 
A 1 74  SER 74  102 102 SER SER A . n 
A 1 75  ASN 75  103 103 ASN ASN A . n 
A 1 76  GLN 76  104 104 GLN GLN A . n 
A 1 77  PHE 77  105 105 PHE PHE A . n 
A 1 78  GLY 78  106 106 GLY GLY A . n 
A 1 79  LYS 79  107 107 LYS LYS A . n 
A 1 80  GLN 80  108 108 GLN GLN A . n 
A 1 81  GLU 81  109 109 GLU GLU A . n 
A 1 82  PRO 82  110 110 PRO PRO A . n 
A 1 83  GLY 83  111 111 GLY GLY A . n 
A 1 84  SER 84  112 112 SER SER A . n 
A 1 85  ASN 85  113 113 ASN ASN A . n 
A 1 86  GLU 86  114 114 GLU GLU A . n 
A 1 87  GLU 87  115 115 GLU GLU A . n 
A 1 88  ILE 88  116 116 ILE ILE A . n 
A 1 89  LYS 89  117 117 LYS LYS A . n 
A 1 90  GLU 90  118 118 GLU GLU A . n 
A 1 91  PHE 91  119 119 PHE PHE A . n 
A 1 92  ALA 92  120 120 ALA ALA A . n 
A 1 93  ALA 93  121 121 ALA ALA A . n 
A 1 94  GLY 94  122 122 GLY GLY A . n 
A 1 95  TYR 95  123 123 TYR TYR A . n 
A 1 96  ASN 96  124 124 ASN ASN A . n 
A 1 97  VAL 97  125 125 VAL VAL A . n 
A 1 98  LYS 98  126 126 LYS LYS A . n 
A 1 99  PHE 99  127 127 PHE PHE A . n 
A 1 100 ASP 100 128 128 ASP ASP A . n 
A 1 101 MET 101 129 129 MET MET A . n 
A 1 102 PHE 102 130 130 PHE PHE A . n 
A 1 103 SER 103 131 131 SER SER A . n 
A 1 104 LYS 104 132 132 LYS LYS A . n 
A 1 105 ILE 105 133 133 ILE ILE A . n 
A 1 106 GLU 106 134 134 GLU GLU A . n 
A 1 107 VAL 107 135 135 VAL VAL A . n 
A 1 108 ASN 108 136 136 ASN ASN A . n 
A 1 109 GLY 109 137 137 GLY GLY A . n 
A 1 110 ASP 110 138 138 ASP ASP A . n 
A 1 111 ASP 111 139 139 ASP ASP A . n 
A 1 112 ALA 112 140 140 ALA ALA A . n 
A 1 113 HIS 113 141 141 HIS HIS A . n 
A 1 114 PRO 114 142 142 PRO PRO A . n 
A 1 115 LEU 115 143 143 LEU LEU A . n 
A 1 116 TRP 116 144 144 TRP TRP A . n 
A 1 117 LYS 117 145 145 LYS LYS A . n 
A 1 118 TRP 118 146 146 TRP TRP A . n 
A 1 119 MET 119 147 147 MET MET A . n 
A 1 120 LYS 120 148 148 LYS LYS A . n 
A 1 121 ILE 121 149 149 ILE ILE A . n 
A 1 122 GLN 122 150 150 GLN GLN A . n 
A 1 123 PRO 123 151 151 PRO PRO A . n 
A 1 124 LYS 124 152 152 LYS LYS A . n 
A 1 125 GLY 125 153 153 GLY GLY A . n 
A 1 126 LYS 126 154 154 LYS LYS A . n 
A 1 127 GLY 127 155 155 GLY GLY A . n 
A 1 128 ILE 128 156 156 ILE ILE A . n 
A 1 129 LEU 129 157 157 LEU LEU A . n 
A 1 130 GLY 130 158 158 GLY GLY A . n 
A 1 131 ASN 131 159 159 ASN ASN A . n 
A 1 132 ALA 132 160 160 ALA ALA A . n 
A 1 133 ILE 133 161 161 ILE ILE A . n 
A 1 134 LYS 134 162 162 LYS LYS A . n 
A 1 135 TRP 135 163 163 TRP TRP A . n 
A 1 136 ASN 136 164 164 ASN ASN A . n 
A 1 137 PHE 137 165 165 PHE PHE A . n 
A 1 138 THR 138 166 166 THR THR A . n 
A 1 139 LYS 139 167 167 LYS LYS A . n 
A 1 140 PHE 140 168 168 PHE PHE A . n 
A 1 141 LEU 141 169 169 LEU LEU A . n 
A 1 142 ILE 142 170 170 ILE ILE A . n 
A 1 143 ASP 143 171 171 ASP ASP A . n 
A 1 144 LYS 144 172 172 LYS LYS A . n 
A 1 145 ASN 145 173 173 ASN ASN A . n 
A 1 146 GLY 146 174 174 GLY GLY A . n 
A 1 147 VAL 147 175 175 VAL VAL A . n 
A 1 148 VAL 148 176 176 VAL VAL A . n 
A 1 149 VAL 149 177 177 VAL VAL A . n 
A 1 150 LYS 150 178 178 LYS LYS A . n 
A 1 151 ARG 151 179 179 ARG ARG A . n 
A 1 152 TYR 152 180 180 TYR TYR A . n 
A 1 153 GLY 153 181 181 GLY GLY A . n 
A 1 154 PRO 154 182 182 PRO PRO A . n 
A 1 155 MET 155 183 183 MET MET A . n 
A 1 156 GLU 156 184 184 GLU GLU A . n 
A 1 157 GLU 157 185 185 GLU GLU A . n 
A 1 158 PRO 158 186 186 PRO PRO A . n 
A 1 159 LEU 159 187 187 LEU LEU A . n 
A 1 160 VAL 160 188 188 VAL VAL A . n 
A 1 161 ILE 161 189 189 ILE ILE A . n 
A 1 162 GLU 162 190 190 GLU GLU A . n 
A 1 163 LYS 163 191 191 LYS LYS A . n 
A 1 164 ASP 164 192 192 ASP ASP A . n 
A 1 165 LEU 165 193 193 LEU LEU A . n 
A 1 166 PRO 166 194 194 PRO PRO A . n 
A 1 167 HIS 167 195 195 HIS HIS A . n 
A 1 168 TYR 168 196 196 TYR TYR A . n 
A 1 169 PHE 169 197 197 PHE PHE A . n 
B 2 1   ACE 1   900 900 ACE ACE B . n 
B 2 2   CYS 2   901 901 CYS CYS B . n 
B 2 3   ARG 3   902 902 ARG ARG B . n 
B 2 4   VAL 4   903 903 VAL VAL B . n 
B 2 5   ASP 5   904 904 ASP ASP B . n 
B 2 6   LEU 6   905 905 LEU LEU B . n 
B 2 7   GLN 7   906 906 GLN GLN B . n 
B 2 8   GLY 8   907 907 GLY GLY B . n 
B 2 9   TRP 9   908 908 TRP TRP B . n 
B 2 10  ARG 10  909 909 ARG ARG B . n 
B 2 11  ARG 11  910 910 ARG ARG B . n 
B 2 12  CYS 12  911 911 CYS CYS B . n 
B 2 13  ARG 13  912 912 ARG ARG B . n 
B 2 14  ARG 14  913 913 ARG ARG B . n 
B 2 15  NH2 15  914 914 NH2 NH2 B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GOL 1   201  1   GOL GOL A . 
D 3 GOL 1   202  2   GOL GOL A . 
E 4 HOH 1   301  120 HOH HOH A . 
E 4 HOH 2   302  7   HOH HOH A . 
E 4 HOH 3   303  98  HOH HOH A . 
E 4 HOH 4   304  33  HOH HOH A . 
E 4 HOH 5   305  137 HOH HOH A . 
E 4 HOH 6   306  119 HOH HOH A . 
E 4 HOH 7   307  31  HOH HOH A . 
E 4 HOH 8   308  112 HOH HOH A . 
E 4 HOH 9   309  24  HOH HOH A . 
E 4 HOH 10  310  84  HOH HOH A . 
E 4 HOH 11  311  67  HOH HOH A . 
E 4 HOH 12  312  6   HOH HOH A . 
E 4 HOH 13  313  50  HOH HOH A . 
E 4 HOH 14  314  109 HOH HOH A . 
E 4 HOH 15  315  61  HOH HOH A . 
E 4 HOH 16  316  28  HOH HOH A . 
E 4 HOH 17  317  116 HOH HOH A . 
E 4 HOH 18  318  42  HOH HOH A . 
E 4 HOH 19  319  8   HOH HOH A . 
E 4 HOH 20  320  90  HOH HOH A . 
E 4 HOH 21  321  53  HOH HOH A . 
E 4 HOH 22  322  79  HOH HOH A . 
E 4 HOH 23  323  13  HOH HOH A . 
E 4 HOH 24  324  14  HOH HOH A . 
E 4 HOH 25  325  40  HOH HOH A . 
E 4 HOH 26  326  134 HOH HOH A . 
E 4 HOH 27  327  30  HOH HOH A . 
E 4 HOH 28  328  115 HOH HOH A . 
E 4 HOH 29  329  57  HOH HOH A . 
E 4 HOH 30  330  43  HOH HOH A . 
E 4 HOH 31  331  17  HOH HOH A . 
E 4 HOH 32  332  32  HOH HOH A . 
E 4 HOH 33  333  94  HOH HOH A . 
E 4 HOH 34  334  4   HOH HOH A . 
E 4 HOH 35  335  44  HOH HOH A . 
E 4 HOH 36  336  80  HOH HOH A . 
E 4 HOH 37  337  65  HOH HOH A . 
E 4 HOH 38  338  68  HOH HOH A . 
E 4 HOH 39  339  62  HOH HOH A . 
E 4 HOH 40  340  2   HOH HOH A . 
E 4 HOH 41  341  12  HOH HOH A . 
E 4 HOH 42  342  77  HOH HOH A . 
E 4 HOH 43  343  86  HOH HOH A . 
E 4 HOH 44  344  26  HOH HOH A . 
E 4 HOH 45  345  70  HOH HOH A . 
E 4 HOH 46  346  118 HOH HOH A . 
E 4 HOH 47  347  89  HOH HOH A . 
E 4 HOH 48  348  3   HOH HOH A . 
E 4 HOH 49  349  54  HOH HOH A . 
E 4 HOH 50  350  122 HOH HOH A . 
E 4 HOH 51  351  22  HOH HOH A . 
E 4 HOH 52  352  123 HOH HOH A . 
E 4 HOH 53  353  126 HOH HOH A . 
E 4 HOH 54  354  5   HOH HOH A . 
E 4 HOH 55  355  1   HOH HOH A . 
E 4 HOH 56  356  110 HOH HOH A . 
E 4 HOH 57  357  18  HOH HOH A . 
E 4 HOH 58  358  15  HOH HOH A . 
E 4 HOH 59  359  140 HOH HOH A . 
E 4 HOH 60  360  29  HOH HOH A . 
E 4 HOH 61  361  35  HOH HOH A . 
E 4 HOH 62  362  58  HOH HOH A . 
E 4 HOH 63  363  48  HOH HOH A . 
E 4 HOH 64  364  9   HOH HOH A . 
E 4 HOH 65  365  37  HOH HOH A . 
E 4 HOH 66  366  25  HOH HOH A . 
E 4 HOH 67  367  74  HOH HOH A . 
E 4 HOH 68  368  127 HOH HOH A . 
E 4 HOH 69  369  92  HOH HOH A . 
E 4 HOH 70  370  117 HOH HOH A . 
E 4 HOH 71  371  99  HOH HOH A . 
E 4 HOH 72  372  41  HOH HOH A . 
E 4 HOH 73  373  102 HOH HOH A . 
E 4 HOH 74  374  82  HOH HOH A . 
E 4 HOH 75  375  135 HOH HOH A . 
E 4 HOH 76  376  71  HOH HOH A . 
E 4 HOH 77  377  87  HOH HOH A . 
E 4 HOH 78  378  20  HOH HOH A . 
E 4 HOH 79  379  52  HOH HOH A . 
E 4 HOH 80  380  66  HOH HOH A . 
E 4 HOH 81  381  23  HOH HOH A . 
E 4 HOH 82  382  39  HOH HOH A . 
E 4 HOH 83  383  45  HOH HOH A . 
E 4 HOH 84  384  78  HOH HOH A . 
E 4 HOH 85  385  19  HOH HOH A . 
E 4 HOH 86  386  47  HOH HOH A . 
E 4 HOH 87  387  105 HOH HOH A . 
E 4 HOH 88  388  136 HOH HOH A . 
E 4 HOH 89  389  63  HOH HOH A . 
E 4 HOH 90  390  60  HOH HOH A . 
E 4 HOH 91  391  104 HOH HOH A . 
E 4 HOH 92  392  27  HOH HOH A . 
E 4 HOH 93  393  93  HOH HOH A . 
E 4 HOH 94  394  59  HOH HOH A . 
E 4 HOH 95  395  34  HOH HOH A . 
E 4 HOH 96  396  16  HOH HOH A . 
E 4 HOH 97  397  83  HOH HOH A . 
E 4 HOH 98  398  49  HOH HOH A . 
E 4 HOH 99  399  51  HOH HOH A . 
E 4 HOH 100 400  75  HOH HOH A . 
E 4 HOH 101 401  72  HOH HOH A . 
E 4 HOH 102 402  88  HOH HOH A . 
E 4 HOH 103 403  56  HOH HOH A . 
E 4 HOH 104 404  139 HOH HOH A . 
E 4 HOH 105 405  129 HOH HOH A . 
E 4 HOH 106 406  133 HOH HOH A . 
E 4 HOH 107 407  132 HOH HOH A . 
E 4 HOH 108 408  130 HOH HOH A . 
E 4 HOH 109 409  111 HOH HOH A . 
E 4 HOH 110 410  100 HOH HOH A . 
E 4 HOH 111 411  121 HOH HOH A . 
E 4 HOH 112 412  124 HOH HOH A . 
E 4 HOH 113 413  113 HOH HOH A . 
E 4 HOH 114 414  73  HOH HOH A . 
E 4 HOH 115 415  96  HOH HOH A . 
E 4 HOH 116 416  95  HOH HOH A . 
E 4 HOH 117 417  21  HOH HOH A . 
E 4 HOH 118 418  11  HOH HOH A . 
E 4 HOH 119 419  101 HOH HOH A . 
E 4 HOH 120 420  85  HOH HOH A . 
E 4 HOH 121 421  91  HOH HOH A . 
E 4 HOH 122 422  128 HOH HOH A . 
E 4 HOH 123 423  10  HOH HOH A . 
E 4 HOH 124 424  125 HOH HOH A . 
E 4 HOH 125 425  138 HOH HOH A . 
E 4 HOH 126 426  81  HOH HOH A . 
E 4 HOH 127 427  103 HOH HOH A . 
E 4 HOH 128 428  46  HOH HOH A . 
E 4 HOH 129 429  97  HOH HOH A . 
E 4 HOH 130 430  64  HOH HOH A . 
E 4 HOH 131 431  131 HOH HOH A . 
F 4 HOH 1   1001 69  HOH HOH B . 
F 4 HOH 2   1002 38  HOH HOH B . 
F 4 HOH 3   1003 36  HOH HOH B . 
F 4 HOH 4   1004 108 HOH HOH B . 
F 4 HOH 5   1005 76  HOH HOH B . 
F 4 HOH 6   1006 107 HOH HOH B . 
F 4 HOH 7   1007 55  HOH HOH B . 
F 4 HOH 8   1008 114 HOH HOH B . 
F 4 HOH 9   1009 106 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1520 ? 
1 MORE         -5   ? 
1 'SSA (A^2)'  8990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-12-07 
2 'Structure model' 1 1 2017-01-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -3.5265 
_pdbx_refine_tls.origin_y         19.2958 
_pdbx_refine_tls.origin_z         -14.6153 
_pdbx_refine_tls.T[1][1]          0.0004 
_pdbx_refine_tls.T[2][2]          0.0084 
_pdbx_refine_tls.T[3][3]          0.0077 
_pdbx_refine_tls.T[1][2]          0.0004 
_pdbx_refine_tls.T[1][3]          -0.0005 
_pdbx_refine_tls.T[2][3]          -0.0063 
_pdbx_refine_tls.L[1][1]          0.6861 
_pdbx_refine_tls.L[2][2]          0.7584 
_pdbx_refine_tls.L[3][3]          0.4936 
_pdbx_refine_tls.L[1][2]          -0.2097 
_pdbx_refine_tls.L[1][3]          -0.0437 
_pdbx_refine_tls.L[2][3]          -0.1551 
_pdbx_refine_tls.S[1][1]          -0.0102 
_pdbx_refine_tls.S[1][2]          -0.0292 
_pdbx_refine_tls.S[1][3]          0.0050 
_pdbx_refine_tls.S[2][1]          0.0131 
_pdbx_refine_tls.S[2][2]          0.0205 
_pdbx_refine_tls.S[2][3]          -0.0093 
_pdbx_refine_tls.S[3][1]          0.0044 
_pdbx_refine_tls.S[3][2]          -0.0221 
_pdbx_refine_tls.S[3][3]          -0.0102 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 33  ? ? A 197 ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 B 900 ? ? B 914 ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC    ? ? ? 5.8.0151 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER    ? ? ? .        4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              910 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              910 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              910 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                115.50 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -4.80 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LEU 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     157 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -114.58 
_pdbx_validate_torsion.psi             51.65 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 29 ? A SER 1 
2 1 Y 1 A ALA 30 ? A ALA 2 
3 1 Y 1 A SER 31 ? A SER 3 
4 1 Y 1 A ARG 32 ? A ARG 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL GOL 
4 water    HOH 
#