data_5H8N
# 
_entry.id   5H8N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5H8N         
WWPDB D_1000216663 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5H8F unspecified 
PDB . 5H8H unspecified 
PDB . 5H8Q unspecified 
PDB . 5H8R unspecified 
PDB . 5H8S unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5H8N 
_pdbx_database_status.recvd_initial_deposition_date   2015-12-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wallweber, H.J.A.' 1 
'Lupardus, P.J.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Neuron 
_citation.journal_id_ASTM           NERNET 
_citation.journal_id_CSD            2038 
_citation.journal_id_ISSN           1097-4199 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            89 
_citation.language                  ? 
_citation.page_first                983 
_citation.page_last                 999 
_citation.title                     
'Positive Allosteric Modulators of GluN2A-Containing NMDARs with Distinct Modes of Action and Impacts on Circuit Function.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.neuron.2016.01.016 
_citation.pdbx_database_id_PubMed   26875626 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hackos, D.H.'    1  
primary 'Lupardus, P.J.'  2  
primary 'Grand, T.'       3  
primary 'Chen, Y.'        4  
primary 'Wang, T.M.'      5  
primary 'Reynen, P.'      6  
primary 'Gustafson, A.'   7  
primary 'Wallweber, H.J.' 8  
primary 'Volgraf, M.'     9  
primary 'Sellers, B.D.'   10 
primary 'Schwarz, J.B.'   11 
primary 'Paoletti, P.'    12 
primary 'Sheng, M.'       13 
primary 'Zhou, Q.'        14 
primary 'Hanson, J.E.'    15 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5H8N 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     54.655 
_cell.length_a_esd                 ? 
_cell.length_b                     89.791 
_cell.length_b_esd                 ? 
_cell.length_c                     124.695 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5H8N 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor ionotropic, NMDA 2A' 31883.441 1   ? ? 
'UNP residues 401-539, GT linker, UNP residues 661-802' ? 
2 polymer     man 'Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1'   33409.074 1   ? ? 
'UNP residues 394-544, GT linker, UNP residues 663-800' ? 
3 non-polymer syn 'GLUTAMIC ACID'                                                                 147.129   1   ? ? ? ? 
4 non-polymer syn '4-[[(4-fluorophenyl)sulfonylamino]methyl]-~{N}-(pyridin-3-ylmethyl)benzamide'  399.439   1   ? ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                                   40.078    1   ? ? ? ? 
6 non-polymer syn GLYCINE                                                                         75.067    1   ? ? ? ? 
7 water       nat water                                                                           18.015    138 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'GluN2A, Glutamate [NMDA] receptor subunit epsilon-1, N-methyl D-aspartate receptor subtype 2A, hNR2A' 
2 'GluN1, Glutamate [NMDA] receptor subunit zeta-1, N-methyl-D-aspartate receptor subunit NR1, NMD-R1'   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLY
LVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYS
PPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFA
TTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHN
;
;GSPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLY
LVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYS
PPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFA
TTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHN
;
A ? 
2 'polypeptide(L)' no no 
;GSMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN
FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGI
NDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLV
TTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
;
;GSMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMN
FTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGI
NDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLV
TTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PRO n 
1 4   ASP n 
1 5   ASP n 
1 6   ASN n 
1 7   HIS n 
1 8   LEU n 
1 9   SER n 
1 10  ILE n 
1 11  VAL n 
1 12  THR n 
1 13  LEU n 
1 14  GLU n 
1 15  GLU n 
1 16  ALA n 
1 17  PRO n 
1 18  PHE n 
1 19  VAL n 
1 20  ILE n 
1 21  VAL n 
1 22  GLU n 
1 23  ASP n 
1 24  ILE n 
1 25  ASP n 
1 26  PRO n 
1 27  LEU n 
1 28  THR n 
1 29  GLU n 
1 30  THR n 
1 31  CYS n 
1 32  VAL n 
1 33  ARG n 
1 34  ASN n 
1 35  THR n 
1 36  VAL n 
1 37  PRO n 
1 38  CYS n 
1 39  ARG n 
1 40  LYS n 
1 41  PHE n 
1 42  VAL n 
1 43  LYS n 
1 44  ILE n 
1 45  ASN n 
1 46  ASN n 
1 47  SER n 
1 48  THR n 
1 49  ASN n 
1 50  GLU n 
1 51  GLY n 
1 52  MET n 
1 53  ASN n 
1 54  VAL n 
1 55  LYS n 
1 56  LYS n 
1 57  CYS n 
1 58  CYS n 
1 59  LYS n 
1 60  GLY n 
1 61  PHE n 
1 62  CYS n 
1 63  ILE n 
1 64  ASP n 
1 65  ILE n 
1 66  LEU n 
1 67  LYS n 
1 68  LYS n 
1 69  LEU n 
1 70  SER n 
1 71  ARG n 
1 72  THR n 
1 73  VAL n 
1 74  LYS n 
1 75  PHE n 
1 76  THR n 
1 77  TYR n 
1 78  ASP n 
1 79  LEU n 
1 80  TYR n 
1 81  LEU n 
1 82  VAL n 
1 83  THR n 
1 84  ASN n 
1 85  GLY n 
1 86  LYS n 
1 87  HIS n 
1 88  GLY n 
1 89  LYS n 
1 90  LYS n 
1 91  VAL n 
1 92  ASN n 
1 93  ASN n 
1 94  VAL n 
1 95  TRP n 
1 96  ASN n 
1 97  GLY n 
1 98  MET n 
1 99  ILE n 
1 100 GLY n 
1 101 GLU n 
1 102 VAL n 
1 103 VAL n 
1 104 TYR n 
1 105 GLN n 
1 106 ARG n 
1 107 ALA n 
1 108 VAL n 
1 109 MET n 
1 110 ALA n 
1 111 VAL n 
1 112 GLY n 
1 113 SER n 
1 114 LEU n 
1 115 THR n 
1 116 ILE n 
1 117 ASN n 
1 118 GLU n 
1 119 GLU n 
1 120 ARG n 
1 121 SER n 
1 122 GLU n 
1 123 VAL n 
1 124 VAL n 
1 125 ASP n 
1 126 PHE n 
1 127 SER n 
1 128 VAL n 
1 129 PRO n 
1 130 PHE n 
1 131 VAL n 
1 132 GLU n 
1 133 THR n 
1 134 GLY n 
1 135 ILE n 
1 136 SER n 
1 137 VAL n 
1 138 MET n 
1 139 VAL n 
1 140 SER n 
1 141 ARG n 
1 142 GLY n 
1 143 THR n 
1 144 GLN n 
1 145 VAL n 
1 146 THR n 
1 147 GLY n 
1 148 LEU n 
1 149 SER n 
1 150 ASP n 
1 151 LYS n 
1 152 LYS n 
1 153 PHE n 
1 154 GLN n 
1 155 ARG n 
1 156 PRO n 
1 157 HIS n 
1 158 ASP n 
1 159 TYR n 
1 160 SER n 
1 161 PRO n 
1 162 PRO n 
1 163 PHE n 
1 164 ARG n 
1 165 PHE n 
1 166 GLY n 
1 167 THR n 
1 168 VAL n 
1 169 PRO n 
1 170 ASN n 
1 171 GLY n 
1 172 SER n 
1 173 THR n 
1 174 GLU n 
1 175 ARG n 
1 176 ASN n 
1 177 ILE n 
1 178 ARG n 
1 179 ASN n 
1 180 ASN n 
1 181 TYR n 
1 182 PRO n 
1 183 TYR n 
1 184 MET n 
1 185 HIS n 
1 186 GLN n 
1 187 TYR n 
1 188 MET n 
1 189 THR n 
1 190 LYS n 
1 191 PHE n 
1 192 ASN n 
1 193 GLN n 
1 194 LYS n 
1 195 GLY n 
1 196 VAL n 
1 197 GLU n 
1 198 ASP n 
1 199 ALA n 
1 200 LEU n 
1 201 VAL n 
1 202 SER n 
1 203 LEU n 
1 204 LYS n 
1 205 THR n 
1 206 GLY n 
1 207 LYS n 
1 208 LEU n 
1 209 ASP n 
1 210 ALA n 
1 211 PHE n 
1 212 ILE n 
1 213 TYR n 
1 214 ASP n 
1 215 ALA n 
1 216 ALA n 
1 217 VAL n 
1 218 LEU n 
1 219 ASN n 
1 220 TYR n 
1 221 LYS n 
1 222 ALA n 
1 223 GLY n 
1 224 ARG n 
1 225 ASP n 
1 226 GLU n 
1 227 GLY n 
1 228 CYS n 
1 229 LYS n 
1 230 LEU n 
1 231 VAL n 
1 232 THR n 
1 233 ILE n 
1 234 GLY n 
1 235 SER n 
1 236 GLY n 
1 237 TYR n 
1 238 ILE n 
1 239 PHE n 
1 240 ALA n 
1 241 THR n 
1 242 THR n 
1 243 GLY n 
1 244 TYR n 
1 245 GLY n 
1 246 ILE n 
1 247 ALA n 
1 248 LEU n 
1 249 GLN n 
1 250 LYS n 
1 251 GLY n 
1 252 SER n 
1 253 PRO n 
1 254 TRP n 
1 255 LYS n 
1 256 ARG n 
1 257 GLN n 
1 258 ILE n 
1 259 ASP n 
1 260 LEU n 
1 261 ALA n 
1 262 LEU n 
1 263 LEU n 
1 264 GLN n 
1 265 PHE n 
1 266 VAL n 
1 267 GLY n 
1 268 ASP n 
1 269 GLY n 
1 270 GLU n 
1 271 MET n 
1 272 GLU n 
1 273 GLU n 
1 274 LEU n 
1 275 GLU n 
1 276 THR n 
1 277 LEU n 
1 278 TRP n 
1 279 LEU n 
1 280 THR n 
1 281 GLY n 
1 282 ILE n 
1 283 CYS n 
1 284 HIS n 
1 285 ASN n 
2 1   GLY n 
2 2   SER n 
2 3   MET n 
2 4   SER n 
2 5   THR n 
2 6   ARG n 
2 7   LEU n 
2 8   LYS n 
2 9   ILE n 
2 10  VAL n 
2 11  THR n 
2 12  ILE n 
2 13  HIS n 
2 14  GLN n 
2 15  GLU n 
2 16  PRO n 
2 17  PHE n 
2 18  VAL n 
2 19  TYR n 
2 20  VAL n 
2 21  LYS n 
2 22  PRO n 
2 23  THR n 
2 24  LEU n 
2 25  SER n 
2 26  ASP n 
2 27  GLY n 
2 28  THR n 
2 29  CYS n 
2 30  LYS n 
2 31  GLU n 
2 32  GLU n 
2 33  PHE n 
2 34  THR n 
2 35  VAL n 
2 36  ASN n 
2 37  GLY n 
2 38  ASP n 
2 39  PRO n 
2 40  VAL n 
2 41  LYS n 
2 42  LYS n 
2 43  VAL n 
2 44  ILE n 
2 45  CYS n 
2 46  THR n 
2 47  GLY n 
2 48  PRO n 
2 49  ASN n 
2 50  ASP n 
2 51  THR n 
2 52  SER n 
2 53  PRO n 
2 54  GLY n 
2 55  SER n 
2 56  PRO n 
2 57  ARG n 
2 58  HIS n 
2 59  THR n 
2 60  VAL n 
2 61  PRO n 
2 62  GLN n 
2 63  CYS n 
2 64  CYS n 
2 65  TYR n 
2 66  GLY n 
2 67  PHE n 
2 68  CYS n 
2 69  ILE n 
2 70  ASP n 
2 71  LEU n 
2 72  LEU n 
2 73  ILE n 
2 74  LYS n 
2 75  LEU n 
2 76  ALA n 
2 77  ARG n 
2 78  THR n 
2 79  MET n 
2 80  ASN n 
2 81  PHE n 
2 82  THR n 
2 83  TYR n 
2 84  GLU n 
2 85  VAL n 
2 86  HIS n 
2 87  LEU n 
2 88  VAL n 
2 89  ALA n 
2 90  ASP n 
2 91  GLY n 
2 92  LYS n 
2 93  PHE n 
2 94  GLY n 
2 95  THR n 
2 96  GLN n 
2 97  GLU n 
2 98  ARG n 
2 99  VAL n 
2 100 ASN n 
2 101 ASN n 
2 102 SER n 
2 103 ASN n 
2 104 LYS n 
2 105 LYS n 
2 106 GLU n 
2 107 TRP n 
2 108 ASN n 
2 109 GLY n 
2 110 MET n 
2 111 MET n 
2 112 GLY n 
2 113 GLU n 
2 114 LEU n 
2 115 LEU n 
2 116 SER n 
2 117 GLY n 
2 118 GLN n 
2 119 ALA n 
2 120 ASP n 
2 121 MET n 
2 122 ILE n 
2 123 VAL n 
2 124 ALA n 
2 125 PRO n 
2 126 LEU n 
2 127 THR n 
2 128 ILE n 
2 129 ASN n 
2 130 ASN n 
2 131 GLU n 
2 132 ARG n 
2 133 ALA n 
2 134 GLN n 
2 135 TYR n 
2 136 ILE n 
2 137 GLU n 
2 138 PHE n 
2 139 SER n 
2 140 LYS n 
2 141 PRO n 
2 142 PHE n 
2 143 LYS n 
2 144 TYR n 
2 145 GLN n 
2 146 GLY n 
2 147 LEU n 
2 148 THR n 
2 149 ILE n 
2 150 LEU n 
2 151 VAL n 
2 152 LYS n 
2 153 LYS n 
2 154 GLY n 
2 155 THR n 
2 156 ARG n 
2 157 ILE n 
2 158 THR n 
2 159 GLY n 
2 160 ILE n 
2 161 ASN n 
2 162 ASP n 
2 163 PRO n 
2 164 ARG n 
2 165 LEU n 
2 166 ARG n 
2 167 ASN n 
2 168 PRO n 
2 169 SER n 
2 170 ASP n 
2 171 LYS n 
2 172 PHE n 
2 173 ILE n 
2 174 TYR n 
2 175 ALA n 
2 176 THR n 
2 177 VAL n 
2 178 LYS n 
2 179 GLN n 
2 180 SER n 
2 181 SER n 
2 182 VAL n 
2 183 ASP n 
2 184 ILE n 
2 185 TYR n 
2 186 PHE n 
2 187 ARG n 
2 188 ARG n 
2 189 GLN n 
2 190 VAL n 
2 191 GLU n 
2 192 LEU n 
2 193 SER n 
2 194 THR n 
2 195 MET n 
2 196 TYR n 
2 197 ARG n 
2 198 HIS n 
2 199 MET n 
2 200 GLU n 
2 201 LYS n 
2 202 HIS n 
2 203 ASN n 
2 204 TYR n 
2 205 GLU n 
2 206 SER n 
2 207 ALA n 
2 208 ALA n 
2 209 GLU n 
2 210 ALA n 
2 211 ILE n 
2 212 GLN n 
2 213 ALA n 
2 214 VAL n 
2 215 ARG n 
2 216 ASP n 
2 217 ASN n 
2 218 LYS n 
2 219 LEU n 
2 220 HIS n 
2 221 ALA n 
2 222 PHE n 
2 223 ILE n 
2 224 TRP n 
2 225 ASP n 
2 226 SER n 
2 227 ALA n 
2 228 VAL n 
2 229 LEU n 
2 230 GLU n 
2 231 PHE n 
2 232 GLU n 
2 233 ALA n 
2 234 SER n 
2 235 GLN n 
2 236 LYS n 
2 237 CYS n 
2 238 ASP n 
2 239 LEU n 
2 240 VAL n 
2 241 THR n 
2 242 THR n 
2 243 GLY n 
2 244 GLU n 
2 245 LEU n 
2 246 PHE n 
2 247 PHE n 
2 248 ARG n 
2 249 SER n 
2 250 GLY n 
2 251 PHE n 
2 252 GLY n 
2 253 ILE n 
2 254 GLY n 
2 255 MET n 
2 256 ARG n 
2 257 LYS n 
2 258 ASP n 
2 259 SER n 
2 260 PRO n 
2 261 TRP n 
2 262 LYS n 
2 263 GLN n 
2 264 ASN n 
2 265 VAL n 
2 266 SER n 
2 267 LEU n 
2 268 SER n 
2 269 ILE n 
2 270 LEU n 
2 271 LYS n 
2 272 SER n 
2 273 HIS n 
2 274 GLU n 
2 275 ASN n 
2 276 GLY n 
2 277 PHE n 
2 278 MET n 
2 279 GLU n 
2 280 ASP n 
2 281 LEU n 
2 282 ASP n 
2 283 LYS n 
2 284 THR n 
2 285 TRP n 
2 286 VAL n 
2 287 ARG n 
2 288 TYR n 
2 289 GLN n 
2 290 GLU n 
2 291 CYS n 
2 292 ASP n 
2 293 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   141 Human ? 'GRIN2A, NMDAR2A' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 142 285 Human ? 'GRIN2A, NMDAR2A' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   153 Human ? 'GRIN1, NMDAR1'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 2 sample 'Biological sequence' 154 293 Human ? 'GRIN1, NMDAR1'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NMDE1_HUMAN Q12879 ? 1 
;PDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSR
;
401 
2 UNP NMDE1_HUMAN Q12879 ? 1 
;QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAG
RDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHN
;
661 
3 UNP NMDZ1_HUMAN Q05586 ? 2 
;MSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFT
YEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKK
;
394 
4 UNP NMDZ1_HUMAN Q05586 ? 2 
;RITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQ
KCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
;
663 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5H8N A 3   ? 141 ? Q12879 401 ? 539 ? 3   141 
2 2 5H8N A 144 ? 285 ? Q12879 661 ? 802 ? 144 285 
3 3 5H8N B 3   ? 153 ? Q05586 394 ? 544 ? 3   153 
4 4 5H8N B 156 ? 293 ? Q05586 663 ? 800 ? 156 293 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5H8N GLY A 1   ? UNP Q12879 ? ? 'expression tag' 1   1 
1 5H8N SER A 2   ? UNP Q12879 ? ? 'expression tag' 2   2 
1 5H8N GLY A 142 ? UNP Q12879 ? ? linker           142 3 
1 5H8N THR A 143 ? UNP Q12879 ? ? linker           143 4 
3 5H8N GLY B 1   ? UNP Q05586 ? ? 'expression tag' 1   5 
3 5H8N SER B 2   ? UNP Q05586 ? ? 'expression tag' 2   6 
3 5H8N GLY B 154 ? UNP Q05586 ? ? linker           154 7 
3 5H8N THR B 155 ? UNP Q05586 ? ? linker           155 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5YD non-polymer         . '4-[[(4-fluorophenyl)sulfonylamino]methyl]-~{N}-(pyridin-3-ylmethyl)benzamide' ? 'C20 H18 F N3 O3 S' 
399.439 
ALA 'L-peptide linking' y ALANINE                                                                        ? 'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking' y ARGININE                                                                       ? 'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                     ? 'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                ? 'C4 H7 N O4'        
133.103 
CA  non-polymer         . 'CALCIUM ION'                                                                  ? 'Ca 2'              
40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                       ? 'C3 H7 N O2 S'      
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                      ? 'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                ? 'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                                                        ? 'C2 H5 N O2'        
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                      ? 'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                                                                          ? 'H2 O'              
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                     ? 'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                        ? 'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                                                         ? 'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                                                     ? 'C5 H11 N O2 S'     
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                  ? 'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                                                        ? 'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                                                         ? 'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                                                                      ? 'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                     ? 'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                       ? 'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                                                                         ? 'C5 H11 N O2'       
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5H8N 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.46 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1:2 v/v protein to mother liquor (0.1 M HEPES, pH 7.0, 10-13% PEG8000, 2 mM calcium acetate)' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-02-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            40.99 
_reflns.entry_id                         5H8N 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.5 
_reflns.d_resolution_low                 37.72 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       21755 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.0 
_reflns.pdbx_Rmerge_I_obs                0.147 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.50 
_reflns_shell.d_res_low                   2.64 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.686 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            4.6617 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -2.0586 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -2.6031 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               30.77 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.9317 
_refine.correlation_coeff_Fo_to_Fc_free          0.8965 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5H8N 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             27.02 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     21755 
_refine.ls_number_reflns_R_free                  1103 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.36 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1820 
_refine.ls_R_factor_R_free                       0.2358 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1791 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 2A5T' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.269 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.269 
_refine.pdbx_overall_SU_R_Blow_DPI               0.555 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.505 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5H8N 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.260 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4381 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             138 
_refine_hist.number_atoms_total               4563 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        27.02 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 4507 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.11  ? 6100 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1553 ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 106  ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 651  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 4507 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 0    ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 3.32  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 18.22 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 589  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 5069 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.62 
_refine_ls_shell.number_reflns_all                2860 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             140 
_refine_ls_shell.number_reflns_R_work             2720 
_refine_ls_shell.percent_reflns_obs               99.36 
_refine_ls_shell.percent_reflns_R_free            4.90 
_refine_ls_shell.R_factor_all                     0.2197 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2900 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2162 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   11 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5H8N 
_struct.title                        'Structure of the human GluN1/GluN2A LBD in complex with NAM' 
_struct.pdbx_descriptor              
;Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor ionotropic, NMDA 2A, Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5H8N 
_struct_keywords.text            'GluN1, GluN2A, NMDA, receptor, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 60  ? LYS A 74  ? GLY A 60  LYS A 74  1 ? 15 
HELX_P HELX_P2  AA2 ASN A 96  ? TYR A 104 ? ASN A 96  TYR A 104 1 ? 9  
HELX_P HELX_P3  AA3 ASN A 117 ? GLU A 122 ? ASN A 117 GLU A 122 1 ? 6  
HELX_P HELX_P4  AA4 ASP A 150 ? ARG A 155 ? ASP A 150 ARG A 155 1 ? 6  
HELX_P HELX_P5  AA5 PRO A 156 ? TYR A 159 ? PRO A 156 TYR A 159 5 ? 4  
HELX_P HELX_P6  AA6 GLY A 171 ? TYR A 181 ? GLY A 171 TYR A 181 1 ? 11 
HELX_P HELX_P7  AA7 TYR A 181 ? THR A 189 ? TYR A 181 THR A 189 1 ? 9  
HELX_P HELX_P8  AA8 LYS A 190 ? ASN A 192 ? LYS A 190 ASN A 192 5 ? 3  
HELX_P HELX_P9  AA9 GLY A 195 ? THR A 205 ? GLY A 195 THR A 205 1 ? 11 
HELX_P HELX_P10 AB1 ALA A 215 ? ARG A 224 ? ALA A 215 ARG A 224 1 ? 10 
HELX_P HELX_P11 AB2 TRP A 254 ? ASP A 268 ? TRP A 254 ASP A 268 1 ? 15 
HELX_P HELX_P12 AB3 GLY A 269 ? THR A 280 ? GLY A 269 THR A 280 1 ? 12 
HELX_P HELX_P13 AB4 GLY B 66  ? ASN B 80  ? GLY B 66  ASN B 80  1 ? 15 
HELX_P HELX_P14 AB5 ASN B 108 ? SER B 116 ? ASN B 108 SER B 116 1 ? 9  
HELX_P HELX_P15 AB6 ASN B 129 ? GLN B 134 ? ASN B 129 GLN B 134 1 ? 6  
HELX_P HELX_P16 AB7 ASP B 162 ? ASN B 167 ? ASP B 162 ASN B 167 1 ? 6  
HELX_P HELX_P17 AB8 SER B 180 ? GLN B 189 ? SER B 180 GLN B 189 1 ? 10 
HELX_P HELX_P18 AB9 LEU B 192 ? GLU B 200 ? LEU B 192 GLU B 200 1 ? 9  
HELX_P HELX_P19 AC1 SER B 206 ? ASP B 216 ? SER B 206 ASP B 216 1 ? 11 
HELX_P HELX_P20 AC2 SER B 226 ? LYS B 236 ? SER B 226 LYS B 236 1 ? 11 
HELX_P HELX_P21 AC3 TRP B 261 ? ASN B 275 ? TRP B 261 ASN B 275 1 ? 15 
HELX_P HELX_P22 AC4 GLY B 276 ? VAL B 286 ? GLY B 276 VAL B 286 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 31  SG ? ? ? 1_555 A CYS 57  SG ? ? A CYS 31  A CYS 57  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf2 disulf ? ? A CYS 38  SG ? ? ? 1_555 A CYS 58  SG ? ? A CYS 38  A CYS 58  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf3 disulf ? ? A CYS 228 SG ? ? ? 1_555 A CYS 283 SG ? ? A CYS 228 A CYS 283 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf4 disulf ? ? B CYS 29  SG ? ? ? 1_555 B CYS 63  SG ? ? B CYS 29  B CYS 63  1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf5 disulf ? ? B CYS 45  SG ? ? ? 1_555 B CYS 64  SG ? ? B CYS 45  B CYS 64  1_555 ? ? ? ? ? ? ? 2.053 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 16  A . ? ALA 16  A PRO 17  A ? PRO 17  A 1 1.74  
2 SER 160 A . ? SER 160 A PRO 161 A ? PRO 161 A 1 -3.72 
3 GLU 15  B . ? GLU 15  B PRO 16  B ? PRO 16  B 1 5.75  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 8 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA5 5 6 ? parallel      
AA5 6 7 ? anti-parallel 
AA5 7 8 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 20  ? ASP A 23  ? ILE A 20  ASP A 23  
AA1 2 GLY A 51  ? LYS A 59  ? GLY A 51  LYS A 59  
AA1 3 VAL A 36  ? LYS A 43  ? VAL A 36  LYS A 43  
AA1 4 THR A 76  ? LEU A 81  ? THR A 76  LEU A 81  
AA1 5 HIS A 7   ? THR A 12  ? HIS A 7   THR A 12  
AA1 6 MET A 109 ? ALA A 110 ? MET A 109 ALA A 110 
AA1 7 ALA A 247 ? LEU A 248 ? ALA A 247 LEU A 248 
AA1 8 ASP A 125 ? PHE A 126 ? ASP A 125 PHE A 126 
AA2 1 LYS A 90  ? VAL A 91  ? LYS A 90  VAL A 91  
AA2 2 VAL A 94  ? TRP A 95  ? VAL A 94  TRP A 95  
AA3 1 PHE A 165 ? GLY A 166 ? PHE A 165 GLY A 166 
AA3 2 ALA A 210 ? ASP A 214 ? ALA A 210 ASP A 214 
AA3 3 VAL A 131 ? SER A 140 ? VAL A 131 SER A 140 
AA3 4 LEU A 230 ? THR A 232 ? LEU A 230 THR A 232 
AA4 1 PHE A 165 ? GLY A 166 ? PHE A 165 GLY A 166 
AA4 2 ALA A 210 ? ASP A 214 ? ALA A 210 ASP A 214 
AA4 3 VAL A 131 ? SER A 140 ? VAL A 131 SER A 140 
AA4 4 PHE A 239 ? TYR A 244 ? PHE A 239 TYR A 244 
AA5 1 TYR B 19  ? PRO B 22  ? TYR B 19  PRO B 22  
AA5 2 THR B 59  ? TYR B 65  ? THR B 59  TYR B 65  
AA5 3 VAL B 43  ? PRO B 48  ? VAL B 43  PRO B 48  
AA5 4 THR B 82  ? LEU B 87  ? THR B 82  LEU B 87  
AA5 5 ARG B 6   ? THR B 11  ? ARG B 6   THR B 11  
AA5 6 MET B 121 ? ILE B 122 ? MET B 121 ILE B 122 
AA5 7 GLY B 254 ? ARG B 256 ? GLY B 254 ARG B 256 
AA5 8 ILE B 136 ? PHE B 138 ? ILE B 136 PHE B 138 
AA6 1 GLN B 96  ? ARG B 98  ? GLN B 96  ARG B 98  
AA6 2 LYS B 105 ? TRP B 107 ? LYS B 105 TRP B 107 
AA7 1 TYR B 174 ? ALA B 175 ? TYR B 174 ALA B 175 
AA7 2 ALA B 221 ? ASP B 225 ? ALA B 221 ASP B 225 
AA7 3 LYS B 143 ? LYS B 152 ? LYS B 143 LYS B 152 
AA7 4 LEU B 239 ? PHE B 251 ? LEU B 239 PHE B 251 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 22  ? N GLU A 22  O CYS A 57  ? O CYS A 57  
AA1 2 3 O MET A 52  ? O MET A 52  N VAL A 42  ? N VAL A 42  
AA1 3 4 N ARG A 39  ? N ARG A 39  O LEU A 81  ? O LEU A 81  
AA1 4 5 O TYR A 80  ? O TYR A 80  N ILE A 10  ? N ILE A 10  
AA1 5 6 N VAL A 11  ? N VAL A 11  O MET A 109 ? O MET A 109 
AA1 6 7 N ALA A 110 ? N ALA A 110 O ALA A 247 ? O ALA A 247 
AA1 7 8 O LEU A 248 ? O LEU A 248 N ASP A 125 ? N ASP A 125 
AA2 1 2 N VAL A 91  ? N VAL A 91  O VAL A 94  ? O VAL A 94  
AA3 1 2 N GLY A 166 ? N GLY A 166 O ILE A 212 ? O ILE A 212 
AA3 2 3 O PHE A 211 ? O PHE A 211 N MET A 138 ? N MET A 138 
AA3 3 4 N VAL A 139 ? N VAL A 139 O VAL A 231 ? O VAL A 231 
AA4 1 2 N GLY A 166 ? N GLY A 166 O ILE A 212 ? O ILE A 212 
AA4 2 3 O PHE A 211 ? O PHE A 211 N MET A 138 ? N MET A 138 
AA4 3 4 N ILE A 135 ? N ILE A 135 O PHE A 239 ? O PHE A 239 
AA5 1 2 N TYR B 19  ? N TYR B 19  O TYR B 65  ? O TYR B 65  
AA5 2 3 O CYS B 64  ? O CYS B 64  N VAL B 43  ? N VAL B 43  
AA5 3 4 N THR B 46  ? N THR B 46  O LEU B 87  ? O LEU B 87  
AA5 4 5 O GLU B 84  ? O GLU B 84  N ILE B 9   ? N ILE B 9   
AA5 5 6 N VAL B 10  ? N VAL B 10  O MET B 121 ? O MET B 121 
AA5 6 7 N ILE B 122 ? N ILE B 122 O GLY B 254 ? O GLY B 254 
AA5 7 8 O MET B 255 ? O MET B 255 N GLU B 137 ? N GLU B 137 
AA6 1 2 N GLU B 97  ? N GLU B 97  O GLU B 106 ? O GLU B 106 
AA7 1 2 N ALA B 175 ? N ALA B 175 O ILE B 223 ? O ILE B 223 
AA7 2 3 O PHE B 222 ? O PHE B 222 N LEU B 150 ? N LEU B 150 
AA7 3 4 N VAL B 151 ? N VAL B 151 O VAL B 240 ? O VAL B 240 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GLU 301 ? 10 'binding site for residue GLU A 301' 
AC2 Software A 5YD 302 ? 13 'binding site for residue 5YD A 302' 
AC3 Software B GLY 302 ? 9  'binding site for residue GLY B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 HIS A 87  ? HIS A 87  . ? 1_555 ? 
2  AC1 10 SER A 113 ? SER A 113 . ? 1_555 ? 
3  AC1 10 THR A 115 ? THR A 115 . ? 1_555 ? 
4  AC1 10 ARG A 120 ? ARG A 120 . ? 1_555 ? 
5  AC1 10 GLY A 171 ? GLY A 171 . ? 1_555 ? 
6  AC1 10 SER A 172 ? SER A 172 . ? 1_555 ? 
7  AC1 10 THR A 173 ? THR A 173 . ? 1_555 ? 
8  AC1 10 ASP A 214 ? ASP A 214 . ? 1_555 ? 
9  AC1 10 HOH G .   ? HOH A 402 . ? 1_555 ? 
10 AC1 10 HOH G .   ? HOH A 438 . ? 1_555 ? 
11 AC2 13 PRO A 129 ? PRO A 129 . ? 1_555 ? 
12 AC2 13 PHE A 130 ? PHE A 130 . ? 1_555 ? 
13 AC2 13 VAL A 131 ? VAL A 131 . ? 1_555 ? 
14 AC2 13 GLU A 132 ? GLU A 132 . ? 1_555 ? 
15 AC2 13 LEU A 263 ? LEU A 263 . ? 1_555 ? 
16 AC2 13 VAL A 266 ? VAL A 266 . ? 1_555 ? 
17 AC2 13 MET A 271 ? MET A 271 . ? 1_555 ? 
18 AC2 13 GLU A 275 ? GLU A 275 . ? 1_555 ? 
19 AC2 13 HOH G .   ? HOH A 424 . ? 1_555 ? 
20 AC2 13 PRO B 141 ? PRO B 141 . ? 1_555 ? 
21 AC2 13 ARG B 248 ? ARG B 248 . ? 1_555 ? 
22 AC2 13 SER B 249 ? SER B 249 . ? 1_555 ? 
23 AC2 13 GLY B 250 ? GLY B 250 . ? 1_555 ? 
24 AC3 9  PHE B 93  ? PHE B 93  . ? 1_555 ? 
25 AC3 9  PRO B 125 ? PRO B 125 . ? 1_555 ? 
26 AC3 9  LEU B 126 ? LEU B 126 . ? 1_555 ? 
27 AC3 9  THR B 127 ? THR B 127 . ? 1_555 ? 
28 AC3 9  ARG B 132 ? ARG B 132 . ? 1_555 ? 
29 AC3 9  SER B 180 ? SER B 180 . ? 1_555 ? 
30 AC3 9  SER B 181 ? SER B 181 . ? 1_555 ? 
31 AC3 9  ASP B 225 ? ASP B 225 . ? 1_555 ? 
32 AC3 9  PHE B 251 ? PHE B 251 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5H8N 
_atom_sites.fract_transf_matrix[1][1]   0.018297 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011137 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008020 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
F  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 6   ? 18.348  10.880  -10.701 1.00 37.56  ? 6   ASN A N   1 
ATOM   2    C  CA  . ASN A 1 6   ? 19.448  10.732  -11.667 1.00 36.48  ? 6   ASN A CA  1 
ATOM   3    C  C   . ASN A 1 6   ? 20.623  9.899   -11.099 1.00 36.70  ? 6   ASN A C   1 
ATOM   4    O  O   . ASN A 1 6   ? 21.334  9.242   -11.869 1.00 35.06  ? 6   ASN A O   1 
ATOM   5    C  CB  . ASN A 1 6   ? 19.915  12.104  -12.175 1.00 39.30  ? 6   ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 6   ? 21.062  12.056  -13.157 1.00 67.77  ? 6   ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 6   ? 20.899  11.689  -14.329 1.00 63.03  ? 6   ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 6   ? 22.259  12.393  -12.682 1.00 57.96  ? 6   ASN A ND2 1 
ATOM   9    N  N   . HIS A 1 7   ? 20.832  9.933   -9.768  1.00 31.87  ? 7   HIS A N   1 
ATOM   10   C  CA  . HIS A 1 7   ? 21.884  9.132   -9.135  1.00 31.82  ? 7   HIS A CA  1 
ATOM   11   C  C   . HIS A 1 7   ? 21.206  7.933   -8.484  1.00 36.02  ? 7   HIS A C   1 
ATOM   12   O  O   . HIS A 1 7   ? 20.545  8.067   -7.443  1.00 36.33  ? 7   HIS A O   1 
ATOM   13   C  CB  . HIS A 1 7   ? 22.738  9.939   -8.149  1.00 32.11  ? 7   HIS A CB  1 
ATOM   14   C  CG  . HIS A 1 7   ? 23.958  9.195   -7.708  1.00 35.22  ? 7   HIS A CG  1 
ATOM   15   N  ND1 . HIS A 1 7   ? 24.963  8.868   -8.599  1.00 36.73  ? 7   HIS A ND1 1 
ATOM   16   C  CD2 . HIS A 1 7   ? 24.296  8.738   -6.484  1.00 36.57  ? 7   HIS A CD2 1 
ATOM   17   C  CE1 . HIS A 1 7   ? 25.873  8.218   -7.894  1.00 35.78  ? 7   HIS A CE1 1 
ATOM   18   N  NE2 . HIS A 1 7   ? 25.515  8.114   -6.619  1.00 36.15  ? 7   HIS A NE2 1 
ATOM   19   N  N   . LEU A 1 8   ? 21.312  6.776   -9.150  1.00 30.92  ? 8   LEU A N   1 
ATOM   20   C  CA  . LEU A 1 8   ? 20.575  5.575   -8.777  1.00 30.48  ? 8   LEU A CA  1 
ATOM   21   C  C   . LEU A 1 8   ? 21.355  4.479   -8.084  1.00 32.92  ? 8   LEU A C   1 
ATOM   22   O  O   . LEU A 1 8   ? 22.426  4.081   -8.542  1.00 33.58  ? 8   LEU A O   1 
ATOM   23   C  CB  . LEU A 1 8   ? 19.908  4.982   -10.033 1.00 30.79  ? 8   LEU A CB  1 
ATOM   24   C  CG  . LEU A 1 8   ? 19.099  5.903   -10.968 1.00 34.22  ? 8   LEU A CG  1 
ATOM   25   C  CD1 . LEU A 1 8   ? 18.789  5.187   -12.242 1.00 33.98  ? 8   LEU A CD1 1 
ATOM   26   C  CD2 . LEU A 1 8   ? 17.801  6.356   -10.325 1.00 35.39  ? 8   LEU A CD2 1 
ATOM   27   N  N   . SER A 1 9   ? 20.764  3.923   -7.031  1.00 27.43  ? 9   SER A N   1 
ATOM   28   C  CA  . SER A 1 9   ? 21.336  2.777   -6.319  1.00 26.69  ? 9   SER A CA  1 
ATOM   29   C  C   . SER A 1 9   ? 21.071  1.499   -7.177  1.00 26.32  ? 9   SER A C   1 
ATOM   30   O  O   . SER A 1 9   ? 19.924  1.236   -7.549  1.00 25.51  ? 9   SER A O   1 
ATOM   31   C  CB  . SER A 1 9   ? 20.709  2.665   -4.927  1.00 30.11  ? 9   SER A CB  1 
ATOM   32   O  OG  . SER A 1 9   ? 20.704  1.337   -4.428  1.00 40.85  ? 9   SER A OG  1 
ATOM   33   N  N   . ILE A 1 10  ? 22.130  0.747   -7.520  1.00 19.15  ? 10  ILE A N   1 
ATOM   34   C  CA  . ILE A 1 10  ? 22.009  -0.465  -8.341  1.00 17.59  ? 10  ILE A CA  1 
ATOM   35   C  C   . ILE A 1 10  ? 22.629  -1.703  -7.660  1.00 20.43  ? 10  ILE A C   1 
ATOM   36   O  O   . ILE A 1 10  ? 23.785  -1.668  -7.229  1.00 19.70  ? 10  ILE A O   1 
ATOM   37   C  CB  . ILE A 1 10  ? 22.583  -0.229  -9.785  1.00 20.17  ? 10  ILE A CB  1 
ATOM   38   C  CG1 . ILE A 1 10  ? 21.841  0.962   -10.473 1.00 20.46  ? 10  ILE A CG1 1 
ATOM   39   C  CG2 . ILE A 1 10  ? 22.507  -1.533  -10.628 1.00 19.92  ? 10  ILE A CG2 1 
ATOM   40   C  CD1 . ILE A 1 10  ? 22.172  1.298   -11.806 1.00 24.44  ? 10  ILE A CD1 1 
ATOM   41   N  N   . VAL A 1 11  ? 21.885  -2.804  -7.619  1.00 17.24  ? 11  VAL A N   1 
ATOM   42   C  CA  . VAL A 1 11  ? 22.377  -4.045  -7.019  1.00 17.43  ? 11  VAL A CA  1 
ATOM   43   C  C   . VAL A 1 11  ? 22.825  -5.012  -8.104  1.00 19.07  ? 11  VAL A C   1 
ATOM   44   O  O   . VAL A 1 11  ? 22.288  -5.004  -9.215  1.00 16.63  ? 11  VAL A O   1 
ATOM   45   C  CB  . VAL A 1 11  ? 21.389  -4.677  -5.971  1.00 22.49  ? 11  VAL A CB  1 
ATOM   46   C  CG1 . VAL A 1 11  ? 20.126  -5.245  -6.612  1.00 22.57  ? 11  VAL A CG1 1 
ATOM   47   C  CG2 . VAL A 1 11  ? 22.073  -5.727  -5.102  1.00 22.15  ? 11  VAL A CG2 1 
ATOM   48   N  N   . THR A 1 12  ? 23.846  -5.819  -7.776  1.00 16.73  ? 12  THR A N   1 
ATOM   49   C  CA  . THR A 1 12  ? 24.407  -6.840  -8.646  1.00 16.41  ? 12  THR A CA  1 
ATOM   50   C  C   . THR A 1 12  ? 24.890  -8.056  -7.795  1.00 23.19  ? 12  THR A C   1 
ATOM   51   O  O   . THR A 1 12  ? 24.770  -8.044  -6.567  1.00 23.67  ? 12  THR A O   1 
ATOM   52   C  CB  . THR A 1 12  ? 25.448  -6.238  -9.632  1.00 24.41  ? 12  THR A CB  1 
ATOM   53   O  OG1 . THR A 1 12  ? 25.712  -7.215  -10.647 1.00 28.48  ? 12  THR A OG1 1 
ATOM   54   C  CG2 . THR A 1 12  ? 26.749  -5.805  -8.967  1.00 20.14  ? 12  THR A CG2 1 
ATOM   55   N  N   . LEU A 1 13  ? 25.369  -9.122  -8.471  1.00 21.74  ? 13  LEU A N   1 
ATOM   56   C  CA  . LEU A 1 13  ? 25.835  -10.385 -7.886  1.00 20.86  ? 13  LEU A CA  1 
ATOM   57   C  C   . LEU A 1 13  ? 26.902  -10.996 -8.798  1.00 23.68  ? 13  LEU A C   1 
ATOM   58   O  O   . LEU A 1 13  ? 26.763  -10.927 -10.011 1.00 22.66  ? 13  LEU A O   1 
ATOM   59   C  CB  . LEU A 1 13  ? 24.628  -11.342 -7.781  1.00 20.70  ? 13  LEU A CB  1 
ATOM   60   C  CG  . LEU A 1 13  ? 24.870  -12.820 -7.417  1.00 25.45  ? 13  LEU A CG  1 
ATOM   61   C  CD1 . LEU A 1 13  ? 25.359  -12.977 -5.961  1.00 25.72  ? 13  LEU A CD1 1 
ATOM   62   C  CD2 . LEU A 1 13  ? 23.590  -13.610 -7.555  1.00 27.78  ? 13  LEU A CD2 1 
ATOM   63   N  N   . GLU A 1 14  ? 27.944  -11.605 -8.225  1.00 21.06  ? 14  GLU A N   1 
ATOM   64   C  CA  . GLU A 1 14  ? 28.974  -12.275 -9.005  1.00 21.79  ? 14  GLU A CA  1 
ATOM   65   C  C   . GLU A 1 14  ? 28.468  -13.594 -9.593  1.00 27.24  ? 14  GLU A C   1 
ATOM   66   O  O   . GLU A 1 14  ? 27.994  -14.478 -8.863  1.00 29.48  ? 14  GLU A O   1 
ATOM   67   C  CB  . GLU A 1 14  ? 30.248  -12.522 -8.169  1.00 23.43  ? 14  GLU A CB  1 
ATOM   68   C  CG  . GLU A 1 14  ? 31.469  -12.871 -9.017  1.00 35.53  ? 14  GLU A CG  1 
ATOM   69   C  CD  . GLU A 1 14  ? 32.811  -12.987 -8.312  1.00 58.38  ? 14  GLU A CD  1 
ATOM   70   O  OE1 . GLU A 1 14  ? 32.824  -13.357 -7.116  1.00 49.18  ? 14  GLU A OE1 1 
ATOM   71   O  OE2 . GLU A 1 14  ? 33.855  -12.753 -8.969  1.00 50.32  ? 14  GLU A OE2 1 
ATOM   72   N  N   . GLU A 1 15  ? 28.570  -13.702 -10.920 1.00 22.38  ? 15  GLU A N   1 
ATOM   73   C  CA  . GLU A 1 15  ? 28.273  -14.856 -11.767 1.00 21.66  ? 15  GLU A CA  1 
ATOM   74   C  C   . GLU A 1 15  ? 28.980  -14.618 -13.114 1.00 24.67  ? 15  GLU A C   1 
ATOM   75   O  O   . GLU A 1 15  ? 28.469  -13.897 -13.970 1.00 23.52  ? 15  GLU A O   1 
ATOM   76   C  CB  . GLU A 1 15  ? 26.766  -15.108 -11.929 1.00 22.84  ? 15  GLU A CB  1 
ATOM   77   C  CG  . GLU A 1 15  ? 26.430  -16.271 -12.851 1.00 33.00  ? 15  GLU A CG  1 
ATOM   78   C  CD  . GLU A 1 15  ? 26.083  -17.598 -12.203 1.00 51.59  ? 15  GLU A CD  1 
ATOM   79   O  OE1 . GLU A 1 15  ? 24.884  -17.966 -12.212 1.00 26.39  ? 15  GLU A OE1 1 
ATOM   80   O  OE2 . GLU A 1 15  ? 27.018  -18.314 -11.776 1.00 51.00  ? 15  GLU A OE2 1 
ATOM   81   N  N   . ALA A 1 16  ? 30.194  -15.179 -13.255 1.00 21.54  ? 16  ALA A N   1 
ATOM   82   C  CA  . ALA A 1 16  ? 31.011  -15.047 -14.460 1.00 21.47  ? 16  ALA A CA  1 
ATOM   83   C  C   . ALA A 1 16  ? 30.342  -15.740 -15.654 1.00 26.63  ? 16  ALA A C   1 
ATOM   84   O  O   . ALA A 1 16  ? 29.698  -16.783 -15.470 1.00 25.72  ? 16  ALA A O   1 
ATOM   85   C  CB  . ALA A 1 16  ? 32.401  -15.612 -14.221 1.00 21.72  ? 16  ALA A CB  1 
ATOM   86   N  N   . PRO A 1 17  ? 30.431  -15.174 -16.879 1.00 24.08  ? 17  PRO A N   1 
ATOM   87   C  CA  . PRO A 1 17  ? 31.136  -13.938 -17.297 1.00 24.10  ? 17  PRO A CA  1 
ATOM   88   C  C   . PRO A 1 17  ? 30.277  -12.649 -17.268 1.00 24.88  ? 17  PRO A C   1 
ATOM   89   O  O   . PRO A 1 17  ? 30.702  -11.598 -17.758 1.00 24.70  ? 17  PRO A O   1 
ATOM   90   C  CB  . PRO A 1 17  ? 31.544  -14.288 -18.728 1.00 26.50  ? 17  PRO A CB  1 
ATOM   91   C  CG  . PRO A 1 17  ? 30.345  -15.096 -19.237 1.00 30.29  ? 17  PRO A CG  1 
ATOM   92   C  CD  . PRO A 1 17  ? 29.784  -15.830 -18.036 1.00 25.53  ? 17  PRO A CD  1 
ATOM   93   N  N   . PHE A 1 18  ? 29.081  -12.736 -16.681 1.00 18.45  ? 18  PHE A N   1 
ATOM   94   C  CA  . PHE A 1 18  ? 28.106  -11.656 -16.617 1.00 17.37  ? 18  PHE A CA  1 
ATOM   95   C  C   . PHE A 1 18  ? 28.534  -10.569 -15.674 1.00 21.77  ? 18  PHE A C   1 
ATOM   96   O  O   . PHE A 1 18  ? 28.484  -9.390  -16.037 1.00 21.43  ? 18  PHE A O   1 
ATOM   97   C  CB  . PHE A 1 18  ? 26.702  -12.223 -16.299 1.00 18.28  ? 18  PHE A CB  1 
ATOM   98   C  CG  . PHE A 1 18  ? 26.315  -13.211 -17.377 1.00 18.65  ? 18  PHE A CG  1 
ATOM   99   C  CD1 . PHE A 1 18  ? 26.019  -12.776 -18.665 1.00 20.79  ? 18  PHE A CD1 1 
ATOM   100  C  CD2 . PHE A 1 18  ? 26.374  -14.582 -17.142 1.00 19.10  ? 18  PHE A CD2 1 
ATOM   101  C  CE1 . PHE A 1 18  ? 25.723  -13.692 -19.676 1.00 21.00  ? 18  PHE A CE1 1 
ATOM   102  C  CE2 . PHE A 1 18  ? 26.116  -15.498 -18.165 1.00 20.67  ? 18  PHE A CE2 1 
ATOM   103  C  CZ  . PHE A 1 18  ? 25.772  -15.047 -19.415 1.00 19.03  ? 18  PHE A CZ  1 
ATOM   104  N  N   . VAL A 1 19  ? 29.007  -10.972 -14.479 1.00 18.38  ? 19  VAL A N   1 
ATOM   105  C  CA  . VAL A 1 19  ? 29.521  -10.101 -13.426 1.00 17.25  ? 19  VAL A CA  1 
ATOM   106  C  C   . VAL A 1 19  ? 30.716  -10.817 -12.803 1.00 24.21  ? 19  VAL A C   1 
ATOM   107  O  O   . VAL A 1 19  ? 30.581  -11.949 -12.325 1.00 22.26  ? 19  VAL A O   1 
ATOM   108  C  CB  . VAL A 1 19  ? 28.468  -9.741  -12.345 1.00 17.73  ? 19  VAL A CB  1 
ATOM   109  C  CG1 . VAL A 1 19  ? 29.059  -8.772  -11.329 1.00 16.34  ? 19  VAL A CG1 1 
ATOM   110  C  CG2 . VAL A 1 19  ? 27.182  -9.185  -12.956 1.00 16.61  ? 19  VAL A CG2 1 
ATOM   111  N  N   . ILE A 1 20  ? 31.895  -10.162 -12.857 1.00 23.56  ? 20  ILE A N   1 
ATOM   112  C  CA  . ILE A 1 20  ? 33.176  -10.653 -12.324 1.00 23.08  ? 20  ILE A CA  1 
ATOM   113  C  C   . ILE A 1 20  ? 33.649  -9.618  -11.291 1.00 26.58  ? 20  ILE A C   1 
ATOM   114  O  O   . ILE A 1 20  ? 33.636  -8.419  -11.563 1.00 24.15  ? 20  ILE A O   1 
ATOM   115  C  CB  . ILE A 1 20  ? 34.203  -10.896 -13.479 1.00 26.45  ? 20  ILE A CB  1 
ATOM   116  C  CG1 . ILE A 1 20  ? 33.608  -11.842 -14.575 1.00 26.77  ? 20  ILE A CG1 1 
ATOM   117  C  CG2 . ILE A 1 20  ? 35.566  -11.430 -12.944 1.00 25.71  ? 20  ILE A CG2 1 
ATOM   118  C  CD1 . ILE A 1 20  ? 34.140  -11.665 -16.003 1.00 26.09  ? 20  ILE A CD1 1 
ATOM   119  N  N   . VAL A 1 21  ? 33.980  -10.083 -10.081 1.00 25.38  ? 21  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 21  ? 34.402  -9.224  -8.967  1.00 25.37  ? 21  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 21  ? 35.923  -9.326  -8.788  1.00 33.00  ? 21  VAL A C   1 
ATOM   122  O  O   . VAL A 1 21  ? 36.499  -10.416 -8.843  1.00 31.72  ? 21  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 21  ? 33.603  -9.521  -7.659  1.00 26.93  ? 21  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 21  ? 34.019  -8.599  -6.512  1.00 25.91  ? 21  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 21  ? 32.099  -9.406  -7.903  1.00 26.28  ? 21  VAL A CG2 1 
ATOM   126  N  N   . GLU A 1 22  ? 36.564  -8.180  -8.610  1.00 32.40  ? 22  GLU A N   1 
ATOM   127  C  CA  . GLU A 1 22  ? 38.006  -8.126  -8.417  1.00 33.22  ? 22  GLU A CA  1 
ATOM   128  C  C   . GLU A 1 22  ? 38.386  -7.199  -7.294  1.00 39.96  ? 22  GLU A C   1 
ATOM   129  O  O   . GLU A 1 22  ? 37.562  -6.406  -6.827  1.00 38.83  ? 22  GLU A O   1 
ATOM   130  C  CB  . GLU A 1 22  ? 38.708  -7.719  -9.710  1.00 34.24  ? 22  GLU A CB  1 
ATOM   131  C  CG  . GLU A 1 22  ? 39.071  -8.923  -10.556 1.00 44.22  ? 22  GLU A CG  1 
ATOM   132  C  CD  . GLU A 1 22  ? 39.501  -8.639  -11.980 1.00 66.43  ? 22  GLU A CD  1 
ATOM   133  O  OE1 . GLU A 1 22  ? 39.761  -7.458  -12.312 1.00 56.74  ? 22  GLU A OE1 1 
ATOM   134  O  OE2 . GLU A 1 22  ? 39.579  -9.611  -12.766 1.00 63.44  ? 22  GLU A OE2 1 
ATOM   135  N  N   . ASP A 1 23  ? 39.637  -7.324  -6.843  1.00 40.19  ? 23  ASP A N   1 
ATOM   136  C  CA  . ASP A 1 23  ? 40.207  -6.487  -5.797  1.00 41.44  ? 23  ASP A CA  1 
ATOM   137  C  C   . ASP A 1 23  ? 40.646  -5.203  -6.456  1.00 50.27  ? 23  ASP A C   1 
ATOM   138  O  O   . ASP A 1 23  ? 41.042  -5.209  -7.631  1.00 49.62  ? 23  ASP A O   1 
ATOM   139  C  CB  . ASP A 1 23  ? 41.424  -7.174  -5.149  1.00 43.05  ? 23  ASP A CB  1 
ATOM   140  C  CG  . ASP A 1 23  ? 41.155  -8.522  -4.491  1.00 55.67  ? 23  ASP A CG  1 
ATOM   141  O  OD1 . ASP A 1 23  ? 39.975  -8.798  -4.138  1.00 55.47  ? 23  ASP A OD1 1 
ATOM   142  O  OD2 . ASP A 1 23  ? 42.127  -9.285  -4.285  1.00 62.59  ? 23  ASP A OD2 1 
ATOM   143  N  N   . ILE A 1 24  ? 40.566  -4.100  -5.708  1.00 51.33  ? 24  ILE A N   1 
ATOM   144  C  CA  . ILE A 1 24  ? 40.992  -2.786  -6.170  1.00 53.25  ? 24  ILE A CA  1 
ATOM   145  C  C   . ILE A 1 24  ? 42.529  -2.811  -6.342  1.00 63.78  ? 24  ILE A C   1 
ATOM   146  O  O   . ILE A 1 24  ? 43.217  -3.461  -5.546  1.00 62.65  ? 24  ILE A O   1 
ATOM   147  C  CB  . ILE A 1 24  ? 40.430  -1.686  -5.224  1.00 56.19  ? 24  ILE A CB  1 
ATOM   148  C  CG1 . ILE A 1 24  ? 38.919  -1.634  -5.317  1.00 56.71  ? 24  ILE A CG1 1 
ATOM   149  C  CG2 . ILE A 1 24  ? 41.087  -0.296  -5.397  1.00 57.07  ? 24  ILE A CG2 1 
ATOM   150  C  CD1 . ILE A 1 24  ? 38.207  -0.804  -4.284  1.00 65.94  ? 24  ILE A CD1 1 
ATOM   151  N  N   . ASP A 1 25  ? 43.041  -2.220  -7.440  1.00 66.25  ? 25  ASP A N   1 
ATOM   152  C  CA  . ASP A 1 25  ? 44.479  -2.202  -7.745  1.00 68.79  ? 25  ASP A CA  1 
ATOM   153  C  C   . ASP A 1 25  ? 45.235  -1.194  -6.858  1.00 78.34  ? 25  ASP A C   1 
ATOM   154  O  O   . ASP A 1 25  ? 44.622  -0.211  -6.442  1.00 78.53  ? 25  ASP A O   1 
ATOM   155  C  CB  . ASP A 1 25  ? 44.691  -1.858  -9.210  1.00 69.72  ? 25  ASP A CB  1 
ATOM   156  N  N   . PRO A 1 26  ? 46.552  -1.380  -6.563  1.00 77.74  ? 26  PRO A N   1 
ATOM   157  C  CA  . PRO A 1 26  ? 47.258  -0.381  -5.734  1.00 83.14  ? 26  PRO A CA  1 
ATOM   158  C  C   . PRO A 1 26  ? 47.838  0.783   -6.544  1.00 113.75 ? 26  PRO A C   1 
ATOM   159  O  O   . PRO A 1 26  ? 47.291  1.182   -7.574  1.00 78.42  ? 26  PRO A O   1 
ATOM   160  C  CB  . PRO A 1 26  ? 48.356  -1.198  -5.037  1.00 84.20  ? 26  PRO A CB  1 
ATOM   161  C  CG  . PRO A 1 26  ? 48.444  -2.518  -5.801  1.00 87.03  ? 26  PRO A CG  1 
ATOM   162  C  CD  . PRO A 1 26  ? 47.454  -2.488  -6.938  1.00 81.31  ? 26  PRO A CD  1 
ATOM   163  N  N   . GLU A 1 29  ? 45.138  4.223   -6.245  1.00 57.06  ? 29  GLU A N   1 
ATOM   164  C  CA  . GLU A 1 29  ? 44.905  2.838   -5.834  1.00 57.05  ? 29  GLU A CA  1 
ATOM   165  C  C   . GLU A 1 29  ? 43.403  2.469   -5.966  1.00 60.25  ? 29  GLU A C   1 
ATOM   166  O  O   . GLU A 1 29  ? 42.761  2.088   -4.978  1.00 59.67  ? 29  GLU A O   1 
ATOM   167  C  CB  . GLU A 1 29  ? 45.401  2.627   -4.402  1.00 57.89  ? 29  GLU A CB  1 
ATOM   168  N  N   . THR A 1 30  ? 42.857  2.564   -7.210  1.00 55.14  ? 30  THR A N   1 
ATOM   169  C  CA  . THR A 1 30  ? 41.433  2.340   -7.485  1.00 53.75  ? 30  THR A CA  1 
ATOM   170  C  C   . THR A 1 30  ? 41.125  1.330   -8.637  1.00 54.69  ? 30  THR A C   1 
ATOM   171  O  O   . THR A 1 30  ? 41.922  0.419   -8.899  1.00 54.06  ? 30  THR A O   1 
ATOM   172  C  CB  . THR A 1 30  ? 40.738  3.688   -7.716  1.00 61.94  ? 30  THR A CB  1 
ATOM   173  O  OG1 . THR A 1 30  ? 41.505  4.467   -8.645  1.00 59.14  ? 30  THR A OG1 1 
ATOM   174  C  CG2 . THR A 1 30  ? 40.501  4.455   -6.411  1.00 60.53  ? 30  THR A CG2 1 
ATOM   175  N  N   . CYS A 1 31  ? 39.901  1.438   -9.229  1.00 48.40  ? 31  CYS A N   1 
ATOM   176  C  CA  . CYS A 1 31  ? 39.398  0.566   -10.300 1.00 46.25  ? 31  CYS A CA  1 
ATOM   177  C  C   . CYS A 1 31  ? 39.886  1.030   -11.673 1.00 53.15  ? 31  CYS A C   1 
ATOM   178  O  O   . CYS A 1 31  ? 39.606  2.156   -12.098 1.00 52.66  ? 31  CYS A O   1 
ATOM   179  C  CB  . CYS A 1 31  ? 37.876  0.432   -10.246 1.00 43.94  ? 31  CYS A CB  1 
ATOM   180  S  SG  . CYS A 1 31  ? 37.254  -0.482  -8.801  1.00 45.94  ? 31  CYS A SG  1 
ATOM   181  N  N   . VAL A 1 32  ? 40.610  0.145   -12.363 1.00 51.98  ? 32  VAL A N   1 
ATOM   182  C  CA  . VAL A 1 32  ? 41.240  0.449   -13.652 1.00 52.74  ? 32  VAL A CA  1 
ATOM   183  C  C   . VAL A 1 32  ? 40.582  -0.201  -14.865 1.00 56.71  ? 32  VAL A C   1 
ATOM   184  O  O   . VAL A 1 32  ? 39.944  -1.240  -14.743 1.00 57.33  ? 32  VAL A O   1 
ATOM   185  C  CB  . VAL A 1 32  ? 42.758  0.110   -13.611 1.00 57.04  ? 32  VAL A CB  1 
ATOM   186  C  CG1 . VAL A 1 32  ? 43.508  1.054   -12.669 1.00 56.88  ? 32  VAL A CG1 1 
ATOM   187  C  CG2 . VAL A 1 32  ? 43.003  -1.361  -13.239 1.00 56.86  ? 32  VAL A CG2 1 
ATOM   188  N  N   . ARG A 1 33  ? 40.802  0.409   -16.044 1.00 52.87  ? 33  ARG A N   1 
ATOM   189  C  CA  . ARG A 1 33  ? 40.412  -0.044  -17.385 1.00 51.99  ? 33  ARG A CA  1 
ATOM   190  C  C   . ARG A 1 33  ? 38.912  -0.292  -17.577 1.00 51.55  ? 33  ARG A C   1 
ATOM   191  O  O   . ARG A 1 33  ? 38.119  0.621   -17.344 1.00 51.09  ? 33  ARG A O   1 
ATOM   192  C  CB  . ARG A 1 33  ? 41.228  -1.281  -17.777 1.00 53.04  ? 33  ARG A CB  1 
ATOM   193  N  N   . ASN A 1 34  ? 38.529  -1.515  -18.031 1.00 45.45  ? 34  ASN A N   1 
ATOM   194  C  CA  . ASN A 1 34  ? 37.146  -1.933  -18.317 1.00 43.83  ? 34  ASN A CA  1 
ATOM   195  C  C   . ASN A 1 34  ? 36.277  -2.189  -17.056 1.00 44.13  ? 34  ASN A C   1 
ATOM   196  O  O   . ASN A 1 34  ? 35.111  -2.595  -17.184 1.00 43.18  ? 34  ASN A O   1 
ATOM   197  C  CB  . ASN A 1 34  ? 37.128  -3.163  -19.262 1.00 42.81  ? 34  ASN A CB  1 
ATOM   198  C  CG  . ASN A 1 34  ? 37.650  -4.491  -18.724 1.00 54.80  ? 34  ASN A CG  1 
ATOM   199  O  OD1 . ASN A 1 34  ? 38.569  -4.573  -17.892 1.00 51.57  ? 34  ASN A OD1 1 
ATOM   200  N  ND2 . ASN A 1 34  ? 37.163  -5.576  -19.305 1.00 39.09  ? 34  ASN A ND2 1 
ATOM   201  N  N   . THR A 1 35  ? 36.835  -1.923  -15.850 1.00 36.94  ? 35  THR A N   1 
ATOM   202  C  CA  . THR A 1 35  ? 36.146  -2.152  -14.583 1.00 34.73  ? 35  THR A CA  1 
ATOM   203  C  C   . THR A 1 35  ? 35.471  -0.899  -14.031 1.00 34.76  ? 35  THR A C   1 
ATOM   204  O  O   . THR A 1 35  ? 35.903  0.219   -14.316 1.00 34.18  ? 35  THR A O   1 
ATOM   205  C  CB  . THR A 1 35  ? 37.092  -2.777  -13.541 1.00 39.56  ? 35  THR A CB  1 
ATOM   206  O  OG1 . THR A 1 35  ? 37.888  -1.743  -12.949 1.00 47.09  ? 35  THR A OG1 1 
ATOM   207  C  CG2 . THR A 1 35  ? 37.974  -3.895  -14.114 1.00 26.08  ? 35  THR A CG2 1 
ATOM   208  N  N   . VAL A 1 36  ? 34.407  -1.099  -13.231 1.00 28.08  ? 36  VAL A N   1 
ATOM   209  C  CA  . VAL A 1 36  ? 33.688  -0.033  -12.556 1.00 25.74  ? 36  VAL A CA  1 
ATOM   210  C  C   . VAL A 1 36  ? 33.729  -0.282  -11.039 1.00 27.18  ? 36  VAL A C   1 
ATOM   211  O  O   . VAL A 1 36  ? 33.753  -1.439  -10.609 1.00 24.12  ? 36  VAL A O   1 
ATOM   212  C  CB  . VAL A 1 36  ? 32.228  0.204   -13.053 1.00 29.03  ? 36  VAL A CB  1 
ATOM   213  C  CG1 . VAL A 1 36  ? 32.156  0.476   -14.550 1.00 28.70  ? 36  VAL A CG1 1 
ATOM   214  C  CG2 . VAL A 1 36  ? 31.277  -0.910  -12.632 1.00 28.52  ? 36  VAL A CG2 1 
ATOM   215  N  N   . PRO A 1 37  ? 33.627  0.774   -10.203 1.00 25.03  ? 37  PRO A N   1 
ATOM   216  C  CA  . PRO A 1 37  ? 33.572  0.532   -8.747  1.00 24.67  ? 37  PRO A CA  1 
ATOM   217  C  C   . PRO A 1 37  ? 32.282  -0.139  -8.270  1.00 28.51  ? 37  PRO A C   1 
ATOM   218  O  O   . PRO A 1 37  ? 31.180  0.268   -8.647  1.00 26.53  ? 37  PRO A O   1 
ATOM   219  C  CB  . PRO A 1 37  ? 33.698  1.940   -8.138  1.00 26.08  ? 37  PRO A CB  1 
ATOM   220  C  CG  . PRO A 1 37  ? 33.262  2.872   -9.199  1.00 30.69  ? 37  PRO A CG  1 
ATOM   221  C  CD  . PRO A 1 37  ? 33.588  2.221   -10.521 1.00 26.09  ? 37  PRO A CD  1 
ATOM   222  N  N   . CYS A 1 38  ? 32.425  -1.168  -7.430  1.00 26.78  ? 38  CYS A N   1 
ATOM   223  C  CA  . CYS A 1 38  ? 31.297  -1.807  -6.757  1.00 27.77  ? 38  CYS A CA  1 
ATOM   224  C  C   . CYS A 1 38  ? 31.624  -1.962  -5.287  1.00 31.07  ? 38  CYS A C   1 
ATOM   225  O  O   . CYS A 1 38  ? 32.797  -1.973  -4.902  1.00 31.14  ? 38  CYS A O   1 
ATOM   226  C  CB  . CYS A 1 38  ? 30.825  -3.112  -7.405  1.00 29.49  ? 38  CYS A CB  1 
ATOM   227  S  SG  . CYS A 1 38  ? 32.150  -4.229  -7.929  1.00 34.42  ? 38  CYS A SG  1 
ATOM   228  N  N   . ARG A 1 39  ? 30.611  -1.951  -4.443  1.00 26.07  ? 39  ARG A N   1 
ATOM   229  C  CA  . ARG A 1 39  ? 30.909  -2.070  -3.031  1.00 25.07  ? 39  ARG A CA  1 
ATOM   230  C  C   . ARG A 1 39  ? 30.260  -3.301  -2.446  1.00 26.40  ? 39  ARG A C   1 
ATOM   231  O  O   . ARG A 1 39  ? 29.159  -3.691  -2.853  1.00 26.37  ? 39  ARG A O   1 
ATOM   232  C  CB  . ARG A 1 39  ? 30.595  -0.776  -2.251  1.00 24.98  ? 39  ARG A CB  1 
ATOM   233  C  CG  . ARG A 1 39  ? 29.236  -0.171  -2.519  1.00 34.14  ? 39  ARG A CG  1 
ATOM   234  C  CD  . ARG A 1 39  ? 28.828  0.806   -1.430  1.00 35.56  ? 39  ARG A CD  1 
ATOM   235  N  NE  . ARG A 1 39  ? 27.526  1.386   -1.743  1.00 39.24  ? 39  ARG A NE  1 
ATOM   236  C  CZ  . ARG A 1 39  ? 26.372  0.947   -1.262  1.00 54.60  ? 39  ARG A CZ  1 
ATOM   237  N  NH1 . ARG A 1 39  ? 26.344  -0.055  -0.392  1.00 40.93  ? 39  ARG A NH1 1 
ATOM   238  N  NH2 . ARG A 1 39  ? 25.235  1.524   -1.624  1.00 48.39  ? 39  ARG A NH2 1 
ATOM   239  N  N   . LYS A 1 40  ? 30.979  -3.961  -1.552  1.00 20.28  ? 40  LYS A N   1 
ATOM   240  C  CA  . LYS A 1 40  ? 30.478  -5.158  -0.898  1.00 19.24  ? 40  LYS A CA  1 
ATOM   241  C  C   . LYS A 1 40  ? 30.522  -4.915  0.603   1.00 24.03  ? 40  LYS A C   1 
ATOM   242  O  O   . LYS A 1 40  ? 31.590  -4.606  1.129   1.00 23.41  ? 40  LYS A O   1 
ATOM   243  C  CB  . LYS A 1 40  ? 31.348  -6.360  -1.297  1.00 21.39  ? 40  LYS A CB  1 
ATOM   244  C  CG  . LYS A 1 40  ? 30.823  -7.737  -0.880  1.00 34.28  ? 40  LYS A CG  1 
ATOM   245  C  CD  . LYS A 1 40  ? 31.882  -8.787  -1.155  1.00 45.61  ? 40  LYS A CD  1 
ATOM   246  C  CE  . LYS A 1 40  ? 31.483  -10.189 -0.755  1.00 63.53  ? 40  LYS A CE  1 
ATOM   247  N  NZ  . LYS A 1 40  ? 32.593  -11.164 -0.984  1.00 69.63  ? 40  LYS A NZ  1 
ATOM   248  N  N   . PHE A 1 41  ? 29.359  -4.996  1.283   1.00 21.00  ? 41  PHE A N   1 
ATOM   249  C  CA  . PHE A 1 41  ? 29.263  -4.876  2.736   1.00 20.82  ? 41  PHE A CA  1 
ATOM   250  C  C   . PHE A 1 41  ? 29.786  -6.201  3.325   1.00 25.44  ? 41  PHE A C   1 
ATOM   251  O  O   . PHE A 1 41  ? 29.230  -7.262  3.037   1.00 26.75  ? 41  PHE A O   1 
ATOM   252  C  CB  . PHE A 1 41  ? 27.806  -4.654  3.173   1.00 22.54  ? 41  PHE A CB  1 
ATOM   253  C  CG  . PHE A 1 41  ? 27.572  -4.653  4.673   1.00 23.93  ? 41  PHE A CG  1 
ATOM   254  C  CD1 . PHE A 1 41  ? 27.708  -3.482  5.415   1.00 27.04  ? 41  PHE A CD1 1 
ATOM   255  C  CD2 . PHE A 1 41  ? 27.153  -5.805  5.328   1.00 25.64  ? 41  PHE A CD2 1 
ATOM   256  C  CE1 . PHE A 1 41  ? 27.437  -3.469  6.788   1.00 28.16  ? 41  PHE A CE1 1 
ATOM   257  C  CE2 . PHE A 1 41  ? 26.904  -5.801  6.708   1.00 28.42  ? 41  PHE A CE2 1 
ATOM   258  C  CZ  . PHE A 1 41  ? 27.033  -4.630  7.426   1.00 27.12  ? 41  PHE A CZ  1 
ATOM   259  N  N   . VAL A 1 42  ? 30.853  -6.129  4.131   1.00 20.07  ? 42  VAL A N   1 
ATOM   260  C  CA  . VAL A 1 42  ? 31.533  -7.263  4.749   1.00 19.01  ? 42  VAL A CA  1 
ATOM   261  C  C   . VAL A 1 42  ? 31.461  -7.100  6.269   1.00 25.21  ? 42  VAL A C   1 
ATOM   262  O  O   . VAL A 1 42  ? 31.849  -6.057  6.805   1.00 23.60  ? 42  VAL A O   1 
ATOM   263  C  CB  . VAL A 1 42  ? 32.991  -7.399  4.194   1.00 20.49  ? 42  VAL A CB  1 
ATOM   264  C  CG1 . VAL A 1 42  ? 33.728  -8.558  4.831   1.00 19.03  ? 42  VAL A CG1 1 
ATOM   265  C  CG2 . VAL A 1 42  ? 32.976  -7.560  2.674   1.00 20.23  ? 42  VAL A CG2 1 
ATOM   266  N  N   . LYS A 1 43  ? 30.908  -8.118  6.952   1.00 24.12  ? 43  LYS A N   1 
ATOM   267  C  CA  . LYS A 1 43  ? 30.718  -8.097  8.408   1.00 23.50  ? 43  LYS A CA  1 
ATOM   268  C  C   . LYS A 1 43  ? 32.001  -8.196  9.183   1.00 25.09  ? 43  LYS A C   1 
ATOM   269  O  O   . LYS A 1 43  ? 32.964  -8.815  8.726   1.00 24.78  ? 43  LYS A O   1 
ATOM   270  C  CB  . LYS A 1 43  ? 29.719  -9.153  8.859   1.00 25.99  ? 43  LYS A CB  1 
ATOM   271  C  CG  . LYS A 1 43  ? 28.287  -8.768  8.503   1.00 47.05  ? 43  LYS A CG  1 
ATOM   272  C  CD  . LYS A 1 43  ? 27.283  -9.768  9.015   1.00 58.36  ? 43  LYS A CD  1 
ATOM   273  C  CE  . LYS A 1 43  ? 26.627  -9.286  10.279  1.00 68.56  ? 43  LYS A CE  1 
ATOM   274  N  NZ  . LYS A 1 43  ? 26.616  -10.359 11.307  1.00 80.54  ? 43  LYS A NZ  1 
ATOM   275  N  N   . ILE A 1 44  ? 32.023  -7.518  10.330  1.00 21.33  ? 44  ILE A N   1 
ATOM   276  C  CA  . ILE A 1 44  ? 33.159  -7.464  11.241  1.00 22.20  ? 44  ILE A CA  1 
ATOM   277  C  C   . ILE A 1 44  ? 33.290  -8.831  11.931  1.00 26.10  ? 44  ILE A C   1 
ATOM   278  O  O   . ILE A 1 44  ? 34.361  -9.428  11.906  1.00 24.34  ? 44  ILE A O   1 
ATOM   279  C  CB  . ILE A 1 44  ? 33.015  -6.257  12.228  1.00 25.52  ? 44  ILE A CB  1 
ATOM   280  C  CG1 . ILE A 1 44  ? 32.886  -4.894  11.470  1.00 26.25  ? 44  ILE A CG1 1 
ATOM   281  C  CG2 . ILE A 1 44  ? 34.126  -6.218  13.281  1.00 25.15  ? 44  ILE A CG2 1 
ATOM   282  C  CD1 . ILE A 1 44  ? 34.083  -4.426  10.725  1.00 27.50  ? 44  ILE A CD1 1 
ATOM   283  N  N   . ASN A 1 45  ? 32.172  -9.318  12.502  1.00 23.89  ? 45  ASN A N   1 
ATOM   284  C  CA  . ASN A 1 45  ? 32.017  -10.604 13.153  1.00 25.26  ? 45  ASN A CA  1 
ATOM   285  C  C   . ASN A 1 45  ? 30.523  -11.009 13.127  1.00 33.77  ? 45  ASN A C   1 
ATOM   286  O  O   . ASN A 1 45  ? 29.694  -10.243 12.643  1.00 33.53  ? 45  ASN A O   1 
ATOM   287  C  CB  . ASN A 1 45  ? 32.647  -10.609 14.574  1.00 25.87  ? 45  ASN A CB  1 
ATOM   288  C  CG  . ASN A 1 45  ? 31.974  -9.702  15.566  1.00 49.78  ? 45  ASN A CG  1 
ATOM   289  O  OD1 . ASN A 1 45  ? 30.832  -9.926  15.952  1.00 47.60  ? 45  ASN A OD1 1 
ATOM   290  N  ND2 . ASN A 1 45  ? 32.668  -8.658  16.011  1.00 38.63  ? 45  ASN A ND2 1 
ATOM   291  N  N   . ASN A 1 46  ? 30.184  -12.202 13.625  1.00 34.28  ? 46  ASN A N   1 
ATOM   292  C  CA  . ASN A 1 46  ? 28.803  -12.710 13.619  1.00 34.98  ? 46  ASN A CA  1 
ATOM   293  C  C   . ASN A 1 46  ? 28.054  -12.459 14.936  1.00 42.91  ? 46  ASN A C   1 
ATOM   294  O  O   . ASN A 1 46  ? 26.922  -12.902 15.098  1.00 43.94  ? 46  ASN A O   1 
ATOM   295  C  CB  . ASN A 1 46  ? 28.774  -14.180 13.215  1.00 29.56  ? 46  ASN A CB  1 
ATOM   296  C  CG  . ASN A 1 46  ? 29.513  -14.455 11.929  1.00 46.97  ? 46  ASN A CG  1 
ATOM   297  O  OD1 . ASN A 1 46  ? 29.421  -13.718 10.939  1.00 46.85  ? 46  ASN A OD1 1 
ATOM   298  N  ND2 . ASN A 1 46  ? 30.264  -15.533 11.913  1.00 39.86  ? 46  ASN A ND2 1 
ATOM   299  N  N   . SER A 1 47  ? 28.667  -11.700 15.849  1.00 40.98  ? 47  SER A N   1 
ATOM   300  C  CA  . SER A 1 47  ? 28.074  -11.314 17.136  1.00 40.41  ? 47  SER A CA  1 
ATOM   301  C  C   . SER A 1 47  ? 27.885  -9.785  17.117  1.00 43.11  ? 47  SER A C   1 
ATOM   302  O  O   . SER A 1 47  ? 28.065  -9.114  18.144  1.00 43.80  ? 47  SER A O   1 
ATOM   303  C  CB  . SER A 1 47  ? 28.991  -11.733 18.287  1.00 43.12  ? 47  SER A CB  1 
ATOM   304  O  OG  . SER A 1 47  ? 29.459  -13.063 18.131  1.00 51.47  ? 47  SER A OG  1 
ATOM   305  N  N   . THR A 1 48  ? 27.570  -9.241  15.914  1.00 36.09  ? 48  THR A N   1 
ATOM   306  C  CA  . THR A 1 48  ? 27.359  -7.816  15.631  1.00 34.93  ? 48  THR A CA  1 
ATOM   307  C  C   . THR A 1 48  ? 26.618  -7.673  14.289  1.00 37.92  ? 48  THR A C   1 
ATOM   308  O  O   . THR A 1 48  ? 26.606  -8.611  13.484  1.00 37.54  ? 48  THR A O   1 
ATOM   309  C  CB  . THR A 1 48  ? 28.721  -7.024  15.646  1.00 44.14  ? 48  THR A CB  1 
ATOM   310  O  OG1 . THR A 1 48  ? 28.475  -5.615  15.607  1.00 42.36  ? 48  THR A OG1 1 
ATOM   311  C  CG2 . THR A 1 48  ? 29.655  -7.388  14.482  1.00 44.03  ? 48  THR A CG2 1 
ATOM   312  N  N   . ASN A 1 49  ? 26.022  -6.495  14.053  1.00 32.93  ? 49  ASN A N   1 
ATOM   313  C  CA  . ASN A 1 49  ? 25.345  -6.157  12.802  1.00 31.50  ? 49  ASN A CA  1 
ATOM   314  C  C   . ASN A 1 49  ? 26.191  -5.144  12.031  1.00 33.71  ? 49  ASN A C   1 
ATOM   315  O  O   . ASN A 1 49  ? 25.833  -4.723  10.924  1.00 32.00  ? 49  ASN A O   1 
ATOM   316  C  CB  . ASN A 1 49  ? 23.940  -5.635  13.069  1.00 28.60  ? 49  ASN A CB  1 
ATOM   317  C  CG  . ASN A 1 49  ? 22.959  -6.735  13.385  1.00 41.02  ? 49  ASN A CG  1 
ATOM   318  O  OD1 . ASN A 1 49  ? 23.042  -7.857  12.878  1.00 39.34  ? 49  ASN A OD1 1 
ATOM   319  N  ND2 . ASN A 1 49  ? 21.993  -6.431  14.215  1.00 32.94  ? 49  ASN A ND2 1 
ATOM   320  N  N   . GLU A 1 50  ? 27.337  -4.785  12.637  1.00 29.96  ? 50  GLU A N   1 
ATOM   321  C  CA  . GLU A 1 50  ? 28.331  -3.857  12.122  1.00 30.55  ? 50  GLU A CA  1 
ATOM   322  C  C   . GLU A 1 50  ? 29.098  -4.524  10.949  1.00 33.03  ? 50  GLU A C   1 
ATOM   323  O  O   . GLU A 1 50  ? 29.270  -5.749  10.921  1.00 32.17  ? 50  GLU A O   1 
ATOM   324  C  CB  . GLU A 1 50  ? 29.292  -3.458  13.276  1.00 32.55  ? 50  GLU A CB  1 
ATOM   325  C  CG  . GLU A 1 50  ? 30.036  -2.142  13.085  1.00 48.24  ? 50  GLU A CG  1 
ATOM   326  C  CD  . GLU A 1 50  ? 31.077  -1.747  14.129  1.00 73.13  ? 50  GLU A CD  1 
ATOM   327  O  OE1 . GLU A 1 50  ? 31.655  -2.637  14.801  1.00 41.95  ? 50  GLU A OE1 1 
ATOM   328  O  OE2 . GLU A 1 50  ? 31.356  -0.530  14.231  1.00 74.30  ? 50  GLU A OE2 1 
ATOM   329  N  N   . GLY A 1 51  ? 29.540  -3.698  10.005  1.00 29.38  ? 51  GLY A N   1 
ATOM   330  C  CA  . GLY A 1 51  ? 30.284  -4.112  8.824   1.00 28.73  ? 51  GLY A CA  1 
ATOM   331  C  C   . GLY A 1 51  ? 30.939  -2.960  8.088   1.00 31.98  ? 51  GLY A C   1 
ATOM   332  O  O   . GLY A 1 51  ? 30.752  -1.792  8.437   1.00 28.63  ? 51  GLY A O   1 
ATOM   333  N  N   . MET A 1 52  ? 31.728  -3.290  7.062   1.00 31.08  ? 52  MET A N   1 
ATOM   334  C  CA  . MET A 1 52  ? 32.450  -2.309  6.260   1.00 31.96  ? 52  MET A CA  1 
ATOM   335  C  C   . MET A 1 52  ? 32.118  -2.488  4.799   1.00 36.33  ? 52  MET A C   1 
ATOM   336  O  O   . MET A 1 52  ? 32.001  -3.628  4.350   1.00 37.77  ? 52  MET A O   1 
ATOM   337  C  CB  . MET A 1 52  ? 33.958  -2.511  6.424   1.00 35.01  ? 52  MET A CB  1 
ATOM   338  C  CG  . MET A 1 52  ? 34.471  -2.334  7.851   1.00 40.10  ? 52  MET A CG  1 
ATOM   339  S  SD  . MET A 1 52  ? 34.716  -0.619  8.344   1.00 45.22  ? 52  MET A SD  1 
ATOM   340  C  CE  . MET A 1 52  ? 35.974  -0.145  7.169   1.00 41.92  ? 52  MET A CE  1 
ATOM   341  N  N   . ASN A 1 53  ? 32.034  -1.385  4.037   1.00 31.30  ? 53  ASN A N   1 
ATOM   342  C  CA  . ASN A 1 53  ? 31.817  -1.455  2.592   1.00 31.25  ? 53  ASN A CA  1 
ATOM   343  C  C   . ASN A 1 53  ? 33.160  -1.509  1.903   1.00 36.21  ? 53  ASN A C   1 
ATOM   344  O  O   . ASN A 1 53  ? 33.817  -0.484  1.755   1.00 38.47  ? 53  ASN A O   1 
ATOM   345  C  CB  . ASN A 1 53  ? 30.971  -0.290  2.078   1.00 29.78  ? 53  ASN A CB  1 
ATOM   346  C  CG  . ASN A 1 53  ? 29.564  -0.318  2.603   1.00 43.61  ? 53  ASN A CG  1 
ATOM   347  O  OD1 . ASN A 1 53  ? 28.870  -1.338  2.537   1.00 36.02  ? 53  ASN A OD1 1 
ATOM   348  N  ND2 . ASN A 1 53  ? 29.119  0.793   3.162   1.00 33.54  ? 53  ASN A ND2 1 
ATOM   349  N  N   . VAL A 1 54  ? 33.607  -2.712  1.555   1.00 31.16  ? 54  VAL A N   1 
ATOM   350  C  CA  . VAL A 1 54  ? 34.881  -2.918  0.873   1.00 30.37  ? 54  VAL A CA  1 
ATOM   351  C  C   . VAL A 1 54  ? 34.754  -2.452  -0.587  1.00 35.17  ? 54  VAL A C   1 
ATOM   352  O  O   . VAL A 1 54  ? 33.814  -2.837  -1.291  1.00 34.55  ? 54  VAL A O   1 
ATOM   353  C  CB  . VAL A 1 54  ? 35.352  -4.392  0.981   1.00 33.66  ? 54  VAL A CB  1 
ATOM   354  C  CG1 . VAL A 1 54  ? 36.584  -4.659  0.103   1.00 33.42  ? 54  VAL A CG1 1 
ATOM   355  C  CG2 . VAL A 1 54  ? 35.629  -4.773  2.433   1.00 33.10  ? 54  VAL A CG2 1 
ATOM   356  N  N   . LYS A 1 55  ? 35.692  -1.604  -1.030  1.00 32.57  ? 55  LYS A N   1 
ATOM   357  C  CA  . LYS A 1 55  ? 35.720  -1.129  -2.410  1.00 31.25  ? 55  LYS A CA  1 
ATOM   358  C  C   . LYS A 1 55  ? 36.219  -2.278  -3.278  1.00 33.58  ? 55  LYS A C   1 
ATOM   359  O  O   . LYS A 1 55  ? 37.280  -2.849  -3.017  1.00 32.92  ? 55  LYS A O   1 
ATOM   360  C  CB  . LYS A 1 55  ? 36.609  0.111   -2.561  1.00 33.49  ? 55  LYS A CB  1 
ATOM   361  C  CG  . LYS A 1 55  ? 36.097  1.343   -1.819  1.00 56.71  ? 55  LYS A CG  1 
ATOM   362  C  CD  . LYS A 1 55  ? 36.962  2.581   -2.109  1.00 71.82  ? 55  LYS A CD  1 
ATOM   363  C  CE  . LYS A 1 55  ? 37.549  3.231   -0.872  1.00 82.53  ? 55  LYS A CE  1 
ATOM   364  N  NZ  . LYS A 1 55  ? 36.503  3.861   -0.017  1.00 89.58  ? 55  LYS A NZ  1 
ATOM   365  N  N   . LYS A 1 56  ? 35.399  -2.686  -4.242  1.00 29.30  ? 56  LYS A N   1 
ATOM   366  C  CA  . LYS A 1 56  ? 35.755  -3.756  -5.160  1.00 29.46  ? 56  LYS A CA  1 
ATOM   367  C  C   . LYS A 1 56  ? 35.540  -3.274  -6.592  1.00 32.62  ? 56  LYS A C   1 
ATOM   368  O  O   . LYS A 1 56  ? 35.025  -2.179  -6.805  1.00 28.96  ? 56  LYS A O   1 
ATOM   369  C  CB  . LYS A 1 56  ? 35.003  -5.079  -4.824  1.00 32.32  ? 56  LYS A CB  1 
ATOM   370  C  CG  . LYS A 1 56  ? 35.371  -5.630  -3.427  1.00 33.99  ? 56  LYS A CG  1 
ATOM   371  C  CD  . LYS A 1 56  ? 35.478  -7.145  -3.309  1.00 36.11  ? 56  LYS A CD  1 
ATOM   372  C  CE  . LYS A 1 56  ? 36.834  -7.710  -3.688  1.00 49.90  ? 56  LYS A CE  1 
ATOM   373  N  NZ  . LYS A 1 56  ? 37.948  -7.225  -2.819  1.00 57.36  ? 56  LYS A NZ  1 
ATOM   374  N  N   . CYS A 1 57  ? 35.992  -4.050  -7.568  1.00 33.50  ? 57  CYS A N   1 
ATOM   375  C  CA  . CYS A 1 57  ? 35.834  -3.678  -8.965  1.00 35.70  ? 57  CYS A CA  1 
ATOM   376  C  C   . CYS A 1 57  ? 35.011  -4.728  -9.692  1.00 34.73  ? 57  CYS A C   1 
ATOM   377  O  O   . CYS A 1 57  ? 35.104  -5.923  -9.391  1.00 34.15  ? 57  CYS A O   1 
ATOM   378  C  CB  . CYS A 1 57  ? 37.189  -3.445  -9.624  1.00 39.08  ? 57  CYS A CB  1 
ATOM   379  S  SG  . CYS A 1 57  ? 38.243  -2.268  -8.738  1.00 45.09  ? 57  CYS A SG  1 
ATOM   380  N  N   . CYS A 1 58  ? 34.157  -4.268  -10.592 1.00 28.35  ? 58  CYS A N   1 
ATOM   381  C  CA  . CYS A 1 58  ? 33.244  -5.123  -11.330 1.00 28.10  ? 58  CYS A CA  1 
ATOM   382  C  C   . CYS A 1 58  ? 33.414  -4.986  -12.836 1.00 27.11  ? 58  CYS A C   1 
ATOM   383  O  O   . CYS A 1 58  ? 33.581  -3.884  -13.356 1.00 25.94  ? 58  CYS A O   1 
ATOM   384  C  CB  . CYS A 1 58  ? 31.799  -4.848  -10.911 1.00 29.66  ? 58  CYS A CB  1 
ATOM   385  S  SG  . CYS A 1 58  ? 31.339  -5.519  -9.291  1.00 34.38  ? 58  CYS A SG  1 
ATOM   386  N  N   . LYS A 1 59  ? 33.295  -6.110  -13.538 1.00 21.38  ? 59  LYS A N   1 
ATOM   387  C  CA  . LYS A 1 59  ? 33.362  -6.172  -14.996 1.00 20.40  ? 59  LYS A CA  1 
ATOM   388  C  C   . LYS A 1 59  ? 32.461  -7.310  -15.527 1.00 23.86  ? 59  LYS A C   1 
ATOM   389  O  O   . LYS A 1 59  ? 31.906  -8.070  -14.737 1.00 24.07  ? 59  LYS A O   1 
ATOM   390  C  CB  . LYS A 1 59  ? 34.834  -6.261  -15.488 1.00 21.01  ? 59  LYS A CB  1 
ATOM   391  C  CG  . LYS A 1 59  ? 35.508  -7.603  -15.299 1.00 30.27  ? 59  LYS A CG  1 
ATOM   392  C  CD  . LYS A 1 59  ? 37.008  -7.547  -15.557 1.00 29.44  ? 59  LYS A CD  1 
ATOM   393  C  CE  . LYS A 1 59  ? 37.606  -8.912  -15.322 1.00 33.79  ? 59  LYS A CE  1 
ATOM   394  N  NZ  . LYS A 1 59  ? 38.990  -9.020  -15.861 1.00 47.29  ? 59  LYS A NZ  1 
ATOM   395  N  N   . GLY A 1 60  ? 32.369  -7.437  -16.844 1.00 20.45  ? 60  GLY A N   1 
ATOM   396  C  CA  . GLY A 1 60  ? 31.592  -8.479  -17.497 1.00 20.11  ? 60  GLY A CA  1 
ATOM   397  C  C   . GLY A 1 60  ? 30.530  -7.944  -18.426 1.00 25.05  ? 60  GLY A C   1 
ATOM   398  O  O   . GLY A 1 60  ? 30.326  -6.723  -18.544 1.00 24.71  ? 60  GLY A O   1 
ATOM   399  N  N   . PHE A 1 61  ? 29.865  -8.876  -19.104 1.00 20.23  ? 61  PHE A N   1 
ATOM   400  C  CA  . PHE A 1 61  ? 28.798  -8.628  -20.055 1.00 20.25  ? 61  PHE A CA  1 
ATOM   401  C  C   . PHE A 1 61  ? 27.707  -7.687  -19.499 1.00 27.84  ? 61  PHE A C   1 
ATOM   402  O  O   . PHE A 1 61  ? 27.338  -6.711  -20.173 1.00 26.96  ? 61  PHE A O   1 
ATOM   403  C  CB  . PHE A 1 61  ? 28.202  -9.982  -20.455 1.00 21.80  ? 61  PHE A CB  1 
ATOM   404  C  CG  . PHE A 1 61  ? 27.181  -9.937  -21.551 1.00 23.05  ? 61  PHE A CG  1 
ATOM   405  C  CD1 . PHE A 1 61  ? 25.833  -9.776  -21.260 1.00 25.15  ? 61  PHE A CD1 1 
ATOM   406  C  CD2 . PHE A 1 61  ? 27.560  -10.092 -22.880 1.00 25.76  ? 61  PHE A CD2 1 
ATOM   407  C  CE1 . PHE A 1 61  ? 24.889  -9.723  -22.279 1.00 27.03  ? 61  PHE A CE1 1 
ATOM   408  C  CE2 . PHE A 1 61  ? 26.606  -10.063 -23.902 1.00 28.68  ? 61  PHE A CE2 1 
ATOM   409  C  CZ  . PHE A 1 61  ? 25.279  -9.878  -23.596 1.00 26.95  ? 61  PHE A CZ  1 
ATOM   410  N  N   . CYS A 1 62  ? 27.191  -7.986  -18.279 1.00 26.59  ? 62  CYS A N   1 
ATOM   411  C  CA  . CYS A 1 62  ? 26.157  -7.180  -17.633 1.00 27.70  ? 62  CYS A CA  1 
ATOM   412  C  C   . CYS A 1 62  ? 26.654  -5.819  -17.190 1.00 25.69  ? 62  CYS A C   1 
ATOM   413  O  O   . CYS A 1 62  ? 25.859  -4.884  -17.162 1.00 24.09  ? 62  CYS A O   1 
ATOM   414  C  CB  . CYS A 1 62  ? 25.499  -7.934  -16.485 1.00 31.03  ? 62  CYS A CB  1 
ATOM   415  S  SG  . CYS A 1 62  ? 24.506  -9.353  -17.013 1.00 37.30  ? 62  CYS A SG  1 
ATOM   416  N  N   . ILE A 1 63  ? 27.949  -5.700  -16.828 1.00 21.59  ? 63  ILE A N   1 
ATOM   417  C  CA  . ILE A 1 63  ? 28.543  -4.422  -16.404 1.00 21.02  ? 63  ILE A CA  1 
ATOM   418  C  C   . ILE A 1 63  ? 28.682  -3.493  -17.618 1.00 24.36  ? 63  ILE A C   1 
ATOM   419  O  O   . ILE A 1 63  ? 28.323  -2.316  -17.523 1.00 25.98  ? 63  ILE A O   1 
ATOM   420  C  CB  . ILE A 1 63  ? 29.847  -4.586  -15.561 1.00 24.26  ? 63  ILE A CB  1 
ATOM   421  C  CG1 . ILE A 1 63  ? 29.618  -5.398  -14.233 1.00 24.19  ? 63  ILE A CG1 1 
ATOM   422  C  CG2 . ILE A 1 63  ? 30.549  -3.244  -15.287 1.00 23.82  ? 63  ILE A CG2 1 
ATOM   423  C  CD1 . ILE A 1 63  ? 28.328  -5.084  -13.380 1.00 32.58  ? 63  ILE A CD1 1 
ATOM   424  N  N   . ASP A 1 64  ? 29.090  -4.040  -18.766 1.00 19.25  ? 64  ASP A N   1 
ATOM   425  C  CA  . ASP A 1 64  ? 29.185  -3.308  -20.041 1.00 19.10  ? 64  ASP A CA  1 
ATOM   426  C  C   . ASP A 1 64  ? 27.819  -2.783  -20.522 1.00 24.09  ? 64  ASP A C   1 
ATOM   427  O  O   . ASP A 1 64  ? 27.746  -1.646  -21.019 1.00 24.26  ? 64  ASP A O   1 
ATOM   428  C  CB  . ASP A 1 64  ? 29.870  -4.158  -21.108 1.00 20.72  ? 64  ASP A CB  1 
ATOM   429  C  CG  . ASP A 1 64  ? 31.380  -4.304  -20.886 1.00 36.58  ? 64  ASP A CG  1 
ATOM   430  O  OD1 . ASP A 1 64  ? 31.908  -3.690  -19.923 1.00 37.03  ? 64  ASP A OD1 1 
ATOM   431  O  OD2 . ASP A 1 64  ? 32.034  -5.035  -21.672 1.00 40.77  ? 64  ASP A OD2 1 
ATOM   432  N  N   . ILE A 1 65  ? 26.729  -3.563  -20.275 1.00 18.34  ? 65  ILE A N   1 
ATOM   433  C  CA  . ILE A 1 65  ? 25.367  -3.149  -20.591 1.00 17.83  ? 65  ILE A CA  1 
ATOM   434  C  C   . ILE A 1 65  ? 25.012  -1.952  -19.717 1.00 22.01  ? 65  ILE A C   1 
ATOM   435  O  O   . ILE A 1 65  ? 24.486  -0.954  -20.235 1.00 20.56  ? 65  ILE A O   1 
ATOM   436  C  CB  . ILE A 1 65  ? 24.361  -4.325  -20.480 1.00 21.04  ? 65  ILE A CB  1 
ATOM   437  C  CG1 . ILE A 1 65  ? 24.341  -5.109  -21.790 1.00 21.21  ? 65  ILE A CG1 1 
ATOM   438  C  CG2 . ILE A 1 65  ? 22.932  -3.862  -20.089 1.00 23.12  ? 65  ILE A CG2 1 
ATOM   439  C  CD1 . ILE A 1 65  ? 24.214  -6.495  -21.579 1.00 28.49  ? 65  ILE A CD1 1 
ATOM   440  N  N   . LEU A 1 66  ? 25.346  -2.040  -18.405 1.00 19.37  ? 66  LEU A N   1 
ATOM   441  C  CA  . LEU A 1 66  ? 25.112  -0.968  -17.431 1.00 19.77  ? 66  LEU A CA  1 
ATOM   442  C  C   . LEU A 1 66  ? 25.835  0.321   -17.834 1.00 23.57  ? 66  LEU A C   1 
ATOM   443  O  O   . LEU A 1 66  ? 25.221  1.389   -17.772 1.00 21.93  ? 66  LEU A O   1 
ATOM   444  C  CB  . LEU A 1 66  ? 25.499  -1.413  -16.000 1.00 20.18  ? 66  LEU A CB  1 
ATOM   445  C  CG  . LEU A 1 66  ? 25.267  -0.421  -14.848 1.00 24.41  ? 66  LEU A CG  1 
ATOM   446  C  CD1 . LEU A 1 66  ? 23.788  -0.072  -14.695 1.00 23.99  ? 66  LEU A CD1 1 
ATOM   447  C  CD2 . LEU A 1 66  ? 25.793  -1.002  -13.542 1.00 27.22  ? 66  LEU A CD2 1 
ATOM   448  N  N   . LYS A 1 67  ? 27.092  0.212   -18.326 1.00 22.50  ? 67  LYS A N   1 
ATOM   449  C  CA  . LYS A 1 67  ? 27.850  1.377   -18.821 1.00 23.71  ? 67  LYS A CA  1 
ATOM   450  C  C   . LYS A 1 67  ? 27.105  2.052   -19.987 1.00 29.61  ? 67  LYS A C   1 
ATOM   451  O  O   . LYS A 1 67  ? 26.879  3.272   -19.954 1.00 30.59  ? 67  LYS A O   1 
ATOM   452  C  CB  . LYS A 1 67  ? 29.262  1.000   -19.283 1.00 24.60  ? 67  LYS A CB  1 
ATOM   453  C  CG  . LYS A 1 67  ? 30.238  0.678   -18.191 1.00 25.55  ? 67  LYS A CG  1 
ATOM   454  C  CD  . LYS A 1 67  ? 31.553  0.336   -18.861 1.00 28.62  ? 67  LYS A CD  1 
ATOM   455  C  CE  . LYS A 1 67  ? 32.455  -0.543  -18.061 1.00 36.68  ? 67  LYS A CE  1 
ATOM   456  N  NZ  . LYS A 1 67  ? 33.728  -0.757  -18.787 1.00 58.21  ? 67  LYS A NZ  1 
ATOM   457  N  N   . LYS A 1 68  ? 26.707  1.254   -20.993 1.00 26.22  ? 68  LYS A N   1 
ATOM   458  C  CA  . LYS A 1 68  ? 25.985  1.753   -22.170 1.00 26.30  ? 68  LYS A CA  1 
ATOM   459  C  C   . LYS A 1 68  ? 24.653  2.410   -21.756 1.00 31.00  ? 68  LYS A C   1 
ATOM   460  O  O   . LYS A 1 68  ? 24.340  3.504   -22.235 1.00 31.21  ? 68  LYS A O   1 
ATOM   461  C  CB  . LYS A 1 68  ? 25.761  0.632   -23.198 1.00 27.97  ? 68  LYS A CB  1 
ATOM   462  C  CG  . LYS A 1 68  ? 27.037  0.093   -23.844 1.00 29.53  ? 68  LYS A CG  1 
ATOM   463  C  CD  . LYS A 1 68  ? 26.701  -1.123  -24.741 1.00 36.96  ? 68  LYS A CD  1 
ATOM   464  C  CE  . LYS A 1 68  ? 27.869  -1.667  -25.519 1.00 42.78  ? 68  LYS A CE  1 
ATOM   465  N  NZ  . LYS A 1 68  ? 28.378  -0.693  -26.524 1.00 48.42  ? 68  LYS A NZ  1 
ATOM   466  N  N   . LEU A 1 69  ? 23.900  1.771   -20.827 1.00 26.30  ? 69  LEU A N   1 
ATOM   467  C  CA  . LEU A 1 69  ? 22.628  2.311   -20.324 1.00 25.22  ? 69  LEU A CA  1 
ATOM   468  C  C   . LEU A 1 69  ? 22.838  3.634   -19.597 1.00 30.11  ? 69  LEU A C   1 
ATOM   469  O  O   . LEU A 1 69  ? 22.023  4.543   -19.735 1.00 30.42  ? 69  LEU A O   1 
ATOM   470  C  CB  . LEU A 1 69  ? 21.928  1.321   -19.381 1.00 24.52  ? 69  LEU A CB  1 
ATOM   471  C  CG  . LEU A 1 69  ? 21.376  0.043   -19.988 1.00 28.54  ? 69  LEU A CG  1 
ATOM   472  C  CD1 . LEU A 1 69  ? 20.783  -0.826  -18.898 1.00 28.10  ? 69  LEU A CD1 1 
ATOM   473  C  CD2 . LEU A 1 69  ? 20.306  0.345   -21.061 1.00 30.38  ? 69  LEU A CD2 1 
ATOM   474  N  N   . SER A 1 70  ? 23.912  3.718   -18.798 1.00 25.59  ? 70  SER A N   1 
ATOM   475  C  CA  . SER A 1 70  ? 24.296  4.889   -18.036 1.00 25.15  ? 70  SER A CA  1 
ATOM   476  C  C   . SER A 1 70  ? 24.504  6.105   -18.964 1.00 28.93  ? 70  SER A C   1 
ATOM   477  O  O   . SER A 1 70  ? 24.028  7.196   -18.646 1.00 26.74  ? 70  SER A O   1 
ATOM   478  C  CB  . SER A 1 70  ? 25.575  4.592   -17.247 1.00 27.45  ? 70  SER A CB  1 
ATOM   479  O  OG  . SER A 1 70  ? 25.878  5.593   -16.289 1.00 30.32  ? 70  SER A OG  1 
ATOM   480  N  N   . ARG A 1 71  ? 25.211  5.914   -20.100 1.00 27.44  ? 71  ARG A N   1 
ATOM   481  C  CA  . ARG A 1 71  ? 25.462  7.014   -21.037 1.00 28.72  ? 71  ARG A CA  1 
ATOM   482  C  C   . ARG A 1 71  ? 24.280  7.303   -21.962 1.00 32.59  ? 71  ARG A C   1 
ATOM   483  O  O   . ARG A 1 71  ? 24.037  8.466   -22.246 1.00 34.80  ? 71  ARG A O   1 
ATOM   484  C  CB  . ARG A 1 71  ? 26.773  6.836   -21.834 1.00 32.70  ? 71  ARG A CB  1 
ATOM   485  C  CG  . ARG A 1 71  ? 26.911  5.555   -22.653 1.00 47.80  ? 71  ARG A CG  1 
ATOM   486  C  CD  . ARG A 1 71  ? 28.235  5.514   -23.394 1.00 60.95  ? 71  ARG A CD  1 
ATOM   487  N  NE  . ARG A 1 71  ? 29.345  5.144   -22.512 1.00 67.61  ? 71  ARG A NE  1 
ATOM   488  C  CZ  . ARG A 1 71  ? 29.833  3.912   -22.394 1.00 75.90  ? 71  ARG A CZ  1 
ATOM   489  N  NH1 . ARG A 1 71  ? 29.316  2.912   -23.104 1.00 52.52  ? 71  ARG A NH1 1 
ATOM   490  N  NH2 . ARG A 1 71  ? 30.842  3.668   -21.567 1.00 62.28  ? 71  ARG A NH2 1 
ATOM   491  N  N   . THR A 1 72  ? 23.528  6.278   -22.390 1.00 26.50  ? 72  THR A N   1 
ATOM   492  C  CA  . THR A 1 72  ? 22.369  6.428   -23.277 1.00 25.78  ? 72  THR A CA  1 
ATOM   493  C  C   . THR A 1 72  ? 21.144  7.003   -22.538 1.00 30.67  ? 72  THR A C   1 
ATOM   494  O  O   . THR A 1 72  ? 20.534  7.959   -23.016 1.00 30.36  ? 72  THR A O   1 
ATOM   495  C  CB  . THR A 1 72  ? 22.054  5.071   -23.932 1.00 29.52  ? 72  THR A CB  1 
ATOM   496  O  OG1 . THR A 1 72  ? 23.255  4.537   -24.501 1.00 30.23  ? 72  THR A OG1 1 
ATOM   497  C  CG2 . THR A 1 72  ? 20.925  5.144   -24.967 1.00 24.38  ? 72  THR A CG2 1 
ATOM   498  N  N   . VAL A 1 73  ? 20.769  6.399   -21.396 1.00 27.60  ? 73  VAL A N   1 
ATOM   499  C  CA  . VAL A 1 73  ? 19.595  6.800   -20.601 1.00 27.31  ? 73  VAL A CA  1 
ATOM   500  C  C   . VAL A 1 73  ? 19.908  8.050   -19.777 1.00 33.84  ? 73  VAL A C   1 
ATOM   501  O  O   . VAL A 1 73  ? 18.984  8.762   -19.378 1.00 35.91  ? 73  VAL A O   1 
ATOM   502  C  CB  . VAL A 1 73  ? 19.022  5.609   -19.764 1.00 29.91  ? 73  VAL A CB  1 
ATOM   503  C  CG1 . VAL A 1 73  ? 17.791  6.012   -18.955 1.00 29.92  ? 73  VAL A CG1 1 
ATOM   504  C  CG2 . VAL A 1 73  ? 18.691  4.422   -20.664 1.00 29.15  ? 73  VAL A CG2 1 
ATOM   505  N  N   . LYS A 1 74  ? 21.214  8.344   -19.585 1.00 29.75  ? 74  LYS A N   1 
ATOM   506  C  CA  . LYS A 1 74  ? 21.760  9.490   -18.852 1.00 29.50  ? 74  LYS A CA  1 
ATOM   507  C  C   . LYS A 1 74  ? 21.441  9.431   -17.350 1.00 31.13  ? 74  LYS A C   1 
ATOM   508  O  O   . LYS A 1 74  ? 20.514  10.082  -16.859 1.00 30.79  ? 74  LYS A O   1 
ATOM   509  C  CB  . LYS A 1 74  ? 21.375  10.846  -19.489 1.00 32.60  ? 74  LYS A CB  1 
ATOM   510  C  CG  . LYS A 1 74  ? 22.322  11.272  -20.598 1.00 43.32  ? 74  LYS A CG  1 
ATOM   511  C  CD  . LYS A 1 74  ? 21.732  11.007  -21.972 1.00 57.91  ? 74  LYS A CD  1 
ATOM   512  C  CE  . LYS A 1 74  ? 21.190  12.250  -22.628 1.00 70.13  ? 74  LYS A CE  1 
ATOM   513  N  NZ  . LYS A 1 74  ? 22.282  13.094  -23.180 1.00 82.90  ? 74  LYS A NZ  1 
ATOM   514  N  N   . PHE A 1 75  ? 22.225  8.621   -16.631 1.00 24.96  ? 75  PHE A N   1 
ATOM   515  C  CA  . PHE A 1 75  ? 22.126  8.466   -15.180 1.00 22.95  ? 75  PHE A CA  1 
ATOM   516  C  C   . PHE A 1 75  ? 23.479  8.103   -14.614 1.00 25.47  ? 75  PHE A C   1 
ATOM   517  O  O   . PHE A 1 75  ? 24.319  7.572   -15.333 1.00 23.00  ? 75  PHE A O   1 
ATOM   518  C  CB  . PHE A 1 75  ? 21.046  7.433   -14.754 1.00 23.62  ? 75  PHE A CB  1 
ATOM   519  C  CG  . PHE A 1 75  ? 21.262  5.981   -15.145 1.00 23.99  ? 75  PHE A CG  1 
ATOM   520  C  CD1 . PHE A 1 75  ? 22.104  5.160   -14.404 1.00 25.63  ? 75  PHE A CD1 1 
ATOM   521  C  CD2 . PHE A 1 75  ? 20.539  5.410   -16.186 1.00 24.79  ? 75  PHE A CD2 1 
ATOM   522  C  CE1 . PHE A 1 75  ? 22.259  3.805   -14.728 1.00 26.28  ? 75  PHE A CE1 1 
ATOM   523  C  CE2 . PHE A 1 75  ? 20.696  4.059   -16.512 1.00 27.21  ? 75  PHE A CE2 1 
ATOM   524  C  CZ  . PHE A 1 75  ? 21.562  3.266   -15.786 1.00 25.19  ? 75  PHE A CZ  1 
ATOM   525  N  N   . THR A 1 76  ? 23.696  8.417   -13.331 1.00 23.97  ? 76  THR A N   1 
ATOM   526  C  CA  . THR A 1 76  ? 24.892  8.024   -12.590 1.00 24.39  ? 76  THR A CA  1 
ATOM   527  C  C   . THR A 1 76  ? 24.415  6.942   -11.605 1.00 27.64  ? 76  THR A C   1 
ATOM   528  O  O   . THR A 1 76  ? 23.201  6.784   -11.391 1.00 25.31  ? 76  THR A O   1 
ATOM   529  C  CB  . THR A 1 76  ? 25.589  9.231   -11.948 1.00 33.12  ? 76  THR A CB  1 
ATOM   530  O  OG1 . THR A 1 76  ? 24.627  9.940   -11.168 1.00 34.23  ? 76  THR A OG1 1 
ATOM   531  C  CG2 . THR A 1 76  ? 26.224  10.170  -12.996 1.00 28.38  ? 76  THR A CG2 1 
ATOM   532  N  N   . TYR A 1 77  ? 25.343  6.165   -11.045 1.00 24.92  ? 77  TYR A N   1 
ATOM   533  C  CA  . TYR A 1 77  ? 24.917  5.078   -10.177 1.00 24.49  ? 77  TYR A CA  1 
ATOM   534  C  C   . TYR A 1 77  ? 25.934  4.699   -9.141  1.00 28.24  ? 77  TYR A C   1 
ATOM   535  O  O   . TYR A 1 77  ? 27.132  4.879   -9.346  1.00 26.89  ? 77  TYR A O   1 
ATOM   536  C  CB  . TYR A 1 77  ? 24.537  3.826   -11.038 1.00 25.02  ? 77  TYR A CB  1 
ATOM   537  C  CG  . TYR A 1 77  ? 25.682  3.274   -11.872 1.00 25.11  ? 77  TYR A CG  1 
ATOM   538  C  CD1 . TYR A 1 77  ? 26.615  2.398   -11.320 1.00 26.46  ? 77  TYR A CD1 1 
ATOM   539  C  CD2 . TYR A 1 77  ? 25.850  3.653   -13.204 1.00 24.57  ? 77  TYR A CD2 1 
ATOM   540  C  CE1 . TYR A 1 77  ? 27.706  1.950   -12.053 1.00 26.12  ? 77  TYR A CE1 1 
ATOM   541  C  CE2 . TYR A 1 77  ? 26.916  3.169   -13.963 1.00 24.35  ? 77  TYR A CE2 1 
ATOM   542  C  CZ  . TYR A 1 77  ? 27.847  2.326   -13.377 1.00 30.42  ? 77  TYR A CZ  1 
ATOM   543  O  OH  . TYR A 1 77  ? 28.923  1.851   -14.087 1.00 29.48  ? 77  TYR A OH  1 
ATOM   544  N  N   . ASP A 1 78  ? 25.453  4.088   -8.053  1.00 25.65  ? 78  ASP A N   1 
ATOM   545  C  CA  . ASP A 1 78  ? 26.296  3.533   -7.009  1.00 25.04  ? 78  ASP A CA  1 
ATOM   546  C  C   . ASP A 1 78  ? 25.981  2.031   -6.981  1.00 24.61  ? 78  ASP A C   1 
ATOM   547  O  O   . ASP A 1 78  ? 24.889  1.621   -6.586  1.00 23.48  ? 78  ASP A O   1 
ATOM   548  C  CB  . ASP A 1 78  ? 26.070  4.245   -5.652  1.00 27.95  ? 78  ASP A CB  1 
ATOM   549  C  CG  . ASP A 1 78  ? 26.589  3.489   -4.433  1.00 43.02  ? 78  ASP A CG  1 
ATOM   550  O  OD1 . ASP A 1 78  ? 27.626  2.784   -4.554  1.00 42.96  ? 78  ASP A OD1 1 
ATOM   551  O  OD2 . ASP A 1 78  ? 25.944  3.568   -3.374  1.00 55.64  ? 78  ASP A OD2 1 
ATOM   552  N  N   . LEU A 1 79  ? 26.911  1.241   -7.502  1.00 19.86  ? 79  LEU A N   1 
ATOM   553  C  CA  . LEU A 1 79  ? 26.797  -0.200  -7.641  1.00 19.78  ? 79  LEU A CA  1 
ATOM   554  C  C   . LEU A 1 79  ? 27.213  -0.930  -6.396  1.00 24.17  ? 79  LEU A C   1 
ATOM   555  O  O   . LEU A 1 79  ? 28.297  -0.695  -5.880  1.00 25.80  ? 79  LEU A O   1 
ATOM   556  C  CB  . LEU A 1 79  ? 27.641  -0.662  -8.838  1.00 20.18  ? 79  LEU A CB  1 
ATOM   557  C  CG  . LEU A 1 79  ? 27.449  -2.097  -9.369  1.00 24.14  ? 79  LEU A CG  1 
ATOM   558  C  CD1 . LEU A 1 79  ? 26.016  -2.321  -9.910  1.00 23.88  ? 79  LEU A CD1 1 
ATOM   559  C  CD2 . LEU A 1 79  ? 28.454  -2.381  -10.471 1.00 22.75  ? 79  LEU A CD2 1 
ATOM   560  N  N   . TYR A 1 80  ? 26.343  -1.807  -5.892  1.00 19.09  ? 80  TYR A N   1 
ATOM   561  C  CA  . TYR A 1 80  ? 26.663  -2.626  -4.737  1.00 17.45  ? 80  TYR A CA  1 
ATOM   562  C  C   . TYR A 1 80  ? 26.337  -4.103  -5.008  1.00 21.30  ? 80  TYR A C   1 
ATOM   563  O  O   . TYR A 1 80  ? 25.551  -4.430  -5.907  1.00 20.29  ? 80  TYR A O   1 
ATOM   564  C  CB  . TYR A 1 80  ? 26.040  -2.083  -3.444  1.00 17.73  ? 80  TYR A CB  1 
ATOM   565  C  CG  . TYR A 1 80  ? 24.543  -2.279  -3.318  1.00 18.07  ? 80  TYR A CG  1 
ATOM   566  C  CD1 . TYR A 1 80  ? 23.650  -1.442  -3.986  1.00 19.26  ? 80  TYR A CD1 1 
ATOM   567  C  CD2 . TYR A 1 80  ? 24.019  -3.259  -2.487  1.00 19.05  ? 80  TYR A CD2 1 
ATOM   568  C  CE1 . TYR A 1 80  ? 22.271  -1.591  -3.844  1.00 19.72  ? 80  TYR A CE1 1 
ATOM   569  C  CE2 . TYR A 1 80  ? 22.639  -3.416  -2.331  1.00 20.70  ? 80  TYR A CE2 1 
ATOM   570  C  CZ  . TYR A 1 80  ? 21.768  -2.569  -2.999  1.00 26.19  ? 80  TYR A CZ  1 
ATOM   571  O  OH  . TYR A 1 80  ? 20.415  -2.737  -2.861  1.00 21.88  ? 80  TYR A OH  1 
ATOM   572  N  N   . LEU A 1 81  ? 26.994  -4.989  -4.277  1.00 18.35  ? 81  LEU A N   1 
ATOM   573  C  CA  . LEU A 1 81  ? 26.811  -6.430  -4.416  1.00 18.31  ? 81  LEU A CA  1 
ATOM   574  C  C   . LEU A 1 81  ? 25.891  -6.955  -3.307  1.00 22.72  ? 81  LEU A C   1 
ATOM   575  O  O   . LEU A 1 81  ? 26.123  -6.653  -2.143  1.00 21.45  ? 81  LEU A O   1 
ATOM   576  C  CB  . LEU A 1 81  ? 28.178  -7.109  -4.339  1.00 18.10  ? 81  LEU A CB  1 
ATOM   577  C  CG  . LEU A 1 81  ? 29.087  -6.892  -5.549  1.00 22.09  ? 81  LEU A CG  1 
ATOM   578  C  CD1 . LEU A 1 81  ? 30.567  -6.890  -5.120  1.00 21.21  ? 81  LEU A CD1 1 
ATOM   579  C  CD2 . LEU A 1 81  ? 28.804  -7.930  -6.626  1.00 20.99  ? 81  LEU A CD2 1 
ATOM   580  N  N   . VAL A 1 82  ? 24.866  -7.746  -3.665  1.00 20.60  ? 82  VAL A N   1 
ATOM   581  C  CA  . VAL A 1 82  ? 23.918  -8.331  -2.710  1.00 20.58  ? 82  VAL A CA  1 
ATOM   582  C  C   . VAL A 1 82  ? 24.634  -9.264  -1.721  1.00 24.88  ? 82  VAL A C   1 
ATOM   583  O  O   . VAL A 1 82  ? 25.541  -10.008 -2.108  1.00 23.16  ? 82  VAL A O   1 
ATOM   584  C  CB  . VAL A 1 82  ? 22.710  -9.021  -3.415  1.00 25.37  ? 82  VAL A CB  1 
ATOM   585  C  CG1 . VAL A 1 82  ? 23.123  -10.291 -4.167  1.00 25.06  ? 82  VAL A CG1 1 
ATOM   586  C  CG2 . VAL A 1 82  ? 21.568  -9.311  -2.434  1.00 25.44  ? 82  VAL A CG2 1 
ATOM   587  N  N   . THR A 1 83  ? 24.238  -9.186  -0.438  1.00 23.27  ? 83  THR A N   1 
ATOM   588  C  CA  . THR A 1 83  ? 24.791  -10.005 0.649   1.00 23.28  ? 83  THR A CA  1 
ATOM   589  C  C   . THR A 1 83  ? 23.682  -10.863 1.305   1.00 28.45  ? 83  THR A C   1 
ATOM   590  O  O   . THR A 1 83  ? 23.982  -11.885 1.913   1.00 30.91  ? 83  THR A O   1 
ATOM   591  C  CB  . THR A 1 83  ? 25.572  -9.115  1.643   1.00 24.20  ? 83  THR A CB  1 
ATOM   592  O  OG1 . THR A 1 83  ? 24.745  -8.026  2.029   1.00 28.70  ? 83  THR A OG1 1 
ATOM   593  C  CG2 . THR A 1 83  ? 26.840  -8.535  1.040   1.00 17.10  ? 83  THR A CG2 1 
ATOM   594  N  N   . ASN A 1 84  ? 22.408  -10.454 1.148   1.00 22.81  ? 84  ASN A N   1 
ATOM   595  C  CA  . ASN A 1 84  ? 21.196  -11.104 1.671   1.00 20.88  ? 84  ASN A CA  1 
ATOM   596  C  C   . ASN A 1 84  ? 20.727  -12.161 0.674   1.00 23.86  ? 84  ASN A C   1 
ATOM   597  O  O   . ASN A 1 84  ? 19.780  -11.955 -0.067  1.00 21.87  ? 84  ASN A O   1 
ATOM   598  C  CB  . ASN A 1 84  ? 20.109  -10.025 1.868   1.00 16.74  ? 84  ASN A CB  1 
ATOM   599  C  CG  . ASN A 1 84  ? 18.854  -10.519 2.557   1.00 37.51  ? 84  ASN A CG  1 
ATOM   600  O  OD1 . ASN A 1 84  ? 18.895  -11.386 3.437   1.00 31.52  ? 84  ASN A OD1 1 
ATOM   601  N  ND2 . ASN A 1 84  ? 17.705  -9.996  2.145   1.00 24.26  ? 84  ASN A ND2 1 
ATOM   602  N  N   . GLY A 1 85  ? 21.422  -13.275 0.602   1.00 23.25  ? 85  GLY A N   1 
ATOM   603  C  CA  . GLY A 1 85  ? 21.068  -14.273 -0.405  1.00 23.32  ? 85  GLY A CA  1 
ATOM   604  C  C   . GLY A 1 85  ? 21.650  -13.931 -1.769  1.00 25.02  ? 85  GLY A C   1 
ATOM   605  O  O   . GLY A 1 85  ? 22.582  -13.130 -1.863  1.00 23.69  ? 85  GLY A O   1 
ATOM   606  N  N   . LYS A 1 86  ? 21.110  -14.530 -2.834  1.00 22.07  ? 86  LYS A N   1 
ATOM   607  C  CA  . LYS A 1 86  ? 21.640  -14.370 -4.201  1.00 21.95  ? 86  LYS A CA  1 
ATOM   608  C  C   . LYS A 1 86  ? 20.711  -13.601 -5.189  1.00 24.70  ? 86  LYS A C   1 
ATOM   609  O  O   . LYS A 1 86  ? 20.487  -12.398 -5.033  1.00 25.10  ? 86  LYS A O   1 
ATOM   610  C  CB  . LYS A 1 86  ? 22.023  -15.750 -4.782  1.00 25.02  ? 86  LYS A CB  1 
ATOM   611  C  CG  . LYS A 1 86  ? 22.761  -16.686 -3.824  1.00 40.03  ? 86  LYS A CG  1 
ATOM   612  C  CD  . LYS A 1 86  ? 24.255  -16.652 -4.009  1.00 46.43  ? 86  LYS A CD  1 
ATOM   613  C  CE  . LYS A 1 86  ? 24.951  -17.487 -2.964  1.00 61.04  ? 86  LYS A CE  1 
ATOM   614  N  NZ  . LYS A 1 86  ? 26.402  -17.639 -3.260  1.00 72.63  ? 86  LYS A NZ  1 
ATOM   615  N  N   . HIS A 1 87  ? 20.241  -14.299 -6.232  1.00 19.30  ? 87  HIS A N   1 
ATOM   616  C  CA  . HIS A 1 87  ? 19.361  -13.820 -7.298  1.00 18.86  ? 87  HIS A CA  1 
ATOM   617  C  C   . HIS A 1 87  ? 17.986  -13.406 -6.740  1.00 24.73  ? 87  HIS A C   1 
ATOM   618  O  O   . HIS A 1 87  ? 17.563  -12.257 -6.931  1.00 25.93  ? 87  HIS A O   1 
ATOM   619  C  CB  . HIS A 1 87  ? 19.214  -14.914 -8.368  1.00 19.16  ? 87  HIS A CB  1 
ATOM   620  C  CG  . HIS A 1 87  ? 20.508  -15.296 -9.019  1.00 22.72  ? 87  HIS A CG  1 
ATOM   621  N  ND1 . HIS A 1 87  ? 21.215  -16.424 -8.619  1.00 25.00  ? 87  HIS A ND1 1 
ATOM   622  C  CD2 . HIS A 1 87  ? 21.186  -14.687 -10.024 1.00 24.36  ? 87  HIS A CD2 1 
ATOM   623  C  CE1 . HIS A 1 87  ? 22.293  -16.468 -9.394  1.00 24.28  ? 87  HIS A CE1 1 
ATOM   624  N  NE2 . HIS A 1 87  ? 22.324  -15.443 -10.251 1.00 24.37  ? 87  HIS A NE2 1 
ATOM   625  N  N   . GLY A 1 88  ? 17.331  -14.319 -6.013  1.00 19.76  ? 88  GLY A N   1 
ATOM   626  C  CA  . GLY A 1 88  ? 16.043  -14.028 -5.399  1.00 19.49  ? 88  GLY A CA  1 
ATOM   627  C  C   . GLY A 1 88  ? 15.194  -15.237 -5.087  1.00 23.96  ? 88  GLY A C   1 
ATOM   628  O  O   . GLY A 1 88  ? 14.922  -16.064 -5.965  1.00 24.65  ? 88  GLY A O   1 
ATOM   629  N  N   . LYS A 1 89  ? 14.806  -15.353 -3.814  1.00 19.44  ? 89  LYS A N   1 
ATOM   630  C  CA  . LYS A 1 89  ? 13.941  -16.415 -3.321  1.00 19.23  ? 89  LYS A CA  1 
ATOM   631  C  C   . LYS A 1 89  ? 12.960  -15.835 -2.311  1.00 23.14  ? 89  LYS A C   1 
ATOM   632  O  O   . LYS A 1 89  ? 13.329  -14.989 -1.498  1.00 22.23  ? 89  LYS A O   1 
ATOM   633  C  CB  . LYS A 1 89  ? 14.734  -17.594 -2.722  1.00 21.46  ? 89  LYS A CB  1 
ATOM   634  C  CG  . LYS A 1 89  ? 13.845  -18.821 -2.455  1.00 24.42  ? 89  LYS A CG  1 
ATOM   635  C  CD  . LYS A 1 89  ? 14.547  -19.856 -1.634  1.00 30.65  ? 89  LYS A CD  1 
ATOM   636  C  CE  . LYS A 1 89  ? 13.676  -21.069 -1.440  1.00 39.44  ? 89  LYS A CE  1 
ATOM   637  N  NZ  . LYS A 1 89  ? 14.296  -22.037 -0.493  1.00 52.24  ? 89  LYS A NZ  1 
ATOM   638  N  N   . LYS A 1 90  ? 11.707  -16.282 -2.404  1.00 20.53  ? 90  LYS A N   1 
ATOM   639  C  CA  . LYS A 1 90  ? 10.598  -15.888 -1.567  1.00 20.92  ? 90  LYS A CA  1 
ATOM   640  C  C   . LYS A 1 90  ? 10.518  -16.883 -0.396  1.00 27.36  ? 90  LYS A C   1 
ATOM   641  O  O   . LYS A 1 90  ? 10.052  -18.016 -0.550  1.00 29.39  ? 90  LYS A O   1 
ATOM   642  C  CB  . LYS A 1 90  ? 9.320   -15.863 -2.419  1.00 23.48  ? 90  LYS A CB  1 
ATOM   643  C  CG  . LYS A 1 90  ? 8.133   -15.156 -1.779  1.00 30.82  ? 90  LYS A CG  1 
ATOM   644  C  CD  . LYS A 1 90  ? 6.834   -15.803 -2.221  1.00 33.91  ? 90  LYS A CD  1 
ATOM   645  C  CE  . LYS A 1 90  ? 6.037   -14.915 -3.125  1.00 52.54  ? 90  LYS A CE  1 
ATOM   646  N  NZ  . LYS A 1 90  ? 4.576   -15.107 -2.917  1.00 68.99  ? 90  LYS A NZ  1 
ATOM   647  N  N   . VAL A 1 91  ? 11.050  -16.474 0.751   1.00 23.50  ? 91  VAL A N   1 
ATOM   648  C  CA  . VAL A 1 91  ? 11.101  -17.270 1.979   1.00 23.74  ? 91  VAL A CA  1 
ATOM   649  C  C   . VAL A 1 91  ? 10.067  -16.672 2.936   1.00 29.04  ? 91  VAL A C   1 
ATOM   650  O  O   . VAL A 1 91  ? 10.180  -15.490 3.289   1.00 27.54  ? 91  VAL A O   1 
ATOM   651  C  CB  . VAL A 1 91  ? 12.539  -17.255 2.597   1.00 26.90  ? 91  VAL A CB  1 
ATOM   652  C  CG1 . VAL A 1 91  ? 12.627  -18.165 3.817   1.00 26.01  ? 91  VAL A CG1 1 
ATOM   653  C  CG2 . VAL A 1 91  ? 13.603  -17.624 1.559   1.00 26.23  ? 91  VAL A CG2 1 
ATOM   654  N  N   . ASN A 1 92  ? 9.032   -17.473 3.312   1.00 27.86  ? 92  ASN A N   1 
ATOM   655  C  CA  . ASN A 1 92  ? 7.932   -17.052 4.216   1.00 27.95  ? 92  ASN A CA  1 
ATOM   656  C  C   . ASN A 1 92  ? 7.220   -15.809 3.707   1.00 31.52  ? 92  ASN A C   1 
ATOM   657  O  O   . ASN A 1 92  ? 6.951   -14.882 4.478   1.00 30.61  ? 92  ASN A O   1 
ATOM   658  C  CB  . ASN A 1 92  ? 8.423   -16.852 5.667   1.00 27.39  ? 92  ASN A CB  1 
ATOM   659  C  CG  . ASN A 1 92  ? 9.031   -18.092 6.256   1.00 42.10  ? 92  ASN A CG  1 
ATOM   660  O  OD1 . ASN A 1 92  ? 8.379   -19.132 6.373   1.00 26.42  ? 92  ASN A OD1 1 
ATOM   661  N  ND2 . ASN A 1 92  ? 10.313  -18.016 6.585   1.00 33.60  ? 92  ASN A ND2 1 
ATOM   662  N  N   . ASN A 1 93  ? 6.963   -15.784 2.380   1.00 28.61  ? 93  ASN A N   1 
ATOM   663  C  CA  . ASN A 1 93  ? 6.310   -14.694 1.647   1.00 28.41  ? 93  ASN A CA  1 
ATOM   664  C  C   . ASN A 1 93  ? 7.115   -13.356 1.676   1.00 32.12  ? 93  ASN A C   1 
ATOM   665  O  O   . ASN A 1 93  ? 6.549   -12.286 1.439   1.00 32.95  ? 93  ASN A O   1 
ATOM   666  C  CB  . ASN A 1 93  ? 4.857   -14.525 2.144   1.00 28.73  ? 93  ASN A CB  1 
ATOM   667  C  CG  . ASN A 1 93  ? 3.950   -13.877 1.146   1.00 47.22  ? 93  ASN A CG  1 
ATOM   668  O  OD1 . ASN A 1 93  ? 3.726   -14.398 0.049   1.00 50.24  ? 93  ASN A OD1 1 
ATOM   669  N  ND2 . ASN A 1 93  ? 3.451   -12.704 1.495   1.00 31.72  ? 93  ASN A ND2 1 
ATOM   670  N  N   . VAL A 1 94  ? 8.441   -13.437 1.928   1.00 27.94  ? 94  VAL A N   1 
ATOM   671  C  CA  . VAL A 1 94  ? 9.409   -12.316 1.971   1.00 26.77  ? 94  VAL A CA  1 
ATOM   672  C  C   . VAL A 1 94  ? 10.532  -12.641 0.956   1.00 30.99  ? 94  VAL A C   1 
ATOM   673  O  O   . VAL A 1 94  ? 11.097  -13.744 0.971   1.00 30.36  ? 94  VAL A O   1 
ATOM   674  C  CB  . VAL A 1 94  ? 9.989   -12.087 3.409   1.00 30.12  ? 94  VAL A CB  1 
ATOM   675  C  CG1 . VAL A 1 94  ? 10.947  -10.893 3.451   1.00 29.64  ? 94  VAL A CG1 1 
ATOM   676  C  CG2 . VAL A 1 94  ? 8.879   -11.927 4.463   1.00 29.47  ? 94  VAL A CG2 1 
ATOM   677  N  N   . TRP A 1 95  ? 10.876  -11.667 0.100   1.00 26.02  ? 95  TRP A N   1 
ATOM   678  C  CA  . TRP A 1 95  ? 11.891  -11.844 -0.940  1.00 22.54  ? 95  TRP A CA  1 
ATOM   679  C  C   . TRP A 1 95  ? 13.281  -11.434 -0.482  1.00 24.98  ? 95  TRP A C   1 
ATOM   680  O  O   . TRP A 1 95  ? 13.457  -10.329 0.029   1.00 26.94  ? 95  TRP A O   1 
ATOM   681  C  CB  . TRP A 1 95  ? 11.516  -11.036 -2.197  1.00 19.04  ? 95  TRP A CB  1 
ATOM   682  C  CG  . TRP A 1 95  ? 10.458  -11.647 -3.064  1.00 18.59  ? 95  TRP A CG  1 
ATOM   683  C  CD1 . TRP A 1 95  ? 9.146   -11.284 -3.130  1.00 21.09  ? 95  TRP A CD1 1 
ATOM   684  C  CD2 . TRP A 1 95  ? 10.652  -12.636 -4.093  1.00 18.00  ? 95  TRP A CD2 1 
ATOM   685  N  NE1 . TRP A 1 95  ? 8.495   -12.026 -4.091  1.00 19.64  ? 95  TRP A NE1 1 
ATOM   686  C  CE2 . TRP A 1 95  ? 9.398   -12.856 -4.704  1.00 21.05  ? 95  TRP A CE2 1 
ATOM   687  C  CE3 . TRP A 1 95  ? 11.767  -13.367 -4.551  1.00 18.28  ? 95  TRP A CE3 1 
ATOM   688  C  CZ2 . TRP A 1 95  ? 9.221   -13.797 -5.728  1.00 20.15  ? 95  TRP A CZ2 1 
ATOM   689  C  CZ3 . TRP A 1 95  ? 11.594  -14.282 -5.575  1.00 18.70  ? 95  TRP A CZ3 1 
ATOM   690  C  CH2 . TRP A 1 95  ? 10.330  -14.506 -6.140  1.00 19.25  ? 95  TRP A CH2 1 
ATOM   691  N  N   . ASN A 1 96  ? 14.264  -12.322 -0.671  1.00 17.07  ? 96  ASN A N   1 
ATOM   692  C  CA  . ASN A 1 96  ? 15.680  -12.033 -0.445  1.00 15.30  ? 96  ASN A CA  1 
ATOM   693  C  C   . ASN A 1 96  ? 16.335  -11.780 -1.837  1.00 20.40  ? 96  ASN A C   1 
ATOM   694  O  O   . ASN A 1 96  ? 15.631  -11.629 -2.858  1.00 18.39  ? 96  ASN A O   1 
ATOM   695  C  CB  . ASN A 1 96  ? 16.388  -13.172 0.333   1.00 9.71   ? 96  ASN A CB  1 
ATOM   696  C  CG  . ASN A 1 96  ? 16.564  -14.540 -0.341  1.00 29.21  ? 96  ASN A CG  1 
ATOM   697  O  OD1 . ASN A 1 96  ? 16.513  -14.711 -1.577  1.00 23.04  ? 96  ASN A OD1 1 
ATOM   698  N  ND2 . ASN A 1 96  ? 16.938  -15.536 0.467   1.00 12.74  ? 96  ASN A ND2 1 
ATOM   699  N  N   . GLY A 1 97  ? 17.663  -11.765 -1.849  1.00 17.23  ? 97  GLY A N   1 
ATOM   700  C  CA  . GLY A 1 97  ? 18.467  -11.552 -3.035  1.00 17.33  ? 97  GLY A CA  1 
ATOM   701  C  C   . GLY A 1 97  ? 18.238  -10.218 -3.700  1.00 23.78  ? 97  GLY A C   1 
ATOM   702  O  O   . GLY A 1 97  ? 17.635  -9.315  -3.111  1.00 23.88  ? 97  GLY A O   1 
ATOM   703  N  N   . MET A 1 98  ? 18.685  -10.119 -4.964  1.00 22.15  ? 98  MET A N   1 
ATOM   704  C  CA  . MET A 1 98  ? 18.536  -8.931  -5.824  1.00 21.43  ? 98  MET A CA  1 
ATOM   705  C  C   . MET A 1 98  ? 17.069  -8.524  -5.977  1.00 24.11  ? 98  MET A C   1 
ATOM   706  O  O   . MET A 1 98  ? 16.774  -7.328  -5.960  1.00 23.99  ? 98  MET A O   1 
ATOM   707  C  CB  . MET A 1 98  ? 19.173  -9.166  -7.198  1.00 22.75  ? 98  MET A CB  1 
ATOM   708  C  CG  . MET A 1 98  ? 20.678  -9.172  -7.183  1.00 25.26  ? 98  MET A CG  1 
ATOM   709  S  SD  . MET A 1 98  ? 21.331  -9.073  -8.877  1.00 30.12  ? 98  MET A SD  1 
ATOM   710  C  CE  . MET A 1 98  ? 21.107  -10.826 -9.447  1.00 26.46  ? 98  MET A CE  1 
ATOM   711  N  N   . ILE A 1 99  ? 16.154  -9.518  -6.095  1.00 20.43  ? 99  ILE A N   1 
ATOM   712  C  CA  . ILE A 1 99  ? 14.708  -9.288  -6.186  1.00 20.88  ? 99  ILE A CA  1 
ATOM   713  C  C   . ILE A 1 99  ? 14.246  -8.523  -4.937  1.00 24.18  ? 99  ILE A C   1 
ATOM   714  O  O   . ILE A 1 99  ? 13.705  -7.423  -5.067  1.00 24.31  ? 99  ILE A O   1 
ATOM   715  C  CB  . ILE A 1 99  ? 13.890  -10.598 -6.465  1.00 24.58  ? 99  ILE A CB  1 
ATOM   716  C  CG1 . ILE A 1 99  ? 14.265  -11.223 -7.827  1.00 24.96  ? 99  ILE A CG1 1 
ATOM   717  C  CG2 . ILE A 1 99  ? 12.351  -10.374 -6.359  1.00 25.38  ? 99  ILE A CG2 1 
ATOM   718  C  CD1 . ILE A 1 99  ? 13.846  -10.393 -9.137  1.00 29.93  ? 99  ILE A CD1 1 
ATOM   719  N  N   . GLY A 1 100 ? 14.588  -9.046  -3.762  1.00 20.71  ? 100 GLY A N   1 
ATOM   720  C  CA  . GLY A 1 100 ? 14.280  -8.419  -2.482  1.00 20.88  ? 100 GLY A CA  1 
ATOM   721  C  C   . GLY A 1 100 ? 14.797  -6.998  -2.329  1.00 24.55  ? 100 GLY A C   1 
ATOM   722  O  O   . GLY A 1 100 ? 14.078  -6.144  -1.798  1.00 25.42  ? 100 GLY A O   1 
ATOM   723  N  N   . GLU A 1 101 ? 16.029  -6.712  -2.832  1.00 18.42  ? 101 GLU A N   1 
ATOM   724  C  CA  . GLU A 1 101 ? 16.626  -5.367  -2.764  1.00 17.66  ? 101 GLU A CA  1 
ATOM   725  C  C   . GLU A 1 101 ? 15.809  -4.357  -3.554  1.00 23.53  ? 101 GLU A C   1 
ATOM   726  O  O   . GLU A 1 101 ? 15.782  -3.189  -3.188  1.00 23.41  ? 101 GLU A O   1 
ATOM   727  C  CB  . GLU A 1 101 ? 18.088  -5.352  -3.260  1.00 18.80  ? 101 GLU A CB  1 
ATOM   728  C  CG  . GLU A 1 101 ? 19.054  -6.185  -2.437  1.00 29.11  ? 101 GLU A CG  1 
ATOM   729  C  CD  . GLU A 1 101 ? 19.261  -5.748  -0.999  1.00 42.82  ? 101 GLU A CD  1 
ATOM   730  O  OE1 . GLU A 1 101 ? 19.587  -4.561  -0.770  1.00 33.54  ? 101 GLU A OE1 1 
ATOM   731  O  OE2 . GLU A 1 101 ? 19.125  -6.608  -0.101  1.00 40.16  ? 101 GLU A OE2 1 
ATOM   732  N  N   . VAL A 1 102 ? 15.142  -4.812  -4.634  1.00 21.62  ? 102 VAL A N   1 
ATOM   733  C  CA  . VAL A 1 102 ? 14.310  -3.980  -5.489  1.00 21.85  ? 102 VAL A CA  1 
ATOM   734  C  C   . VAL A 1 102 ? 12.895  -3.858  -4.895  1.00 27.35  ? 102 VAL A C   1 
ATOM   735  O  O   . VAL A 1 102 ? 12.382  -2.731  -4.793  1.00 27.94  ? 102 VAL A O   1 
ATOM   736  C  CB  . VAL A 1 102 ? 14.359  -4.460  -6.978  1.00 26.05  ? 102 VAL A CB  1 
ATOM   737  C  CG1 . VAL A 1 102 ? 13.291  -3.780  -7.835  1.00 25.56  ? 102 VAL A CG1 1 
ATOM   738  C  CG2 . VAL A 1 102 ? 15.751  -4.225  -7.585  1.00 25.70  ? 102 VAL A CG2 1 
ATOM   739  N  N   . VAL A 1 103 ? 12.285  -5.002  -4.465  1.00 23.39  ? 103 VAL A N   1 
ATOM   740  C  CA  . VAL A 1 103 ? 10.938  -5.064  -3.847  1.00 22.44  ? 103 VAL A CA  1 
ATOM   741  C  C   . VAL A 1 103 ? 10.844  -4.083  -2.642  1.00 25.28  ? 103 VAL A C   1 
ATOM   742  O  O   . VAL A 1 103 ? 9.913   -3.285  -2.564  1.00 23.59  ? 103 VAL A O   1 
ATOM   743  C  CB  . VAL A 1 103 ? 10.532  -6.522  -3.437  1.00 25.86  ? 103 VAL A CB  1 
ATOM   744  C  CG1 . VAL A 1 103 ? 9.202   -6.566  -2.669  1.00 25.62  ? 103 VAL A CG1 1 
ATOM   745  C  CG2 . VAL A 1 103 ? 10.464  -7.437  -4.640  1.00 25.67  ? 103 VAL A CG2 1 
ATOM   746  N  N   . TYR A 1 104 ? 11.839  -4.148  -1.742  1.00 23.02  ? 104 TYR A N   1 
ATOM   747  C  CA  . TYR A 1 104 ? 11.921  -3.370  -0.511  1.00 23.46  ? 104 TYR A CA  1 
ATOM   748  C  C   . TYR A 1 104 ? 12.669  -2.037  -0.694  1.00 28.48  ? 104 TYR A C   1 
ATOM   749  O  O   . TYR A 1 104 ? 13.056  -1.402  0.288   1.00 27.98  ? 104 TYR A O   1 
ATOM   750  C  CB  . TYR A 1 104 ? 12.477  -4.231  0.636   1.00 24.45  ? 104 TYR A CB  1 
ATOM   751  C  CG  . TYR A 1 104 ? 11.645  -5.485  0.815   1.00 27.71  ? 104 TYR A CG  1 
ATOM   752  C  CD1 . TYR A 1 104 ? 10.306  -5.410  1.201   1.00 31.23  ? 104 TYR A CD1 1 
ATOM   753  C  CD2 . TYR A 1 104 ? 12.158  -6.736  0.490   1.00 27.54  ? 104 TYR A CD2 1 
ATOM   754  C  CE1 . TYR A 1 104 ? 9.510   -6.554  1.284   1.00 34.62  ? 104 TYR A CE1 1 
ATOM   755  C  CE2 . TYR A 1 104 ? 11.380  -7.887  0.588   1.00 28.58  ? 104 TYR A CE2 1 
ATOM   756  C  CZ  . TYR A 1 104 ? 10.056  -7.793  0.984   1.00 41.78  ? 104 TYR A CZ  1 
ATOM   757  O  OH  . TYR A 1 104 ? 9.293   -8.933  1.078   1.00 46.72  ? 104 TYR A OH  1 
ATOM   758  N  N   . GLN A 1 105 ? 12.793  -1.597  -1.969  1.00 25.08  ? 105 GLN A N   1 
ATOM   759  C  CA  . GLN A 1 105 ? 13.318  -0.304  -2.419  1.00 25.15  ? 105 GLN A CA  1 
ATOM   760  C  C   . GLN A 1 105 ? 14.708  0.111   -1.873  1.00 28.29  ? 105 GLN A C   1 
ATOM   761  O  O   . GLN A 1 105 ? 14.972  1.306   -1.704  1.00 27.51  ? 105 GLN A O   1 
ATOM   762  C  CB  . GLN A 1 105 ? 12.286  0.791   -2.135  1.00 26.91  ? 105 GLN A CB  1 
ATOM   763  C  CG  . GLN A 1 105 ? 10.929  0.495   -2.785  1.00 39.08  ? 105 GLN A CG  1 
ATOM   764  C  CD  . GLN A 1 105 ? 9.875   1.478   -2.380  1.00 55.59  ? 105 GLN A CD  1 
ATOM   765  O  OE1 . GLN A 1 105 ? 9.236   2.113   -3.224  1.00 59.25  ? 105 GLN A OE1 1 
ATOM   766  N  NE2 . GLN A 1 105 ? 9.660   1.614   -1.083  1.00 33.58  ? 105 GLN A NE2 1 
ATOM   767  N  N   . ARG A 1 106 ? 15.616  -0.865  -1.699  1.00 24.08  ? 106 ARG A N   1 
ATOM   768  C  CA  . ARG A 1 106 ? 17.000  -0.601  -1.310  1.00 24.08  ? 106 ARG A CA  1 
ATOM   769  C  C   . ARG A 1 106 ? 17.779  -0.360  -2.611  1.00 27.93  ? 106 ARG A C   1 
ATOM   770  O  O   . ARG A 1 106 ? 18.882  0.193   -2.579  1.00 27.50  ? 106 ARG A O   1 
ATOM   771  C  CB  . ARG A 1 106 ? 17.591  -1.769  -0.492  1.00 24.90  ? 106 ARG A CB  1 
ATOM   772  C  CG  . ARG A 1 106 ? 16.776  -2.086  0.757   1.00 34.77  ? 106 ARG A CG  1 
ATOM   773  C  CD  . ARG A 1 106 ? 17.422  -3.148  1.615   1.00 51.64  ? 106 ARG A CD  1 
ATOM   774  N  NE  . ARG A 1 106 ? 16.771  -4.462  1.511   1.00 59.81  ? 106 ARG A NE  1 
ATOM   775  C  CZ  . ARG A 1 106 ? 15.854  -4.928  2.357   1.00 71.27  ? 106 ARG A CZ  1 
ATOM   776  N  NH1 . ARG A 1 106 ? 15.420  -4.173  3.363   1.00 52.51  ? 106 ARG A NH1 1 
ATOM   777  N  NH2 . ARG A 1 106 ? 15.344  -6.141  2.190   1.00 58.94  ? 106 ARG A NH2 1 
ATOM   778  N  N   . ALA A 1 107 ? 17.182  -0.747  -3.771  1.00 23.28  ? 107 ALA A N   1 
ATOM   779  C  CA  . ALA A 1 107 ? 17.789  -0.525  -5.082  1.00 22.64  ? 107 ALA A CA  1 
ATOM   780  C  C   . ALA A 1 107 ? 16.782  -0.090  -6.125  1.00 26.65  ? 107 ALA A C   1 
ATOM   781  O  O   . ALA A 1 107 ? 15.636  -0.536  -6.100  1.00 26.37  ? 107 ALA A O   1 
ATOM   782  C  CB  . ALA A 1 107 ? 18.543  -1.751  -5.549  1.00 23.13  ? 107 ALA A CB  1 
ATOM   783  N  N   . VAL A 1 108 ? 17.209  0.812   -7.034  1.00 22.61  ? 108 VAL A N   1 
ATOM   784  C  CA  . VAL A 1 108 ? 16.383  1.288   -8.138  1.00 21.67  ? 108 VAL A CA  1 
ATOM   785  C  C   . VAL A 1 108 ? 16.322  0.150   -9.169  1.00 25.04  ? 108 VAL A C   1 
ATOM   786  O  O   . VAL A 1 108 ? 15.261  -0.089  -9.778  1.00 23.73  ? 108 VAL A O   1 
ATOM   787  C  CB  . VAL A 1 108 ? 16.913  2.617   -8.748  1.00 25.22  ? 108 VAL A CB  1 
ATOM   788  C  CG1 . VAL A 1 108 ? 16.029  3.098   -9.889  1.00 24.53  ? 108 VAL A CG1 1 
ATOM   789  C  CG2 . VAL A 1 108 ? 17.020  3.695   -7.687  1.00 25.35  ? 108 VAL A CG2 1 
ATOM   790  N  N   . MET A 1 109 ? 17.463  -0.552  -9.372  1.00 20.91  ? 109 MET A N   1 
ATOM   791  C  CA  . MET A 1 109 ? 17.472  -1.656  -10.327 1.00 21.36  ? 109 MET A CA  1 
ATOM   792  C  C   . MET A 1 109 ? 18.477  -2.769  -9.968  1.00 22.46  ? 109 MET A C   1 
ATOM   793  O  O   . MET A 1 109 ? 19.364  -2.576  -9.150  1.00 19.66  ? 109 MET A O   1 
ATOM   794  C  CB  . MET A 1 109 ? 17.616  -1.187  -11.802 1.00 24.53  ? 109 MET A CB  1 
ATOM   795  C  CG  . MET A 1 109 ? 18.811  -0.349  -12.097 1.00 30.94  ? 109 MET A CG  1 
ATOM   796  S  SD  . MET A 1 109 ? 18.795  0.402   -13.764 1.00 37.39  ? 109 MET A SD  1 
ATOM   797  C  CE  . MET A 1 109 ? 17.767  1.791   -13.479 1.00 33.72  ? 109 MET A CE  1 
ATOM   798  N  N   . ALA A 1 110 ? 18.261  -3.954  -10.535 1.00 21.23  ? 110 ALA A N   1 
ATOM   799  C  CA  . ALA A 1 110 ? 19.100  -5.131  -10.342 1.00 22.44  ? 110 ALA A CA  1 
ATOM   800  C  C   . ALA A 1 110 ? 19.668  -5.509  -11.683 1.00 27.12  ? 110 ALA A C   1 
ATOM   801  O  O   . ALA A 1 110 ? 18.923  -5.654  -12.650 1.00 28.20  ? 110 ALA A O   1 
ATOM   802  C  CB  . ALA A 1 110 ? 18.286  -6.291  -9.760  1.00 23.28  ? 110 ALA A CB  1 
ATOM   803  N  N   . VAL A 1 111 ? 20.976  -5.622  -11.765 1.00 25.12  ? 111 VAL A N   1 
ATOM   804  C  CA  . VAL A 1 111 ? 21.600  -5.990  -13.030 1.00 27.50  ? 111 VAL A CA  1 
ATOM   805  C  C   . VAL A 1 111 ? 22.501  -7.223  -12.821 1.00 31.71  ? 111 VAL A C   1 
ATOM   806  O  O   . VAL A 1 111 ? 23.308  -7.250  -11.896 1.00 32.98  ? 111 VAL A O   1 
ATOM   807  C  CB  . VAL A 1 111 ? 22.294  -4.782  -13.744 1.00 33.20  ? 111 VAL A CB  1 
ATOM   808  C  CG1 . VAL A 1 111 ? 23.483  -4.252  -12.956 1.00 33.32  ? 111 VAL A CG1 1 
ATOM   809  C  CG2 . VAL A 1 111 ? 22.712  -5.134  -15.166 1.00 33.81  ? 111 VAL A CG2 1 
ATOM   810  N  N   . GLY A 1 112 ? 22.311  -8.243  -13.642 1.00 26.04  ? 112 GLY A N   1 
ATOM   811  C  CA  . GLY A 1 112 ? 23.091  -9.472  -13.546 1.00 24.78  ? 112 GLY A CA  1 
ATOM   812  C  C   . GLY A 1 112 ? 22.467  -10.631 -14.287 1.00 27.94  ? 112 GLY A C   1 
ATOM   813  O  O   . GLY A 1 112 ? 21.654  -10.442 -15.206 1.00 28.66  ? 112 GLY A O   1 
ATOM   814  N  N   . SER A 1 113 ? 22.835  -11.839 -13.882 1.00 22.43  ? 113 SER A N   1 
ATOM   815  C  CA  . SER A 1 113 ? 22.339  -13.079 -14.474 1.00 20.07  ? 113 SER A CA  1 
ATOM   816  C  C   . SER A 1 113 ? 20.988  -13.437 -13.789 1.00 20.75  ? 113 SER A C   1 
ATOM   817  O  O   . SER A 1 113 ? 20.796  -14.530 -13.233 1.00 19.45  ? 113 SER A O   1 
ATOM   818  C  CB  . SER A 1 113 ? 23.398  -14.178 -14.367 1.00 20.48  ? 113 SER A CB  1 
ATOM   819  O  OG  . SER A 1 113 ? 23.710  -14.511 -13.024 1.00 25.40  ? 113 SER A OG  1 
ATOM   820  N  N   . LEU A 1 114 ? 20.066  -12.462 -13.830 1.00 15.48  ? 114 LEU A N   1 
ATOM   821  C  CA  . LEU A 1 114 ? 18.759  -12.501 -13.189 1.00 14.76  ? 114 LEU A CA  1 
ATOM   822  C  C   . LEU A 1 114 ? 17.642  -12.970 -14.107 1.00 19.56  ? 114 LEU A C   1 
ATOM   823  O  O   . LEU A 1 114 ? 17.149  -12.202 -14.929 1.00 20.36  ? 114 LEU A O   1 
ATOM   824  C  CB  . LEU A 1 114 ? 18.451  -11.128 -12.565 1.00 14.16  ? 114 LEU A CB  1 
ATOM   825  C  CG  . LEU A 1 114 ? 17.124  -11.017 -11.750 1.00 18.54  ? 114 LEU A CG  1 
ATOM   826  C  CD1 . LEU A 1 114 ? 17.115  -11.973 -10.540 1.00 17.34  ? 114 LEU A CD1 1 
ATOM   827  C  CD2 . LEU A 1 114 ? 16.930  -9.590  -11.267 1.00 19.51  ? 114 LEU A CD2 1 
ATOM   828  N  N   . THR A 1 115 ? 17.220  -14.226 -13.927 1.00 16.06  ? 115 THR A N   1 
ATOM   829  C  CA  . THR A 1 115 ? 16.186  -14.872 -14.732 1.00 15.42  ? 115 THR A CA  1 
ATOM   830  C  C   . THR A 1 115 ? 14.791  -14.261 -14.539 1.00 18.62  ? 115 THR A C   1 
ATOM   831  O  O   . THR A 1 115 ? 14.329  -14.075 -13.409 1.00 17.75  ? 115 THR A O   1 
ATOM   832  C  CB  . THR A 1 115 ? 16.203  -16.386 -14.475 1.00 17.42  ? 115 THR A CB  1 
ATOM   833  O  OG1 . THR A 1 115 ? 17.458  -16.906 -14.892 1.00 23.70  ? 115 THR A OG1 1 
ATOM   834  C  CG2 . THR A 1 115 ? 15.115  -17.122 -15.226 1.00 9.58   ? 115 THR A CG2 1 
ATOM   835  N  N   . ILE A 1 116 ? 14.115  -14.008 -15.666 1.00 14.61  ? 116 ILE A N   1 
ATOM   836  C  CA  . ILE A 1 116 ? 12.753  -13.493 -15.703 1.00 13.59  ? 116 ILE A CA  1 
ATOM   837  C  C   . ILE A 1 116 ? 11.841  -14.685 -15.535 1.00 18.81  ? 116 ILE A C   1 
ATOM   838  O  O   . ILE A 1 116 ? 11.881  -15.618 -16.335 1.00 18.27  ? 116 ILE A O   1 
ATOM   839  C  CB  . ILE A 1 116 ? 12.409  -12.704 -17.029 1.00 14.90  ? 116 ILE A CB  1 
ATOM   840  C  CG1 . ILE A 1 116 ? 13.179  -11.390 -17.113 1.00 14.42  ? 116 ILE A CG1 1 
ATOM   841  C  CG2 . ILE A 1 116 ? 10.892  -12.452 -17.142 1.00 13.57  ? 116 ILE A CG2 1 
ATOM   842  C  CD1 . ILE A 1 116 ? 13.400  -10.811 -18.552 1.00 18.86  ? 116 ILE A CD1 1 
ATOM   843  N  N   . ASN A 1 117 ? 11.014  -14.655 -14.504 1.00 16.34  ? 117 ASN A N   1 
ATOM   844  C  CA  . ASN A 1 117 ? 10.021  -15.697 -14.322 1.00 15.88  ? 117 ASN A CA  1 
ATOM   845  C  C   . ASN A 1 117 ? 8.702   -15.073 -13.857 1.00 19.47  ? 117 ASN A C   1 
ATOM   846  O  O   . ASN A 1 117 ? 8.657   -13.872 -13.550 1.00 16.74  ? 117 ASN A O   1 
ATOM   847  C  CB  . ASN A 1 117 ? 10.531  -16.870 -13.451 1.00 14.27  ? 117 ASN A CB  1 
ATOM   848  C  CG  . ASN A 1 117 ? 10.789  -16.585 -12.003 1.00 29.78  ? 117 ASN A CG  1 
ATOM   849  O  OD1 . ASN A 1 117 ? 10.159  -15.745 -11.372 1.00 26.53  ? 117 ASN A OD1 1 
ATOM   850  N  ND2 . ASN A 1 117 ? 11.647  -17.379 -11.412 1.00 24.12  ? 117 ASN A ND2 1 
ATOM   851  N  N   . GLU A 1 118 ? 7.636   -15.878 -13.815 1.00 19.49  ? 118 GLU A N   1 
ATOM   852  C  CA  . GLU A 1 118 ? 6.297   -15.403 -13.462 1.00 20.03  ? 118 GLU A CA  1 
ATOM   853  C  C   . GLU A 1 118 ? 6.184   -14.888 -12.019 1.00 25.21  ? 118 GLU A C   1 
ATOM   854  O  O   . GLU A 1 118 ? 5.667   -13.777 -11.832 1.00 23.70  ? 118 GLU A O   1 
ATOM   855  C  CB  . GLU A 1 118 ? 5.233   -16.469 -13.777 1.00 20.87  ? 118 GLU A CB  1 
ATOM   856  C  CG  . GLU A 1 118 ? 3.813   -16.049 -13.444 1.00 33.28  ? 118 GLU A CG  1 
ATOM   857  C  CD  . GLU A 1 118 ? 2.797   -17.166 -13.296 1.00 69.80  ? 118 GLU A CD  1 
ATOM   858  O  OE1 . GLU A 1 118 ? 1.643   -16.859 -12.922 1.00 75.17  ? 118 GLU A OE1 1 
ATOM   859  O  OE2 . GLU A 1 118 ? 3.147   -18.343 -13.547 1.00 73.34  ? 118 GLU A OE2 1 
ATOM   860  N  N   . GLU A 1 119 ? 6.667   -15.659 -11.010 1.00 23.80  ? 119 GLU A N   1 
ATOM   861  C  CA  . GLU A 1 119 ? 6.499   -15.211 -9.612  1.00 24.27  ? 119 GLU A CA  1 
ATOM   862  C  C   . GLU A 1 119 ? 7.267   -13.907 -9.295  1.00 29.14  ? 119 GLU A C   1 
ATOM   863  O  O   . GLU A 1 119 ? 6.738   -13.057 -8.569  1.00 28.91  ? 119 GLU A O   1 
ATOM   864  C  CB  . GLU A 1 119 ? 6.771   -16.306 -8.573  1.00 25.24  ? 119 GLU A CB  1 
ATOM   865  C  CG  . GLU A 1 119 ? 8.195   -16.818 -8.545  1.00 39.01  ? 119 GLU A CG  1 
ATOM   866  C  CD  . GLU A 1 119 ? 8.645   -17.483 -7.261  1.00 57.84  ? 119 GLU A CD  1 
ATOM   867  O  OE1 . GLU A 1 119 ? 7.795   -17.803 -6.396  1.00 46.94  ? 119 GLU A OE1 1 
ATOM   868  O  OE2 . GLU A 1 119 ? 9.870   -17.702 -7.134  1.00 49.81  ? 119 GLU A OE2 1 
ATOM   869  N  N   . ARG A 1 120 ? 8.455   -13.721 -9.890  1.00 25.32  ? 120 ARG A N   1 
ATOM   870  C  CA  . ARG A 1 120 ? 9.251   -12.503 -9.703  1.00 24.16  ? 120 ARG A CA  1 
ATOM   871  C  C   . ARG A 1 120 ? 8.583   -11.331 -10.411 1.00 27.09  ? 120 ARG A C   1 
ATOM   872  O  O   . ARG A 1 120 ? 8.635   -10.216 -9.891  1.00 27.05  ? 120 ARG A O   1 
ATOM   873  C  CB  . ARG A 1 120 ? 10.673  -12.696 -10.239 1.00 21.91  ? 120 ARG A CB  1 
ATOM   874  C  CG  . ARG A 1 120 ? 11.533  -13.607 -9.379  1.00 14.88  ? 120 ARG A CG  1 
ATOM   875  C  CD  . ARG A 1 120 ? 12.791  -14.012 -10.115 1.00 7.97   ? 120 ARG A CD  1 
ATOM   876  N  NE  . ARG A 1 120 ? 13.638  -14.872 -9.282  1.00 11.46  ? 120 ARG A NE  1 
ATOM   877  C  CZ  . ARG A 1 120 ? 14.851  -15.301 -9.620  1.00 24.65  ? 120 ARG A CZ  1 
ATOM   878  N  NH1 . ARG A 1 120 ? 15.375  -14.980 -10.801 1.00 17.25  ? 120 ARG A NH1 1 
ATOM   879  N  NH2 . ARG A 1 120 ? 15.535  -16.080 -8.798  1.00 14.15  ? 120 ARG A NH2 1 
ATOM   880  N  N   . SER A 1 121 ? 7.946   -11.577 -11.596 1.00 21.57  ? 121 SER A N   1 
ATOM   881  C  CA  . SER A 1 121 ? 7.264   -10.529 -12.376 1.00 20.64  ? 121 SER A CA  1 
ATOM   882  C  C   . SER A 1 121 ? 5.976   -9.995  -11.718 1.00 25.73  ? 121 SER A C   1 
ATOM   883  O  O   . SER A 1 121 ? 5.456   -8.943  -12.116 1.00 25.29  ? 121 SER A O   1 
ATOM   884  C  CB  . SER A 1 121 ? 7.001   -10.994 -13.800 1.00 23.00  ? 121 SER A CB  1 
ATOM   885  O  OG  . SER A 1 121 ? 8.224   -11.356 -14.420 1.00 27.29  ? 121 SER A OG  1 
ATOM   886  N  N   . GLU A 1 122 ? 5.496   -10.681 -10.679 1.00 22.76  ? 122 GLU A N   1 
ATOM   887  C  CA  . GLU A 1 122 ? 4.343   -10.230 -9.904  1.00 22.32  ? 122 GLU A CA  1 
ATOM   888  C  C   . GLU A 1 122 ? 4.749   -9.130  -8.911  1.00 25.20  ? 122 GLU A C   1 
ATOM   889  O  O   . GLU A 1 122 ? 3.902   -8.321  -8.533  1.00 26.79  ? 122 GLU A O   1 
ATOM   890  C  CB  . GLU A 1 122 ? 3.722   -11.399 -9.131  1.00 23.43  ? 122 GLU A CB  1 
ATOM   891  C  CG  . GLU A 1 122 ? 2.928   -12.364 -9.997  1.00 29.01  ? 122 GLU A CG  1 
ATOM   892  C  CD  . GLU A 1 122 ? 2.415   -13.609 -9.296  1.00 53.24  ? 122 GLU A CD  1 
ATOM   893  O  OE1 . GLU A 1 122 ? 2.731   -13.811 -8.100  1.00 58.29  ? 122 GLU A OE1 1 
ATOM   894  O  OE2 . GLU A 1 122 ? 1.717   -14.405 -9.963  1.00 51.51  ? 122 GLU A OE2 1 
ATOM   895  N  N   . VAL A 1 123 ? 6.041   -9.082  -8.515  1.00 17.84  ? 123 VAL A N   1 
ATOM   896  C  CA  . VAL A 1 123 ? 6.548   -8.168  -7.480  1.00 16.57  ? 123 VAL A CA  1 
ATOM   897  C  C   . VAL A 1 123 ? 7.532   -7.083  -7.962  1.00 23.07  ? 123 VAL A C   1 
ATOM   898  O  O   . VAL A 1 123 ? 7.752   -6.112  -7.239  1.00 24.14  ? 123 VAL A O   1 
ATOM   899  C  CB  . VAL A 1 123 ? 7.158   -8.970  -6.295  1.00 17.90  ? 123 VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 123 ? 6.112   -9.879  -5.667  1.00 16.50  ? 123 VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 123 ? 8.399   -9.766  -6.723  1.00 16.59  ? 123 VAL A CG2 1 
ATOM   902  N  N   . VAL A 1 124 ? 8.173   -7.281  -9.121  1.00 19.97  ? 124 VAL A N   1 
ATOM   903  C  CA  . VAL A 1 124 ? 9.097   -6.321  -9.725  1.00 19.34  ? 124 VAL A CA  1 
ATOM   904  C  C   . VAL A 1 124 ? 8.715   -6.190  -11.193 1.00 25.02  ? 124 VAL A C   1 
ATOM   905  O  O   . VAL A 1 124 ? 8.060   -7.088  -11.730 1.00 26.01  ? 124 VAL A O   1 
ATOM   906  C  CB  . VAL A 1 124 ? 10.616  -6.710  -9.570  1.00 21.90  ? 124 VAL A CB  1 
ATOM   907  C  CG1 . VAL A 1 124 ? 11.028  -6.890  -8.113  1.00 20.58  ? 124 VAL A CG1 1 
ATOM   908  C  CG2 . VAL A 1 124 ? 11.004  -7.940  -10.410 1.00 21.21  ? 124 VAL A CG2 1 
ATOM   909  N  N   . ASP A 1 125 ? 9.198   -5.133  -11.868 1.00 21.70  ? 125 ASP A N   1 
ATOM   910  C  CA  . ASP A 1 125 ? 9.044   -4.977  -13.314 1.00 20.97  ? 125 ASP A CA  1 
ATOM   911  C  C   . ASP A 1 125 ? 10.353  -5.384  -13.993 1.00 23.62  ? 125 ASP A C   1 
ATOM   912  O  O   . ASP A 1 125 ? 11.424  -5.031  -13.515 1.00 24.29  ? 125 ASP A O   1 
ATOM   913  C  CB  . ASP A 1 125 ? 8.664   -3.538  -13.699 1.00 23.36  ? 125 ASP A CB  1 
ATOM   914  C  CG  . ASP A 1 125 ? 7.169   -3.254  -13.638 1.00 39.06  ? 125 ASP A CG  1 
ATOM   915  O  OD1 . ASP A 1 125 ? 6.376   -4.224  -13.664 1.00 43.07  ? 125 ASP A OD1 1 
ATOM   916  O  OD2 . ASP A 1 125 ? 6.790   -2.062  -13.544 1.00 42.78  ? 125 ASP A OD2 1 
ATOM   917  N  N   . PHE A 1 126 ? 10.280  -6.175  -15.058 1.00 18.90  ? 126 PHE A N   1 
ATOM   918  C  CA  . PHE A 1 126 ? 11.479  -6.568  -15.803 1.00 17.43  ? 126 PHE A CA  1 
ATOM   919  C  C   . PHE A 1 126 ? 11.491  -5.860  -17.121 1.00 22.91  ? 126 PHE A C   1 
ATOM   920  O  O   . PHE A 1 126 ? 10.452  -5.736  -17.784 1.00 23.39  ? 126 PHE A O   1 
ATOM   921  C  CB  . PHE A 1 126 ? 11.574  -8.089  -16.064 1.00 17.82  ? 126 PHE A CB  1 
ATOM   922  C  CG  . PHE A 1 126 ? 11.958  -8.942  -14.876 1.00 18.79  ? 126 PHE A CG  1 
ATOM   923  C  CD1 . PHE A 1 126 ? 13.282  -8.999  -14.433 1.00 19.80  ? 126 PHE A CD1 1 
ATOM   924  C  CD2 . PHE A 1 126 ? 11.009  -9.729  -14.230 1.00 19.54  ? 126 PHE A CD2 1 
ATOM   925  C  CE1 . PHE A 1 126 ? 13.641  -9.796  -13.350 1.00 19.22  ? 126 PHE A CE1 1 
ATOM   926  C  CE2 . PHE A 1 126 ? 11.367  -10.525 -13.140 1.00 21.89  ? 126 PHE A CE2 1 
ATOM   927  C  CZ  . PHE A 1 126 ? 12.685  -10.552 -12.709 1.00 20.17  ? 126 PHE A CZ  1 
ATOM   928  N  N   . SER A 1 127 ? 12.694  -5.456  -17.538 1.00 19.32  ? 127 SER A N   1 
ATOM   929  C  CA  . SER A 1 127 ? 12.968  -4.882  -18.843 1.00 18.37  ? 127 SER A CA  1 
ATOM   930  C  C   . SER A 1 127 ? 12.786  -6.003  -19.878 1.00 22.06  ? 127 SER A C   1 
ATOM   931  O  O   . SER A 1 127 ? 12.514  -7.166  -19.520 1.00 20.02  ? 127 SER A O   1 
ATOM   932  C  CB  . SER A 1 127 ? 14.421  -4.406  -18.902 1.00 20.84  ? 127 SER A CB  1 
ATOM   933  O  OG  . SER A 1 127 ? 15.314  -5.509  -18.996 1.00 24.08  ? 127 SER A OG  1 
ATOM   934  N  N   . VAL A 1 128 ? 13.029  -5.675  -21.161 1.00 19.60  ? 128 VAL A N   1 
ATOM   935  C  CA  . VAL A 1 128 ? 12.992  -6.694  -22.207 1.00 19.31  ? 128 VAL A CA  1 
ATOM   936  C  C   . VAL A 1 128 ? 14.161  -7.645  -21.917 1.00 21.95  ? 128 VAL A C   1 
ATOM   937  O  O   . VAL A 1 128 ? 15.185  -7.177  -21.391 1.00 19.52  ? 128 VAL A O   1 
ATOM   938  C  CB  . VAL A 1 128 ? 13.096  -6.084  -23.636 1.00 23.65  ? 128 VAL A CB  1 
ATOM   939  C  CG1 . VAL A 1 128 ? 11.829  -5.302  -23.986 1.00 24.19  ? 128 VAL A CG1 1 
ATOM   940  C  CG2 . VAL A 1 128 ? 14.356  -5.217  -23.807 1.00 22.59  ? 128 VAL A CG2 1 
ATOM   941  N  N   . PRO A 1 129 ? 14.079  -8.905  -22.268 1.00 19.68  ? 129 PRO A N   1 
ATOM   942  C  CA  . PRO A 1 129 ? 15.199  -9.788  -22.035 1.00 19.97  ? 129 PRO A CA  1 
ATOM   943  C  C   . PRO A 1 129 ? 16.382  -9.401  -22.885 1.00 26.47  ? 129 PRO A C   1 
ATOM   944  O  O   . PRO A 1 129 ? 16.192  -8.953  -23.940 1.00 26.66  ? 129 PRO A O   1 
ATOM   945  C  CB  . PRO A 1 129 ? 14.677  -11.151 -22.441 1.00 21.22  ? 129 PRO A CB  1 
ATOM   946  C  CG  . PRO A 1 129 ? 13.413  -10.915 -23.073 1.00 25.76  ? 129 PRO A CG  1 
ATOM   947  C  CD  . PRO A 1 129 ? 12.875  -9.651  -22.554 1.00 21.46  ? 129 PRO A CD  1 
ATOM   948  N  N   . PHE A 1 130 ? 17.592  -9.567  -22.402 1.00 24.67  ? 130 PHE A N   1 
ATOM   949  C  CA  . PHE A 1 130 ? 18.754  -9.189  -23.213 1.00 24.75  ? 130 PHE A CA  1 
ATOM   950  C  C   . PHE A 1 130 ? 19.715  -10.382 -23.422 1.00 26.70  ? 130 PHE A C   1 
ATOM   951  O  O   . PHE A 1 130 ? 20.694  -10.275 -24.148 1.00 26.08  ? 130 PHE A O   1 
ATOM   952  C  CB  . PHE A 1 130 ? 19.461  -7.925  -22.678 1.00 27.06  ? 130 PHE A CB  1 
ATOM   953  C  CG  . PHE A 1 130 ? 19.952  -8.035  -21.263 1.00 29.40  ? 130 PHE A CG  1 
ATOM   954  C  CD1 . PHE A 1 130 ? 21.213  -8.551  -20.987 1.00 33.91  ? 130 PHE A CD1 1 
ATOM   955  C  CD2 . PHE A 1 130 ? 19.162  -7.610  -20.201 1.00 32.34  ? 130 PHE A CD2 1 
ATOM   956  C  CE1 . PHE A 1 130 ? 21.658  -8.684  -19.666 1.00 36.08  ? 130 PHE A CE1 1 
ATOM   957  C  CE2 . PHE A 1 130 ? 19.609  -7.736  -18.883 1.00 35.86  ? 130 PHE A CE2 1 
ATOM   958  C  CZ  . PHE A 1 130 ? 20.852  -8.275  -18.624 1.00 34.63  ? 130 PHE A CZ  1 
ATOM   959  N  N   . VAL A 1 131 ? 19.418  -11.509 -22.792 1.00 22.18  ? 131 VAL A N   1 
ATOM   960  C  CA  . VAL A 1 131 ? 20.172  -12.755 -22.906 1.00 22.07  ? 131 VAL A CA  1 
ATOM   961  C  C   . VAL A 1 131 ? 19.147  -13.870 -22.858 1.00 25.31  ? 131 VAL A C   1 
ATOM   962  O  O   . VAL A 1 131 ? 18.415  -13.966 -21.884 1.00 23.31  ? 131 VAL A O   1 
ATOM   963  C  CB  . VAL A 1 131 ? 21.257  -12.951 -21.793 1.00 25.62  ? 131 VAL A CB  1 
ATOM   964  C  CG1 . VAL A 1 131 ? 21.777  -14.385 -21.754 1.00 24.25  ? 131 VAL A CG1 1 
ATOM   965  C  CG2 . VAL A 1 131 ? 22.412  -11.988 -21.978 1.00 25.80  ? 131 VAL A CG2 1 
ATOM   966  N  N   . GLU A 1 132 ? 19.114  -14.726 -23.886 1.00 22.28  ? 132 GLU A N   1 
ATOM   967  C  CA  . GLU A 1 132 ? 18.216  -15.871 -23.895 1.00 21.23  ? 132 GLU A CA  1 
ATOM   968  C  C   . GLU A 1 132 ? 18.753  -16.909 -22.908 1.00 22.67  ? 132 GLU A C   1 
ATOM   969  O  O   . GLU A 1 132 ? 19.955  -17.213 -22.929 1.00 23.57  ? 132 GLU A O   1 
ATOM   970  C  CB  . GLU A 1 132 ? 18.128  -16.467 -25.295 1.00 22.65  ? 132 GLU A CB  1 
ATOM   971  C  CG  . GLU A 1 132 ? 17.063  -17.544 -25.419 1.00 35.57  ? 132 GLU A CG  1 
ATOM   972  C  CD  . GLU A 1 132 ? 17.106  -18.370 -26.686 1.00 46.15  ? 132 GLU A CD  1 
ATOM   973  O  OE1 . GLU A 1 132 ? 17.715  -17.918 -27.684 1.00 50.98  ? 132 GLU A OE1 1 
ATOM   974  O  OE2 . GLU A 1 132 ? 16.499  -19.464 -26.684 1.00 31.46  ? 132 GLU A OE2 1 
ATOM   975  N  N   . THR A 1 133 ? 17.871  -17.424 -22.037 1.00 16.01  ? 133 THR A N   1 
ATOM   976  C  CA  . THR A 1 133 ? 18.213  -18.448 -21.070 1.00 15.14  ? 133 THR A CA  1 
ATOM   977  C  C   . THR A 1 133 ? 17.007  -19.382 -20.811 1.00 18.79  ? 133 THR A C   1 
ATOM   978  O  O   . THR A 1 133 ? 16.045  -19.438 -21.593 1.00 18.45  ? 133 THR A O   1 
ATOM   979  C  CB  . THR A 1 133 ? 18.875  -17.826 -19.794 1.00 21.65  ? 133 THR A CB  1 
ATOM   980  O  OG1 . THR A 1 133 ? 19.534  -18.854 -19.061 1.00 19.13  ? 133 THR A OG1 1 
ATOM   981  C  CG2 . THR A 1 133 ? 17.918  -17.027 -18.913 1.00 13.76  ? 133 THR A CG2 1 
ATOM   982  N  N   . GLY A 1 134 ? 17.124  -20.158 -19.747 1.00 14.33  ? 134 GLY A N   1 
ATOM   983  C  CA  . GLY A 1 134 ? 16.154  -21.155 -19.340 1.00 14.15  ? 134 GLY A CA  1 
ATOM   984  C  C   . GLY A 1 134 ? 16.882  -22.296 -18.677 1.00 19.85  ? 134 GLY A C   1 
ATOM   985  O  O   . GLY A 1 134 ? 17.901  -22.075 -18.012 1.00 20.61  ? 134 GLY A O   1 
ATOM   986  N  N   . ILE A 1 135 ? 16.378  -23.516 -18.843 1.00 16.27  ? 135 ILE A N   1 
ATOM   987  C  CA  . ILE A 1 135 ? 17.001  -24.677 -18.207 1.00 15.99  ? 135 ILE A CA  1 
ATOM   988  C  C   . ILE A 1 135 ? 17.669  -25.581 -19.229 1.00 20.75  ? 135 ILE A C   1 
ATOM   989  O  O   . ILE A 1 135 ? 17.071  -25.940 -20.256 1.00 18.66  ? 135 ILE A O   1 
ATOM   990  C  CB  . ILE A 1 135 ? 16.002  -25.454 -17.324 1.00 19.12  ? 135 ILE A CB  1 
ATOM   991  C  CG1 . ILE A 1 135 ? 15.391  -24.558 -16.226 1.00 19.47  ? 135 ILE A CG1 1 
ATOM   992  C  CG2 . ILE A 1 135 ? 16.639  -26.709 -16.718 1.00 20.80  ? 135 ILE A CG2 1 
ATOM   993  C  CD1 . ILE A 1 135 ? 14.053  -25.139 -15.659 1.00 28.59  ? 135 ILE A CD1 1 
ATOM   994  N  N   . SER A 1 136 ? 18.928  -25.955 -18.924 1.00 17.58  ? 136 SER A N   1 
ATOM   995  C  CA  . SER A 1 136 ? 19.699  -26.880 -19.733 1.00 17.11  ? 136 SER A CA  1 
ATOM   996  C  C   . SER A 1 136 ? 20.235  -27.958 -18.826 1.00 19.23  ? 136 SER A C   1 
ATOM   997  O  O   . SER A 1 136 ? 20.190  -27.799 -17.613 1.00 17.28  ? 136 SER A O   1 
ATOM   998  C  CB  . SER A 1 136 ? 20.809  -26.149 -20.478 1.00 20.09  ? 136 SER A CB  1 
ATOM   999  O  OG  . SER A 1 136 ? 20.197  -25.374 -21.490 1.00 28.69  ? 136 SER A OG  1 
ATOM   1000 N  N   . VAL A 1 137 ? 20.700  -29.064 -19.407 1.00 18.37  ? 137 VAL A N   1 
ATOM   1001 C  CA  . VAL A 1 137 ? 21.273  -30.208 -18.670 1.00 18.96  ? 137 VAL A CA  1 
ATOM   1002 C  C   . VAL A 1 137 ? 22.723  -30.402 -19.110 1.00 23.68  ? 137 VAL A C   1 
ATOM   1003 O  O   . VAL A 1 137 ? 22.978  -30.510 -20.304 1.00 21.66  ? 137 VAL A O   1 
ATOM   1004 C  CB  . VAL A 1 137 ? 20.460  -31.517 -18.874 1.00 22.81  ? 137 VAL A CB  1 
ATOM   1005 C  CG1 . VAL A 1 137 ? 20.959  -32.619 -17.945 1.00 22.73  ? 137 VAL A CG1 1 
ATOM   1006 C  CG2 . VAL A 1 137 ? 18.958  -31.289 -18.682 1.00 22.37  ? 137 VAL A CG2 1 
ATOM   1007 N  N   . MET A 1 138 ? 23.668  -30.409 -18.162 1.00 22.16  ? 138 MET A N   1 
ATOM   1008 C  CA  . MET A 1 138 ? 25.069  -30.661 -18.491 1.00 22.66  ? 138 MET A CA  1 
ATOM   1009 C  C   . MET A 1 138 ? 25.471  -32.066 -18.055 1.00 23.54  ? 138 MET A C   1 
ATOM   1010 O  O   . MET A 1 138 ? 25.299  -32.452 -16.887 1.00 21.34  ? 138 MET A O   1 
ATOM   1011 C  CB  . MET A 1 138 ? 26.022  -29.611 -17.915 1.00 25.90  ? 138 MET A CB  1 
ATOM   1012 C  CG  . MET A 1 138 ? 27.458  -29.842 -18.348 1.00 31.09  ? 138 MET A CG  1 
ATOM   1013 S  SD  . MET A 1 138 ? 28.534  -28.484 -17.884 1.00 37.60  ? 138 MET A SD  1 
ATOM   1014 C  CE  . MET A 1 138 ? 28.389  -27.472 -19.287 1.00 34.02  ? 138 MET A CE  1 
ATOM   1015 N  N   . VAL A 1 139 ? 25.997  -32.822 -19.017 1.00 18.82  ? 139 VAL A N   1 
ATOM   1016 C  CA  . VAL A 1 139 ? 26.439  -34.203 -18.847 1.00 18.76  ? 139 VAL A CA  1 
ATOM   1017 C  C   . VAL A 1 139 ? 27.878  -34.378 -19.398 1.00 27.66  ? 139 VAL A C   1 
ATOM   1018 O  O   . VAL A 1 139 ? 28.412  -33.478 -20.063 1.00 27.72  ? 139 VAL A O   1 
ATOM   1019 C  CB  . VAL A 1 139 ? 25.463  -35.182 -19.582 1.00 20.59  ? 139 VAL A CB  1 
ATOM   1020 C  CG1 . VAL A 1 139 ? 24.035  -35.106 -19.030 1.00 19.64  ? 139 VAL A CG1 1 
ATOM   1021 C  CG2 . VAL A 1 139 ? 25.482  -34.967 -21.094 1.00 20.13  ? 139 VAL A CG2 1 
ATOM   1022 N  N   . SER A 1 140 ? 28.473  -35.564 -19.177 1.00 26.34  ? 140 SER A N   1 
ATOM   1023 C  CA  . SER A 1 140 ? 29.743  -35.906 -19.809 1.00 26.64  ? 140 SER A CA  1 
ATOM   1024 C  C   . SER A 1 140 ? 29.356  -36.351 -21.228 1.00 31.00  ? 140 SER A C   1 
ATOM   1025 O  O   . SER A 1 140 ? 28.308  -36.982 -21.406 1.00 30.92  ? 140 SER A O   1 
ATOM   1026 C  CB  . SER A 1 140 ? 30.429  -37.064 -19.095 1.00 30.35  ? 140 SER A CB  1 
ATOM   1027 O  OG  . SER A 1 140 ? 31.633  -37.391 -19.770 1.00 40.90  ? 140 SER A OG  1 
ATOM   1028 N  N   . ARG A 1 141 ? 30.160  -35.979 -22.235 1.00 26.97  ? 141 ARG A N   1 
ATOM   1029 C  CA  . ARG A 1 141 ? 29.916  -36.345 -23.632 1.00 25.98  ? 141 ARG A CA  1 
ATOM   1030 C  C   . ARG A 1 141 ? 29.687  -37.867 -23.753 1.00 29.54  ? 141 ARG A C   1 
ATOM   1031 O  O   . ARG A 1 141 ? 30.443  -38.679 -23.191 1.00 27.63  ? 141 ARG A O   1 
ATOM   1032 C  CB  . ARG A 1 141 ? 31.084  -35.870 -24.526 1.00 23.21  ? 141 ARG A CB  1 
ATOM   1033 C  CG  . ARG A 1 141 ? 30.815  -36.047 -26.027 1.00 34.98  ? 141 ARG A CG  1 
ATOM   1034 C  CD  . ARG A 1 141 ? 32.002  -35.665 -26.907 1.00 39.19  ? 141 ARG A CD  1 
ATOM   1035 N  NE  . ARG A 1 141 ? 32.385  -34.252 -26.779 1.00 37.90  ? 141 ARG A NE  1 
ATOM   1036 C  CZ  . ARG A 1 141 ? 31.828  -33.256 -27.462 1.00 45.15  ? 141 ARG A CZ  1 
ATOM   1037 N  NH1 . ARG A 1 141 ? 30.857  -33.499 -28.330 1.00 27.40  ? 141 ARG A NH1 1 
ATOM   1038 N  NH2 . ARG A 1 141 ? 32.232  -32.005 -27.272 1.00 32.93  ? 141 ARG A NH2 1 
ATOM   1039 N  N   . GLY A 1 142 ? 28.611  -38.212 -24.436 1.00 28.09  ? 142 GLY A N   1 
ATOM   1040 C  CA  . GLY A 1 142 ? 28.205  -39.591 -24.653 1.00 28.52  ? 142 GLY A CA  1 
ATOM   1041 C  C   . GLY A 1 142 ? 27.009  -40.029 -23.837 1.00 35.41  ? 142 GLY A C   1 
ATOM   1042 O  O   . GLY A 1 142 ? 26.351  -41.002 -24.218 1.00 36.38  ? 142 GLY A O   1 
ATOM   1043 N  N   . THR A 1 143 ? 26.704  -39.318 -22.711 1.00 32.52  ? 143 THR A N   1 
ATOM   1044 C  CA  . THR A 1 143 ? 25.584  -39.637 -21.802 1.00 32.74  ? 143 THR A CA  1 
ATOM   1045 C  C   . THR A 1 143 ? 24.232  -39.539 -22.505 1.00 38.34  ? 143 THR A C   1 
ATOM   1046 O  O   . THR A 1 143 ? 23.920  -38.520 -23.122 1.00 38.61  ? 143 THR A O   1 
ATOM   1047 C  CB  . THR A 1 143 ? 25.665  -38.782 -20.520 1.00 37.99  ? 143 THR A CB  1 
ATOM   1048 O  OG1 . THR A 1 143 ? 26.964  -38.921 -19.935 1.00 33.32  ? 143 THR A OG1 1 
ATOM   1049 C  CG2 . THR A 1 143 ? 24.592  -39.122 -19.500 1.00 34.42  ? 143 THR A CG2 1 
ATOM   1050 N  N   . GLN A 1 144 ? 23.433  -40.599 -22.397 1.00 36.63  ? 144 GLN A N   1 
ATOM   1051 C  CA  . GLN A 1 144 ? 22.116  -40.666 -23.032 1.00 37.01  ? 144 GLN A CA  1 
ATOM   1052 C  C   . GLN A 1 144 ? 20.952  -40.244 -22.129 1.00 40.91  ? 144 GLN A C   1 
ATOM   1053 O  O   . GLN A 1 144 ? 20.495  -41.002 -21.274 1.00 39.98  ? 144 GLN A O   1 
ATOM   1054 C  CB  . GLN A 1 144 ? 21.880  -42.060 -23.610 1.00 37.94  ? 144 GLN A CB  1 
ATOM   1055 N  N   . VAL A 1 145 ? 20.506  -39.006 -22.312 1.00 38.95  ? 145 VAL A N   1 
ATOM   1056 C  CA  . VAL A 1 145 ? 19.339  -38.422 -21.657 1.00 39.98  ? 145 VAL A CA  1 
ATOM   1057 C  C   . VAL A 1 145 ? 18.601  -37.587 -22.678 1.00 41.34  ? 145 VAL A C   1 
ATOM   1058 O  O   . VAL A 1 145 ? 19.169  -36.650 -23.236 1.00 40.29  ? 145 VAL A O   1 
ATOM   1059 C  CB  . VAL A 1 145 ? 19.553  -37.703 -20.292 1.00 45.72  ? 145 VAL A CB  1 
ATOM   1060 C  CG1 . VAL A 1 145 ? 19.506  -38.700 -19.136 1.00 46.07  ? 145 VAL A CG1 1 
ATOM   1061 C  CG2 . VAL A 1 145 ? 20.842  -36.888 -20.263 1.00 45.74  ? 145 VAL A CG2 1 
ATOM   1062 N  N   . THR A 1 146 ? 17.367  -37.987 -22.979 1.00 37.35  ? 146 THR A N   1 
ATOM   1063 C  CA  . THR A 1 146 ? 16.512  -37.360 -23.990 1.00 37.52  ? 146 THR A CA  1 
ATOM   1064 C  C   . THR A 1 146 ? 16.275  -35.888 -23.676 1.00 44.02  ? 146 THR A C   1 
ATOM   1065 O  O   . THR A 1 146 ? 16.471  -35.032 -24.544 1.00 45.58  ? 146 THR A O   1 
ATOM   1066 C  CB  . THR A 1 146 ? 15.225  -38.169 -24.185 1.00 42.54  ? 146 THR A CB  1 
ATOM   1067 O  OG1 . THR A 1 146 ? 14.369  -38.027 -23.039 1.00 40.08  ? 146 THR A OG1 1 
ATOM   1068 C  CG2 . THR A 1 146 ? 15.501  -39.645 -24.477 1.00 38.00  ? 146 THR A CG2 1 
ATOM   1069 N  N   . GLY A 1 147 ? 15.956  -35.617 -22.413 1.00 38.93  ? 147 GLY A N   1 
ATOM   1070 C  CA  . GLY A 1 147 ? 15.708  -34.285 -21.886 1.00 37.53  ? 147 GLY A CA  1 
ATOM   1071 C  C   . GLY A 1 147 ? 15.204  -34.375 -20.465 1.00 39.38  ? 147 GLY A C   1 
ATOM   1072 O  O   . GLY A 1 147 ? 15.244  -35.460 -19.866 1.00 38.39  ? 147 GLY A O   1 
ATOM   1073 N  N   . LEU A 1 148 ? 14.676  -33.241 -19.929 1.00 33.27  ? 148 LEU A N   1 
ATOM   1074 C  CA  . LEU A 1 148 ? 14.109  -33.185 -18.583 1.00 31.48  ? 148 LEU A CA  1 
ATOM   1075 C  C   . LEU A 1 148 ? 13.084  -34.283 -18.329 1.00 33.62  ? 148 LEU A C   1 
ATOM   1076 O  O   . LEU A 1 148 ? 13.068  -34.870 -17.247 1.00 33.33  ? 148 LEU A O   1 
ATOM   1077 C  CB  . LEU A 1 148 ? 13.510  -31.809 -18.276 1.00 30.99  ? 148 LEU A CB  1 
ATOM   1078 C  CG  . LEU A 1 148 ? 14.468  -30.763 -17.727 1.00 34.49  ? 148 LEU A CG  1 
ATOM   1079 C  CD1 . LEU A 1 148 ? 13.766  -29.455 -17.541 1.00 32.53  ? 148 LEU A CD1 1 
ATOM   1080 C  CD2 . LEU A 1 148 ? 15.082  -31.203 -16.403 1.00 38.20  ? 148 LEU A CD2 1 
ATOM   1081 N  N   . SER A 1 149 ? 12.296  -34.611 -19.353 1.00 29.97  ? 149 SER A N   1 
ATOM   1082 C  CA  . SER A 1 149 ? 11.258  -35.641 -19.299 1.00 29.87  ? 149 SER A CA  1 
ATOM   1083 C  C   . SER A 1 149 ? 11.782  -37.086 -19.420 1.00 31.37  ? 149 SER A C   1 
ATOM   1084 O  O   . SER A 1 149 ? 10.972  -38.016 -19.447 1.00 31.78  ? 149 SER A O   1 
ATOM   1085 C  CB  . SER A 1 149 ? 10.175  -35.359 -20.342 1.00 30.81  ? 149 SER A CB  1 
ATOM   1086 N  N   . ASP A 1 150 ? 13.117  -37.286 -19.433 1.00 26.92  ? 150 ASP A N   1 
ATOM   1087 C  CA  . ASP A 1 150 ? 13.713  -38.625 -19.455 1.00 26.83  ? 150 ASP A CA  1 
ATOM   1088 C  C   . ASP A 1 150 ? 13.320  -39.346 -18.134 1.00 30.54  ? 150 ASP A C   1 
ATOM   1089 O  O   . ASP A 1 150 ? 13.314  -38.711 -17.070 1.00 29.60  ? 150 ASP A O   1 
ATOM   1090 C  CB  . ASP A 1 150 ? 15.253  -38.522 -19.583 1.00 28.80  ? 150 ASP A CB  1 
ATOM   1091 C  CG  . ASP A 1 150 ? 15.976  -39.824 -19.930 1.00 40.14  ? 150 ASP A CG  1 
ATOM   1092 O  OD1 . ASP A 1 150 ? 16.197  -40.635 -19.022 1.00 44.22  ? 150 ASP A OD1 1 
ATOM   1093 O  OD2 . ASP A 1 150 ? 16.381  -39.990 -21.099 1.00 42.37  ? 150 ASP A OD2 1 
ATOM   1094 N  N   . LYS A 1 151 ? 12.971  -40.652 -18.213 1.00 27.57  ? 151 LYS A N   1 
ATOM   1095 C  CA  . LYS A 1 151 ? 12.587  -41.466 -17.049 1.00 27.60  ? 151 LYS A CA  1 
ATOM   1096 C  C   . LYS A 1 151 ? 13.653  -41.476 -15.965 1.00 30.21  ? 151 LYS A C   1 
ATOM   1097 O  O   . LYS A 1 151 ? 13.299  -41.478 -14.786 1.00 29.69  ? 151 LYS A O   1 
ATOM   1098 C  CB  . LYS A 1 151 ? 12.276  -42.889 -17.489 1.00 20.00  ? 151 LYS A CB  1 
ATOM   1099 N  N   . LYS A 1 152 ? 14.952  -41.420 -16.351 1.00 26.07  ? 152 LYS A N   1 
ATOM   1100 C  CA  . LYS A 1 152 ? 16.084  -41.356 -15.400 1.00 25.12  ? 152 LYS A CA  1 
ATOM   1101 C  C   . LYS A 1 152 ? 15.904  -40.177 -14.403 1.00 28.97  ? 152 LYS A C   1 
ATOM   1102 O  O   . LYS A 1 152 ? 16.229  -40.300 -13.215 1.00 29.37  ? 152 LYS A O   1 
ATOM   1103 C  CB  . LYS A 1 152 ? 17.417  -41.227 -16.149 1.00 25.18  ? 152 LYS A CB  1 
ATOM   1104 C  CG  . LYS A 1 152 ? 18.008  -42.557 -16.598 1.00 31.04  ? 152 LYS A CG  1 
ATOM   1105 C  CD  . LYS A 1 152 ? 19.074  -42.370 -17.688 1.00 42.66  ? 152 LYS A CD  1 
ATOM   1106 C  CE  . LYS A 1 152 ? 19.099  -43.576 -18.610 1.00 54.81  ? 152 LYS A CE  1 
ATOM   1107 N  NZ  . LYS A 1 152 ? 19.986  -43.384 -19.785 1.00 56.39  ? 152 LYS A NZ  1 
ATOM   1108 N  N   . PHE A 1 153 ? 15.342  -39.062 -14.903 1.00 23.36  ? 153 PHE A N   1 
ATOM   1109 C  CA  . PHE A 1 153 ? 15.029  -37.874 -14.133 1.00 22.38  ? 153 PHE A CA  1 
ATOM   1110 C  C   . PHE A 1 153 ? 13.666  -37.988 -13.491 1.00 24.33  ? 153 PHE A C   1 
ATOM   1111 O  O   . PHE A 1 153 ? 13.555  -37.733 -12.307 1.00 22.73  ? 153 PHE A O   1 
ATOM   1112 C  CB  . PHE A 1 153 ? 15.060  -36.616 -15.019 1.00 24.01  ? 153 PHE A CB  1 
ATOM   1113 C  CG  . PHE A 1 153 ? 16.407  -36.197 -15.536 1.00 25.90  ? 153 PHE A CG  1 
ATOM   1114 C  CD1 . PHE A 1 153 ? 17.543  -36.308 -14.740 1.00 28.45  ? 153 PHE A CD1 1 
ATOM   1115 C  CD2 . PHE A 1 153 ? 16.537  -35.641 -16.802 1.00 28.95  ? 153 PHE A CD2 1 
ATOM   1116 C  CE1 . PHE A 1 153 ? 18.786  -35.898 -15.212 1.00 29.87  ? 153 PHE A CE1 1 
ATOM   1117 C  CE2 . PHE A 1 153 ? 17.782  -35.232 -17.276 1.00 31.88  ? 153 PHE A CE2 1 
ATOM   1118 C  CZ  . PHE A 1 153 ? 18.899  -35.362 -16.476 1.00 29.86  ? 153 PHE A CZ  1 
ATOM   1119 N  N   . GLN A 1 154 ? 12.632  -38.341 -14.278 1.00 21.84  ? 154 GLN A N   1 
ATOM   1120 C  CA  . GLN A 1 154 ? 11.221  -38.403 -13.868 1.00 22.00  ? 154 GLN A CA  1 
ATOM   1121 C  C   . GLN A 1 154 ? 10.918  -39.422 -12.773 1.00 24.07  ? 154 GLN A C   1 
ATOM   1122 O  O   . GLN A 1 154 ? 10.317  -39.060 -11.772 1.00 22.77  ? 154 GLN A O   1 
ATOM   1123 C  CB  . GLN A 1 154 ? 10.319  -38.653 -15.094 1.00 23.73  ? 154 GLN A CB  1 
ATOM   1124 C  CG  . GLN A 1 154 ? 10.410  -37.597 -16.189 1.00 26.97  ? 154 GLN A CG  1 
ATOM   1125 C  CD  . GLN A 1 154 ? 9.877   -36.272 -15.745 1.00 46.77  ? 154 GLN A CD  1 
ATOM   1126 O  OE1 . GLN A 1 154 ? 8.551   -36.180 -15.582 1.00 46.92  ? 154 GLN A OE1 1 
ATOM   1127 N  NE2 . GLN A 1 154 ? 10.648  -35.343 -15.484 1.00 30.70  ? 154 GLN A NE2 1 
ATOM   1128 N  N   . ARG A 1 155 ? 11.316  -40.696 -12.981 1.00 21.34  ? 155 ARG A N   1 
ATOM   1129 C  CA  . ARG A 1 155 ? 11.128  -41.824 -12.060 1.00 21.47  ? 155 ARG A CA  1 
ATOM   1130 C  C   . ARG A 1 155 ? 12.537  -42.377 -11.724 1.00 26.74  ? 155 ARG A C   1 
ATOM   1131 O  O   . ARG A 1 155 ? 12.882  -43.465 -12.182 1.00 26.67  ? 155 ARG A O   1 
ATOM   1132 C  CB  . ARG A 1 155 ? 10.251  -42.918 -12.705 1.00 17.27  ? 155 ARG A CB  1 
ATOM   1133 C  CG  . ARG A 1 155 ? 8.878   -42.458 -13.238 1.00 12.73  ? 155 ARG A CG  1 
ATOM   1134 C  CD  . ARG A 1 155 ? 8.141   -43.615 -13.924 1.00 15.23  ? 155 ARG A CD  1 
ATOM   1135 N  NE  . ARG A 1 155 ? 8.120   -44.785 -13.046 1.00 13.18  ? 155 ARG A NE  1 
ATOM   1136 C  CZ  . ARG A 1 155 ? 7.127   -45.099 -12.224 1.00 29.11  ? 155 ARG A CZ  1 
ATOM   1137 N  NH1 . ARG A 1 155 ? 5.991   -44.402 -12.242 1.00 18.24  ? 155 ARG A NH1 1 
ATOM   1138 N  NH2 . ARG A 1 155 ? 7.254   -46.114 -11.384 1.00 12.05  ? 155 ARG A NH2 1 
ATOM   1139 N  N   . PRO A 1 156 ? 13.385  -41.625 -10.973 1.00 23.30  ? 156 PRO A N   1 
ATOM   1140 C  CA  . PRO A 1 156 ? 14.762  -42.076 -10.746 1.00 23.44  ? 156 PRO A CA  1 
ATOM   1141 C  C   . PRO A 1 156 ? 14.969  -43.455 -10.123 1.00 29.87  ? 156 PRO A C   1 
ATOM   1142 O  O   . PRO A 1 156 ? 15.969  -44.111 -10.452 1.00 29.86  ? 156 PRO A O   1 
ATOM   1143 C  CB  . PRO A 1 156 ? 15.346  -40.985 -9.847  1.00 24.58  ? 156 PRO A CB  1 
ATOM   1144 C  CG  . PRO A 1 156 ? 14.193  -40.264 -9.313  1.00 28.50  ? 156 PRO A CG  1 
ATOM   1145 C  CD  . PRO A 1 156 ? 13.180  -40.293 -10.372 1.00 24.08  ? 156 PRO A CD  1 
ATOM   1146 N  N   . HIS A 1 157 ? 14.048  -43.909 -9.258  1.00 26.99  ? 157 HIS A N   1 
ATOM   1147 C  CA  . HIS A 1 157 ? 14.257  -45.189 -8.583  1.00 26.91  ? 157 HIS A CA  1 
ATOM   1148 C  C   . HIS A 1 157 ? 13.855  -46.425 -9.398  1.00 30.05  ? 157 HIS A C   1 
ATOM   1149 O  O   . HIS A 1 157 ? 13.995  -47.533 -8.890  1.00 31.74  ? 157 HIS A O   1 
ATOM   1150 C  CB  . HIS A 1 157 ? 13.641  -45.196 -7.182  1.00 27.67  ? 157 HIS A CB  1 
ATOM   1151 C  CG  . HIS A 1 157 ? 14.558  -44.527 -6.206  1.00 31.27  ? 157 HIS A CG  1 
ATOM   1152 N  ND1 . HIS A 1 157 ? 14.185  -43.380 -5.537  1.00 33.00  ? 157 HIS A ND1 1 
ATOM   1153 C  CD2 . HIS A 1 157 ? 15.858  -44.798 -5.920  1.00 32.76  ? 157 HIS A CD2 1 
ATOM   1154 C  CE1 . HIS A 1 157 ? 15.242  -43.029 -4.814  1.00 32.49  ? 157 HIS A CE1 1 
ATOM   1155 N  NE2 . HIS A 1 157 ? 16.279  -43.836 -5.036  1.00 32.65  ? 157 HIS A NE2 1 
ATOM   1156 N  N   . ASP A 1 158 ? 13.491  -46.249 -10.676 1.00 24.04  ? 158 ASP A N   1 
ATOM   1157 C  CA  . ASP A 1 158 ? 13.226  -47.330 -11.635 1.00 23.04  ? 158 ASP A CA  1 
ATOM   1158 C  C   . ASP A 1 158 ? 14.580  -47.842 -12.182 1.00 29.43  ? 158 ASP A C   1 
ATOM   1159 O  O   . ASP A 1 158 ? 14.621  -48.844 -12.896 1.00 29.70  ? 158 ASP A O   1 
ATOM   1160 C  CB  . ASP A 1 158 ? 12.383  -46.814 -12.828 1.00 23.06  ? 158 ASP A CB  1 
ATOM   1161 C  CG  . ASP A 1 158 ? 10.891  -46.663 -12.597 1.00 26.84  ? 158 ASP A CG  1 
ATOM   1162 O  OD1 . ASP A 1 158 ? 10.455  -46.707 -11.426 1.00 26.80  ? 158 ASP A OD1 1 
ATOM   1163 O  OD2 . ASP A 1 158 ? 10.164  -46.470 -13.579 1.00 35.15  ? 158 ASP A OD2 1 
ATOM   1164 N  N   . TYR A 1 159 ? 15.682  -47.135 -11.865 1.00 26.26  ? 159 TYR A N   1 
ATOM   1165 C  CA  . TYR A 1 159 ? 17.008  -47.484 -12.347 1.00 25.42  ? 159 TYR A CA  1 
ATOM   1166 C  C   . TYR A 1 159 ? 17.880  -47.975 -11.229 1.00 28.88  ? 159 TYR A C   1 
ATOM   1167 O  O   . TYR A 1 159 ? 17.812  -47.457 -10.117 1.00 27.19  ? 159 TYR A O   1 
ATOM   1168 C  CB  . TYR A 1 159 ? 17.635  -46.323 -13.133 1.00 26.02  ? 159 TYR A CB  1 
ATOM   1169 C  CG  . TYR A 1 159 ? 16.890  -46.026 -14.416 1.00 27.40  ? 159 TYR A CG  1 
ATOM   1170 C  CD1 . TYR A 1 159 ? 15.747  -45.219 -14.416 1.00 29.28  ? 159 TYR A CD1 1 
ATOM   1171 C  CD2 . TYR A 1 159 ? 17.293  -46.585 -15.626 1.00 27.47  ? 159 TYR A CD2 1 
ATOM   1172 C  CE1 . TYR A 1 159 ? 15.052  -44.949 -15.589 1.00 28.09  ? 159 TYR A CE1 1 
ATOM   1173 C  CE2 . TYR A 1 159 ? 16.603  -46.320 -16.810 1.00 28.10  ? 159 TYR A CE2 1 
ATOM   1174 C  CZ  . TYR A 1 159 ? 15.480  -45.508 -16.785 1.00 36.68  ? 159 TYR A CZ  1 
ATOM   1175 O  OH  . TYR A 1 159 ? 14.795  -45.245 -17.944 1.00 39.25  ? 159 TYR A OH  1 
ATOM   1176 N  N   . SER A 1 160 ? 18.654  -49.038 -11.503 1.00 27.35  ? 160 SER A N   1 
ATOM   1177 C  CA  . SER A 1 160 ? 19.504  -49.628 -10.483 1.00 27.86  ? 160 SER A CA  1 
ATOM   1178 C  C   . SER A 1 160 ? 20.952  -49.787 -10.939 1.00 30.85  ? 160 SER A C   1 
ATOM   1179 O  O   . SER A 1 160 ? 21.234  -50.645 -11.772 1.00 31.45  ? 160 SER A O   1 
ATOM   1180 C  CB  . SER A 1 160 ? 18.911  -50.939 -9.973  1.00 33.70  ? 160 SER A CB  1 
ATOM   1181 O  OG  . SER A 1 160 ? 19.772  -51.530 -9.010  1.00 49.90  ? 160 SER A OG  1 
ATOM   1182 N  N   . PRO A 1 161 ? 21.903  -48.978 -10.425 1.00 26.48  ? 161 PRO A N   1 
ATOM   1183 C  CA  . PRO A 1 161 ? 21.734  -47.850 -9.486  1.00 25.68  ? 161 PRO A CA  1 
ATOM   1184 C  C   . PRO A 1 161 ? 20.982  -46.655 -10.113 1.00 28.08  ? 161 PRO A C   1 
ATOM   1185 O  O   . PRO A 1 161 ? 20.936  -46.538 -11.343 1.00 26.01  ? 161 PRO A O   1 
ATOM   1186 C  CB  . PRO A 1 161 ? 23.185  -47.476 -9.140  1.00 26.80  ? 161 PRO A CB  1 
ATOM   1187 C  CG  . PRO A 1 161 ? 23.977  -47.879 -10.333 1.00 31.06  ? 161 PRO A CG  1 
ATOM   1188 C  CD  . PRO A 1 161 ? 23.315  -49.127 -10.840 1.00 27.35  ? 161 PRO A CD  1 
ATOM   1189 N  N   . PRO A 1 162 ? 20.376  -45.749 -9.310  1.00 24.77  ? 162 PRO A N   1 
ATOM   1190 C  CA  . PRO A 1 162 ? 19.697  -44.598 -9.931  1.00 24.49  ? 162 PRO A CA  1 
ATOM   1191 C  C   . PRO A 1 162 ? 20.703  -43.553 -10.425 1.00 28.15  ? 162 PRO A C   1 
ATOM   1192 O  O   . PRO A 1 162 ? 21.819  -43.474 -9.913  1.00 28.64  ? 162 PRO A O   1 
ATOM   1193 C  CB  . PRO A 1 162 ? 18.827  -44.061 -8.798  1.00 26.08  ? 162 PRO A CB  1 
ATOM   1194 C  CG  . PRO A 1 162 ? 19.593  -44.391 -7.556  1.00 29.09  ? 162 PRO A CG  1 
ATOM   1195 C  CD  . PRO A 1 162 ? 20.310  -45.685 -7.830  1.00 24.42  ? 162 PRO A CD  1 
ATOM   1196 N  N   . PHE A 1 163 ? 20.304  -42.773 -11.428 1.00 24.40  ? 163 PHE A N   1 
ATOM   1197 C  CA  . PHE A 1 163 ? 21.060  -41.668 -12.046 1.00 23.09  ? 163 PHE A CA  1 
ATOM   1198 C  C   . PHE A 1 163 ? 21.294  -40.534 -10.995 1.00 25.80  ? 163 PHE A C   1 
ATOM   1199 O  O   . PHE A 1 163 ? 20.361  -40.127 -10.308 1.00 23.87  ? 163 PHE A O   1 
ATOM   1200 C  CB  . PHE A 1 163 ? 20.238  -41.151 -13.231 1.00 24.12  ? 163 PHE A CB  1 
ATOM   1201 C  CG  . PHE A 1 163 ? 20.974  -40.427 -14.324 1.00 25.83  ? 163 PHE A CG  1 
ATOM   1202 C  CD1 . PHE A 1 163 ? 21.852  -41.106 -15.162 1.00 28.53  ? 163 PHE A CD1 1 
ATOM   1203 C  CD2 . PHE A 1 163 ? 20.712  -39.086 -14.589 1.00 27.64  ? 163 PHE A CD2 1 
ATOM   1204 C  CE1 . PHE A 1 163 ? 22.499  -40.446 -16.201 1.00 29.66  ? 163 PHE A CE1 1 
ATOM   1205 C  CE2 . PHE A 1 163 ? 21.357  -38.426 -15.633 1.00 30.86  ? 163 PHE A CE2 1 
ATOM   1206 C  CZ  . PHE A 1 163 ? 22.243  -39.111 -16.439 1.00 28.83  ? 163 PHE A CZ  1 
ATOM   1207 N  N   . ARG A 1 164 ? 22.541  -40.088 -10.822 1.00 22.35  ? 164 ARG A N   1 
ATOM   1208 C  CA  . ARG A 1 164 ? 22.853  -39.029 -9.850  1.00 21.72  ? 164 ARG A CA  1 
ATOM   1209 C  C   . ARG A 1 164 ? 22.775  -37.644 -10.528 1.00 23.80  ? 164 ARG A C   1 
ATOM   1210 O  O   . ARG A 1 164 ? 23.546  -37.364 -11.448 1.00 24.58  ? 164 ARG A O   1 
ATOM   1211 C  CB  . ARG A 1 164 ? 24.229  -39.263 -9.182  1.00 18.76  ? 164 ARG A CB  1 
ATOM   1212 C  CG  . ARG A 1 164 ? 24.333  -40.642 -8.510  1.00 22.44  ? 164 ARG A CG  1 
ATOM   1213 C  CD  . ARG A 1 164 ? 25.740  -41.203 -8.468  1.00 27.29  ? 164 ARG A CD  1 
ATOM   1214 N  NE  . ARG A 1 164 ? 26.452  -41.041 -9.743  1.00 29.48  ? 164 ARG A NE  1 
ATOM   1215 C  CZ  . ARG A 1 164 ? 27.773  -41.077 -9.868  1.00 36.71  ? 164 ARG A CZ  1 
ATOM   1216 N  NH1 . ARG A 1 164 ? 28.541  -41.303 -8.809  1.00 26.22  ? 164 ARG A NH1 1 
ATOM   1217 N  NH2 . ARG A 1 164 ? 28.337  -40.893 -11.050 1.00 21.74  ? 164 ARG A NH2 1 
ATOM   1218 N  N   . PHE A 1 165 ? 21.830  -36.798 -10.106 1.00 16.10  ? 165 PHE A N   1 
ATOM   1219 C  CA  . PHE A 1 165 ? 21.717  -35.473 -10.723 1.00 15.09  ? 165 PHE A CA  1 
ATOM   1220 C  C   . PHE A 1 165 ? 21.286  -34.419 -9.729  1.00 18.74  ? 165 PHE A C   1 
ATOM   1221 O  O   . PHE A 1 165 ? 20.490  -34.697 -8.840  1.00 18.58  ? 165 PHE A O   1 
ATOM   1222 C  CB  . PHE A 1 165 ? 20.792  -35.484 -11.966 1.00 15.41  ? 165 PHE A CB  1 
ATOM   1223 C  CG  . PHE A 1 165 ? 19.392  -35.958 -11.640 1.00 15.35  ? 165 PHE A CG  1 
ATOM   1224 C  CD1 . PHE A 1 165 ? 19.084  -37.313 -11.626 1.00 15.83  ? 165 PHE A CD1 1 
ATOM   1225 C  CD2 . PHE A 1 165 ? 18.379  -35.045 -11.355 1.00 15.75  ? 165 PHE A CD2 1 
ATOM   1226 C  CE1 . PHE A 1 165 ? 17.801  -37.744 -11.310 1.00 16.52  ? 165 PHE A CE1 1 
ATOM   1227 C  CE2 . PHE A 1 165 ? 17.099  -35.481 -11.038 1.00 18.03  ? 165 PHE A CE2 1 
ATOM   1228 C  CZ  . PHE A 1 165 ? 16.819  -36.827 -11.002 1.00 15.89  ? 165 PHE A CZ  1 
ATOM   1229 N  N   . GLY A 1 166 ? 21.793  -33.220 -9.905  1.00 15.83  ? 166 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 166 ? 21.469  -32.116 -9.018  1.00 16.61  ? 166 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 166 ? 21.489  -30.733 -9.631  1.00 20.34  ? 166 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 166 ? 21.732  -30.564 -10.825 1.00 19.66  ? 166 GLY A O   1 
ATOM   1233 N  N   . THR A 1 167 ? 21.232  -29.736 -8.795  1.00 17.96  ? 167 THR A N   1 
ATOM   1234 C  CA  . THR A 1 167 ? 21.217  -28.323 -9.176  1.00 18.32  ? 167 THR A CA  1 
ATOM   1235 C  C   . THR A 1 167 ? 21.828  -27.524 -8.023  1.00 21.80  ? 167 THR A C   1 
ATOM   1236 O  O   . THR A 1 167 ? 22.131  -28.090 -6.978  1.00 19.52  ? 167 THR A O   1 
ATOM   1237 C  CB  . THR A 1 167 ? 19.730  -27.858 -9.451  1.00 22.85  ? 167 THR A CB  1 
ATOM   1238 O  OG1 . THR A 1 167 ? 19.731  -26.524 -9.970  1.00 17.08  ? 167 THR A OG1 1 
ATOM   1239 C  CG2 . THR A 1 167 ? 18.830  -27.902 -8.184  1.00 17.20  ? 167 THR A CG2 1 
ATOM   1240 N  N   . VAL A 1 168 ? 21.969  -26.207 -8.217  1.00 20.03  ? 168 VAL A N   1 
ATOM   1241 C  CA  . VAL A 1 168 ? 22.341  -25.251 -7.187  1.00 19.97  ? 168 VAL A CA  1 
ATOM   1242 C  C   . VAL A 1 168 ? 20.963  -24.789 -6.692  1.00 24.38  ? 168 VAL A C   1 
ATOM   1243 O  O   . VAL A 1 168 ? 20.184  -24.310 -7.518  1.00 25.44  ? 168 VAL A O   1 
ATOM   1244 C  CB  . VAL A 1 168 ? 23.202  -24.081 -7.711  1.00 22.98  ? 168 VAL A CB  1 
ATOM   1245 C  CG1 . VAL A 1 168 ? 23.446  -23.051 -6.595  1.00 22.01  ? 168 VAL A CG1 1 
ATOM   1246 C  CG2 . VAL A 1 168 ? 24.521  -24.609 -8.262  1.00 22.42  ? 168 VAL A CG2 1 
ATOM   1247 N  N   . PRO A 1 169 ? 20.579  -25.038 -5.416  1.00 18.84  ? 169 PRO A N   1 
ATOM   1248 C  CA  . PRO A 1 169 ? 19.205  -24.692 -4.997  1.00 18.17  ? 169 PRO A CA  1 
ATOM   1249 C  C   . PRO A 1 169 ? 18.933  -23.185 -4.822  1.00 22.04  ? 169 PRO A C   1 
ATOM   1250 O  O   . PRO A 1 169 ? 19.864  -22.392 -4.823  1.00 20.74  ? 169 PRO A O   1 
ATOM   1251 C  CB  . PRO A 1 169 ? 19.039  -25.470 -3.677  1.00 19.57  ? 169 PRO A CB  1 
ATOM   1252 C  CG  . PRO A 1 169 ? 20.437  -25.563 -3.112  1.00 23.43  ? 169 PRO A CG  1 
ATOM   1253 C  CD  . PRO A 1 169 ? 21.361  -25.644 -4.308  1.00 18.99  ? 169 PRO A CD  1 
ATOM   1254 N  N   . ASN A 1 170 ? 17.640  -22.801 -4.687  1.00 19.79  ? 170 ASN A N   1 
ATOM   1255 C  CA  . ASN A 1 170 ? 17.138  -21.447 -4.370  1.00 20.33  ? 170 ASN A CA  1 
ATOM   1256 C  C   . ASN A 1 170 ? 17.069  -20.444 -5.526  1.00 24.49  ? 170 ASN A C   1 
ATOM   1257 O  O   . ASN A 1 170 ? 16.606  -19.317 -5.312  1.00 23.44  ? 170 ASN A O   1 
ATOM   1258 C  CB  . ASN A 1 170 ? 17.911  -20.830 -3.199  1.00 18.79  ? 170 ASN A CB  1 
ATOM   1259 C  CG  . ASN A 1 170 ? 17.934  -21.735 -1.985  1.00 23.81  ? 170 ASN A CG  1 
ATOM   1260 O  OD1 . ASN A 1 170 ? 16.964  -22.415 -1.631  1.00 23.67  ? 170 ASN A OD1 1 
ATOM   1261 N  ND2 . ASN A 1 170 ? 19.060  -21.819 -1.371  1.00 8.90   ? 170 ASN A ND2 1 
ATOM   1262 N  N   . GLY A 1 171 ? 17.458  -20.873 -6.730  1.00 21.63  ? 171 GLY A N   1 
ATOM   1263 C  CA  . GLY A 1 171 ? 17.354  -20.070 -7.947  1.00 20.48  ? 171 GLY A CA  1 
ATOM   1264 C  C   . GLY A 1 171 ? 16.080  -20.410 -8.700  1.00 23.65  ? 171 GLY A C   1 
ATOM   1265 O  O   . GLY A 1 171 ? 15.236  -21.157 -8.191  1.00 24.15  ? 171 GLY A O   1 
ATOM   1266 N  N   . SER A 1 172 ? 15.924  -19.859 -9.912  1.00 19.20  ? 172 SER A N   1 
ATOM   1267 C  CA  . SER A 1 172 ? 14.750  -20.065 -10.770 1.00 17.20  ? 172 SER A CA  1 
ATOM   1268 C  C   . SER A 1 172 ? 14.633  -21.513 -11.292 1.00 17.96  ? 172 SER A C   1 
ATOM   1269 O  O   . SER A 1 172 ? 13.513  -22.005 -11.495 1.00 18.21  ? 172 SER A O   1 
ATOM   1270 C  CB  . SER A 1 172 ? 14.749  -19.053 -11.910 1.00 19.47  ? 172 SER A CB  1 
ATOM   1271 O  OG  . SER A 1 172 ? 16.013  -19.088 -12.545 1.00 32.03  ? 172 SER A OG  1 
ATOM   1272 N  N   . THR A 1 173 ? 15.780  -22.203 -11.453 1.00 11.42  ? 173 THR A N   1 
ATOM   1273 C  CA  . THR A 1 173 ? 15.850  -23.593 -11.902 1.00 11.06  ? 173 THR A CA  1 
ATOM   1274 C  C   . THR A 1 173 ? 15.217  -24.537 -10.886 1.00 15.10  ? 173 THR A C   1 
ATOM   1275 O  O   . THR A 1 173 ? 14.371  -25.334 -11.269 1.00 14.30  ? 173 THR A O   1 
ATOM   1276 C  CB  . THR A 1 173 ? 17.283  -24.012 -12.306 1.00 19.98  ? 173 THR A CB  1 
ATOM   1277 O  OG1 . THR A 1 173 ? 17.771  -23.134 -13.324 1.00 17.79  ? 173 THR A OG1 1 
ATOM   1278 C  CG2 . THR A 1 173 ? 17.341  -25.430 -12.839 1.00 23.18  ? 173 THR A CG2 1 
ATOM   1279 N  N   . GLU A 1 174 ? 15.608  -24.446 -9.599  1.00 12.59  ? 174 GLU A N   1 
ATOM   1280 C  CA  . GLU A 1 174 ? 15.056  -25.342 -8.588  1.00 12.48  ? 174 GLU A CA  1 
ATOM   1281 C  C   . GLU A 1 174 ? 13.548  -25.089 -8.411  1.00 17.81  ? 174 GLU A C   1 
ATOM   1282 O  O   . GLU A 1 174 ? 12.778  -26.045 -8.318  1.00 16.94  ? 174 GLU A O   1 
ATOM   1283 C  CB  . GLU A 1 174 ? 15.835  -25.252 -7.266  1.00 13.49  ? 174 GLU A CB  1 
ATOM   1284 C  CG  . GLU A 1 174 ? 15.396  -26.290 -6.236  1.00 20.72  ? 174 GLU A CG  1 
ATOM   1285 C  CD  . GLU A 1 174 ? 15.636  -25.982 -4.769  1.00 39.06  ? 174 GLU A CD  1 
ATOM   1286 O  OE1 . GLU A 1 174 ? 15.726  -24.785 -4.410  1.00 32.46  ? 174 GLU A OE1 1 
ATOM   1287 O  OE2 . GLU A 1 174 ? 15.689  -26.945 -3.968  1.00 33.72  ? 174 GLU A OE2 1 
ATOM   1288 N  N   . ARG A 1 175 ? 13.143  -23.802 -8.429  1.00 15.03  ? 175 ARG A N   1 
ATOM   1289 C  CA  . ARG A 1 175 ? 11.765  -23.355 -8.304  1.00 15.37  ? 175 ARG A CA  1 
ATOM   1290 C  C   . ARG A 1 175 ? 10.851  -24.041 -9.350  1.00 19.49  ? 175 ARG A C   1 
ATOM   1291 O  O   . ARG A 1 175 ? 9.806   -24.594 -9.003  1.00 17.71  ? 175 ARG A O   1 
ATOM   1292 C  CB  . ARG A 1 175 ? 11.723  -21.818 -8.427  1.00 16.38  ? 175 ARG A CB  1 
ATOM   1293 C  CG  . ARG A 1 175 ? 10.317  -21.226 -8.576  1.00 25.91  ? 175 ARG A CG  1 
ATOM   1294 C  CD  . ARG A 1 175 ? 9.712   -20.803 -7.265  1.00 34.35  ? 175 ARG A CD  1 
ATOM   1295 N  NE  . ARG A 1 175 ? 9.046   -21.888 -6.559  1.00 53.30  ? 175 ARG A NE  1 
ATOM   1296 C  CZ  . ARG A 1 175 ? 8.021   -21.711 -5.732  1.00 83.84  ? 175 ARG A CZ  1 
ATOM   1297 N  NH1 . ARG A 1 175 ? 7.528   -20.495 -5.525  1.00 77.63  ? 175 ARG A NH1 1 
ATOM   1298 N  NH2 . ARG A 1 175 ? 7.468   -22.749 -5.121  1.00 79.29  ? 175 ARG A NH2 1 
ATOM   1299 N  N   . ASN A 1 176 ? 11.293  -24.019 -10.619 1.00 17.46  ? 176 ASN A N   1 
ATOM   1300 C  CA  . ASN A 1 176 ? 10.623  -24.606 -11.761 1.00 16.80  ? 176 ASN A CA  1 
ATOM   1301 C  C   . ASN A 1 176 ? 10.546  -26.099 -11.594 1.00 21.01  ? 176 ASN A C   1 
ATOM   1302 O  O   . ASN A 1 176 ? 9.488   -26.665 -11.840 1.00 23.50  ? 176 ASN A O   1 
ATOM   1303 C  CB  . ASN A 1 176 ? 11.366  -24.240 -13.055 1.00 19.60  ? 176 ASN A CB  1 
ATOM   1304 C  CG  . ASN A 1 176 ? 10.717  -24.826 -14.290 1.00 41.30  ? 176 ASN A CG  1 
ATOM   1305 O  OD1 . ASN A 1 176 ? 10.904  -26.001 -14.629 1.00 36.05  ? 176 ASN A OD1 1 
ATOM   1306 N  ND2 . ASN A 1 176 ? 9.884   -24.044 -14.942 1.00 33.06  ? 176 ASN A ND2 1 
ATOM   1307 N  N   . ILE A 1 177 ? 11.655  -26.744 -11.201 1.00 16.98  ? 177 ILE A N   1 
ATOM   1308 C  CA  . ILE A 1 177 ? 11.692  -28.187 -10.962 1.00 17.82  ? 177 ILE A CA  1 
ATOM   1309 C  C   . ILE A 1 177 ? 10.710  -28.580 -9.868  1.00 22.53  ? 177 ILE A C   1 
ATOM   1310 O  O   . ILE A 1 177 ? 9.935   -29.504 -10.098 1.00 22.01  ? 177 ILE A O   1 
ATOM   1311 C  CB  . ILE A 1 177 ? 13.108  -28.758 -10.734 1.00 20.49  ? 177 ILE A CB  1 
ATOM   1312 C  CG1 . ILE A 1 177 ? 13.968  -28.523 -12.010 1.00 20.48  ? 177 ILE A CG1 1 
ATOM   1313 C  CG2 . ILE A 1 177 ? 13.031  -30.272 -10.392 1.00 19.35  ? 177 ILE A CG2 1 
ATOM   1314 C  CD1 . ILE A 1 177 ? 15.461  -28.733 -11.823 1.00 23.30  ? 177 ILE A CD1 1 
ATOM   1315 N  N   . ARG A 1 178 ? 10.684  -27.839 -8.738  1.00 21.06  ? 178 ARG A N   1 
ATOM   1316 C  CA  . ARG A 1 178 ? 9.756   -28.062 -7.620  1.00 22.34  ? 178 ARG A CA  1 
ATOM   1317 C  C   . ARG A 1 178 ? 8.310   -28.035 -8.077  1.00 27.96  ? 178 ARG A C   1 
ATOM   1318 O  O   . ARG A 1 178 ? 7.555   -28.939 -7.727  1.00 29.75  ? 178 ARG A O   1 
ATOM   1319 C  CB  . ARG A 1 178 ? 9.968   -27.040 -6.478  1.00 23.91  ? 178 ARG A CB  1 
ATOM   1320 C  CG  . ARG A 1 178 ? 9.349   -27.479 -5.144  1.00 36.03  ? 178 ARG A CG  1 
ATOM   1321 C  CD  . ARG A 1 178 ? 9.386   -26.390 -4.092  1.00 55.79  ? 178 ARG A CD  1 
ATOM   1322 N  NE  . ARG A 1 178 ? 8.142   -25.615 -4.081  1.00 77.25  ? 178 ARG A NE  1 
ATOM   1323 C  CZ  . ARG A 1 178 ? 7.225   -25.664 -3.115  1.00 94.08  ? 178 ARG A CZ  1 
ATOM   1324 N  NH1 . ARG A 1 178 ? 7.407   -26.440 -2.053  1.00 81.71  ? 178 ARG A NH1 1 
ATOM   1325 N  NH2 . ARG A 1 178 ? 6.125   -24.924 -3.199  1.00 79.06  ? 178 ARG A NH2 1 
ATOM   1326 N  N   . ASN A 1 179 ? 7.933   -27.021 -8.868  1.00 23.84  ? 179 ASN A N   1 
ATOM   1327 C  CA  . ASN A 1 179 ? 6.577   -26.863 -9.385  1.00 24.35  ? 179 ASN A CA  1 
ATOM   1328 C  C   . ASN A 1 179 ? 6.193   -27.915 -10.424 1.00 28.65  ? 179 ASN A C   1 
ATOM   1329 O  O   . ASN A 1 179 ? 5.050   -28.389 -10.411 1.00 29.48  ? 179 ASN A O   1 
ATOM   1330 C  CB  . ASN A 1 179 ? 6.377   -25.458 -10.008 1.00 26.38  ? 179 ASN A CB  1 
ATOM   1331 C  CG  . ASN A 1 179 ? 6.593   -24.274 -9.075  1.00 55.82  ? 179 ASN A CG  1 
ATOM   1332 O  OD1 . ASN A 1 179 ? 6.778   -24.408 -7.849  1.00 51.72  ? 179 ASN A OD1 1 
ATOM   1333 N  ND2 . ASN A 1 179 ? 6.600   -23.072 -9.657  1.00 46.21  ? 179 ASN A ND2 1 
ATOM   1334 N  N   . ASN A 1 180 ? 7.108   -28.228 -11.364 1.00 21.84  ? 180 ASN A N   1 
ATOM   1335 C  CA  . ASN A 1 180 ? 6.773   -29.137 -12.452 1.00 19.95  ? 180 ASN A CA  1 
ATOM   1336 C  C   . ASN A 1 180 ? 6.971   -30.623 -12.163 1.00 22.45  ? 180 ASN A C   1 
ATOM   1337 O  O   . ASN A 1 180 ? 6.172   -31.405 -12.673 1.00 21.41  ? 180 ASN A O   1 
ATOM   1338 C  CB  . ASN A 1 180 ? 7.514   -28.751 -13.742 1.00 14.82  ? 180 ASN A CB  1 
ATOM   1339 C  CG  . ASN A 1 180 ? 7.047   -27.450 -14.344 1.00 33.26  ? 180 ASN A CG  1 
ATOM   1340 O  OD1 . ASN A 1 180 ? 5.848   -27.157 -14.435 1.00 32.66  ? 180 ASN A OD1 1 
ATOM   1341 N  ND2 . ASN A 1 180 ? 7.985   -26.642 -14.800 1.00 29.40  ? 180 ASN A ND2 1 
ATOM   1342 N  N   . TYR A 1 181 ? 8.035   -31.028 -11.407 1.00 17.81  ? 181 TYR A N   1 
ATOM   1343 C  CA  . TYR A 1 181 ? 8.361   -32.454 -11.175 1.00 16.66  ? 181 TYR A CA  1 
ATOM   1344 C  C   . TYR A 1 181 ? 8.573   -32.749 -9.703  1.00 18.28  ? 181 TYR A C   1 
ATOM   1345 O  O   . TYR A 1 181 ? 9.728   -32.875 -9.253  1.00 16.29  ? 181 TYR A O   1 
ATOM   1346 C  CB  . TYR A 1 181 ? 9.599   -32.880 -11.997 1.00 18.26  ? 181 TYR A CB  1 
ATOM   1347 C  CG  . TYR A 1 181 ? 9.603   -32.425 -13.440 1.00 20.20  ? 181 TYR A CG  1 
ATOM   1348 C  CD1 . TYR A 1 181 ? 8.766   -33.018 -14.381 1.00 22.05  ? 181 TYR A CD1 1 
ATOM   1349 C  CD2 . TYR A 1 181 ? 10.433  -31.388 -13.862 1.00 21.08  ? 181 TYR A CD2 1 
ATOM   1350 C  CE1 . TYR A 1 181 ? 8.733   -32.569 -15.704 1.00 24.92  ? 181 TYR A CE1 1 
ATOM   1351 C  CE2 . TYR A 1 181 ? 10.428  -30.949 -15.187 1.00 21.76  ? 181 TYR A CE2 1 
ATOM   1352 C  CZ  . TYR A 1 181 ? 9.575   -31.541 -16.104 1.00 29.91  ? 181 TYR A CZ  1 
ATOM   1353 O  OH  . TYR A 1 181 ? 9.559   -31.098 -17.400 1.00 31.56  ? 181 TYR A OH  1 
ATOM   1354 N  N   . PRO A 1 182 ? 7.462   -32.822 -8.918  1.00 15.36  ? 182 PRO A N   1 
ATOM   1355 C  CA  . PRO A 1 182 ? 7.603   -33.007 -7.457  1.00 14.57  ? 182 PRO A CA  1 
ATOM   1356 C  C   . PRO A 1 182 ? 8.513   -34.168 -7.044  1.00 19.73  ? 182 PRO A C   1 
ATOM   1357 O  O   . PRO A 1 182 ? 9.473   -33.939 -6.278  1.00 17.59  ? 182 PRO A O   1 
ATOM   1358 C  CB  . PRO A 1 182 ? 6.162   -33.167 -6.971  1.00 15.79  ? 182 PRO A CB  1 
ATOM   1359 C  CG  . PRO A 1 182 ? 5.332   -32.533 -8.008  1.00 19.31  ? 182 PRO A CG  1 
ATOM   1360 C  CD  . PRO A 1 182 ? 6.036   -32.678 -9.311  1.00 15.15  ? 182 PRO A CD  1 
ATOM   1361 N  N   . TYR A 1 183 ? 8.291   -35.377 -7.630  1.00 17.84  ? 183 TYR A N   1 
ATOM   1362 C  CA  . TYR A 1 183 ? 9.096   -36.564 -7.307  1.00 19.28  ? 183 TYR A CA  1 
ATOM   1363 C  C   . TYR A 1 183 ? 10.581  -36.396 -7.645  1.00 24.89  ? 183 TYR A C   1 
ATOM   1364 O  O   . TYR A 1 183 ? 11.424  -36.681 -6.786  1.00 25.90  ? 183 TYR A O   1 
ATOM   1365 C  CB  . TYR A 1 183 ? 8.520   -37.837 -7.924  1.00 21.43  ? 183 TYR A CB  1 
ATOM   1366 C  CG  . TYR A 1 183 ? 9.236   -39.079 -7.452  1.00 24.44  ? 183 TYR A CG  1 
ATOM   1367 C  CD1 . TYR A 1 183 ? 9.049   -39.567 -6.163  1.00 27.17  ? 183 TYR A CD1 1 
ATOM   1368 C  CD2 . TYR A 1 183 ? 10.069  -39.792 -8.306  1.00 25.40  ? 183 TYR A CD2 1 
ATOM   1369 C  CE1 . TYR A 1 183 ? 9.683   -40.732 -5.733  1.00 29.70  ? 183 TYR A CE1 1 
ATOM   1370 C  CE2 . TYR A 1 183 ? 10.702  -40.960 -7.890  1.00 26.69  ? 183 TYR A CE2 1 
ATOM   1371 C  CZ  . TYR A 1 183 ? 10.526  -41.414 -6.596  1.00 37.77  ? 183 TYR A CZ  1 
ATOM   1372 O  OH  . TYR A 1 183 ? 11.179  -42.548 -6.180  1.00 43.15  ? 183 TYR A OH  1 
ATOM   1373 N  N   . MET A 1 184 ? 10.888  -35.927 -8.883  1.00 19.96  ? 184 MET A N   1 
ATOM   1374 C  CA  A MET A 1 184 ? 12.254  -35.648 -9.327  0.49 19.82  ? 184 MET A CA  1 
ATOM   1375 C  CA  B MET A 1 184 ? 12.249  -35.650 -9.329  0.51 19.12  ? 184 MET A CA  1 
ATOM   1376 C  C   . MET A 1 184 ? 12.910  -34.679 -8.337  1.00 23.09  ? 184 MET A C   1 
ATOM   1377 O  O   . MET A 1 184 ? 14.024  -34.938 -7.882  1.00 23.28  ? 184 MET A O   1 
ATOM   1378 C  CB  A MET A 1 184 ? 12.258  -35.030 -10.736 0.49 22.25  ? 184 MET A CB  1 
ATOM   1379 C  CB  B MET A 1 184 ? 12.214  -35.051 -10.741 0.51 21.01  ? 184 MET A CB  1 
ATOM   1380 C  CG  A MET A 1 184 ? 13.646  -34.737 -11.263 0.49 26.15  ? 184 MET A CG  1 
ATOM   1381 C  CG  B MET A 1 184 ? 13.536  -34.560 -11.246 0.51 24.07  ? 184 MET A CG  1 
ATOM   1382 S  SD  A MET A 1 184 ? 13.747  -33.295 -12.337 0.49 30.78  ? 184 MET A SD  1 
ATOM   1383 S  SD  B MET A 1 184 ? 13.343  -34.010 -12.943 0.51 27.73  ? 184 MET A SD  1 
ATOM   1384 C  CE  A MET A 1 184 ? 13.041  -33.927 -13.808 0.49 27.54  ? 184 MET A CE  1 
ATOM   1385 C  CE  B MET A 1 184 ? 14.870  -33.153 -13.161 0.51 24.36  ? 184 MET A CE  1 
ATOM   1386 N  N   . HIS A 1 185 ? 12.203  -33.579 -7.993  1.00 18.99  ? 185 HIS A N   1 
ATOM   1387 C  CA  . HIS A 1 185 ? 12.690  -32.564 -7.067  1.00 18.24  ? 185 HIS A CA  1 
ATOM   1388 C  C   . HIS A 1 185 ? 13.090  -33.125 -5.708  1.00 20.97  ? 185 HIS A C   1 
ATOM   1389 O  O   . HIS A 1 185 ? 14.191  -32.855 -5.279  1.00 21.74  ? 185 HIS A O   1 
ATOM   1390 C  CB  . HIS A 1 185 ? 11.689  -31.397 -6.925  1.00 18.78  ? 185 HIS A CB  1 
ATOM   1391 C  CG  . HIS A 1 185 ? 12.096  -30.412 -5.885  1.00 22.10  ? 185 HIS A CG  1 
ATOM   1392 N  ND1 . HIS A 1 185 ? 11.673  -30.285 -4.609  1.00 23.95  ? 185 HIS A ND1 1 
ATOM   1393 C  CD2 . HIS A 1 185 ? 13.126  -29.525 -6.103  1.00 24.33  ? 185 HIS A CD2 1 
ATOM   1394 C  CE1 . HIS A 1 185 ? 12.432  -29.293 -4.040  1.00 23.30  ? 185 HIS A CE1 1 
ATOM   1395 N  NE2 . HIS A 1 185 ? 13.277  -28.863 -4.969  1.00 23.86  ? 185 HIS A NE2 1 
ATOM   1396 N  N   . GLN A 1 186 ? 12.221  -33.888 -5.032  1.00 18.63  ? 186 GLN A N   1 
ATOM   1397 C  CA  . GLN A 1 186 ? 12.517  -34.443 -3.694  1.00 17.50  ? 186 GLN A CA  1 
ATOM   1398 C  C   . GLN A 1 186 ? 13.674  -35.446 -3.728  1.00 21.09  ? 186 GLN A C   1 
ATOM   1399 O  O   . GLN A 1 186 ? 14.437  -35.498 -2.768  1.00 21.37  ? 186 GLN A O   1 
ATOM   1400 C  CB  . GLN A 1 186 ? 11.258  -35.000 -2.976  1.00 17.88  ? 186 GLN A CB  1 
ATOM   1401 C  CG  . GLN A 1 186 ? 10.582  -36.203 -3.610  1.00 26.50  ? 186 GLN A CG  1 
ATOM   1402 C  CD  . GLN A 1 186 ? 11.077  -37.524 -3.074  1.00 48.85  ? 186 GLN A CD  1 
ATOM   1403 O  OE1 . GLN A 1 186 ? 11.176  -37.751 -1.850  1.00 42.96  ? 186 GLN A OE1 1 
ATOM   1404 N  NE2 . GLN A 1 186 ? 11.382  -38.439 -3.991  1.00 39.97  ? 186 GLN A NE2 1 
ATOM   1405 N  N   . TYR A 1 187 ? 13.843  -36.191 -4.844  1.00 17.02  ? 187 TYR A N   1 
ATOM   1406 C  CA  . TYR A 1 187 ? 14.967  -37.112 -5.022  1.00 16.03  ? 187 TYR A CA  1 
ATOM   1407 C  C   . TYR A 1 187 ? 16.307  -36.354 -5.219  1.00 18.90  ? 187 TYR A C   1 
ATOM   1408 O  O   . TYR A 1 187 ? 17.357  -36.796 -4.750  1.00 18.15  ? 187 TYR A O   1 
ATOM   1409 C  CB  . TYR A 1 187 ? 14.720  -38.060 -6.238  1.00 16.55  ? 187 TYR A CB  1 
ATOM   1410 C  CG  . TYR A 1 187 ? 15.969  -38.800 -6.703  1.00 16.15  ? 187 TYR A CG  1 
ATOM   1411 C  CD1 . TYR A 1 187 ? 16.353  -40.004 -6.115  1.00 16.39  ? 187 TYR A CD1 1 
ATOM   1412 C  CD2 . TYR A 1 187 ? 16.799  -38.260 -7.686  1.00 17.39  ? 187 TYR A CD2 1 
ATOM   1413 C  CE1 . TYR A 1 187 ? 17.500  -40.682 -6.531  1.00 14.25  ? 187 TYR A CE1 1 
ATOM   1414 C  CE2 . TYR A 1 187 ? 17.970  -38.909 -8.085  1.00 18.70  ? 187 TYR A CE2 1 
ATOM   1415 C  CZ  . TYR A 1 187 ? 18.317  -40.122 -7.507  1.00 27.75  ? 187 TYR A CZ  1 
ATOM   1416 O  OH  . TYR A 1 187 ? 19.491  -40.742 -7.885  1.00 27.49  ? 187 TYR A OH  1 
ATOM   1417 N  N   . MET A 1 188 ? 16.286  -35.275 -5.977  1.00 17.18  ? 188 MET A N   1 
ATOM   1418 C  CA  . MET A 1 188 ? 17.531  -34.614 -6.342  1.00 18.13  ? 188 MET A CA  1 
ATOM   1419 C  C   . MET A 1 188 ? 18.121  -33.662 -5.270  1.00 21.93  ? 188 MET A C   1 
ATOM   1420 O  O   . MET A 1 188 ? 19.284  -33.284 -5.405  1.00 21.57  ? 188 MET A O   1 
ATOM   1421 C  CB  . MET A 1 188 ? 17.393  -33.925 -7.714  1.00 20.13  ? 188 MET A CB  1 
ATOM   1422 C  CG  . MET A 1 188 ? 16.683  -32.597 -7.681  1.00 23.61  ? 188 MET A CG  1 
ATOM   1423 S  SD  . MET A 1 188 ? 16.434  -31.931 -9.338  1.00 28.03  ? 188 MET A SD  1 
ATOM   1424 C  CE  . MET A 1 188 ? 17.986  -31.404 -9.766  1.00 24.84  ? 188 MET A CE  1 
ATOM   1425 N  N   . THR A 1 189 ? 17.392  -33.351 -4.194  1.00 19.16  ? 189 THR A N   1 
ATOM   1426 C  CA  . THR A 1 189 ? 17.894  -32.430 -3.148  1.00 19.74  ? 189 THR A CA  1 
ATOM   1427 C  C   . THR A 1 189 ? 19.136  -32.981 -2.433  1.00 25.90  ? 189 THR A C   1 
ATOM   1428 O  O   . THR A 1 189 ? 19.972  -32.220 -1.940  1.00 25.86  ? 189 THR A O   1 
ATOM   1429 C  CB  . THR A 1 189 ? 16.767  -32.024 -2.197  1.00 29.28  ? 189 THR A CB  1 
ATOM   1430 O  OG1 . THR A 1 189 ? 16.124  -33.195 -1.696  1.00 35.42  ? 189 THR A OG1 1 
ATOM   1431 C  CG2 . THR A 1 189 ? 15.737  -31.134 -2.882  1.00 23.18  ? 189 THR A CG2 1 
ATOM   1432 N  N   . LYS A 1 190 ? 19.278  -34.309 -2.452  1.00 23.96  ? 190 LYS A N   1 
ATOM   1433 C  CA  . LYS A 1 190 ? 20.394  -35.124 -1.959  1.00 23.66  ? 190 LYS A CA  1 
ATOM   1434 C  C   . LYS A 1 190 ? 21.682  -34.726 -2.722  1.00 27.56  ? 190 LYS A C   1 
ATOM   1435 O  O   . LYS A 1 190 ? 22.791  -34.875 -2.189  1.00 27.08  ? 190 LYS A O   1 
ATOM   1436 C  CB  . LYS A 1 190 ? 20.035  -36.581 -2.326  1.00 26.18  ? 190 LYS A CB  1 
ATOM   1437 C  CG  . LYS A 1 190 ? 20.933  -37.689 -1.816  1.00 33.55  ? 190 LYS A CG  1 
ATOM   1438 C  CD  . LYS A 1 190 ? 20.838  -38.957 -2.707  1.00 31.32  ? 190 LYS A CD  1 
ATOM   1439 C  CE  . LYS A 1 190 ? 19.632  -39.850 -2.496  1.00 36.16  ? 190 LYS A CE  1 
ATOM   1440 N  NZ  . LYS A 1 190 ? 18.358  -39.261 -3.006  1.00 39.97  ? 190 LYS A NZ  1 
ATOM   1441 N  N   . PHE A 1 191 ? 21.522  -34.253 -3.996  1.00 22.46  ? 191 PHE A N   1 
ATOM   1442 C  CA  . PHE A 1 191 ? 22.637  -33.904 -4.884  1.00 20.72  ? 191 PHE A CA  1 
ATOM   1443 C  C   . PHE A 1 191 ? 22.806  -32.396 -5.102  1.00 23.77  ? 191 PHE A C   1 
ATOM   1444 O  O   . PHE A 1 191 ? 23.508  -31.988 -6.039  1.00 22.81  ? 191 PHE A O   1 
ATOM   1445 C  CB  . PHE A 1 191 ? 22.523  -34.660 -6.220  1.00 20.93  ? 191 PHE A CB  1 
ATOM   1446 C  CG  . PHE A 1 191 ? 22.455  -36.162 -6.075  1.00 21.46  ? 191 PHE A CG  1 
ATOM   1447 C  CD1 . PHE A 1 191 ? 23.614  -36.912 -5.819  1.00 22.83  ? 191 PHE A CD1 1 
ATOM   1448 C  CD2 . PHE A 1 191 ? 21.246  -36.840 -6.241  1.00 22.35  ? 191 PHE A CD2 1 
ATOM   1449 C  CE1 . PHE A 1 191 ? 23.556  -38.309 -5.698  1.00 21.91  ? 191 PHE A CE1 1 
ATOM   1450 C  CE2 . PHE A 1 191 ? 21.188  -38.236 -6.119  1.00 24.55  ? 191 PHE A CE2 1 
ATOM   1451 C  CZ  . PHE A 1 191 ? 22.347  -38.961 -5.848  1.00 21.96  ? 191 PHE A CZ  1 
ATOM   1452 N  N   . ASN A 1 192 ? 22.195  -31.582 -4.207  1.00 19.08  ? 192 ASN A N   1 
ATOM   1453 C  CA  . ASN A 1 192 ? 22.289  -30.118 -4.184  1.00 18.80  ? 192 ASN A CA  1 
ATOM   1454 C  C   . ASN A 1 192 ? 23.745  -29.721 -4.132  1.00 22.75  ? 192 ASN A C   1 
ATOM   1455 O  O   . ASN A 1 192 ? 24.505  -30.252 -3.313  1.00 22.59  ? 192 ASN A O   1 
ATOM   1456 C  CB  . ASN A 1 192 ? 21.568  -29.537 -2.953  1.00 18.29  ? 192 ASN A CB  1 
ATOM   1457 C  CG  . ASN A 1 192 ? 20.095  -29.306 -3.151  1.00 32.74  ? 192 ASN A CG  1 
ATOM   1458 O  OD1 . ASN A 1 192 ? 19.531  -29.562 -4.219  1.00 24.08  ? 192 ASN A OD1 1 
ATOM   1459 N  ND2 . ASN A 1 192 ? 19.430  -28.843 -2.108  1.00 21.83  ? 192 ASN A ND2 1 
ATOM   1460 N  N   . GLN A 1 193 ? 24.136  -28.810 -5.025  1.00 19.14  ? 193 GLN A N   1 
ATOM   1461 C  CA  . GLN A 1 193 ? 25.508  -28.330 -5.173  1.00 18.94  ? 193 GLN A CA  1 
ATOM   1462 C  C   . GLN A 1 193 ? 25.601  -26.930 -4.612  1.00 23.76  ? 193 GLN A C   1 
ATOM   1463 O  O   . GLN A 1 193 ? 24.626  -26.180 -4.698  1.00 22.82  ? 193 GLN A O   1 
ATOM   1464 C  CB  . GLN A 1 193 ? 25.881  -28.319 -6.672  1.00 20.50  ? 193 GLN A CB  1 
ATOM   1465 C  CG  . GLN A 1 193 ? 25.803  -29.698 -7.339  1.00 28.29  ? 193 GLN A CG  1 
ATOM   1466 C  CD  . GLN A 1 193 ? 26.883  -30.630 -6.838  1.00 34.49  ? 193 GLN A CD  1 
ATOM   1467 O  OE1 . GLN A 1 193 ? 28.072  -30.349 -6.936  1.00 31.60  ? 193 GLN A OE1 1 
ATOM   1468 N  NE2 . GLN A 1 193 ? 26.499  -31.762 -6.297  1.00 27.19  ? 193 GLN A NE2 1 
ATOM   1469 N  N   . LYS A 1 194 ? 26.769  -26.554 -4.064  1.00 22.13  ? 194 LYS A N   1 
ATOM   1470 C  CA  . LYS A 1 194 ? 26.977  -25.210 -3.506  1.00 22.14  ? 194 LYS A CA  1 
ATOM   1471 C  C   . LYS A 1 194 ? 27.027  -24.140 -4.592  1.00 24.35  ? 194 LYS A C   1 
ATOM   1472 O  O   . LYS A 1 194 ? 26.458  -23.059 -4.417  1.00 23.30  ? 194 LYS A O   1 
ATOM   1473 C  CB  . LYS A 1 194 ? 28.235  -25.162 -2.650  1.00 22.85  ? 194 LYS A CB  1 
ATOM   1474 N  N   . GLY A 1 195 ? 27.681  -24.458 -5.702  1.00 20.99  ? 195 GLY A N   1 
ATOM   1475 C  CA  . GLY A 1 195 ? 27.815  -23.544 -6.831  1.00 21.25  ? 195 GLY A CA  1 
ATOM   1476 C  C   . GLY A 1 195 ? 28.164  -24.248 -8.124  1.00 26.38  ? 195 GLY A C   1 
ATOM   1477 O  O   . GLY A 1 195 ? 28.324  -25.464 -8.141  1.00 26.50  ? 195 GLY A O   1 
ATOM   1478 N  N   . VAL A 1 196 ? 28.327  -23.481 -9.210  1.00 24.52  ? 196 VAL A N   1 
ATOM   1479 C  CA  . VAL A 1 196 ? 28.663  -24.014 -10.534 1.00 24.70  ? 196 VAL A CA  1 
ATOM   1480 C  C   . VAL A 1 196 ? 30.005  -24.784 -10.523 1.00 31.03  ? 196 VAL A C   1 
ATOM   1481 O  O   . VAL A 1 196 ? 30.030  -25.945 -10.944 1.00 30.92  ? 196 VAL A O   1 
ATOM   1482 C  CB  . VAL A 1 196 ? 28.588  -22.914 -11.611 1.00 27.09  ? 196 VAL A CB  1 
ATOM   1483 C  CG1 . VAL A 1 196 ? 28.816  -23.476 -13.005 1.00 26.23  ? 196 VAL A CG1 1 
ATOM   1484 C  CG2 . VAL A 1 196 ? 27.239  -22.216 -11.547 1.00 26.87  ? 196 VAL A CG2 1 
ATOM   1485 N  N   . GLU A 1 197 ? 31.087  -24.162 -9.999  1.00 28.64  ? 197 GLU A N   1 
ATOM   1486 C  CA  . GLU A 1 197 ? 32.431  -24.760 -9.889  1.00 29.07  ? 197 GLU A CA  1 
ATOM   1487 C  C   . GLU A 1 197 ? 32.422  -26.148 -9.198  1.00 31.85  ? 197 GLU A C   1 
ATOM   1488 O  O   . GLU A 1 197 ? 33.049  -27.085 -9.694  1.00 32.07  ? 197 GLU A O   1 
ATOM   1489 C  CB  . GLU A 1 197 ? 33.396  -23.805 -9.162  1.00 30.92  ? 197 GLU A CB  1 
ATOM   1490 C  CG  . GLU A 1 197 ? 33.588  -22.459 -9.845  1.00 47.01  ? 197 GLU A CG  1 
ATOM   1491 C  CD  . GLU A 1 197 ? 34.283  -22.486 -11.197 1.00 77.62  ? 197 GLU A CD  1 
ATOM   1492 O  OE1 . GLU A 1 197 ? 35.111  -23.399 -11.432 1.00 67.34  ? 197 GLU A OE1 1 
ATOM   1493 O  OE2 . GLU A 1 197 ? 34.011  -21.577 -12.016 1.00 74.59  ? 197 GLU A OE2 1 
ATOM   1494 N  N   . ASP A 1 198 ? 31.682  -26.277 -8.087  1.00 26.66  ? 198 ASP A N   1 
ATOM   1495 C  CA  . ASP A 1 198 ? 31.540  -27.532 -7.352  1.00 25.64  ? 198 ASP A CA  1 
ATOM   1496 C  C   . ASP A 1 198 ? 30.878  -28.569 -8.240  1.00 27.11  ? 198 ASP A C   1 
ATOM   1497 O  O   . ASP A 1 198 ? 31.360  -29.691 -8.320  1.00 27.73  ? 198 ASP A O   1 
ATOM   1498 C  CB  . ASP A 1 198 ? 30.693  -27.310 -6.083  1.00 27.85  ? 198 ASP A CB  1 
ATOM   1499 C  CG  . ASP A 1 198 ? 31.457  -26.890 -4.844  1.00 41.96  ? 198 ASP A CG  1 
ATOM   1500 O  OD1 . ASP A 1 198 ? 32.343  -26.002 -4.956  1.00 43.32  ? 198 ASP A OD1 1 
ATOM   1501 O  OD2 . ASP A 1 198 ? 31.123  -27.392 -3.744  1.00 49.98  ? 198 ASP A OD2 1 
ATOM   1502 N  N   . ALA A 1 199 ? 29.789  -28.187 -8.928  1.00 21.82  ? 199 ALA A N   1 
ATOM   1503 C  CA  . ALA A 1 199 ? 29.043  -29.072 -9.823  1.00 20.40  ? 199 ALA A CA  1 
ATOM   1504 C  C   . ALA A 1 199 ? 29.909  -29.610 -10.950 1.00 24.85  ? 199 ALA A C   1 
ATOM   1505 O  O   . ALA A 1 199 ? 29.916  -30.819 -11.195 1.00 24.47  ? 199 ALA A O   1 
ATOM   1506 C  CB  . ALA A 1 199 ? 27.828  -28.360 -10.376 1.00 20.36  ? 199 ALA A CB  1 
ATOM   1507 N  N   . LEU A 1 200 ? 30.659  -28.726 -11.607 1.00 23.21  ? 200 LEU A N   1 
ATOM   1508 C  CA  . LEU A 1 200 ? 31.541  -29.082 -12.716 1.00 24.77  ? 200 LEU A CA  1 
ATOM   1509 C  C   . LEU A 1 200 ? 32.609  -30.095 -12.311 1.00 31.46  ? 200 LEU A C   1 
ATOM   1510 O  O   . LEU A 1 200 ? 32.818  -31.066 -13.044 1.00 31.68  ? 200 LEU A O   1 
ATOM   1511 C  CB  . LEU A 1 200 ? 32.152  -27.823 -13.345 1.00 24.98  ? 200 LEU A CB  1 
ATOM   1512 C  CG  . LEU A 1 200 ? 31.141  -26.901 -14.048 1.00 29.41  ? 200 LEU A CG  1 
ATOM   1513 C  CD1 . LEU A 1 200 ? 31.837  -25.806 -14.807 1.00 29.64  ? 200 LEU A CD1 1 
ATOM   1514 C  CD2 . LEU A 1 200 ? 30.236  -27.680 -14.979 1.00 28.28  ? 200 LEU A CD2 1 
ATOM   1515 N  N   . VAL A 1 201 ? 33.213  -29.906 -11.108 1.00 27.89  ? 201 VAL A N   1 
ATOM   1516 C  CA  . VAL A 1 201 ? 34.219  -30.796 -10.518 1.00 27.95  ? 201 VAL A CA  1 
ATOM   1517 C  C   . VAL A 1 201 ? 33.599  -32.180 -10.283 1.00 31.64  ? 201 VAL A C   1 
ATOM   1518 O  O   . VAL A 1 201 ? 34.208  -33.193 -10.618 1.00 31.67  ? 201 VAL A O   1 
ATOM   1519 C  CB  . VAL A 1 201 ? 34.841  -30.163 -9.234  1.00 31.42  ? 201 VAL A CB  1 
ATOM   1520 C  CG1 . VAL A 1 201 ? 35.578  -31.187 -8.373  1.00 30.52  ? 201 VAL A CG1 1 
ATOM   1521 C  CG2 . VAL A 1 201 ? 35.766  -29.011 -9.596  1.00 31.24  ? 201 VAL A CG2 1 
ATOM   1522 N  N   . SER A 1 202 ? 32.371  -32.193 -9.747  1.00 27.95  ? 202 SER A N   1 
ATOM   1523 C  CA  . SER A 1 202 ? 31.559  -33.369 -9.438  1.00 27.11  ? 202 SER A CA  1 
ATOM   1524 C  C   . SER A 1 202 ? 31.236  -34.198 -10.700 1.00 32.23  ? 202 SER A C   1 
ATOM   1525 O  O   . SER A 1 202 ? 31.273  -35.426 -10.647 1.00 32.23  ? 202 SER A O   1 
ATOM   1526 C  CB  . SER A 1 202 ? 30.277  -32.929 -8.744  1.00 29.01  ? 202 SER A CB  1 
ATOM   1527 O  OG  . SER A 1 202 ? 30.302  -33.206 -7.360  1.00 35.46  ? 202 SER A OG  1 
ATOM   1528 N  N   . LEU A 1 203 ? 30.930  -33.531 -11.825 1.00 30.03  ? 203 LEU A N   1 
ATOM   1529 C  CA  . LEU A 1 203 ? 30.661  -34.195 -13.098 1.00 31.03  ? 203 LEU A CA  1 
ATOM   1530 C  C   . LEU A 1 203 ? 31.939  -34.911 -13.620 1.00 38.93  ? 203 LEU A C   1 
ATOM   1531 O  O   . LEU A 1 203 ? 31.943  -36.145 -13.770 1.00 40.51  ? 203 LEU A O   1 
ATOM   1532 C  CB  . LEU A 1 203 ? 30.167  -33.173 -14.145 1.00 31.04  ? 203 LEU A CB  1 
ATOM   1533 C  CG  . LEU A 1 203 ? 28.691  -32.796 -14.112 1.00 35.48  ? 203 LEU A CG  1 
ATOM   1534 C  CD1 . LEU A 1 203 ? 28.450  -31.539 -14.894 1.00 35.03  ? 203 LEU A CD1 1 
ATOM   1535 C  CD2 . LEU A 1 203 ? 27.807  -33.931 -14.643 1.00 37.95  ? 203 LEU A CD2 1 
ATOM   1536 N  N   . LYS A 1 204 ? 33.022  -34.135 -13.832 1.00 34.90  ? 204 LYS A N   1 
ATOM   1537 C  CA  . LYS A 1 204 ? 34.322  -34.593 -14.341 1.00 35.07  ? 204 LYS A CA  1 
ATOM   1538 C  C   . LYS A 1 204 ? 34.965  -35.729 -13.536 1.00 38.74  ? 204 LYS A C   1 
ATOM   1539 O  O   . LYS A 1 204 ? 35.594  -36.603 -14.129 1.00 38.52  ? 204 LYS A O   1 
ATOM   1540 C  CB  . LYS A 1 204 ? 35.302  -33.417 -14.482 1.00 36.98  ? 204 LYS A CB  1 
ATOM   1541 C  CG  . LYS A 1 204 ? 34.969  -32.511 -15.658 1.00 48.01  ? 204 LYS A CG  1 
ATOM   1542 C  CD  . LYS A 1 204 ? 36.125  -31.614 -16.035 1.00 54.64  ? 204 LYS A CD  1 
ATOM   1543 C  CE  . LYS A 1 204 ? 36.107  -31.323 -17.512 1.00 65.43  ? 204 LYS A CE  1 
ATOM   1544 N  NZ  . LYS A 1 204 ? 37.477  -31.078 -18.035 1.00 79.57  ? 204 LYS A NZ  1 
ATOM   1545 N  N   . THR A 1 205 ? 34.793  -35.728 -12.204 1.00 33.92  ? 205 THR A N   1 
ATOM   1546 C  CA  . THR A 1 205 ? 35.352  -36.769 -11.333 1.00 32.44  ? 205 THR A CA  1 
ATOM   1547 C  C   . THR A 1 205 ? 34.388  -37.959 -11.122 1.00 35.44  ? 205 THR A C   1 
ATOM   1548 O  O   . THR A 1 205 ? 34.647  -38.804 -10.275 1.00 35.43  ? 205 THR A O   1 
ATOM   1549 C  CB  . THR A 1 205 ? 35.839  -36.161 -10.007 1.00 33.48  ? 205 THR A CB  1 
ATOM   1550 O  OG1 . THR A 1 205 ? 34.740  -35.540 -9.356  1.00 39.21  ? 205 THR A OG1 1 
ATOM   1551 C  CG2 . THR A 1 205 ? 36.953  -35.158 -10.195 1.00 25.95  ? 205 THR A CG2 1 
ATOM   1552 N  N   . GLY A 1 206 ? 33.283  -38.001 -11.870 1.00 32.23  ? 206 GLY A N   1 
ATOM   1553 C  CA  . GLY A 1 206 ? 32.291  -39.075 -11.814 1.00 31.39  ? 206 GLY A CA  1 
ATOM   1554 C  C   . GLY A 1 206 ? 31.458  -39.198 -10.552 1.00 34.18  ? 206 GLY A C   1 
ATOM   1555 O  O   . GLY A 1 206 ? 30.903  -40.273 -10.283 1.00 33.28  ? 206 GLY A O   1 
ATOM   1556 N  N   . LYS A 1 207 ? 31.318  -38.091 -9.788  1.00 29.85  ? 207 LYS A N   1 
ATOM   1557 C  CA  . LYS A 1 207 ? 30.528  -38.054 -8.542  1.00 28.93  ? 207 LYS A CA  1 
ATOM   1558 C  C   . LYS A 1 207 ? 29.065  -37.699 -8.795  1.00 30.87  ? 207 LYS A C   1 
ATOM   1559 O  O   . LYS A 1 207 ? 28.217  -37.838 -7.906  1.00 32.03  ? 207 LYS A O   1 
ATOM   1560 C  CB  . LYS A 1 207 ? 31.157  -37.056 -7.548  1.00 31.51  ? 207 LYS A CB  1 
ATOM   1561 C  CG  . LYS A 1 207 ? 32.496  -37.530 -6.983  1.00 47.79  ? 207 LYS A CG  1 
ATOM   1562 C  CD  . LYS A 1 207 ? 33.317  -36.391 -6.348  1.00 64.94  ? 207 LYS A CD  1 
ATOM   1563 C  CE  . LYS A 1 207 ? 33.014  -36.134 -4.880  1.00 73.86  ? 207 LYS A CE  1 
ATOM   1564 N  NZ  . LYS A 1 207 ? 31.881  -35.186 -4.689  1.00 78.67  ? 207 LYS A NZ  1 
ATOM   1565 N  N   . LEU A 1 208 ? 28.781  -37.234 -10.013 1.00 24.47  ? 208 LEU A N   1 
ATOM   1566 C  CA  . LEU A 1 208 ? 27.493  -36.768 -10.486 1.00 23.18  ? 208 LEU A CA  1 
ATOM   1567 C  C   . LEU A 1 208 ? 27.383  -37.129 -11.966 1.00 24.72  ? 208 LEU A C   1 
ATOM   1568 O  O   . LEU A 1 208 ? 28.406  -37.177 -12.652 1.00 24.21  ? 208 LEU A O   1 
ATOM   1569 C  CB  . LEU A 1 208 ? 27.463  -35.238 -10.300 1.00 23.72  ? 208 LEU A CB  1 
ATOM   1570 C  CG  . LEU A 1 208 ? 26.102  -34.548 -10.243 1.00 28.61  ? 208 LEU A CG  1 
ATOM   1571 C  CD1 . LEU A 1 208 ? 25.351  -34.914 -8.951  1.00 28.09  ? 208 LEU A CD1 1 
ATOM   1572 C  CD2 . LEU A 1 208 ? 26.264  -33.021 -10.374 1.00 28.88  ? 208 LEU A CD2 1 
ATOM   1573 N  N   . ASP A 1 209 ? 26.155  -37.430 -12.449 1.00 19.78  ? 209 ASP A N   1 
ATOM   1574 C  CA  . ASP A 1 209 ? 25.890  -37.802 -13.853 1.00 18.89  ? 209 ASP A CA  1 
ATOM   1575 C  C   . ASP A 1 209 ? 25.337  -36.639 -14.697 1.00 21.86  ? 209 ASP A C   1 
ATOM   1576 O  O   . ASP A 1 209 ? 25.637  -36.556 -15.890 1.00 21.05  ? 209 ASP A O   1 
ATOM   1577 C  CB  . ASP A 1 209 ? 24.968  -39.038 -13.932 1.00 20.67  ? 209 ASP A CB  1 
ATOM   1578 C  CG  . ASP A 1 209 ? 25.494  -40.248 -13.161 1.00 31.63  ? 209 ASP A CG  1 
ATOM   1579 O  OD1 . ASP A 1 209 ? 26.708  -40.523 -13.251 1.00 31.97  ? 209 ASP A OD1 1 
ATOM   1580 O  OD2 . ASP A 1 209 ? 24.684  -40.913 -12.451 1.00 35.50  ? 209 ASP A OD2 1 
ATOM   1581 N  N   . ALA A 1 210 ? 24.498  -35.764 -14.085 1.00 17.83  ? 210 ALA A N   1 
ATOM   1582 C  CA  . ALA A 1 210 ? 23.919  -34.593 -14.742 1.00 16.09  ? 210 ALA A CA  1 
ATOM   1583 C  C   . ALA A 1 210 ? 23.799  -33.407 -13.784 1.00 19.93  ? 210 ALA A C   1 
ATOM   1584 O  O   . ALA A 1 210 ? 23.597  -33.577 -12.586 1.00 18.54  ? 210 ALA A O   1 
ATOM   1585 C  CB  . ALA A 1 210 ? 22.560  -34.927 -15.359 1.00 15.95  ? 210 ALA A CB  1 
ATOM   1586 N  N   . PHE A 1 211 ? 23.931  -32.204 -14.327 1.00 17.43  ? 211 PHE A N   1 
ATOM   1587 C  CA  . PHE A 1 211 ? 23.785  -30.959 -13.587 1.00 16.42  ? 211 PHE A CA  1 
ATOM   1588 C  C   . PHE A 1 211 ? 22.764  -30.118 -14.343 1.00 19.24  ? 211 PHE A C   1 
ATOM   1589 O  O   . PHE A 1 211 ? 22.958  -29.812 -15.510 1.00 16.25  ? 211 PHE A O   1 
ATOM   1590 C  CB  . PHE A 1 211 ? 25.131  -30.235 -13.446 1.00 17.63  ? 211 PHE A CB  1 
ATOM   1591 C  CG  . PHE A 1 211 ? 25.061  -28.874 -12.799 1.00 18.31  ? 211 PHE A CG  1 
ATOM   1592 C  CD1 . PHE A 1 211 ? 24.417  -28.697 -11.578 1.00 18.95  ? 211 PHE A CD1 1 
ATOM   1593 C  CD2 . PHE A 1 211 ? 25.711  -27.785 -13.365 1.00 20.09  ? 211 PHE A CD2 1 
ATOM   1594 C  CE1 . PHE A 1 211 ? 24.362  -27.439 -10.976 1.00 19.83  ? 211 PHE A CE1 1 
ATOM   1595 C  CE2 . PHE A 1 211 ? 25.645  -26.521 -12.765 1.00 22.21  ? 211 PHE A CE2 1 
ATOM   1596 C  CZ  . PHE A 1 211 ? 24.968  -26.357 -11.576 1.00 19.24  ? 211 PHE A CZ  1 
ATOM   1597 N  N   . ILE A 1 212 ? 21.641  -29.825 -13.685 1.00 18.11  ? 212 ILE A N   1 
ATOM   1598 C  CA  . ILE A 1 212 ? 20.521  -29.061 -14.243 1.00 17.75  ? 212 ILE A CA  1 
ATOM   1599 C  C   . ILE A 1 212 ? 20.672  -27.618 -13.758 1.00 21.38  ? 212 ILE A C   1 
ATOM   1600 O  O   . ILE A 1 212 ? 20.785  -27.389 -12.548 1.00 20.17  ? 212 ILE A O   1 
ATOM   1601 C  CB  . ILE A 1 212 ? 19.196  -29.751 -13.840 1.00 20.36  ? 212 ILE A CB  1 
ATOM   1602 C  CG1 . ILE A 1 212 ? 19.120  -31.169 -14.450 1.00 20.95  ? 212 ILE A CG1 1 
ATOM   1603 C  CG2 . ILE A 1 212 ? 18.016  -28.927 -14.246 1.00 21.17  ? 212 ILE A CG2 1 
ATOM   1604 C  CD1 . ILE A 1 212 ? 18.477  -32.202 -13.588 1.00 28.88  ? 212 ILE A CD1 1 
ATOM   1605 N  N   . TYR A 1 213 ? 20.770  -26.658 -14.712 1.00 16.54  ? 213 TYR A N   1 
ATOM   1606 C  CA  . TYR A 1 213 ? 21.041  -25.257 -14.389 1.00 15.51  ? 213 TYR A CA  1 
ATOM   1607 C  C   . TYR A 1 213 ? 20.733  -24.289 -15.527 1.00 17.91  ? 213 TYR A C   1 
ATOM   1608 O  O   . TYR A 1 213 ? 20.371  -24.705 -16.630 1.00 17.51  ? 213 TYR A O   1 
ATOM   1609 C  CB  . TYR A 1 213 ? 22.531  -25.141 -14.004 1.00 17.22  ? 213 TYR A CB  1 
ATOM   1610 C  CG  . TYR A 1 213 ? 22.913  -23.894 -13.244 1.00 19.65  ? 213 TYR A CG  1 
ATOM   1611 C  CD1 . TYR A 1 213 ? 22.527  -23.714 -11.915 1.00 20.81  ? 213 TYR A CD1 1 
ATOM   1612 C  CD2 . TYR A 1 213 ? 23.692  -22.909 -13.837 1.00 20.97  ? 213 TYR A CD2 1 
ATOM   1613 C  CE1 . TYR A 1 213 ? 22.894  -22.572 -11.207 1.00 20.76  ? 213 TYR A CE1 1 
ATOM   1614 C  CE2 . TYR A 1 213 ? 24.040  -21.748 -13.147 1.00 22.00  ? 213 TYR A CE2 1 
ATOM   1615 C  CZ  . TYR A 1 213 ? 23.662  -21.596 -11.824 1.00 26.86  ? 213 TYR A CZ  1 
ATOM   1616 O  OH  . TYR A 1 213 ? 24.060  -20.461 -11.151 1.00 24.75  ? 213 TYR A OH  1 
ATOM   1617 N  N   . ASP A 1 214 ? 20.898  -22.990 -15.246 1.00 14.69  ? 214 ASP A N   1 
ATOM   1618 C  CA  . ASP A 1 214 ? 20.716  -21.861 -16.151 1.00 14.70  ? 214 ASP A CA  1 
ATOM   1619 C  C   . ASP A 1 214 ? 21.395  -22.141 -17.456 1.00 20.54  ? 214 ASP A C   1 
ATOM   1620 O  O   . ASP A 1 214 ? 22.592  -22.463 -17.467 1.00 20.01  ? 214 ASP A O   1 
ATOM   1621 C  CB  . ASP A 1 214 ? 21.296  -20.594 -15.526 1.00 17.18  ? 214 ASP A CB  1 
ATOM   1622 C  CG  . ASP A 1 214 ? 21.133  -19.371 -16.392 1.00 27.63  ? 214 ASP A CG  1 
ATOM   1623 O  OD1 . ASP A 1 214 ? 20.032  -18.800 -16.397 1.00 29.81  ? 214 ASP A OD1 1 
ATOM   1624 O  OD2 . ASP A 1 214 ? 22.104  -19.001 -17.081 1.00 31.96  ? 214 ASP A OD2 1 
ATOM   1625 N  N   . ALA A 1 215 ? 20.602  -22.084 -18.562 1.00 17.51  ? 215 ALA A N   1 
ATOM   1626 C  CA  . ALA A 1 215 ? 21.055  -22.377 -19.913 1.00 15.86  ? 215 ALA A CA  1 
ATOM   1627 C  C   . ALA A 1 215 ? 22.249  -21.505 -20.327 1.00 22.35  ? 215 ALA A C   1 
ATOM   1628 O  O   . ALA A 1 215 ? 23.255  -22.067 -20.768 1.00 24.32  ? 215 ALA A O   1 
ATOM   1629 C  CB  . ALA A 1 215 ? 19.909  -22.237 -20.892 1.00 15.80  ? 215 ALA A CB  1 
ATOM   1630 N  N   . ALA A 1 216 ? 22.184  -20.169 -20.105 1.00 17.53  ? 216 ALA A N   1 
ATOM   1631 C  CA  . ALA A 1 216 ? 23.240  -19.231 -20.504 1.00 17.14  ? 216 ALA A CA  1 
ATOM   1632 C  C   . ALA A 1 216 ? 24.602  -19.535 -19.848 1.00 23.08  ? 216 ALA A C   1 
ATOM   1633 O  O   . ALA A 1 216 ? 25.592  -19.661 -20.565 1.00 23.18  ? 216 ALA A O   1 
ATOM   1634 C  CB  . ALA A 1 216 ? 22.802  -17.790 -20.269 1.00 17.40  ? 216 ALA A CB  1 
ATOM   1635 N  N   . VAL A 1 217 ? 24.639  -19.743 -18.518 1.00 20.34  ? 217 VAL A N   1 
ATOM   1636 C  CA  . VAL A 1 217 ? 25.870  -20.117 -17.793 1.00 19.90  ? 217 VAL A CA  1 
ATOM   1637 C  C   . VAL A 1 217 ? 26.361  -21.535 -18.237 1.00 24.58  ? 217 VAL A C   1 
ATOM   1638 O  O   . VAL A 1 217 ? 27.563  -21.731 -18.452 1.00 25.05  ? 217 VAL A O   1 
ATOM   1639 C  CB  . VAL A 1 217 ? 25.692  -20.002 -16.241 1.00 22.44  ? 217 VAL A CB  1 
ATOM   1640 C  CG1 . VAL A 1 217 ? 26.876  -20.604 -15.491 1.00 21.46  ? 217 VAL A CG1 1 
ATOM   1641 C  CG2 . VAL A 1 217 ? 25.462  -18.549 -15.809 1.00 21.81  ? 217 VAL A CG2 1 
ATOM   1642 N  N   . LEU A 1 218 ? 25.444  -22.497 -18.400 1.00 20.83  ? 218 LEU A N   1 
ATOM   1643 C  CA  . LEU A 1 218 ? 25.847  -23.841 -18.818 1.00 21.74  ? 218 LEU A CA  1 
ATOM   1644 C  C   . LEU A 1 218 ? 26.480  -23.871 -20.202 1.00 27.09  ? 218 LEU A C   1 
ATOM   1645 O  O   . LEU A 1 218 ? 27.496  -24.537 -20.376 1.00 26.65  ? 218 LEU A O   1 
ATOM   1646 C  CB  . LEU A 1 218 ? 24.704  -24.867 -18.729 1.00 21.72  ? 218 LEU A CB  1 
ATOM   1647 C  CG  . LEU A 1 218 ? 24.320  -25.393 -17.368 1.00 25.42  ? 218 LEU A CG  1 
ATOM   1648 C  CD1 . LEU A 1 218 ? 23.336  -26.509 -17.506 1.00 25.16  ? 218 LEU A CD1 1 
ATOM   1649 C  CD2 . LEU A 1 218 ? 25.536  -25.807 -16.538 1.00 26.84  ? 218 LEU A CD2 1 
ATOM   1650 N  N   . ASN A 1 219 ? 25.915  -23.116 -21.165 1.00 24.58  ? 219 ASN A N   1 
ATOM   1651 C  CA  . ASN A 1 219 ? 26.440  -23.020 -22.530 1.00 24.35  ? 219 ASN A CA  1 
ATOM   1652 C  C   . ASN A 1 219 ? 27.745  -22.258 -22.595 1.00 27.86  ? 219 ASN A C   1 
ATOM   1653 O  O   . ASN A 1 219 ? 28.575  -22.554 -23.446 1.00 26.48  ? 219 ASN A O   1 
ATOM   1654 C  CB  . ASN A 1 219 ? 25.392  -22.472 -23.493 1.00 27.41  ? 219 ASN A CB  1 
ATOM   1655 C  CG  . ASN A 1 219 ? 24.381  -23.565 -23.811 1.00 61.94  ? 219 ASN A CG  1 
ATOM   1656 O  OD1 . ASN A 1 219 ? 24.744  -24.669 -24.262 1.00 52.56  ? 219 ASN A OD1 1 
ATOM   1657 N  ND2 . ASN A 1 219 ? 23.108  -23.337 -23.480 1.00 55.96  ? 219 ASN A ND2 1 
ATOM   1658 N  N   . TYR A 1 220 ? 27.963  -21.329 -21.646 1.00 25.13  ? 220 TYR A N   1 
ATOM   1659 C  CA  . TYR A 1 220 ? 29.217  -20.602 -21.542 1.00 23.75  ? 220 TYR A CA  1 
ATOM   1660 C  C   . TYR A 1 220 ? 30.314  -21.551 -21.037 1.00 28.98  ? 220 TYR A C   1 
ATOM   1661 O  O   . TYR A 1 220 ? 31.423  -21.563 -21.580 1.00 30.52  ? 220 TYR A O   1 
ATOM   1662 C  CB  . TYR A 1 220 ? 29.076  -19.381 -20.614 1.00 23.26  ? 220 TYR A CB  1 
ATOM   1663 C  CG  . TYR A 1 220 ? 30.418  -18.777 -20.262 1.00 23.25  ? 220 TYR A CG  1 
ATOM   1664 C  CD1 . TYR A 1 220 ? 31.148  -18.056 -21.205 1.00 24.25  ? 220 TYR A CD1 1 
ATOM   1665 C  CD2 . TYR A 1 220 ? 31.012  -19.018 -19.018 1.00 22.99  ? 220 TYR A CD2 1 
ATOM   1666 C  CE1 . TYR A 1 220 ? 32.400  -17.533 -20.903 1.00 24.39  ? 220 TYR A CE1 1 
ATOM   1667 C  CE2 . TYR A 1 220 ? 32.269  -18.508 -18.711 1.00 23.15  ? 220 TYR A CE2 1 
ATOM   1668 C  CZ  . TYR A 1 220 ? 32.948  -17.748 -19.652 1.00 33.88  ? 220 TYR A CZ  1 
ATOM   1669 O  OH  . TYR A 1 220 ? 34.181  -17.212 -19.372 1.00 42.91  ? 220 TYR A OH  1 
ATOM   1670 N  N   . LYS A 1 221 ? 30.008  -22.321 -19.988 1.00 25.30  ? 221 LYS A N   1 
ATOM   1671 C  CA  . LYS A 1 221 ? 30.946  -23.272 -19.389 1.00 25.02  ? 221 LYS A CA  1 
ATOM   1672 C  C   . LYS A 1 221 ? 31.263  -24.420 -20.314 1.00 29.69  ? 221 LYS A C   1 
ATOM   1673 O  O   . LYS A 1 221 ? 32.406  -24.857 -20.328 1.00 30.12  ? 221 LYS A O   1 
ATOM   1674 C  CB  . LYS A 1 221 ? 30.470  -23.777 -18.006 1.00 26.47  ? 221 LYS A CB  1 
ATOM   1675 C  CG  . LYS A 1 221 ? 30.423  -22.685 -16.941 1.00 31.64  ? 221 LYS A CG  1 
ATOM   1676 C  CD  . LYS A 1 221 ? 31.781  -22.335 -16.346 1.00 32.89  ? 221 LYS A CD  1 
ATOM   1677 C  CE  . LYS A 1 221 ? 31.571  -21.338 -15.239 1.00 46.02  ? 221 LYS A CE  1 
ATOM   1678 N  NZ  . LYS A 1 221 ? 32.856  -20.822 -14.705 1.00 62.71  ? 221 LYS A NZ  1 
ATOM   1679 N  N   . ALA A 1 222 ? 30.270  -24.902 -21.093 1.00 26.78  ? 222 ALA A N   1 
ATOM   1680 C  CA  . ALA A 1 222 ? 30.466  -25.981 -22.070 1.00 26.88  ? 222 ALA A CA  1 
ATOM   1681 C  C   . ALA A 1 222 ? 31.415  -25.537 -23.181 1.00 32.20  ? 222 ALA A C   1 
ATOM   1682 O  O   . ALA A 1 222 ? 32.257  -26.326 -23.602 1.00 32.56  ? 222 ALA A O   1 
ATOM   1683 C  CB  . ALA A 1 222 ? 29.139  -26.414 -22.669 1.00 27.17  ? 222 ALA A CB  1 
ATOM   1684 N  N   . GLY A 1 223 ? 31.299  -24.277 -23.602 1.00 29.40  ? 223 GLY A N   1 
ATOM   1685 C  CA  . GLY A 1 223 ? 32.114  -23.697 -24.670 1.00 29.62  ? 223 GLY A CA  1 
ATOM   1686 C  C   . GLY A 1 223 ? 33.592  -23.548 -24.356 1.00 34.67  ? 223 GLY A C   1 
ATOM   1687 O  O   . GLY A 1 223 ? 34.420  -23.636 -25.261 1.00 34.80  ? 223 GLY A O   1 
ATOM   1688 N  N   . ARG A 1 224 ? 33.931  -23.342 -23.066 1.00 32.03  ? 224 ARG A N   1 
ATOM   1689 C  CA  . ARG A 1 224 ? 35.288  -23.133 -22.544 1.00 31.31  ? 224 ARG A CA  1 
ATOM   1690 C  C   . ARG A 1 224 ? 35.830  -24.336 -21.770 1.00 38.07  ? 224 ARG A C   1 
ATOM   1691 O  O   . ARG A 1 224 ? 36.880  -24.228 -21.131 1.00 38.62  ? 224 ARG A O   1 
ATOM   1692 C  CB  . ARG A 1 224 ? 35.349  -21.848 -21.684 1.00 30.26  ? 224 ARG A CB  1 
ATOM   1693 C  CG  . ARG A 1 224 ? 35.026  -20.591 -22.493 1.00 44.14  ? 224 ARG A CG  1 
ATOM   1694 C  CD  . ARG A 1 224 ? 35.840  -19.372 -22.118 1.00 58.82  ? 224 ARG A CD  1 
ATOM   1695 N  NE  . ARG A 1 224 ? 35.405  -18.204 -22.892 1.00 72.71  ? 224 ARG A NE  1 
ATOM   1696 C  CZ  . ARG A 1 224 ? 35.860  -16.964 -22.718 1.00 84.83  ? 224 ARG A CZ  1 
ATOM   1697 N  NH1 . ARG A 1 224 ? 36.774  -16.708 -21.788 1.00 72.19  ? 224 ARG A NH1 1 
ATOM   1698 N  NH2 . ARG A 1 224 ? 35.399  -15.971 -23.467 1.00 65.33  ? 224 ARG A NH2 1 
ATOM   1699 N  N   . ASP A 1 225 ? 35.144  -25.486 -21.843 1.00 36.04  ? 225 ASP A N   1 
ATOM   1700 C  CA  . ASP A 1 225 ? 35.592  -26.694 -21.156 1.00 36.55  ? 225 ASP A CA  1 
ATOM   1701 C  C   . ASP A 1 225 ? 36.851  -27.362 -21.780 1.00 41.45  ? 225 ASP A C   1 
ATOM   1702 O  O   . ASP A 1 225 ? 36.856  -27.716 -22.969 1.00 39.90  ? 225 ASP A O   1 
ATOM   1703 C  CB  . ASP A 1 225 ? 34.457  -27.713 -21.025 1.00 38.30  ? 225 ASP A CB  1 
ATOM   1704 C  CG  . ASP A 1 225 ? 34.809  -28.792 -20.030 1.00 45.99  ? 225 ASP A CG  1 
ATOM   1705 O  OD1 . ASP A 1 225 ? 34.992  -28.456 -18.837 1.00 47.27  ? 225 ASP A OD1 1 
ATOM   1706 O  OD2 . ASP A 1 225 ? 34.953  -29.967 -20.452 1.00 47.46  ? 225 ASP A OD2 1 
ATOM   1707 N  N   . GLU A 1 226 ? 37.883  -27.567 -20.935 1.00 39.27  ? 226 GLU A N   1 
ATOM   1708 C  CA  . GLU A 1 226 ? 39.160  -28.203 -21.265 1.00 40.13  ? 226 GLU A CA  1 
ATOM   1709 C  C   . GLU A 1 226 ? 38.952  -29.650 -21.771 1.00 45.59  ? 226 GLU A C   1 
ATOM   1710 O  O   . GLU A 1 226 ? 38.536  -30.531 -21.004 1.00 44.30  ? 226 GLU A O   1 
ATOM   1711 C  CB  . GLU A 1 226 ? 40.062  -28.200 -20.037 1.00 40.99  ? 226 GLU A CB  1 
ATOM   1712 N  N   . GLY A 1 227 ? 39.216  -29.846 -23.069 1.00 43.56  ? 227 GLY A N   1 
ATOM   1713 C  CA  . GLY A 1 227 ? 39.047  -31.112 -23.774 1.00 43.34  ? 227 GLY A CA  1 
ATOM   1714 C  C   . GLY A 1 227 ? 37.678  -31.313 -24.405 1.00 48.75  ? 227 GLY A C   1 
ATOM   1715 O  O   . GLY A 1 227 ? 37.477  -32.299 -25.120 1.00 48.81  ? 227 GLY A O   1 
ATOM   1716 N  N   . CYS A 1 228 ? 36.722  -30.379 -24.151 1.00 45.94  ? 228 CYS A N   1 
ATOM   1717 C  CA  . CYS A 1 228 ? 35.316  -30.411 -24.611 1.00 46.04  ? 228 CYS A CA  1 
ATOM   1718 C  C   . CYS A 1 228 ? 34.574  -31.692 -24.153 1.00 45.76  ? 228 CYS A C   1 
ATOM   1719 O  O   . CYS A 1 228 ? 33.772  -32.268 -24.898 1.00 44.90  ? 228 CYS A O   1 
ATOM   1720 C  CB  . CYS A 1 228 ? 35.187  -30.171 -26.118 1.00 47.43  ? 228 CYS A CB  1 
ATOM   1721 S  SG  . CYS A 1 228 ? 36.010  -28.664 -26.708 1.00 52.04  ? 228 CYS A SG  1 
ATOM   1722 N  N   . LYS A 1 229 ? 34.843  -32.102 -22.899 1.00 39.57  ? 229 LYS A N   1 
ATOM   1723 C  CA  . LYS A 1 229 ? 34.281  -33.275 -22.234 1.00 38.24  ? 229 LYS A CA  1 
ATOM   1724 C  C   . LYS A 1 229 ? 32.837  -33.081 -21.747 1.00 38.98  ? 229 LYS A C   1 
ATOM   1725 O  O   . LYS A 1 229 ? 32.061  -34.039 -21.744 1.00 37.31  ? 229 LYS A O   1 
ATOM   1726 C  CB  . LYS A 1 229 ? 35.170  -33.664 -21.063 1.00 39.06  ? 229 LYS A CB  1 
ATOM   1727 N  N   . LEU A 1 230 ? 32.494  -31.855 -21.300 1.00 34.52  ? 230 LEU A N   1 
ATOM   1728 C  CA  . LEU A 1 230 ? 31.170  -31.523 -20.763 1.00 33.00  ? 230 LEU A CA  1 
ATOM   1729 C  C   . LEU A 1 230 ? 30.322  -30.795 -21.760 1.00 34.21  ? 230 LEU A C   1 
ATOM   1730 O  O   . LEU A 1 230 ? 30.700  -29.743 -22.283 1.00 33.98  ? 230 LEU A O   1 
ATOM   1731 C  CB  . LEU A 1 230 ? 31.248  -30.737 -19.441 1.00 32.95  ? 230 LEU A CB  1 
ATOM   1732 C  CG  . LEU A 1 230 ? 32.001  -31.390 -18.270 1.00 36.99  ? 230 LEU A CG  1 
ATOM   1733 C  CD1 . LEU A 1 230 ? 31.898  -30.520 -17.014 1.00 36.92  ? 230 LEU A CD1 1 
ATOM   1734 C  CD2 . LEU A 1 230 ? 31.510  -32.825 -18.001 1.00 37.71  ? 230 LEU A CD2 1 
ATOM   1735 N  N   . VAL A 1 231 ? 29.159  -31.379 -22.042 1.00 28.59  ? 231 VAL A N   1 
ATOM   1736 C  CA  . VAL A 1 231 ? 28.225  -30.855 -23.030 1.00 26.19  ? 231 VAL A CA  1 
ATOM   1737 C  C   . VAL A 1 231 ? 26.830  -30.696 -22.428 1.00 28.63  ? 231 VAL A C   1 
ATOM   1738 O  O   . VAL A 1 231 ? 26.476  -31.403 -21.485 1.00 26.38  ? 231 VAL A O   1 
ATOM   1739 C  CB  . VAL A 1 231 ? 28.192  -31.777 -24.301 1.00 28.33  ? 231 VAL A CB  1 
ATOM   1740 C  CG1 . VAL A 1 231 ? 29.569  -31.872 -24.965 1.00 28.00  ? 231 VAL A CG1 1 
ATOM   1741 C  CG2 . VAL A 1 231 ? 27.648  -33.174 -23.986 1.00 27.56  ? 231 VAL A CG2 1 
ATOM   1742 N  N   . THR A 1 232 ? 26.028  -29.814 -23.031 1.00 27.38  ? 232 THR A N   1 
ATOM   1743 C  CA  . THR A 1 232 ? 24.612  -29.636 -22.723 1.00 28.32  ? 232 THR A CA  1 
ATOM   1744 C  C   . THR A 1 232 ? 23.865  -30.574 -23.682 1.00 35.20  ? 232 THR A C   1 
ATOM   1745 O  O   . THR A 1 232 ? 24.297  -30.744 -24.828 1.00 36.22  ? 232 THR A O   1 
ATOM   1746 C  CB  . THR A 1 232 ? 24.184  -28.157 -22.800 1.00 35.04  ? 232 THR A CB  1 
ATOM   1747 O  OG1 . THR A 1 232 ? 24.625  -27.600 -24.031 1.00 38.32  ? 232 THR A OG1 1 
ATOM   1748 C  CG2 . THR A 1 232 ? 24.734  -27.322 -21.644 1.00 30.35  ? 232 THR A CG2 1 
ATOM   1749 N  N   . ILE A 1 233 ? 22.805  -31.235 -23.205 1.00 32.77  ? 233 ILE A N   1 
ATOM   1750 C  CA  . ILE A 1 233 ? 22.044  -32.208 -23.998 1.00 33.33  ? 233 ILE A CA  1 
ATOM   1751 C  C   . ILE A 1 233 ? 21.273  -31.511 -25.136 1.00 40.15  ? 233 ILE A C   1 
ATOM   1752 O  O   . ILE A 1 233 ? 20.943  -30.321 -25.011 1.00 40.32  ? 233 ILE A O   1 
ATOM   1753 C  CB  . ILE A 1 233 ? 21.162  -33.144 -23.122 1.00 36.25  ? 233 ILE A CB  1 
ATOM   1754 C  CG1 . ILE A 1 233 ? 19.937  -32.437 -22.540 1.00 37.34  ? 233 ILE A CG1 1 
ATOM   1755 C  CG2 . ILE A 1 233 ? 21.976  -33.792 -22.020 1.00 35.78  ? 233 ILE A CG2 1 
ATOM   1756 C  CD1 . ILE A 1 233 ? 18.668  -32.830 -23.194 1.00 53.39  ? 233 ILE A CD1 1 
ATOM   1757 N  N   . GLY A 1 234 ? 21.028  -32.256 -26.231 1.00 37.52  ? 234 GLY A N   1 
ATOM   1758 C  CA  . GLY A 1 234 ? 20.395  -31.755 -27.451 1.00 37.27  ? 234 GLY A CA  1 
ATOM   1759 C  C   . GLY A 1 234 ? 21.385  -30.866 -28.182 1.00 43.58  ? 234 GLY A C   1 
ATOM   1760 O  O   . GLY A 1 234 ? 22.598  -31.027 -28.020 1.00 44.12  ? 234 GLY A O   1 
ATOM   1761 N  N   . SER A 1 235 ? 20.917  -29.879 -28.927 1.00 41.76  ? 235 SER A N   1 
ATOM   1762 C  CA  . SER A 1 235 ? 21.876  -28.993 -29.601 1.00 43.09  ? 235 SER A CA  1 
ATOM   1763 C  C   . SER A 1 235 ? 22.219  -27.859 -28.631 1.00 46.62  ? 235 SER A C   1 
ATOM   1764 O  O   . SER A 1 235 ? 22.337  -26.691 -29.032 1.00 47.04  ? 235 SER A O   1 
ATOM   1765 C  CB  . SER A 1 235 ? 21.253  -28.440 -30.882 1.00 44.41  ? 235 SER A CB  1 
ATOM   1766 N  N   . GLY A 1 236 ? 22.384  -28.221 -27.357 1.00 40.99  ? 236 GLY A N   1 
ATOM   1767 C  CA  . GLY A 1 236 ? 22.505  -27.261 -26.272 1.00 39.16  ? 236 GLY A CA  1 
ATOM   1768 C  C   . GLY A 1 236 ? 21.103  -26.706 -26.113 1.00 39.65  ? 236 GLY A C   1 
ATOM   1769 O  O   . GLY A 1 236 ? 20.893  -25.499 -26.227 1.00 40.94  ? 236 GLY A O   1 
ATOM   1770 N  N   . TYR A 1 237 ? 20.118  -27.628 -26.004 1.00 32.33  ? 237 TYR A N   1 
ATOM   1771 C  CA  . TYR A 1 237 ? 18.679  -27.369 -25.919 1.00 30.70  ? 237 TYR A CA  1 
ATOM   1772 C  C   . TYR A 1 237 ? 18.269  -26.619 -24.656 1.00 31.20  ? 237 TYR A C   1 
ATOM   1773 O  O   . TYR A 1 237 ? 18.783  -26.913 -23.581 1.00 31.02  ? 237 TYR A O   1 
ATOM   1774 C  CB  . TYR A 1 237 ? 17.881  -28.688 -26.047 1.00 31.80  ? 237 TYR A CB  1 
ATOM   1775 C  CG  . TYR A 1 237 ? 16.381  -28.473 -26.125 1.00 33.62  ? 237 TYR A CG  1 
ATOM   1776 C  CD1 . TYR A 1 237 ? 15.765  -28.152 -27.332 1.00 35.85  ? 237 TYR A CD1 1 
ATOM   1777 C  CD2 . TYR A 1 237 ? 15.581  -28.561 -24.987 1.00 34.32  ? 237 TYR A CD2 1 
ATOM   1778 C  CE1 . TYR A 1 237 ? 14.398  -27.894 -27.402 1.00 37.55  ? 237 TYR A CE1 1 
ATOM   1779 C  CE2 . TYR A 1 237 ? 14.214  -28.291 -25.041 1.00 35.36  ? 237 TYR A CE2 1 
ATOM   1780 C  CZ  . TYR A 1 237 ? 13.626  -27.962 -26.253 1.00 46.69  ? 237 TYR A CZ  1 
ATOM   1781 O  OH  . TYR A 1 237 ? 12.279  -27.719 -26.329 1.00 52.58  ? 237 TYR A OH  1 
ATOM   1782 N  N   . ILE A 1 238 ? 17.297  -25.690 -24.781 1.00 25.08  ? 238 ILE A N   1 
ATOM   1783 C  CA  . ILE A 1 238 ? 16.774  -24.918 -23.651 1.00 22.98  ? 238 ILE A CA  1 
ATOM   1784 C  C   . ILE A 1 238 ? 15.325  -25.304 -23.312 1.00 25.50  ? 238 ILE A C   1 
ATOM   1785 O  O   . ILE A 1 238 ? 14.465  -25.167 -24.173 1.00 26.18  ? 238 ILE A O   1 
ATOM   1786 C  CB  . ILE A 1 238 ? 16.915  -23.386 -23.911 1.00 25.03  ? 238 ILE A CB  1 
ATOM   1787 C  CG1 . ILE A 1 238 ? 18.369  -22.981 -24.241 1.00 24.26  ? 238 ILE A CG1 1 
ATOM   1788 C  CG2 . ILE A 1 238 ? 16.342  -22.557 -22.744 1.00 24.95  ? 238 ILE A CG2 1 
ATOM   1789 C  CD1 . ILE A 1 238 ? 18.500  -21.539 -24.775 1.00 22.44  ? 238 ILE A CD1 1 
ATOM   1790 N  N   . PHE A 1 239 ? 15.038  -25.759 -22.075 1.00 21.46  ? 239 PHE A N   1 
ATOM   1791 C  CA  . PHE A 1 239 ? 13.639  -25.975 -21.656 1.00 20.95  ? 239 PHE A CA  1 
ATOM   1792 C  C   . PHE A 1 239 ? 13.203  -24.682 -20.933 1.00 23.21  ? 239 PHE A C   1 
ATOM   1793 O  O   . PHE A 1 239 ? 14.036  -24.038 -20.267 1.00 21.61  ? 239 PHE A O   1 
ATOM   1794 C  CB  . PHE A 1 239 ? 13.409  -27.215 -20.748 1.00 23.14  ? 239 PHE A CB  1 
ATOM   1795 C  CG  . PHE A 1 239 ? 12.032  -27.256 -20.068 1.00 27.06  ? 239 PHE A CG  1 
ATOM   1796 C  CD1 . PHE A 1 239 ? 10.875  -27.546 -20.800 1.00 31.90  ? 239 PHE A CD1 1 
ATOM   1797 C  CD2 . PHE A 1 239 ? 11.888  -26.938 -18.717 1.00 31.35  ? 239 PHE A CD2 1 
ATOM   1798 C  CE1 . PHE A 1 239 ? 9.607   -27.547 -20.186 1.00 33.20  ? 239 PHE A CE1 1 
ATOM   1799 C  CE2 . PHE A 1 239 ? 10.616  -26.952 -18.100 1.00 34.90  ? 239 PHE A CE2 1 
ATOM   1800 C  CZ  . PHE A 1 239 ? 9.487   -27.250 -18.845 1.00 33.24  ? 239 PHE A CZ  1 
ATOM   1801 N  N   . ALA A 1 240 ? 11.898  -24.334 -21.034 1.00 18.62  ? 240 ALA A N   1 
ATOM   1802 C  CA  . ALA A 1 240 ? 11.280  -23.161 -20.379 1.00 18.46  ? 240 ALA A CA  1 
ATOM   1803 C  C   . ALA A 1 240 ? 12.075  -21.890 -20.683 1.00 22.89  ? 240 ALA A C   1 
ATOM   1804 O  O   . ALA A 1 240 ? 12.539  -21.187 -19.787 1.00 23.87  ? 240 ALA A O   1 
ATOM   1805 C  CB  . ALA A 1 240 ? 11.142  -23.385 -18.864 1.00 18.34  ? 240 ALA A CB  1 
ATOM   1806 N  N   . THR A 1 241 ? 12.248  -21.635 -21.959 1.00 19.70  ? 241 THR A N   1 
ATOM   1807 C  CA  . THR A 1 241 ? 13.004  -20.510 -22.492 1.00 20.48  ? 241 THR A CA  1 
ATOM   1808 C  C   . THR A 1 241 ? 12.469  -19.174 -21.963 1.00 24.32  ? 241 THR A C   1 
ATOM   1809 O  O   . THR A 1 241 ? 11.268  -18.941 -21.910 1.00 24.97  ? 241 THR A O   1 
ATOM   1810 C  CB  . THR A 1 241 ? 13.090  -20.605 -24.028 1.00 32.12  ? 241 THR A CB  1 
ATOM   1811 O  OG1 . THR A 1 241 ? 14.010  -19.632 -24.499 1.00 43.50  ? 241 THR A OG1 1 
ATOM   1812 C  CG2 . THR A 1 241 ? 11.753  -20.401 -24.713 1.00 25.05  ? 241 THR A CG2 1 
ATOM   1813 N  N   . THR A 1 242 ? 13.388  -18.356 -21.487 1.00 19.75  ? 242 THR A N   1 
ATOM   1814 C  CA  . THR A 1 242 ? 13.169  -17.035 -20.917 1.00 18.26  ? 242 THR A CA  1 
ATOM   1815 C  C   . THR A 1 242 ? 14.434  -16.203 -21.174 1.00 20.03  ? 242 THR A C   1 
ATOM   1816 O  O   . THR A 1 242 ? 15.277  -16.595 -21.973 1.00 18.94  ? 242 THR A O   1 
ATOM   1817 C  CB  . THR A 1 242 ? 12.806  -17.167 -19.409 1.00 23.56  ? 242 THR A CB  1 
ATOM   1818 O  OG1 . THR A 1 242 ? 12.496  -15.870 -18.894 1.00 14.52  ? 242 THR A OG1 1 
ATOM   1819 C  CG2 . THR A 1 242 ? 13.928  -17.847 -18.564 1.00 21.40  ? 242 THR A CG2 1 
ATOM   1820 N  N   . GLY A 1 243 ? 14.575  -15.086 -20.481 1.00 16.42  ? 243 GLY A N   1 
ATOM   1821 C  CA  . GLY A 1 243 ? 15.781  -14.285 -20.577 1.00 14.67  ? 243 GLY A CA  1 
ATOM   1822 C  C   . GLY A 1 243 ? 16.229  -13.719 -19.253 1.00 17.10  ? 243 GLY A C   1 
ATOM   1823 O  O   . GLY A 1 243 ? 15.530  -13.841 -18.243 1.00 16.77  ? 243 GLY A O   1 
ATOM   1824 N  N   . TYR A 1 244 ? 17.413  -13.106 -19.256 1.00 14.22  ? 244 TYR A N   1 
ATOM   1825 C  CA  . TYR A 1 244 ? 17.909  -12.316 -18.138 1.00 14.41  ? 244 TYR A CA  1 
ATOM   1826 C  C   . TYR A 1 244 ? 17.293  -10.939 -18.425 1.00 19.97  ? 244 TYR A C   1 
ATOM   1827 O  O   . TYR A 1 244 ? 17.196  -10.527 -19.591 1.00 19.26  ? 244 TYR A O   1 
ATOM   1828 C  CB  . TYR A 1 244 ? 19.451  -12.126 -18.177 1.00 13.70  ? 244 TYR A CB  1 
ATOM   1829 C  CG  . TYR A 1 244 ? 20.336  -13.314 -17.855 1.00 13.28  ? 244 TYR A CG  1 
ATOM   1830 C  CD1 . TYR A 1 244 ? 19.844  -14.414 -17.158 1.00 14.64  ? 244 TYR A CD1 1 
ATOM   1831 C  CD2 . TYR A 1 244 ? 21.696  -13.289 -18.149 1.00 14.31  ? 244 TYR A CD2 1 
ATOM   1832 C  CE1 . TYR A 1 244 ? 20.664  -15.492 -16.835 1.00 12.05  ? 244 TYR A CE1 1 
ATOM   1833 C  CE2 . TYR A 1 244 ? 22.513  -14.386 -17.886 1.00 14.82  ? 244 TYR A CE2 1 
ATOM   1834 C  CZ  . TYR A 1 244 ? 21.990  -15.485 -17.232 1.00 17.43  ? 244 TYR A CZ  1 
ATOM   1835 O  OH  . TYR A 1 244 ? 22.825  -16.512 -16.914 1.00 16.30  ? 244 TYR A OH  1 
ATOM   1836 N  N   . GLY A 1 245 ? 16.914  -10.230 -17.386 1.00 18.10  ? 245 GLY A N   1 
ATOM   1837 C  CA  . GLY A 1 245 ? 16.403  -8.872  -17.540 1.00 18.14  ? 245 GLY A CA  1 
ATOM   1838 C  C   . GLY A 1 245 ? 16.830  -7.956  -16.415 1.00 21.15  ? 245 GLY A C   1 
ATOM   1839 O  O   . GLY A 1 245 ? 17.327  -8.415  -15.385 1.00 20.29  ? 245 GLY A O   1 
ATOM   1840 N  N   . ILE A 1 246 ? 16.621  -6.657  -16.591 1.00 19.12  ? 246 ILE A N   1 
ATOM   1841 C  CA  . ILE A 1 246 ? 16.905  -5.697  -15.530 1.00 19.33  ? 246 ILE A CA  1 
ATOM   1842 C  C   . ILE A 1 246 ? 15.657  -5.668  -14.627 1.00 21.80  ? 246 ILE A C   1 
ATOM   1843 O  O   . ILE A 1 246 ? 14.555  -5.440  -15.133 1.00 20.55  ? 246 ILE A O   1 
ATOM   1844 C  CB  . ILE A 1 246 ? 17.304  -4.290  -16.117 1.00 22.44  ? 246 ILE A CB  1 
ATOM   1845 C  CG1 . ILE A 1 246 ? 18.779  -4.278  -16.538 1.00 22.52  ? 246 ILE A CG1 1 
ATOM   1846 C  CG2 . ILE A 1 246 ? 17.064  -3.144  -15.112 1.00 23.72  ? 246 ILE A CG2 1 
ATOM   1847 C  CD1 . ILE A 1 246 ? 18.998  -4.127  -17.946 1.00 37.18  ? 246 ILE A CD1 1 
ATOM   1848 N  N   . ALA A 1 247 ? 15.807  -5.951  -13.320 1.00 18.28  ? 247 ALA A N   1 
ATOM   1849 C  CA  . ALA A 1 247 ? 14.647  -5.834  -12.436 1.00 18.29  ? 247 ALA A CA  1 
ATOM   1850 C  C   . ALA A 1 247 ? 14.574  -4.379  -11.946 1.00 23.85  ? 247 ALA A C   1 
ATOM   1851 O  O   . ALA A 1 247 ? 15.585  -3.801  -11.539 1.00 21.42  ? 247 ALA A O   1 
ATOM   1852 C  CB  . ALA A 1 247 ? 14.756  -6.778  -11.264 1.00 18.80  ? 247 ALA A CB  1 
ATOM   1853 N  N   . LEU A 1 248 ? 13.378  -3.789  -12.032 1.00 21.75  ? 248 LEU A N   1 
ATOM   1854 C  CA  . LEU A 1 248 ? 13.052  -2.417  -11.619 1.00 21.01  ? 248 LEU A CA  1 
ATOM   1855 C  C   . LEU A 1 248 ? 11.856  -2.460  -10.705 1.00 24.02  ? 248 LEU A C   1 
ATOM   1856 O  O   . LEU A 1 248 ? 11.207  -3.509  -10.581 1.00 25.11  ? 248 LEU A O   1 
ATOM   1857 C  CB  . LEU A 1 248 ? 12.706  -1.569  -12.857 1.00 21.33  ? 248 LEU A CB  1 
ATOM   1858 C  CG  . LEU A 1 248 ? 13.820  -1.401  -13.866 1.00 25.99  ? 248 LEU A CG  1 
ATOM   1859 C  CD1 . LEU A 1 248 ? 13.442  -2.022  -15.185 1.00 27.26  ? 248 LEU A CD1 1 
ATOM   1860 C  CD2 . LEU A 1 248 ? 14.204  0.028   -14.011 1.00 25.78  ? 248 LEU A CD2 1 
ATOM   1861 N  N   . GLN A 1 249 ? 11.549  -1.349  -10.036 1.00 20.28  ? 249 GLN A N   1 
ATOM   1862 C  CA  . GLN A 1 249 ? 10.369  -1.346  -9.158  1.00 19.51  ? 249 GLN A CA  1 
ATOM   1863 C  C   . GLN A 1 249 ? 9.092   -1.250  -9.984  1.00 25.70  ? 249 GLN A C   1 
ATOM   1864 O  O   . GLN A 1 249 ? 9.095   -0.700  -11.091 1.00 25.18  ? 249 GLN A O   1 
ATOM   1865 C  CB  . GLN A 1 249 ? 10.452  -0.232  -8.120  1.00 20.30  ? 249 GLN A CB  1 
ATOM   1866 C  CG  . GLN A 1 249 ? 11.719  -0.314  -7.256  1.00 23.18  ? 249 GLN A CG  1 
ATOM   1867 C  CD  . GLN A 1 249 ? 11.982  0.950   -6.478  1.00 40.23  ? 249 GLN A CD  1 
ATOM   1868 O  OE1 . GLN A 1 249 ? 11.068  1.745   -6.177  1.00 35.94  ? 249 GLN A OE1 1 
ATOM   1869 N  NE2 . GLN A 1 249 ? 13.237  1.126   -6.071  1.00 26.84  ? 249 GLN A NE2 1 
ATOM   1870 N  N   . LYS A 1 250 ? 8.005   -1.829  -9.467  1.00 24.22  ? 250 LYS A N   1 
ATOM   1871 C  CA  . LYS A 1 250 ? 6.712   -1.794  -10.126 1.00 24.14  ? 250 LYS A CA  1 
ATOM   1872 C  C   . LYS A 1 250 ? 6.325   -0.341  -10.389 1.00 29.20  ? 250 LYS A C   1 
ATOM   1873 O  O   . LYS A 1 250 ? 6.424   0.498   -9.479  1.00 29.55  ? 250 LYS A O   1 
ATOM   1874 C  CB  . LYS A 1 250 ? 5.663   -2.531  -9.300  1.00 26.98  ? 250 LYS A CB  1 
ATOM   1875 C  CG  . LYS A 1 250 ? 5.914   -4.034  -9.228  1.00 44.41  ? 250 LYS A CG  1 
ATOM   1876 C  CD  . LYS A 1 250 ? 4.627   -4.851  -9.090  1.00 55.43  ? 250 LYS A CD  1 
ATOM   1877 C  CE  . LYS A 1 250 ? 4.052   -5.323  -10.415 1.00 59.94  ? 250 LYS A CE  1 
ATOM   1878 N  NZ  . LYS A 1 250 ? 4.952   -6.262  -11.139 1.00 59.20  ? 250 LYS A NZ  1 
ATOM   1879 N  N   . GLY A 1 251 ? 6.017   -0.038  -11.656 1.00 24.07  ? 251 GLY A N   1 
ATOM   1880 C  CA  . GLY A 1 251 ? 5.650   1.309   -12.077 1.00 23.64  ? 251 GLY A CA  1 
ATOM   1881 C  C   . GLY A 1 251 ? 6.809   2.289   -12.164 1.00 30.05  ? 251 GLY A C   1 
ATOM   1882 O  O   . GLY A 1 251 ? 6.577   3.505   -12.250 1.00 30.04  ? 251 GLY A O   1 
ATOM   1883 N  N   . SER A 1 252 ? 8.068   1.769   -12.182 1.00 27.38  ? 252 SER A N   1 
ATOM   1884 C  CA  . SER A 1 252 ? 9.305   2.558   -12.283 1.00 28.07  ? 252 SER A CA  1 
ATOM   1885 C  C   . SER A 1 252 ? 9.314   3.486   -13.504 1.00 33.91  ? 252 SER A C   1 
ATOM   1886 O  O   . SER A 1 252 ? 8.981   3.044   -14.606 1.00 34.00  ? 252 SER A O   1 
ATOM   1887 C  CB  . SER A 1 252 ? 10.527  1.650   -12.359 1.00 30.75  ? 252 SER A CB  1 
ATOM   1888 O  OG  . SER A 1 252 ? 11.695  2.382   -12.693 1.00 34.81  ? 252 SER A OG  1 
ATOM   1889 N  N   . PRO A 1 253 ? 9.717   4.761   -13.339 1.00 31.32  ? 253 PRO A N   1 
ATOM   1890 C  CA  . PRO A 1 253 ? 9.732   5.665   -14.501 1.00 32.15  ? 253 PRO A CA  1 
ATOM   1891 C  C   . PRO A 1 253 ? 10.933  5.426   -15.431 1.00 37.13  ? 253 PRO A C   1 
ATOM   1892 O  O   . PRO A 1 253 ? 11.043  6.080   -16.468 1.00 38.93  ? 253 PRO A O   1 
ATOM   1893 C  CB  . PRO A 1 253 ? 9.754   7.057   -13.859 1.00 33.73  ? 253 PRO A CB  1 
ATOM   1894 C  CG  . PRO A 1 253 ? 10.450  6.849   -12.546 1.00 36.92  ? 253 PRO A CG  1 
ATOM   1895 C  CD  . PRO A 1 253 ? 10.147  5.450   -12.100 1.00 32.11  ? 253 PRO A CD  1 
ATOM   1896 N  N   . TRP A 1 254 ? 11.819  4.490   -15.067 1.00 30.48  ? 254 TRP A N   1 
ATOM   1897 C  CA  . TRP A 1 254 ? 13.010  4.169   -15.841 1.00 28.98  ? 254 TRP A CA  1 
ATOM   1898 C  C   . TRP A 1 254 ? 12.817  3.122   -16.932 1.00 32.01  ? 254 TRP A C   1 
ATOM   1899 O  O   . TRP A 1 254 ? 13.625  3.090   -17.865 1.00 33.32  ? 254 TRP A O   1 
ATOM   1900 C  CB  . TRP A 1 254 ? 14.130  3.727   -14.897 1.00 27.22  ? 254 TRP A CB  1 
ATOM   1901 C  CG  . TRP A 1 254 ? 14.604  4.844   -14.024 1.00 27.60  ? 254 TRP A CG  1 
ATOM   1902 C  CD1 . TRP A 1 254 ? 14.242  5.087   -12.731 1.00 30.06  ? 254 TRP A CD1 1 
ATOM   1903 C  CD2 . TRP A 1 254 ? 15.431  5.949   -14.427 1.00 27.00  ? 254 TRP A CD2 1 
ATOM   1904 N  NE1 . TRP A 1 254 ? 14.838  6.244   -12.284 1.00 29.04  ? 254 TRP A NE1 1 
ATOM   1905 C  CE2 . TRP A 1 254 ? 15.564  6.801   -13.308 1.00 30.12  ? 254 TRP A CE2 1 
ATOM   1906 C  CE3 . TRP A 1 254 ? 16.066  6.303   -15.631 1.00 27.60  ? 254 TRP A CE3 1 
ATOM   1907 C  CZ2 . TRP A 1 254 ? 16.333  7.969   -13.344 1.00 29.05  ? 254 TRP A CZ2 1 
ATOM   1908 C  CZ3 . TRP A 1 254 ? 16.836  7.460   -15.664 1.00 28.89  ? 254 TRP A CZ3 1 
ATOM   1909 C  CH2 . TRP A 1 254 ? 16.986  8.264   -14.523 1.00 29.21  ? 254 TRP A CH2 1 
ATOM   1910 N  N   . LYS A 1 255 ? 11.791  2.257   -16.812 1.00 25.67  ? 255 LYS A N   1 
ATOM   1911 C  CA  . LYS A 1 255 ? 11.568  1.124   -17.709 1.00 25.75  ? 255 LYS A CA  1 
ATOM   1912 C  C   . LYS A 1 255 ? 11.528  1.464   -19.216 1.00 30.52  ? 255 LYS A C   1 
ATOM   1913 O  O   . LYS A 1 255 ? 12.305  0.883   -19.981 1.00 28.77  ? 255 LYS A O   1 
ATOM   1914 C  CB  . LYS A 1 255 ? 10.331  0.305   -17.310 1.00 27.59  ? 255 LYS A CB  1 
ATOM   1915 C  CG  . LYS A 1 255 ? 10.463  -1.145  -17.797 1.00 37.33  ? 255 LYS A CG  1 
ATOM   1916 C  CD  . LYS A 1 255 ? 9.488   -2.115  -17.144 1.00 42.73  ? 255 LYS A CD  1 
ATOM   1917 C  CE  . LYS A 1 255 ? 8.191   -2.268  -17.898 1.00 40.01  ? 255 LYS A CE  1 
ATOM   1918 N  NZ  . LYS A 1 255 ? 8.406   -2.915  -19.217 1.00 55.42  ? 255 LYS A NZ  1 
ATOM   1919 N  N   . ARG A 1 256 ? 10.646  2.393   -19.628 1.00 28.71  ? 256 ARG A N   1 
ATOM   1920 C  CA  . ARG A 1 256 ? 10.473  2.800   -21.021 1.00 28.75  ? 256 ARG A CA  1 
ATOM   1921 C  C   . ARG A 1 256 ? 11.825  3.106   -21.703 1.00 32.64  ? 256 ARG A C   1 
ATOM   1922 O  O   . ARG A 1 256 ? 12.160  2.498   -22.724 1.00 32.38  ? 256 ARG A O   1 
ATOM   1923 C  CB  . ARG A 1 256 ? 9.487   3.985   -21.109 1.00 29.12  ? 256 ARG A CB  1 
ATOM   1924 C  CG  . ARG A 1 256 ? 9.208   4.452   -22.535 1.00 39.57  ? 256 ARG A CG  1 
ATOM   1925 C  CD  . ARG A 1 256 ? 7.910   5.209   -22.658 1.00 45.73  ? 256 ARG A CD  1 
ATOM   1926 N  NE  . ARG A 1 256 ? 7.566   5.434   -24.063 1.00 60.77  ? 256 ARG A NE  1 
ATOM   1927 C  CZ  . ARG A 1 256 ? 6.407   5.935   -24.484 1.00 73.15  ? 256 ARG A CZ  1 
ATOM   1928 N  NH1 . ARG A 1 256 ? 5.463   6.270   -23.610 1.00 53.79  ? 256 ARG A NH1 1 
ATOM   1929 N  NH2 . ARG A 1 256 ? 6.180   6.098   -25.781 1.00 56.81  ? 256 ARG A NH2 1 
ATOM   1930 N  N   . GLN A 1 257 ? 12.628  3.977   -21.079 1.00 27.98  ? 257 GLN A N   1 
ATOM   1931 C  CA  . GLN A 1 257 ? 13.921  4.367   -21.606 1.00 26.83  ? 257 GLN A CA  1 
ATOM   1932 C  C   . GLN A 1 257 ? 14.968  3.222   -21.555 1.00 27.10  ? 257 GLN A C   1 
ATOM   1933 O  O   . GLN A 1 257 ? 15.793  3.116   -22.467 1.00 25.81  ? 257 GLN A O   1 
ATOM   1934 C  CB  . GLN A 1 257 ? 14.395  5.651   -20.921 1.00 28.56  ? 257 GLN A CB  1 
ATOM   1935 C  CG  . GLN A 1 257 ? 14.914  6.722   -21.886 1.00 51.71  ? 257 GLN A CG  1 
ATOM   1936 C  CD  . GLN A 1 257 ? 13.902  7.239   -22.887 1.00 71.57  ? 257 GLN A CD  1 
ATOM   1937 O  OE1 . GLN A 1 257 ? 13.785  6.567   -24.025 1.00 74.73  ? 257 GLN A OE1 1 
ATOM   1938 N  NE2 . GLN A 1 257 ? 13.296  8.297   -22.697 1.00 50.08  ? 257 GLN A NE2 1 
ATOM   1939 N  N   . ILE A 1 258 ? 14.879  2.329   -20.550 1.00 22.03  ? 258 ILE A N   1 
ATOM   1940 C  CA  . ILE A 1 258 ? 15.781  1.187   -20.444 1.00 21.68  ? 258 ILE A CA  1 
ATOM   1941 C  C   . ILE A 1 258 ? 15.487  0.176   -21.557 1.00 24.72  ? 258 ILE A C   1 
ATOM   1942 O  O   . ILE A 1 258 ? 16.427  -0.226  -22.263 1.00 24.34  ? 258 ILE A O   1 
ATOM   1943 C  CB  . ILE A 1 258 ? 15.827  0.578   -19.010 1.00 24.09  ? 258 ILE A CB  1 
ATOM   1944 C  CG1 . ILE A 1 258 ? 16.637  1.540   -18.098 1.00 24.26  ? 258 ILE A CG1 1 
ATOM   1945 C  CG2 . ILE A 1 258 ? 16.464  -0.846  -19.022 1.00 21.80  ? 258 ILE A CG2 1 
ATOM   1946 C  CD1 . ILE A 1 258 ? 16.567  1.302   -16.702 1.00 29.75  ? 258 ILE A CD1 1 
ATOM   1947 N  N   . ASP A 1 259 ? 14.197  -0.174  -21.767 1.00 20.58  ? 259 ASP A N   1 
ATOM   1948 C  CA  . ASP A 1 259 ? 13.798  -1.069  -22.866 1.00 20.79  ? 259 ASP A CA  1 
ATOM   1949 C  C   . ASP A 1 259 ? 14.207  -0.556  -24.248 1.00 24.31  ? 259 ASP A C   1 
ATOM   1950 O  O   . ASP A 1 259 ? 14.751  -1.332  -25.041 1.00 24.09  ? 259 ASP A O   1 
ATOM   1951 C  CB  . ASP A 1 259 ? 12.292  -1.365  -22.837 1.00 23.16  ? 259 ASP A CB  1 
ATOM   1952 C  CG  . ASP A 1 259 ? 11.875  -2.194  -21.640 1.00 38.21  ? 259 ASP A CG  1 
ATOM   1953 O  OD1 . ASP A 1 259 ? 12.742  -2.479  -20.789 1.00 37.91  ? 259 ASP A OD1 1 
ATOM   1954 O  OD2 . ASP A 1 259 ? 10.674  -2.546  -21.548 1.00 47.00  ? 259 ASP A OD2 1 
ATOM   1955 N  N   . LEU A 1 260 ? 13.991  0.755   -24.522 1.00 20.40  ? 260 LEU A N   1 
ATOM   1956 C  CA  . LEU A 1 260 ? 14.338  1.339   -25.824 1.00 20.00  ? 260 LEU A CA  1 
ATOM   1957 C  C   . LEU A 1 260 ? 15.822  1.339   -26.066 1.00 24.79  ? 260 LEU A C   1 
ATOM   1958 O  O   . LEU A 1 260 ? 16.253  1.010   -27.179 1.00 25.86  ? 260 LEU A O   1 
ATOM   1959 C  CB  . LEU A 1 260 ? 13.722  2.737   -26.040 1.00 20.01  ? 260 LEU A CB  1 
ATOM   1960 C  CG  . LEU A 1 260 ? 12.177  2.769   -26.135 1.00 24.46  ? 260 LEU A CG  1 
ATOM   1961 C  CD1 . LEU A 1 260 ? 11.647  4.181   -26.092 1.00 23.51  ? 260 LEU A CD1 1 
ATOM   1962 C  CD2 . LEU A 1 260 ? 11.677  2.078   -27.389 1.00 28.52  ? 260 LEU A CD2 1 
ATOM   1963 N  N   . ALA A 1 261 ? 16.614  1.654   -25.024 1.00 20.62  ? 261 ALA A N   1 
ATOM   1964 C  CA  . ALA A 1 261 ? 18.074  1.646   -25.133 1.00 19.88  ? 261 ALA A CA  1 
ATOM   1965 C  C   . ALA A 1 261 ? 18.600  0.229   -25.373 1.00 23.49  ? 261 ALA A C   1 
ATOM   1966 O  O   . ALA A 1 261 ? 19.446  0.058   -26.262 1.00 23.93  ? 261 ALA A O   1 
ATOM   1967 C  CB  . ALA A 1 261 ? 18.715  2.274   -23.909 1.00 20.28  ? 261 ALA A CB  1 
ATOM   1968 N  N   . LEU A 1 262 ? 18.054  -0.801  -24.661 1.00 18.64  ? 262 LEU A N   1 
ATOM   1969 C  CA  . LEU A 1 262 ? 18.497  -2.196  -24.901 1.00 18.22  ? 262 LEU A CA  1 
ATOM   1970 C  C   . LEU A 1 262 ? 18.187  -2.637  -26.319 1.00 24.34  ? 262 LEU A C   1 
ATOM   1971 O  O   . LEU A 1 262 ? 19.028  -3.262  -26.965 1.00 24.26  ? 262 LEU A O   1 
ATOM   1972 C  CB  . LEU A 1 262 ? 17.890  -3.206  -23.918 1.00 17.38  ? 262 LEU A CB  1 
ATOM   1973 C  CG  . LEU A 1 262 ? 18.387  -3.147  -22.446 1.00 20.69  ? 262 LEU A CG  1 
ATOM   1974 C  CD1 . LEU A 1 262 ? 17.441  -3.926  -21.524 1.00 19.93  ? 262 LEU A CD1 1 
ATOM   1975 C  CD2 . LEU A 1 262 ? 19.830  -3.654  -22.301 1.00 17.81  ? 262 LEU A CD2 1 
ATOM   1976 N  N   . LEU A 1 263 ? 16.981  -2.275  -26.817 1.00 21.26  ? 263 LEU A N   1 
ATOM   1977 C  CA  . LEU A 1 263 ? 16.550  -2.628  -28.163 1.00 19.81  ? 263 LEU A CA  1 
ATOM   1978 C  C   . LEU A 1 263 ? 17.371  -1.874  -29.227 1.00 23.97  ? 263 LEU A C   1 
ATOM   1979 O  O   . LEU A 1 263 ? 17.659  -2.419  -30.294 1.00 24.72  ? 263 LEU A O   1 
ATOM   1980 C  CB  . LEU A 1 263 ? 15.022  -2.463  -28.307 1.00 18.93  ? 263 LEU A CB  1 
ATOM   1981 C  CG  . LEU A 1 263 ? 14.148  -3.470  -27.491 1.00 20.99  ? 263 LEU A CG  1 
ATOM   1982 C  CD1 . LEU A 1 263 ? 12.734  -3.063  -27.473 1.00 18.17  ? 263 LEU A CD1 1 
ATOM   1983 C  CD2 . LEU A 1 263 ? 14.253  -4.887  -28.008 1.00 23.01  ? 263 LEU A CD2 1 
ATOM   1984 N  N   . GLN A 1 264 ? 17.839  -0.677  -28.891 1.00 20.46  ? 264 GLN A N   1 
ATOM   1985 C  CA  . GLN A 1 264 ? 18.710  0.079   -29.770 1.00 21.57  ? 264 GLN A CA  1 
ATOM   1986 C  C   . GLN A 1 264 ? 20.076  -0.620  -29.854 1.00 23.80  ? 264 GLN A C   1 
ATOM   1987 O  O   . GLN A 1 264 ? 20.604  -0.724  -30.944 1.00 22.93  ? 264 GLN A O   1 
ATOM   1988 C  CB  . GLN A 1 264 ? 18.848  1.523   -29.270 1.00 24.39  ? 264 GLN A CB  1 
ATOM   1989 C  CG  . GLN A 1 264 ? 19.600  2.465   -30.195 1.00 39.39  ? 264 GLN A CG  1 
ATOM   1990 C  CD  . GLN A 1 264 ? 20.367  3.479   -29.390 1.00 63.37  ? 264 GLN A CD  1 
ATOM   1991 O  OE1 . GLN A 1 264 ? 19.808  4.454   -28.869 1.00 54.34  ? 264 GLN A OE1 1 
ATOM   1992 N  NE2 . GLN A 1 264 ? 21.668  3.244   -29.240 1.00 64.49  ? 264 GLN A NE2 1 
ATOM   1993 N  N   . PHE A 1 265 ? 20.610  -1.155  -28.739 1.00 22.19  ? 265 PHE A N   1 
ATOM   1994 C  CA  . PHE A 1 265 ? 21.908  -1.866  -28.743 1.00 23.11  ? 265 PHE A CA  1 
ATOM   1995 C  C   . PHE A 1 265 ? 21.860  -3.117  -29.617 1.00 31.14  ? 265 PHE A C   1 
ATOM   1996 O  O   . PHE A 1 265 ? 22.864  -3.457  -30.259 1.00 32.13  ? 265 PHE A O   1 
ATOM   1997 C  CB  . PHE A 1 265 ? 22.448  -2.200  -27.323 1.00 23.81  ? 265 PHE A CB  1 
ATOM   1998 C  CG  . PHE A 1 265 ? 22.462  -1.091  -26.295 1.00 24.55  ? 265 PHE A CG  1 
ATOM   1999 C  CD1 . PHE A 1 265 ? 22.684  0.227   -26.668 1.00 26.44  ? 265 PHE A CD1 1 
ATOM   2000 C  CD2 . PHE A 1 265 ? 22.270  -1.369  -24.947 1.00 26.61  ? 265 PHE A CD2 1 
ATOM   2001 C  CE1 . PHE A 1 265 ? 22.655  1.251   -25.718 1.00 26.84  ? 265 PHE A CE1 1 
ATOM   2002 C  CE2 . PHE A 1 265 ? 22.281  -0.348  -23.997 1.00 28.03  ? 265 PHE A CE2 1 
ATOM   2003 C  CZ  . PHE A 1 265 ? 22.458  0.955   -24.390 1.00 25.44  ? 265 PHE A CZ  1 
ATOM   2004 N  N   . VAL A 1 266 ? 20.695  -3.785  -29.640 1.00 28.97  ? 266 VAL A N   1 
ATOM   2005 C  CA  . VAL A 1 266 ? 20.411  -4.967  -30.458 1.00 30.22  ? 266 VAL A CA  1 
ATOM   2006 C  C   . VAL A 1 266 ? 20.472  -4.569  -31.943 1.00 37.26  ? 266 VAL A C   1 
ATOM   2007 O  O   . VAL A 1 266 ? 21.189  -5.203  -32.726 1.00 36.82  ? 266 VAL A O   1 
ATOM   2008 C  CB  . VAL A 1 266 ? 19.030  -5.575  -30.089 1.00 33.64  ? 266 VAL A CB  1 
ATOM   2009 C  CG1 . VAL A 1 266 ? 18.559  -6.608  -31.113 1.00 33.28  ? 266 VAL A CG1 1 
ATOM   2010 C  CG2 . VAL A 1 266 ? 19.068  -6.175  -28.704 1.00 33.09  ? 266 VAL A CG2 1 
ATOM   2011 N  N   . GLY A 1 267 ? 19.735  -3.513  -32.289 1.00 35.33  ? 267 GLY A N   1 
ATOM   2012 C  CA  . GLY A 1 267 ? 19.650  -2.994  -33.649 1.00 35.64  ? 267 GLY A CA  1 
ATOM   2013 C  C   . GLY A 1 267 ? 20.887  -2.316  -34.199 1.00 40.46  ? 267 GLY A C   1 
ATOM   2014 O  O   . GLY A 1 267 ? 21.066  -2.313  -35.413 1.00 40.24  ? 267 GLY A O   1 
ATOM   2015 N  N   . ASP A 1 268 ? 21.718  -1.693  -33.329 1.00 38.40  ? 268 ASP A N   1 
ATOM   2016 C  CA  . ASP A 1 268 ? 22.956  -0.963  -33.680 1.00 38.69  ? 268 ASP A CA  1 
ATOM   2017 C  C   . ASP A 1 268 ? 24.190  -1.860  -33.816 1.00 40.12  ? 268 ASP A C   1 
ATOM   2018 O  O   . ASP A 1 268 ? 25.241  -1.368  -34.236 1.00 39.92  ? 268 ASP A O   1 
ATOM   2019 C  CB  . ASP A 1 268 ? 23.275  0.101   -32.611 1.00 42.19  ? 268 ASP A CB  1 
ATOM   2020 C  CG  . ASP A 1 268 ? 22.468  1.390   -32.650 1.00 64.11  ? 268 ASP A CG  1 
ATOM   2021 O  OD1 . ASP A 1 268 ? 21.712  1.598   -33.634 1.00 66.51  ? 268 ASP A OD1 1 
ATOM   2022 O  OD2 . ASP A 1 268 ? 22.622  2.214   -31.714 1.00 72.57  ? 268 ASP A OD2 1 
ATOM   2023 N  N   . GLY A 1 269 ? 24.077  -3.120  -33.386 1.00 34.24  ? 269 GLY A N   1 
ATOM   2024 C  CA  . GLY A 1 269 ? 25.159  -4.098  -33.429 1.00 33.52  ? 269 GLY A CA  1 
ATOM   2025 C  C   . GLY A 1 269 ? 26.012  -4.215  -32.176 1.00 37.61  ? 269 GLY A C   1 
ATOM   2026 O  O   . GLY A 1 269 ? 26.914  -5.059  -32.126 1.00 37.84  ? 269 GLY A O   1 
ATOM   2027 N  N   . GLU A 1 270 ? 25.727  -3.386  -31.146 1.00 33.18  ? 270 GLU A N   1 
ATOM   2028 C  CA  . GLU A 1 270 ? 26.458  -3.347  -29.869 1.00 31.90  ? 270 GLU A CA  1 
ATOM   2029 C  C   . GLU A 1 270 ? 26.323  -4.645  -29.036 1.00 36.82  ? 270 GLU A C   1 
ATOM   2030 O  O   . GLU A 1 270 ? 27.299  -5.044  -28.389 1.00 36.60  ? 270 GLU A O   1 
ATOM   2031 C  CB  . GLU A 1 270 ? 26.077  -2.106  -29.036 1.00 32.24  ? 270 GLU A CB  1 
ATOM   2032 C  CG  . GLU A 1 270 ? 26.540  -0.798  -29.644 1.00 36.47  ? 270 GLU A CG  1 
ATOM   2033 C  CD  . GLU A 1 270 ? 25.783  0.420   -29.151 1.00 67.90  ? 270 GLU A CD  1 
ATOM   2034 O  OE1 . GLU A 1 270 ? 26.033  0.854   -28.004 1.00 47.14  ? 270 GLU A OE1 1 
ATOM   2035 O  OE2 . GLU A 1 270 ? 24.929  0.937   -29.908 1.00 77.84  ? 270 GLU A OE2 1 
ATOM   2036 N  N   . MET A 1 271 ? 25.135  -5.299  -29.059 1.00 33.07  ? 271 MET A N   1 
ATOM   2037 C  CA  . MET A 1 271 ? 24.902  -6.547  -28.318 1.00 32.86  ? 271 MET A CA  1 
ATOM   2038 C  C   . MET A 1 271 ? 25.766  -7.686  -28.818 1.00 36.64  ? 271 MET A C   1 
ATOM   2039 O  O   . MET A 1 271 ? 26.237  -8.480  -28.003 1.00 35.94  ? 271 MET A O   1 
ATOM   2040 C  CB  . MET A 1 271 ? 23.434  -6.979  -28.369 1.00 35.33  ? 271 MET A CB  1 
ATOM   2041 C  CG  . MET A 1 271 ? 22.525  -6.187  -27.466 1.00 39.69  ? 271 MET A CG  1 
ATOM   2042 S  SD  . MET A 1 271 ? 22.680  -6.362  -25.657 1.00 44.15  ? 271 MET A SD  1 
ATOM   2043 C  CE  . MET A 1 271 ? 22.936  -8.047  -25.490 1.00 40.61  ? 271 MET A CE  1 
ATOM   2044 N  N   . GLU A 1 272 ? 25.952  -7.789  -30.155 1.00 34.49  ? 272 GLU A N   1 
ATOM   2045 C  CA  . GLU A 1 272 ? 26.784  -8.819  -30.781 1.00 35.17  ? 272 GLU A CA  1 
ATOM   2046 C  C   . GLU A 1 272 ? 28.249  -8.642  -30.378 1.00 39.34  ? 272 GLU A C   1 
ATOM   2047 O  O   . GLU A 1 272 ? 28.895  -9.642  -30.065 1.00 39.68  ? 272 GLU A O   1 
ATOM   2048 C  CB  . GLU A 1 272 ? 26.621  -8.838  -32.306 1.00 37.09  ? 272 GLU A CB  1 
ATOM   2049 C  CG  . GLU A 1 272 ? 26.225  -10.203 -32.855 1.00 52.20  ? 272 GLU A CG  1 
ATOM   2050 C  CD  . GLU A 1 272 ? 26.043  -10.267 -34.364 1.00 75.18  ? 272 GLU A CD  1 
ATOM   2051 O  OE1 . GLU A 1 272 ? 24.916  -9.994  -34.845 1.00 55.70  ? 272 GLU A OE1 1 
ATOM   2052 O  OE2 . GLU A 1 272 ? 27.029  -10.600 -35.064 1.00 65.26  ? 272 GLU A OE2 1 
ATOM   2053 N  N   . GLU A 1 273 ? 28.755  -7.378  -30.316 1.00 35.21  ? 273 GLU A N   1 
ATOM   2054 C  CA  . GLU A 1 273 ? 30.130  -7.097  -29.864 1.00 35.30  ? 273 GLU A CA  1 
ATOM   2055 C  C   . GLU A 1 273 ? 30.310  -7.600  -28.407 1.00 38.48  ? 273 GLU A C   1 
ATOM   2056 O  O   . GLU A 1 273 ? 31.368  -8.128  -28.080 1.00 39.92  ? 273 GLU A O   1 
ATOM   2057 C  CB  . GLU A 1 273 ? 30.447  -5.595  -29.900 1.00 37.01  ? 273 GLU A CB  1 
ATOM   2058 C  CG  . GLU A 1 273 ? 30.610  -4.963  -31.271 1.00 52.60  ? 273 GLU A CG  1 
ATOM   2059 C  CD  . GLU A 1 273 ? 31.122  -3.529  -31.205 1.00 83.93  ? 273 GLU A CD  1 
ATOM   2060 O  OE1 . GLU A 1 273 ? 30.363  -2.639  -30.750 1.00 67.91  ? 273 GLU A OE1 1 
ATOM   2061 O  OE2 . GLU A 1 273 ? 32.296  -3.301  -31.582 1.00 84.10  ? 273 GLU A OE2 1 
ATOM   2062 N  N   . LEU A 1 274 ? 29.279  -7.441  -27.543 1.00 31.40  ? 274 LEU A N   1 
ATOM   2063 C  CA  . LEU A 1 274 ? 29.326  -7.907  -26.151 1.00 29.51  ? 274 LEU A CA  1 
ATOM   2064 C  C   . LEU A 1 274 ? 29.311  -9.430  -26.048 1.00 33.42  ? 274 LEU A C   1 
ATOM   2065 O  O   . LEU A 1 274 ? 30.033  -10.002 -25.232 1.00 32.40  ? 274 LEU A O   1 
ATOM   2066 C  CB  . LEU A 1 274 ? 28.220  -7.271  -25.299 1.00 28.48  ? 274 LEU A CB  1 
ATOM   2067 C  CG  . LEU A 1 274 ? 28.335  -5.767  -25.075 1.00 30.90  ? 274 LEU A CG  1 
ATOM   2068 C  CD1 . LEU A 1 274 ? 27.230  -5.280  -24.192 1.00 30.42  ? 274 LEU A CD1 1 
ATOM   2069 C  CD2 . LEU A 1 274 ? 29.718  -5.366  -24.534 1.00 30.39  ? 274 LEU A CD2 1 
ATOM   2070 N  N   . GLU A 1 275 ? 28.515  -10.084 -26.906 1.00 32.35  ? 275 GLU A N   1 
ATOM   2071 C  CA  . GLU A 1 275 ? 28.441  -11.537 -27.002 1.00 32.10  ? 275 GLU A CA  1 
ATOM   2072 C  C   . GLU A 1 275 ? 29.804  -12.055 -27.504 1.00 35.76  ? 275 GLU A C   1 
ATOM   2073 O  O   . GLU A 1 275 ? 30.319  -13.030 -26.961 1.00 35.83  ? 275 GLU A O   1 
ATOM   2074 C  CB  . GLU A 1 275 ? 27.306  -11.949 -27.942 1.00 33.72  ? 275 GLU A CB  1 
ATOM   2075 C  CG  . GLU A 1 275 ? 27.040  -13.448 -27.916 1.00 48.97  ? 275 GLU A CG  1 
ATOM   2076 C  CD  . GLU A 1 275 ? 25.851  -13.978 -28.697 1.00 73.65  ? 275 GLU A CD  1 
ATOM   2077 O  OE1 . GLU A 1 275 ? 24.946  -13.183 -29.042 1.00 63.26  ? 275 GLU A OE1 1 
ATOM   2078 O  OE2 . GLU A 1 275 ? 25.794  -15.213 -28.900 1.00 72.25  ? 275 GLU A OE2 1 
ATOM   2079 N  N   . THR A 1 276 ? 30.431  -11.339 -28.456 1.00 31.85  ? 276 THR A N   1 
ATOM   2080 C  CA  . THR A 1 276 ? 31.734  -11.705 -29.012 1.00 31.59  ? 276 THR A CA  1 
ATOM   2081 C  C   . THR A 1 276 ? 32.843  -11.616 -27.950 1.00 36.26  ? 276 THR A C   1 
ATOM   2082 O  O   . THR A 1 276 ? 33.569  -12.608 -27.778 1.00 36.31  ? 276 THR A O   1 
ATOM   2083 C  CB  . THR A 1 276 ? 32.010  -10.914 -30.299 1.00 35.99  ? 276 THR A CB  1 
ATOM   2084 O  OG1 . THR A 1 276 ? 31.064  -11.358 -31.276 1.00 33.28  ? 276 THR A OG1 1 
ATOM   2085 C  CG2 . THR A 1 276 ? 33.433  -11.125 -30.847 1.00 32.53  ? 276 THR A CG2 1 
ATOM   2086 N  N   . LEU A 1 277 ? 32.957  -10.478 -27.220 1.00 32.79  ? 277 LEU A N   1 
ATOM   2087 C  CA  . LEU A 1 277 ? 33.987  -10.333 -26.179 1.00 33.37  ? 277 LEU A CA  1 
ATOM   2088 C  C   . LEU A 1 277 ? 33.888  -11.347 -25.054 1.00 34.77  ? 277 LEU A C   1 
ATOM   2089 O  O   . LEU A 1 277 ? 34.870  -12.036 -24.756 1.00 36.15  ? 277 LEU A O   1 
ATOM   2090 C  CB  . LEU A 1 277 ? 34.004  -8.949  -25.491 1.00 34.67  ? 277 LEU A CB  1 
ATOM   2091 C  CG  . LEU A 1 277 ? 33.743  -7.660  -26.236 1.00 42.16  ? 277 LEU A CG  1 
ATOM   2092 C  CD1 . LEU A 1 277 ? 33.940  -6.478  -25.288 1.00 42.41  ? 277 LEU A CD1 1 
ATOM   2093 C  CD2 . LEU A 1 277 ? 34.622  -7.527  -27.495 1.00 49.23  ? 277 LEU A CD2 1 
ATOM   2094 N  N   . TRP A 1 278 ? 32.708  -11.401 -24.402 1.00 26.97  ? 278 TRP A N   1 
ATOM   2095 C  CA  . TRP A 1 278 ? 32.454  -12.136 -23.171 1.00 23.55  ? 278 TRP A CA  1 
ATOM   2096 C  C   . TRP A 1 278 ? 31.939  -13.558 -23.238 1.00 27.47  ? 278 TRP A C   1 
ATOM   2097 O  O   . TRP A 1 278 ? 32.168  -14.294 -22.281 1.00 25.39  ? 278 TRP A O   1 
ATOM   2098 C  CB  . TRP A 1 278 ? 31.448  -11.334 -22.339 1.00 20.19  ? 278 TRP A CB  1 
ATOM   2099 C  CG  . TRP A 1 278 ? 31.958  -9.999  -21.887 1.00 19.24  ? 278 TRP A CG  1 
ATOM   2100 C  CD1 . TRP A 1 278 ? 31.579  -8.774  -22.353 1.00 21.41  ? 278 TRP A CD1 1 
ATOM   2101 C  CD2 . TRP A 1 278 ? 32.992  -9.762  -20.931 1.00 18.51  ? 278 TRP A CD2 1 
ATOM   2102 N  NE1 . TRP A 1 278 ? 32.279  -7.785  -21.705 1.00 19.56  ? 278 TRP A NE1 1 
ATOM   2103 C  CE2 . TRP A 1 278 ? 33.153  -8.361  -20.825 1.00 21.45  ? 278 TRP A CE2 1 
ATOM   2104 C  CE3 . TRP A 1 278 ? 33.774  -10.597 -20.117 1.00 19.89  ? 278 TRP A CE3 1 
ATOM   2105 C  CZ2 . TRP A 1 278 ? 34.087  -7.776  -19.959 1.00 21.20  ? 278 TRP A CZ2 1 
ATOM   2106 C  CZ3 . TRP A 1 278 ? 34.670  -10.015 -19.229 1.00 21.81  ? 278 TRP A CZ3 1 
ATOM   2107 C  CH2 . TRP A 1 278 ? 34.836  -8.620  -19.171 1.00 22.40  ? 278 TRP A CH2 1 
ATOM   2108 N  N   . LEU A 1 279 ? 31.190  -13.934 -24.281 1.00 27.51  ? 279 LEU A N   1 
ATOM   2109 C  CA  . LEU A 1 279 ? 30.457  -15.205 -24.261 1.00 28.57  ? 279 LEU A CA  1 
ATOM   2110 C  C   . LEU A 1 279 ? 30.935  -16.326 -25.185 1.00 38.61  ? 279 LEU A C   1 
ATOM   2111 O  O   . LEU A 1 279 ? 30.589  -17.481 -24.939 1.00 38.80  ? 279 LEU A O   1 
ATOM   2112 C  CB  . LEU A 1 279 ? 28.961  -14.926 -24.545 1.00 27.75  ? 279 LEU A CB  1 
ATOM   2113 C  CG  . LEU A 1 279 ? 28.257  -13.847 -23.694 1.00 31.26  ? 279 LEU A CG  1 
ATOM   2114 C  CD1 . LEU A 1 279 ? 26.778  -13.747 -24.041 1.00 29.44  ? 279 LEU A CD1 1 
ATOM   2115 C  CD2 . LEU A 1 279 ? 28.412  -14.126 -22.187 1.00 34.58  ? 279 LEU A CD2 1 
ATOM   2116 N  N   . THR A 1 280 ? 31.687  -16.010 -26.232 1.00 39.54  ? 280 THR A N   1 
ATOM   2117 C  CA  . THR A 1 280 ? 32.179  -17.010 -27.182 1.00 41.63  ? 280 THR A CA  1 
ATOM   2118 C  C   . THR A 1 280 ? 33.214  -17.970 -26.564 1.00 49.02  ? 280 THR A C   1 
ATOM   2119 O  O   . THR A 1 280 ? 34.034  -17.557 -25.740 1.00 49.24  ? 280 THR A O   1 
ATOM   2120 C  CB  . THR A 1 280 ? 32.702  -16.326 -28.448 1.00 54.11  ? 280 THR A CB  1 
ATOM   2121 O  OG1 . THR A 1 280 ? 33.690  -15.360 -28.078 1.00 54.31  ? 280 THR A OG1 1 
ATOM   2122 C  CG2 . THR A 1 280 ? 31.580  -15.665 -29.258 1.00 53.04  ? 280 THR A CG2 1 
ATOM   2123 N  N   . GLY A 1 281 ? 33.131  -19.240 -26.958 1.00 47.08  ? 281 GLY A N   1 
ATOM   2124 C  CA  . GLY A 1 281 ? 34.019  -20.302 -26.508 1.00 47.72  ? 281 GLY A CA  1 
ATOM   2125 C  C   . GLY A 1 281 ? 34.567  -21.151 -27.635 1.00 54.32  ? 281 GLY A C   1 
ATOM   2126 O  O   . GLY A 1 281 ? 34.137  -21.027 -28.784 1.00 54.38  ? 281 GLY A O   1 
ATOM   2127 N  N   . ILE A 1 282 ? 35.507  -22.040 -27.300 1.00 52.49  ? 282 ILE A N   1 
ATOM   2128 C  CA  . ILE A 1 282 ? 36.194  -22.939 -28.237 1.00 52.67  ? 282 ILE A CA  1 
ATOM   2129 C  C   . ILE A 1 282 ? 35.278  -24.084 -28.718 1.00 55.59  ? 282 ILE A C   1 
ATOM   2130 O  O   . ILE A 1 282 ? 35.135  -24.289 -29.927 1.00 55.93  ? 282 ILE A O   1 
ATOM   2131 C  CB  . ILE A 1 282 ? 37.527  -23.468 -27.618 1.00 56.11  ? 282 ILE A CB  1 
ATOM   2132 C  CG1 . ILE A 1 282 ? 38.238  -22.407 -26.700 1.00 56.79  ? 282 ILE A CG1 1 
ATOM   2133 C  CG2 . ILE A 1 282 ? 38.466  -24.027 -28.687 1.00 56.63  ? 282 ILE A CG2 1 
ATOM   2134 C  CD1 . ILE A 1 282 ? 38.664  -20.985 -27.341 1.00 60.42  ? 282 ILE A CD1 1 
ATOM   2135 N  N   . CYS A 1 283 ? 34.674  -24.823 -27.775 1.00 49.94  ? 283 CYS A N   1 
ATOM   2136 C  CA  . CYS A 1 283 ? 33.783  -25.955 -28.048 1.00 48.84  ? 283 CYS A CA  1 
ATOM   2137 C  C   . CYS A 1 283 ? 32.436  -25.456 -28.588 1.00 83.21  ? 283 CYS A C   1 
ATOM   2138 O  O   . CYS A 1 283 ? 31.784  -26.137 -29.382 1.00 47.78  ? 283 CYS A O   1 
ATOM   2139 C  CB  . CYS A 1 283 ? 33.601  -26.820 -26.798 1.00 48.51  ? 283 CYS A CB  1 
ATOM   2140 S  SG  . CYS A 1 283 ? 35.111  -27.062 -25.816 1.00 52.05  ? 283 CYS A SG  1 
ATOM   2141 N  N   . THR B 2 5   ? -13.784 -8.280  -22.362 1.00 52.22  ? 5   THR B N   1 
ATOM   2142 C  CA  . THR B 2 5   ? -14.197 -7.407  -23.462 1.00 51.34  ? 5   THR B CA  1 
ATOM   2143 C  C   . THR B 2 5   ? -14.178 -8.188  -24.778 1.00 51.30  ? 5   THR B C   1 
ATOM   2144 O  O   . THR B 2 5   ? -13.781 -9.361  -24.763 1.00 51.61  ? 5   THR B O   1 
ATOM   2145 C  CB  . THR B 2 5   ? -13.271 -6.195  -23.546 1.00 52.09  ? 5   THR B CB  1 
ATOM   2146 N  N   . ARG B 2 6   ? -14.665 -7.570  -25.900 1.00 43.42  ? 6   ARG B N   1 
ATOM   2147 C  CA  . ARG B 2 6   ? -14.645 -8.208  -27.227 1.00 40.45  ? 6   ARG B CA  1 
ATOM   2148 C  C   . ARG B 2 6   ? -13.488 -7.631  -28.048 1.00 36.28  ? 6   ARG B C   1 
ATOM   2149 O  O   . ARG B 2 6   ? -13.621 -6.634  -28.759 1.00 33.63  ? 6   ARG B O   1 
ATOM   2150 C  CB  . ARG B 2 6   ? -15.989 -8.127  -27.963 1.00 39.32  ? 6   ARG B CB  1 
ATOM   2151 C  CG  . ARG B 2 6   ? -15.977 -8.890  -29.292 1.00 36.51  ? 6   ARG B CG  1 
ATOM   2152 C  CD  . ARG B 2 6   ? -16.594 -10.268 -29.199 1.00 38.50  ? 6   ARG B CD  1 
ATOM   2153 N  NE  . ARG B 2 6   ? -17.055 -10.704 -30.515 1.00 49.91  ? 6   ARG B NE  1 
ATOM   2154 C  CZ  . ARG B 2 6   ? -17.455 -11.937 -30.806 1.00 62.31  ? 6   ARG B CZ  1 
ATOM   2155 N  NH1 . ARG B 2 6   ? -17.466 -12.876 -29.869 1.00 42.10  ? 6   ARG B NH1 1 
ATOM   2156 N  NH2 . ARG B 2 6   ? -17.850 -12.241 -32.039 1.00 45.94  ? 6   ARG B NH2 1 
ATOM   2157 N  N   . LEU B 2 7   ? -12.340 -8.273  -27.903 1.00 29.85  ? 7   LEU B N   1 
ATOM   2158 C  CA  . LEU B 2 7   ? -11.094 -7.857  -28.525 1.00 27.78  ? 7   LEU B CA  1 
ATOM   2159 C  C   . LEU B 2 7   ? -11.033 -8.152  -30.001 1.00 26.45  ? 7   LEU B C   1 
ATOM   2160 O  O   . LEU B 2 7   ? -11.370 -9.249  -30.436 1.00 24.64  ? 7   LEU B O   1 
ATOM   2161 C  CB  . LEU B 2 7   ? -9.915  -8.509  -27.782 1.00 27.78  ? 7   LEU B CB  1 
ATOM   2162 C  CG  . LEU B 2 7   ? -9.262  -7.733  -26.636 1.00 31.63  ? 7   LEU B CG  1 
ATOM   2163 C  CD1 . LEU B 2 7   ? -10.267 -7.184  -25.668 1.00 31.69  ? 7   LEU B CD1 1 
ATOM   2164 C  CD2 . LEU B 2 7   ? -8.285  -8.604  -25.896 1.00 33.40  ? 7   LEU B CD2 1 
ATOM   2165 N  N   . LYS B 2 8   ? -10.636 -7.147  -30.779 1.00 22.24  ? 8   LYS B N   1 
ATOM   2166 C  CA  . LYS B 2 8   ? -10.416 -7.301  -32.213 1.00 21.14  ? 8   LYS B CA  1 
ATOM   2167 C  C   . LYS B 2 8   ? -8.932  -7.695  -32.351 1.00 24.38  ? 8   LYS B C   1 
ATOM   2168 O  O   . LYS B 2 8   ? -8.024  -6.893  -32.078 1.00 23.14  ? 8   LYS B O   1 
ATOM   2169 C  CB  . LYS B 2 8   ? -10.717 -6.001  -32.971 1.00 22.72  ? 8   LYS B CB  1 
ATOM   2170 C  CG  . LYS B 2 8   ? -12.156 -5.858  -33.429 1.00 29.65  ? 8   LYS B CG  1 
ATOM   2171 C  CD  . LYS B 2 8   ? -12.339 -4.545  -34.202 1.00 42.34  ? 8   LYS B CD  1 
ATOM   2172 C  CE  . LYS B 2 8   ? -13.088 -3.466  -33.450 1.00 58.55  ? 8   LYS B CE  1 
ATOM   2173 N  NZ  . LYS B 2 8   ? -12.247 -2.800  -32.411 1.00 75.46  ? 8   LYS B NZ  1 
ATOM   2174 N  N   . ILE B 2 9   ? -8.693  -8.958  -32.706 1.00 19.28  ? 9   ILE B N   1 
ATOM   2175 C  CA  . ILE B 2 9   ? -7.345  -9.472  -32.875 1.00 17.80  ? 9   ILE B CA  1 
ATOM   2176 C  C   . ILE B 2 9   ? -6.945  -9.364  -34.330 1.00 21.96  ? 9   ILE B C   1 
ATOM   2177 O  O   . ILE B 2 9   ? -7.704  -9.787  -35.206 1.00 23.34  ? 9   ILE B O   1 
ATOM   2178 C  CB  . ILE B 2 9   ? -7.232  -10.951 -32.394 1.00 20.28  ? 9   ILE B CB  1 
ATOM   2179 C  CG1 . ILE B 2 9   ? -7.838  -11.170 -30.971 1.00 19.40  ? 9   ILE B CG1 1 
ATOM   2180 C  CG2 . ILE B 2 9   ? -5.775  -11.463 -32.509 1.00 20.05  ? 9   ILE B CG2 1 
ATOM   2181 C  CD1 . ILE B 2 9   ? -7.024  -10.635 -29.749 1.00 26.01  ? 9   ILE B CD1 1 
ATOM   2182 N  N   . VAL B 2 10  ? -5.729  -8.864  -34.594 1.00 17.28  ? 10  VAL B N   1 
ATOM   2183 C  CA  . VAL B 2 10  ? -5.193  -8.854  -35.958 1.00 15.84  ? 10  VAL B CA  1 
ATOM   2184 C  C   . VAL B 2 10  ? -4.067  -9.899  -36.071 1.00 18.32  ? 10  VAL B C   1 
ATOM   2185 O  O   . VAL B 2 10  ? -3.260  -10.055 -35.159 1.00 17.68  ? 10  VAL B O   1 
ATOM   2186 C  CB  . VAL B 2 10  ? -4.778  -7.463  -36.493 1.00 17.61  ? 10  VAL B CB  1 
ATOM   2187 C  CG1 . VAL B 2 10  ? -3.488  -6.964  -35.837 1.00 16.39  ? 10  VAL B CG1 1 
ATOM   2188 C  CG2 . VAL B 2 10  ? -4.640  -7.485  -38.016 1.00 17.06  ? 10  VAL B CG2 1 
ATOM   2189 N  N   . THR B 2 11  ? -4.024  -10.589 -37.199 1.00 14.63  ? 11  THR B N   1 
ATOM   2190 C  CA  . THR B 2 11  ? -3.029  -11.606 -37.498 1.00 14.37  ? 11  THR B CA  1 
ATOM   2191 C  C   . THR B 2 11  ? -2.610  -11.528 -38.976 1.00 17.18  ? 11  THR B C   1 
ATOM   2192 O  O   . THR B 2 11  ? -3.092  -10.670 -39.730 1.00 17.66  ? 11  THR B O   1 
ATOM   2193 C  CB  . THR B 2 11  ? -3.536  -13.000 -37.010 1.00 27.36  ? 11  THR B CB  1 
ATOM   2194 O  OG1 . THR B 2 11  ? -2.415  -13.856 -36.800 1.00 28.12  ? 11  THR B OG1 1 
ATOM   2195 C  CG2 . THR B 2 11  ? -4.585  -13.646 -37.940 1.00 24.26  ? 11  THR B CG2 1 
ATOM   2196 N  N   . ILE B 2 12  ? -1.665  -12.384 -39.359 1.00 13.84  ? 12  ILE B N   1 
ATOM   2197 C  CA  . ILE B 2 12  ? -1.103  -12.469 -40.694 1.00 14.02  ? 12  ILE B CA  1 
ATOM   2198 C  C   . ILE B 2 12  ? -0.932  -13.936 -41.053 1.00 19.15  ? 12  ILE B C   1 
ATOM   2199 O  O   . ILE B 2 12  ? -0.708  -14.756 -40.155 1.00 17.69  ? 12  ILE B O   1 
ATOM   2200 C  CB  . ILE B 2 12  ? 0.254   -11.692 -40.754 1.00 17.27  ? 12  ILE B CB  1 
ATOM   2201 C  CG1 . ILE B 2 12  ? 0.698   -11.396 -42.214 1.00 16.18  ? 12  ILE B CG1 1 
ATOM   2202 C  CG2 . ILE B 2 12  ? 1.384   -12.391 -39.938 1.00 19.46  ? 12  ILE B CG2 1 
ATOM   2203 C  CD1 . ILE B 2 12  ? 1.722   -10.271 -42.333 1.00 9.26   ? 12  ILE B CD1 1 
ATOM   2204 N  N   . HIS B 2 13  ? -1.013  -14.258 -42.359 1.00 17.55  ? 13  HIS B N   1 
ATOM   2205 C  CA  . HIS B 2 13  ? -0.721  -15.601 -42.842 1.00 19.75  ? 13  HIS B CA  1 
ATOM   2206 C  C   . HIS B 2 13  ? 0.799   -15.817 -42.669 1.00 26.61  ? 13  HIS B C   1 
ATOM   2207 O  O   . HIS B 2 13  ? 1.589   -14.952 -43.070 1.00 28.06  ? 13  HIS B O   1 
ATOM   2208 C  CB  . HIS B 2 13  ? -1.098  -15.757 -44.320 1.00 20.88  ? 13  HIS B CB  1 
ATOM   2209 C  CG  . HIS B 2 13  ? -0.837  -17.135 -44.851 1.00 25.61  ? 13  HIS B CG  1 
ATOM   2210 N  ND1 . HIS B 2 13  ? -0.470  -17.342 -46.167 1.00 28.22  ? 13  HIS B ND1 1 
ATOM   2211 C  CD2 . HIS B 2 13  ? -0.891  -18.336 -44.222 1.00 27.82  ? 13  HIS B CD2 1 
ATOM   2212 C  CE1 . HIS B 2 13  ? -0.309  -18.649 -46.294 1.00 27.77  ? 13  HIS B CE1 1 
ATOM   2213 N  NE2 . HIS B 2 13  ? -0.557  -19.288 -45.156 1.00 27.72  ? 13  HIS B NE2 1 
ATOM   2214 N  N   . GLN B 2 14  ? 1.198   -16.935 -42.041 1.00 21.83  ? 14  GLN B N   1 
ATOM   2215 C  CA  . GLN B 2 14  ? 2.600   -17.251 -41.760 1.00 20.82  ? 14  GLN B CA  1 
ATOM   2216 C  C   . GLN B 2 14  ? 2.748   -18.636 -41.170 1.00 23.89  ? 14  GLN B C   1 
ATOM   2217 O  O   . GLN B 2 14  ? 2.710   -18.790 -39.951 1.00 23.02  ? 14  GLN B O   1 
ATOM   2218 C  CB  . GLN B 2 14  ? 3.207   -16.207 -40.786 1.00 21.86  ? 14  GLN B CB  1 
ATOM   2219 C  CG  . GLN B 2 14  ? 4.730   -16.184 -40.774 1.00 15.16  ? 14  GLN B CG  1 
ATOM   2220 C  CD  . GLN B 2 14  ? 5.375   -15.492 -41.946 1.00 24.88  ? 14  GLN B CD  1 
ATOM   2221 O  OE1 . GLN B 2 14  ? 6.578   -15.626 -42.154 1.00 24.36  ? 14  GLN B OE1 1 
ATOM   2222 N  NE2 . GLN B 2 14  ? 4.629   -14.719 -42.725 1.00 15.26  ? 14  GLN B NE2 1 
ATOM   2223 N  N   . GLU B 2 15  ? 2.935   -19.638 -42.018 1.00 22.15  ? 15  GLU B N   1 
ATOM   2224 C  CA  . GLU B 2 15  ? 3.090   -21.019 -41.537 1.00 22.97  ? 15  GLU B CA  1 
ATOM   2225 C  C   . GLU B 2 15  ? 4.397   -21.224 -40.749 1.00 28.82  ? 15  GLU B C   1 
ATOM   2226 O  O   . GLU B 2 15  ? 5.410   -20.633 -41.113 1.00 29.90  ? 15  GLU B O   1 
ATOM   2227 C  CB  . GLU B 2 15  ? 2.932   -22.027 -42.686 1.00 23.87  ? 15  GLU B CB  1 
ATOM   2228 C  CG  . GLU B 2 15  ? 1.511   -22.055 -43.222 1.00 31.57  ? 15  GLU B CG  1 
ATOM   2229 C  CD  . GLU B 2 15  ? 1.271   -22.773 -44.539 1.00 47.43  ? 15  GLU B CD  1 
ATOM   2230 O  OE1 . GLU B 2 15  ? 2.098   -23.632 -44.929 1.00 41.96  ? 15  GLU B OE1 1 
ATOM   2231 O  OE2 . GLU B 2 15  ? 0.245   -22.462 -45.187 1.00 27.20  ? 15  GLU B OE2 1 
ATOM   2232 N  N   . PRO B 2 16  ? 4.400   -21.982 -39.633 1.00 25.88  ? 16  PRO B N   1 
ATOM   2233 C  CA  . PRO B 2 16  ? 3.304   -22.786 -39.068 1.00 25.22  ? 16  PRO B CA  1 
ATOM   2234 C  C   . PRO B 2 16  ? 2.550   -22.080 -37.935 1.00 25.86  ? 16  PRO B C   1 
ATOM   2235 O  O   . PRO B 2 16  ? 1.816   -22.723 -37.186 1.00 25.63  ? 16  PRO B O   1 
ATOM   2236 C  CB  . PRO B 2 16  ? 4.043   -24.047 -38.626 1.00 27.06  ? 16  PRO B CB  1 
ATOM   2237 C  CG  . PRO B 2 16  ? 5.386   -23.509 -38.117 1.00 31.43  ? 16  PRO B CG  1 
ATOM   2238 C  CD  . PRO B 2 16  ? 5.647   -22.206 -38.868 1.00 27.31  ? 16  PRO B CD  1 
ATOM   2239 N  N   . PHE B 2 17  ? 2.741   -20.753 -37.815 1.00 19.04  ? 17  PHE B N   1 
ATOM   2240 C  CA  . PHE B 2 17  ? 2.115   -19.931 -36.791 1.00 17.42  ? 17  PHE B CA  1 
ATOM   2241 C  C   . PHE B 2 17  ? 0.649   -19.693 -37.059 1.00 23.13  ? 17  PHE B C   1 
ATOM   2242 O  O   . PHE B 2 17  ? -0.154  -19.762 -36.128 1.00 24.12  ? 17  PHE B O   1 
ATOM   2243 C  CB  . PHE B 2 17  ? 2.864   -18.599 -36.640 1.00 18.08  ? 17  PHE B CB  1 
ATOM   2244 C  CG  . PHE B 2 17  ? 4.281   -18.818 -36.196 1.00 18.10  ? 17  PHE B CG  1 
ATOM   2245 C  CD1 . PHE B 2 17  ? 4.573   -19.089 -34.864 1.00 19.30  ? 17  PHE B CD1 1 
ATOM   2246 C  CD2 . PHE B 2 17  ? 5.321   -18.826 -37.120 1.00 18.92  ? 17  PHE B CD2 1 
ATOM   2247 C  CE1 . PHE B 2 17  ? 5.874   -19.359 -34.464 1.00 19.47  ? 17  PHE B CE1 1 
ATOM   2248 C  CE2 . PHE B 2 17  ? 6.626   -19.076 -36.715 1.00 20.91  ? 17  PHE B CE2 1 
ATOM   2249 C  CZ  . PHE B 2 17  ? 6.894   -19.320 -35.386 1.00 19.24  ? 17  PHE B CZ  1 
ATOM   2250 N  N   . VAL B 2 18  ? 0.298   -19.373 -38.317 1.00 19.68  ? 18  VAL B N   1 
ATOM   2251 C  CA  . VAL B 2 18  ? -1.072  -19.096 -38.735 1.00 19.02  ? 18  VAL B CA  1 
ATOM   2252 C  C   . VAL B 2 18  ? -1.249  -19.658 -40.125 1.00 24.82  ? 18  VAL B C   1 
ATOM   2253 O  O   . VAL B 2 18  ? -0.678  -19.136 -41.083 1.00 25.31  ? 18  VAL B O   1 
ATOM   2254 C  CB  . VAL B 2 18  ? -1.439  -17.576 -38.764 1.00 21.10  ? 18  VAL B CB  1 
ATOM   2255 C  CG1 . VAL B 2 18  ? -2.899  -17.378 -39.162 1.00 19.45  ? 18  VAL B CG1 1 
ATOM   2256 C  CG2 . VAL B 2 18  ? -1.112  -16.846 -37.454 1.00 20.28  ? 18  VAL B CG2 1 
ATOM   2257 N  N   . TYR B 2 19  ? -2.066  -20.695 -40.238 1.00 20.77  ? 19  TYR B N   1 
ATOM   2258 C  CA  . TYR B 2 19  ? -2.461  -21.274 -41.508 1.00 19.03  ? 19  TYR B CA  1 
ATOM   2259 C  C   . TYR B 2 19  ? -3.754  -20.581 -41.859 1.00 23.94  ? 19  TYR B C   1 
ATOM   2260 O  O   . TYR B 2 19  ? -4.573  -20.319 -40.971 1.00 22.89  ? 19  TYR B O   1 
ATOM   2261 C  CB  . TYR B 2 19  ? -2.744  -22.759 -41.346 1.00 18.11  ? 19  TYR B CB  1 
ATOM   2262 C  CG  . TYR B 2 19  ? -1.509  -23.611 -41.188 1.00 16.28  ? 19  TYR B CG  1 
ATOM   2263 C  CD1 . TYR B 2 19  ? -0.934  -23.817 -39.933 1.00 17.89  ? 19  TYR B CD1 1 
ATOM   2264 C  CD2 . TYR B 2 19  ? -0.968  -24.290 -42.271 1.00 15.48  ? 19  TYR B CD2 1 
ATOM   2265 C  CE1 . TYR B 2 19  ? 0.168   -24.654 -39.771 1.00 15.98  ? 19  TYR B CE1 1 
ATOM   2266 C  CE2 . TYR B 2 19  ? 0.143   -25.118 -42.125 1.00 16.33  ? 19  TYR B CE2 1 
ATOM   2267 C  CZ  . TYR B 2 19  ? 0.710   -25.292 -40.876 1.00 24.47  ? 19  TYR B CZ  1 
ATOM   2268 O  OH  . TYR B 2 19  ? 1.809   -26.099 -40.753 1.00 29.69  ? 19  TYR B OH  1 
ATOM   2269 N  N   . VAL B 2 20  ? -3.933  -20.245 -43.137 1.00 22.50  ? 20  VAL B N   1 
ATOM   2270 C  CA  . VAL B 2 20  ? -5.162  -19.595 -43.605 1.00 22.61  ? 20  VAL B CA  1 
ATOM   2271 C  C   . VAL B 2 20  ? -5.751  -20.484 -44.689 1.00 27.75  ? 20  VAL B C   1 
ATOM   2272 O  O   . VAL B 2 20  ? -5.030  -20.922 -45.596 1.00 26.60  ? 20  VAL B O   1 
ATOM   2273 C  CB  . VAL B 2 20  ? -4.958  -18.117 -44.065 1.00 25.72  ? 20  VAL B CB  1 
ATOM   2274 C  CG1 . VAL B 2 20  ? -6.288  -17.481 -44.460 1.00 25.07  ? 20  VAL B CG1 1 
ATOM   2275 C  CG2 . VAL B 2 20  ? -4.273  -17.281 -42.974 1.00 24.71  ? 20  VAL B CG2 1 
ATOM   2276 N  N   . LYS B 2 21  ? -7.044  -20.810 -44.555 1.00 25.44  ? 21  LYS B N   1 
ATOM   2277 C  CA  . LYS B 2 21  ? -7.752  -21.698 -45.480 1.00 25.38  ? 21  LYS B CA  1 
ATOM   2278 C  C   . LYS B 2 21  ? -9.163  -21.203 -45.785 1.00 30.25  ? 21  LYS B C   1 
ATOM   2279 O  O   . LYS B 2 21  ? -9.783  -20.560 -44.937 1.00 27.57  ? 21  LYS B O   1 
ATOM   2280 C  CB  . LYS B 2 21  ? -7.830  -23.146 -44.912 1.00 27.15  ? 21  LYS B CB  1 
ATOM   2281 C  CG  . LYS B 2 21  ? -6.481  -23.847 -44.663 1.00 30.44  ? 21  LYS B CG  1 
ATOM   2282 C  CD  . LYS B 2 21  ? -5.703  -24.193 -45.957 1.00 24.22  ? 21  LYS B CD  1 
ATOM   2283 C  CE  . LYS B 2 21  ? -4.331  -24.736 -45.644 1.00 29.75  ? 21  LYS B CE  1 
ATOM   2284 N  NZ  . LYS B 2 21  ? -3.499  -24.892 -46.865 1.00 45.10  ? 21  LYS B NZ  1 
ATOM   2285 N  N   . PRO B 2 22  ? -9.738  -21.538 -46.961 1.00 30.49  ? 22  PRO B N   1 
ATOM   2286 C  CA  . PRO B 2 22  ? -11.128 -21.135 -47.196 1.00 30.90  ? 22  PRO B CA  1 
ATOM   2287 C  C   . PRO B 2 22  ? -12.050 -21.990 -46.341 1.00 35.87  ? 22  PRO B C   1 
ATOM   2288 O  O   . PRO B 2 22  ? -11.712 -23.135 -46.010 1.00 34.80  ? 22  PRO B O   1 
ATOM   2289 C  CB  . PRO B 2 22  ? -11.342 -21.394 -48.699 1.00 32.60  ? 22  PRO B CB  1 
ATOM   2290 C  CG  . PRO B 2 22  ? -10.368 -22.432 -49.061 1.00 36.84  ? 22  PRO B CG  1 
ATOM   2291 C  CD  . PRO B 2 22  ? -9.195  -22.316 -48.101 1.00 32.44  ? 22  PRO B CD  1 
ATOM   2292 N  N   . THR B 2 23  ? -13.209 -21.424 -45.973 1.00 34.24  ? 23  THR B N   1 
ATOM   2293 C  CA  . THR B 2 23  ? -14.246 -22.151 -45.231 1.00 34.26  ? 23  THR B CA  1 
ATOM   2294 C  C   . THR B 2 23  ? -14.907 -23.139 -46.214 1.00 37.79  ? 23  THR B C   1 
ATOM   2295 O  O   . THR B 2 23  ? -14.730 -23.009 -47.435 1.00 37.13  ? 23  THR B O   1 
ATOM   2296 C  CB  . THR B 2 23  ? -15.334 -21.167 -44.730 1.00 38.31  ? 23  THR B CB  1 
ATOM   2297 O  OG1 . THR B 2 23  ? -16.007 -20.597 -45.856 1.00 35.76  ? 23  THR B OG1 1 
ATOM   2298 C  CG2 . THR B 2 23  ? -14.783 -20.075 -43.844 1.00 35.39  ? 23  THR B CG2 1 
ATOM   2299 N  N   . LEU B 2 24  ? -15.722 -24.068 -45.702 1.00 34.61  ? 24  LEU B N   1 
ATOM   2300 C  CA  . LEU B 2 24  ? -16.493 -24.967 -46.569 1.00 34.77  ? 24  LEU B CA  1 
ATOM   2301 C  C   . LEU B 2 24  ? -17.710 -24.162 -47.127 1.00 40.31  ? 24  LEU B C   1 
ATOM   2302 O  O   . LEU B 2 24  ? -17.862 -22.977 -46.805 1.00 39.74  ? 24  LEU B O   1 
ATOM   2303 C  CB  . LEU B 2 24  ? -16.958 -26.219 -45.767 1.00 34.45  ? 24  LEU B CB  1 
ATOM   2304 C  CG  . LEU B 2 24  ? -15.856 -27.083 -45.112 1.00 37.89  ? 24  LEU B CG  1 
ATOM   2305 C  CD1 . LEU B 2 24  ? -16.424 -27.961 -44.041 1.00 36.85  ? 24  LEU B CD1 1 
ATOM   2306 C  CD2 . LEU B 2 24  ? -15.142 -27.931 -46.125 1.00 40.13  ? 24  LEU B CD2 1 
ATOM   2307 N  N   . SER B 2 25  ? -18.568 -24.797 -47.943 1.00 39.41  ? 25  SER B N   1 
ATOM   2308 C  CA  . SER B 2 25  ? -19.800 -24.190 -48.495 1.00 39.89  ? 25  SER B CA  1 
ATOM   2309 C  C   . SER B 2 25  ? -20.657 -23.479 -47.433 1.00 42.56  ? 25  SER B C   1 
ATOM   2310 O  O   . SER B 2 25  ? -21.056 -22.342 -47.660 1.00 41.72  ? 25  SER B O   1 
ATOM   2311 C  CB  . SER B 2 25  ? -20.653 -25.245 -49.196 1.00 43.57  ? 25  SER B CB  1 
ATOM   2312 O  OG  . SER B 2 25  ? -20.064 -25.621 -50.428 1.00 56.22  ? 25  SER B OG  1 
ATOM   2313 N  N   . ASP B 2 26  ? -20.887 -24.125 -46.267 1.00 39.32  ? 26  ASP B N   1 
ATOM   2314 C  CA  . ASP B 2 26  ? -21.714 -23.592 -45.178 1.00 40.11  ? 26  ASP B CA  1 
ATOM   2315 C  C   . ASP B 2 26  ? -20.986 -22.618 -44.208 1.00 45.15  ? 26  ASP B C   1 
ATOM   2316 O  O   . ASP B 2 26  ? -21.509 -22.329 -43.119 1.00 45.17  ? 26  ASP B O   1 
ATOM   2317 C  CB  . ASP B 2 26  ? -22.381 -24.743 -44.395 1.00 42.30  ? 26  ASP B CB  1 
ATOM   2318 C  CG  . ASP B 2 26  ? -21.449 -25.569 -43.523 1.00 57.85  ? 26  ASP B CG  1 
ATOM   2319 O  OD1 . ASP B 2 26  ? -20.257 -25.705 -43.885 1.00 59.64  ? 26  ASP B OD1 1 
ATOM   2320 O  OD2 . ASP B 2 26  ? -21.922 -26.108 -42.495 1.00 65.15  ? 26  ASP B OD2 1 
ATOM   2321 N  N   . GLY B 2 27  ? -19.821 -22.111 -44.618 1.00 40.72  ? 27  GLY B N   1 
ATOM   2322 C  CA  . GLY B 2 27  ? -19.062 -21.140 -43.838 1.00 39.97  ? 27  GLY B CA  1 
ATOM   2323 C  C   . GLY B 2 27  ? -18.439 -21.664 -42.558 1.00 42.64  ? 27  GLY B C   1 
ATOM   2324 O  O   . GLY B 2 27  ? -18.102 -20.883 -41.661 1.00 42.07  ? 27  GLY B O   1 
ATOM   2325 N  N   . THR B 2 28  ? -18.271 -22.988 -42.475 1.00 37.59  ? 28  THR B N   1 
ATOM   2326 C  CA  . THR B 2 28  ? -17.638 -23.639 -41.343 1.00 36.75  ? 28  THR B CA  1 
ATOM   2327 C  C   . THR B 2 28  ? -16.233 -24.115 -41.736 1.00 39.80  ? 28  THR B C   1 
ATOM   2328 O  O   . THR B 2 28  ? -15.823 -24.013 -42.895 1.00 37.76  ? 28  THR B O   1 
ATOM   2329 C  CB  . THR B 2 28  ? -18.524 -24.765 -40.762 1.00 43.83  ? 28  THR B CB  1 
ATOM   2330 O  OG1 . THR B 2 28  ? -18.628 -25.830 -41.707 1.00 40.88  ? 28  THR B OG1 1 
ATOM   2331 C  CG2 . THR B 2 28  ? -19.903 -24.275 -40.332 1.00 41.25  ? 28  THR B CG2 1 
ATOM   2332 N  N   . CYS B 2 29  ? -15.502 -24.629 -40.760 1.00 37.57  ? 29  CYS B N   1 
ATOM   2333 C  CA  . CYS B 2 29  ? -14.156 -25.110 -40.973 1.00 37.97  ? 29  CYS B CA  1 
ATOM   2334 C  C   . CYS B 2 29  ? -14.143 -26.628 -40.969 1.00 42.92  ? 29  CYS B C   1 
ATOM   2335 O  O   . CYS B 2 29  ? -14.842 -27.250 -40.164 1.00 43.82  ? 29  CYS B O   1 
ATOM   2336 C  CB  . CYS B 2 29  ? -13.227 -24.516 -39.920 1.00 38.13  ? 29  CYS B CB  1 
ATOM   2337 S  SG  . CYS B 2 29  ? -13.147 -22.704 -39.973 1.00 41.98  ? 29  CYS B SG  1 
ATOM   2338 N  N   . LYS B 2 30  ? -13.408 -27.220 -41.915 1.00 38.22  ? 30  LYS B N   1 
ATOM   2339 C  CA  . LYS B 2 30  ? -13.276 -28.671 -42.037 1.00 37.81  ? 30  LYS B CA  1 
ATOM   2340 C  C   . LYS B 2 30  ? -12.524 -29.191 -40.816 1.00 41.64  ? 30  LYS B C   1 
ATOM   2341 O  O   . LYS B 2 30  ? -11.507 -28.603 -40.435 1.00 40.06  ? 30  LYS B O   1 
ATOM   2342 C  CB  . LYS B 2 30  ? -12.512 -29.043 -43.331 1.00 39.51  ? 30  LYS B CB  1 
ATOM   2343 C  CG  . LYS B 2 30  ? -12.455 -30.542 -43.593 1.00 52.60  ? 30  LYS B CG  1 
ATOM   2344 C  CD  . LYS B 2 30  ? -11.547 -30.888 -44.763 1.00 65.35  ? 30  LYS B CD  1 
ATOM   2345 C  CE  . LYS B 2 30  ? -10.782 -32.174 -44.537 1.00 76.93  ? 30  LYS B CE  1 
ATOM   2346 N  NZ  . LYS B 2 30  ? -9.588  -31.968 -43.664 1.00 86.79  ? 30  LYS B NZ  1 
ATOM   2347 N  N   . GLU B 2 31  ? -13.038 -30.280 -40.207 1.00 38.56  ? 31  GLU B N   1 
ATOM   2348 C  CA  . GLU B 2 31  ? -12.433 -30.952 -39.056 1.00 37.85  ? 31  GLU B CA  1 
ATOM   2349 C  C   . GLU B 2 31  ? -11.106 -31.606 -39.470 1.00 38.69  ? 31  GLU B C   1 
ATOM   2350 O  O   . GLU B 2 31  ? -11.049 -32.253 -40.514 1.00 37.59  ? 31  GLU B O   1 
ATOM   2351 C  CB  . GLU B 2 31  ? -13.397 -31.999 -38.480 1.00 39.56  ? 31  GLU B CB  1 
ATOM   2352 C  CG  . GLU B 2 31  ? -13.237 -32.202 -36.981 1.00 56.86  ? 31  GLU B CG  1 
ATOM   2353 C  CD  . GLU B 2 31  ? -14.281 -33.092 -36.331 1.00 87.60  ? 31  GLU B CD  1 
ATOM   2354 O  OE1 . GLU B 2 31  ? -15.475 -32.707 -36.327 1.00 86.80  ? 31  GLU B OE1 1 
ATOM   2355 O  OE2 . GLU B 2 31  ? -13.902 -34.164 -35.802 1.00 79.17  ? 31  GLU B OE2 1 
ATOM   2356 N  N   . GLU B 2 32  ? -10.033 -31.385 -38.676 1.00 33.52  ? 32  GLU B N   1 
ATOM   2357 C  CA  . GLU B 2 32  ? -8.669  -31.907 -38.902 1.00 31.67  ? 32  GLU B CA  1 
ATOM   2358 C  C   . GLU B 2 32  ? -8.068  -32.416 -37.600 1.00 31.29  ? 32  GLU B C   1 
ATOM   2359 O  O   . GLU B 2 32  ? -8.467  -31.997 -36.521 1.00 29.52  ? 32  GLU B O   1 
ATOM   2360 C  CB  . GLU B 2 32  ? -7.749  -30.796 -39.441 1.00 32.97  ? 32  GLU B CB  1 
ATOM   2361 C  CG  . GLU B 2 32  ? -7.441  -30.875 -40.920 1.00 50.17  ? 32  GLU B CG  1 
ATOM   2362 C  CD  . GLU B 2 32  ? -6.579  -29.729 -41.423 1.00 77.24  ? 32  GLU B CD  1 
ATOM   2363 O  OE1 . GLU B 2 32  ? -7.129  -28.830 -42.102 1.00 66.38  ? 32  GLU B OE1 1 
ATOM   2364 O  OE2 . GLU B 2 32  ? -5.361  -29.716 -41.122 1.00 69.51  ? 32  GLU B OE2 1 
ATOM   2365 N  N   . PHE B 2 33  ? -7.063  -33.266 -37.704 1.00 27.79  ? 33  PHE B N   1 
ATOM   2366 C  CA  . PHE B 2 33  ? -6.360  -33.786 -36.538 1.00 27.22  ? 33  PHE B CA  1 
ATOM   2367 C  C   . PHE B 2 33  ? -4.906  -33.381 -36.611 1.00 28.33  ? 33  PHE B C   1 
ATOM   2368 O  O   . PHE B 2 33  ? -4.343  -33.388 -37.694 1.00 26.68  ? 33  PHE B O   1 
ATOM   2369 C  CB  . PHE B 2 33  ? -6.480  -35.315 -36.467 1.00 28.81  ? 33  PHE B CB  1 
ATOM   2370 C  CG  . PHE B 2 33  ? -7.883  -35.784 -36.218 1.00 30.85  ? 33  PHE B CG  1 
ATOM   2371 C  CD1 . PHE B 2 33  ? -8.438  -35.727 -34.940 1.00 34.36  ? 33  PHE B CD1 1 
ATOM   2372 C  CD2 . PHE B 2 33  ? -8.663  -36.274 -37.259 1.00 33.66  ? 33  PHE B CD2 1 
ATOM   2373 C  CE1 . PHE B 2 33  ? -9.753  -36.153 -34.709 1.00 35.25  ? 33  PHE B CE1 1 
ATOM   2374 C  CE2 . PHE B 2 33  ? -9.983  -36.698 -37.029 1.00 36.67  ? 33  PHE B CE2 1 
ATOM   2375 C  CZ  . PHE B 2 33  ? -10.514 -36.637 -35.754 1.00 34.41  ? 33  PHE B CZ  1 
ATOM   2376 N  N   . THR B 2 34  ? -4.282  -33.080 -35.470 1.00 25.00  ? 34  THR B N   1 
ATOM   2377 C  CA  . THR B 2 34  ? -2.857  -32.725 -35.429 1.00 25.36  ? 34  THR B CA  1 
ATOM   2378 C  C   . THR B 2 34  ? -1.982  -33.971 -35.699 1.00 31.45  ? 34  THR B C   1 
ATOM   2379 O  O   . THR B 2 34  ? -2.487  -35.103 -35.784 1.00 31.56  ? 34  THR B O   1 
ATOM   2380 C  CB  . THR B 2 34  ? -2.472  -32.132 -34.056 1.00 30.88  ? 34  THR B CB  1 
ATOM   2381 O  OG1 . THR B 2 34  ? -2.605  -33.131 -33.037 1.00 33.21  ? 34  THR B OG1 1 
ATOM   2382 C  CG2 . THR B 2 34  ? -3.247  -30.871 -33.703 1.00 24.51  ? 34  THR B CG2 1 
ATOM   2383 N  N   . VAL B 2 35  ? -0.661  -33.756 -35.752 1.00 29.07  ? 35  VAL B N   1 
ATOM   2384 C  CA  . VAL B 2 35  ? 0.341   -34.797 -35.918 1.00 30.28  ? 35  VAL B CA  1 
ATOM   2385 C  C   . VAL B 2 35  ? 0.226   -35.862 -34.765 1.00 35.47  ? 35  VAL B C   1 
ATOM   2386 O  O   . VAL B 2 35  ? 0.596   -37.017 -34.972 1.00 35.97  ? 35  VAL B O   1 
ATOM   2387 C  CB  . VAL B 2 35  ? 1.759   -34.164 -36.058 1.00 35.25  ? 35  VAL B CB  1 
ATOM   2388 C  CG1 . VAL B 2 35  ? 2.316   -33.659 -34.711 1.00 34.87  ? 35  VAL B CG1 1 
ATOM   2389 C  CG2 . VAL B 2 35  ? 2.738   -35.117 -36.749 1.00 35.36  ? 35  VAL B CG2 1 
ATOM   2390 N  N   . ASN B 2 36  ? -0.336  -35.453 -33.589 1.00 30.67  ? 36  ASN B N   1 
ATOM   2391 C  CA  . ASN B 2 36  ? -0.579  -36.242 -32.371 1.00 29.38  ? 36  ASN B CA  1 
ATOM   2392 C  C   . ASN B 2 36  ? -2.020  -36.766 -32.220 1.00 29.97  ? 36  ASN B C   1 
ATOM   2393 O  O   . ASN B 2 36  ? -2.373  -37.212 -31.136 1.00 30.25  ? 36  ASN B O   1 
ATOM   2394 C  CB  . ASN B 2 36  ? -0.224  -35.416 -31.104 1.00 32.13  ? 36  ASN B CB  1 
ATOM   2395 C  CG  . ASN B 2 36  ? 1.160   -34.802 -31.088 1.00 62.98  ? 36  ASN B CG  1 
ATOM   2396 O  OD1 . ASN B 2 36  ? 2.147   -35.406 -31.541 1.00 55.22  ? 36  ASN B OD1 1 
ATOM   2397 N  ND2 . ASN B 2 36  ? 1.260   -33.587 -30.541 1.00 54.42  ? 36  ASN B ND2 1 
ATOM   2398 N  N   . GLY B 2 37  ? -2.849  -36.674 -33.259 1.00 24.71  ? 37  GLY B N   1 
ATOM   2399 C  CA  . GLY B 2 37  ? -4.221  -37.183 -33.215 1.00 23.05  ? 37  GLY B CA  1 
ATOM   2400 C  C   . GLY B 2 37  ? -5.269  -36.369 -32.481 1.00 24.20  ? 37  GLY B C   1 
ATOM   2401 O  O   . GLY B 2 37  ? -6.419  -36.787 -32.422 1.00 23.23  ? 37  GLY B O   1 
ATOM   2402 N  N   . ASP B 2 38  ? -4.909  -35.210 -31.932 1.00 22.14  ? 38  ASP B N   1 
ATOM   2403 C  CA  . ASP B 2 38  ? -5.863  -34.322 -31.249 1.00 22.97  ? 38  ASP B CA  1 
ATOM   2404 C  C   . ASP B 2 38  ? -6.585  -33.465 -32.285 1.00 24.75  ? 38  ASP B C   1 
ATOM   2405 O  O   . ASP B 2 38  ? -5.991  -33.131 -33.301 1.00 24.58  ? 38  ASP B O   1 
ATOM   2406 C  CB  . ASP B 2 38  ? -5.151  -33.402 -30.240 1.00 25.43  ? 38  ASP B CB  1 
ATOM   2407 C  CG  . ASP B 2 38  ? -4.454  -34.139 -29.128 1.00 41.78  ? 38  ASP B CG  1 
ATOM   2408 O  OD1 . ASP B 2 38  ? -5.121  -34.935 -28.441 1.00 44.21  ? 38  ASP B OD1 1 
ATOM   2409 O  OD2 . ASP B 2 38  ? -3.247  -33.898 -28.924 1.00 51.22  ? 38  ASP B OD2 1 
ATOM   2410 N  N   . PRO B 2 39  ? -7.851  -33.080 -32.091 1.00 20.86  ? 39  PRO B N   1 
ATOM   2411 C  CA  . PRO B 2 39  ? -8.488  -32.210 -33.118 1.00 21.17  ? 39  PRO B CA  1 
ATOM   2412 C  C   . PRO B 2 39  ? -7.863  -30.804 -33.170 1.00 23.51  ? 39  PRO B C   1 
ATOM   2413 O  O   . PRO B 2 39  ? -7.456  -30.266 -32.140 1.00 23.15  ? 39  PRO B O   1 
ATOM   2414 C  CB  . PRO B 2 39  ? -9.981  -32.157 -32.705 1.00 22.20  ? 39  PRO B CB  1 
ATOM   2415 C  CG  . PRO B 2 39  ? -10.120 -33.105 -31.526 1.00 25.61  ? 39  PRO B CG  1 
ATOM   2416 C  CD  . PRO B 2 39  ? -8.752  -33.343 -30.947 1.00 20.67  ? 39  PRO B CD  1 
ATOM   2417 N  N   . VAL B 2 40  ? -7.798  -30.223 -34.359 1.00 20.40  ? 40  VAL B N   1 
ATOM   2418 C  CA  . VAL B 2 40  ? -7.278  -28.866 -34.593 1.00 21.18  ? 40  VAL B CA  1 
ATOM   2419 C  C   . VAL B 2 40  ? -8.333  -27.809 -34.230 1.00 27.50  ? 40  VAL B C   1 
ATOM   2420 O  O   . VAL B 2 40  ? -9.455  -27.874 -34.733 1.00 27.64  ? 40  VAL B O   1 
ATOM   2421 C  CB  . VAL B 2 40  ? -6.756  -28.712 -36.053 1.00 23.86  ? 40  VAL B CB  1 
ATOM   2422 C  CG1 . VAL B 2 40  ? -6.470  -27.253 -36.395 1.00 23.14  ? 40  VAL B CG1 1 
ATOM   2423 C  CG2 . VAL B 2 40  ? -5.514  -29.569 -36.271 1.00 22.88  ? 40  VAL B CG2 1 
ATOM   2424 N  N   . LYS B 2 41  ? -7.992  -26.856 -33.340 1.00 25.24  ? 41  LYS B N   1 
ATOM   2425 C  CA  . LYS B 2 41  ? -8.949  -25.800 -32.961 1.00 24.37  ? 41  LYS B CA  1 
ATOM   2426 C  C   . LYS B 2 41  ? -8.845  -24.698 -34.022 1.00 27.95  ? 41  LYS B C   1 
ATOM   2427 O  O   . LYS B 2 41  ? -7.786  -24.082 -34.181 1.00 27.83  ? 41  LYS B O   1 
ATOM   2428 C  CB  . LYS B 2 41  ? -8.677  -25.220 -31.555 1.00 25.90  ? 41  LYS B CB  1 
ATOM   2429 C  CG  . LYS B 2 41  ? -8.361  -26.217 -30.453 1.00 29.86  ? 41  LYS B CG  1 
ATOM   2430 C  CD  . LYS B 2 41  ? -8.726  -25.627 -29.095 1.00 33.02  ? 41  LYS B CD  1 
ATOM   2431 C  CE  . LYS B 2 41  ? -8.497  -26.579 -27.947 1.00 43.36  ? 41  LYS B CE  1 
ATOM   2432 N  NZ  . LYS B 2 41  ? -7.049  -26.686 -27.596 1.00 55.63  ? 41  LYS B NZ  1 
ATOM   2433 N  N   . LYS B 2 42  ? -9.915  -24.487 -34.776 1.00 23.76  ? 42  LYS B N   1 
ATOM   2434 C  CA  . LYS B 2 42  ? -9.918  -23.483 -35.833 1.00 23.51  ? 42  LYS B CA  1 
ATOM   2435 C  C   . LYS B 2 42  ? -10.803 -22.304 -35.467 1.00 28.30  ? 42  LYS B C   1 
ATOM   2436 O  O   . LYS B 2 42  ? -11.768 -22.472 -34.738 1.00 28.03  ? 42  LYS B O   1 
ATOM   2437 C  CB  . LYS B 2 42  ? -10.371 -24.104 -37.165 1.00 24.00  ? 42  LYS B CB  1 
ATOM   2438 C  CG  . LYS B 2 42  ? -9.645  -25.412 -37.492 1.00 18.81  ? 42  LYS B CG  1 
ATOM   2439 C  CD  . LYS B 2 42  ? -9.564  -25.647 -38.980 1.00 24.75  ? 42  LYS B CD  1 
ATOM   2440 C  CE  . LYS B 2 42  ? -8.884  -26.939 -39.307 1.00 25.45  ? 42  LYS B CE  1 
ATOM   2441 N  NZ  . LYS B 2 42  ? -9.045  -27.274 -40.743 1.00 31.65  ? 42  LYS B NZ  1 
ATOM   2442 N  N   . VAL B 2 43  ? -10.467 -21.108 -35.942 1.00 25.17  ? 43  VAL B N   1 
ATOM   2443 C  CA  . VAL B 2 43  ? -11.306 -19.931 -35.716 1.00 24.71  ? 43  VAL B CA  1 
ATOM   2444 C  C   . VAL B 2 43  ? -11.695 -19.363 -37.074 1.00 30.74  ? 43  VAL B C   1 
ATOM   2445 O  O   . VAL B 2 43  ? -10.992 -19.584 -38.080 1.00 29.89  ? 43  VAL B O   1 
ATOM   2446 C  CB  . VAL B 2 43  ? -10.691 -18.828 -34.801 1.00 27.71  ? 43  VAL B CB  1 
ATOM   2447 C  CG1 . VAL B 2 43  ? -10.415 -19.339 -33.389 1.00 27.50  ? 43  VAL B CG1 1 
ATOM   2448 C  CG2 . VAL B 2 43  ? -9.455  -18.184 -35.423 1.00 27.01  ? 43  VAL B CG2 1 
ATOM   2449 N  N   . ILE B 2 44  ? -12.800 -18.615 -37.104 1.00 28.39  ? 44  ILE B N   1 
ATOM   2450 C  CA  . ILE B 2 44  ? -13.204 -17.917 -38.318 1.00 28.50  ? 44  ILE B CA  1 
ATOM   2451 C  C   . ILE B 2 44  ? -12.446 -16.588 -38.266 1.00 34.01  ? 44  ILE B C   1 
ATOM   2452 O  O   . ILE B 2 44  ? -12.418 -15.934 -37.221 1.00 35.13  ? 44  ILE B O   1 
ATOM   2453 C  CB  . ILE B 2 44  ? -14.755 -17.747 -38.440 1.00 31.14  ? 44  ILE B CB  1 
ATOM   2454 C  CG1 . ILE B 2 44  ? -15.474 -19.107 -38.720 1.00 31.65  ? 44  ILE B CG1 1 
ATOM   2455 C  CG2 . ILE B 2 44  ? -15.152 -16.680 -39.466 1.00 30.95  ? 44  ILE B CG2 1 
ATOM   2456 C  CD1 . ILE B 2 44  ? -15.253 -19.783 -40.167 1.00 39.84  ? 44  ILE B CD1 1 
ATOM   2457 N  N   . CYS B 2 45  ? -11.755 -16.257 -39.348 1.00 30.04  ? 45  CYS B N   1 
ATOM   2458 C  CA  . CYS B 2 45  ? -11.030 -15.007 -39.490 1.00 30.09  ? 45  CYS B CA  1 
ATOM   2459 C  C   . CYS B 2 45  ? -11.439 -14.356 -40.778 1.00 33.24  ? 45  CYS B C   1 
ATOM   2460 O  O   . CYS B 2 45  ? -11.565 -15.023 -41.796 1.00 33.56  ? 45  CYS B O   1 
ATOM   2461 C  CB  . CYS B 2 45  ? -9.514  -15.195 -39.409 1.00 30.75  ? 45  CYS B CB  1 
ATOM   2462 S  SG  . CYS B 2 45  ? -8.836  -16.371 -40.606 1.00 34.82  ? 45  CYS B SG  1 
ATOM   2463 N  N   . THR B 2 46  ? -11.697 -13.067 -40.733 1.00 29.08  ? 46  THR B N   1 
ATOM   2464 C  CA  . THR B 2 46  ? -12.059 -12.355 -41.942 1.00 28.42  ? 46  THR B CA  1 
ATOM   2465 C  C   . THR B 2 46  ? -10.809 -11.697 -42.502 1.00 32.16  ? 46  THR B C   1 
ATOM   2466 O  O   . THR B 2 46  ? -9.976  -11.217 -41.747 1.00 30.40  ? 46  THR B O   1 
ATOM   2467 C  CB  . THR B 2 46  ? -13.254 -11.421 -41.712 1.00 31.47  ? 46  THR B CB  1 
ATOM   2468 O  OG1 . THR B 2 46  ? -12.961 -10.524 -40.648 1.00 32.05  ? 46  THR B OG1 1 
ATOM   2469 C  CG2 . THR B 2 46  ? -14.536 -12.180 -41.404 1.00 27.42  ? 46  THR B CG2 1 
ATOM   2470 N  N   . GLY B 2 47  ? -10.668 -11.721 -43.813 1.00 30.86  ? 47  GLY B N   1 
ATOM   2471 C  CA  . GLY B 2 47  ? -9.530  -11.109 -44.484 1.00 31.36  ? 47  GLY B CA  1 
ATOM   2472 C  C   . GLY B 2 47  ? -9.727  -10.981 -45.973 1.00 35.99  ? 47  GLY B C   1 
ATOM   2473 O  O   . GLY B 2 47  ? -10.613 -11.629 -46.532 1.00 35.97  ? 47  GLY B O   1 
ATOM   2474 N  N   . PRO B 2 48  ? -8.929  -10.146 -46.663 1.00 34.57  ? 48  PRO B N   1 
ATOM   2475 C  CA  . PRO B 2 48  ? -9.108  -10.032 -48.125 1.00 35.72  ? 48  PRO B CA  1 
ATOM   2476 C  C   . PRO B 2 48  ? -8.679  -11.314 -48.851 1.00 46.04  ? 48  PRO B C   1 
ATOM   2477 O  O   . PRO B 2 48  ? -7.887  -12.091 -48.308 1.00 45.14  ? 48  PRO B O   1 
ATOM   2478 C  CB  . PRO B 2 48  ? -8.241  -8.828  -48.498 1.00 36.70  ? 48  PRO B CB  1 
ATOM   2479 C  CG  . PRO B 2 48  ? -7.191  -8.774  -47.434 1.00 40.46  ? 48  PRO B CG  1 
ATOM   2480 C  CD  . PRO B 2 48  ? -7.809  -9.310  -46.176 1.00 35.47  ? 48  PRO B CD  1 
ATOM   2481 N  N   . ASN B 2 49  ? -9.227  -11.554 -50.045 1.00 48.63  ? 49  ASN B N   1 
ATOM   2482 C  CA  . ASN B 2 49  ? -8.866  -12.738 -50.824 1.00 51.66  ? 49  ASN B CA  1 
ATOM   2483 C  C   . ASN B 2 49  ? -7.713  -12.440 -51.796 1.00 61.16  ? 49  ASN B C   1 
ATOM   2484 O  O   . ASN B 2 49  ? -6.680  -13.108 -51.715 1.00 61.00  ? 49  ASN B O   1 
ATOM   2485 C  CB  . ASN B 2 49  ? -10.081 -13.399 -51.521 1.00 54.63  ? 49  ASN B CB  1 
ATOM   2486 C  CG  . ASN B 2 49  ? -11.074 -12.458 -52.177 1.00 83.12  ? 49  ASN B CG  1 
ATOM   2487 O  OD1 . ASN B 2 49  ? -12.144 -12.169 -51.630 1.00 74.88  ? 49  ASN B OD1 1 
ATOM   2488 N  ND2 . ASN B 2 49  ? -10.785 -12.018 -53.396 1.00 77.31  ? 49  ASN B ND2 1 
ATOM   2489 N  N   . ASP B 2 50  ? -7.880  -11.421 -52.684 1.00 60.92  ? 50  ASP B N   1 
ATOM   2490 C  CA  . ASP B 2 50  ? -6.888  -11.003 -53.687 1.00 61.88  ? 50  ASP B CA  1 
ATOM   2491 C  C   . ASP B 2 50  ? -5.662  -10.351 -53.044 1.00 66.76  ? 50  ASP B C   1 
ATOM   2492 O  O   . ASP B 2 50  ? -5.804  -9.441  -52.215 1.00 66.73  ? 50  ASP B O   1 
ATOM   2493 C  CB  . ASP B 2 50  ? -7.519  -10.048 -54.695 1.00 62.81  ? 50  ASP B CB  1 
ATOM   2494 N  N   . THR B 2 51  ? -4.461  -10.822 -53.437 1.00 62.71  ? 51  THR B N   1 
ATOM   2495 C  CA  . THR B 2 51  ? -3.180  -10.328 -52.924 1.00 61.95  ? 51  THR B CA  1 
ATOM   2496 C  C   . THR B 2 51  ? -2.382  -9.519  -53.972 1.00 64.15  ? 51  THR B C   1 
ATOM   2497 O  O   . THR B 2 51  ? -1.141  -9.528  -53.949 1.00 64.94  ? 51  THR B O   1 
ATOM   2498 C  CB  . THR B 2 51  ? -2.352  -11.487 -52.380 1.00 62.64  ? 51  THR B CB  1 
ATOM   2499 N  N   . SER B 2 52  ? -3.097  -8.802  -54.873 1.00 57.34  ? 52  SER B N   1 
ATOM   2500 C  CA  . SER B 2 52  ? -2.474  -7.962  -55.902 1.00 55.76  ? 52  SER B CA  1 
ATOM   2501 C  C   . SER B 2 52  ? -2.395  -6.479  -55.460 1.00 55.34  ? 52  SER B C   1 
ATOM   2502 O  O   . SER B 2 52  ? -3.431  -5.844  -55.251 1.00 53.68  ? 52  SER B O   1 
ATOM   2503 C  CB  . SER B 2 52  ? -3.146  -8.136  -57.265 1.00 59.54  ? 52  SER B CB  1 
ATOM   2504 O  OG  . SER B 2 52  ? -4.525  -8.457  -57.164 1.00 71.29  ? 52  SER B OG  1 
ATOM   2505 N  N   . PRO B 2 53  ? -1.164  -5.932  -55.281 1.00 49.61  ? 53  PRO B N   1 
ATOM   2506 C  CA  . PRO B 2 53  ? -1.025  -4.536  -54.803 1.00 48.26  ? 53  PRO B CA  1 
ATOM   2507 C  C   . PRO B 2 53  ? -1.670  -3.453  -55.673 1.00 47.30  ? 53  PRO B C   1 
ATOM   2508 O  O   . PRO B 2 53  ? -1.596  -3.498  -56.905 1.00 46.75  ? 53  PRO B O   1 
ATOM   2509 C  CB  . PRO B 2 53  ? 0.492   -4.345  -54.697 1.00 50.64  ? 53  PRO B CB  1 
ATOM   2510 C  CG  . PRO B 2 53  ? 1.052   -5.751  -54.578 1.00 55.58  ? 53  PRO B CG  1 
ATOM   2511 C  CD  . PRO B 2 53  ? 0.157   -6.577  -55.448 1.00 51.08  ? 53  PRO B CD  1 
ATOM   2512 N  N   . GLY B 2 54  ? -2.300  -2.491  -55.003 1.00 40.33  ? 54  GLY B N   1 
ATOM   2513 C  CA  . GLY B 2 54  ? -3.001  -1.378  -55.638 1.00 38.72  ? 54  GLY B CA  1 
ATOM   2514 C  C   . GLY B 2 54  ? -4.370  -1.741  -56.186 1.00 39.46  ? 54  GLY B C   1 
ATOM   2515 O  O   . GLY B 2 54  ? -4.892  -1.047  -57.056 1.00 36.98  ? 54  GLY B O   1 
ATOM   2516 N  N   . SER B 2 55  ? -4.964  -2.832  -55.678 1.00 36.49  ? 55  SER B N   1 
ATOM   2517 C  CA  . SER B 2 55  ? -6.269  -3.325  -56.115 1.00 37.01  ? 55  SER B CA  1 
ATOM   2518 C  C   . SER B 2 55  ? -7.321  -3.290  -54.986 1.00 38.72  ? 55  SER B C   1 
ATOM   2519 O  O   . SER B 2 55  ? -6.939  -3.278  -53.810 1.00 37.76  ? 55  SER B O   1 
ATOM   2520 C  CB  . SER B 2 55  ? -6.132  -4.749  -56.654 1.00 42.82  ? 55  SER B CB  1 
ATOM   2521 O  OG  . SER B 2 55  ? -5.382  -4.776  -57.860 1.00 53.82  ? 55  SER B OG  1 
ATOM   2522 N  N   . PRO B 2 56  ? -8.641  -3.272  -55.306 1.00 34.51  ? 56  PRO B N   1 
ATOM   2523 C  CA  . PRO B 2 56  ? -9.655  -3.311  -54.230 1.00 34.85  ? 56  PRO B CA  1 
ATOM   2524 C  C   . PRO B 2 56  ? -9.555  -4.591  -53.402 1.00 41.18  ? 56  PRO B C   1 
ATOM   2525 O  O   . PRO B 2 56  ? -9.272  -5.665  -53.942 1.00 40.65  ? 56  PRO B O   1 
ATOM   2526 C  CB  . PRO B 2 56  ? -10.995 -3.246  -54.981 1.00 36.15  ? 56  PRO B CB  1 
ATOM   2527 C  CG  . PRO B 2 56  ? -10.652 -2.741  -56.358 1.00 40.19  ? 56  PRO B CG  1 
ATOM   2528 C  CD  . PRO B 2 56  ? -9.277  -3.256  -56.639 1.00 35.80  ? 56  PRO B CD  1 
ATOM   2529 N  N   . ARG B 2 57  ? -9.780  -4.468  -52.091 1.00 40.24  ? 57  ARG B N   1 
ATOM   2530 C  CA  . ARG B 2 57  ? -9.717  -5.586  -51.150 1.00 40.77  ? 57  ARG B CA  1 
ATOM   2531 C  C   . ARG B 2 57  ? -11.107 -6.059  -50.723 1.00 46.36  ? 57  ARG B C   1 
ATOM   2532 O  O   . ARG B 2 57  ? -11.785 -5.371  -49.952 1.00 46.71  ? 57  ARG B O   1 
ATOM   2533 C  CB  . ARG B 2 57  ? -8.890  -5.205  -49.909 1.00 38.43  ? 57  ARG B CB  1 
ATOM   2534 C  CG  . ARG B 2 57  ? -7.413  -5.027  -50.176 1.00 36.83  ? 57  ARG B CG  1 
ATOM   2535 C  CD  . ARG B 2 57  ? -6.836  -4.083  -49.158 1.00 28.59  ? 57  ARG B CD  1 
ATOM   2536 N  NE  . ARG B 2 57  ? -5.454  -3.735  -49.459 1.00 33.78  ? 57  ARG B NE  1 
ATOM   2537 C  CZ  . ARG B 2 57  ? -4.747  -2.849  -48.769 1.00 52.58  ? 57  ARG B CZ  1 
ATOM   2538 N  NH1 . ARG B 2 57  ? -5.285  -2.226  -47.725 1.00 39.89  ? 57  ARG B NH1 1 
ATOM   2539 N  NH2 . ARG B 2 57  ? -3.493  -2.578  -49.116 1.00 41.08  ? 57  ARG B NH2 1 
ATOM   2540 N  N   . HIS B 2 58  ? -11.510 -7.255  -51.182 1.00 42.79  ? 58  HIS B N   1 
ATOM   2541 C  CA  . HIS B 2 58  ? -12.797 -7.825  -50.790 1.00 42.20  ? 58  HIS B CA  1 
ATOM   2542 C  C   . HIS B 2 58  ? -12.613 -8.827  -49.662 1.00 41.60  ? 58  HIS B C   1 
ATOM   2543 O  O   . HIS B 2 58  ? -11.989 -9.860  -49.849 1.00 41.39  ? 58  HIS B O   1 
ATOM   2544 C  CB  . HIS B 2 58  ? -13.580 -8.393  -51.989 1.00 44.03  ? 58  HIS B CB  1 
ATOM   2545 C  CG  . HIS B 2 58  ? -14.075 -7.325  -52.922 1.00 48.96  ? 58  HIS B CG  1 
ATOM   2546 N  ND1 . HIS B 2 58  ? -14.893 -6.285  -52.476 1.00 51.15  ? 58  HIS B ND1 1 
ATOM   2547 C  CD2 . HIS B 2 58  ? -13.832 -7.150  -54.245 1.00 51.40  ? 58  HIS B CD2 1 
ATOM   2548 C  CE1 . HIS B 2 58  ? -15.128 -5.535  -53.538 1.00 50.68  ? 58  HIS B CE1 1 
ATOM   2549 N  NE2 . HIS B 2 58  ? -14.509 -6.012  -54.625 1.00 51.25  ? 58  HIS B NE2 1 
ATOM   2550 N  N   . THR B 2 59  ? -13.130 -8.489  -48.485 1.00 36.34  ? 59  THR B N   1 
ATOM   2551 C  CA  . THR B 2 59  ? -13.045 -9.280  -47.263 1.00 35.75  ? 59  THR B CA  1 
ATOM   2552 C  C   . THR B 2 59  ? -14.035 -10.451 -47.297 1.00 39.12  ? 59  THR B C   1 
ATOM   2553 O  O   . THR B 2 59  ? -15.190 -10.281 -47.681 1.00 40.51  ? 59  THR B O   1 
ATOM   2554 C  CB  . THR B 2 59  ? -13.182 -8.342  -46.043 1.00 37.15  ? 59  THR B CB  1 
ATOM   2555 O  OG1 . THR B 2 59  ? -12.032 -7.497  -46.027 1.00 34.47  ? 59  THR B OG1 1 
ATOM   2556 C  CG2 . THR B 2 59  ? -13.258 -9.080  -44.713 1.00 34.61  ? 59  THR B CG2 1 
ATOM   2557 N  N   . VAL B 2 60  ? -13.566 -11.642 -46.911 1.00 33.01  ? 60  VAL B N   1 
ATOM   2558 C  CA  . VAL B 2 60  ? -14.375 -12.863 -46.872 1.00 31.32  ? 60  VAL B CA  1 
ATOM   2559 C  C   . VAL B 2 60  ? -14.091 -13.664 -45.582 1.00 31.41  ? 60  VAL B C   1 
ATOM   2560 O  O   . VAL B 2 60  ? -12.967 -13.621 -45.080 1.00 28.56  ? 60  VAL B O   1 
ATOM   2561 C  CB  . VAL B 2 60  ? -14.179 -13.777 -48.137 1.00 34.97  ? 60  VAL B CB  1 
ATOM   2562 C  CG1 . VAL B 2 60  ? -14.595 -13.081 -49.431 1.00 34.56  ? 60  VAL B CG1 1 
ATOM   2563 C  CG2 . VAL B 2 60  ? -12.756 -14.323 -48.243 1.00 34.43  ? 60  VAL B CG2 1 
ATOM   2564 N  N   . PRO B 2 61  ? -15.057 -14.470 -45.075 1.00 29.01  ? 61  PRO B N   1 
ATOM   2565 C  CA  . PRO B 2 61  ? -14.741 -15.350 -43.939 1.00 28.69  ? 61  PRO B CA  1 
ATOM   2566 C  C   . PRO B 2 61  ? -13.775 -16.444 -44.407 1.00 31.49  ? 61  PRO B C   1 
ATOM   2567 O  O   . PRO B 2 61  ? -13.869 -16.905 -45.539 1.00 31.46  ? 61  PRO B O   1 
ATOM   2568 C  CB  . PRO B 2 61  ? -16.109 -15.928 -43.547 1.00 29.91  ? 61  PRO B CB  1 
ATOM   2569 C  CG  . PRO B 2 61  ? -17.124 -15.033 -44.238 1.00 33.79  ? 61  PRO B CG  1 
ATOM   2570 C  CD  . PRO B 2 61  ? -16.456 -14.672 -45.509 1.00 29.68  ? 61  PRO B CD  1 
ATOM   2571 N  N   . GLN B 2 62  ? -12.792 -16.774 -43.564 1.00 27.57  ? 62  GLN B N   1 
ATOM   2572 C  CA  . GLN B 2 62  ? -11.740 -17.768 -43.795 1.00 27.20  ? 62  GLN B CA  1 
ATOM   2573 C  C   . GLN B 2 62  ? -11.496 -18.526 -42.477 1.00 31.81  ? 62  GLN B C   1 
ATOM   2574 O  O   . GLN B 2 62  ? -11.989 -18.089 -41.434 1.00 30.08  ? 62  GLN B O   1 
ATOM   2575 C  CB  . GLN B 2 62  ? -10.447 -17.066 -44.277 1.00 27.90  ? 62  GLN B CB  1 
ATOM   2576 C  CG  . GLN B 2 62  ? -10.566 -16.527 -45.695 1.00 38.45  ? 62  GLN B CG  1 
ATOM   2577 C  CD  . GLN B 2 62  ? -9.355  -15.776 -46.177 1.00 50.17  ? 62  GLN B CD  1 
ATOM   2578 O  OE1 . GLN B 2 62  ? -8.380  -16.371 -46.644 1.00 48.34  ? 62  GLN B OE1 1 
ATOM   2579 N  NE2 . GLN B 2 62  ? -9.436  -14.450 -46.188 1.00 30.45  ? 62  GLN B NE2 1 
ATOM   2580 N  N   . CYS B 2 63  ? -10.753 -19.654 -42.526 1.00 31.21  ? 63  CYS B N   1 
ATOM   2581 C  CA  . CYS B 2 63  ? -10.389 -20.467 -41.358 1.00 33.09  ? 63  CYS B CA  1 
ATOM   2582 C  C   . CYS B 2 63  ? -8.934  -20.214 -40.965 1.00 32.74  ? 63  CYS B C   1 
ATOM   2583 O  O   . CYS B 2 63  ? -8.031  -20.324 -41.789 1.00 30.28  ? 63  CYS B O   1 
ATOM   2584 C  CB  . CYS B 2 63  ? -10.654 -21.955 -41.602 1.00 36.13  ? 63  CYS B CB  1 
ATOM   2585 S  SG  . CYS B 2 63  ? -12.408 -22.374 -41.856 1.00 41.95  ? 63  CYS B SG  1 
ATOM   2586 N  N   . CYS B 2 64  ? -8.717  -19.881 -39.703 1.00 28.87  ? 64  CYS B N   1 
ATOM   2587 C  CA  . CYS B 2 64  ? -7.394  -19.640 -39.134 1.00 28.83  ? 64  CYS B CA  1 
ATOM   2588 C  C   . CYS B 2 64  ? -7.103  -20.699 -38.046 1.00 27.71  ? 64  CYS B C   1 
ATOM   2589 O  O   . CYS B 2 64  ? -7.962  -21.013 -37.219 1.00 26.01  ? 64  CYS B O   1 
ATOM   2590 C  CB  . CYS B 2 64  ? -7.306  -18.220 -38.566 1.00 30.35  ? 64  CYS B CB  1 
ATOM   2591 S  SG  . CYS B 2 64  ? -7.024  -16.922 -39.813 1.00 34.96  ? 64  CYS B SG  1 
ATOM   2592 N  N   . TYR B 2 65  ? -5.889  -21.246 -38.060 1.00 21.25  ? 65  TYR B N   1 
ATOM   2593 C  CA  . TYR B 2 65  ? -5.393  -22.205 -37.075 1.00 18.45  ? 65  TYR B CA  1 
ATOM   2594 C  C   . TYR B 2 65  ? -3.875  -22.173 -37.061 1.00 20.37  ? 65  TYR B C   1 
ATOM   2595 O  O   . TYR B 2 65  ? -3.266  -21.658 -38.000 1.00 19.23  ? 65  TYR B O   1 
ATOM   2596 C  CB  . TYR B 2 65  ? -5.932  -23.633 -37.311 1.00 18.18  ? 65  TYR B CB  1 
ATOM   2597 C  CG  . TYR B 2 65  ? -5.566  -24.245 -38.645 1.00 17.82  ? 65  TYR B CG  1 
ATOM   2598 C  CD1 . TYR B 2 65  ? -6.341  -24.009 -39.782 1.00 19.62  ? 65  TYR B CD1 1 
ATOM   2599 C  CD2 . TYR B 2 65  ? -4.458  -25.080 -38.770 1.00 17.44  ? 65  TYR B CD2 1 
ATOM   2600 C  CE1 . TYR B 2 65  ? -6.014  -24.586 -41.014 1.00 20.81  ? 65  TYR B CE1 1 
ATOM   2601 C  CE2 . TYR B 2 65  ? -4.126  -25.665 -39.988 1.00 17.99  ? 65  TYR B CE2 1 
ATOM   2602 C  CZ  . TYR B 2 65  ? -4.919  -25.436 -41.106 1.00 26.95  ? 65  TYR B CZ  1 
ATOM   2603 O  OH  . TYR B 2 65  ? -4.594  -26.040 -42.304 1.00 27.55  ? 65  TYR B OH  1 
ATOM   2604 N  N   . GLY B 2 66  ? -3.275  -22.734 -36.014 1.00 16.19  ? 66  GLY B N   1 
ATOM   2605 C  CA  . GLY B 2 66  ? -1.827  -22.816 -35.897 1.00 15.02  ? 66  GLY B CA  1 
ATOM   2606 C  C   . GLY B 2 66  ? -1.342  -22.525 -34.510 1.00 18.40  ? 66  GLY B C   1 
ATOM   2607 O  O   . GLY B 2 66  ? -2.141  -22.439 -33.572 1.00 17.80  ? 66  GLY B O   1 
ATOM   2608 N  N   . PHE B 2 67  ? -0.009  -22.408 -34.382 1.00 15.58  ? 67  PHE B N   1 
ATOM   2609 C  CA  . PHE B 2 67  ? 0.706   -22.115 -33.143 1.00 15.25  ? 67  PHE B CA  1 
ATOM   2610 C  C   . PHE B 2 67  ? 0.120   -20.840 -32.478 1.00 23.68  ? 67  PHE B C   1 
ATOM   2611 O  O   . PHE B 2 67  ? -0.296  -20.897 -31.327 1.00 24.43  ? 67  PHE B O   1 
ATOM   2612 C  CB  . PHE B 2 67  ? 2.218   -21.979 -33.449 1.00 16.40  ? 67  PHE B CB  1 
ATOM   2613 C  CG  . PHE B 2 67  ? 3.117   -21.694 -32.271 1.00 17.73  ? 67  PHE B CG  1 
ATOM   2614 C  CD1 . PHE B 2 67  ? 3.063   -20.457 -31.609 1.00 21.10  ? 67  PHE B CD1 1 
ATOM   2615 C  CD2 . PHE B 2 67  ? 4.071   -22.622 -31.865 1.00 18.57  ? 67  PHE B CD2 1 
ATOM   2616 C  CE1 . PHE B 2 67  ? 3.896   -20.188 -30.518 1.00 22.44  ? 67  PHE B CE1 1 
ATOM   2617 C  CE2 . PHE B 2 67  ? 4.948   -22.331 -30.811 1.00 22.15  ? 67  PHE B CE2 1 
ATOM   2618 C  CZ  . PHE B 2 67  ? 4.842   -21.127 -30.125 1.00 21.35  ? 67  PHE B CZ  1 
ATOM   2619 N  N   . CYS B 2 68  ? 0.021   -19.735 -33.224 1.00 23.69  ? 68  CYS B N   1 
ATOM   2620 C  CA  . CYS B 2 68  ? -0.509  -18.471 -32.734 1.00 25.34  ? 68  CYS B CA  1 
ATOM   2621 C  C   . CYS B 2 68  ? -2.011  -18.502 -32.397 1.00 25.25  ? 68  CYS B C   1 
ATOM   2622 O  O   . CYS B 2 68  ? -2.408  -17.847 -31.432 1.00 24.65  ? 68  CYS B O   1 
ATOM   2623 C  CB  . CYS B 2 68  ? -0.162  -17.337 -33.688 1.00 28.39  ? 68  CYS B CB  1 
ATOM   2624 S  SG  . CYS B 2 68  ? 1.565   -16.788 -33.561 1.00 34.42  ? 68  CYS B SG  1 
ATOM   2625 N  N   . ILE B 2 69  ? -2.830  -19.280 -33.130 1.00 19.13  ? 69  ILE B N   1 
ATOM   2626 C  CA  . ILE B 2 69  ? -4.260  -19.424 -32.824 1.00 18.56  ? 69  ILE B CA  1 
ATOM   2627 C  C   . ILE B 2 69  ? -4.468  -20.213 -31.494 1.00 25.25  ? 69  ILE B C   1 
ATOM   2628 O  O   . ILE B 2 69  ? -5.292  -19.799 -30.666 1.00 24.55  ? 69  ILE B O   1 
ATOM   2629 C  CB  . ILE B 2 69  ? -5.077  -19.980 -34.026 1.00 21.40  ? 69  ILE B CB  1 
ATOM   2630 C  CG1 . ILE B 2 69  ? -4.904  -19.084 -35.293 1.00 21.64  ? 69  ILE B CG1 1 
ATOM   2631 C  CG2 . ILE B 2 69  ? -6.575  -20.201 -33.689 1.00 21.62  ? 69  ILE B CG2 1 
ATOM   2632 C  CD1 . ILE B 2 69  ? -5.135  -17.534 -35.159 1.00 25.41  ? 69  ILE B CD1 1 
ATOM   2633 N  N   . ASP B 2 70  ? -3.663  -21.276 -31.249 1.00 23.09  ? 70  ASP B N   1 
ATOM   2634 C  CA  . ASP B 2 70  ? -3.745  -22.022 -29.994 1.00 23.36  ? 70  ASP B CA  1 
ATOM   2635 C  C   . ASP B 2 70  ? -3.336  -21.133 -28.836 1.00 27.08  ? 70  ASP B C   1 
ATOM   2636 O  O   . ASP B 2 70  ? -3.930  -21.217 -27.755 1.00 24.64  ? 70  ASP B O   1 
ATOM   2637 C  CB  . ASP B 2 70  ? -2.863  -23.273 -30.032 1.00 25.30  ? 70  ASP B CB  1 
ATOM   2638 C  CG  . ASP B 2 70  ? -3.411  -24.396 -30.877 1.00 37.99  ? 70  ASP B CG  1 
ATOM   2639 O  OD1 . ASP B 2 70  ? -4.525  -24.229 -31.447 1.00 37.64  ? 70  ASP B OD1 1 
ATOM   2640 O  OD2 . ASP B 2 70  ? -2.749  -25.459 -30.950 1.00 45.25  ? 70  ASP B OD2 1 
ATOM   2641 N  N   . LEU B 2 71  ? -2.327  -20.266 -29.073 1.00 25.73  ? 71  LEU B N   1 
ATOM   2642 C  CA  . LEU B 2 71  ? -1.860  -19.295 -28.084 1.00 26.29  ? 71  LEU B CA  1 
ATOM   2643 C  C   . LEU B 2 71  ? -3.009  -18.294 -27.775 1.00 26.68  ? 71  LEU B C   1 
ATOM   2644 O  O   . LEU B 2 71  ? -3.314  -18.061 -26.601 1.00 26.45  ? 71  LEU B O   1 
ATOM   2645 C  CB  . LEU B 2 71  ? -0.574  -18.575 -28.558 1.00 27.01  ? 71  LEU B CB  1 
ATOM   2646 C  CG  . LEU B 2 71  ? 0.152   -17.715 -27.494 1.00 33.05  ? 71  LEU B CG  1 
ATOM   2647 C  CD1 . LEU B 2 71  ? 0.549   -18.563 -26.246 1.00 34.09  ? 71  LEU B CD1 1 
ATOM   2648 C  CD2 . LEU B 2 71  ? 1.378   -17.054 -28.084 1.00 34.25  ? 71  LEU B CD2 1 
ATOM   2649 N  N   . LEU B 2 72  ? -3.683  -17.787 -28.823 1.00 20.50  ? 72  LEU B N   1 
ATOM   2650 C  CA  . LEU B 2 72  ? -4.833  -16.901 -28.680 1.00 20.56  ? 72  LEU B CA  1 
ATOM   2651 C  C   . LEU B 2 72  ? -5.906  -17.490 -27.757 1.00 25.37  ? 72  LEU B C   1 
ATOM   2652 O  O   . LEU B 2 72  ? -6.299  -16.844 -26.788 1.00 25.20  ? 72  LEU B O   1 
ATOM   2653 C  CB  . LEU B 2 72  ? -5.446  -16.532 -30.037 1.00 20.31  ? 72  LEU B CB  1 
ATOM   2654 C  CG  . LEU B 2 72  ? -6.651  -15.570 -29.960 1.00 24.24  ? 72  LEU B CG  1 
ATOM   2655 C  CD1 . LEU B 2 72  ? -6.252  -14.223 -29.398 1.00 23.91  ? 72  LEU B CD1 1 
ATOM   2656 C  CD2 . LEU B 2 72  ? -7.295  -15.422 -31.294 1.00 26.00  ? 72  LEU B CD2 1 
ATOM   2657 N  N   . ILE B 2 73  ? -6.346  -18.719 -28.058 1.00 22.04  ? 73  ILE B N   1 
ATOM   2658 C  CA  . ILE B 2 73  ? -7.342  -19.493 -27.322 1.00 21.43  ? 73  ILE B CA  1 
ATOM   2659 C  C   . ILE B 2 73  ? -6.897  -19.678 -25.854 1.00 25.32  ? 73  ILE B C   1 
ATOM   2660 O  O   . ILE B 2 73  ? -7.713  -19.493 -24.950 1.00 25.73  ? 73  ILE B O   1 
ATOM   2661 C  CB  . ILE B 2 73  ? -7.604  -20.845 -28.095 1.00 24.62  ? 73  ILE B CB  1 
ATOM   2662 C  CG1 . ILE B 2 73  ? -8.291  -20.577 -29.453 1.00 23.62  ? 73  ILE B CG1 1 
ATOM   2663 C  CG2 . ILE B 2 73  ? -8.420  -21.867 -27.257 1.00 26.15  ? 73  ILE B CG2 1 
ATOM   2664 C  CD1 . ILE B 2 73  ? -8.233  -21.715 -30.469 1.00 28.48  ? 73  ILE B CD1 1 
ATOM   2665 N  N   . LYS B 2 74  ? -5.605  -19.987 -25.618 1.00 21.28  ? 74  LYS B N   1 
ATOM   2666 C  CA  . LYS B 2 74  ? -5.077  -20.171 -24.266 1.00 21.48  ? 74  LYS B CA  1 
ATOM   2667 C  C   . LYS B 2 74  ? -5.152  -18.863 -23.483 1.00 28.22  ? 74  LYS B C   1 
ATOM   2668 O  O   . LYS B 2 74  ? -5.700  -18.871 -22.381 1.00 28.45  ? 74  LYS B O   1 
ATOM   2669 C  CB  . LYS B 2 74  ? -3.660  -20.818 -24.266 1.00 23.53  ? 74  LYS B CB  1 
ATOM   2670 C  CG  . LYS B 2 74  ? -2.950  -20.934 -22.882 1.00 33.07  ? 74  LYS B CG  1 
ATOM   2671 C  CD  . LYS B 2 74  ? -3.658  -21.840 -21.858 1.00 34.69  ? 74  LYS B CD  1 
ATOM   2672 C  CE  . LYS B 2 74  ? -3.238  -23.284 -21.949 1.00 48.98  ? 74  LYS B CE  1 
ATOM   2673 N  NZ  . LYS B 2 74  ? -4.304  -24.213 -21.480 1.00 54.43  ? 74  LYS B NZ  1 
ATOM   2674 N  N   . LEU B 2 75  ? -4.665  -17.739 -24.075 1.00 25.83  ? 75  LEU B N   1 
ATOM   2675 C  CA  . LEU B 2 75  ? -4.736  -16.390 -23.491 1.00 25.12  ? 75  LEU B CA  1 
ATOM   2676 C  C   . LEU B 2 75  ? -6.196  -15.995 -23.204 1.00 29.68  ? 75  LEU B C   1 
ATOM   2677 O  O   . LEU B 2 75  ? -6.495  -15.594 -22.073 1.00 30.23  ? 75  LEU B O   1 
ATOM   2678 C  CB  . LEU B 2 75  ? -4.090  -15.342 -24.409 1.00 24.93  ? 75  LEU B CB  1 
ATOM   2679 C  CG  . LEU B 2 75  ? -2.564  -15.394 -24.565 1.00 30.09  ? 75  LEU B CG  1 
ATOM   2680 C  CD1 . LEU B 2 75  ? -2.137  -14.687 -25.833 1.00 29.59  ? 75  LEU B CD1 1 
ATOM   2681 C  CD2 . LEU B 2 75  ? -1.853  -14.758 -23.356 1.00 32.88  ? 75  LEU B CD2 1 
ATOM   2682 N  N   . ALA B 2 76  ? -7.100  -16.137 -24.212 1.00 24.90  ? 76  ALA B N   1 
ATOM   2683 C  CA  . ALA B 2 76  ? -8.520  -15.834 -24.075 1.00 25.41  ? 76  ALA B CA  1 
ATOM   2684 C  C   . ALA B 2 76  ? -9.191  -16.563 -22.896 1.00 33.31  ? 76  ALA B C   1 
ATOM   2685 O  O   . ALA B 2 76  ? -9.902  -15.916 -22.135 1.00 35.21  ? 76  ALA B O   1 
ATOM   2686 C  CB  . ALA B 2 76  ? -9.262  -16.114 -25.373 1.00 25.88  ? 76  ALA B CB  1 
ATOM   2687 N  N   . ARG B 2 77  ? -8.941  -17.877 -22.716 1.00 29.84  ? 77  ARG B N   1 
ATOM   2688 C  CA  . ARG B 2 77  ? -9.524  -18.661 -21.621 1.00 29.43  ? 77  ARG B CA  1 
ATOM   2689 C  C   . ARG B 2 77  ? -8.838  -18.386 -20.280 1.00 34.96  ? 77  ARG B C   1 
ATOM   2690 O  O   . ARG B 2 77  ? -9.487  -18.494 -19.236 1.00 34.61  ? 77  ARG B O   1 
ATOM   2691 C  CB  . ARG B 2 77  ? -9.478  -20.150 -21.947 1.00 29.99  ? 77  ARG B CB  1 
ATOM   2692 N  N   . THR B 2 78  ? -7.539  -18.018 -20.300 1.00 32.24  ? 78  THR B N   1 
ATOM   2693 C  CA  . THR B 2 78  ? -6.794  -17.715 -19.077 1.00 32.52  ? 78  THR B CA  1 
ATOM   2694 C  C   . THR B 2 78  ? -7.213  -16.368 -18.487 1.00 37.18  ? 78  THR B C   1 
ATOM   2695 O  O   . THR B 2 78  ? -7.403  -16.265 -17.271 1.00 38.33  ? 78  THR B O   1 
ATOM   2696 C  CB  . THR B 2 78  ? -5.288  -17.841 -19.321 1.00 40.73  ? 78  THR B CB  1 
ATOM   2697 O  OG1 . THR B 2 78  ? -5.010  -19.218 -19.560 1.00 44.52  ? 78  THR B OG1 1 
ATOM   2698 C  CG2 . THR B 2 78  ? -4.444  -17.352 -18.143 1.00 39.29  ? 78  THR B CG2 1 
ATOM   2699 N  N   . MET B 2 79  ? -7.363  -15.354 -19.338 1.00 32.28  ? 79  MET B N   1 
ATOM   2700 C  CA  . MET B 2 79  ? -7.751  -14.021 -18.911 1.00 32.35  ? 79  MET B CA  1 
ATOM   2701 C  C   . MET B 2 79  ? -9.234  -13.726 -19.077 1.00 38.44  ? 79  MET B C   1 
ATOM   2702 O  O   . MET B 2 79  ? -9.652  -12.604 -18.793 1.00 39.18  ? 79  MET B O   1 
ATOM   2703 C  CB  . MET B 2 79  ? -6.895  -12.980 -19.599 1.00 34.81  ? 79  MET B CB  1 
ATOM   2704 C  CG  . MET B 2 79  ? -5.459  -13.042 -19.144 1.00 39.30  ? 79  MET B CG  1 
ATOM   2705 S  SD  . MET B 2 79  ? -4.384  -12.482 -20.452 1.00 44.60  ? 79  MET B SD  1 
ATOM   2706 C  CE  . MET B 2 79  ? -4.738  -10.697 -20.375 1.00 41.74  ? 79  MET B CE  1 
ATOM   2707 N  N   . ASN B 2 80  ? -10.039 -14.733 -19.489 1.00 35.60  ? 80  ASN B N   1 
ATOM   2708 C  CA  . ASN B 2 80  ? -11.502 -14.637 -19.608 1.00 35.87  ? 80  ASN B CA  1 
ATOM   2709 C  C   . ASN B 2 80  ? -11.950 -13.446 -20.487 1.00 37.90  ? 80  ASN B C   1 
ATOM   2710 O  O   . ASN B 2 80  ? -12.403 -12.424 -19.976 1.00 38.69  ? 80  ASN B O   1 
ATOM   2711 C  CB  . ASN B 2 80  ? -12.148 -14.622 -18.177 1.00 37.84  ? 80  ASN B CB  1 
ATOM   2712 C  CG  . ASN B 2 80  ? -13.662 -14.564 -18.093 1.00 65.78  ? 80  ASN B CG  1 
ATOM   2713 O  OD1 . ASN B 2 80  ? -14.402 -15.061 -18.958 1.00 61.52  ? 80  ASN B OD1 1 
ATOM   2714 N  ND2 . ASN B 2 80  ? -14.154 -13.991 -17.001 1.00 58.46  ? 80  ASN B ND2 1 
ATOM   2715 N  N   . PHE B 2 81  ? -11.752 -13.563 -21.804 1.00 32.40  ? 81  PHE B N   1 
ATOM   2716 C  CA  . PHE B 2 81  ? -12.160 -12.555 -22.792 1.00 30.27  ? 81  PHE B CA  1 
ATOM   2717 C  C   . PHE B 2 81  ? -12.651 -13.196 -24.084 1.00 31.86  ? 81  PHE B C   1 
ATOM   2718 O  O   . PHE B 2 81  ? -12.391 -14.378 -24.329 1.00 30.62  ? 81  PHE B O   1 
ATOM   2719 C  CB  . PHE B 2 81  ? -11.072 -11.485 -23.054 1.00 31.23  ? 81  PHE B CB  1 
ATOM   2720 C  CG  . PHE B 2 81  ? -9.778  -11.907 -23.725 1.00 31.68  ? 81  PHE B CG  1 
ATOM   2721 C  CD1 . PHE B 2 81  ? -9.740  -12.190 -25.089 1.00 33.99  ? 81  PHE B CD1 1 
ATOM   2722 C  CD2 . PHE B 2 81  ? -8.577  -11.876 -23.029 1.00 32.31  ? 81  PHE B CD2 1 
ATOM   2723 C  CE1 . PHE B 2 81  ? -8.539  -12.522 -25.721 1.00 34.63  ? 81  PHE B CE1 1 
ATOM   2724 C  CE2 . PHE B 2 81  ? -7.377  -12.231 -23.654 1.00 34.85  ? 81  PHE B CE2 1 
ATOM   2725 C  CZ  . PHE B 2 81  ? -7.363  -12.544 -24.998 1.00 32.98  ? 81  PHE B CZ  1 
ATOM   2726 N  N   . THR B 2 82  ? -13.392 -12.428 -24.884 1.00 27.63  ? 82  THR B N   1 
ATOM   2727 C  CA  . THR B 2 82  ? -13.878 -12.896 -26.175 1.00 27.37  ? 82  THR B CA  1 
ATOM   2728 C  C   . THR B 2 82  ? -13.185 -12.099 -27.258 1.00 29.13  ? 82  THR B C   1 
ATOM   2729 O  O   . THR B 2 82  ? -12.632 -11.015 -26.993 1.00 28.38  ? 82  THR B O   1 
ATOM   2730 C  CB  . THR B 2 82  ? -15.418 -12.957 -26.277 1.00 35.79  ? 82  THR B CB  1 
ATOM   2731 O  OG1 . THR B 2 82  ? -15.988 -11.662 -26.090 1.00 38.32  ? 82  THR B OG1 1 
ATOM   2732 C  CG2 . THR B 2 82  ? -16.016 -13.959 -25.320 1.00 32.36  ? 82  THR B CG2 1 
ATOM   2733 N  N   . TYR B 2 83  ? -13.184 -12.645 -28.474 1.00 22.79  ? 83  TYR B N   1 
ATOM   2734 C  CA  . TYR B 2 83  ? -12.429 -12.039 -29.545 1.00 21.65  ? 83  TYR B CA  1 
ATOM   2735 C  C   . TYR B 2 83  ? -13.042 -12.240 -30.894 1.00 27.28  ? 83  TYR B C   1 
ATOM   2736 O  O   . TYR B 2 83  ? -13.908 -13.092 -31.055 1.00 29.04  ? 83  TYR B O   1 
ATOM   2737 C  CB  . TYR B 2 83  ? -11.001 -12.638 -29.535 1.00 21.23  ? 83  TYR B CB  1 
ATOM   2738 C  CG  . TYR B 2 83  ? -10.971 -14.149 -29.644 1.00 20.67  ? 83  TYR B CG  1 
ATOM   2739 C  CD1 . TYR B 2 83  ? -10.971 -14.779 -30.887 1.00 22.94  ? 83  TYR B CD1 1 
ATOM   2740 C  CD2 . TYR B 2 83  ? -10.957 -14.948 -28.509 1.00 20.53  ? 83  TYR B CD2 1 
ATOM   2741 C  CE1 . TYR B 2 83  ? -10.979 -16.167 -30.993 1.00 24.19  ? 83  TYR B CE1 1 
ATOM   2742 C  CE2 . TYR B 2 83  ? -10.951 -16.339 -28.605 1.00 21.52  ? 83  TYR B CE2 1 
ATOM   2743 C  CZ  . TYR B 2 83  ? -10.965 -16.944 -29.849 1.00 31.84  ? 83  TYR B CZ  1 
ATOM   2744 O  OH  . TYR B 2 83  ? -10.968 -18.316 -29.946 1.00 39.02  ? 83  TYR B OH  1 
ATOM   2745 N  N   . GLU B 2 84  ? -12.519 -11.502 -31.879 1.00 23.77  ? 84  GLU B N   1 
ATOM   2746 C  CA  . GLU B 2 84  ? -12.853 -11.563 -33.299 1.00 23.42  ? 84  GLU B CA  1 
ATOM   2747 C  C   . GLU B 2 84  ? -11.508 -11.458 -34.014 1.00 24.86  ? 84  GLU B C   1 
ATOM   2748 O  O   . GLU B 2 84  ? -10.816 -10.459 -33.863 1.00 24.36  ? 84  GLU B O   1 
ATOM   2749 C  CB  . GLU B 2 84  ? -13.738 -10.382 -33.724 1.00 25.13  ? 84  GLU B CB  1 
ATOM   2750 C  CG  . GLU B 2 84  ? -15.147 -10.429 -33.180 1.00 46.18  ? 84  GLU B CG  1 
ATOM   2751 C  CD  . GLU B 2 84  ? -16.017 -9.205  -33.405 1.00 78.33  ? 84  GLU B CD  1 
ATOM   2752 O  OE1 . GLU B 2 84  ? -15.475 -8.129  -33.753 1.00 72.16  ? 84  GLU B OE1 1 
ATOM   2753 O  OE2 . GLU B 2 84  ? -17.245 -9.315  -33.183 1.00 77.69  ? 84  GLU B OE2 1 
ATOM   2754 N  N   . VAL B 2 85  ? -11.143 -12.483 -34.772 1.00 19.92  ? 85  VAL B N   1 
ATOM   2755 C  CA  . VAL B 2 85  ? -9.894  -12.527 -35.518 1.00 18.67  ? 85  VAL B CA  1 
ATOM   2756 C  C   . VAL B 2 85  ? -10.078 -11.992 -36.939 1.00 22.53  ? 85  VAL B C   1 
ATOM   2757 O  O   . VAL B 2 85  ? -11.008 -12.374 -37.641 1.00 20.48  ? 85  VAL B O   1 
ATOM   2758 C  CB  . VAL B 2 85  ? -9.261  -13.944 -35.537 1.00 21.35  ? 85  VAL B CB  1 
ATOM   2759 C  CG1 . VAL B 2 85  ? -7.848  -13.900 -36.109 1.00 21.05  ? 85  VAL B CG1 1 
ATOM   2760 C  CG2 . VAL B 2 85  ? -9.246  -14.570 -34.138 1.00 20.96  ? 85  VAL B CG2 1 
ATOM   2761 N  N   . HIS B 2 86  ? -9.168  -11.113 -37.361 1.00 20.08  ? 86  HIS B N   1 
ATOM   2762 C  CA  . HIS B 2 86  ? -9.133  -10.647 -38.734 1.00 19.61  ? 86  HIS B CA  1 
ATOM   2763 C  C   . HIS B 2 86  ? -7.690  -10.609 -39.223 1.00 22.18  ? 86  HIS B C   1 
ATOM   2764 O  O   . HIS B 2 86  ? -6.741  -10.555 -38.429 1.00 19.92  ? 86  HIS B O   1 
ATOM   2765 C  CB  . HIS B 2 86  ? -9.903  -9.336  -38.960 1.00 20.16  ? 86  HIS B CB  1 
ATOM   2766 C  CG  . HIS B 2 86  ? -9.167  -8.106  -38.539 1.00 23.57  ? 86  HIS B CG  1 
ATOM   2767 N  ND1 . HIS B 2 86  ? -9.316  -7.574  -37.270 1.00 25.61  ? 86  HIS B ND1 1 
ATOM   2768 C  CD2 . HIS B 2 86  ? -8.302  -7.337  -39.236 1.00 24.71  ? 86  HIS B CD2 1 
ATOM   2769 C  CE1 . HIS B 2 86  ? -8.539  -6.508  -37.235 1.00 24.73  ? 86  HIS B CE1 1 
ATOM   2770 N  NE2 . HIS B 2 86  ? -7.914  -6.323  -38.396 1.00 24.67  ? 86  HIS B NE2 1 
ATOM   2771 N  N   . LEU B 2 87  ? -7.539  -10.730 -40.527 1.00 19.77  ? 87  LEU B N   1 
ATOM   2772 C  CA  . LEU B 2 87  ? -6.260  -10.687 -41.201 1.00 19.64  ? 87  LEU B CA  1 
ATOM   2773 C  C   . LEU B 2 87  ? -5.983  -9.265  -41.629 1.00 24.98  ? 87  LEU B C   1 
ATOM   2774 O  O   . LEU B 2 87  ? -6.867  -8.584  -42.157 1.00 26.14  ? 87  LEU B O   1 
ATOM   2775 C  CB  . LEU B 2 87  ? -6.285  -11.604 -42.425 1.00 19.76  ? 87  LEU B CB  1 
ATOM   2776 C  CG  . LEU B 2 87  ? -6.335  -13.120 -42.161 1.00 25.00  ? 87  LEU B CG  1 
ATOM   2777 C  CD1 . LEU B 2 87  ? -6.839  -13.861 -43.408 1.00 25.41  ? 87  LEU B CD1 1 
ATOM   2778 C  CD2 . LEU B 2 87  ? -4.963  -13.663 -41.776 1.00 25.81  ? 87  LEU B CD2 1 
ATOM   2779 N  N   . VAL B 2 88  ? -4.750  -8.820  -41.403 1.00 21.71  ? 88  VAL B N   1 
ATOM   2780 C  CA  . VAL B 2 88  ? -4.251  -7.501  -41.789 1.00 20.55  ? 88  VAL B CA  1 
ATOM   2781 C  C   . VAL B 2 88  ? -4.579  -7.244  -43.260 1.00 23.69  ? 88  VAL B C   1 
ATOM   2782 O  O   . VAL B 2 88  ? -4.280  -8.092  -44.109 1.00 22.18  ? 88  VAL B O   1 
ATOM   2783 C  CB  . VAL B 2 88  ? -2.740  -7.362  -41.433 1.00 23.15  ? 88  VAL B CB  1 
ATOM   2784 C  CG1 . VAL B 2 88  ? -1.875  -8.468  -42.061 1.00 21.94  ? 88  VAL B CG1 1 
ATOM   2785 C  CG2 . VAL B 2 88  ? -2.203  -5.962  -41.732 1.00 22.43  ? 88  VAL B CG2 1 
ATOM   2786 N  N   . ALA B 2 89  ? -5.298  -6.137  -43.534 1.00 21.04  ? 89  ALA B N   1 
ATOM   2787 C  CA  . ALA B 2 89  ? -5.766  -5.788  -44.889 1.00 20.96  ? 89  ALA B CA  1 
ATOM   2788 C  C   . ALA B 2 89  ? -4.639  -5.651  -45.960 1.00 25.08  ? 89  ALA B C   1 
ATOM   2789 O  O   . ALA B 2 89  ? -4.807  -6.111  -47.089 1.00 24.66  ? 89  ALA B O   1 
ATOM   2790 C  CB  . ALA B 2 89  ? -6.617  -4.539  -44.846 1.00 21.27  ? 89  ALA B CB  1 
ATOM   2791 N  N   . ASP B 2 90  ? -3.492  -5.081  -45.594 1.00 21.46  ? 90  ASP B N   1 
ATOM   2792 C  CA  . ASP B 2 90  ? -2.391  -4.923  -46.549 1.00 20.55  ? 90  ASP B CA  1 
ATOM   2793 C  C   . ASP B 2 90  ? -1.440  -6.117  -46.583 1.00 21.54  ? 90  ASP B C   1 
ATOM   2794 O  O   . ASP B 2 90  ? -0.466  -6.074  -47.316 1.00 19.95  ? 90  ASP B O   1 
ATOM   2795 C  CB  . ASP B 2 90  ? -1.628  -3.611  -46.302 1.00 22.58  ? 90  ASP B CB  1 
ATOM   2796 C  CG  . ASP B 2 90  ? -0.864  -3.512  -44.982 1.00 32.96  ? 90  ASP B CG  1 
ATOM   2797 O  OD1 . ASP B 2 90  ? -0.600  -4.568  -44.362 1.00 32.78  ? 90  ASP B OD1 1 
ATOM   2798 O  OD2 . ASP B 2 90  ? -0.456  -2.382  -44.612 1.00 38.12  ? 90  ASP B OD2 1 
ATOM   2799 N  N   . GLY B 2 91  ? -1.700  -7.134  -45.756 1.00 18.16  ? 91  GLY B N   1 
ATOM   2800 C  CA  . GLY B 2 91  ? -0.884  -8.346  -45.663 1.00 17.26  ? 91  GLY B CA  1 
ATOM   2801 C  C   . GLY B 2 91  ? 0.547   -8.147  -45.191 1.00 21.03  ? 91  GLY B C   1 
ATOM   2802 O  O   . GLY B 2 91  ? 1.394   -9.003  -45.473 1.00 21.82  ? 91  GLY B O   1 
ATOM   2803 N  N   . LYS B 2 92  ? 0.829   -7.035  -44.435 1.00 15.45  ? 92  LYS B N   1 
ATOM   2804 C  CA  . LYS B 2 92  ? 2.171   -6.699  -43.941 1.00 15.18  ? 92  LYS B CA  1 
ATOM   2805 C  C   . LYS B 2 92  ? 2.330   -6.720  -42.423 1.00 19.76  ? 92  LYS B C   1 
ATOM   2806 O  O   . LYS B 2 92  ? 1.371   -6.459  -41.681 1.00 20.47  ? 92  LYS B O   1 
ATOM   2807 C  CB  . LYS B 2 92  ? 2.668   -5.336  -44.493 1.00 16.93  ? 92  LYS B CB  1 
ATOM   2808 C  CG  . LYS B 2 92  ? 2.689   -5.227  -46.029 1.00 16.94  ? 92  LYS B CG  1 
ATOM   2809 C  CD  . LYS B 2 92  ? 3.673   -6.184  -46.698 1.00 27.80  ? 92  LYS B CD  1 
ATOM   2810 C  CE  . LYS B 2 92  ? 3.888   -5.874  -48.159 1.00 43.53  ? 92  LYS B CE  1 
ATOM   2811 N  NZ  . LYS B 2 92  ? 2.624   -5.999  -48.955 1.00 54.34  ? 92  LYS B NZ  1 
ATOM   2812 N  N   . PHE B 2 93  ? 3.569   -7.012  -41.958 1.00 14.55  ? 93  PHE B N   1 
ATOM   2813 C  CA  . PHE B 2 93  ? 3.896   -7.005  -40.528 1.00 13.61  ? 93  PHE B CA  1 
ATOM   2814 C  C   . PHE B 2 93  ? 3.827   -5.575  -39.963 1.00 19.51  ? 93  PHE B C   1 
ATOM   2815 O  O   . PHE B 2 93  ? 3.076   -5.305  -39.014 1.00 18.98  ? 93  PHE B O   1 
ATOM   2816 C  CB  . PHE B 2 93  ? 5.261   -7.670  -40.262 1.00 14.78  ? 93  PHE B CB  1 
ATOM   2817 C  CG  . PHE B 2 93  ? 5.213   -9.182  -40.288 1.00 14.36  ? 93  PHE B CG  1 
ATOM   2818 C  CD1 . PHE B 2 93  ? 5.415   -9.878  -41.469 1.00 15.42  ? 93  PHE B CD1 1 
ATOM   2819 C  CD2 . PHE B 2 93  ? 4.918   -9.905  -39.136 1.00 15.03  ? 93  PHE B CD2 1 
ATOM   2820 C  CE1 . PHE B 2 93  ? 5.359   -11.276 -41.496 1.00 15.31  ? 93  PHE B CE1 1 
ATOM   2821 C  CE2 . PHE B 2 93  ? 4.849   -11.298 -39.164 1.00 16.60  ? 93  PHE B CE2 1 
ATOM   2822 C  CZ  . PHE B 2 93  ? 5.066   -11.975 -40.345 1.00 13.96  ? 93  PHE B CZ  1 
ATOM   2823 N  N   . GLY B 2 94  ? 4.555   -4.657  -40.585 1.00 18.44  ? 94  GLY B N   1 
ATOM   2824 C  CA  . GLY B 2 94  ? 4.511   -3.269  -40.154 1.00 18.18  ? 94  GLY B CA  1 
ATOM   2825 C  C   . GLY B 2 94  ? 5.854   -2.627  -39.943 1.00 23.05  ? 94  GLY B C   1 
ATOM   2826 O  O   . GLY B 2 94  ? 6.704   -3.146  -39.218 1.00 23.38  ? 94  GLY B O   1 
ATOM   2827 N  N   . THR B 2 95  ? 6.028   -1.488  -40.602 1.00 21.40  ? 95  THR B N   1 
ATOM   2828 C  CA  . THR B 2 95  ? 7.169   -0.575  -40.557 1.00 21.53  ? 95  THR B CA  1 
ATOM   2829 C  C   . THR B 2 95  ? 6.663   0.869   -40.592 1.00 24.59  ? 95  THR B C   1 
ATOM   2830 O  O   . THR B 2 95  ? 5.542   1.124   -41.033 1.00 23.45  ? 95  THR B O   1 
ATOM   2831 C  CB  . THR B 2 95  ? 8.139   -0.853  -41.715 1.00 25.64  ? 95  THR B CB  1 
ATOM   2832 O  OG1 . THR B 2 95  ? 7.457   -0.660  -42.956 1.00 22.82  ? 95  THR B OG1 1 
ATOM   2833 C  CG2 . THR B 2 95  ? 8.790   -2.242  -41.623 1.00 16.71  ? 95  THR B CG2 1 
ATOM   2834 N  N   . GLN B 2 96  ? 7.470   1.802   -40.108 1.00 23.95  ? 96  GLN B N   1 
ATOM   2835 C  CA  . GLN B 2 96  ? 7.128   3.224   -40.128 1.00 25.16  ? 96  GLN B CA  1 
ATOM   2836 C  C   . GLN B 2 96  ? 7.807   3.822   -41.352 1.00 32.46  ? 96  GLN B C   1 
ATOM   2837 O  O   . GLN B 2 96  ? 9.027   3.794   -41.432 1.00 34.12  ? 96  GLN B O   1 
ATOM   2838 C  CB  . GLN B 2 96  ? 7.558   3.926   -38.827 1.00 26.11  ? 96  GLN B CB  1 
ATOM   2839 C  CG  . GLN B 2 96  ? 6.694   5.146   -38.528 1.00 43.76  ? 96  GLN B CG  1 
ATOM   2840 C  CD  . GLN B 2 96  ? 7.115   5.902   -37.294 1.00 54.17  ? 96  GLN B CD  1 
ATOM   2841 O  OE1 . GLN B 2 96  ? 8.252   5.799   -36.830 1.00 42.96  ? 96  GLN B OE1 1 
ATOM   2842 N  NE2 . GLN B 2 96  ? 6.210   6.729   -36.765 1.00 46.48  ? 96  GLN B NE2 1 
ATOM   2843 N  N   . GLU B 2 97  ? 7.035   4.264   -42.349 1.00 30.42  ? 97  GLU B N   1 
ATOM   2844 C  CA  . GLU B 2 97  ? 7.631   4.809   -43.576 1.00 30.87  ? 97  GLU B CA  1 
ATOM   2845 C  C   . GLU B 2 97  ? 7.397   6.312   -43.734 1.00 34.72  ? 97  GLU B C   1 
ATOM   2846 O  O   . GLU B 2 97  ? 6.367   6.837   -43.285 1.00 34.97  ? 97  GLU B O   1 
ATOM   2847 C  CB  . GLU B 2 97  ? 7.140   4.050   -44.826 1.00 32.59  ? 97  GLU B CB  1 
ATOM   2848 C  CG  . GLU B 2 97  ? 7.354   2.536   -44.784 1.00 46.63  ? 97  GLU B CG  1 
ATOM   2849 C  CD  . GLU B 2 97  ? 8.768   1.980   -44.925 1.00 69.75  ? 97  GLU B CD  1 
ATOM   2850 O  OE1 . GLU B 2 97  ? 9.711   2.753   -45.216 1.00 45.99  ? 97  GLU B OE1 1 
ATOM   2851 O  OE2 . GLU B 2 97  ? 8.925   0.747   -44.773 1.00 70.13  ? 97  GLU B OE2 1 
ATOM   2852 N  N   . ARG B 2 98  ? 8.359   7.003   -44.373 1.00 29.37  ? 98  ARG B N   1 
ATOM   2853 C  CA  . ARG B 2 98  ? 8.233   8.429   -44.667 1.00 28.53  ? 98  ARG B CA  1 
ATOM   2854 C  C   . ARG B 2 98  ? 7.264   8.572   -45.857 1.00 29.22  ? 98  ARG B C   1 
ATOM   2855 O  O   . ARG B 2 98  ? 7.355   7.814   -46.820 1.00 26.33  ? 98  ARG B O   1 
ATOM   2856 C  CB  . ARG B 2 98  ? 9.595   9.049   -44.995 1.00 29.03  ? 98  ARG B CB  1 
ATOM   2857 N  N   . VAL B 2 99  ? 6.298   9.497   -45.730 1.00 26.79  ? 99  VAL B N   1 
ATOM   2858 C  CA  . VAL B 2 99  ? 5.251   9.800   -46.714 1.00 49.27  ? 99  VAL B CA  1 
ATOM   2859 C  C   . VAL B 2 99  ? 5.793   10.767  -47.783 1.00 81.10  ? 99  VAL B C   1 
ATOM   2860 O  O   . VAL B 2 99  ? 6.340   11.822  -47.454 1.00 45.29  ? 99  VAL B O   1 
ATOM   2861 C  CB  . VAL B 2 99  ? 3.977   10.348  -46.007 1.00 52.84  ? 99  VAL B CB  1 
ATOM   2862 C  CG1 . VAL B 2 99  ? 2.917   10.766  -47.017 1.00 53.12  ? 99  VAL B CG1 1 
ATOM   2863 C  CG2 . VAL B 2 99  ? 3.401   9.330   -45.025 1.00 52.27  ? 99  VAL B CG2 1 
ATOM   2864 N  N   . ASN B 2 103 ? 8.762   14.584  -43.939 1.00 45.62  ? 103 ASN B N   1 
ATOM   2865 C  CA  . ASN B 2 103 ? 8.578   14.997  -42.540 1.00 45.45  ? 103 ASN B CA  1 
ATOM   2866 C  C   . ASN B 2 103 ? 7.663   14.036  -41.744 1.00 48.44  ? 103 ASN B C   1 
ATOM   2867 O  O   . ASN B 2 103 ? 8.059   13.566  -40.672 1.00 48.55  ? 103 ASN B O   1 
ATOM   2868 C  CB  . ASN B 2 103 ? 8.046   16.424  -42.470 1.00 46.05  ? 103 ASN B CB  1 
ATOM   2869 N  N   . LYS B 2 104 ? 6.446   13.754  -42.258 1.00 43.66  ? 104 LYS B N   1 
ATOM   2870 C  CA  . LYS B 2 104 ? 5.505   12.841  -41.596 1.00 42.33  ? 104 LYS B CA  1 
ATOM   2871 C  C   . LYS B 2 104 ? 5.828   11.388  -41.944 1.00 42.75  ? 104 LYS B C   1 
ATOM   2872 O  O   . LYS B 2 104 ? 6.082   11.050  -43.111 1.00 41.27  ? 104 LYS B O   1 
ATOM   2873 C  CB  . LYS B 2 104 ? 4.068   13.173  -41.975 1.00 42.96  ? 104 LYS B CB  1 
ATOM   2874 N  N   . LYS B 2 105 ? 5.884   10.551  -40.898 1.00 37.97  ? 105 LYS B N   1 
ATOM   2875 C  CA  . LYS B 2 105 ? 6.142   9.112   -40.964 1.00 36.51  ? 105 LYS B CA  1 
ATOM   2876 C  C   . LYS B 2 105 ? 4.879   8.396   -40.535 1.00 37.38  ? 105 LYS B C   1 
ATOM   2877 O  O   . LYS B 2 105 ? 4.284   8.771   -39.523 1.00 37.78  ? 105 LYS B O   1 
ATOM   2878 C  CB  . LYS B 2 105 ? 7.328   8.706   -40.077 1.00 38.46  ? 105 LYS B CB  1 
ATOM   2879 C  CG  . LYS B 2 105 ? 8.648   8.622   -40.837 1.00 52.28  ? 105 LYS B CG  1 
ATOM   2880 C  CD  . LYS B 2 105 ? 9.822   8.172   -39.952 1.00 63.73  ? 105 LYS B CD  1 
ATOM   2881 C  CE  . LYS B 2 105 ? 10.221  6.715   -40.143 1.00 74.72  ? 105 LYS B CE  1 
ATOM   2882 N  NZ  . LYS B 2 105 ? 11.024  6.473   -41.381 1.00 75.91  ? 105 LYS B NZ  1 
ATOM   2883 N  N   . GLU B 2 106 ? 4.440   7.409   -41.318 1.00 31.60  ? 106 GLU B N   1 
ATOM   2884 C  CA  . GLU B 2 106 ? 3.242   6.625   -40.995 1.00 31.22  ? 106 GLU B CA  1 
ATOM   2885 C  C   . GLU B 2 106 ? 3.518   5.114   -40.883 1.00 30.39  ? 106 GLU B C   1 
ATOM   2886 O  O   . GLU B 2 106 ? 4.363   4.567   -41.590 1.00 28.56  ? 106 GLU B O   1 
ATOM   2887 C  CB  . GLU B 2 106 ? 2.144   6.886   -42.031 1.00 32.47  ? 106 GLU B CB  1 
ATOM   2888 N  N   . TRP B 2 107 ? 2.781   4.450   -40.003 1.00 25.79  ? 107 TRP B N   1 
ATOM   2889 C  CA  . TRP B 2 107 ? 2.875   3.007   -39.806 1.00 24.51  ? 107 TRP B CA  1 
ATOM   2890 C  C   . TRP B 2 107 ? 1.947   2.274   -40.772 1.00 26.69  ? 107 TRP B C   1 
ATOM   2891 O  O   . TRP B 2 107 ? 0.840   2.741   -41.056 1.00 27.89  ? 107 TRP B O   1 
ATOM   2892 C  CB  . TRP B 2 107 ? 2.527   2.635   -38.352 1.00 23.09  ? 107 TRP B CB  1 
ATOM   2893 C  CG  . TRP B 2 107 ? 3.632   2.912   -37.355 1.00 24.42  ? 107 TRP B CG  1 
ATOM   2894 C  CD1 . TRP B 2 107 ? 3.749   4.004   -36.545 1.00 27.46  ? 107 TRP B CD1 1 
ATOM   2895 C  CD2 . TRP B 2 107 ? 4.747   2.063   -37.045 1.00 23.81  ? 107 TRP B CD2 1 
ATOM   2896 N  NE1 . TRP B 2 107 ? 4.863   3.886   -35.744 1.00 26.43  ? 107 TRP B NE1 1 
ATOM   2897 C  CE2 . TRP B 2 107 ? 5.504   2.712   -36.042 1.00 27.77  ? 107 TRP B CE2 1 
ATOM   2898 C  CE3 . TRP B 2 107 ? 5.173   0.807   -37.507 1.00 25.16  ? 107 TRP B CE3 1 
ATOM   2899 C  CZ2 . TRP B 2 107 ? 6.669   2.150   -35.494 1.00 26.75  ? 107 TRP B CZ2 1 
ATOM   2900 C  CZ3 . TRP B 2 107 ? 6.328   0.251   -36.966 1.00 26.72  ? 107 TRP B CZ3 1 
ATOM   2901 C  CH2 . TRP B 2 107 ? 7.064   0.925   -35.974 1.00 27.13  ? 107 TRP B CH2 1 
ATOM   2902 N  N   . ASN B 2 108 ? 2.392   1.130   -41.278 1.00 20.05  ? 108 ASN B N   1 
ATOM   2903 C  CA  . ASN B 2 108 ? 1.559   0.255   -42.114 1.00 17.96  ? 108 ASN B CA  1 
ATOM   2904 C  C   . ASN B 2 108 ? 1.393   -1.082  -41.355 1.00 19.62  ? 108 ASN B C   1 
ATOM   2905 O  O   . ASN B 2 108 ? 1.768   -1.160  -40.176 1.00 18.18  ? 108 ASN B O   1 
ATOM   2906 C  CB  . ASN B 2 108 ? 2.177   0.053   -43.505 1.00 14.56  ? 108 ASN B CB  1 
ATOM   2907 C  CG  . ASN B 2 108 ? 3.659   -0.238  -43.495 1.00 37.91  ? 108 ASN B CG  1 
ATOM   2908 O  OD1 . ASN B 2 108 ? 4.136   -1.235  -42.953 1.00 29.83  ? 108 ASN B OD1 1 
ATOM   2909 N  ND2 . ASN B 2 108 ? 4.422   0.642   -44.094 1.00 35.23  ? 108 ASN B ND2 1 
ATOM   2910 N  N   . GLY B 2 109 ? 0.836   -2.100  -42.031 1.00 15.45  ? 109 GLY B N   1 
ATOM   2911 C  CA  . GLY B 2 109 ? 0.645   -3.452  -41.517 1.00 14.32  ? 109 GLY B CA  1 
ATOM   2912 C  C   . GLY B 2 109 ? -0.168  -3.542  -40.241 1.00 22.31  ? 109 GLY B C   1 
ATOM   2913 O  O   . GLY B 2 109 ? -1.025  -2.693  -39.976 1.00 25.35  ? 109 GLY B O   1 
ATOM   2914 N  N   . MET B 2 110 ? 0.112   -4.570  -39.436 1.00 17.94  ? 110 MET B N   1 
ATOM   2915 C  CA  . MET B 2 110 ? -0.545  -4.849  -38.160 1.00 17.70  ? 110 MET B CA  1 
ATOM   2916 C  C   . MET B 2 110 ? -0.309  -3.732  -37.165 1.00 21.01  ? 110 MET B C   1 
ATOM   2917 O  O   . MET B 2 110 ? -1.199  -3.410  -36.373 1.00 20.27  ? 110 MET B O   1 
ATOM   2918 C  CB  . MET B 2 110 ? -0.087  -6.214  -37.605 1.00 19.70  ? 110 MET B CB  1 
ATOM   2919 C  CG  . MET B 2 110 ? -0.348  -7.335  -38.591 1.00 22.06  ? 110 MET B CG  1 
ATOM   2920 S  SD  . MET B 2 110 ? -0.099  -8.973  -37.938 1.00 24.90  ? 110 MET B SD  1 
ATOM   2921 C  CE  . MET B 2 110 ? 1.654   -9.140  -38.170 1.00 21.21  ? 110 MET B CE  1 
ATOM   2922 N  N   . MET B 2 111 ? 0.880   -3.112  -37.251 1.00 17.51  ? 111 MET B N   1 
ATOM   2923 C  CA  . MET B 2 111 ? 1.313   -1.967  -36.455 1.00 16.80  ? 111 MET B CA  1 
ATOM   2924 C  C   . MET B 2 111 ? 0.361   -0.772  -36.669 1.00 20.44  ? 111 MET B C   1 
ATOM   2925 O  O   . MET B 2 111 ? -0.074  -0.151  -35.700 1.00 20.95  ? 111 MET B O   1 
ATOM   2926 C  CB  . MET B 2 111 ? 2.740   -1.596  -36.873 1.00 19.10  ? 111 MET B CB  1 
ATOM   2927 C  CG  . MET B 2 111 ? 3.812   -2.495  -36.243 1.00 22.58  ? 111 MET B CG  1 
ATOM   2928 S  SD  . MET B 2 111 ? 3.816   -2.493  -34.427 1.00 26.55  ? 111 MET B SD  1 
ATOM   2929 C  CE  . MET B 2 111 ? 4.017   -0.653  -34.083 1.00 22.32  ? 111 MET B CE  1 
ATOM   2930 N  N   . GLY B 2 112 ? 0.020   -0.513  -37.931 1.00 17.36  ? 112 GLY B N   1 
ATOM   2931 C  CA  . GLY B 2 112 ? -0.909  0.531   -38.352 1.00 17.44  ? 112 GLY B CA  1 
ATOM   2932 C  C   . GLY B 2 112 ? -2.311  0.263   -37.848 1.00 22.20  ? 112 GLY B C   1 
ATOM   2933 O  O   . GLY B 2 112 ? -2.959  1.162   -37.313 1.00 21.12  ? 112 GLY B O   1 
ATOM   2934 N  N   . GLU B 2 113 ? -2.773  -0.997  -37.986 1.00 20.18  ? 113 GLU B N   1 
ATOM   2935 C  CA  . GLU B 2 113 ? -4.098  -1.445  -37.542 1.00 19.89  ? 113 GLU B CA  1 
ATOM   2936 C  C   . GLU B 2 113 ? -4.261  -1.347  -36.032 1.00 24.43  ? 113 GLU B C   1 
ATOM   2937 O  O   . GLU B 2 113 ? -5.295  -0.852  -35.571 1.00 22.65  ? 113 GLU B O   1 
ATOM   2938 C  CB  . GLU B 2 113 ? -4.414  -2.837  -38.078 1.00 21.02  ? 113 GLU B CB  1 
ATOM   2939 C  CG  . GLU B 2 113 ? -4.742  -2.773  -39.563 1.00 31.71  ? 113 GLU B CG  1 
ATOM   2940 C  CD  . GLU B 2 113 ? -5.512  -3.936  -40.152 1.00 47.40  ? 113 GLU B CD  1 
ATOM   2941 O  OE1 . GLU B 2 113 ? -5.900  -4.835  -39.377 1.00 38.95  ? 113 GLU B OE1 1 
ATOM   2942 O  OE2 . GLU B 2 113 ? -5.743  -3.943  -41.383 1.00 38.03  ? 113 GLU B OE2 1 
ATOM   2943 N  N   . LEU B 2 114 ? -3.196  -1.711  -35.270 1.00 22.22  ? 114 LEU B N   1 
ATOM   2944 C  CA  . LEU B 2 114 ? -3.179  -1.578  -33.813 1.00 22.40  ? 114 LEU B CA  1 
ATOM   2945 C  C   . LEU B 2 114 ? -3.209  -0.098  -33.366 1.00 26.11  ? 114 LEU B C   1 
ATOM   2946 O  O   . LEU B 2 114 ? -4.061  0.277   -32.564 1.00 27.57  ? 114 LEU B O   1 
ATOM   2947 C  CB  . LEU B 2 114 ? -2.004  -2.358  -33.182 1.00 22.42  ? 114 LEU B CB  1 
ATOM   2948 C  CG  . LEU B 2 114 ? -1.887  -2.356  -31.636 1.00 26.28  ? 114 LEU B CG  1 
ATOM   2949 C  CD1 . LEU B 2 114 ? -3.049  -3.036  -30.979 1.00 24.86  ? 114 LEU B CD1 1 
ATOM   2950 C  CD2 . LEU B 2 114 ? -0.615  -3.042  -31.188 1.00 29.98  ? 114 LEU B CD2 1 
ATOM   2951 N  N   . LEU B 2 115 ? -2.357  0.745   -33.929 1.00 22.21  ? 115 LEU B N   1 
ATOM   2952 C  CA  . LEU B 2 115 ? -2.324  2.174   -33.561 1.00 21.89  ? 115 LEU B CA  1 
ATOM   2953 C  C   . LEU B 2 115 ? -3.566  2.993   -34.003 1.00 26.55  ? 115 LEU B C   1 
ATOM   2954 O  O   . LEU B 2 115 ? -3.967  3.924   -33.292 1.00 25.80  ? 115 LEU B O   1 
ATOM   2955 C  CB  . LEU B 2 115 ? -1.030  2.831   -34.060 1.00 21.48  ? 115 LEU B CB  1 
ATOM   2956 C  CG  . LEU B 2 115 ? 0.229   2.308   -33.352 1.00 24.45  ? 115 LEU B CG  1 
ATOM   2957 C  CD1 . LEU B 2 115 ? 1.496   2.572   -34.172 1.00 23.78  ? 115 LEU B CD1 1 
ATOM   2958 C  CD2 . LEU B 2 115 ? 0.312   2.815   -31.931 1.00 23.35  ? 115 LEU B CD2 1 
ATOM   2959 N  N   . SER B 2 116 ? -4.209  2.613   -35.119 1.00 23.05  ? 116 SER B N   1 
ATOM   2960 C  CA  . SER B 2 116 ? -5.402  3.315   -35.589 1.00 22.70  ? 116 SER B CA  1 
ATOM   2961 C  C   . SER B 2 116 ? -6.701  2.820   -34.941 1.00 28.44  ? 116 SER B C   1 
ATOM   2962 O  O   . SER B 2 116 ? -7.773  3.282   -35.326 1.00 31.27  ? 116 SER B O   1 
ATOM   2963 C  CB  . SER B 2 116 ? -5.510  3.246   -37.109 1.00 24.38  ? 116 SER B CB  1 
ATOM   2964 O  OG  . SER B 2 116 ? -5.870  1.944   -37.549 1.00 34.66  ? 116 SER B OG  1 
ATOM   2965 N  N   . GLY B 2 117 ? -6.615  1.865   -34.022 1.00 23.15  ? 117 GLY B N   1 
ATOM   2966 C  CA  . GLY B 2 117 ? -7.797  1.313   -33.364 1.00 21.97  ? 117 GLY B CA  1 
ATOM   2967 C  C   . GLY B 2 117 ? -8.541  0.250   -34.156 1.00 24.59  ? 117 GLY B C   1 
ATOM   2968 O  O   . GLY B 2 117 ? -9.552  -0.264  -33.681 1.00 25.19  ? 117 GLY B O   1 
ATOM   2969 N  N   . GLN B 2 118 ? -8.067  -0.097  -35.365 1.00 19.49  ? 118 GLN B N   1 
ATOM   2970 C  CA  . GLN B 2 118 ? -8.663  -1.160  -36.194 1.00 18.83  ? 118 GLN B CA  1 
ATOM   2971 C  C   . GLN B 2 118 ? -8.498  -2.546  -35.534 1.00 23.76  ? 118 GLN B C   1 
ATOM   2972 O  O   . GLN B 2 118 ? -9.296  -3.453  -35.774 1.00 23.78  ? 118 GLN B O   1 
ATOM   2973 C  CB  . GLN B 2 118 ? -8.048  -1.160  -37.600 1.00 19.89  ? 118 GLN B CB  1 
ATOM   2974 C  CG  . GLN B 2 118 ? -8.738  -0.180  -38.556 1.00 35.56  ? 118 GLN B CG  1 
ATOM   2975 C  CD  . GLN B 2 118 ? -7.952  0.068   -39.827 1.00 63.19  ? 118 GLN B CD  1 
ATOM   2976 O  OE1 . GLN B 2 118 ? -7.423  1.163   -40.050 1.00 62.42  ? 118 GLN B OE1 1 
ATOM   2977 N  NE2 . GLN B 2 118 ? -7.864  -0.935  -40.699 1.00 53.95  ? 118 GLN B NE2 1 
ATOM   2978 N  N   . ALA B 2 119 ? -7.483  -2.680  -34.670 1.00 20.79  ? 119 ALA B N   1 
ATOM   2979 C  CA  . ALA B 2 119 ? -7.190  -3.872  -33.896 1.00 20.44  ? 119 ALA B CA  1 
ATOM   2980 C  C   . ALA B 2 119 ? -6.915  -3.480  -32.460 1.00 23.53  ? 119 ALA B C   1 
ATOM   2981 O  O   . ALA B 2 119 ? -6.455  -2.379  -32.202 1.00 23.17  ? 119 ALA B O   1 
ATOM   2982 C  CB  . ALA B 2 119 ? -5.975  -4.570  -34.471 1.00 21.27  ? 119 ALA B CB  1 
ATOM   2983 N  N   . ASP B 2 120 ? -7.163  -4.393  -31.532 1.00 20.24  ? 120 ASP B N   1 
ATOM   2984 C  CA  . ASP B 2 120 ? -6.890  -4.216  -30.113 1.00 19.75  ? 120 ASP B CA  1 
ATOM   2985 C  C   . ASP B 2 120 ? -5.670  -5.002  -29.719 1.00 24.23  ? 120 ASP B C   1 
ATOM   2986 O  O   . ASP B 2 120 ? -5.054  -4.717  -28.695 1.00 22.98  ? 120 ASP B O   1 
ATOM   2987 C  CB  . ASP B 2 120 ? -8.107  -4.649  -29.285 1.00 21.24  ? 120 ASP B CB  1 
ATOM   2988 C  CG  . ASP B 2 120 ? -9.322  -3.790  -29.594 1.00 33.58  ? 120 ASP B CG  1 
ATOM   2989 O  OD1 . ASP B 2 120 ? -9.164  -2.534  -29.679 1.00 34.55  ? 120 ASP B OD1 1 
ATOM   2990 O  OD2 . ASP B 2 120 ? -10.427 -4.366  -29.791 1.00 36.65  ? 120 ASP B OD2 1 
ATOM   2991 N  N   . MET B 2 121 ? -5.309  -6.004  -30.524 1.00 23.19  ? 121 MET B N   1 
ATOM   2992 C  CA  . MET B 2 121 ? -4.173  -6.834  -30.184 1.00 24.29  ? 121 MET B CA  1 
ATOM   2993 C  C   . MET B 2 121 ? -3.584  -7.530  -31.391 1.00 27.00  ? 121 MET B C   1 
ATOM   2994 O  O   . MET B 2 121 ? -4.326  -7.965  -32.274 1.00 25.01  ? 121 MET B O   1 
ATOM   2995 C  CB  . MET B 2 121 ? -4.588  -7.865  -29.117 1.00 27.10  ? 121 MET B CB  1 
ATOM   2996 C  CG  . MET B 2 121 ? -3.431  -8.492  -28.388 1.00 31.87  ? 121 MET B CG  1 
ATOM   2997 S  SD  . MET B 2 121 ? -3.952  -9.889  -27.359 1.00 37.89  ? 121 MET B SD  1 
ATOM   2998 C  CE  . MET B 2 121 ? -4.517  -8.984  -25.880 1.00 34.00  ? 121 MET B CE  1 
ATOM   2999 N  N   . ILE B 2 122 ? -2.236  -7.648  -31.409 1.00 23.65  ? 122 ILE B N   1 
ATOM   3000 C  CA  . ILE B 2 122 ? -1.505  -8.394  -32.433 1.00 23.29  ? 122 ILE B CA  1 
ATOM   3001 C  C   . ILE B 2 122 ? -1.101  -9.748  -31.857 1.00 26.40  ? 122 ILE B C   1 
ATOM   3002 O  O   . ILE B 2 122 ? -0.373  -9.835  -30.860 1.00 26.01  ? 122 ILE B O   1 
ATOM   3003 C  CB  . ILE B 2 122 ? -0.294  -7.649  -33.075 1.00 26.05  ? 122 ILE B CB  1 
ATOM   3004 C  CG1 . ILE B 2 122 ? -0.635  -6.167  -33.425 1.00 26.51  ? 122 ILE B CG1 1 
ATOM   3005 C  CG2 . ILE B 2 122 ? 0.238   -8.428  -34.289 1.00 23.68  ? 122 ILE B CG2 1 
ATOM   3006 C  CD1 . ILE B 2 122 ? 0.590   -5.289  -33.852 1.00 22.58  ? 122 ILE B CD1 1 
ATOM   3007 N  N   . VAL B 2 123 ? -1.627  -10.799 -32.472 1.00 22.59  ? 123 VAL B N   1 
ATOM   3008 C  CA  . VAL B 2 123 ? -1.320  -12.181 -32.136 1.00 21.89  ? 123 VAL B CA  1 
ATOM   3009 C  C   . VAL B 2 123 ? -0.841  -12.755 -33.456 1.00 28.24  ? 123 VAL B C   1 
ATOM   3010 O  O   . VAL B 2 123 ? -1.647  -13.144 -34.295 1.00 27.45  ? 123 VAL B O   1 
ATOM   3011 C  CB  . VAL B 2 123 ? -2.489  -12.990 -31.510 1.00 24.11  ? 123 VAL B CB  1 
ATOM   3012 C  CG1 . VAL B 2 123 ? -2.016  -14.386 -31.096 1.00 23.97  ? 123 VAL B CG1 1 
ATOM   3013 C  CG2 . VAL B 2 123 ? -3.098  -12.258 -30.322 1.00 23.25  ? 123 VAL B CG2 1 
ATOM   3014 N  N   . ALA B 2 124 ? 0.485   -12.695 -33.658 1.00 26.47  ? 124 ALA B N   1 
ATOM   3015 C  CA  . ALA B 2 124 ? 1.205   -13.117 -34.847 1.00 27.55  ? 124 ALA B CA  1 
ATOM   3016 C  C   . ALA B 2 124 ? 2.714   -13.219 -34.533 1.00 30.94  ? 124 ALA B C   1 
ATOM   3017 O  O   . ALA B 2 124 ? 3.145   -12.640 -33.523 1.00 32.52  ? 124 ALA B O   1 
ATOM   3018 C  CB  . ALA B 2 124 ? 0.985   -12.080 -35.957 1.00 28.79  ? 124 ALA B CB  1 
ATOM   3019 N  N   . PRO B 2 125 ? 3.548   -13.876 -35.397 1.00 24.50  ? 125 PRO B N   1 
ATOM   3020 C  CA  . PRO B 2 125 ? 5.018   -13.863 -35.169 1.00 22.64  ? 125 PRO B CA  1 
ATOM   3021 C  C   . PRO B 2 125 ? 5.638   -12.461 -35.459 1.00 23.35  ? 125 PRO B C   1 
ATOM   3022 O  O   . PRO B 2 125 ? 6.380   -12.263 -36.415 1.00 21.63  ? 125 PRO B O   1 
ATOM   3023 C  CB  . PRO B 2 125 ? 5.520   -14.941 -36.145 1.00 23.99  ? 125 PRO B CB  1 
ATOM   3024 C  CG  . PRO B 2 125 ? 4.549   -14.914 -37.272 1.00 27.98  ? 125 PRO B CG  1 
ATOM   3025 C  CD  . PRO B 2 125 ? 3.206   -14.607 -36.642 1.00 25.03  ? 125 PRO B CD  1 
ATOM   3026 N  N   . LEU B 2 126 ? 5.286   -11.477 -34.630 1.00 19.27  ? 126 LEU B N   1 
ATOM   3027 C  CA  . LEU B 2 126 ? 5.711   -10.094 -34.726 1.00 18.64  ? 126 LEU B CA  1 
ATOM   3028 C  C   . LEU B 2 126 ? 6.990   -9.878  -33.892 1.00 21.87  ? 126 LEU B C   1 
ATOM   3029 O  O   . LEU B 2 126 ? 6.971   -10.009 -32.655 1.00 20.44  ? 126 LEU B O   1 
ATOM   3030 C  CB  . LEU B 2 126 ? 4.556   -9.209  -34.198 1.00 18.63  ? 126 LEU B CB  1 
ATOM   3031 C  CG  . LEU B 2 126 ? 4.725   -7.682  -34.304 1.00 21.85  ? 126 LEU B CG  1 
ATOM   3032 C  CD1 . LEU B 2 126 ? 4.341   -7.180  -35.690 1.00 21.42  ? 126 LEU B CD1 1 
ATOM   3033 C  CD2 . LEU B 2 126 ? 3.918   -6.995  -33.240 1.00 22.63  ? 126 LEU B CD2 1 
ATOM   3034 N  N   . THR B 2 127 ? 8.080   -9.512  -34.576 1.00 17.98  ? 127 THR B N   1 
ATOM   3035 C  CA  . THR B 2 127 ? 9.373   -9.284  -33.942 1.00 17.22  ? 127 THR B CA  1 
ATOM   3036 C  C   . THR B 2 127 ? 9.408   -8.018  -33.092 1.00 21.19  ? 127 THR B C   1 
ATOM   3037 O  O   . THR B 2 127 ? 8.943   -6.948  -33.514 1.00 20.83  ? 127 THR B O   1 
ATOM   3038 C  CB  . THR B 2 127 ? 10.505  -9.319  -34.979 1.00 19.99  ? 127 THR B CB  1 
ATOM   3039 O  OG1 . THR B 2 127 ? 10.603  -10.648 -35.511 1.00 22.50  ? 127 THR B OG1 1 
ATOM   3040 C  CG2 . THR B 2 127 ? 11.856  -8.913  -34.387 1.00 13.98  ? 127 THR B CG2 1 
ATOM   3041 N  N   . ILE B 2 128 ? 10.018  -8.150  -31.910 1.00 15.34  ? 128 ILE B N   1 
ATOM   3042 C  CA  . ILE B 2 128 ? 10.254  -7.057  -30.991 1.00 14.19  ? 128 ILE B CA  1 
ATOM   3043 C  C   . ILE B 2 128 ? 11.470  -6.243  -31.499 1.00 18.01  ? 128 ILE B C   1 
ATOM   3044 O  O   . ILE B 2 128 ? 12.549  -6.796  -31.692 1.00 18.23  ? 128 ILE B O   1 
ATOM   3045 C  CB  . ILE B 2 128 ? 10.477  -7.613  -29.544 1.00 16.34  ? 128 ILE B CB  1 
ATOM   3046 C  CG1 . ILE B 2 128 ? 9.315   -8.566  -29.107 1.00 17.09  ? 128 ILE B CG1 1 
ATOM   3047 C  CG2 . ILE B 2 128 ? 10.667  -6.471  -28.555 1.00 14.35  ? 128 ILE B CG2 1 
ATOM   3048 C  CD1 . ILE B 2 128 ? 9.502   -9.364  -27.698 1.00 18.34  ? 128 ILE B CD1 1 
ATOM   3049 N  N   . ASN B 2 129 ? 11.306  -4.931  -31.673 1.00 13.25  ? 129 ASN B N   1 
ATOM   3050 C  CA  . ASN B 2 129 ? 12.405  -4.057  -32.068 1.00 12.32  ? 129 ASN B CA  1 
ATOM   3051 C  C   . ASN B 2 129 ? 12.214  -2.685  -31.489 1.00 16.88  ? 129 ASN B C   1 
ATOM   3052 O  O   . ASN B 2 129 ? 11.127  -2.365  -31.017 1.00 16.73  ? 129 ASN B O   1 
ATOM   3053 C  CB  . ASN B 2 129 ? 12.634  -4.020  -33.605 1.00 11.82  ? 129 ASN B CB  1 
ATOM   3054 C  CG  . ASN B 2 129 ? 11.507  -3.465  -34.438 1.00 27.73  ? 129 ASN B CG  1 
ATOM   3055 O  OD1 . ASN B 2 129 ? 10.749  -2.591  -34.018 1.00 28.28  ? 129 ASN B OD1 1 
ATOM   3056 N  ND2 . ASN B 2 129 ? 11.419  -3.917  -35.676 1.00 15.52  ? 129 ASN B ND2 1 
ATOM   3057 N  N   . ASN B 2 130 ? 13.247  -1.859  -31.560 1.00 16.28  ? 130 ASN B N   1 
ATOM   3058 C  CA  . ASN B 2 130 ? 13.236  -0.509  -31.010 1.00 17.79  ? 130 ASN B CA  1 
ATOM   3059 C  C   . ASN B 2 130 ? 12.110  0.376   -31.566 1.00 23.17  ? 130 ASN B C   1 
ATOM   3060 O  O   . ASN B 2 130 ? 11.406  1.034   -30.804 1.00 23.56  ? 130 ASN B O   1 
ATOM   3061 C  CB  . ASN B 2 130 ? 14.609  0.150   -31.180 1.00 16.78  ? 130 ASN B CB  1 
ATOM   3062 C  CG  . ASN B 2 130 ? 14.579  1.594   -30.775 1.00 35.80  ? 130 ASN B CG  1 
ATOM   3063 O  OD1 . ASN B 2 130 ? 14.298  2.478   -31.597 1.00 28.92  ? 130 ASN B OD1 1 
ATOM   3064 N  ND2 . ASN B 2 130 ? 14.731  1.848   -29.476 1.00 25.70  ? 130 ASN B ND2 1 
ATOM   3065 N  N   . GLU B 2 131 ? 11.968  0.380   -32.887 1.00 21.15  ? 131 GLU B N   1 
ATOM   3066 C  CA  . GLU B 2 131 ? 10.996  1.141   -33.668 1.00 20.71  ? 131 GLU B CA  1 
ATOM   3067 C  C   . GLU B 2 131 ? 9.539   0.899   -33.195 1.00 24.44  ? 131 GLU B C   1 
ATOM   3068 O  O   . GLU B 2 131 ? 8.823   1.851   -32.852 1.00 25.29  ? 131 GLU B O   1 
ATOM   3069 C  CB  . GLU B 2 131 ? 11.168  0.770   -35.150 1.00 22.17  ? 131 GLU B CB  1 
ATOM   3070 C  CG  . GLU B 2 131 ? 12.491  1.216   -35.790 1.00 38.05  ? 131 GLU B CG  1 
ATOM   3071 C  CD  . GLU B 2 131 ? 13.760  0.366   -35.693 1.00 59.07  ? 131 GLU B CD  1 
ATOM   3072 O  OE1 . GLU B 2 131 ? 13.793  -0.588  -34.884 1.00 32.36  ? 131 GLU B OE1 1 
ATOM   3073 O  OE2 . GLU B 2 131 ? 14.742  0.683   -36.409 1.00 54.11  ? 131 GLU B OE2 1 
ATOM   3074 N  N   . ARG B 2 132 ? 9.121   -0.372  -33.141 1.00 18.62  ? 132 ARG B N   1 
ATOM   3075 C  CA  . ARG B 2 132 ? 7.766   -0.778  -32.741 1.00 16.84  ? 132 ARG B CA  1 
ATOM   3076 C  C   . ARG B 2 132 ? 7.516   -0.523  -31.260 1.00 18.26  ? 132 ARG B C   1 
ATOM   3077 O  O   . ARG B 2 132 ? 6.483   0.072   -30.924 1.00 18.04  ? 132 ARG B O   1 
ATOM   3078 C  CB  . ARG B 2 132 ? 7.517   -2.255  -33.101 1.00 14.71  ? 132 ARG B CB  1 
ATOM   3079 C  CG  . ARG B 2 132 ? 7.466   -2.505  -34.588 1.00 16.39  ? 132 ARG B CG  1 
ATOM   3080 C  CD  . ARG B 2 132 ? 7.548   -3.980  -34.877 1.00 20.39  ? 132 ARG B CD  1 
ATOM   3081 N  NE  . ARG B 2 132 ? 7.520   -4.261  -36.313 1.00 9.07   ? 132 ARG B NE  1 
ATOM   3082 C  CZ  . ARG B 2 132 ? 7.628   -5.475  -36.828 1.00 23.52  ? 132 ARG B CZ  1 
ATOM   3083 N  NH1 . ARG B 2 132 ? 7.792   -6.524  -36.036 1.00 13.59  ? 132 ARG B NH1 1 
ATOM   3084 N  NH2 . ARG B 2 132 ? 7.568   -5.652  -38.144 1.00 15.37  ? 132 ARG B NH2 1 
ATOM   3085 N  N   . ALA B 2 133 ? 8.483   -0.908  -30.384 1.00 12.56  ? 133 ALA B N   1 
ATOM   3086 C  CA  . ALA B 2 133 ? 8.420   -0.705  -28.916 1.00 12.96  ? 133 ALA B CA  1 
ATOM   3087 C  C   . ALA B 2 133 ? 8.232   0.776   -28.510 1.00 19.25  ? 133 ALA B C   1 
ATOM   3088 O  O   . ALA B 2 133 ? 7.697   1.044   -27.441 1.00 18.21  ? 133 ALA B O   1 
ATOM   3089 C  CB  . ALA B 2 133 ? 9.659   -1.285  -28.229 1.00 13.15  ? 133 ALA B CB  1 
ATOM   3090 N  N   . GLN B 2 134 ? 8.643   1.738   -29.364 1.00 18.08  ? 134 GLN B N   1 
ATOM   3091 C  CA  . GLN B 2 134 ? 8.412   3.147   -29.045 1.00 18.42  ? 134 GLN B CA  1 
ATOM   3092 C  C   . GLN B 2 134 ? 6.915   3.510   -29.038 1.00 22.10  ? 134 GLN B C   1 
ATOM   3093 O  O   . GLN B 2 134 ? 6.505   4.402   -28.297 1.00 23.23  ? 134 GLN B O   1 
ATOM   3094 C  CB  . GLN B 2 134 ? 9.170   4.046   -30.021 1.00 19.74  ? 134 GLN B CB  1 
ATOM   3095 C  CG  . GLN B 2 134 ? 9.237   5.509   -29.562 1.00 25.96  ? 134 GLN B CG  1 
ATOM   3096 C  CD  . GLN B 2 134 ? 9.820   6.385   -30.629 1.00 38.64  ? 134 GLN B CD  1 
ATOM   3097 O  OE1 . GLN B 2 134 ? 9.157   7.304   -31.145 1.00 26.09  ? 134 GLN B OE1 1 
ATOM   3098 N  NE2 . GLN B 2 134 ? 11.072  6.099   -30.998 1.00 37.50  ? 134 GLN B NE2 1 
ATOM   3099 N  N   . TYR B 2 135 ? 6.112   2.802   -29.843 1.00 16.93  ? 135 TYR B N   1 
ATOM   3100 C  CA  . TYR B 2 135 ? 4.691   3.060   -30.063 1.00 15.54  ? 135 TYR B CA  1 
ATOM   3101 C  C   . TYR B 2 135 ? 3.776   2.056   -29.408 1.00 20.46  ? 135 TYR B C   1 
ATOM   3102 O  O   . TYR B 2 135 ? 2.606   2.364   -29.149 1.00 20.05  ? 135 TYR B O   1 
ATOM   3103 C  CB  . TYR B 2 135 ? 4.425   3.079   -31.593 1.00 15.98  ? 135 TYR B CB  1 
ATOM   3104 C  CG  . TYR B 2 135 ? 5.012   4.307   -32.249 1.00 16.99  ? 135 TYR B CG  1 
ATOM   3105 C  CD1 . TYR B 2 135 ? 6.355   4.350   -32.620 1.00 18.90  ? 135 TYR B CD1 1 
ATOM   3106 C  CD2 . TYR B 2 135 ? 4.257   5.465   -32.400 1.00 17.81  ? 135 TYR B CD2 1 
ATOM   3107 C  CE1 . TYR B 2 135 ? 6.924   5.508   -33.150 1.00 17.89  ? 135 TYR B CE1 1 
ATOM   3108 C  CE2 . TYR B 2 135 ? 4.803   6.614   -32.967 1.00 19.22  ? 135 TYR B CE2 1 
ATOM   3109 C  CZ  . TYR B 2 135 ? 6.142   6.637   -33.326 1.00 24.15  ? 135 TYR B CZ  1 
ATOM   3110 O  OH  . TYR B 2 135 ? 6.674   7.783   -33.866 1.00 24.10  ? 135 TYR B OH  1 
ATOM   3111 N  N   . ILE B 2 136 ? 4.257   0.827   -29.209 1.00 17.50  ? 136 ILE B N   1 
ATOM   3112 C  CA  . ILE B 2 136 ? 3.383   -0.192  -28.644 1.00 16.90  ? 136 ILE B CA  1 
ATOM   3113 C  C   . ILE B 2 136 ? 3.997   -0.915  -27.467 1.00 20.76  ? 136 ILE B C   1 
ATOM   3114 O  O   . ILE B 2 136 ? 5.179   -0.801  -27.196 1.00 19.65  ? 136 ILE B O   1 
ATOM   3115 C  CB  . ILE B 2 136 ? 2.867   -1.197  -29.728 1.00 19.87  ? 136 ILE B CB  1 
ATOM   3116 C  CG1 . ILE B 2 136 ? 3.998   -2.141  -30.244 1.00 19.19  ? 136 ILE B CG1 1 
ATOM   3117 C  CG2 . ILE B 2 136 ? 2.134   -0.453  -30.891 1.00 21.75  ? 136 ILE B CG2 1 
ATOM   3118 C  CD1 . ILE B 2 136 ? 3.509   -3.490  -30.804 1.00 23.49  ? 136 ILE B CD1 1 
ATOM   3119 N  N   . GLU B 2 137 ? 3.151   -1.633  -26.752 1.00 18.77  ? 137 GLU B N   1 
ATOM   3120 C  CA  . GLU B 2 137 ? 3.533   -2.512  -25.694 1.00 19.28  ? 137 GLU B CA  1 
ATOM   3121 C  C   . GLU B 2 137 ? 3.714   -3.923  -26.307 1.00 21.51  ? 137 GLU B C   1 
ATOM   3122 O  O   . GLU B 2 137 ? 2.823   -4.450  -27.001 1.00 19.40  ? 137 GLU B O   1 
ATOM   3123 C  CB  . GLU B 2 137 ? 2.438   -2.560  -24.617 1.00 21.46  ? 137 GLU B CB  1 
ATOM   3124 C  CG  . GLU B 2 137 ? 2.764   -3.506  -23.468 1.00 36.06  ? 137 GLU B CG  1 
ATOM   3125 C  CD  . GLU B 2 137 ? 3.920   -3.101  -22.574 1.00 63.82  ? 137 GLU B CD  1 
ATOM   3126 O  OE1 . GLU B 2 137 ? 4.140   -1.881  -22.394 1.00 67.10  ? 137 GLU B OE1 1 
ATOM   3127 O  OE2 . GLU B 2 137 ? 4.590   -4.009  -22.031 1.00 63.09  ? 137 GLU B OE2 1 
ATOM   3128 N  N   . PHE B 2 138 ? 4.865   -4.511  -26.029 1.00 18.20  ? 138 PHE B N   1 
ATOM   3129 C  CA  . PHE B 2 138 ? 5.162   -5.889  -26.390 1.00 18.34  ? 138 PHE B CA  1 
ATOM   3130 C  C   . PHE B 2 138 ? 5.097   -6.696  -25.131 1.00 21.89  ? 138 PHE B C   1 
ATOM   3131 O  O   . PHE B 2 138 ? 5.504   -6.220  -24.058 1.00 21.75  ? 138 PHE B O   1 
ATOM   3132 C  CB  . PHE B 2 138 ? 6.568   -6.058  -26.982 1.00 19.35  ? 138 PHE B CB  1 
ATOM   3133 C  CG  . PHE B 2 138 ? 6.658   -5.766  -28.456 1.00 19.77  ? 138 PHE B CG  1 
ATOM   3134 C  CD1 . PHE B 2 138 ? 6.163   -6.676  -29.395 1.00 20.59  ? 138 PHE B CD1 1 
ATOM   3135 C  CD2 . PHE B 2 138 ? 7.254   -4.590  -28.913 1.00 20.35  ? 138 PHE B CD2 1 
ATOM   3136 C  CE1 . PHE B 2 138 ? 6.261   -6.418  -30.759 1.00 20.69  ? 138 PHE B CE1 1 
ATOM   3137 C  CE2 . PHE B 2 138 ? 7.354   -4.329  -30.280 1.00 22.87  ? 138 PHE B CE2 1 
ATOM   3138 C  CZ  . PHE B 2 138 ? 6.835   -5.236  -31.195 1.00 21.15  ? 138 PHE B CZ  1 
ATOM   3139 N  N   . SER B 2 139 ? 4.635   -7.939  -25.256 1.00 16.58  ? 139 SER B N   1 
ATOM   3140 C  CA  . SER B 2 139 ? 4.663   -8.834  -24.120 1.00 14.94  ? 139 SER B CA  1 
ATOM   3141 C  C   . SER B 2 139 ? 6.109   -9.397  -24.050 1.00 20.30  ? 139 SER B C   1 
ATOM   3142 O  O   . SER B 2 139 ? 6.918   -9.193  -24.972 1.00 19.93  ? 139 SER B O   1 
ATOM   3143 C  CB  . SER B 2 139 ? 3.696   -9.980  -24.356 1.00 15.34  ? 139 SER B CB  1 
ATOM   3144 O  OG  . SER B 2 139 ? 4.272   -10.887 -25.282 1.00 17.48  ? 139 SER B OG  1 
ATOM   3145 N  N   . LYS B 2 140 ? 6.403   -10.183 -23.015 1.00 18.09  ? 140 LYS B N   1 
ATOM   3146 C  CA  . LYS B 2 140 ? 7.675   -10.903 -22.941 1.00 16.71  ? 140 LYS B CA  1 
ATOM   3147 C  C   . LYS B 2 140 ? 7.611   -11.906 -24.101 1.00 19.92  ? 140 LYS B C   1 
ATOM   3148 O  O   . LYS B 2 140 ? 6.500   -12.254 -24.536 1.00 20.07  ? 140 LYS B O   1 
ATOM   3149 C  CB  . LYS B 2 140 ? 7.812   -11.601 -21.588 1.00 17.79  ? 140 LYS B CB  1 
ATOM   3150 C  CG  . LYS B 2 140 ? 7.940   -10.606 -20.435 1.00 9.92   ? 140 LYS B CG  1 
ATOM   3151 C  CD  . LYS B 2 140 ? 9.403   -10.134 -20.208 1.00 18.87  ? 140 LYS B CD  1 
ATOM   3152 C  CE  . LYS B 2 140 ? 9.525   -9.085  -19.121 1.00 20.31  ? 140 LYS B CE  1 
ATOM   3153 N  NZ  . LYS B 2 140 ? 9.223   -7.712  -19.630 1.00 24.46  ? 140 LYS B NZ  1 
ATOM   3154 N  N   . PRO B 2 141 ? 8.741   -12.265 -24.736 1.00 14.40  ? 141 PRO B N   1 
ATOM   3155 C  CA  . PRO B 2 141 ? 8.652   -13.143 -25.917 1.00 13.48  ? 141 PRO B CA  1 
ATOM   3156 C  C   . PRO B 2 141 ? 7.979   -14.501 -25.698 1.00 17.57  ? 141 PRO B C   1 
ATOM   3157 O  O   . PRO B 2 141 ? 8.202   -15.172 -24.667 1.00 15.66  ? 141 PRO B O   1 
ATOM   3158 C  CB  . PRO B 2 141 ? 10.111  -13.307 -26.363 1.00 14.47  ? 141 PRO B CB  1 
ATOM   3159 C  CG  . PRO B 2 141 ? 10.836  -12.243 -25.692 1.00 17.76  ? 141 PRO B CG  1 
ATOM   3160 C  CD  . PRO B 2 141 ? 10.143  -11.905 -24.434 1.00 13.80  ? 141 PRO B CD  1 
ATOM   3161 N  N   . PHE B 2 142 ? 7.128   -14.894 -26.664 1.00 13.73  ? 142 PHE B N   1 
ATOM   3162 C  CA  . PHE B 2 142 ? 6.457   -16.197 -26.609 1.00 13.99  ? 142 PHE B CA  1 
ATOM   3163 C  C   . PHE B 2 142 ? 7.284   -17.211 -27.389 1.00 18.26  ? 142 PHE B C   1 
ATOM   3164 O  O   . PHE B 2 142 ? 6.998   -18.391 -27.313 1.00 17.58  ? 142 PHE B O   1 
ATOM   3165 C  CB  . PHE B 2 142 ? 4.986   -16.130 -27.116 1.00 15.65  ? 142 PHE B CB  1 
ATOM   3166 C  CG  . PHE B 2 142 ? 4.756   -15.828 -28.590 1.00 16.15  ? 142 PHE B CG  1 
ATOM   3167 C  CD1 . PHE B 2 142 ? 4.977   -16.802 -29.562 1.00 16.48  ? 142 PHE B CD1 1 
ATOM   3168 C  CD2 . PHE B 2 142 ? 4.247   -14.596 -28.994 1.00 17.93  ? 142 PHE B CD2 1 
ATOM   3169 C  CE1 . PHE B 2 142 ? 4.718   -16.541 -30.917 1.00 17.24  ? 142 PHE B CE1 1 
ATOM   3170 C  CE2 . PHE B 2 142 ? 3.992   -14.335 -30.353 1.00 19.74  ? 142 PHE B CE2 1 
ATOM   3171 C  CZ  . PHE B 2 142 ? 4.218   -15.315 -31.303 1.00 16.47  ? 142 PHE B CZ  1 
ATOM   3172 N  N   . LYS B 2 143 ? 8.290   -16.736 -28.159 1.00 16.47  ? 143 LYS B N   1 
ATOM   3173 C  CA  . LYS B 2 143 ? 9.203   -17.541 -28.977 1.00 17.15  ? 143 LYS B CA  1 
ATOM   3174 C  C   . LYS B 2 143 ? 10.544  -16.812 -29.130 1.00 20.15  ? 143 LYS B C   1 
ATOM   3175 O  O   . LYS B 2 143 ? 10.550  -15.664 -29.557 1.00 20.13  ? 143 LYS B O   1 
ATOM   3176 C  CB  . LYS B 2 143 ? 8.595   -17.815 -30.391 1.00 20.18  ? 143 LYS B CB  1 
ATOM   3177 C  CG  . LYS B 2 143 ? 9.449   -18.738 -31.295 1.00 29.02  ? 143 LYS B CG  1 
ATOM   3178 C  CD  . LYS B 2 143 ? 9.025   -20.206 -31.207 1.00 39.62  ? 143 LYS B CD  1 
ATOM   3179 C  CE  . LYS B 2 143 ? 10.098  -21.188 -31.624 1.00 60.73  ? 143 LYS B CE  1 
ATOM   3180 N  NZ  . LYS B 2 143 ? 11.111  -21.425 -30.555 1.00 74.00  ? 143 LYS B NZ  1 
ATOM   3181 N  N   . TYR B 2 144 ? 11.672  -17.487 -28.830 1.00 16.43  ? 144 TYR B N   1 
ATOM   3182 C  CA  . TYR B 2 144 ? 13.030  -16.932 -29.012 1.00 16.06  ? 144 TYR B CA  1 
ATOM   3183 C  C   . TYR B 2 144 ? 13.590  -17.576 -30.259 1.00 19.97  ? 144 TYR B C   1 
ATOM   3184 O  O   . TYR B 2 144 ? 13.443  -18.787 -30.416 1.00 20.96  ? 144 TYR B O   1 
ATOM   3185 C  CB  . TYR B 2 144 ? 13.942  -17.191 -27.787 1.00 16.04  ? 144 TYR B CB  1 
ATOM   3186 C  CG  . TYR B 2 144 ? 13.535  -16.445 -26.524 1.00 16.97  ? 144 TYR B CG  1 
ATOM   3187 C  CD1 . TYR B 2 144 ? 12.498  -16.909 -25.716 1.00 17.77  ? 144 TYR B CD1 1 
ATOM   3188 C  CD2 . TYR B 2 144 ? 14.196  -15.285 -26.133 1.00 18.09  ? 144 TYR B CD2 1 
ATOM   3189 C  CE1 . TYR B 2 144 ? 12.106  -16.214 -24.571 1.00 17.29  ? 144 TYR B CE1 1 
ATOM   3190 C  CE2 . TYR B 2 144 ? 13.837  -14.602 -24.968 1.00 18.45  ? 144 TYR B CE2 1 
ATOM   3191 C  CZ  . TYR B 2 144 ? 12.794  -15.071 -24.190 1.00 24.39  ? 144 TYR B CZ  1 
ATOM   3192 O  OH  . TYR B 2 144 ? 12.468  -14.403 -23.034 1.00 23.84  ? 144 TYR B OH  1 
ATOM   3193 N  N   . GLN B 2 145 ? 14.150  -16.775 -31.191 1.00 15.10  ? 145 GLN B N   1 
ATOM   3194 C  CA  . GLN B 2 145 ? 14.705  -17.294 -32.458 1.00 13.86  ? 145 GLN B CA  1 
ATOM   3195 C  C   . GLN B 2 145 ? 15.673  -16.282 -33.076 1.00 18.16  ? 145 GLN B C   1 
ATOM   3196 O  O   . GLN B 2 145 ? 16.398  -15.618 -32.340 1.00 16.54  ? 145 GLN B O   1 
ATOM   3197 C  CB  . GLN B 2 145 ? 13.569  -17.718 -33.437 1.00 14.34  ? 145 GLN B CB  1 
ATOM   3198 C  CG  . GLN B 2 145 ? 12.522  -16.637 -33.708 1.00 12.38  ? 145 GLN B CG  1 
ATOM   3199 C  CD  . GLN B 2 145 ? 12.494  -16.188 -35.155 1.00 29.33  ? 145 GLN B CD  1 
ATOM   3200 O  OE1 . GLN B 2 145 ? 12.363  -17.002 -36.086 1.00 24.86  ? 145 GLN B OE1 1 
ATOM   3201 N  NE2 . GLN B 2 145 ? 12.534  -14.869 -35.377 1.00 13.05  ? 145 GLN B NE2 1 
ATOM   3202 N  N   . GLY B 2 146 ? 15.684  -16.167 -34.403 1.00 16.77  ? 146 GLY B N   1 
ATOM   3203 C  CA  . GLY B 2 146 ? 16.510  -15.186 -35.089 1.00 16.51  ? 146 GLY B CA  1 
ATOM   3204 C  C   . GLY B 2 146 ? 16.471  -15.286 -36.590 1.00 20.27  ? 146 GLY B C   1 
ATOM   3205 O  O   . GLY B 2 146 ? 15.567  -15.902 -37.142 1.00 19.99  ? 146 GLY B O   1 
ATOM   3206 N  N   . LEU B 2 147 ? 17.477  -14.710 -37.255 1.00 16.79  ? 147 LEU B N   1 
ATOM   3207 C  CA  . LEU B 2 147 ? 17.543  -14.705 -38.699 1.00 16.14  ? 147 LEU B CA  1 
ATOM   3208 C  C   . LEU B 2 147 ? 18.463  -15.746 -39.245 1.00 20.17  ? 147 LEU B C   1 
ATOM   3209 O  O   . LEU B 2 147 ? 19.568  -15.954 -38.743 1.00 19.66  ? 147 LEU B O   1 
ATOM   3210 C  CB  . LEU B 2 147 ? 17.922  -13.320 -39.253 1.00 16.19  ? 147 LEU B CB  1 
ATOM   3211 C  CG  . LEU B 2 147 ? 17.052  -12.129 -38.793 1.00 21.27  ? 147 LEU B CG  1 
ATOM   3212 C  CD1 . LEU B 2 147 ? 17.617  -10.775 -39.301 1.00 19.79  ? 147 LEU B CD1 1 
ATOM   3213 C  CD2 . LEU B 2 147 ? 15.571  -12.342 -39.149 1.00 23.14  ? 147 LEU B CD2 1 
ATOM   3214 N  N   . THR B 2 148 ? 17.996  -16.402 -40.295 1.00 17.16  ? 148 THR B N   1 
ATOM   3215 C  CA  . THR B 2 148 ? 18.766  -17.380 -41.042 1.00 17.56  ? 148 THR B CA  1 
ATOM   3216 C  C   . THR B 2 148 ? 18.551  -17.107 -42.536 1.00 21.67  ? 148 THR B C   1 
ATOM   3217 O  O   . THR B 2 148 ? 17.844  -16.159 -42.891 1.00 21.51  ? 148 THR B O   1 
ATOM   3218 C  CB  . THR B 2 148 ? 18.502  -18.811 -40.554 1.00 25.69  ? 148 THR B CB  1 
ATOM   3219 O  OG1 . THR B 2 148 ? 19.591  -19.603 -40.995 1.00 23.39  ? 148 THR B OG1 1 
ATOM   3220 C  CG2 . THR B 2 148 ? 17.163  -19.400 -41.066 1.00 24.63  ? 148 THR B CG2 1 
ATOM   3221 N  N   . ILE B 2 149 ? 19.173  -17.914 -43.399 1.00 17.76  ? 149 ILE B N   1 
ATOM   3222 C  CA  . ILE B 2 149 ? 19.091  -17.770 -44.849 1.00 16.74  ? 149 ILE B CA  1 
ATOM   3223 C  C   . ILE B 2 149 ? 18.589  -19.083 -45.460 1.00 21.49  ? 149 ILE B C   1 
ATOM   3224 O  O   . ILE B 2 149 ? 19.133  -20.144 -45.159 1.00 21.39  ? 149 ILE B O   1 
ATOM   3225 C  CB  . ILE B 2 149 ? 20.476  -17.349 -45.406 1.00 19.53  ? 149 ILE B CB  1 
ATOM   3226 C  CG1 . ILE B 2 149 ? 21.009  -16.051 -44.720 1.00 19.66  ? 149 ILE B CG1 1 
ATOM   3227 C  CG2 . ILE B 2 149 ? 20.457  -17.230 -46.942 1.00 19.92  ? 149 ILE B CG2 1 
ATOM   3228 C  CD1 . ILE B 2 149 ? 22.513  -15.889 -44.666 1.00 21.48  ? 149 ILE B CD1 1 
ATOM   3229 N  N   . LEU B 2 150 ? 17.556  -19.013 -46.315 1.00 17.82  ? 150 LEU B N   1 
ATOM   3230 C  CA  . LEU B 2 150 ? 17.028  -20.194 -46.978 1.00 17.77  ? 150 LEU B CA  1 
ATOM   3231 C  C   . LEU B 2 150 ? 17.489  -20.216 -48.433 1.00 24.10  ? 150 LEU B C   1 
ATOM   3232 O  O   . LEU B 2 150 ? 17.350  -19.223 -49.148 1.00 24.25  ? 150 LEU B O   1 
ATOM   3233 C  CB  . LEU B 2 150 ? 15.493  -20.225 -46.887 1.00 17.63  ? 150 LEU B CB  1 
ATOM   3234 C  CG  . LEU B 2 150 ? 14.775  -21.415 -47.518 1.00 21.60  ? 150 LEU B CG  1 
ATOM   3235 C  CD1 . LEU B 2 150 ? 14.644  -22.586 -46.515 1.00 21.07  ? 150 LEU B CD1 1 
ATOM   3236 C  CD2 . LEU B 2 150 ? 13.418  -20.998 -48.049 1.00 21.99  ? 150 LEU B CD2 1 
ATOM   3237 N  N   . VAL B 2 151 ? 18.038  -21.360 -48.862 1.00 22.50  ? 151 VAL B N   1 
ATOM   3238 C  CA  . VAL B 2 151 ? 18.497  -21.596 -50.239 1.00 22.82  ? 151 VAL B CA  1 
ATOM   3239 C  C   . VAL B 2 151 ? 17.949  -22.931 -50.748 1.00 27.84  ? 151 VAL B C   1 
ATOM   3240 O  O   . VAL B 2 151 ? 17.447  -23.749 -49.967 1.00 26.26  ? 151 VAL B O   1 
ATOM   3241 C  CB  . VAL B 2 151 ? 20.053  -21.534 -50.406 1.00 25.69  ? 151 VAL B CB  1 
ATOM   3242 C  CG1 . VAL B 2 151 ? 20.627  -20.184 -49.962 1.00 24.87  ? 151 VAL B CG1 1 
ATOM   3243 C  CG2 . VAL B 2 151 ? 20.754  -22.697 -49.693 1.00 25.22  ? 151 VAL B CG2 1 
ATOM   3244 N  N   . LYS B 2 152 ? 18.096  -23.154 -52.058 1.00 26.62  ? 152 LYS B N   1 
ATOM   3245 C  CA  . LYS B 2 152 ? 17.749  -24.406 -52.744 1.00 26.73  ? 152 LYS B CA  1 
ATOM   3246 C  C   . LYS B 2 152 ? 18.866  -25.399 -52.422 1.00 31.28  ? 152 LYS B C   1 
ATOM   3247 O  O   . LYS B 2 152 ? 20.030  -24.990 -52.321 1.00 31.64  ? 152 LYS B O   1 
ATOM   3248 C  CB  . LYS B 2 152 ? 17.676  -24.142 -54.272 1.00 28.91  ? 152 LYS B CB  1 
ATOM   3249 C  CG  . LYS B 2 152 ? 17.135  -25.280 -55.123 1.00 36.75  ? 152 LYS B CG  1 
ATOM   3250 C  CD  . LYS B 2 152 ? 15.644  -25.387 -55.118 1.00 40.56  ? 152 LYS B CD  1 
ATOM   3251 C  CE  . LYS B 2 152 ? 15.161  -26.291 -56.218 1.00 39.57  ? 152 LYS B CE  1 
ATOM   3252 N  NZ  . LYS B 2 152 ? 13.708  -26.583 -56.080 1.00 47.99  ? 152 LYS B NZ  1 
ATOM   3253 N  N   . LYS B 2 153 ? 18.528  -26.693 -52.228 1.00 28.55  ? 153 LYS B N   1 
ATOM   3254 C  CA  . LYS B 2 153 ? 19.530  -27.732 -51.946 1.00 27.82  ? 153 LYS B CA  1 
ATOM   3255 C  C   . LYS B 2 153 ? 20.483  -27.775 -53.136 1.00 33.28  ? 153 LYS B C   1 
ATOM   3256 O  O   . LYS B 2 153 ? 20.038  -27.752 -54.296 1.00 32.08  ? 153 LYS B O   1 
ATOM   3257 C  CB  . LYS B 2 153 ? 18.873  -29.091 -51.699 1.00 29.60  ? 153 LYS B CB  1 
ATOM   3258 C  CG  . LYS B 2 153 ? 19.679  -29.967 -50.761 1.00 42.66  ? 153 LYS B CG  1 
ATOM   3259 C  CD  . LYS B 2 153 ? 19.055  -31.346 -50.583 1.00 54.14  ? 153 LYS B CD  1 
ATOM   3260 C  CE  . LYS B 2 153 ? 19.586  -32.078 -49.359 1.00 65.39  ? 153 LYS B CE  1 
ATOM   3261 N  NZ  . LYS B 2 153 ? 20.999  -32.531 -49.507 1.00 67.21  ? 153 LYS B NZ  1 
ATOM   3262 N  N   . GLY B 2 154 ? 21.770  -27.668 -52.842 1.00 32.20  ? 154 GLY B N   1 
ATOM   3263 C  CA  . GLY B 2 154 ? 22.793  -27.587 -53.881 1.00 33.22  ? 154 GLY B CA  1 
ATOM   3264 C  C   . GLY B 2 154 ? 23.500  -26.243 -53.930 1.00 39.90  ? 154 GLY B C   1 
ATOM   3265 O  O   . GLY B 2 154 ? 24.676  -26.207 -54.289 1.00 40.02  ? 154 GLY B O   1 
ATOM   3266 N  N   . THR B 2 155 ? 22.791  -25.119 -53.571 1.00 37.97  ? 155 THR B N   1 
ATOM   3267 C  CA  . THR B 2 155 ? 23.346  -23.749 -53.529 1.00 37.87  ? 155 THR B CA  1 
ATOM   3268 C  C   . THR B 2 155 ? 24.371  -23.648 -52.396 1.00 42.83  ? 155 THR B C   1 
ATOM   3269 O  O   . THR B 2 155 ? 24.000  -23.745 -51.226 1.00 42.72  ? 155 THR B O   1 
ATOM   3270 C  CB  . THR B 2 155 ? 22.225  -22.678 -53.451 1.00 39.80  ? 155 THR B CB  1 
ATOM   3271 O  OG1 . THR B 2 155 ? 21.625  -22.559 -54.736 1.00 42.98  ? 155 THR B OG1 1 
ATOM   3272 C  CG2 . THR B 2 155 ? 22.740  -21.298 -53.034 1.00 33.80  ? 155 THR B CG2 1 
ATOM   3273 N  N   . ARG B 2 156 ? 25.656  -23.496 -52.745 1.00 40.50  ? 156 ARG B N   1 
ATOM   3274 C  CA  . ARG B 2 156 ? 26.721  -23.392 -51.750 1.00 40.87  ? 156 ARG B CA  1 
ATOM   3275 C  C   . ARG B 2 156 ? 26.874  -21.937 -51.306 1.00 44.13  ? 156 ARG B C   1 
ATOM   3276 O  O   . ARG B 2 156 ? 27.241  -21.088 -52.114 1.00 44.41  ? 156 ARG B O   1 
ATOM   3277 C  CB  . ARG B 2 156 ? 28.044  -23.970 -52.292 1.00 42.92  ? 156 ARG B CB  1 
ATOM   3278 C  CG  . ARG B 2 156 ? 28.172  -25.477 -52.100 1.00 54.69  ? 156 ARG B CG  1 
ATOM   3279 C  CD  . ARG B 2 156 ? 29.632  -25.910 -52.141 1.00 68.30  ? 156 ARG B CD  1 
ATOM   3280 N  NE  . ARG B 2 156 ? 29.907  -27.061 -51.273 1.00 78.99  ? 156 ARG B NE  1 
ATOM   3281 C  CZ  . ARG B 2 156 ? 31.076  -27.696 -51.211 1.00 95.17  ? 156 ARG B CZ  1 
ATOM   3282 N  NH1 . ARG B 2 156 ? 32.093  -27.309 -51.973 1.00 85.19  ? 156 ARG B NH1 1 
ATOM   3283 N  NH2 . ARG B 2 156 ? 31.235  -28.728 -50.392 1.00 79.86  ? 156 ARG B NH2 1 
ATOM   3284 N  N   . ILE B 2 157 ? 26.511  -21.645 -50.044 1.00 39.25  ? 157 ILE B N   1 
ATOM   3285 C  CA  . ILE B 2 157 ? 26.574  -20.322 -49.396 1.00 38.59  ? 157 ILE B CA  1 
ATOM   3286 C  C   . ILE B 2 157 ? 27.011  -20.569 -47.942 1.00 40.82  ? 157 ILE B C   1 
ATOM   3287 O  O   . ILE B 2 157 ? 26.533  -21.521 -47.339 1.00 41.28  ? 157 ILE B O   1 
ATOM   3288 C  CB  . ILE B 2 157 ? 25.194  -19.563 -49.570 1.00 41.68  ? 157 ILE B CB  1 
ATOM   3289 C  CG1 . ILE B 2 157 ? 25.067  -18.907 -50.963 1.00 42.21  ? 157 ILE B CG1 1 
ATOM   3290 C  CG2 . ILE B 2 157 ? 24.839  -18.557 -48.468 1.00 41.52  ? 157 ILE B CG2 1 
ATOM   3291 C  CD1 . ILE B 2 157 ? 26.024  -17.764 -51.307 1.00 47.19  ? 157 ILE B CD1 1 
ATOM   3292 N  N   . THR B 2 158 ? 27.967  -19.789 -47.411 1.00 36.48  ? 158 THR B N   1 
ATOM   3293 C  CA  . THR B 2 158 ? 28.470  -19.981 -46.030 1.00 35.84  ? 158 THR B CA  1 
ATOM   3294 C  C   . THR B 2 158 ? 27.521  -19.415 -44.988 1.00 39.75  ? 158 THR B C   1 
ATOM   3295 O  O   . THR B 2 158 ? 27.350  -20.002 -43.922 1.00 40.70  ? 158 THR B O   1 
ATOM   3296 C  CB  . THR B 2 158 ? 29.870  -19.359 -45.813 1.00 40.49  ? 158 THR B CB  1 
ATOM   3297 O  OG1 . THR B 2 158 ? 29.852  -17.961 -46.138 1.00 38.45  ? 158 THR B OG1 1 
ATOM   3298 C  CG2 . THR B 2 158 ? 30.965  -20.084 -46.571 1.00 38.68  ? 158 THR B CG2 1 
ATOM   3299 N  N   . GLY B 2 159 ? 26.964  -18.251 -45.293 1.00 34.58  ? 159 GLY B N   1 
ATOM   3300 C  CA  . GLY B 2 159 ? 26.071  -17.509 -44.426 1.00 33.30  ? 159 GLY B CA  1 
ATOM   3301 C  C   . GLY B 2 159 ? 26.072  -16.048 -44.801 1.00 35.50  ? 159 GLY B C   1 
ATOM   3302 O  O   . GLY B 2 159 ? 26.192  -15.705 -45.984 1.00 34.69  ? 159 GLY B O   1 
ATOM   3303 N  N   . ILE B 2 160 ? 25.920  -15.186 -43.786 1.00 31.02  ? 160 ILE B N   1 
ATOM   3304 C  CA  . ILE B 2 160 ? 25.794  -13.732 -43.916 1.00 29.68  ? 160 ILE B CA  1 
ATOM   3305 C  C   . ILE B 2 160 ? 27.068  -13.037 -44.376 1.00 33.12  ? 160 ILE B C   1 
ATOM   3306 O  O   . ILE B 2 160 ? 26.979  -11.985 -44.999 1.00 31.71  ? 160 ILE B O   1 
ATOM   3307 C  CB  . ILE B 2 160 ? 25.227  -13.108 -42.616 1.00 32.05  ? 160 ILE B CB  1 
ATOM   3308 C  CG1 . ILE B 2 160 ? 24.522  -11.756 -42.900 1.00 31.54  ? 160 ILE B CG1 1 
ATOM   3309 C  CG2 . ILE B 2 160 ? 26.255  -13.017 -41.484 1.00 31.89  ? 160 ILE B CG2 1 
ATOM   3310 C  CD1 . ILE B 2 160 ? 23.240  -11.929 -43.740 1.00 31.69  ? 160 ILE B CD1 1 
ATOM   3311 N  N   . ASN B 2 161 ? 28.236  -13.620 -44.085 1.00 30.90  ? 161 ASN B N   1 
ATOM   3312 C  CA  . ASN B 2 161 ? 29.532  -13.044 -44.442 1.00 30.23  ? 161 ASN B CA  1 
ATOM   3313 C  C   . ASN B 2 161 ? 30.045  -13.571 -45.773 1.00 32.51  ? 161 ASN B C   1 
ATOM   3314 O  O   . ASN B 2 161 ? 31.188  -13.294 -46.140 1.00 33.63  ? 161 ASN B O   1 
ATOM   3315 C  CB  . ASN B 2 161 ? 30.542  -13.277 -43.315 1.00 30.05  ? 161 ASN B CB  1 
ATOM   3316 C  CG  . ASN B 2 161 ? 30.139  -12.685 -41.987 1.00 48.32  ? 161 ASN B CG  1 
ATOM   3317 O  OD1 . ASN B 2 161 ? 29.611  -11.556 -41.891 1.00 37.27  ? 161 ASN B OD1 1 
ATOM   3318 N  ND2 . ASN B 2 161 ? 30.419  -13.430 -40.927 1.00 40.78  ? 161 ASN B ND2 1 
ATOM   3319 N  N   . ASP B 2 162 ? 29.202  -14.317 -46.503 1.00 27.12  ? 162 ASP B N   1 
ATOM   3320 C  CA  . ASP B 2 162 ? 29.538  -14.865 -47.816 1.00 26.66  ? 162 ASP B CA  1 
ATOM   3321 C  C   . ASP B 2 162 ? 29.721  -13.756 -48.854 1.00 29.33  ? 162 ASP B C   1 
ATOM   3322 O  O   . ASP B 2 162 ? 28.879  -12.850 -48.936 1.00 28.73  ? 162 ASP B O   1 
ATOM   3323 C  CB  . ASP B 2 162 ? 28.459  -15.841 -48.305 1.00 28.53  ? 162 ASP B CB  1 
ATOM   3324 C  CG  . ASP B 2 162 ? 28.896  -16.667 -49.495 1.00 39.14  ? 162 ASP B CG  1 
ATOM   3325 O  OD1 . ASP B 2 162 ? 28.875  -16.131 -50.630 1.00 39.07  ? 162 ASP B OD1 1 
ATOM   3326 O  OD2 . ASP B 2 162 ? 29.269  -17.845 -49.292 1.00 45.34  ? 162 ASP B OD2 1 
ATOM   3327 N  N   . PRO B 2 163 ? 30.789  -13.836 -49.684 1.00 25.58  ? 163 PRO B N   1 
ATOM   3328 C  CA  . PRO B 2 163 ? 31.003  -12.793 -50.709 1.00 25.48  ? 163 PRO B CA  1 
ATOM   3329 C  C   . PRO B 2 163 ? 29.825  -12.600 -51.675 1.00 30.55  ? 163 PRO B C   1 
ATOM   3330 O  O   . PRO B 2 163 ? 29.577  -11.464 -52.079 1.00 30.63  ? 163 PRO B O   1 
ATOM   3331 C  CB  . PRO B 2 163 ? 32.282  -13.255 -51.416 1.00 26.41  ? 163 PRO B CB  1 
ATOM   3332 C  CG  . PRO B 2 163 ? 33.002  -14.070 -50.383 1.00 29.36  ? 163 PRO B CG  1 
ATOM   3333 C  CD  . PRO B 2 163 ? 31.902  -14.813 -49.682 1.00 25.28  ? 163 PRO B CD  1 
ATOM   3334 N  N   . ARG B 2 164 ? 29.046  -13.668 -51.983 1.00 26.79  ? 164 ARG B N   1 
ATOM   3335 C  CA  . ARG B 2 164 ? 27.891  -13.512 -52.886 1.00 26.89  ? 164 ARG B CA  1 
ATOM   3336 C  C   . ARG B 2 164 ? 26.747  -12.654 -52.277 1.00 30.25  ? 164 ARG B C   1 
ATOM   3337 O  O   . ARG B 2 164 ? 25.846  -12.245 -53.004 1.00 31.28  ? 164 ARG B O   1 
ATOM   3338 C  CB  . ARG B 2 164 ? 27.389  -14.852 -53.425 1.00 26.44  ? 164 ARG B CB  1 
ATOM   3339 C  CG  . ARG B 2 164 ? 28.268  -15.344 -54.584 1.00 30.67  ? 164 ARG B CG  1 
ATOM   3340 C  CD  . ARG B 2 164 ? 27.623  -16.426 -55.441 1.00 28.23  ? 164 ARG B CD  1 
ATOM   3341 N  NE  . ARG B 2 164 ? 27.503  -17.716 -54.746 1.00 27.03  ? 164 ARG B NE  1 
ATOM   3342 C  CZ  . ARG B 2 164 ? 26.920  -18.795 -55.262 1.00 38.45  ? 164 ARG B CZ  1 
ATOM   3343 N  NH1 . ARG B 2 164 ? 26.406  -18.762 -56.486 1.00 20.42  ? 164 ARG B NH1 1 
ATOM   3344 N  NH2 . ARG B 2 164 ? 26.851  -19.915 -54.563 1.00 31.00  ? 164 ARG B NH2 1 
ATOM   3345 N  N   . LEU B 2 165 ? 26.834  -12.311 -50.976 1.00 25.25  ? 165 LEU B N   1 
ATOM   3346 C  CA  . LEU B 2 165 ? 25.901  -11.399 -50.331 1.00 24.58  ? 165 LEU B CA  1 
ATOM   3347 C  C   . LEU B 2 165 ? 26.624  -10.088 -49.969 1.00 29.14  ? 165 LEU B C   1 
ATOM   3348 O  O   . LEU B 2 165 ? 26.065  -9.015  -50.140 1.00 28.11  ? 165 LEU B O   1 
ATOM   3349 C  CB  . LEU B 2 165 ? 25.227  -11.977 -49.068 1.00 24.83  ? 165 LEU B CB  1 
ATOM   3350 C  CG  . LEU B 2 165 ? 24.860  -13.472 -48.915 1.00 28.85  ? 165 LEU B CG  1 
ATOM   3351 C  CD1 . LEU B 2 165 ? 24.140  -13.692 -47.574 1.00 28.54  ? 165 LEU B CD1 1 
ATOM   3352 C  CD2 . LEU B 2 165 ? 24.008  -13.984 -50.056 1.00 27.23  ? 165 LEU B CD2 1 
ATOM   3353 N  N   . ARG B 2 166 ? 27.866  -10.175 -49.462 1.00 26.76  ? 166 ARG B N   1 
ATOM   3354 C  CA  . ARG B 2 166 ? 28.625  -9.004  -49.031 1.00 26.93  ? 166 ARG B CA  1 
ATOM   3355 C  C   . ARG B 2 166 ? 29.108  -8.120  -50.174 1.00 32.41  ? 166 ARG B C   1 
ATOM   3356 O  O   . ARG B 2 166 ? 29.225  -6.898  -50.013 1.00 32.28  ? 166 ARG B O   1 
ATOM   3357 C  CB  . ARG B 2 166 ? 29.775  -9.423  -48.120 1.00 25.36  ? 166 ARG B CB  1 
ATOM   3358 C  CG  . ARG B 2 166 ? 29.294  -10.006 -46.789 1.00 24.45  ? 166 ARG B CG  1 
ATOM   3359 C  CD  . ARG B 2 166 ? 28.531  -8.990  -45.956 1.00 30.03  ? 166 ARG B CD  1 
ATOM   3360 N  NE  . ARG B 2 166 ? 28.246  -9.513  -44.617 1.00 38.44  ? 166 ARG B NE  1 
ATOM   3361 C  CZ  . ARG B 2 166 ? 27.987  -8.766  -43.550 1.00 45.15  ? 166 ARG B CZ  1 
ATOM   3362 N  NH1 . ARG B 2 166 ? 27.985  -7.440  -43.640 1.00 25.94  ? 166 ARG B NH1 1 
ATOM   3363 N  NH2 . ARG B 2 166 ? 27.750  -9.335  -42.380 1.00 35.52  ? 166 ARG B NH2 1 
ATOM   3364 N  N   . ASN B 2 167 ? 29.335  -8.728  -51.333 1.00 28.89  ? 167 ASN B N   1 
ATOM   3365 C  CA  . ASN B 2 167 ? 29.776  -8.049  -52.543 1.00 28.66  ? 167 ASN B CA  1 
ATOM   3366 C  C   . ASN B 2 167 ? 28.863  -8.562  -53.664 1.00 32.57  ? 167 ASN B C   1 
ATOM   3367 O  O   . ASN B 2 167 ? 29.265  -9.432  -54.440 1.00 31.43  ? 167 ASN B O   1 
ATOM   3368 C  CB  . ASN B 2 167 ? 31.264  -8.359  -52.807 1.00 27.83  ? 167 ASN B CB  1 
ATOM   3369 C  CG  . ASN B 2 167 ? 31.891  -7.648  -53.992 1.00 44.44  ? 167 ASN B CG  1 
ATOM   3370 O  OD1 . ASN B 2 167 ? 31.598  -6.483  -54.293 1.00 34.25  ? 167 ASN B OD1 1 
ATOM   3371 N  ND2 . ASN B 2 167 ? 32.833  -8.324  -54.645 1.00 30.90  ? 167 ASN B ND2 1 
ATOM   3372 N  N   . PRO B 2 168 ? 27.605  -8.069  -53.723 1.00 29.56  ? 168 PRO B N   1 
ATOM   3373 C  CA  . PRO B 2 168 ? 26.656  -8.598  -54.705 1.00 29.47  ? 168 PRO B CA  1 
ATOM   3374 C  C   . PRO B 2 168 ? 26.723  -8.077  -56.140 1.00 34.90  ? 168 PRO B C   1 
ATOM   3375 O  O   . PRO B 2 168 ? 27.231  -7.001  -56.434 1.00 34.64  ? 168 PRO B O   1 
ATOM   3376 C  CB  . PRO B 2 168 ? 25.299  -8.259  -54.084 1.00 31.22  ? 168 PRO B CB  1 
ATOM   3377 C  CG  . PRO B 2 168 ? 25.523  -7.021  -53.335 1.00 35.59  ? 168 PRO B CG  1 
ATOM   3378 C  CD  . PRO B 2 168 ? 26.953  -7.079  -52.837 1.00 31.51  ? 168 PRO B CD  1 
ATOM   3379 N  N   . SER B 2 169 ? 26.088  -8.860  -57.020 1.00 33.41  ? 169 SER B N   1 
ATOM   3380 C  CA  . SER B 2 169 ? 25.888  -8.668  -58.452 1.00 33.37  ? 169 SER B CA  1 
ATOM   3381 C  C   . SER B 2 169 ? 24.469  -9.172  -58.792 1.00 38.93  ? 169 SER B C   1 
ATOM   3382 O  O   . SER B 2 169 ? 23.792  -9.727  -57.920 1.00 37.49  ? 169 SER B O   1 
ATOM   3383 C  CB  . SER B 2 169 ? 26.912  -9.491  -59.232 1.00 35.40  ? 169 SER B CB  1 
ATOM   3384 O  OG  . SER B 2 169 ? 26.721  -10.883 -59.045 1.00 38.09  ? 169 SER B OG  1 
ATOM   3385 N  N   . ASP B 2 170 ? 24.055  -9.038  -60.077 1.00 36.88  ? 170 ASP B N   1 
ATOM   3386 C  CA  . ASP B 2 170 ? 22.769  -9.526  -60.599 1.00 36.19  ? 170 ASP B CA  1 
ATOM   3387 C  C   . ASP B 2 170 ? 22.825  -11.036 -60.860 1.00 38.20  ? 170 ASP B C   1 
ATOM   3388 O  O   . ASP B 2 170 ? 21.806  -11.618 -61.219 1.00 39.14  ? 170 ASP B O   1 
ATOM   3389 C  CB  . ASP B 2 170 ? 22.408  -8.784  -61.885 1.00 37.13  ? 170 ASP B CB  1 
ATOM   3390 N  N   . LYS B 2 171 ? 24.009  -11.671 -60.687 1.00 32.50  ? 171 LYS B N   1 
ATOM   3391 C  CA  . LYS B 2 171 ? 24.189  -13.112 -60.891 1.00 31.44  ? 171 LYS B CA  1 
ATOM   3392 C  C   . LYS B 2 171 ? 23.612  -13.962 -59.742 1.00 36.15  ? 171 LYS B C   1 
ATOM   3393 O  O   . LYS B 2 171 ? 23.170  -15.083 -59.986 1.00 38.67  ? 171 LYS B O   1 
ATOM   3394 C  CB  . LYS B 2 171 ? 25.655  -13.447 -61.132 1.00 31.53  ? 171 LYS B CB  1 
ATOM   3395 N  N   . PHE B 2 172 ? 23.610  -13.443 -58.511 1.00 29.82  ? 172 PHE B N   1 
ATOM   3396 C  CA  . PHE B 2 172 ? 23.071  -14.134 -57.338 1.00 28.74  ? 172 PHE B CA  1 
ATOM   3397 C  C   . PHE B 2 172 ? 22.108  -13.188 -56.606 1.00 31.68  ? 172 PHE B C   1 
ATOM   3398 O  O   . PHE B 2 172 ? 22.541  -12.274 -55.909 1.00 31.48  ? 172 PHE B O   1 
ATOM   3399 C  CB  . PHE B 2 172 ? 24.203  -14.611 -56.406 1.00 30.14  ? 172 PHE B CB  1 
ATOM   3400 C  CG  . PHE B 2 172 ? 23.729  -15.497 -55.278 1.00 31.13  ? 172 PHE B CG  1 
ATOM   3401 C  CD1 . PHE B 2 172 ? 23.292  -14.948 -54.075 1.00 33.38  ? 172 PHE B CD1 1 
ATOM   3402 C  CD2 . PHE B 2 172 ? 23.732  -16.879 -55.412 1.00 32.34  ? 172 PHE B CD2 1 
ATOM   3403 C  CE1 . PHE B 2 172 ? 22.848  -15.763 -53.039 1.00 33.95  ? 172 PHE B CE1 1 
ATOM   3404 C  CE2 . PHE B 2 172 ? 23.299  -17.696 -54.372 1.00 35.42  ? 172 PHE B CE2 1 
ATOM   3405 C  CZ  . PHE B 2 172 ? 22.850  -17.133 -53.194 1.00 33.69  ? 172 PHE B CZ  1 
ATOM   3406 N  N   . ILE B 2 173 ? 20.810  -13.413 -56.771 1.00 28.20  ? 173 ILE B N   1 
ATOM   3407 C  CA  . ILE B 2 173 ? 19.749  -12.584 -56.200 1.00 27.74  ? 173 ILE B CA  1 
ATOM   3408 C  C   . ILE B 2 173 ? 19.287  -13.074 -54.814 1.00 29.76  ? 173 ILE B C   1 
ATOM   3409 O  O   . ILE B 2 173 ? 18.980  -14.261 -54.625 1.00 29.64  ? 173 ILE B O   1 
ATOM   3410 C  CB  . ILE B 2 173 ? 18.595  -12.470 -57.226 1.00 31.02  ? 173 ILE B CB  1 
ATOM   3411 C  CG1 . ILE B 2 173 ? 19.093  -11.722 -58.494 1.00 31.94  ? 173 ILE B CG1 1 
ATOM   3412 C  CG2 . ILE B 2 173 ? 17.350  -11.780 -56.612 1.00 31.60  ? 173 ILE B CG2 1 
ATOM   3413 C  CD1 . ILE B 2 173 ? 18.444  -12.140 -59.780 1.00 48.29  ? 173 ILE B CD1 1 
ATOM   3414 N  N   . TYR B 2 174 ? 19.253  -12.148 -53.848 1.00 22.96  ? 174 TYR B N   1 
ATOM   3415 C  CA  . TYR B 2 174 ? 18.772  -12.445 -52.500 1.00 21.23  ? 174 TYR B CA  1 
ATOM   3416 C  C   . TYR B 2 174 ? 17.807  -11.352 -52.045 1.00 24.30  ? 174 TYR B C   1 
ATOM   3417 O  O   . TYR B 2 174 ? 17.873  -10.227 -52.574 1.00 22.69  ? 174 TYR B O   1 
ATOM   3418 C  CB  . TYR B 2 174 ? 19.914  -12.720 -51.512 1.00 21.71  ? 174 TYR B CB  1 
ATOM   3419 C  CG  . TYR B 2 174 ? 20.878  -11.575 -51.325 1.00 23.90  ? 174 TYR B CG  1 
ATOM   3420 C  CD1 . TYR B 2 174 ? 20.648  -10.595 -50.362 1.00 26.54  ? 174 TYR B CD1 1 
ATOM   3421 C  CD2 . TYR B 2 174 ? 22.048  -11.489 -52.080 1.00 24.30  ? 174 TYR B CD2 1 
ATOM   3422 C  CE1 . TYR B 2 174 ? 21.541  -9.541  -50.172 1.00 28.63  ? 174 TYR B CE1 1 
ATOM   3423 C  CE2 . TYR B 2 174 ? 22.950  -10.438 -51.898 1.00 24.89  ? 174 TYR B CE2 1 
ATOM   3424 C  CZ  . TYR B 2 174 ? 22.699  -9.476  -50.929 1.00 32.90  ? 174 TYR B CZ  1 
ATOM   3425 O  OH  . TYR B 2 174 ? 23.549  -8.420  -50.728 1.00 30.03  ? 174 TYR B OH  1 
ATOM   3426 N  N   . ALA B 2 175 ? 16.854  -11.695 -51.135 1.00 20.33  ? 175 ALA B N   1 
ATOM   3427 C  CA  . ALA B 2 175 ? 15.844  -10.735 -50.663 1.00 19.57  ? 175 ALA B CA  1 
ATOM   3428 C  C   . ALA B 2 175 ? 15.167  -11.120 -49.353 1.00 21.54  ? 175 ALA B C   1 
ATOM   3429 O  O   . ALA B 2 175 ? 15.355  -12.223 -48.828 1.00 20.61  ? 175 ALA B O   1 
ATOM   3430 C  CB  . ALA B 2 175 ? 14.775  -10.526 -51.735 1.00 20.15  ? 175 ALA B CB  1 
ATOM   3431 N  N   . THR B 2 176 ? 14.344  -10.200 -48.851 1.00 16.96  ? 176 THR B N   1 
ATOM   3432 C  CA  . THR B 2 176 ? 13.502  -10.420 -47.681 1.00 16.83  ? 176 THR B CA  1 
ATOM   3433 C  C   . THR B 2 176 ? 12.051  -10.048 -48.016 1.00 18.96  ? 176 THR B C   1 
ATOM   3434 O  O   . THR B 2 176 ? 11.688  -9.912  -49.190 1.00 18.33  ? 176 THR B O   1 
ATOM   3435 C  CB  . THR B 2 176 ? 14.090  -9.749  -46.420 1.00 25.35  ? 176 THR B CB  1 
ATOM   3436 O  OG1 . THR B 2 176 ? 13.419  -10.309 -45.305 1.00 24.54  ? 176 THR B OG1 1 
ATOM   3437 C  CG2 . THR B 2 176 ? 13.978  -8.198  -46.412 1.00 19.55  ? 176 THR B CG2 1 
ATOM   3438 N  N   . VAL B 2 177 ? 11.230  -9.875  -46.993 1.00 16.43  ? 177 VAL B N   1 
ATOM   3439 C  CA  . VAL B 2 177 ? 9.832   -9.463  -47.125 1.00 15.92  ? 177 VAL B CA  1 
ATOM   3440 C  C   . VAL B 2 177 ? 9.750   -7.951  -46.912 1.00 20.61  ? 177 VAL B C   1 
ATOM   3441 O  O   . VAL B 2 177 ? 10.294  -7.450  -45.935 1.00 19.58  ? 177 VAL B O   1 
ATOM   3442 C  CB  . VAL B 2 177 ? 8.935   -10.236 -46.141 1.00 18.96  ? 177 VAL B CB  1 
ATOM   3443 C  CG1 . VAL B 2 177 ? 7.470   -9.842  -46.306 1.00 19.19  ? 177 VAL B CG1 1 
ATOM   3444 C  CG2 . VAL B 2 177 ? 9.115   -11.738 -46.318 1.00 18.75  ? 177 VAL B CG2 1 
ATOM   3445 N  N   . LYS B 2 178 ? 9.084   -7.232  -47.839 1.00 18.55  ? 178 LYS B N   1 
ATOM   3446 C  CA  . LYS B 2 178 ? 8.881   -5.782  -47.765 1.00 17.80  ? 178 LYS B CA  1 
ATOM   3447 C  C   . LYS B 2 178 ? 8.128   -5.436  -46.501 1.00 21.03  ? 178 LYS B C   1 
ATOM   3448 O  O   . LYS B 2 178 ? 7.168   -6.129  -46.151 1.00 19.74  ? 178 LYS B O   1 
ATOM   3449 C  CB  . LYS B 2 178 ? 7.990   -5.278  -48.916 1.00 18.91  ? 178 LYS B CB  1 
ATOM   3450 C  CG  . LYS B 2 178 ? 8.520   -5.417  -50.316 1.00 28.45  ? 178 LYS B CG  1 
ATOM   3451 C  CD  . LYS B 2 178 ? 7.456   -4.946  -51.261 1.00 31.29  ? 178 LYS B CD  1 
ATOM   3452 C  CE  . LYS B 2 178 ? 7.930   -4.918  -52.681 1.00 41.17  ? 178 LYS B CE  1 
ATOM   3453 N  NZ  . LYS B 2 178 ? 7.039   -4.076  -53.523 1.00 49.18  ? 178 LYS B NZ  1 
ATOM   3454 N  N   . GLN B 2 179 ? 8.523   -4.323  -45.855 1.00 17.44  ? 179 GLN B N   1 
ATOM   3455 C  CA  . GLN B 2 179 ? 7.819   -3.721  -44.713 1.00 16.48  ? 179 GLN B CA  1 
ATOM   3456 C  C   . GLN B 2 179 ? 7.664   -4.662  -43.527 1.00 20.00  ? 179 GLN B C   1 
ATOM   3457 O  O   . GLN B 2 179 ? 6.647   -4.650  -42.822 1.00 19.50  ? 179 GLN B O   1 
ATOM   3458 C  CB  . GLN B 2 179 ? 6.470   -3.126  -45.155 1.00 17.00  ? 179 GLN B CB  1 
ATOM   3459 C  CG  . GLN B 2 179 ? 6.648   -2.042  -46.216 1.00 28.92  ? 179 GLN B CG  1 
ATOM   3460 C  CD  . GLN B 2 179 ? 5.378   -1.758  -46.962 1.00 56.83  ? 179 GLN B CD  1 
ATOM   3461 O  OE1 . GLN B 2 179 ? 4.786   -2.635  -47.595 1.00 57.15  ? 179 GLN B OE1 1 
ATOM   3462 N  NE2 . GLN B 2 179 ? 4.947   -0.513  -46.930 1.00 49.23  ? 179 GLN B NE2 1 
ATOM   3463 N  N   . SER B 2 180 ? 8.732   -5.428  -43.283 1.00 16.10  ? 180 SER B N   1 
ATOM   3464 C  CA  . SER B 2 180 ? 8.864   -6.364  -42.187 1.00 15.41  ? 180 SER B CA  1 
ATOM   3465 C  C   . SER B 2 180 ? 10.031  -5.895  -41.328 1.00 18.58  ? 180 SER B C   1 
ATOM   3466 O  O   . SER B 2 180 ? 10.754  -4.978  -41.716 1.00 19.05  ? 180 SER B O   1 
ATOM   3467 C  CB  . SER B 2 180 ? 9.135   -7.762  -42.726 1.00 17.22  ? 180 SER B CB  1 
ATOM   3468 O  OG  . SER B 2 180 ? 10.442  -7.840  -43.266 1.00 20.38  ? 180 SER B OG  1 
ATOM   3469 N  N   . SER B 2 181 ? 10.225  -6.529  -40.186 1.00 15.18  ? 181 SER B N   1 
ATOM   3470 C  CA  . SER B 2 181 ? 11.323  -6.213  -39.268 1.00 15.72  ? 181 SER B CA  1 
ATOM   3471 C  C   . SER B 2 181 ? 12.702  -6.508  -39.880 1.00 21.16  ? 181 SER B C   1 
ATOM   3472 O  O   . SER B 2 181 ? 13.640  -5.784  -39.576 1.00 20.43  ? 181 SER B O   1 
ATOM   3473 C  CB  . SER B 2 181 ? 11.147  -6.951  -37.942 1.00 16.55  ? 181 SER B CB  1 
ATOM   3474 O  OG  . SER B 2 181 ? 11.147  -8.354  -38.152 1.00 23.66  ? 181 SER B OG  1 
ATOM   3475 N  N   . VAL B 2 182 ? 12.818  -7.550  -40.760 1.00 20.20  ? 182 VAL B N   1 
ATOM   3476 C  CA  . VAL B 2 182 ? 14.088  -7.926  -41.421 1.00 20.42  ? 182 VAL B CA  1 
ATOM   3477 C  C   . VAL B 2 182 ? 14.494  -6.784  -42.325 1.00 26.74  ? 182 VAL B C   1 
ATOM   3478 O  O   . VAL B 2 182 ? 15.636  -6.333  -42.261 1.00 27.31  ? 182 VAL B O   1 
ATOM   3479 C  CB  . VAL B 2 182 ? 14.027  -9.274  -42.190 1.00 23.36  ? 182 VAL B CB  1 
ATOM   3480 C  CG1 . VAL B 2 182 ? 15.393  -9.646  -42.765 1.00 22.35  ? 182 VAL B CG1 1 
ATOM   3481 C  CG2 . VAL B 2 182 ? 13.500  -10.395 -41.299 1.00 23.12  ? 182 VAL B CG2 1 
ATOM   3482 N  N   . ASP B 2 183 ? 13.528  -6.281  -43.107 1.00 24.19  ? 183 ASP B N   1 
ATOM   3483 C  CA  . ASP B 2 183 ? 13.662  -5.140  -43.997 1.00 24.67  ? 183 ASP B CA  1 
ATOM   3484 C  C   . ASP B 2 183 ? 14.198  -3.892  -43.227 1.00 28.98  ? 183 ASP B C   1 
ATOM   3485 O  O   . ASP B 2 183 ? 15.211  -3.346  -43.652 1.00 28.72  ? 183 ASP B O   1 
ATOM   3486 C  CB  . ASP B 2 183 ? 12.304  -4.879  -44.686 1.00 26.66  ? 183 ASP B CB  1 
ATOM   3487 C  CG  . ASP B 2 183 ? 12.234  -3.748  -45.712 1.00 35.72  ? 183 ASP B CG  1 
ATOM   3488 O  OD1 . ASP B 2 183 ? 13.284  -3.397  -46.285 1.00 37.22  ? 183 ASP B OD1 1 
ATOM   3489 O  OD2 . ASP B 2 183 ? 11.110  -3.248  -45.973 1.00 38.54  ? 183 ASP B OD2 1 
ATOM   3490 N  N   . ILE B 2 184 ? 13.591  -3.498  -42.067 1.00 25.92  ? 184 ILE B N   1 
ATOM   3491 C  CA  . ILE B 2 184 ? 14.075  -2.332  -41.298 1.00 26.42  ? 184 ILE B CA  1 
ATOM   3492 C  C   . ILE B 2 184 ? 15.407  -2.598  -40.611 1.00 29.28  ? 184 ILE B C   1 
ATOM   3493 O  O   . ILE B 2 184 ? 16.138  -1.649  -40.343 1.00 27.42  ? 184 ILE B O   1 
ATOM   3494 C  CB  . ILE B 2 184 ? 13.081  -1.650  -40.305 1.00 30.37  ? 184 ILE B CB  1 
ATOM   3495 C  CG1 . ILE B 2 184 ? 12.164  -2.666  -39.612 1.00 31.10  ? 184 ILE B CG1 1 
ATOM   3496 C  CG2 . ILE B 2 184 ? 12.305  -0.524  -41.027 1.00 32.31  ? 184 ILE B CG2 1 
ATOM   3497 C  CD1 . ILE B 2 184 ? 11.132  -2.109  -38.532 1.00 46.41  ? 184 ILE B CD1 1 
ATOM   3498 N  N   . TYR B 2 185 ? 15.730  -3.871  -40.337 1.00 27.00  ? 185 TYR B N   1 
ATOM   3499 C  CA  . TYR B 2 185 ? 17.006  -4.231  -39.722 1.00 26.19  ? 185 TYR B CA  1 
ATOM   3500 C  C   . TYR B 2 185 ? 18.179  -3.932  -40.681 1.00 28.60  ? 185 TYR B C   1 
ATOM   3501 O  O   . TYR B 2 185 ? 19.170  -3.355  -40.252 1.00 27.59  ? 185 TYR B O   1 
ATOM   3502 C  CB  . TYR B 2 185 ? 16.997  -5.696  -39.251 1.00 26.62  ? 185 TYR B CB  1 
ATOM   3503 C  CG  . TYR B 2 185 ? 18.358  -6.222  -38.852 1.00 27.31  ? 185 TYR B CG  1 
ATOM   3504 C  CD1 . TYR B 2 185 ? 19.038  -5.699  -37.750 1.00 29.08  ? 185 TYR B CD1 1 
ATOM   3505 C  CD2 . TYR B 2 185 ? 18.980  -7.224  -39.589 1.00 27.35  ? 185 TYR B CD2 1 
ATOM   3506 C  CE1 . TYR B 2 185 ? 20.300  -6.173  -37.389 1.00 30.17  ? 185 TYR B CE1 1 
ATOM   3507 C  CE2 . TYR B 2 185 ? 20.230  -7.722  -39.224 1.00 28.21  ? 185 TYR B CE2 1 
ATOM   3508 C  CZ  . TYR B 2 185 ? 20.885  -7.198  -38.122 1.00 36.87  ? 185 TYR B CZ  1 
ATOM   3509 O  OH  . TYR B 2 185 ? 22.123  -7.702  -37.788 1.00 39.56  ? 185 TYR B OH  1 
ATOM   3510 N  N   . PHE B 2 186 ? 18.039  -4.299  -41.970 1.00 24.47  ? 186 PHE B N   1 
ATOM   3511 C  CA  . PHE B 2 186 ? 19.036  -4.061  -43.004 1.00 24.41  ? 186 PHE B CA  1 
ATOM   3512 C  C   . PHE B 2 186 ? 19.096  -2.582  -43.413 1.00 31.88  ? 186 PHE B C   1 
ATOM   3513 O  O   . PHE B 2 186 ? 20.173  -2.091  -43.770 1.00 32.05  ? 186 PHE B O   1 
ATOM   3514 C  CB  . PHE B 2 186 ? 18.794  -4.979  -44.215 1.00 25.39  ? 186 PHE B CB  1 
ATOM   3515 C  CG  . PHE B 2 186 ? 19.368  -6.372  -44.047 1.00 26.26  ? 186 PHE B CG  1 
ATOM   3516 C  CD1 . PHE B 2 186 ? 18.668  -7.356  -43.354 1.00 28.01  ? 186 PHE B CD1 1 
ATOM   3517 C  CD2 . PHE B 2 186 ? 20.600  -6.708  -44.604 1.00 27.04  ? 186 PHE B CD2 1 
ATOM   3518 C  CE1 . PHE B 2 186 ? 19.207  -8.638  -43.194 1.00 28.49  ? 186 PHE B CE1 1 
ATOM   3519 C  CE2 . PHE B 2 186 ? 21.123  -8.002  -44.469 1.00 28.62  ? 186 PHE B CE2 1 
ATOM   3520 C  CZ  . PHE B 2 186 ? 20.428  -8.953  -43.759 1.00 26.44  ? 186 PHE B CZ  1 
ATOM   3521 N  N   . ARG B 2 187 ? 17.948  -1.876  -43.349 1.00 29.23  ? 187 ARG B N   1 
ATOM   3522 C  CA  . ARG B 2 187 ? 17.849  -0.471  -43.707 1.00 29.33  ? 187 ARG B CA  1 
ATOM   3523 C  C   . ARG B 2 187 ? 18.618  0.414   -42.755 1.00 34.63  ? 187 ARG B C   1 
ATOM   3524 O  O   . ARG B 2 187 ? 19.351  1.284   -43.206 1.00 34.65  ? 187 ARG B O   1 
ATOM   3525 C  CB  . ARG B 2 187 ? 16.378  -0.033  -43.724 1.00 32.06  ? 187 ARG B CB  1 
ATOM   3526 C  CG  . ARG B 2 187 ? 16.126  1.290   -44.473 1.00 43.51  ? 187 ARG B CG  1 
ATOM   3527 C  CD  . ARG B 2 187 ? 14.662  1.691   -44.514 1.00 52.02  ? 187 ARG B CD  1 
ATOM   3528 N  NE  . ARG B 2 187 ? 13.811  0.665   -45.130 1.00 71.89  ? 187 ARG B NE  1 
ATOM   3529 C  CZ  . ARG B 2 187 ? 12.506  0.529   -44.898 1.00 90.84  ? 187 ARG B CZ  1 
ATOM   3530 N  NH1 . ARG B 2 187 ? 11.880  1.361   -44.074 1.00 83.93  ? 187 ARG B NH1 1 
ATOM   3531 N  NH2 . ARG B 2 187 ? 11.819  -0.442  -45.486 1.00 73.08  ? 187 ARG B NH2 1 
ATOM   3532 N  N   . ARG B 2 188 ? 18.457  0.194   -41.446 1.00 31.61  ? 188 ARG B N   1 
ATOM   3533 C  CA  . ARG B 2 188 ? 19.018  1.061   -40.424 1.00 31.86  ? 188 ARG B CA  1 
ATOM   3534 C  C   . ARG B 2 188 ? 20.470  0.685   -39.990 1.00 36.28  ? 188 ARG B C   1 
ATOM   3535 O  O   . ARG B 2 188 ? 21.124  1.485   -39.312 1.00 36.24  ? 188 ARG B O   1 
ATOM   3536 C  CB  . ARG B 2 188 ? 18.021  1.171   -39.234 1.00 31.26  ? 188 ARG B CB  1 
ATOM   3537 C  CG  . ARG B 2 188 ? 18.468  0.628   -37.874 1.00 48.72  ? 188 ARG B CG  1 
ATOM   3538 C  CD  . ARG B 2 188 ? 18.746  1.739   -36.862 1.00 67.47  ? 188 ARG B CD  1 
ATOM   3539 N  NE  . ARG B 2 188 ? 19.263  1.235   -35.582 1.00 81.75  ? 188 ARG B NE  1 
ATOM   3540 C  CZ  . ARG B 2 188 ? 18.510  0.801   -34.570 1.00 98.13  ? 188 ARG B CZ  1 
ATOM   3541 N  NH1 . ARG B 2 188 ? 17.185  0.777   -34.677 1.00 89.31  ? 188 ARG B NH1 1 
ATOM   3542 N  NH2 . ARG B 2 188 ? 19.076  0.375   -33.451 1.00 82.06  ? 188 ARG B NH2 1 
ATOM   3543 N  N   . GLN B 2 189 ? 20.978  -0.474  -40.409 1.00 32.81  ? 189 GLN B N   1 
ATOM   3544 C  CA  . GLN B 2 189 ? 22.327  -0.906  -40.054 1.00 33.17  ? 189 GLN B CA  1 
ATOM   3545 C  C   . GLN B 2 189 ? 23.336  -0.572  -41.173 1.00 39.65  ? 189 GLN B C   1 
ATOM   3546 O  O   . GLN B 2 189 ? 23.319  -1.206  -42.232 1.00 39.40  ? 189 GLN B O   1 
ATOM   3547 C  CB  . GLN B 2 189 ? 22.325  -2.401  -39.696 1.00 34.51  ? 189 GLN B CB  1 
ATOM   3548 C  CG  . GLN B 2 189 ? 22.573  -2.690  -38.228 1.00 41.94  ? 189 GLN B CG  1 
ATOM   3549 C  CD  . GLN B 2 189 ? 23.996  -3.110  -37.945 1.00 66.81  ? 189 GLN B CD  1 
ATOM   3550 O  OE1 . GLN B 2 189 ? 24.236  -4.154  -37.324 1.00 62.37  ? 189 GLN B OE1 1 
ATOM   3551 N  NE2 . GLN B 2 189 ? 24.976  -2.312  -38.383 1.00 58.17  ? 189 GLN B NE2 1 
ATOM   3552 N  N   . VAL B 2 190 ? 24.184  0.458   -40.937 1.00 38.17  ? 190 VAL B N   1 
ATOM   3553 C  CA  . VAL B 2 190 ? 25.211  0.979   -41.866 1.00 39.30  ? 190 VAL B CA  1 
ATOM   3554 C  C   . VAL B 2 190 ? 26.198  -0.126  -42.360 1.00 41.20  ? 190 VAL B C   1 
ATOM   3555 O  O   . VAL B 2 190 ? 26.629  -0.069  -43.515 1.00 39.64  ? 190 VAL B O   1 
ATOM   3556 C  CB  . VAL B 2 190 ? 25.968  2.228   -41.312 1.00 45.08  ? 190 VAL B CB  1 
ATOM   3557 C  CG1 . VAL B 2 190 ? 26.591  3.030   -42.451 1.00 45.21  ? 190 VAL B CG1 1 
ATOM   3558 C  CG2 . VAL B 2 190 ? 25.048  3.134   -40.485 1.00 45.23  ? 190 VAL B CG2 1 
ATOM   3559 N  N   . GLU B 2 191 ? 26.525  -1.129  -41.504 1.00 36.87  ? 191 GLU B N   1 
ATOM   3560 C  CA  . GLU B 2 191 ? 27.355  -2.301  -41.865 1.00 36.29  ? 191 GLU B CA  1 
ATOM   3561 C  C   . GLU B 2 191 ? 26.655  -3.156  -42.955 1.00 36.44  ? 191 GLU B C   1 
ATOM   3562 O  O   . GLU B 2 191 ? 27.314  -3.883  -43.700 1.00 35.02  ? 191 GLU B O   1 
ATOM   3563 C  CB  . GLU B 2 191 ? 27.542  -3.239  -40.654 1.00 38.12  ? 191 GLU B CB  1 
ATOM   3564 C  CG  . GLU B 2 191 ? 28.332  -2.705  -39.473 1.00 57.00  ? 191 GLU B CG  1 
ATOM   3565 C  CD  . GLU B 2 191 ? 28.062  -3.458  -38.178 1.00 96.46  ? 191 GLU B CD  1 
ATOM   3566 O  OE1 . GLU B 2 191 ? 28.292  -4.691  -38.139 1.00 94.82  ? 191 GLU B OE1 1 
ATOM   3567 O  OE2 . GLU B 2 191 ? 27.601  -2.815  -37.205 1.00 96.09  ? 191 GLU B OE2 1 
ATOM   3568 N  N   . LEU B 2 192 ? 25.311  -3.097  -43.004 1.00 31.53  ? 192 LEU B N   1 
ATOM   3569 C  CA  . LEU B 2 192 ? 24.487  -3.923  -43.888 1.00 29.18  ? 192 LEU B CA  1 
ATOM   3570 C  C   . LEU B 2 192 ? 24.008  -3.210  -45.136 1.00 27.81  ? 192 LEU B C   1 
ATOM   3571 O  O   . LEU B 2 192 ? 23.296  -3.803  -45.941 1.00 26.59  ? 192 LEU B O   1 
ATOM   3572 C  CB  . LEU B 2 192 ? 23.304  -4.498  -43.071 1.00 28.89  ? 192 LEU B CB  1 
ATOM   3573 C  CG  . LEU B 2 192 ? 23.685  -5.484  -41.960 1.00 33.06  ? 192 LEU B CG  1 
ATOM   3574 C  CD1 . LEU B 2 192 ? 22.461  -5.920  -41.181 1.00 33.34  ? 192 LEU B CD1 1 
ATOM   3575 C  CD2 . LEU B 2 192 ? 24.425  -6.698  -42.506 1.00 32.27  ? 192 LEU B CD2 1 
ATOM   3576 N  N   . SER B 2 193 ? 24.422  -1.952  -45.300 1.00 24.04  ? 193 SER B N   1 
ATOM   3577 C  CA  . SER B 2 193 ? 24.085  -1.025  -46.388 1.00 23.98  ? 193 SER B CA  1 
ATOM   3578 C  C   . SER B 2 193 ? 24.185  -1.586  -47.827 1.00 26.65  ? 193 SER B C   1 
ATOM   3579 O  O   . SER B 2 193 ? 23.282  -1.361  -48.635 1.00 26.22  ? 193 SER B O   1 
ATOM   3580 C  CB  . SER B 2 193 ? 24.942  0.228   -46.270 1.00 28.30  ? 193 SER B CB  1 
ATOM   3581 O  OG  . SER B 2 193 ? 24.356  1.269   -47.028 1.00 43.35  ? 193 SER B OG  1 
ATOM   3582 N  N   . THR B 2 194 ? 25.288  -2.276  -48.154 1.00 22.87  ? 194 THR B N   1 
ATOM   3583 C  CA  . THR B 2 194 ? 25.510  -2.861  -49.487 1.00 22.16  ? 194 THR B CA  1 
ATOM   3584 C  C   . THR B 2 194 ? 24.460  -3.943  -49.776 1.00 24.66  ? 194 THR B C   1 
ATOM   3585 O  O   . THR B 2 194 ? 23.946  -4.017  -50.883 1.00 24.66  ? 194 THR B O   1 
ATOM   3586 C  CB  . THR B 2 194 ? 26.944  -3.382  -49.582 1.00 32.21  ? 194 THR B CB  1 
ATOM   3587 O  OG1 . THR B 2 194 ? 27.859  -2.304  -49.339 1.00 32.02  ? 194 THR B OG1 1 
ATOM   3588 C  CG2 . THR B 2 194 ? 27.250  -4.044  -50.919 1.00 33.12  ? 194 THR B CG2 1 
ATOM   3589 N  N   . MET B 2 195 ? 24.110  -4.732  -48.760 1.00 21.05  ? 195 MET B N   1 
ATOM   3590 C  CA  . MET B 2 195 ? 23.103  -5.776  -48.835 1.00 21.57  ? 195 MET B CA  1 
ATOM   3591 C  C   . MET B 2 195 ? 21.706  -5.192  -49.009 1.00 25.79  ? 195 MET B C   1 
ATOM   3592 O  O   . MET B 2 195 ? 20.950  -5.679  -49.848 1.00 24.84  ? 195 MET B O   1 
ATOM   3593 C  CB  . MET B 2 195 ? 23.182  -6.693  -47.602 1.00 24.20  ? 195 MET B CB  1 
ATOM   3594 C  CG  . MET B 2 195 ? 24.451  -7.534  -47.559 1.00 27.43  ? 195 MET B CG  1 
ATOM   3595 S  SD  . MET B 2 195 ? 24.432  -8.816  -46.282 1.00 31.29  ? 195 MET B SD  1 
ATOM   3596 C  CE  . MET B 2 195 ? 23.147  -9.898  -46.903 1.00 28.21  ? 195 MET B CE  1 
ATOM   3597 N  N   . TYR B 2 196 ? 21.383  -4.117  -48.265 1.00 24.72  ? 196 TYR B N   1 
ATOM   3598 C  CA  . TYR B 2 196 ? 20.078  -3.455  -48.353 1.00 25.77  ? 196 TYR B CA  1 
ATOM   3599 C  C   . TYR B 2 196 ? 19.859  -2.889  -49.743 1.00 30.24  ? 196 TYR B C   1 
ATOM   3600 O  O   . TYR B 2 196 ? 18.776  -3.060  -50.303 1.00 30.93  ? 196 TYR B O   1 
ATOM   3601 C  CB  . TYR B 2 196 ? 19.887  -2.404  -47.239 1.00 28.10  ? 196 TYR B CB  1 
ATOM   3602 C  CG  . TYR B 2 196 ? 18.593  -1.621  -47.346 1.00 31.19  ? 196 TYR B CG  1 
ATOM   3603 C  CD1 . TYR B 2 196 ? 17.393  -2.147  -46.865 1.00 32.95  ? 196 TYR B CD1 1 
ATOM   3604 C  CD2 . TYR B 2 196 ? 18.562  -0.362  -47.948 1.00 32.23  ? 196 TYR B CD2 1 
ATOM   3605 C  CE1 . TYR B 2 196 ? 16.192  -1.453  -47.011 1.00 33.91  ? 196 TYR B CE1 1 
ATOM   3606 C  CE2 . TYR B 2 196 ? 17.373  0.353   -48.070 1.00 33.26  ? 196 TYR B CE2 1 
ATOM   3607 C  CZ  . TYR B 2 196 ? 16.190  -0.197  -47.603 1.00 44.38  ? 196 TYR B CZ  1 
ATOM   3608 O  OH  . TYR B 2 196 ? 15.022  0.523   -47.714 1.00 51.23  ? 196 TYR B OH  1 
ATOM   3609 N  N   . ARG B 2 197 ? 20.905  -2.286  -50.325 1.00 27.25  ? 197 ARG B N   1 
ATOM   3610 C  CA  . ARG B 2 197 ? 20.889  -1.738  -51.686 1.00 27.34  ? 197 ARG B CA  1 
ATOM   3611 C  C   . ARG B 2 197 ? 20.532  -2.799  -52.745 1.00 32.14  ? 197 ARG B C   1 
ATOM   3612 O  O   . ARG B 2 197 ? 19.708  -2.520  -53.617 1.00 32.31  ? 197 ARG B O   1 
ATOM   3613 C  CB  . ARG B 2 197 ? 22.202  -1.009  -51.993 1.00 26.38  ? 197 ARG B CB  1 
ATOM   3614 C  CG  . ARG B 2 197 ? 22.183  0.429   -51.449 1.00 31.48  ? 197 ARG B CG  1 
ATOM   3615 C  CD  . ARG B 2 197 ? 23.350  1.267   -51.941 1.00 33.90  ? 197 ARG B CD  1 
ATOM   3616 N  NE  . ARG B 2 197 ? 24.610  0.967   -51.254 1.00 35.19  ? 197 ARG B NE  1 
ATOM   3617 C  CZ  . ARG B 2 197 ? 24.977  1.514   -50.100 1.00 47.67  ? 197 ARG B CZ  1 
ATOM   3618 N  NH1 . ARG B 2 197 ? 24.188  2.396   -49.494 1.00 31.76  ? 197 ARG B NH1 1 
ATOM   3619 N  NH2 . ARG B 2 197 ? 26.146  1.202   -49.552 1.00 36.28  ? 197 ARG B NH2 1 
ATOM   3620 N  N   . HIS B 2 198 ? 21.072  -4.032  -52.613 1.00 28.94  ? 198 HIS B N   1 
ATOM   3621 C  CA  . HIS B 2 198 ? 20.733  -5.167  -53.485 1.00 28.61  ? 198 HIS B CA  1 
ATOM   3622 C  C   . HIS B 2 198 ? 19.272  -5.616  -53.203 1.00 32.24  ? 198 HIS B C   1 
ATOM   3623 O  O   . HIS B 2 198 ? 18.454  -5.587  -54.121 1.00 33.92  ? 198 HIS B O   1 
ATOM   3624 C  CB  . HIS B 2 198 ? 21.742  -6.331  -53.291 1.00 29.53  ? 198 HIS B CB  1 
ATOM   3625 C  CG  . HIS B 2 198 ? 21.441  -7.566  -54.098 1.00 32.86  ? 198 HIS B CG  1 
ATOM   3626 N  ND1 . HIS B 2 198 ? 21.969  -7.751  -55.367 1.00 34.30  ? 198 HIS B ND1 1 
ATOM   3627 C  CD2 . HIS B 2 198 ? 20.680  -8.642  -53.786 1.00 34.49  ? 198 HIS B CD2 1 
ATOM   3628 C  CE1 . HIS B 2 198 ? 21.518  -8.924  -55.778 1.00 33.49  ? 198 HIS B CE1 1 
ATOM   3629 N  NE2 . HIS B 2 198 ? 20.731  -9.491  -54.867 1.00 34.13  ? 198 HIS B NE2 1 
ATOM   3630 N  N   . MET B 2 199 ? 18.942  -5.965  -51.930 1.00 27.18  ? 199 MET B N   1 
ATOM   3631 C  CA  . MET B 2 199 ? 17.618  -6.428  -51.470 1.00 27.08  ? 199 MET B CA  1 
ATOM   3632 C  C   . MET B 2 199 ? 16.414  -5.533  -51.840 1.00 29.79  ? 199 MET B C   1 
ATOM   3633 O  O   . MET B 2 199 ? 15.381  -6.072  -52.222 1.00 28.72  ? 199 MET B O   1 
ATOM   3634 C  CB  . MET B 2 199 ? 17.607  -6.666  -49.949 1.00 29.59  ? 199 MET B CB  1 
ATOM   3635 C  CG  . MET B 2 199 ? 18.307  -7.915  -49.516 1.00 33.89  ? 199 MET B CG  1 
ATOM   3636 S  SD  . MET B 2 199 ? 18.949  -7.788  -47.818 1.00 39.07  ? 199 MET B SD  1 
ATOM   3637 C  CE  . MET B 2 199 ? 17.674  -8.688  -46.940 1.00 36.04  ? 199 MET B CE  1 
ATOM   3638 N  N   . GLU B 2 200 ? 16.532  -4.191  -51.695 1.00 26.75  ? 200 GLU B N   1 
ATOM   3639 C  CA  . GLU B 2 200 ? 15.458  -3.211  -51.970 1.00 27.22  ? 200 GLU B CA  1 
ATOM   3640 C  C   . GLU B 2 200 ? 14.894  -3.245  -53.440 1.00 31.63  ? 200 GLU B C   1 
ATOM   3641 O  O   . GLU B 2 200 ? 13.797  -2.747  -53.687 1.00 30.31  ? 200 GLU B O   1 
ATOM   3642 C  CB  . GLU B 2 200 ? 15.892  -1.780  -51.573 1.00 28.73  ? 200 GLU B CB  1 
ATOM   3643 C  CG  . GLU B 2 200 ? 16.966  -1.197  -52.478 1.00 41.30  ? 200 GLU B CG  1 
ATOM   3644 C  CD  . GLU B 2 200 ? 17.369  0.250   -52.277 1.00 61.41  ? 200 GLU B CD  1 
ATOM   3645 O  OE1 . GLU B 2 200 ? 16.924  0.879   -51.290 1.00 35.65  ? 200 GLU B OE1 1 
ATOM   3646 O  OE2 . GLU B 2 200 ? 18.152  0.750   -53.115 1.00 67.37  ? 200 GLU B OE2 1 
ATOM   3647 N  N   . LYS B 2 201 ? 15.635  -3.838  -54.380 1.00 30.07  ? 201 LYS B N   1 
ATOM   3648 C  CA  . LYS B 2 201 ? 15.197  -4.007  -55.765 1.00 31.03  ? 201 LYS B CA  1 
ATOM   3649 C  C   . LYS B 2 201 ? 14.479  -5.356  -55.925 1.00 36.78  ? 201 LYS B C   1 
ATOM   3650 O  O   . LYS B 2 201 ? 13.862  -5.595  -56.966 1.00 38.28  ? 201 LYS B O   1 
ATOM   3651 C  CB  . LYS B 2 201 ? 16.421  -4.011  -56.719 1.00 33.32  ? 201 LYS B CB  1 
ATOM   3652 C  CG  . LYS B 2 201 ? 17.280  -2.751  -56.689 1.00 38.43  ? 201 LYS B CG  1 
ATOM   3653 C  CD  . LYS B 2 201 ? 18.562  -2.884  -57.515 1.00 43.79  ? 201 LYS B CD  1 
ATOM   3654 C  CE  . LYS B 2 201 ? 19.662  -3.618  -56.782 1.00 61.64  ? 201 LYS B CE  1 
ATOM   3655 N  NZ  . LYS B 2 201 ? 20.982  -3.469  -57.450 1.00 76.48  ? 201 LYS B NZ  1 
ATOM   3656 N  N   . HIS B 2 202 ? 14.604  -6.256  -54.931 1.00 32.46  ? 202 HIS B N   1 
ATOM   3657 C  CA  . HIS B 2 202 ? 14.102  -7.620  -55.052 1.00 32.22  ? 202 HIS B CA  1 
ATOM   3658 C  C   . HIS B 2 202 ? 13.154  -8.112  -53.969 1.00 32.43  ? 202 HIS B C   1 
ATOM   3659 O  O   . HIS B 2 202 ? 12.623  -9.216  -54.125 1.00 31.83  ? 202 HIS B O   1 
ATOM   3660 C  CB  . HIS B 2 202 ? 15.291  -8.594  -55.143 1.00 34.00  ? 202 HIS B CB  1 
ATOM   3661 C  CG  . HIS B 2 202 ? 16.177  -8.356  -56.323 1.00 38.87  ? 202 HIS B CG  1 
ATOM   3662 N  ND1 . HIS B 2 202 ? 17.474  -7.876  -56.170 1.00 41.16  ? 202 HIS B ND1 1 
ATOM   3663 C  CD2 . HIS B 2 202 ? 15.922  -8.517  -57.643 1.00 41.65  ? 202 HIS B CD2 1 
ATOM   3664 C  CE1 . HIS B 2 202 ? 17.967  -7.784  -57.395 1.00 41.00  ? 202 HIS B CE1 1 
ATOM   3665 N  NE2 . HIS B 2 202 ? 17.071  -8.155  -58.314 1.00 41.54  ? 202 HIS B NE2 1 
ATOM   3666 N  N   . ASN B 2 203 ? 12.965  -7.354  -52.867 1.00 26.43  ? 203 ASN B N   1 
ATOM   3667 C  CA  . ASN B 2 203 ? 12.110  -7.791  -51.761 1.00 25.20  ? 203 ASN B CA  1 
ATOM   3668 C  C   . ASN B 2 203 ? 10.724  -8.335  -52.220 1.00 29.17  ? 203 ASN B C   1 
ATOM   3669 O  O   . ASN B 2 203 ? 10.172  -7.895  -53.240 1.00 29.01  ? 203 ASN B O   1 
ATOM   3670 C  CB  . ASN B 2 203 ? 11.974  -6.686  -50.704 1.00 22.98  ? 203 ASN B CB  1 
ATOM   3671 C  CG  . ASN B 2 203 ? 13.215  -6.475  -49.852 1.00 30.72  ? 203 ASN B CG  1 
ATOM   3672 O  OD1 . ASN B 2 203 ? 14.077  -7.348  -49.731 1.00 16.33  ? 203 ASN B OD1 1 
ATOM   3673 N  ND2 . ASN B 2 203 ? 13.347  -5.296  -49.244 1.00 18.26  ? 203 ASN B ND2 1 
ATOM   3674 N  N   . TYR B 2 204 ? 10.190  -9.321  -51.486 1.00 24.67  ? 204 TYR B N   1 
ATOM   3675 C  CA  . TYR B 2 204 ? 8.877   -9.911  -51.807 1.00 23.12  ? 204 TYR B CA  1 
ATOM   3676 C  C   . TYR B 2 204 ? 7.739   -9.340  -50.937 1.00 24.03  ? 204 TYR B C   1 
ATOM   3677 O  O   . TYR B 2 204 ? 7.997   -8.769  -49.870 1.00 22.98  ? 204 TYR B O   1 
ATOM   3678 C  CB  . TYR B 2 204 ? 8.943   -11.452 -51.755 1.00 23.88  ? 204 TYR B CB  1 
ATOM   3679 C  CG  . TYR B 2 204 ? 9.596   -12.047 -52.988 1.00 24.96  ? 204 TYR B CG  1 
ATOM   3680 C  CD1 . TYR B 2 204 ? 10.975  -11.983 -53.172 1.00 26.91  ? 204 TYR B CD1 1 
ATOM   3681 C  CD2 . TYR B 2 204 ? 8.833   -12.652 -53.983 1.00 25.03  ? 204 TYR B CD2 1 
ATOM   3682 C  CE1 . TYR B 2 204 ? 11.574  -12.467 -54.335 1.00 27.43  ? 204 TYR B CE1 1 
ATOM   3683 C  CE2 . TYR B 2 204 ? 9.424   -13.166 -55.133 1.00 25.81  ? 204 TYR B CE2 1 
ATOM   3684 C  CZ  . TYR B 2 204 ? 10.797  -13.071 -55.304 1.00 34.66  ? 204 TYR B CZ  1 
ATOM   3685 O  OH  . TYR B 2 204 ? 11.399  -13.566 -56.437 1.00 40.33  ? 204 TYR B OH  1 
ATOM   3686 N  N   . GLU B 2 205 ? 6.500   -9.451  -51.423 1.00 19.44  ? 205 GLU B N   1 
ATOM   3687 C  CA  . GLU B 2 205 ? 5.304   -8.983  -50.729 1.00 20.17  ? 205 GLU B CA  1 
ATOM   3688 C  C   . GLU B 2 205 ? 4.991   -9.829  -49.507 1.00 25.47  ? 205 GLU B C   1 
ATOM   3689 O  O   . GLU B 2 205 ? 4.473   -9.319  -48.514 1.00 26.70  ? 205 GLU B O   1 
ATOM   3690 C  CB  . GLU B 2 205 ? 4.073   -8.996  -51.666 1.00 21.70  ? 205 GLU B CB  1 
ATOM   3691 C  CG  . GLU B 2 205 ? 4.126   -8.009  -52.831 1.00 31.45  ? 205 GLU B CG  1 
ATOM   3692 C  CD  . GLU B 2 205 ? 4.307   -6.530  -52.539 1.00 52.46  ? 205 GLU B CD  1 
ATOM   3693 O  OE1 . GLU B 2 205 ? 3.892   -6.069  -51.452 1.00 38.79  ? 205 GLU B OE1 1 
ATOM   3694 O  OE2 . GLU B 2 205 ? 4.826   -5.818  -53.428 1.00 56.36  ? 205 GLU B OE2 1 
ATOM   3695 N  N   . SER B 2 206 ? 5.250   -11.126 -49.602 1.00 21.39  ? 206 SER B N   1 
ATOM   3696 C  CA  . SER B 2 206 ? 4.951   -12.062 -48.543 1.00 21.58  ? 206 SER B CA  1 
ATOM   3697 C  C   . SER B 2 206 ? 6.034   -13.144 -48.482 1.00 26.07  ? 206 SER B C   1 
ATOM   3698 O  O   . SER B 2 206 ? 6.680   -13.426 -49.487 1.00 25.55  ? 206 SER B O   1 
ATOM   3699 C  CB  . SER B 2 206 ? 3.581   -12.697 -48.790 1.00 24.57  ? 206 SER B CB  1 
ATOM   3700 O  OG  . SER B 2 206 ? 3.657   -13.734 -49.756 1.00 33.09  ? 206 SER B OG  1 
ATOM   3701 N  N   . ALA B 2 207 ? 6.196   -13.769 -47.303 1.00 23.07  ? 207 ALA B N   1 
ATOM   3702 C  CA  . ALA B 2 207 ? 7.139   -14.857 -47.055 1.00 21.81  ? 207 ALA B CA  1 
ATOM   3703 C  C   . ALA B 2 207 ? 6.857   -16.069 -47.942 1.00 25.89  ? 207 ALA B C   1 
ATOM   3704 O  O   . ALA B 2 207 ? 7.803   -16.645 -48.452 1.00 27.62  ? 207 ALA B O   1 
ATOM   3705 C  CB  . ALA B 2 207 ? 7.115   -15.246 -45.582 1.00 21.95  ? 207 ALA B CB  1 
ATOM   3706 N  N   . ALA B 2 208 ? 5.581   -16.437 -48.163 1.00 21.81  ? 208 ALA B N   1 
ATOM   3707 C  CA  . ALA B 2 208 ? 5.215   -17.587 -49.020 1.00 21.81  ? 208 ALA B CA  1 
ATOM   3708 C  C   . ALA B 2 208 ? 5.707   -17.452 -50.461 1.00 28.89  ? 208 ALA B C   1 
ATOM   3709 O  O   . ALA B 2 208 ? 6.254   -18.421 -50.992 1.00 29.61  ? 208 ALA B O   1 
ATOM   3710 C  CB  . ALA B 2 208 ? 3.714   -17.835 -48.997 1.00 21.52  ? 208 ALA B CB  1 
ATOM   3711 N  N   . GLU B 2 209 ? 5.525   -16.256 -51.086 1.00 26.29  ? 209 GLU B N   1 
ATOM   3712 C  CA  . GLU B 2 209 ? 5.962   -15.948 -52.461 1.00 26.18  ? 209 GLU B CA  1 
ATOM   3713 C  C   . GLU B 2 209 ? 7.480   -16.081 -52.569 1.00 28.56  ? 209 GLU B C   1 
ATOM   3714 O  O   . GLU B 2 209 ? 7.974   -16.621 -53.554 1.00 27.61  ? 209 GLU B O   1 
ATOM   3715 C  CB  . GLU B 2 209 ? 5.560   -14.519 -52.873 1.00 27.84  ? 209 GLU B CB  1 
ATOM   3716 C  CG  . GLU B 2 209 ? 4.085   -14.316 -53.183 1.00 41.97  ? 209 GLU B CG  1 
ATOM   3717 C  CD  . GLU B 2 209 ? 3.733   -12.880 -53.525 1.00 68.31  ? 209 GLU B CD  1 
ATOM   3718 O  OE1 . GLU B 2 209 ? 4.282   -12.345 -54.517 1.00 68.67  ? 209 GLU B OE1 1 
ATOM   3719 O  OE2 . GLU B 2 209 ? 2.923   -12.280 -52.782 1.00 59.94  ? 209 GLU B OE2 1 
ATOM   3720 N  N   . ALA B 2 210 ? 8.212   -15.578 -51.550 1.00 24.12  ? 210 ALA B N   1 
ATOM   3721 C  CA  . ALA B 2 210 ? 9.665   -15.666 -51.484 1.00 23.50  ? 210 ALA B CA  1 
ATOM   3722 C  C   . ALA B 2 210 ? 10.098  -17.146 -51.377 1.00 26.29  ? 210 ALA B C   1 
ATOM   3723 O  O   . ALA B 2 210 ? 10.943  -17.577 -52.160 1.00 24.99  ? 210 ALA B O   1 
ATOM   3724 C  CB  . ALA B 2 210 ? 10.185  -14.855 -50.313 1.00 23.96  ? 210 ALA B CB  1 
ATOM   3725 N  N   . ILE B 2 211 ? 9.438   -17.943 -50.496 1.00 23.49  ? 211 ILE B N   1 
ATOM   3726 C  CA  . ILE B 2 211 ? 9.725   -19.380 -50.348 1.00 23.31  ? 211 ILE B CA  1 
ATOM   3727 C  C   . ILE B 2 211 ? 9.482   -20.105 -51.691 1.00 26.12  ? 211 ILE B C   1 
ATOM   3728 O  O   . ILE B 2 211 ? 10.318  -20.911 -52.116 1.00 24.58  ? 211 ILE B O   1 
ATOM   3729 C  CB  . ILE B 2 211 ? 8.991   -20.012 -49.133 1.00 26.45  ? 211 ILE B CB  1 
ATOM   3730 C  CG1 . ILE B 2 211 ? 9.549   -19.432 -47.813 1.00 27.43  ? 211 ILE B CG1 1 
ATOM   3731 C  CG2 . ILE B 2 211 ? 9.140   -21.545 -49.117 1.00 27.73  ? 211 ILE B CG2 1 
ATOM   3732 C  CD1 . ILE B 2 211 ? 8.544   -19.416 -46.576 1.00 32.78  ? 211 ILE B CD1 1 
ATOM   3733 N  N   . GLN B 2 212 ? 8.396   -19.726 -52.398 1.00 23.05  ? 212 GLN B N   1 
ATOM   3734 C  CA  . GLN B 2 212 ? 8.042   -20.284 -53.708 1.00 23.14  ? 212 GLN B CA  1 
ATOM   3735 C  C   . GLN B 2 212 ? 9.112   -19.972 -54.771 1.00 27.78  ? 212 GLN B C   1 
ATOM   3736 O  O   . GLN B 2 212 ? 9.517   -20.863 -55.516 1.00 27.81  ? 212 GLN B O   1 
ATOM   3737 C  CB  . GLN B 2 212 ? 6.645   -19.792 -54.148 1.00 23.77  ? 212 GLN B CB  1 
ATOM   3738 C  CG  . GLN B 2 212 ? 6.064   -20.527 -55.356 1.00 34.37  ? 212 GLN B CG  1 
ATOM   3739 C  CD  . GLN B 2 212 ? 6.081   -22.035 -55.210 1.00 51.29  ? 212 GLN B CD  1 
ATOM   3740 O  OE1 . GLN B 2 212 ? 6.864   -22.733 -55.858 1.00 45.37  ? 212 GLN B OE1 1 
ATOM   3741 N  NE2 . GLN B 2 212 ? 5.257   -22.567 -54.325 1.00 43.61  ? 212 GLN B NE2 1 
ATOM   3742 N  N   . ALA B 2 213 ? 9.577   -18.711 -54.799 1.00 24.32  ? 213 ALA B N   1 
ATOM   3743 C  CA  . ALA B 2 213 ? 10.596  -18.178 -55.694 1.00 23.98  ? 213 ALA B CA  1 
ATOM   3744 C  C   . ALA B 2 213 ? 11.946  -18.915 -55.560 1.00 29.58  ? 213 ALA B C   1 
ATOM   3745 O  O   . ALA B 2 213 ? 12.630  -19.093 -56.569 1.00 29.82  ? 213 ALA B O   1 
ATOM   3746 C  CB  . ALA B 2 213 ? 10.768  -16.694 -55.437 1.00 24.44  ? 213 ALA B CB  1 
ATOM   3747 N  N   . VAL B 2 214 ? 12.318  -19.339 -54.330 1.00 26.09  ? 214 VAL B N   1 
ATOM   3748 C  CA  . VAL B 2 214 ? 13.534  -20.116 -54.029 1.00 26.68  ? 214 VAL B CA  1 
ATOM   3749 C  C   . VAL B 2 214 ? 13.400  -21.531 -54.592 1.00 33.03  ? 214 VAL B C   1 
ATOM   3750 O  O   . VAL B 2 214 ? 14.369  -22.062 -55.140 1.00 33.87  ? 214 VAL B O   1 
ATOM   3751 C  CB  . VAL B 2 214 ? 13.926  -20.109 -52.514 1.00 30.14  ? 214 VAL B CB  1 
ATOM   3752 C  CG1 . VAL B 2 214 ? 15.166  -20.976 -52.243 1.00 29.43  ? 214 VAL B CG1 1 
ATOM   3753 C  CG2 . VAL B 2 214 ? 14.147  -18.676 -52.009 1.00 29.60  ? 214 VAL B CG2 1 
ATOM   3754 N  N   . ARG B 2 215 ? 12.200  -22.131 -54.482 1.00 30.40  ? 215 ARG B N   1 
ATOM   3755 C  CA  . ARG B 2 215 ? 11.924  -23.461 -55.051 1.00 30.41  ? 215 ARG B CA  1 
ATOM   3756 C  C   . ARG B 2 215 ? 11.971  -23.396 -56.581 1.00 33.65  ? 215 ARG B C   1 
ATOM   3757 O  O   . ARG B 2 215 ? 12.570  -24.272 -57.208 1.00 34.61  ? 215 ARG B O   1 
ATOM   3758 C  CB  . ARG B 2 215 ? 10.556  -23.978 -54.615 1.00 30.12  ? 215 ARG B CB  1 
ATOM   3759 C  CG  . ARG B 2 215 ? 10.397  -24.105 -53.115 1.00 36.10  ? 215 ARG B CG  1 
ATOM   3760 C  CD  . ARG B 2 215 ? 9.178   -24.932 -52.824 1.00 39.95  ? 215 ARG B CD  1 
ATOM   3761 N  NE  . ARG B 2 215 ? 9.500   -26.354 -52.722 1.00 36.43  ? 215 ARG B NE  1 
ATOM   3762 C  CZ  . ARG B 2 215 ? 8.590   -27.315 -52.637 1.00 45.22  ? 215 ARG B CZ  1 
ATOM   3763 N  NH1 . ARG B 2 215 ? 7.296   -27.017 -52.669 1.00 32.32  ? 215 ARG B NH1 1 
ATOM   3764 N  NH2 . ARG B 2 215 ? 8.965   -28.582 -52.505 1.00 28.01  ? 215 ARG B NH2 1 
ATOM   3765 N  N   . ASP B 2 216 ? 11.405  -22.320 -57.162 1.00 28.13  ? 216 ASP B N   1 
ATOM   3766 C  CA  . ASP B 2 216 ? 11.332  -22.066 -58.606 1.00 27.25  ? 216 ASP B CA  1 
ATOM   3767 C  C   . ASP B 2 216 ? 12.604  -21.495 -59.227 1.00 32.09  ? 216 ASP B C   1 
ATOM   3768 O  O   . ASP B 2 216 ? 12.586  -21.161 -60.402 1.00 32.02  ? 216 ASP B O   1 
ATOM   3769 C  CB  . ASP B 2 216 ? 10.138  -21.146 -58.923 1.00 28.55  ? 216 ASP B CB  1 
ATOM   3770 C  CG  . ASP B 2 216 ? 8.772   -21.740 -58.630 1.00 37.96  ? 216 ASP B CG  1 
ATOM   3771 O  OD1 . ASP B 2 216 ? 8.678   -22.986 -58.478 1.00 34.75  ? 216 ASP B OD1 1 
ATOM   3772 O  OD2 . ASP B 2 216 ? 7.789   -20.961 -58.564 1.00 49.85  ? 216 ASP B OD2 1 
ATOM   3773 N  N   . ASN B 2 217 ? 13.690  -21.353 -58.442 1.00 30.59  ? 217 ASN B N   1 
ATOM   3774 C  CA  . ASN B 2 217 ? 15.015  -20.840 -58.845 1.00 30.94  ? 217 ASN B CA  1 
ATOM   3775 C  C   . ASN B 2 217 ? 15.023  -19.335 -59.266 1.00 36.10  ? 217 ASN B C   1 
ATOM   3776 O  O   . ASN B 2 217 ? 16.030  -18.859 -59.809 1.00 36.70  ? 217 ASN B O   1 
ATOM   3777 C  CB  . ASN B 2 217 ? 15.648  -21.737 -59.924 1.00 31.99  ? 217 ASN B CB  1 
ATOM   3778 C  CG  . ASN B 2 217 ? 15.643  -23.206 -59.551 1.00 73.82  ? 217 ASN B CG  1 
ATOM   3779 O  OD1 . ASN B 2 217 ? 16.488  -23.683 -58.786 1.00 73.78  ? 217 ASN B OD1 1 
ATOM   3780 N  ND2 . ASN B 2 217 ? 14.651  -23.948 -60.033 1.00 68.61  ? 217 ASN B ND2 1 
ATOM   3781 N  N   . LYS B 2 218 ? 13.924  -18.591 -58.979 1.00 31.37  ? 218 LYS B N   1 
ATOM   3782 C  CA  . LYS B 2 218 ? 13.780  -17.164 -59.286 1.00 31.10  ? 218 LYS B CA  1 
ATOM   3783 C  C   . LYS B 2 218 ? 14.517  -16.283 -58.247 1.00 34.78  ? 218 LYS B C   1 
ATOM   3784 O  O   . LYS B 2 218 ? 14.949  -15.175 -58.569 1.00 34.90  ? 218 LYS B O   1 
ATOM   3785 C  CB  . LYS B 2 218 ? 12.282  -16.758 -59.382 1.00 34.19  ? 218 LYS B CB  1 
ATOM   3786 C  CG  . LYS B 2 218 ? 11.375  -17.653 -60.257 1.00 49.19  ? 218 LYS B CG  1 
ATOM   3787 C  CD  . LYS B 2 218 ? 11.687  -17.606 -61.772 1.00 65.43  ? 218 LYS B CD  1 
ATOM   3788 C  CE  . LYS B 2 218 ? 11.039  -16.455 -62.519 1.00 75.86  ? 218 LYS B CE  1 
ATOM   3789 N  NZ  . LYS B 2 218 ? 11.731  -16.169 -63.805 1.00 79.65  ? 218 LYS B NZ  1 
ATOM   3790 N  N   . LEU B 2 219 ? 14.595  -16.758 -56.984 1.00 30.24  ? 219 LEU B N   1 
ATOM   3791 C  CA  . LEU B 2 219 ? 15.277  -16.117 -55.852 1.00 27.93  ? 219 LEU B CA  1 
ATOM   3792 C  C   . LEU B 2 219 ? 16.305  -17.139 -55.347 1.00 29.19  ? 219 LEU B C   1 
ATOM   3793 O  O   . LEU B 2 219 ? 15.947  -18.292 -55.131 1.00 27.66  ? 219 LEU B O   1 
ATOM   3794 C  CB  . LEU B 2 219 ? 14.245  -15.757 -54.758 1.00 27.56  ? 219 LEU B CB  1 
ATOM   3795 C  CG  . LEU B 2 219 ? 14.724  -15.070 -53.445 1.00 30.72  ? 219 LEU B CG  1 
ATOM   3796 C  CD1 . LEU B 2 219 ? 15.356  -13.707 -53.705 1.00 29.39  ? 219 LEU B CD1 1 
ATOM   3797 C  CD2 . LEU B 2 219 ? 13.569  -14.933 -52.454 1.00 32.15  ? 219 LEU B CD2 1 
ATOM   3798 N  N   . HIS B 2 220 ? 17.583  -16.746 -55.249 1.00 25.22  ? 220 HIS B N   1 
ATOM   3799 C  CA  . HIS B 2 220 ? 18.653  -17.659 -54.827 1.00 25.73  ? 220 HIS B CA  1 
ATOM   3800 C  C   . HIS B 2 220 ? 18.808  -17.775 -53.311 1.00 25.07  ? 220 HIS B C   1 
ATOM   3801 O  O   . HIS B 2 220 ? 19.303  -18.787 -52.814 1.00 21.93  ? 220 HIS B O   1 
ATOM   3802 C  CB  . HIS B 2 220 ? 19.987  -17.288 -55.495 1.00 28.18  ? 220 HIS B CB  1 
ATOM   3803 C  CG  . HIS B 2 220 ? 19.896  -17.206 -56.987 1.00 33.11  ? 220 HIS B CG  1 
ATOM   3804 N  ND1 . HIS B 2 220 ? 20.141  -16.018 -57.659 1.00 35.69  ? 220 HIS B ND1 1 
ATOM   3805 C  CD2 . HIS B 2 220 ? 19.508  -18.148 -57.885 1.00 35.80  ? 220 HIS B CD2 1 
ATOM   3806 C  CE1 . HIS B 2 220 ? 19.930  -16.281 -58.940 1.00 35.73  ? 220 HIS B CE1 1 
ATOM   3807 N  NE2 . HIS B 2 220 ? 19.538  -17.548 -59.124 1.00 36.06  ? 220 HIS B NE2 1 
ATOM   3808 N  N   . ALA B 2 221 ? 18.390  -16.734 -52.579 1.00 21.22  ? 221 ALA B N   1 
ATOM   3809 C  CA  . ALA B 2 221 ? 18.453  -16.721 -51.126 1.00 20.97  ? 221 ALA B CA  1 
ATOM   3810 C  C   . ALA B 2 221 ? 17.351  -15.855 -50.515 1.00 24.40  ? 221 ALA B C   1 
ATOM   3811 O  O   . ALA B 2 221 ? 17.081  -14.733 -50.969 1.00 23.73  ? 221 ALA B O   1 
ATOM   3812 C  CB  . ALA B 2 221 ? 19.842  -16.296 -50.637 1.00 21.46  ? 221 ALA B CB  1 
ATOM   3813 N  N   . PHE B 2 222 ? 16.681  -16.411 -49.507 1.00 20.17  ? 222 PHE B N   1 
ATOM   3814 C  CA  . PHE B 2 222 ? 15.630  -15.697 -48.796 1.00 19.23  ? 222 PHE B CA  1 
ATOM   3815 C  C   . PHE B 2 222 ? 16.094  -15.491 -47.355 1.00 21.80  ? 222 PHE B C   1 
ATOM   3816 O  O   . PHE B 2 222 ? 16.445  -16.461 -46.674 1.00 20.99  ? 222 PHE B O   1 
ATOM   3817 C  CB  . PHE B 2 222 ? 14.289  -16.461 -48.890 1.00 21.03  ? 222 PHE B CB  1 
ATOM   3818 C  CG  . PHE B 2 222 ? 13.137  -15.890 -48.085 1.00 22.23  ? 222 PHE B CG  1 
ATOM   3819 C  CD1 . PHE B 2 222 ? 12.943  -14.512 -47.991 1.00 24.60  ? 222 PHE B CD1 1 
ATOM   3820 C  CD2 . PHE B 2 222 ? 12.214  -16.724 -47.485 1.00 24.00  ? 222 PHE B CD2 1 
ATOM   3821 C  CE1 . PHE B 2 222 ? 11.887  -13.989 -47.262 1.00 25.17  ? 222 PHE B CE1 1 
ATOM   3822 C  CE2 . PHE B 2 222 ? 11.141  -16.195 -46.770 1.00 27.42  ? 222 PHE B CE2 1 
ATOM   3823 C  CZ  . PHE B 2 222 ? 10.986  -14.830 -46.666 1.00 25.19  ? 222 PHE B CZ  1 
ATOM   3824 N  N   . ILE B 2 223 ? 16.191  -14.220 -46.932 1.00 18.60  ? 223 ILE B N   1 
ATOM   3825 C  CA  . ILE B 2 223 ? 16.597  -13.869 -45.564 1.00 18.39  ? 223 ILE B CA  1 
ATOM   3826 C  C   . ILE B 2 223 ? 15.302  -13.612 -44.789 1.00 21.56  ? 223 ILE B C   1 
ATOM   3827 O  O   . ILE B 2 223 ? 14.499  -12.766 -45.213 1.00 20.87  ? 223 ILE B O   1 
ATOM   3828 C  CB  . ILE B 2 223 ? 17.617  -12.698 -45.486 1.00 21.31  ? 223 ILE B CB  1 
ATOM   3829 C  CG1 . ILE B 2 223 ? 18.899  -13.022 -46.310 1.00 21.74  ? 223 ILE B CG1 1 
ATOM   3830 C  CG2 . ILE B 2 223 ? 17.962  -12.385 -44.013 1.00 20.91  ? 223 ILE B CG2 1 
ATOM   3831 C  CD1 . ILE B 2 223 ? 19.824  -11.828 -46.619 1.00 28.37  ? 223 ILE B CD1 1 
ATOM   3832 N  N   . TRP B 2 224 ? 15.077  -14.394 -43.695 1.00 16.80  ? 224 TRP B N   1 
ATOM   3833 C  CA  . TRP B 2 224 ? 13.857  -14.348 -42.888 1.00 16.24  ? 224 TRP B CA  1 
ATOM   3834 C  C   . TRP B 2 224 ? 14.055  -15.039 -41.528 1.00 19.27  ? 224 TRP B C   1 
ATOM   3835 O  O   . TRP B 2 224 ? 15.158  -15.487 -41.224 1.00 18.42  ? 224 TRP B O   1 
ATOM   3836 C  CB  . TRP B 2 224 ? 12.731  -15.050 -43.678 1.00 15.41  ? 224 TRP B CB  1 
ATOM   3837 C  CG  . TRP B 2 224 ? 11.324  -14.760 -43.243 1.00 17.25  ? 224 TRP B CG  1 
ATOM   3838 C  CD1 . TRP B 2 224 ? 10.358  -15.679 -42.961 1.00 20.14  ? 224 TRP B CD1 1 
ATOM   3839 C  CD2 . TRP B 2 224 ? 10.702  -13.472 -43.108 1.00 17.51  ? 224 TRP B CD2 1 
ATOM   3840 N  NE1 . TRP B 2 224 ? 9.175   -15.052 -42.675 1.00 19.59  ? 224 TRP B NE1 1 
ATOM   3841 C  CE2 . TRP B 2 224 ? 9.358   -13.696 -42.737 1.00 21.37  ? 224 TRP B CE2 1 
ATOM   3842 C  CE3 . TRP B 2 224 ? 11.155  -12.147 -43.242 1.00 19.01  ? 224 TRP B CE3 1 
ATOM   3843 C  CZ2 . TRP B 2 224 ? 8.460   -12.649 -42.494 1.00 21.19  ? 224 TRP B CZ2 1 
ATOM   3844 C  CZ3 . TRP B 2 224 ? 10.280  -11.112 -42.957 1.00 21.05  ? 224 TRP B CZ3 1 
ATOM   3845 C  CH2 . TRP B 2 224 ? 8.944   -11.364 -42.597 1.00 21.85  ? 224 TRP B CH2 1 
ATOM   3846 N  N   . ASP B 2 225 ? 12.971  -15.116 -40.722 1.00 14.66  ? 225 ASP B N   1 
ATOM   3847 C  CA  . ASP B 2 225 ? 12.882  -15.749 -39.416 1.00 14.56  ? 225 ASP B CA  1 
ATOM   3848 C  C   . ASP B 2 225 ? 13.195  -17.246 -39.461 1.00 19.56  ? 225 ASP B C   1 
ATOM   3849 O  O   . ASP B 2 225 ? 12.636  -17.958 -40.302 1.00 19.71  ? 225 ASP B O   1 
ATOM   3850 C  CB  . ASP B 2 225 ? 11.470  -15.530 -38.848 1.00 16.01  ? 225 ASP B CB  1 
ATOM   3851 C  CG  . ASP B 2 225 ? 11.174  -14.081 -38.531 1.00 28.48  ? 225 ASP B CG  1 
ATOM   3852 O  OD1 . ASP B 2 225 ? 12.104  -13.365 -38.050 1.00 31.81  ? 225 ASP B OD1 1 
ATOM   3853 O  OD2 . ASP B 2 225 ? 10.018  -13.661 -38.730 1.00 28.80  ? 225 ASP B OD2 1 
ATOM   3854 N  N   . SER B 2 226 ? 14.054  -17.721 -38.529 1.00 14.81  ? 226 SER B N   1 
ATOM   3855 C  CA  . SER B 2 226 ? 14.468  -19.116 -38.424 1.00 15.14  ? 226 SER B CA  1 
ATOM   3856 C  C   . SER B 2 226 ? 13.351  -20.054 -38.019 1.00 21.10  ? 226 SER B C   1 
ATOM   3857 O  O   . SER B 2 226 ? 13.351  -21.202 -38.459 1.00 21.20  ? 226 SER B O   1 
ATOM   3858 C  CB  . SER B 2 226 ? 15.657  -19.272 -37.483 1.00 19.00  ? 226 SER B CB  1 
ATOM   3859 O  OG  . SER B 2 226 ? 15.396  -18.765 -36.182 1.00 30.02  ? 226 SER B OG  1 
ATOM   3860 N  N   . ALA B 2 227 ? 12.387  -19.578 -37.202 1.00 17.90  ? 227 ALA B N   1 
ATOM   3861 C  CA  . ALA B 2 227 ? 11.253  -20.405 -36.794 1.00 18.63  ? 227 ALA B CA  1 
ATOM   3862 C  C   . ALA B 2 227 ? 10.402  -20.890 -38.024 1.00 24.21  ? 227 ALA B C   1 
ATOM   3863 O  O   . ALA B 2 227 ? 9.868   -22.004 -38.012 1.00 24.06  ? 227 ALA B O   1 
ATOM   3864 C  CB  . ALA B 2 227 ? 10.388  -19.650 -35.794 1.00 19.22  ? 227 ALA B CB  1 
ATOM   3865 N  N   . VAL B 2 228 ? 10.351  -20.067 -39.096 1.00 20.35  ? 228 VAL B N   1 
ATOM   3866 C  CA  . VAL B 2 228 ? 9.613   -20.314 -40.337 1.00 19.23  ? 228 VAL B CA  1 
ATOM   3867 C  C   . VAL B 2 228 ? 10.447  -21.124 -41.332 1.00 24.34  ? 228 VAL B C   1 
ATOM   3868 O  O   . VAL B 2 228 ? 9.953   -22.105 -41.914 1.00 23.65  ? 228 VAL B O   1 
ATOM   3869 C  CB  . VAL B 2 228 ? 9.166   -18.959 -40.936 1.00 22.32  ? 228 VAL B CB  1 
ATOM   3870 C  CG1 . VAL B 2 228 ? 8.582   -19.116 -42.342 1.00 22.26  ? 228 VAL B CG1 1 
ATOM   3871 C  CG2 . VAL B 2 228 ? 8.197   -18.234 -40.008 1.00 21.41  ? 228 VAL B CG2 1 
ATOM   3872 N  N   . LEU B 2 229 ? 11.705  -20.676 -41.551 1.00 20.51  ? 229 LEU B N   1 
ATOM   3873 C  CA  . LEU B 2 229 ? 12.663  -21.248 -42.496 1.00 18.16  ? 229 LEU B CA  1 
ATOM   3874 C  C   . LEU B 2 229 ? 13.105  -22.645 -42.112 1.00 19.33  ? 229 LEU B C   1 
ATOM   3875 O  O   . LEU B 2 229 ? 13.131  -23.530 -42.969 1.00 18.12  ? 229 LEU B O   1 
ATOM   3876 C  CB  . LEU B 2 229 ? 13.843  -20.298 -42.688 1.00 18.07  ? 229 LEU B CB  1 
ATOM   3877 C  CG  . LEU B 2 229 ? 13.531  -18.963 -43.357 1.00 21.98  ? 229 LEU B CG  1 
ATOM   3878 C  CD1 . LEU B 2 229 ? 14.825  -18.241 -43.739 1.00 21.96  ? 229 LEU B CD1 1 
ATOM   3879 C  CD2 . LEU B 2 229 ? 12.601  -19.152 -44.580 1.00 23.99  ? 229 LEU B CD2 1 
ATOM   3880 N  N   . GLU B 2 230 ? 13.382  -22.872 -40.828 1.00 16.30  ? 230 GLU B N   1 
ATOM   3881 C  CA  . GLU B 2 230 ? 13.679  -24.218 -40.312 1.00 17.06  ? 230 GLU B CA  1 
ATOM   3882 C  C   . GLU B 2 230 ? 12.446  -25.127 -40.492 1.00 23.86  ? 230 GLU B C   1 
ATOM   3883 O  O   . GLU B 2 230 ? 12.612  -26.285 -40.879 1.00 24.76  ? 230 GLU B O   1 
ATOM   3884 C  CB  . GLU B 2 230 ? 14.136  -24.187 -38.841 1.00 17.93  ? 230 GLU B CB  1 
ATOM   3885 C  CG  . GLU B 2 230 ? 15.610  -23.817 -38.721 1.00 32.36  ? 230 GLU B CG  1 
ATOM   3886 C  CD  . GLU B 2 230 ? 16.088  -23.284 -37.383 1.00 69.79  ? 230 GLU B CD  1 
ATOM   3887 O  OE1 . GLU B 2 230 ? 15.673  -23.822 -36.331 1.00 78.67  ? 230 GLU B OE1 1 
ATOM   3888 O  OE2 . GLU B 2 230 ? 16.924  -22.351 -37.392 1.00 68.93  ? 230 GLU B OE2 1 
ATOM   3889 N  N   . PHE B 2 231 ? 11.215  -24.585 -40.301 1.00 20.12  ? 231 PHE B N   1 
ATOM   3890 C  CA  . PHE B 2 231 ? 10.012  -25.385 -40.513 1.00 20.85  ? 231 PHE B CA  1 
ATOM   3891 C  C   . PHE B 2 231 ? 9.829   -25.766 -42.004 1.00 27.22  ? 231 PHE B C   1 
ATOM   3892 O  O   . PHE B 2 231 ? 9.509   -26.910 -42.319 1.00 28.13  ? 231 PHE B O   1 
ATOM   3893 C  CB  . PHE B 2 231 ? 8.764   -24.708 -39.924 1.00 22.43  ? 231 PHE B CB  1 
ATOM   3894 C  CG  . PHE B 2 231 ? 7.476   -25.380 -40.363 1.00 24.14  ? 231 PHE B CG  1 
ATOM   3895 C  CD1 . PHE B 2 231 ? 6.994   -26.503 -39.696 1.00 26.96  ? 231 PHE B CD1 1 
ATOM   3896 C  CD2 . PHE B 2 231 ? 6.764   -24.907 -41.464 1.00 24.90  ? 231 PHE B CD2 1 
ATOM   3897 C  CE1 . PHE B 2 231 ? 5.817   -27.133 -40.117 1.00 27.45  ? 231 PHE B CE1 1 
ATOM   3898 C  CE2 . PHE B 2 231 ? 5.601   -25.547 -41.887 1.00 27.24  ? 231 PHE B CE2 1 
ATOM   3899 C  CZ  . PHE B 2 231 ? 5.134   -26.654 -41.211 1.00 25.25  ? 231 PHE B CZ  1 
ATOM   3900 N  N   . GLU B 2 232 ? 10.014  -24.803 -42.900 1.00 24.14  ? 232 GLU B N   1 
ATOM   3901 C  CA  . GLU B 2 232 ? 9.934   -25.003 -44.345 1.00 24.03  ? 232 GLU B CA  1 
ATOM   3902 C  C   . GLU B 2 232 ? 10.932  -26.028 -44.823 1.00 30.29  ? 232 GLU B C   1 
ATOM   3903 O  O   . GLU B 2 232 ? 10.562  -26.868 -45.631 1.00 31.38  ? 232 GLU B O   1 
ATOM   3904 C  CB  . GLU B 2 232 ? 10.157  -23.681 -45.099 1.00 25.09  ? 232 GLU B CB  1 
ATOM   3905 C  CG  . GLU B 2 232 ? 8.971   -22.731 -45.003 1.00 34.69  ? 232 GLU B CG  1 
ATOM   3906 C  CD  . GLU B 2 232 ? 7.674   -23.168 -45.659 1.00 50.24  ? 232 GLU B CD  1 
ATOM   3907 O  OE1 . GLU B 2 232 ? 7.698   -24.095 -46.503 1.00 44.15  ? 232 GLU B OE1 1 
ATOM   3908 O  OE2 . GLU B 2 232 ? 6.628   -22.564 -45.332 1.00 37.26  ? 232 GLU B OE2 1 
ATOM   3909 N  N   . ALA B 2 233 ? 12.192  -25.970 -44.331 1.00 27.12  ? 233 ALA B N   1 
ATOM   3910 C  CA  . ALA B 2 233 ? 13.251  -26.906 -44.714 1.00 26.74  ? 233 ALA B CA  1 
ATOM   3911 C  C   . ALA B 2 233 ? 12.925  -28.301 -44.197 1.00 32.69  ? 233 ALA B C   1 
ATOM   3912 O  O   . ALA B 2 233 ? 13.192  -29.280 -44.887 1.00 34.06  ? 233 ALA B O   1 
ATOM   3913 C  CB  . ALA B 2 233 ? 14.595  -26.438 -44.187 1.00 27.16  ? 233 ALA B CB  1 
ATOM   3914 N  N   . SER B 2 234 ? 12.274  -28.389 -43.030 1.00 29.47  ? 234 SER B N   1 
ATOM   3915 C  CA  . SER B 2 234 ? 11.832  -29.656 -42.444 1.00 29.30  ? 234 SER B CA  1 
ATOM   3916 C  C   . SER B 2 234 ? 10.634  -30.285 -43.215 1.00 32.61  ? 234 SER B C   1 
ATOM   3917 O  O   . SER B 2 234 ? 10.380  -31.487 -43.059 1.00 31.59  ? 234 SER B O   1 
ATOM   3918 C  CB  . SER B 2 234 ? 11.515  -29.486 -40.961 1.00 32.55  ? 234 SER B CB  1 
ATOM   3919 O  OG  . SER B 2 234 ? 10.264  -28.854 -40.747 1.00 43.20  ? 234 SER B OG  1 
ATOM   3920 N  N   . GLN B 2 235 ? 9.957   -29.491 -44.079 1.00 28.63  ? 235 GLN B N   1 
ATOM   3921 C  CA  . GLN B 2 235 ? 8.812   -29.932 -44.876 1.00 29.13  ? 235 GLN B CA  1 
ATOM   3922 C  C   . GLN B 2 235 ? 9.129   -30.129 -46.351 1.00 34.89  ? 235 GLN B C   1 
ATOM   3923 O  O   . GLN B 2 235 ? 8.595   -31.055 -46.945 1.00 35.63  ? 235 GLN B O   1 
ATOM   3924 C  CB  . GLN B 2 235 ? 7.601   -28.987 -44.691 1.00 30.69  ? 235 GLN B CB  1 
ATOM   3925 C  CG  . GLN B 2 235 ? 6.517   -29.490 -43.720 1.00 48.35  ? 235 GLN B CG  1 
ATOM   3926 C  CD  . GLN B 2 235 ? 7.030   -30.139 -42.438 1.00 74.50  ? 235 GLN B CD  1 
ATOM   3927 O  OE1 . GLN B 2 235 ? 7.780   -29.548 -41.648 1.00 71.89  ? 235 GLN B OE1 1 
ATOM   3928 N  NE2 . GLN B 2 235 ? 6.622   -31.375 -42.198 1.00 67.79  ? 235 GLN B NE2 1 
ATOM   3929 N  N   . LYS B 2 236 ? 9.973   -29.269 -46.945 1.00 32.96  ? 236 LYS B N   1 
ATOM   3930 C  CA  . LYS B 2 236 ? 10.392  -29.335 -48.363 1.00 32.95  ? 236 LYS B CA  1 
ATOM   3931 C  C   . LYS B 2 236 ? 11.864  -29.805 -48.426 1.00 38.87  ? 236 LYS B C   1 
ATOM   3932 O  O   . LYS B 2 236 ? 12.742  -29.135 -47.876 1.00 38.16  ? 236 LYS B O   1 
ATOM   3933 C  CB  . LYS B 2 236 ? 10.245  -27.963 -49.061 1.00 34.55  ? 236 LYS B CB  1 
ATOM   3934 C  CG  . LYS B 2 236 ? 9.128   -27.043 -48.535 1.00 43.30  ? 236 LYS B CG  1 
ATOM   3935 C  CD  . LYS B 2 236 ? 7.771   -27.266 -49.191 1.00 43.28  ? 236 LYS B CD  1 
ATOM   3936 C  CE  . LYS B 2 236 ? 6.682   -26.444 -48.547 1.00 43.62  ? 236 LYS B CE  1 
ATOM   3937 N  NZ  . LYS B 2 236 ? 6.719   -25.025 -48.973 1.00 40.61  ? 236 LYS B NZ  1 
ATOM   3938 N  N   . CYS B 2 237 ? 12.126  -30.965 -49.057 1.00 37.27  ? 237 CYS B N   1 
ATOM   3939 C  CA  . CYS B 2 237 ? 13.477  -31.540 -49.156 1.00 38.91  ? 237 CYS B CA  1 
ATOM   3940 C  C   . CYS B 2 237 ? 14.394  -30.840 -50.184 1.00 38.22  ? 237 CYS B C   1 
ATOM   3941 O  O   . CYS B 2 237 ? 15.615  -31.019 -50.129 1.00 37.60  ? 237 CYS B O   1 
ATOM   3942 C  CB  . CYS B 2 237 ? 13.413  -33.044 -49.394 1.00 41.54  ? 237 CYS B CB  1 
ATOM   3943 S  SG  . CYS B 2 237 ? 12.543  -33.949 -48.088 1.00 46.91  ? 237 CYS B SG  1 
ATOM   3944 N  N   . ASP B 2 238 ? 13.817  -30.027 -51.085 1.00 31.64  ? 238 ASP B N   1 
ATOM   3945 C  CA  . ASP B 2 238 ? 14.559  -29.234 -52.067 1.00 30.03  ? 238 ASP B CA  1 
ATOM   3946 C  C   . ASP B 2 238 ? 15.068  -27.902 -51.461 1.00 31.95  ? 238 ASP B C   1 
ATOM   3947 O  O   . ASP B 2 238 ? 15.787  -27.157 -52.130 1.00 29.87  ? 238 ASP B O   1 
ATOM   3948 C  CB  . ASP B 2 238 ? 13.709  -28.978 -53.317 1.00 31.18  ? 238 ASP B CB  1 
ATOM   3949 C  CG  . ASP B 2 238 ? 12.425  -28.211 -53.083 1.00 42.44  ? 238 ASP B CG  1 
ATOM   3950 O  OD1 . ASP B 2 238 ? 11.733  -28.501 -52.081 1.00 43.82  ? 238 ASP B OD1 1 
ATOM   3951 O  OD2 . ASP B 2 238 ? 12.064  -27.384 -53.947 1.00 48.34  ? 238 ASP B OD2 1 
ATOM   3952 N  N   . LEU B 2 239 ? 14.705  -27.620 -50.192 1.00 28.33  ? 239 LEU B N   1 
ATOM   3953 C  CA  . LEU B 2 239 ? 15.131  -26.412 -49.486 1.00 27.86  ? 239 LEU B CA  1 
ATOM   3954 C  C   . LEU B 2 239 ? 15.978  -26.701 -48.266 1.00 31.96  ? 239 LEU B C   1 
ATOM   3955 O  O   . LEU B 2 239 ? 15.734  -27.686 -47.567 1.00 32.53  ? 239 LEU B O   1 
ATOM   3956 C  CB  . LEU B 2 239 ? 13.921  -25.575 -49.062 1.00 27.78  ? 239 LEU B CB  1 
ATOM   3957 C  CG  . LEU B 2 239 ? 12.964  -25.098 -50.152 1.00 31.58  ? 239 LEU B CG  1 
ATOM   3958 C  CD1 . LEU B 2 239 ? 11.744  -24.459 -49.534 1.00 32.29  ? 239 LEU B CD1 1 
ATOM   3959 C  CD2 . LEU B 2 239 ? 13.634  -24.150 -51.090 1.00 31.09  ? 239 LEU B CD2 1 
ATOM   3960 N  N   . VAL B 2 240 ? 16.961  -25.821 -47.993 1.00 28.12  ? 240 VAL B N   1 
ATOM   3961 C  CA  . VAL B 2 240 ? 17.834  -25.877 -46.807 1.00 27.45  ? 240 VAL B CA  1 
ATOM   3962 C  C   . VAL B 2 240 ? 18.120  -24.479 -46.266 1.00 29.25  ? 240 VAL B C   1 
ATOM   3963 O  O   . VAL B 2 240 ? 18.045  -23.494 -47.015 1.00 27.25  ? 240 VAL B O   1 
ATOM   3964 C  CB  . VAL B 2 240 ? 19.166  -26.682 -46.975 1.00 31.92  ? 240 VAL B CB  1 
ATOM   3965 C  CG1 . VAL B 2 240 ? 18.917  -28.173 -47.205 1.00 32.52  ? 240 VAL B CG1 1 
ATOM   3966 C  CG2 . VAL B 2 240 ? 20.070  -26.095 -48.053 1.00 31.27  ? 240 VAL B CG2 1 
ATOM   3967 N  N   . THR B 2 241 ? 18.471  -24.402 -44.963 1.00 26.06  ? 241 THR B N   1 
ATOM   3968 C  CA  . THR B 2 241 ? 18.896  -23.152 -44.356 1.00 26.46  ? 241 THR B CA  1 
ATOM   3969 C  C   . THR B 2 241 ? 20.395  -23.209 -44.317 1.00 34.86  ? 241 THR B C   1 
ATOM   3970 O  O   . THR B 2 241 ? 20.975  -24.296 -44.324 1.00 33.97  ? 241 THR B O   1 
ATOM   3971 C  CB  . THR B 2 241 ? 18.239  -22.820 -43.003 1.00 28.47  ? 241 THR B CB  1 
ATOM   3972 O  OG1 . THR B 2 241 ? 18.668  -23.739 -42.011 1.00 31.57  ? 241 THR B OG1 1 
ATOM   3973 C  CG2 . THR B 2 241 ? 16.729  -22.747 -43.077 1.00 21.44  ? 241 THR B CG2 1 
ATOM   3974 N  N   . THR B 2 242 ? 21.027  -22.052 -44.351 1.00 36.09  ? 242 THR B N   1 
ATOM   3975 C  CA  . THR B 2 242 ? 22.469  -21.990 -44.395 1.00 37.74  ? 242 THR B CA  1 
ATOM   3976 C  C   . THR B 2 242 ? 22.956  -21.315 -43.146 1.00 43.59  ? 242 THR B C   1 
ATOM   3977 O  O   . THR B 2 242 ? 22.469  -20.229 -42.776 1.00 40.84  ? 242 THR B O   1 
ATOM   3978 C  CB  . THR B 2 242 ? 22.956  -21.407 -45.743 1.00 52.30  ? 242 THR B CB  1 
ATOM   3979 O  OG1 . THR B 2 242 ? 24.269  -21.882 -46.009 1.00 57.42  ? 242 THR B OG1 1 
ATOM   3980 C  CG2 . THR B 2 242 ? 22.916  -19.894 -45.805 1.00 50.61  ? 242 THR B CG2 1 
ATOM   3981 N  N   . GLY B 2 243 ? 23.894  -22.005 -42.493 1.00 43.38  ? 243 GLY B N   1 
ATOM   3982 C  CA  . GLY B 2 243 ? 24.467  -21.593 -41.222 1.00 44.59  ? 243 GLY B CA  1 
ATOM   3983 C  C   . GLY B 2 243 ? 23.424  -21.689 -40.121 1.00 50.30  ? 243 GLY B C   1 
ATOM   3984 O  O   . GLY B 2 243 ? 22.380  -22.348 -40.277 1.00 50.68  ? 243 GLY B O   1 
ATOM   3985 N  N   . GLU B 2 244 ? 23.700  -21.035 -39.004 1.00 45.26  ? 244 GLU B N   1 
ATOM   3986 C  CA  . GLU B 2 244 ? 22.758  -21.007 -37.899 1.00 44.12  ? 244 GLU B CA  1 
ATOM   3987 C  C   . GLU B 2 244 ? 22.151  -19.594 -37.921 1.00 44.28  ? 244 GLU B C   1 
ATOM   3988 O  O   . GLU B 2 244 ? 21.856  -19.071 -39.001 1.00 43.80  ? 244 GLU B O   1 
ATOM   3989 C  CB  . GLU B 2 244 ? 23.493  -21.275 -36.588 1.00 45.11  ? 244 GLU B CB  1 
ATOM   3990 N  N   . LEU B 2 245 ? 21.989  -18.977 -36.752 1.00 37.22  ? 245 LEU B N   1 
ATOM   3991 C  CA  . LEU B 2 245 ? 21.458  -17.639 -36.648 1.00 35.45  ? 245 LEU B CA  1 
ATOM   3992 C  C   . LEU B 2 245 ? 22.578  -16.650 -36.779 1.00 35.33  ? 245 LEU B C   1 
ATOM   3993 O  O   . LEU B 2 245 ? 23.643  -16.869 -36.209 1.00 35.41  ? 245 LEU B O   1 
ATOM   3994 C  CB  . LEU B 2 245 ? 20.757  -17.434 -35.293 1.00 35.59  ? 245 LEU B CB  1 
ATOM   3995 C  CG  . LEU B 2 245 ? 19.622  -18.391 -34.937 1.00 39.78  ? 245 LEU B CG  1 
ATOM   3996 C  CD1 . LEU B 2 245 ? 18.849  -17.877 -33.753 1.00 39.92  ? 245 LEU B CD1 1 
ATOM   3997 C  CD2 . LEU B 2 245 ? 18.704  -18.603 -36.088 1.00 39.11  ? 245 LEU B CD2 1 
ATOM   3998 N  N   . PHE B 2 246 ? 22.344  -15.546 -37.502 1.00 28.70  ? 246 PHE B N   1 
ATOM   3999 C  CA  . PHE B 2 246 ? 23.351  -14.496 -37.610 1.00 27.16  ? 246 PHE B CA  1 
ATOM   4000 C  C   . PHE B 2 246 ? 22.923  -13.294 -36.780 1.00 30.78  ? 246 PHE B C   1 
ATOM   4001 O  O   . PHE B 2 246 ? 23.710  -12.387 -36.531 1.00 31.29  ? 246 PHE B O   1 
ATOM   4002 C  CB  . PHE B 2 246 ? 23.657  -14.127 -39.073 1.00 27.91  ? 246 PHE B CB  1 
ATOM   4003 C  CG  . PHE B 2 246 ? 22.523  -13.537 -39.869 1.00 28.17  ? 246 PHE B CG  1 
ATOM   4004 C  CD1 . PHE B 2 246 ? 22.178  -12.195 -39.731 1.00 29.79  ? 246 PHE B CD1 1 
ATOM   4005 C  CD2 . PHE B 2 246 ? 21.827  -14.308 -40.795 1.00 28.49  ? 246 PHE B CD2 1 
ATOM   4006 C  CE1 . PHE B 2 246 ? 21.128  -11.650 -40.472 1.00 30.26  ? 246 PHE B CE1 1 
ATOM   4007 C  CE2 . PHE B 2 246 ? 20.794  -13.753 -41.553 1.00 30.52  ? 246 PHE B CE2 1 
ATOM   4008 C  CZ  . PHE B 2 246 ? 20.461  -12.424 -41.395 1.00 28.36  ? 246 PHE B CZ  1 
ATOM   4009 N  N   . PHE B 2 247 ? 21.667  -13.303 -36.341 1.00 26.90  ? 247 PHE B N   1 
ATOM   4010 C  CA  . PHE B 2 247 ? 21.068  -12.247 -35.531 1.00 26.24  ? 247 PHE B CA  1 
ATOM   4011 C  C   . PHE B 2 247 ? 19.937  -12.893 -34.747 1.00 31.45  ? 247 PHE B C   1 
ATOM   4012 O  O   . PHE B 2 247 ? 19.194  -13.688 -35.326 1.00 33.19  ? 247 PHE B O   1 
ATOM   4013 C  CB  . PHE B 2 247 ? 20.560  -11.140 -36.453 1.00 27.83  ? 247 PHE B CB  1 
ATOM   4014 C  CG  . PHE B 2 247 ? 19.899  -9.981  -35.774 1.00 29.91  ? 247 PHE B CG  1 
ATOM   4015 C  CD1 . PHE B 2 247 ? 20.655  -9.040  -35.072 1.00 33.38  ? 247 PHE B CD1 1 
ATOM   4016 C  CD2 . PHE B 2 247 ? 18.519  -9.804  -35.854 1.00 31.71  ? 247 PHE B CD2 1 
ATOM   4017 C  CE1 . PHE B 2 247 ? 20.032  -7.969  -34.416 1.00 34.56  ? 247 PHE B CE1 1 
ATOM   4018 C  CE2 . PHE B 2 247 ? 17.900  -8.727  -35.217 1.00 34.53  ? 247 PHE B CE2 1 
ATOM   4019 C  CZ  . PHE B 2 247 ? 18.660  -7.815  -34.505 1.00 33.12  ? 247 PHE B CZ  1 
ATOM   4020 N  N   . ARG B 2 248 ? 19.866  -12.649 -33.423 1.00 26.16  ? 248 ARG B N   1 
ATOM   4021 C  CA  . ARG B 2 248 ? 18.841  -13.230 -32.543 1.00 25.23  ? 248 ARG B CA  1 
ATOM   4022 C  C   . ARG B 2 248 ? 17.690  -12.249 -32.388 1.00 26.22  ? 248 ARG B C   1 
ATOM   4023 O  O   . ARG B 2 248 ? 17.923  -11.051 -32.269 1.00 25.58  ? 248 ARG B O   1 
ATOM   4024 C  CB  . ARG B 2 248 ? 19.403  -13.524 -31.138 1.00 26.04  ? 248 ARG B CB  1 
ATOM   4025 C  CG  . ARG B 2 248 ? 20.437  -14.632 -31.025 1.00 30.27  ? 248 ARG B CG  1 
ATOM   4026 C  CD  . ARG B 2 248 ? 21.010  -14.575 -29.621 1.00 41.75  ? 248 ARG B CD  1 
ATOM   4027 N  NE  . ARG B 2 248 ? 22.097  -15.528 -29.396 1.00 51.86  ? 248 ARG B NE  1 
ATOM   4028 C  CZ  . ARG B 2 248 ? 21.922  -16.766 -28.946 1.00 68.01  ? 248 ARG B CZ  1 
ATOM   4029 N  NH1 . ARG B 2 248 ? 20.703  -17.210 -28.662 1.00 56.59  ? 248 ARG B NH1 1 
ATOM   4030 N  NH2 . ARG B 2 248 ? 22.964  -17.565 -28.764 1.00 54.79  ? 248 ARG B NH2 1 
ATOM   4031 N  N   . SER B 2 249 ? 16.457  -12.760 -32.358 1.00 21.68  ? 249 SER B N   1 
ATOM   4032 C  CA  . SER B 2 249 ? 15.241  -11.959 -32.177 1.00 21.62  ? 249 SER B CA  1 
ATOM   4033 C  C   . SER B 2 249 ? 14.143  -12.815 -31.576 1.00 23.56  ? 249 SER B C   1 
ATOM   4034 O  O   . SER B 2 249 ? 14.268  -14.024 -31.518 1.00 25.24  ? 249 SER B O   1 
ATOM   4035 C  CB  . SER B 2 249 ? 14.787  -11.320 -33.497 1.00 27.27  ? 249 SER B CB  1 
ATOM   4036 O  OG  . SER B 2 249 ? 14.517  -12.271 -34.515 1.00 36.80  ? 249 SER B OG  1 
ATOM   4037 N  N   . GLY B 2 250 ? 13.098  -12.189 -31.091 1.00 18.97  ? 250 GLY B N   1 
ATOM   4038 C  CA  . GLY B 2 250 ? 11.967  -12.906 -30.509 1.00 18.73  ? 250 GLY B CA  1 
ATOM   4039 C  C   . GLY B 2 250 ? 10.629  -12.313 -30.905 1.00 20.25  ? 250 GLY B C   1 
ATOM   4040 O  O   . GLY B 2 250 ? 10.555  -11.148 -31.297 1.00 20.41  ? 250 GLY B O   1 
ATOM   4041 N  N   . PHE B 2 251 ? 9.570   -13.108 -30.795 1.00 14.69  ? 251 PHE B N   1 
ATOM   4042 C  CA  . PHE B 2 251 ? 8.193   -12.687 -31.094 1.00 12.93  ? 251 PHE B CA  1 
ATOM   4043 C  C   . PHE B 2 251 ? 7.464   -12.379 -29.811 1.00 18.60  ? 251 PHE B C   1 
ATOM   4044 O  O   . PHE B 2 251 ? 7.563   -13.131 -28.840 1.00 17.38  ? 251 PHE B O   1 
ATOM   4045 C  CB  . PHE B 2 251 ? 7.438   -13.783 -31.844 1.00 12.69  ? 251 PHE B CB  1 
ATOM   4046 C  CG  . PHE B 2 251 ? 8.085   -14.228 -33.127 1.00 13.02  ? 251 PHE B CG  1 
ATOM   4047 C  CD1 . PHE B 2 251 ? 8.704   -13.309 -33.970 1.00 14.87  ? 251 PHE B CD1 1 
ATOM   4048 C  CD2 . PHE B 2 251 ? 8.033   -15.555 -33.522 1.00 14.61  ? 251 PHE B CD2 1 
ATOM   4049 C  CE1 . PHE B 2 251 ? 9.273   -13.719 -35.175 1.00 15.92  ? 251 PHE B CE1 1 
ATOM   4050 C  CE2 . PHE B 2 251 ? 8.616   -15.965 -34.724 1.00 17.40  ? 251 PHE B CE2 1 
ATOM   4051 C  CZ  . PHE B 2 251 ? 9.223   -15.044 -35.543 1.00 15.00  ? 251 PHE B CZ  1 
ATOM   4052 N  N   . GLY B 2 252 ? 6.735   -11.279 -29.815 1.00 17.40  ? 252 GLY B N   1 
ATOM   4053 C  CA  . GLY B 2 252 ? 5.921   -10.886 -28.673 1.00 16.98  ? 252 GLY B CA  1 
ATOM   4054 C  C   . GLY B 2 252 ? 4.505   -10.572 -29.099 1.00 19.45  ? 252 GLY B C   1 
ATOM   4055 O  O   . GLY B 2 252 ? 4.256   -10.387 -30.288 1.00 18.05  ? 252 GLY B O   1 
ATOM   4056 N  N   . ILE B 2 253 ? 3.563   -10.527 -28.139 1.00 16.52  ? 253 ILE B N   1 
ATOM   4057 C  CA  . ILE B 2 253 ? 2.181   -10.089 -28.391 1.00 16.27  ? 253 ILE B CA  1 
ATOM   4058 C  C   . ILE B 2 253 ? 2.237   -8.552  -28.366 1.00 19.56  ? 253 ILE B C   1 
ATOM   4059 O  O   . ILE B 2 253 ? 2.941   -7.985  -27.527 1.00 18.75  ? 253 ILE B O   1 
ATOM   4060 C  CB  . ILE B 2 253 ? 1.209   -10.595 -27.296 1.00 19.74  ? 253 ILE B CB  1 
ATOM   4061 C  CG1 . ILE B 2 253 ? 1.223   -12.152 -27.152 1.00 20.40  ? 253 ILE B CG1 1 
ATOM   4062 C  CG2 . ILE B 2 253 ? -0.214  -10.035 -27.489 1.00 19.72  ? 253 ILE B CG2 1 
ATOM   4063 C  CD1 . ILE B 2 253 ? 0.753   -13.030 -28.361 1.00 26.72  ? 253 ILE B CD1 1 
ATOM   4064 N  N   . GLY B 2 254 ? 1.490   -7.904  -29.257 1.00 16.31  ? 254 GLY B N   1 
ATOM   4065 C  CA  . GLY B 2 254 ? 1.442   -6.452  -29.347 1.00 16.05  ? 254 GLY B CA  1 
ATOM   4066 C  C   . GLY B 2 254 ? 0.130   -5.850  -28.912 1.00 23.02  ? 254 GLY B C   1 
ATOM   4067 O  O   . GLY B 2 254 ? -0.936  -6.295  -29.340 1.00 24.03  ? 254 GLY B O   1 
ATOM   4068 N  N   . MET B 2 255 ? 0.193   -4.846  -28.037 1.00 21.67  ? 255 MET B N   1 
ATOM   4069 C  CA  . MET B 2 255 ? -0.987  -4.118  -27.560 1.00 22.72  ? 255 MET B CA  1 
ATOM   4070 C  C   . MET B 2 255 ? -0.657  -2.631  -27.524 1.00 25.49  ? 255 MET B C   1 
ATOM   4071 O  O   . MET B 2 255 ? 0.522   -2.245  -27.526 1.00 24.26  ? 255 MET B O   1 
ATOM   4072 C  CB  . MET B 2 255 ? -1.394  -4.554  -26.138 1.00 26.27  ? 255 MET B CB  1 
ATOM   4073 C  CG  . MET B 2 255 ? -1.729  -6.033  -25.991 1.00 31.88  ? 255 MET B CG  1 
ATOM   4074 S  SD  . MET B 2 255 ? -1.085  -6.725  -24.436 1.00 38.31  ? 255 MET B SD  1 
ATOM   4075 C  CE  . MET B 2 255 ? 0.713   -6.871  -24.850 1.00 34.20  ? 255 MET B CE  1 
ATOM   4076 N  N   . ARG B 2 256 ? -1.689  -1.791  -27.434 1.00 23.07  ? 256 ARG B N   1 
ATOM   4077 C  CA  . ARG B 2 256 ? -1.482  -0.352  -27.269 1.00 23.23  ? 256 ARG B CA  1 
ATOM   4078 C  C   . ARG B 2 256 ? -0.933  -0.101  -25.847 1.00 29.39  ? 256 ARG B C   1 
ATOM   4079 O  O   . ARG B 2 256 ? -1.151  -0.921  -24.946 1.00 28.63  ? 256 ARG B O   1 
ATOM   4080 C  CB  . ARG B 2 256 ? -2.781  0.424   -27.520 1.00 19.54  ? 256 ARG B CB  1 
ATOM   4081 C  CG  . ARG B 2 256 ? -3.054  0.641   -29.013 1.00 27.66  ? 256 ARG B CG  1 
ATOM   4082 C  CD  . ARG B 2 256 ? -4.230  1.572   -29.256 1.00 22.91  ? 256 ARG B CD  1 
ATOM   4083 N  NE  . ARG B 2 256 ? -5.494  1.030   -28.739 1.00 23.81  ? 256 ARG B NE  1 
ATOM   4084 C  CZ  . ARG B 2 256 ? -6.281  0.206   -29.422 1.00 38.07  ? 256 ARG B CZ  1 
ATOM   4085 N  NH1 . ARG B 2 256 ? -5.931  -0.204  -30.635 1.00 25.78  ? 256 ARG B NH1 1 
ATOM   4086 N  NH2 . ARG B 2 256 ? -7.419  -0.221  -28.896 1.00 18.31  ? 256 ARG B NH2 1 
ATOM   4087 N  N   . LYS B 2 257 ? -0.197  0.993   -25.654 1.00 27.85  ? 257 LYS B N   1 
ATOM   4088 C  CA  . LYS B 2 257 ? 0.391   1.295   -24.342 1.00 28.76  ? 257 LYS B CA  1 
ATOM   4089 C  C   . LYS B 2 257 ? -0.660  1.551   -23.227 1.00 35.71  ? 257 LYS B C   1 
ATOM   4090 O  O   . LYS B 2 257 ? -0.320  1.412   -22.053 1.00 35.82  ? 257 LYS B O   1 
ATOM   4091 C  CB  . LYS B 2 257 ? 1.417   2.446   -24.433 1.00 30.85  ? 257 LYS B CB  1 
ATOM   4092 C  CG  . LYS B 2 257 ? 2.571   2.176   -25.414 1.00 44.00  ? 257 LYS B CG  1 
ATOM   4093 C  CD  . LYS B 2 257 ? 3.908   1.919   -24.709 1.00 49.99  ? 257 LYS B CD  1 
ATOM   4094 C  CE  . LYS B 2 257 ? 5.085   2.253   -25.597 1.00 52.96  ? 257 LYS B CE  1 
ATOM   4095 N  NZ  . LYS B 2 257 ? 6.377   2.333   -24.841 1.00 56.09  ? 257 LYS B NZ  1 
ATOM   4096 N  N   . ASP B 2 258 ? -1.925  1.865   -23.592 1.00 34.57  ? 258 ASP B N   1 
ATOM   4097 C  CA  . ASP B 2 258 ? -3.038  2.125   -22.659 1.00 35.33  ? 258 ASP B CA  1 
ATOM   4098 C  C   . ASP B 2 258 ? -3.873  0.869   -22.320 1.00 38.71  ? 258 ASP B C   1 
ATOM   4099 O  O   . ASP B 2 258 ? -4.881  0.964   -21.606 1.00 37.51  ? 258 ASP B O   1 
ATOM   4100 C  CB  . ASP B 2 258 ? -3.952  3.256   -23.205 1.00 38.05  ? 258 ASP B CB  1 
ATOM   4101 C  CG  . ASP B 2 258 ? -4.931  2.906   -24.328 1.00 57.26  ? 258 ASP B CG  1 
ATOM   4102 O  OD1 . ASP B 2 258 ? -4.702  1.893   -25.036 1.00 58.42  ? 258 ASP B OD1 1 
ATOM   4103 O  OD2 . ASP B 2 258 ? -5.907  3.668   -24.520 1.00 68.35  ? 258 ASP B OD2 1 
ATOM   4104 N  N   . SER B 2 259 ? -3.475  -0.293  -22.858 1.00 34.68  ? 259 SER B N   1 
ATOM   4105 C  CA  . SER B 2 259 ? -4.212  -1.538  -22.664 1.00 33.40  ? 259 SER B CA  1 
ATOM   4106 C  C   . SER B 2 259 ? -4.243  -2.034  -21.201 1.00 37.16  ? 259 SER B C   1 
ATOM   4107 O  O   . SER B 2 259 ? -3.211  -2.064  -20.542 1.00 36.15  ? 259 SER B O   1 
ATOM   4108 C  CB  . SER B 2 259 ? -3.694  -2.626  -23.599 1.00 33.07  ? 259 SER B CB  1 
ATOM   4109 O  OG  . SER B 2 259 ? -4.286  -3.879  -23.302 1.00 31.68  ? 259 SER B OG  1 
ATOM   4110 N  N   . PRO B 2 260 ? -5.418  -2.463  -20.699 1.00 33.97  ? 260 PRO B N   1 
ATOM   4111 C  CA  . PRO B 2 260 ? -5.469  -3.001  -19.330 1.00 33.66  ? 260 PRO B CA  1 
ATOM   4112 C  C   . PRO B 2 260 ? -5.080  -4.495  -19.242 1.00 37.20  ? 260 PRO B C   1 
ATOM   4113 O  O   . PRO B 2 260 ? -5.064  -5.063  -18.150 1.00 36.12  ? 260 PRO B O   1 
ATOM   4114 C  CB  . PRO B 2 260 ? -6.926  -2.756  -18.926 1.00 35.38  ? 260 PRO B CB  1 
ATOM   4115 C  CG  . PRO B 2 260 ? -7.704  -2.799  -20.231 1.00 39.24  ? 260 PRO B CG  1 
ATOM   4116 C  CD  . PRO B 2 260 ? -6.749  -2.504  -21.357 1.00 35.04  ? 260 PRO B CD  1 
ATOM   4117 N  N   . TRP B 2 261 ? -4.746  -5.120  -20.383 1.00 34.04  ? 261 TRP B N   1 
ATOM   4118 C  CA  . TRP B 2 261 ? -4.385  -6.535  -20.480 1.00 34.51  ? 261 TRP B CA  1 
ATOM   4119 C  C   . TRP B 2 261 ? -2.856  -6.780  -20.438 1.00 35.63  ? 261 TRP B C   1 
ATOM   4120 O  O   . TRP B 2 261 ? -2.420  -7.936  -20.345 1.00 33.74  ? 261 TRP B O   1 
ATOM   4121 C  CB  . TRP B 2 261 ? -4.981  -7.144  -21.781 1.00 34.17  ? 261 TRP B CB  1 
ATOM   4122 C  CG  . TRP B 2 261 ? -6.444  -6.875  -21.984 1.00 35.71  ? 261 TRP B CG  1 
ATOM   4123 C  CD1 . TRP B 2 261 ? -6.993  -5.859  -22.706 1.00 38.85  ? 261 TRP B CD1 1 
ATOM   4124 C  CD2 . TRP B 2 261 ? -7.548  -7.618  -21.431 1.00 35.72  ? 261 TRP B CD2 1 
ATOM   4125 N  NE1 . TRP B 2 261 ? -8.369  -5.912  -22.632 1.00 38.99  ? 261 TRP B NE1 1 
ATOM   4126 C  CE2 . TRP B 2 261 ? -8.736  -6.996  -21.873 1.00 40.22  ? 261 TRP B CE2 1 
ATOM   4127 C  CE3 . TRP B 2 261 ? -7.649  -8.763  -20.617 1.00 36.69  ? 261 TRP B CE3 1 
ATOM   4128 C  CZ2 . TRP B 2 261 ? -10.009 -7.477  -21.531 1.00 39.42  ? 261 TRP B CZ2 1 
ATOM   4129 C  CZ3 . TRP B 2 261 ? -8.907  -9.216  -20.244 1.00 37.93  ? 261 TRP B CZ3 1 
ATOM   4130 C  CH2 . TRP B 2 261 ? -10.069 -8.594  -20.720 1.00 38.71  ? 261 TRP B CH2 1 
ATOM   4131 N  N   . LYS B 2 262 ? -2.056  -5.699  -20.517 1.00 31.07  ? 262 LYS B N   1 
ATOM   4132 C  CA  . LYS B 2 262 ? -0.589  -5.759  -20.592 1.00 30.06  ? 262 LYS B CA  1 
ATOM   4133 C  C   . LYS B 2 262 ? 0.076   -6.699  -19.584 1.00 31.10  ? 262 LYS B C   1 
ATOM   4134 O  O   . LYS B 2 262 ? 0.816   -7.597  -19.998 1.00 30.06  ? 262 LYS B O   1 
ATOM   4135 C  CB  . LYS B 2 262 ? 0.070   -4.363  -20.508 1.00 31.60  ? 262 LYS B CB  1 
ATOM   4136 C  CG  . LYS B 2 262 ? -0.405  -3.351  -21.540 1.00 45.84  ? 262 LYS B CG  1 
ATOM   4137 C  CD  . LYS B 2 262 ? 0.248   -1.961  -21.347 1.00 56.35  ? 262 LYS B CD  1 
ATOM   4138 C  CE  . LYS B 2 262 ? -0.100  -1.248  -20.058 1.00 61.16  ? 262 LYS B CE  1 
ATOM   4139 N  NZ  . LYS B 2 262 ? 0.749   -0.046  -19.847 1.00 74.00  ? 262 LYS B NZ  1 
ATOM   4140 N  N   . GLN B 2 263 ? -0.167  -6.489  -18.279 1.00 26.82  ? 263 GLN B N   1 
ATOM   4141 C  CA  . GLN B 2 263 ? 0.479   -7.256  -17.217 1.00 26.23  ? 263 GLN B CA  1 
ATOM   4142 C  C   . GLN B 2 263 ? 0.196   -8.764  -17.316 1.00 29.08  ? 263 GLN B C   1 
ATOM   4143 O  O   . GLN B 2 263 ? 1.149   -9.562  -17.390 1.00 28.86  ? 263 GLN B O   1 
ATOM   4144 C  CB  . GLN B 2 263 ? 0.129   -6.676  -15.834 1.00 27.64  ? 263 GLN B CB  1 
ATOM   4145 C  CG  . GLN B 2 263 ? 0.737   -7.411  -14.616 1.00 48.90  ? 263 GLN B CG  1 
ATOM   4146 C  CD  . GLN B 2 263 ? 2.250   -7.299  -14.428 1.00 66.46  ? 263 GLN B CD  1 
ATOM   4147 O  OE1 . GLN B 2 263 ? 2.986   -6.671  -15.206 1.00 66.36  ? 263 GLN B OE1 1 
ATOM   4148 N  NE2 . GLN B 2 263 ? 2.748   -7.920  -13.370 1.00 43.46  ? 263 GLN B NE2 1 
ATOM   4149 N  N   . ASN B 2 264 ? -1.106  -9.125  -17.387 1.00 22.83  ? 264 ASN B N   1 
ATOM   4150 C  CA  . ASN B 2 264 ? -1.597  -10.492 -17.457 1.00 21.57  ? 264 ASN B CA  1 
ATOM   4151 C  C   . ASN B 2 264 ? -1.320  -11.189 -18.781 1.00 24.47  ? 264 ASN B C   1 
ATOM   4152 O  O   . ASN B 2 264 ? -1.223  -12.425 -18.779 1.00 23.83  ? 264 ASN B O   1 
ATOM   4153 C  CB  . ASN B 2 264 ? -3.072  -10.561 -17.092 1.00 22.90  ? 264 ASN B CB  1 
ATOM   4154 C  CG  . ASN B 2 264 ? -3.347  -10.142 -15.674 1.00 47.97  ? 264 ASN B CG  1 
ATOM   4155 O  OD1 . ASN B 2 264 ? -2.489  -10.251 -14.781 1.00 48.81  ? 264 ASN B OD1 1 
ATOM   4156 N  ND2 . ASN B 2 264 ? -4.530  -9.588  -15.454 1.00 35.35  ? 264 ASN B ND2 1 
ATOM   4157 N  N   . VAL B 2 265 ? -1.165  -10.439 -19.904 1.00 20.61  ? 265 VAL B N   1 
ATOM   4158 C  CA  . VAL B 2 265 ? -0.755  -11.089 -21.161 1.00 20.48  ? 265 VAL B CA  1 
ATOM   4159 C  C   . VAL B 2 265 ? 0.667   -11.678 -20.918 1.00 23.57  ? 265 VAL B C   1 
ATOM   4160 O  O   . VAL B 2 265 ? 0.852   -12.885 -21.063 1.00 23.74  ? 265 VAL B O   1 
ATOM   4161 C  CB  . VAL B 2 265 ? -0.833  -10.200 -22.440 1.00 23.33  ? 265 VAL B CB  1 
ATOM   4162 C  CG1 . VAL B 2 265 ? -0.050  -10.820 -23.593 1.00 22.36  ? 265 VAL B CG1 1 
ATOM   4163 C  CG2 . VAL B 2 265 ? -2.283  -9.972  -22.852 1.00 23.02  ? 265 VAL B CG2 1 
ATOM   4164 N  N   . SER B 2 266 ? 1.617   -10.836 -20.461 1.00 18.79  ? 266 SER B N   1 
ATOM   4165 C  CA  . SER B 2 266 ? 2.996   -11.243 -20.163 1.00 18.85  ? 266 SER B CA  1 
ATOM   4166 C  C   . SER B 2 266 ? 3.127   -12.346 -19.101 1.00 23.37  ? 266 SER B C   1 
ATOM   4167 O  O   . SER B 2 266 ? 3.933   -13.263 -19.309 1.00 22.46  ? 266 SER B O   1 
ATOM   4168 C  CB  . SER B 2 266 ? 3.857   -10.047 -19.794 1.00 21.18  ? 266 SER B CB  1 
ATOM   4169 O  OG  . SER B 2 266 ? 4.552   -9.623  -20.954 1.00 27.47  ? 266 SER B OG  1 
ATOM   4170 N  N   . LEU B 2 267 ? 2.341   -12.275 -17.987 1.00 19.16  ? 267 LEU B N   1 
ATOM   4171 C  CA  . LEU B 2 267 ? 2.369   -13.311 -16.936 1.00 17.24  ? 267 LEU B CA  1 
ATOM   4172 C  C   . LEU B 2 267 ? 1.898   -14.651 -17.499 1.00 20.61  ? 267 LEU B C   1 
ATOM   4173 O  O   . LEU B 2 267 ? 2.477   -15.680 -17.156 1.00 20.93  ? 267 LEU B O   1 
ATOM   4174 C  CB  . LEU B 2 267 ? 1.535   -12.922 -15.704 1.00 16.43  ? 267 LEU B CB  1 
ATOM   4175 C  CG  . LEU B 2 267 ? 2.067   -11.773 -14.822 1.00 21.15  ? 267 LEU B CG  1 
ATOM   4176 C  CD1 . LEU B 2 267 ? 1.006   -11.296 -13.866 1.00 20.69  ? 267 LEU B CD1 1 
ATOM   4177 C  CD2 . LEU B 2 267 ? 3.349   -12.166 -14.063 1.00 20.66  ? 267 LEU B CD2 1 
ATOM   4178 N  N   . SER B 2 268 ? 0.890   -14.637 -18.401 1.00 16.08  ? 268 SER B N   1 
ATOM   4179 C  CA  . SER B 2 268 ? 0.378   -15.866 -19.034 1.00 16.50  ? 268 SER B CA  1 
ATOM   4180 C  C   . SER B 2 268 ? 1.449   -16.496 -19.905 1.00 20.56  ? 268 SER B C   1 
ATOM   4181 O  O   . SER B 2 268 ? 1.643   -17.709 -19.845 1.00 21.15  ? 268 SER B O   1 
ATOM   4182 C  CB  . SER B 2 268 ? -0.879  -15.598 -19.869 1.00 18.58  ? 268 SER B CB  1 
ATOM   4183 O  OG  . SER B 2 268 ? -1.979  -15.235 -19.055 1.00 25.22  ? 268 SER B OG  1 
ATOM   4184 N  N   . ILE B 2 269 ? 2.166   -15.661 -20.679 1.00 16.64  ? 269 ILE B N   1 
ATOM   4185 C  CA  . ILE B 2 269 ? 3.265   -16.096 -21.546 1.00 16.96  ? 269 ILE B CA  1 
ATOM   4186 C  C   . ILE B 2 269 ? 4.383   -16.753 -20.710 1.00 21.39  ? 269 ILE B C   1 
ATOM   4187 O  O   . ILE B 2 269 ? 4.717   -17.908 -20.974 1.00 22.71  ? 269 ILE B O   1 
ATOM   4188 C  CB  . ILE B 2 269 ? 3.738   -14.945 -22.485 1.00 19.68  ? 269 ILE B CB  1 
ATOM   4189 C  CG1 . ILE B 2 269 ? 2.633   -14.720 -23.572 1.00 20.74  ? 269 ILE B CG1 1 
ATOM   4190 C  CG2 . ILE B 2 269 ? 5.108   -15.263 -23.133 1.00 19.00  ? 269 ILE B CG2 1 
ATOM   4191 C  CD1 . ILE B 2 269 ? 2.932   -13.804 -24.623 1.00 31.14  ? 269 ILE B CD1 1 
ATOM   4192 N  N   . LEU B 2 270 ? 4.880   -16.066 -19.663 1.00 16.06  ? 270 LEU B N   1 
ATOM   4193 C  CA  . LEU B 2 270 ? 5.910   -16.584 -18.765 1.00 15.70  ? 270 LEU B CA  1 
ATOM   4194 C  C   . LEU B 2 270 ? 5.495   -17.925 -18.168 1.00 20.54  ? 270 LEU B C   1 
ATOM   4195 O  O   . LEU B 2 270 ? 6.250   -18.894 -18.283 1.00 19.97  ? 270 LEU B O   1 
ATOM   4196 C  CB  . LEU B 2 270 ? 6.256   -15.568 -17.672 1.00 15.55  ? 270 LEU B CB  1 
ATOM   4197 C  CG  . LEU B 2 270 ? 6.835   -14.234 -18.143 1.00 19.65  ? 270 LEU B CG  1 
ATOM   4198 C  CD1 . LEU B 2 270 ? 7.091   -13.307 -16.974 1.00 17.79  ? 270 LEU B CD1 1 
ATOM   4199 C  CD2 . LEU B 2 270 ? 8.076   -14.429 -18.995 1.00 25.16  ? 270 LEU B CD2 1 
ATOM   4200 N  N   . LYS B 2 271 ? 4.241   -17.997 -17.658 1.00 17.72  ? 271 LYS B N   1 
ATOM   4201 C  CA  . LYS B 2 271 ? 3.607   -19.190 -17.117 1.00 18.58  ? 271 LYS B CA  1 
ATOM   4202 C  C   . LYS B 2 271 ? 3.661   -20.377 -18.125 1.00 22.91  ? 271 LYS B C   1 
ATOM   4203 O  O   . LYS B 2 271 ? 4.128   -21.459 -17.768 1.00 23.87  ? 271 LYS B O   1 
ATOM   4204 C  CB  . LYS B 2 271 ? 2.156   -18.876 -16.674 1.00 21.46  ? 271 LYS B CB  1 
ATOM   4205 C  CG  . LYS B 2 271 ? 1.474   -20.026 -15.918 1.00 31.93  ? 271 LYS B CG  1 
ATOM   4206 C  CD  . LYS B 2 271 ? -0.020  -19.787 -15.755 1.00 45.31  ? 271 LYS B CD  1 
ATOM   4207 C  CE  . LYS B 2 271 ? -0.740  -20.992 -15.201 1.00 54.91  ? 271 LYS B CE  1 
ATOM   4208 N  NZ  . LYS B 2 271 ? -2.199  -20.745 -15.042 1.00 55.00  ? 271 LYS B NZ  1 
ATOM   4209 N  N   . SER B 2 272 ? 3.291   -20.118 -19.387 1.00 18.49  ? 272 SER B N   1 
ATOM   4210 C  CA  . SER B 2 272 ? 3.266   -21.065 -20.509 1.00 17.57  ? 272 SER B CA  1 
ATOM   4211 C  C   . SER B 2 272 ? 4.617   -21.606 -20.918 1.00 19.29  ? 272 SER B C   1 
ATOM   4212 O  O   . SER B 2 272 ? 4.697   -22.742 -21.381 1.00 19.59  ? 272 SER B O   1 
ATOM   4213 C  CB  . SER B 2 272 ? 2.565   -20.448 -21.710 1.00 19.66  ? 272 SER B CB  1 
ATOM   4214 O  OG  . SER B 2 272 ? 1.226   -20.184 -21.340 1.00 24.97  ? 272 SER B OG  1 
ATOM   4215 N  N   . HIS B 2 273 ? 5.677   -20.816 -20.776 1.00 14.52  ? 273 HIS B N   1 
ATOM   4216 C  CA  . HIS B 2 273 ? 7.010   -21.339 -21.083 1.00 13.13  ? 273 HIS B CA  1 
ATOM   4217 C  C   . HIS B 2 273 ? 7.394   -22.288 -19.917 1.00 18.60  ? 273 HIS B C   1 
ATOM   4218 O  O   . HIS B 2 273 ? 7.897   -23.390 -20.140 1.00 18.48  ? 273 HIS B O   1 
ATOM   4219 C  CB  . HIS B 2 273 ? 8.059   -20.218 -21.181 1.00 12.28  ? 273 HIS B CB  1 
ATOM   4220 C  CG  . HIS B 2 273 ? 8.093   -19.452 -22.463 1.00 14.84  ? 273 HIS B CG  1 
ATOM   4221 N  ND1 . HIS B 2 273 ? 8.611   -20.006 -23.618 1.00 16.18  ? 273 HIS B ND1 1 
ATOM   4222 C  CD2 . HIS B 2 273 ? 7.791   -18.153 -22.705 1.00 15.11  ? 273 HIS B CD2 1 
ATOM   4223 C  CE1 . HIS B 2 273 ? 8.569   -19.046 -24.533 1.00 14.19  ? 273 HIS B CE1 1 
ATOM   4224 N  NE2 . HIS B 2 273 ? 8.102   -17.914 -24.033 1.00 14.32  ? 273 HIS B NE2 1 
ATOM   4225 N  N   . GLU B 2 274 ? 7.122   -21.845 -18.679 1.00 15.46  ? 274 GLU B N   1 
ATOM   4226 C  CA  . GLU B 2 274 ? 7.484   -22.545 -17.447 1.00 15.77  ? 274 GLU B CA  1 
ATOM   4227 C  C   . GLU B 2 274 ? 6.802   -23.900 -17.247 1.00 20.48  ? 274 GLU B C   1 
ATOM   4228 O  O   . GLU B 2 274 ? 7.467   -24.811 -16.771 1.00 20.20  ? 274 GLU B O   1 
ATOM   4229 C  CB  . GLU B 2 274 ? 7.252   -21.639 -16.216 1.00 16.61  ? 274 GLU B CB  1 
ATOM   4230 C  CG  . GLU B 2 274 ? 8.201   -20.456 -16.131 1.00 15.33  ? 274 GLU B CG  1 
ATOM   4231 C  CD  . GLU B 2 274 ? 7.848   -19.408 -15.090 1.00 37.90  ? 274 GLU B CD  1 
ATOM   4232 O  OE1 . GLU B 2 274 ? 7.333   -19.777 -14.010 1.00 53.92  ? 274 GLU B OE1 1 
ATOM   4233 O  OE2 . GLU B 2 274 ? 8.076   -18.208 -15.361 1.00 23.36  ? 274 GLU B OE2 1 
ATOM   4234 N  N   . ASN B 2 275 ? 5.492   -24.035 -17.587 1.00 17.67  ? 275 ASN B N   1 
ATOM   4235 C  CA  . ASN B 2 275 ? 4.722   -25.272 -17.379 1.00 16.50  ? 275 ASN B CA  1 
ATOM   4236 C  C   . ASN B 2 275 ? 4.734   -26.244 -18.587 1.00 20.92  ? 275 ASN B C   1 
ATOM   4237 O  O   . ASN B 2 275 ? 4.120   -27.324 -18.526 1.00 21.46  ? 275 ASN B O   1 
ATOM   4238 C  CB  . ASN B 2 275 ? 3.287   -24.948 -16.929 1.00 13.62  ? 275 ASN B CB  1 
ATOM   4239 C  CG  . ASN B 2 275 ? 2.421   -24.255 -17.962 1.00 28.62  ? 275 ASN B CG  1 
ATOM   4240 O  OD1 . ASN B 2 275 ? 2.761   -24.134 -19.143 1.00 19.19  ? 275 ASN B OD1 1 
ATOM   4241 N  ND2 . ASN B 2 275 ? 1.278   -23.756 -17.529 1.00 13.14  ? 275 ASN B ND2 1 
ATOM   4242 N  N   . GLY B 2 276 ? 5.425   -25.862 -19.658 1.00 15.18  ? 276 GLY B N   1 
ATOM   4243 C  CA  . GLY B 2 276 ? 5.564   -26.710 -20.833 1.00 14.70  ? 276 GLY B CA  1 
ATOM   4244 C  C   . GLY B 2 276 ? 4.598   -26.470 -21.969 1.00 19.24  ? 276 GLY B C   1 
ATOM   4245 O  O   . GLY B 2 276 ? 4.761   -27.070 -23.040 1.00 18.10  ? 276 GLY B O   1 
ATOM   4246 N  N   . PHE B 2 277 ? 3.583   -25.613 -21.756 1.00 17.98  ? 277 PHE B N   1 
ATOM   4247 C  CA  . PHE B 2 277 ? 2.579   -25.321 -22.794 1.00 19.19  ? 277 PHE B CA  1 
ATOM   4248 C  C   . PHE B 2 277 ? 3.232   -24.816 -24.088 1.00 23.38  ? 277 PHE B C   1 
ATOM   4249 O  O   . PHE B 2 277 ? 2.831   -25.230 -25.165 1.00 22.92  ? 277 PHE B O   1 
ATOM   4250 C  CB  . PHE B 2 277 ? 1.465   -24.366 -22.291 1.00 20.97  ? 277 PHE B CB  1 
ATOM   4251 C  CG  . PHE B 2 277 ? 0.485   -23.964 -23.375 1.00 22.88  ? 277 PHE B CG  1 
ATOM   4252 C  CD1 . PHE B 2 277 ? -0.457  -24.871 -23.857 1.00 27.17  ? 277 PHE B CD1 1 
ATOM   4253 C  CD2 . PHE B 2 277 ? 0.551   -22.703 -23.965 1.00 24.58  ? 277 PHE B CD2 1 
ATOM   4254 C  CE1 . PHE B 2 277 ? -1.355  -24.505 -24.875 1.00 28.36  ? 277 PHE B CE1 1 
ATOM   4255 C  CE2 . PHE B 2 277 ? -0.341  -22.340 -24.981 1.00 28.00  ? 277 PHE B CE2 1 
ATOM   4256 C  CZ  . PHE B 2 277 ? -1.290  -23.243 -25.429 1.00 26.82  ? 277 PHE B CZ  1 
ATOM   4257 N  N   . MET B 2 278 ? 4.193   -23.944 -23.982 1.00 21.27  ? 278 MET B N   1 
ATOM   4258 C  CA  . MET B 2 278 ? 4.997   -23.512 -25.068 1.00 21.71  ? 278 MET B CA  1 
ATOM   4259 C  C   . MET B 2 278 ? 5.803   -24.589 -25.784 1.00 27.23  ? 278 MET B C   1 
ATOM   4260 O  O   . MET B 2 278 ? 5.895   -24.574 -26.973 1.00 26.56  ? 278 MET B O   1 
ATOM   4261 C  CB  . MET B 2 278 ? 5.921   -22.450 -24.554 1.00 23.66  ? 278 MET B CB  1 
ATOM   4262 C  CG  . MET B 2 278 ? 5.801   -21.130 -25.235 1.00 27.76  ? 278 MET B CG  1 
ATOM   4263 S  SD  . MET B 2 278 ? 4.209   -20.454 -25.661 1.00 32.12  ? 278 MET B SD  1 
ATOM   4264 C  CE  . MET B 2 278 ? 4.302   -19.036 -24.639 1.00 29.29  ? 278 MET B CE  1 
ATOM   4265 N  N   . GLU B 2 279 ? 6.382   -25.510 -25.032 1.00 25.63  ? 279 GLU B N   1 
ATOM   4266 C  CA  . GLU B 2 279 ? 7.048   -26.705 -25.579 1.00 25.75  ? 279 GLU B CA  1 
ATOM   4267 C  C   . GLU B 2 279 ? 6.002   -27.595 -26.333 1.00 26.15  ? 279 GLU B C   1 
ATOM   4268 O  O   . GLU B 2 279 ? 6.297   -28.039 -27.438 1.00 24.97  ? 279 GLU B O   1 
ATOM   4269 C  CB  . GLU B 2 279 ? 7.734   -27.505 -24.463 1.00 27.55  ? 279 GLU B CB  1 
ATOM   4270 C  CG  . GLU B 2 279 ? 8.791   -28.471 -24.962 1.00 40.42  ? 279 GLU B CG  1 
ATOM   4271 C  CD  . GLU B 2 279 ? 10.115  -28.402 -24.226 1.00 66.67  ? 279 GLU B CD  1 
ATOM   4272 O  OE1 . GLU B 2 279 ? 10.637  -27.280 -24.015 1.00 65.90  ? 279 GLU B OE1 1 
ATOM   4273 O  OE2 . GLU B 2 279 ? 10.666  -29.485 -23.922 1.00 58.01  ? 279 GLU B OE2 1 
ATOM   4274 N  N   . ASP B 2 280 ? 4.790   -27.817 -25.750 1.00 21.09  ? 280 ASP B N   1 
ATOM   4275 C  CA  . ASP B 2 280 ? 3.693   -28.562 -26.402 1.00 21.62  ? 280 ASP B CA  1 
ATOM   4276 C  C   . ASP B 2 280 ? 3.359   -27.977 -27.794 1.00 27.51  ? 280 ASP B C   1 
ATOM   4277 O  O   . ASP B 2 280 ? 3.286   -28.730 -28.763 1.00 29.90  ? 280 ASP B O   1 
ATOM   4278 C  CB  . ASP B 2 280 ? 2.406   -28.552 -25.549 1.00 23.19  ? 280 ASP B CB  1 
ATOM   4279 C  CG  . ASP B 2 280 ? 2.424   -29.380 -24.271 1.00 37.62  ? 280 ASP B CG  1 
ATOM   4280 O  OD1 . ASP B 2 280 ? 3.420   -30.131 -24.049 1.00 38.17  ? 280 ASP B OD1 1 
ATOM   4281 O  OD2 . ASP B 2 280 ? 1.466   -29.249 -23.466 1.00 40.32  ? 280 ASP B OD2 1 
ATOM   4282 N  N   . LEU B 2 281 ? 3.185   -26.639 -27.886 1.00 21.66  ? 281 LEU B N   1 
ATOM   4283 C  CA  . LEU B 2 281 ? 2.917   -25.927 -29.138 1.00 20.94  ? 281 LEU B CA  1 
ATOM   4284 C  C   . LEU B 2 281 ? 3.996   -26.194 -30.202 1.00 22.97  ? 281 LEU B C   1 
ATOM   4285 O  O   . LEU B 2 281 ? 3.674   -26.485 -31.366 1.00 21.53  ? 281 LEU B O   1 
ATOM   4286 C  CB  . LEU B 2 281 ? 2.729   -24.413 -28.888 1.00 20.38  ? 281 LEU B CB  1 
ATOM   4287 C  CG  . LEU B 2 281 ? 1.455   -24.001 -28.140 1.00 22.59  ? 281 LEU B CG  1 
ATOM   4288 C  CD1 . LEU B 2 281 ? 1.301   -22.511 -28.123 1.00 21.32  ? 281 LEU B CD1 1 
ATOM   4289 C  CD2 . LEU B 2 281 ? 0.237   -24.610 -28.767 1.00 23.02  ? 281 LEU B CD2 1 
ATOM   4290 N  N   . ASP B 2 282 ? 5.261   -26.156 -29.785 1.00 19.89  ? 282 ASP B N   1 
ATOM   4291 C  CA  . ASP B 2 282 ? 6.377   -26.473 -30.660 1.00 21.24  ? 282 ASP B CA  1 
ATOM   4292 C  C   . ASP B 2 282 ? 6.330   -27.960 -31.106 1.00 25.40  ? 282 ASP B C   1 
ATOM   4293 O  O   . ASP B 2 282 ? 6.572   -28.241 -32.281 1.00 26.29  ? 282 ASP B O   1 
ATOM   4294 C  CB  . ASP B 2 282 ? 7.697   -26.154 -29.962 1.00 24.92  ? 282 ASP B CB  1 
ATOM   4295 C  CG  . ASP B 2 282 ? 8.627   -25.312 -30.813 1.00 48.04  ? 282 ASP B CG  1 
ATOM   4296 O  OD1 . ASP B 2 282 ? 8.335   -24.098 -30.994 1.00 50.26  ? 282 ASP B OD1 1 
ATOM   4297 O  OD2 . ASP B 2 282 ? 9.660   -25.858 -31.284 1.00 56.55  ? 282 ASP B OD2 1 
ATOM   4298 N  N   . LYS B 2 283 ? 5.937   -28.887 -30.211 1.00 20.15  ? 283 LYS B N   1 
ATOM   4299 C  CA  . LYS B 2 283 ? 5.825   -30.305 -30.555 1.00 20.52  ? 283 LYS B CA  1 
ATOM   4300 C  C   . LYS B 2 283 ? 4.677   -30.527 -31.550 1.00 23.93  ? 283 LYS B C   1 
ATOM   4301 O  O   . LYS B 2 283 ? 4.768   -31.380 -32.443 1.00 23.14  ? 283 LYS B O   1 
ATOM   4302 C  CB  . LYS B 2 283 ? 5.617   -31.184 -29.299 1.00 24.46  ? 283 LYS B CB  1 
ATOM   4303 C  CG  . LYS B 2 283 ? 6.668   -31.011 -28.192 1.00 39.04  ? 283 LYS B CG  1 
ATOM   4304 C  CD  . LYS B 2 283 ? 7.765   -32.062 -28.187 1.00 49.21  ? 283 LYS B CD  1 
ATOM   4305 C  CE  . LYS B 2 283 ? 8.673   -31.941 -26.971 1.00 62.75  ? 283 LYS B CE  1 
ATOM   4306 N  NZ  . LYS B 2 283 ? 7.992   -32.285 -25.684 1.00 70.61  ? 283 LYS B NZ  1 
ATOM   4307 N  N   . THR B 2 284 ? 3.613   -29.730 -31.416 1.00 20.01  ? 284 THR B N   1 
ATOM   4308 C  CA  . THR B 2 284 ? 2.446   -29.817 -32.284 1.00 19.72  ? 284 THR B CA  1 
ATOM   4309 C  C   . THR B 2 284 ? 2.627   -29.188 -33.668 1.00 24.82  ? 284 THR B C   1 
ATOM   4310 O  O   . THR B 2 284 ? 2.229   -29.790 -34.669 1.00 25.73  ? 284 THR B O   1 
ATOM   4311 C  CB  . THR B 2 284 ? 1.245   -29.184 -31.574 1.00 22.61  ? 284 THR B CB  1 
ATOM   4312 O  OG1 . THR B 2 284 ? 1.030   -29.848 -30.321 1.00 24.71  ? 284 THR B OG1 1 
ATOM   4313 C  CG2 . THR B 2 284 ? -0.014  -29.184 -32.438 1.00 12.64  ? 284 THR B CG2 1 
ATOM   4314 N  N   . TRP B 2 285 ? 3.177   -27.963 -33.721 1.00 21.08  ? 285 TRP B N   1 
ATOM   4315 C  CA  . TRP B 2 285 ? 3.216   -27.164 -34.941 1.00 20.59  ? 285 TRP B CA  1 
ATOM   4316 C  C   . TRP B 2 285 ? 4.550   -26.957 -35.595 1.00 26.78  ? 285 TRP B C   1 
ATOM   4317 O  O   . TRP B 2 285 ? 4.580   -26.713 -36.801 1.00 23.09  ? 285 TRP B O   1 
ATOM   4318 C  CB  . TRP B 2 285 ? 2.608   -25.773 -34.637 1.00 18.44  ? 285 TRP B CB  1 
ATOM   4319 C  CG  . TRP B 2 285 ? 1.180   -25.812 -34.184 1.00 18.30  ? 285 TRP B CG  1 
ATOM   4320 C  CD1 . TRP B 2 285 ? 0.718   -25.658 -32.906 1.00 20.80  ? 285 TRP B CD1 1 
ATOM   4321 C  CD2 . TRP B 2 285 ? 0.028   -26.074 -35.001 1.00 17.96  ? 285 TRP B CD2 1 
ATOM   4322 N  NE1 . TRP B 2 285 ? -0.663  -25.750 -32.885 1.00 19.94  ? 285 TRP B NE1 1 
ATOM   4323 C  CE2 . TRP B 2 285 ? -1.112  -26.026 -34.151 1.00 21.60  ? 285 TRP B CE2 1 
ATOM   4324 C  CE3 . TRP B 2 285 ? -0.161  -26.310 -36.380 1.00 19.11  ? 285 TRP B CE3 1 
ATOM   4325 C  CZ2 . TRP B 2 285 ? -2.421  -26.217 -34.634 1.00 21.01  ? 285 TRP B CZ2 1 
ATOM   4326 C  CZ3 . TRP B 2 285 ? -1.461  -26.499 -36.864 1.00 20.53  ? 285 TRP B CZ3 1 
ATOM   4327 C  CH2 . TRP B 2 285 ? -2.572  -26.451 -36.000 1.00 21.22  ? 285 TRP B CH2 1 
ATOM   4328 N  N   . VAL B 2 286 ? 5.647   -26.994 -34.819 1.00 29.89  ? 286 VAL B N   1 
ATOM   4329 C  CA  . VAL B 2 286 ? 6.971   -26.645 -35.345 1.00 32.94  ? 286 VAL B CA  1 
ATOM   4330 C  C   . VAL B 2 286 ? 7.926   -27.837 -35.571 1.00 43.41  ? 286 VAL B C   1 
ATOM   4331 O  O   . VAL B 2 286 ? 8.571   -27.885 -36.618 1.00 43.90  ? 286 VAL B O   1 
ATOM   4332 C  CB  . VAL B 2 286 ? 7.640   -25.551 -34.465 1.00 36.77  ? 286 VAL B CB  1 
ATOM   4333 C  CG1 . VAL B 2 286 ? 8.937   -25.038 -35.089 1.00 36.54  ? 286 VAL B CG1 1 
ATOM   4334 C  CG2 . VAL B 2 286 ? 6.682   -24.390 -34.192 1.00 36.49  ? 286 VAL B CG2 1 
ATOM   4335 N  N   . ARG B 2 287 ? 8.060   -28.747 -34.599 1.00 44.12  ? 287 ARG B N   1 
ATOM   4336 C  CA  . ARG B 2 287 ? 9.038   -29.831 -34.699 1.00 45.65  ? 287 ARG B CA  1 
ATOM   4337 C  C   . ARG B 2 287 ? 8.431   -31.215 -34.955 1.00 50.91  ? 287 ARG B C   1 
ATOM   4338 O  O   . ARG B 2 287 ? 7.982   -31.907 -34.041 1.00 50.46  ? 287 ARG B O   1 
ATOM   4339 C  CB  . ARG B 2 287 ? 10.017  -29.856 -33.484 1.00 48.83  ? 287 ARG B CB  1 
ATOM   4340 C  CG  . ARG B 2 287 ? 9.426   -29.421 -32.136 1.00 66.41  ? 287 ARG B CG  1 
ATOM   4341 C  CD  . ARG B 2 287 ? 10.453  -29.253 -31.026 1.00 79.34  ? 287 ARG B CD  1 
ATOM   4342 N  NE  . ARG B 2 287 ? 10.739  -30.526 -30.361 1.00 87.50  ? 287 ARG B NE  1 
ATOM   4343 C  CZ  . ARG B 2 287 ? 11.311  -30.639 -29.167 1.00 100.02 ? 287 ARG B CZ  1 
ATOM   4344 N  NH1 . ARG B 2 287 ? 11.661  -29.556 -28.484 1.00 88.03  ? 287 ARG B NH1 1 
ATOM   4345 N  NH2 . ARG B 2 287 ? 11.537  -31.837 -28.646 1.00 84.26  ? 287 ARG B NH2 1 
ATOM   4346 N  N   . TYR B 2 288 ? 8.478   -31.609 -36.235 1.00 49.77  ? 288 TYR B N   1 
ATOM   4347 C  CA  . TYR B 2 288 ? 8.081   -32.898 -36.816 1.00 50.45  ? 288 TYR B CA  1 
ATOM   4348 C  C   . TYR B 2 288 ? 8.581   -32.989 -38.269 1.00 57.92  ? 288 TYR B C   1 
ATOM   4349 O  O   . TYR B 2 288 ? 8.432   -32.033 -39.037 1.00 58.47  ? 288 TYR B O   1 
ATOM   4350 C  CB  . TYR B 2 288 ? 6.569   -33.200 -36.675 1.00 50.98  ? 288 TYR B CB  1 
ATOM   4351 C  CG  . TYR B 2 288 ? 5.643   -32.259 -37.414 1.00 51.45  ? 288 TYR B CG  1 
ATOM   4352 C  CD1 . TYR B 2 288 ? 5.181   -31.086 -36.814 1.00 52.80  ? 288 TYR B CD1 1 
ATOM   4353 C  CD2 . TYR B 2 288 ? 5.188   -32.561 -38.694 1.00 51.84  ? 288 TYR B CD2 1 
ATOM   4354 C  CE1 . TYR B 2 288 ? 4.311   -30.226 -37.483 1.00 52.44  ? 288 TYR B CE1 1 
ATOM   4355 C  CE2 . TYR B 2 288 ? 4.321   -31.708 -39.373 1.00 52.62  ? 288 TYR B CE2 1 
ATOM   4356 C  CZ  . TYR B 2 288 ? 3.879   -30.546 -38.761 1.00 57.57  ? 288 TYR B CZ  1 
ATOM   4357 O  OH  . TYR B 2 288 ? 3.023   -29.724 -39.440 1.00 54.63  ? 288 TYR B OH  1 
ATOM   4358 N  N   . GLN B 2 289 ? 9.204   -34.135 -38.619 1.00 56.47  ? 289 GLN B N   1 
ATOM   4359 C  CA  . GLN B 2 289 ? 9.816   -34.485 -39.922 1.00 85.36  ? 289 GLN B CA  1 
ATOM   4360 C  C   . GLN B 2 289 ? 11.089  -33.708 -40.229 1.00 90.90  ? 289 GLN B C   1 
ATOM   4361 O  O   . GLN B 2 289 ? 11.725  -33.192 -39.320 1.00 53.14  ? 289 GLN B O   1 
ATOM   4362 C  CB  . GLN B 2 289 ? 8.819   -34.358 -41.071 1.00 86.03  ? 289 GLN B CB  1 
HETATM 4363 N  N   . GLU C 3 .   ? 19.742  -17.091 -13.316 1.00 17.32  ? 301 GLU A N   1 
HETATM 4364 C  CA  . GLU C 3 .   ? 19.205  -17.880 -12.215 1.00 19.99  ? 301 GLU A CA  1 
HETATM 4365 C  C   . GLU C 3 .   ? 18.300  -17.052 -11.274 1.00 18.20  ? 301 GLU A C   1 
HETATM 4366 O  O   . GLU C 3 .   ? 18.124  -15.823 -11.500 1.00 21.40  ? 301 GLU A O   1 
HETATM 4367 C  CB  . GLU C 3 .   ? 20.378  -18.531 -11.467 1.00 21.58  ? 301 GLU A CB  1 
HETATM 4368 C  CG  . GLU C 3 .   ? 20.071  -19.825 -10.739 1.00 33.52  ? 301 GLU A CG  1 
HETATM 4369 C  CD  . GLU C 3 .   ? 19.329  -20.933 -11.461 1.00 46.32  ? 301 GLU A CD  1 
HETATM 4370 O  OE1 . GLU C 3 .   ? 19.689  -21.279 -12.610 1.00 36.37  ? 301 GLU A OE1 1 
HETATM 4371 O  OE2 . GLU C 3 .   ? 18.408  -21.496 -10.834 1.00 43.80  ? 301 GLU A OE2 1 
HETATM 4372 O  OXT . GLU C 3 .   ? 17.732  -17.638 -10.327 1.00 24.26  ? 301 GLU A OXT 1 
HETATM 4373 C  C4  . 5YD D 4 .   ? 21.160  -13.378 -26.279 1.00 29.15  ? 302 5YD A C4  1 
HETATM 4374 C  C14 . 5YD D 4 .   ? 16.633  -8.842  -28.210 1.00 35.58  ? 302 5YD A C14 1 
HETATM 4375 C  C6  . 5YD D 4 .   ? 22.098  -15.430 -25.728 1.00 32.59  ? 302 5YD A C6  1 
HETATM 4376 C  C11 . 5YD D 4 .   ? 19.230  -9.811  -27.982 1.00 31.67  ? 302 5YD A C11 1 
HETATM 4377 C  C7  . 5YD D 4 .   ? 22.552  -11.303 -26.699 1.00 34.24  ? 302 5YD A C7  1 
HETATM 4378 C  C9  . 5YD D 4 .   ? 20.597  -10.375 -27.956 1.00 34.56  ? 302 5YD A C9  1 
HETATM 4379 C  C12 . 5YD D 4 .   ? 18.479  -10.011 -29.156 1.00 31.07  ? 302 5YD A C12 1 
HETATM 4380 C  C13 . 5YD D 4 .   ? 17.195  -9.538  -29.269 1.00 31.62  ? 302 5YD A C13 1 
HETATM 4381 C  C3  . 5YD D 4 .   ? 22.421  -12.770 -26.358 1.00 32.25  ? 302 5YD A C3  1 
HETATM 4382 C  C1  . 5YD D 4 .   ? 23.394  -14.906 -25.799 1.00 32.40  ? 302 5YD A C1  1 
HETATM 4383 C  C2  . 5YD D 4 .   ? 23.564  -13.544 -26.107 1.00 32.38  ? 302 5YD A C2  1 
HETATM 4384 N  N5  . 5YD D 4 .   ? 21.030  -14.662 -25.966 1.00 29.73  ? 302 5YD A N5  1 
HETATM 4385 N  N8  . 5YD D 4 .   ? 21.207  -10.689 -26.786 1.00 35.10  ? 302 5YD A N8  1 
HETATM 4386 O  O10 . 5YD D 4 .   ? 21.158  -10.581 -29.024 1.00 37.55  ? 302 5YD A O10 1 
HETATM 4387 C  C15 . 5YD D 4 .   ? 17.358  -8.618  -27.026 1.00 35.45  ? 302 5YD A C15 1 
HETATM 4388 C  C16 . 5YD D 4 .   ? 18.665  -9.106  -26.902 1.00 33.13  ? 302 5YD A C16 1 
HETATM 4389 C  C17 . 5YD D 4 .   ? 15.219  -8.353  -28.406 1.00 38.60  ? 302 5YD A C17 1 
HETATM 4390 N  N18 . 5YD D 4 .   ? 14.278  -8.863  -27.414 1.00 40.92  ? 302 5YD A N18 1 
HETATM 4391 S  S19 . 5YD D 4 .   ? 13.719  -10.427 -27.344 1.00 42.91  ? 302 5YD A S19 1 
HETATM 4392 O  O20 . 5YD D 4 .   ? 13.228  -10.464 -26.018 1.00 47.01  ? 302 5YD A O20 1 
HETATM 4393 O  O21 . 5YD D 4 .   ? 12.913  -10.646 -28.482 1.00 41.15  ? 302 5YD A O21 1 
HETATM 4394 C  C22 . 5YD D 4 .   ? 15.092  -11.545 -27.361 1.00 39.99  ? 302 5YD A C22 1 
HETATM 4395 C  C23 . 5YD D 4 .   ? 15.273  -12.440 -28.418 1.00 39.13  ? 302 5YD A C23 1 
HETATM 4396 C  C24 . 5YD D 4 .   ? 16.392  -13.260 -28.446 1.00 38.73  ? 302 5YD A C24 1 
HETATM 4397 C  C25 . 5YD D 4 .   ? 17.322  -13.170 -27.406 1.00 39.47  ? 302 5YD A C25 1 
HETATM 4398 C  C26 . 5YD D 4 .   ? 17.160  -12.282 -26.350 1.00 36.14  ? 302 5YD A C26 1 
HETATM 4399 C  C27 . 5YD D 4 .   ? 16.023  -11.490 -26.322 1.00 36.46  ? 302 5YD A C27 1 
HETATM 4400 F  F28 . 5YD D 4 .   ? 18.394  -13.968 -27.417 1.00 43.49  ? 302 5YD A F28 1 
HETATM 4401 CA CA  . CA  E 5 .   ? -8.888  -3.185  -25.091 1.00 68.33  2 301 CA  B CA  1 
HETATM 4402 N  N   . GLY F 6 .   ? 8.611   -11.424 -37.887 1.00 24.84  ? 302 GLY B N   1 
HETATM 4403 C  CA  . GLY F 6 .   ? 8.556   -10.466 -38.990 1.00 24.35  ? 302 GLY B CA  1 
HETATM 4404 C  C   . GLY F 6 .   ? 8.144   -9.091  -38.489 1.00 20.19  ? 302 GLY B C   1 
HETATM 4405 O  O   . GLY F 6 .   ? 8.184   -8.141  -39.290 1.00 23.39  ? 302 GLY B O   1 
HETATM 4406 O  OXT . GLY F 6 .   ? 7.803   -8.960  -37.296 1.00 29.14  ? 302 GLY B OXT 1 
HETATM 4407 O  O   . HOH G 7 .   ? 28.731  -28.478 -3.335  1.00 30.33  ? 401 HOH A O   1 
HETATM 4408 O  O   . HOH G 7 .   ? 18.064  -23.232 -8.717  1.00 17.36  ? 402 HOH A O   1 
HETATM 4409 O  O   . HOH G 7 .   ? 33.593  -4.653  -18.096 1.00 38.40  ? 403 HOH A O   1 
HETATM 4410 O  O   . HOH G 7 .   ? 34.439  -14.496 -20.897 1.00 32.91  ? 404 HOH A O   1 
HETATM 4411 O  O   . HOH G 7 .   ? 26.884  -4.902  -0.267  1.00 20.56  ? 405 HOH A O   1 
HETATM 4412 O  O   . HOH G 7 .   ? 23.225  -20.164 -8.621  1.00 38.09  ? 406 HOH A O   1 
HETATM 4413 O  O   . HOH G 7 .   ? 11.800  5.616   -18.999 1.00 24.16  ? 407 HOH A O   1 
HETATM 4414 O  O   . HOH G 7 .   ? 11.211  -17.875 -4.813  1.00 15.47  ? 408 HOH A O   1 
HETATM 4415 O  O   . HOH G 7 .   ? 17.530  -8.762  -0.358  1.00 22.09  ? 409 HOH A O   1 
HETATM 4416 O  O   . HOH G 7 .   ? 29.663  2.490   -8.819  1.00 44.72  ? 410 HOH A O   1 
HETATM 4417 O  O   . HOH G 7 .   ? 27.617  -2.378  0.379   1.00 20.76  ? 411 HOH A O   1 
HETATM 4418 O  O   . HOH G 7 .   ? 36.748  -8.381  11.177  1.00 16.50  ? 412 HOH A O   1 
HETATM 4419 O  O   . HOH G 7 .   ? 18.611  -15.905 -2.803  1.00 28.04  ? 413 HOH A O   1 
HETATM 4420 O  O   . HOH G 7 .   ? 19.015  -2.196  -37.189 1.00 44.55  ? 414 HOH A O   1 
HETATM 4421 O  O   . HOH G 7 .   ? 19.871  -30.799 -6.620  1.00 16.33  ? 415 HOH A O   1 
HETATM 4422 O  O   . HOH G 7 .   ? 9.721   -17.036 -20.726 1.00 18.11  ? 416 HOH A O   1 
HETATM 4423 O  O   . HOH G 7 .   ? 12.114  -17.458 -8.665  1.00 13.85  ? 417 HOH A O   1 
HETATM 4424 O  O   . HOH G 7 .   ? 32.419  -28.930 -24.400 1.00 20.70  ? 418 HOH A O   1 
HETATM 4425 O  O   . HOH G 7 .   ? 18.227  -17.116 -5.203  1.00 21.51  ? 419 HOH A O   1 
HETATM 4426 O  O   . HOH G 7 .   ? 24.282  -5.347  1.714   1.00 31.09  ? 420 HOH A O   1 
HETATM 4427 O  O   . HOH G 7 .   ? 17.623  -43.005 -12.343 1.00 26.38  ? 421 HOH A O   1 
HETATM 4428 O  O   . HOH G 7 .   ? 24.963  -32.807 -2.411  1.00 39.60  ? 422 HOH A O   1 
HETATM 4429 O  O   . HOH G 7 .   ? 13.016  1.323   -10.500 1.00 33.43  ? 423 HOH A O   1 
HETATM 4430 O  O   . HOH G 7 .   ? 13.566  -9.396  -30.859 1.00 11.03  ? 424 HOH A O   1 
HETATM 4431 O  O   . HOH G 7 .   ? 20.484  -18.157 -6.585  1.00 35.87  ? 425 HOH A O   1 
HETATM 4432 O  O   . HOH G 7 .   ? 16.886  -27.859 -1.600  1.00 20.74  ? 426 HOH A O   1 
HETATM 4433 O  O   . HOH G 7 .   ? 13.799  -18.594 -6.293  1.00 16.85  ? 427 HOH A O   1 
HETATM 4434 O  O   . HOH G 7 .   ? 20.373  -28.921 -22.451 1.00 15.74  ? 428 HOH A O   1 
HETATM 4435 O  O   . HOH G 7 .   ? 32.063  -20.376 -24.051 1.00 40.04  ? 429 HOH A O   1 
HETATM 4436 O  O   . HOH G 7 .   ? 24.010  -42.770 -20.698 1.00 36.05  ? 430 HOH A O   1 
HETATM 4437 O  O   . HOH G 7 .   ? 5.896   -20.341 -9.673  1.00 35.75  ? 431 HOH A O   1 
HETATM 4438 O  O   . HOH G 7 .   ? 13.939  -21.333 -5.681  1.00 21.60  ? 432 HOH A O   1 
HETATM 4439 O  O   . HOH G 7 .   ? 11.280  -20.527 -12.420 1.00 32.58  ? 433 HOH A O   1 
HETATM 4440 O  O   . HOH G 7 .   ? 7.269   -18.055 0.710   1.00 30.39  ? 434 HOH A O   1 
HETATM 4441 O  O   . HOH G 7 .   ? 25.998  -17.779 -22.654 1.00 38.82  ? 435 HOH A O   1 
HETATM 4442 O  O   . HOH G 7 .   ? 25.222  -13.799 -1.037  1.00 40.46  ? 436 HOH A O   1 
HETATM 4443 O  O   . HOH G 7 .   ? 30.432  -18.784 -13.565 1.00 41.43  ? 437 HOH A O   1 
HETATM 4444 O  O   . HOH G 7 .   ? 22.519  -17.612 -13.785 1.00 11.58  ? 438 HOH A O   1 
HETATM 4445 O  O   . HOH G 7 .   ? 22.101  -7.450  0.353   1.00 37.89  ? 439 HOH A O   1 
HETATM 4446 O  O   . HOH G 7 .   ? 22.151  -18.659 -24.070 1.00 36.27  ? 440 HOH A O   1 
HETATM 4447 O  O   . HOH G 7 .   ? 8.818   -20.296 2.793   1.00 35.69  ? 441 HOH A O   1 
HETATM 4448 O  O   . HOH G 7 .   ? 31.019  -23.857 -6.376  1.00 23.65  ? 442 HOH A O   1 
HETATM 4449 O  O   . HOH G 7 .   ? 5.575   -13.325 -5.933  1.00 33.64  ? 443 HOH A O   1 
HETATM 4450 O  O   . HOH G 7 .   ? 17.630  -19.850 -15.146 1.00 41.20  ? 444 HOH A O   1 
HETATM 4451 O  O   . HOH G 7 .   ? 16.819  5.293   -24.175 1.00 42.40  ? 445 HOH A O   1 
HETATM 4452 O  O   . HOH G 7 .   ? 31.474  -16.514 -10.947 1.00 41.61  ? 446 HOH A O   1 
HETATM 4453 O  O   . HOH G 7 .   ? 8.619   -32.377 -3.906  1.00 40.74  ? 447 HOH A O   1 
HETATM 4454 O  O   . HOH G 7 .   ? 9.870   -35.802 -0.007  1.00 45.59  ? 448 HOH A O   1 
HETATM 4455 O  O   . HOH G 7 .   ? 24.295  -44.112 -11.453 1.00 41.80  ? 449 HOH A O   1 
HETATM 4456 O  O   . HOH G 7 .   ? 27.790  -20.586 -8.693  1.00 29.68  ? 450 HOH A O   1 
HETATM 4457 O  O   . HOH G 7 .   ? 12.787  -41.651 -21.038 1.00 37.01  ? 451 HOH A O   1 
HETATM 4458 O  O   . HOH G 7 .   ? 28.167  -34.459 -5.650  1.00 37.27  ? 452 HOH A O   1 
HETATM 4459 O  O   . HOH G 7 .   ? 11.035  -44.429 -9.406  1.00 26.79  ? 453 HOH A O   1 
HETATM 4460 O  O   . HOH G 7 .   ? 17.896  -18.442 0.163   1.00 28.28  ? 454 HOH A O   1 
HETATM 4461 O  O   . HOH G 7 .   ? 30.281  -10.692 5.390   1.00 19.94  ? 455 HOH A O   1 
HETATM 4462 O  O   . HOH G 7 .   ? 11.435  -20.058 -17.135 1.00 36.77  ? 456 HOH A O   1 
HETATM 4463 O  O   . HOH G 7 .   ? 8.632   3.732   -17.648 1.00 43.78  ? 457 HOH A O   1 
HETATM 4464 O  O   . HOH G 7 .   ? 13.636  -13.796 2.812   1.00 28.85  ? 458 HOH A O   1 
HETATM 4465 O  O   . HOH G 7 .   ? 28.283  -11.234 -5.114  1.00 32.89  ? 459 HOH A O   1 
HETATM 4466 O  O   . HOH G 7 .   ? 17.384  4.871   -26.867 1.00 29.05  ? 460 HOH A O   1 
HETATM 4467 O  O   . HOH G 7 .   ? 28.375  6.423   -11.981 1.00 26.41  ? 461 HOH A O   1 
HETATM 4468 O  O   . HOH G 7 .   ? 5.733   -24.234 -13.157 1.00 31.86  ? 462 HOH A O   1 
HETATM 4469 O  O   . HOH G 7 .   ? 18.398  5.584   -5.597  1.00 31.24  ? 463 HOH A O   1 
HETATM 4470 O  O   . HOH G 7 .   ? 20.533  -20.821 -7.723  1.00 21.96  ? 464 HOH A O   1 
HETATM 4471 O  O   . HOH G 7 .   ? 7.403   -7.503  -15.695 1.00 36.56  ? 465 HOH A O   1 
HETATM 4472 O  O   . HOH G 7 .   ? 8.076   -3.210  -23.413 1.00 49.86  ? 466 HOH A O   1 
HETATM 4473 O  O   . HOH G 7 .   ? 12.344  -23.566 -4.806  1.00 37.07  ? 467 HOH A O   1 
HETATM 4474 O  O   . HOH G 7 .   ? 12.101  3.875   -9.282  1.00 45.90  ? 468 HOH A O   1 
HETATM 4475 O  O   . HOH G 7 .   ? 15.588  -29.917 -21.895 1.00 44.15  ? 469 HOH A O   1 
HETATM 4476 O  O   . HOH G 7 .   ? 13.548  9.180   -15.893 1.00 46.69  ? 470 HOH A O   1 
HETATM 4477 O  O   . HOH G 7 .   ? 11.576  -7.280  4.807   1.00 46.59  ? 471 HOH A O   1 
HETATM 4478 O  O   . HOH G 7 .   ? 10.056  -4.867  4.975   1.00 53.26  ? 472 HOH A O   1 
HETATM 4479 O  O   . HOH H 7 .   ? 2.448   -27.416 -38.367 1.00 22.24  ? 401 HOH B O   1 
HETATM 4480 O  O   . HOH H 7 .   ? 7.309   -24.534 -22.415 1.00 22.46  ? 402 HOH B O   1 
HETATM 4481 O  O   . HOH H 7 .   ? -10.215 -0.634  -31.169 1.00 37.10  ? 403 HOH B O   1 
HETATM 4482 O  O   . HOH H 7 .   ? -4.551  -2.503  -27.375 1.00 13.41  ? 404 HOH B O   1 
HETATM 4483 O  O   . HOH H 7 .   ? -3.673  -10.526 -44.979 1.00 19.75  ? 405 HOH B O   1 
HETATM 4484 O  O   . HOH H 7 .   ? -11.207 -8.427  -35.537 1.00 25.98  ? 406 HOH B O   1 
HETATM 4485 O  O   . HOH H 7 .   ? -2.359  -21.874 -44.949 1.00 32.19  ? 407 HOH B O   1 
HETATM 4486 O  O   . HOH H 7 .   ? 25.023  -11.308 -55.550 1.00 34.93  ? 408 HOH B O   1 
HETATM 4487 O  O   . HOH H 7 .   ? 16.818  -20.742 -55.811 1.00 22.95  ? 409 HOH B O   1 
HETATM 4488 O  O   . HOH H 7 .   ? 19.125  -21.154 -54.092 1.00 22.51  ? 410 HOH B O   1 
HETATM 4489 O  O   . HOH H 7 .   ? -2.506  -27.707 -42.683 1.00 38.53  ? 411 HOH B O   1 
HETATM 4490 O  O   . HOH H 7 .   ? 13.823  -5.069  -36.977 1.00 28.40  ? 412 HOH B O   1 
HETATM 4491 O  O   . HOH H 7 .   ? 24.356  -3.243  -53.443 1.00 33.97  ? 413 HOH B O   1 
HETATM 4492 O  O   . HOH H 7 .   ? 4.120   -9.711  -45.859 1.00 19.52  ? 414 HOH B O   1 
HETATM 4493 O  O   . HOH H 7 .   ? 12.844  -10.878 -37.017 1.00 23.35  ? 415 HOH B O   1 
HETATM 4494 O  O   . HOH H 7 .   ? -13.607 -18.857 -47.406 1.00 40.91  ? 416 HOH B O   1 
HETATM 4495 O  O   . HOH H 7 .   ? 0.069   2.170   -28.200 1.00 30.71  ? 417 HOH B O   1 
HETATM 4496 O  O   . HOH H 7 .   ? 2.088   -13.717 -45.437 1.00 17.69  ? 418 HOH B O   1 
HETATM 4497 O  O   . HOH H 7 .   ? -5.109  -23.477 -33.992 1.00 12.14  ? 419 HOH B O   1 
HETATM 4498 O  O   . HOH H 7 .   ? 6.995   -1.852  -25.468 1.00 39.36  ? 420 HOH B O   1 
HETATM 4499 O  O   . HOH H 7 .   ? -3.880  -2.802  -43.005 1.00 40.87  ? 421 HOH B O   1 
HETATM 4500 O  O   . HOH H 7 .   ? 9.581   -17.767 -17.590 1.00 26.86  ? 422 HOH B O   1 
HETATM 4501 O  O   . HOH H 7 .   ? 7.305   -18.395 -11.659 1.00 13.81  ? 423 HOH B O   1 
HETATM 4502 O  O   . HOH H 7 .   ? -3.588  -8.056  -48.562 1.00 33.47  ? 424 HOH B O   1 
HETATM 4503 O  O   . HOH H 7 .   ? -1.656  -32.412 -30.570 1.00 23.23  ? 425 HOH B O   1 
HETATM 4504 O  O   . HOH H 7 .   ? 14.167  -12.846 -57.370 1.00 30.12  ? 426 HOH B O   1 
HETATM 4505 O  O   . HOH H 7 .   ? 22.385  -17.701 -41.671 1.00 30.41  ? 427 HOH B O   1 
HETATM 4506 O  O   . HOH H 7 .   ? -10.502 -29.223 -36.998 1.00 32.76  ? 428 HOH B O   1 
HETATM 4507 O  O   . HOH H 7 .   ? 1.077   5.867   -38.322 1.00 32.80  ? 429 HOH B O   1 
HETATM 4508 O  O   . HOH H 7 .   ? -17.707 -27.208 -49.042 1.00 34.77  ? 430 HOH B O   1 
HETATM 4509 O  O   . HOH H 7 .   ? 24.840  -23.381 -48.538 1.00 38.66  ? 431 HOH B O   1 
HETATM 4510 O  O   . HOH H 7 .   ? 9.795   -14.868 -22.381 1.00 15.84  ? 432 HOH B O   1 
HETATM 4511 O  O   . HOH H 7 .   ? 3.523   -15.844 -46.357 1.00 20.37  ? 433 HOH B O   1 
HETATM 4512 O  O   . HOH H 7 .   ? 29.145  -5.074  -47.884 1.00 29.24  ? 434 HOH B O   1 
HETATM 4513 O  O   . HOH H 7 .   ? -9.750  -9.374  -52.259 1.00 46.02  ? 435 HOH B O   1 
HETATM 4514 O  O   . HOH H 7 .   ? 23.251  -4.888  -56.592 1.00 30.97  ? 436 HOH B O   1 
HETATM 4515 O  O   . HOH H 7 .   ? -5.382  -26.890 -31.978 1.00 18.26  ? 437 HOH B O   1 
HETATM 4516 O  O   . HOH H 7 .   ? 0.437   -11.621 -46.066 1.00 17.92  ? 438 HOH B O   1 
HETATM 4517 O  O   . HOH H 7 .   ? 26.753  -5.378  -46.090 1.00 33.66  ? 439 HOH B O   1 
HETATM 4518 O  O   . HOH H 7 .   ? 9.107   -6.450  -22.212 1.00 35.35  ? 440 HOH B O   1 
HETATM 4519 O  O   . HOH H 7 .   ? 6.109   -30.061 -23.003 1.00 33.19  ? 441 HOH B O   1 
HETATM 4520 O  O   . HOH H 7 .   ? 4.716   -12.530 -45.119 1.00 17.96  ? 442 HOH B O   1 
HETATM 4521 O  O   . HOH H 7 .   ? -14.730 -18.573 -34.896 1.00 40.40  ? 443 HOH B O   1 
HETATM 4522 O  O   . HOH H 7 .   ? -3.483  -7.281  -17.019 1.00 30.43  ? 444 HOH B O   1 
HETATM 4523 O  O   . HOH H 7 .   ? 11.130  -20.124 -27.608 1.00 19.51  ? 445 HOH B O   1 
HETATM 4524 O  O   . HOH H 7 .   ? 2.267   -28.120 -42.876 1.00 39.44  ? 446 HOH B O   1 
HETATM 4525 O  O   . HOH H 7 .   ? -4.851  -23.866 -26.769 1.00 41.38  ? 447 HOH B O   1 
HETATM 4526 O  O   . HOH H 7 .   ? -1.700  -12.449 -44.621 1.00 25.99  ? 448 HOH B O   1 
HETATM 4527 O  O   . HOH H 7 .   ? 5.653   -7.610  -44.012 1.00 21.51  ? 449 HOH B O   1 
HETATM 4528 O  O   . HOH H 7 .   ? 9.641   -8.167  -24.273 1.00 26.27  ? 450 HOH B O   1 
HETATM 4529 O  O   . HOH H 7 .   ? -11.748 -28.554 -32.934 1.00 41.43  ? 451 HOH B O   1 
HETATM 4530 O  O   . HOH H 7 .   ? 29.026  -16.475 -43.568 1.00 38.69  ? 452 HOH B O   1 
HETATM 4531 O  O   . HOH H 7 .   ? 8.512   -20.949 -27.938 1.00 43.20  ? 453 HOH B O   1 
HETATM 4532 O  O   . HOH H 7 .   ? 15.903  -2.384  -36.169 1.00 45.38  ? 454 HOH B O   1 
HETATM 4533 O  O   . HOH H 7 .   ? 2.897   -18.556 -44.898 1.00 33.60  ? 455 HOH B O   1 
HETATM 4534 O  O   . HOH H 7 .   ? 21.416  -19.393 -26.597 1.00 39.63  ? 456 HOH B O   1 
HETATM 4535 O  O   . HOH H 7 .   ? 8.110   -22.366 -12.505 1.00 34.77  ? 457 HOH B O   1 
HETATM 4536 O  O   . HOH H 7 .   ? 26.042  -22.686 -55.735 1.00 39.27  ? 458 HOH B O   1 
HETATM 4537 O  O   . HOH H 7 .   ? 18.316  -27.238 -43.571 1.00 33.58  ? 459 HOH B O   1 
HETATM 4538 O  O   . HOH H 7 .   ? -12.533 -26.165 -34.161 1.00 23.35  ? 460 HOH B O   1 
HETATM 4539 O  O   . HOH H 7 .   ? 25.102  -16.865 -41.183 1.00 32.75  ? 461 HOH B O   1 
HETATM 4540 O  O   . HOH H 7 .   ? 14.386  -8.545  -37.222 1.00 25.05  ? 462 HOH B O   1 
HETATM 4541 O  O   . HOH H 7 .   ? 27.082  -5.687  -59.580 1.00 50.87  ? 463 HOH B O   1 
HETATM 4542 O  O   . HOH H 7 .   ? -6.438  -34.549 -40.818 1.00 31.53  ? 464 HOH B O   1 
HETATM 4543 O  O   . HOH H 7 .   ? -13.183 -17.495 -23.065 1.00 38.85  ? 465 HOH B O   1 
HETATM 4544 O  O   . HOH H 7 .   ? -4.639  -28.621 -30.060 1.00 48.30  ? 466 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   ASP 4   4   ?   ?   ?   A . n 
A 1 5   ASP 5   5   ?   ?   ?   A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  THR 12  12  12  THR THR A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  ASP 25  25  25  ASP ALA A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  THR 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  29  GLU ALA A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ARG 33  33  33  ARG ALA A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  MET 52  52  52  MET MET A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  CYS 57  57  57  CYS CYS A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  TRP 95  95  95  TRP TRP A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 MET 138 138 138 MET MET A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 GLN 144 144 144 GLN ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 SER 149 149 149 SER ALA A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LYS 151 151 151 LYS ALA A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 HIS 157 157 157 HIS HIS A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 PRO 161 161 161 PRO PRO A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 PHE 165 165 165 PHE PHE A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 ASN 180 180 180 ASN ASN A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 HIS 185 185 185 HIS HIS A . n 
A 1 186 GLN 186 186 186 GLN GLN A . n 
A 1 187 TYR 187 187 187 TYR TYR A . n 
A 1 188 MET 188 188 188 MET MET A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 ASN 192 192 192 ASN ASN A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 LYS 194 194 194 LYS ALA A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 THR 205 205 205 THR THR A . n 
A 1 206 GLY 206 206 206 GLY GLY A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 PHE 211 211 211 PHE PHE A . n 
A 1 212 ILE 212 212 212 ILE ILE A . n 
A 1 213 TYR 213 213 213 TYR TYR A . n 
A 1 214 ASP 214 214 214 ASP ASP A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 TYR 220 220 220 TYR TYR A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 GLY 223 223 223 GLY GLY A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 GLU 226 226 226 GLU ALA A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 CYS 228 228 228 CYS CYS A . n 
A 1 229 LYS 229 229 229 LYS ALA A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 THR 232 232 232 THR THR A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 SER 235 235 235 SER ALA A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 GLY 243 243 243 GLY GLY A . n 
A 1 244 TYR 244 244 244 TYR TYR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 LYS 250 250 250 LYS LYS A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 TRP 254 254 254 TRP TRP A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 GLN 257 257 257 GLN GLN A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 ALA 261 261 261 ALA ALA A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLN 264 264 264 GLN GLN A . n 
A 1 265 PHE 265 265 265 PHE PHE A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 MET 271 271 271 MET MET A . n 
A 1 272 GLU 272 272 272 GLU GLU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 LEU 277 277 277 LEU LEU A . n 
A 1 278 TRP 278 278 278 TRP TRP A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 CYS 283 283 283 CYS CYS A . n 
A 1 284 HIS 284 284 ?   ?   ?   A . n 
A 1 285 ASN 285 285 ?   ?   ?   A . n 
B 2 1   GLY 1   1   ?   ?   ?   B . n 
B 2 2   SER 2   2   ?   ?   ?   B . n 
B 2 3   MET 3   3   ?   ?   ?   B . n 
B 2 4   SER 4   4   ?   ?   ?   B . n 
B 2 5   THR 5   5   5   THR ALA B . n 
B 2 6   ARG 6   6   6   ARG ARG B . n 
B 2 7   LEU 7   7   7   LEU LEU B . n 
B 2 8   LYS 8   8   8   LYS LYS B . n 
B 2 9   ILE 9   9   9   ILE ILE B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  THR 11  11  11  THR THR B . n 
B 2 12  ILE 12  12  12  ILE ILE B . n 
B 2 13  HIS 13  13  13  HIS HIS B . n 
B 2 14  GLN 14  14  14  GLN GLN B . n 
B 2 15  GLU 15  15  15  GLU GLU B . n 
B 2 16  PRO 16  16  16  PRO PRO B . n 
B 2 17  PHE 17  17  17  PHE PHE B . n 
B 2 18  VAL 18  18  18  VAL VAL B . n 
B 2 19  TYR 19  19  19  TYR TYR B . n 
B 2 20  VAL 20  20  20  VAL VAL B . n 
B 2 21  LYS 21  21  21  LYS LYS B . n 
B 2 22  PRO 22  22  22  PRO PRO B . n 
B 2 23  THR 23  23  23  THR THR B . n 
B 2 24  LEU 24  24  24  LEU LEU B . n 
B 2 25  SER 25  25  25  SER SER B . n 
B 2 26  ASP 26  26  26  ASP ASP B . n 
B 2 27  GLY 27  27  27  GLY GLY B . n 
B 2 28  THR 28  28  28  THR THR B . n 
B 2 29  CYS 29  29  29  CYS CYS B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  GLU 31  31  31  GLU GLU B . n 
B 2 32  GLU 32  32  32  GLU GLU B . n 
B 2 33  PHE 33  33  33  PHE PHE B . n 
B 2 34  THR 34  34  34  THR THR B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  ASN 36  36  36  ASN ASN B . n 
B 2 37  GLY 37  37  37  GLY GLY B . n 
B 2 38  ASP 38  38  38  ASP ASP B . n 
B 2 39  PRO 39  39  39  PRO PRO B . n 
B 2 40  VAL 40  40  40  VAL VAL B . n 
B 2 41  LYS 41  41  41  LYS LYS B . n 
B 2 42  LYS 42  42  42  LYS LYS B . n 
B 2 43  VAL 43  43  43  VAL VAL B . n 
B 2 44  ILE 44  44  44  ILE ILE B . n 
B 2 45  CYS 45  45  45  CYS CYS B . n 
B 2 46  THR 46  46  46  THR THR B . n 
B 2 47  GLY 47  47  47  GLY GLY B . n 
B 2 48  PRO 48  48  48  PRO PRO B . n 
B 2 49  ASN 49  49  49  ASN ASN B . n 
B 2 50  ASP 50  50  50  ASP ALA B . n 
B 2 51  THR 51  51  51  THR ALA B . n 
B 2 52  SER 52  52  52  SER SER B . n 
B 2 53  PRO 53  53  53  PRO PRO B . n 
B 2 54  GLY 54  54  54  GLY GLY B . n 
B 2 55  SER 55  55  55  SER SER B . n 
B 2 56  PRO 56  56  56  PRO PRO B . n 
B 2 57  ARG 57  57  57  ARG ARG B . n 
B 2 58  HIS 58  58  58  HIS HIS B . n 
B 2 59  THR 59  59  59  THR THR B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PRO 61  61  61  PRO PRO B . n 
B 2 62  GLN 62  62  62  GLN GLN B . n 
B 2 63  CYS 63  63  63  CYS CYS B . n 
B 2 64  CYS 64  64  64  CYS CYS B . n 
B 2 65  TYR 65  65  65  TYR TYR B . n 
B 2 66  GLY 66  66  66  GLY GLY B . n 
B 2 67  PHE 67  67  67  PHE PHE B . n 
B 2 68  CYS 68  68  68  CYS CYS B . n 
B 2 69  ILE 69  69  69  ILE ILE B . n 
B 2 70  ASP 70  70  70  ASP ASP B . n 
B 2 71  LEU 71  71  71  LEU LEU B . n 
B 2 72  LEU 72  72  72  LEU LEU B . n 
B 2 73  ILE 73  73  73  ILE ILE B . n 
B 2 74  LYS 74  74  74  LYS LYS B . n 
B 2 75  LEU 75  75  75  LEU LEU B . n 
B 2 76  ALA 76  76  76  ALA ALA B . n 
B 2 77  ARG 77  77  77  ARG ALA B . n 
B 2 78  THR 78  78  78  THR THR B . n 
B 2 79  MET 79  79  79  MET MET B . n 
B 2 80  ASN 80  80  80  ASN ASN B . n 
B 2 81  PHE 81  81  81  PHE PHE B . n 
B 2 82  THR 82  82  82  THR THR B . n 
B 2 83  TYR 83  83  83  TYR TYR B . n 
B 2 84  GLU 84  84  84  GLU GLU B . n 
B 2 85  VAL 85  85  85  VAL VAL B . n 
B 2 86  HIS 86  86  86  HIS HIS B . n 
B 2 87  LEU 87  87  87  LEU LEU B . n 
B 2 88  VAL 88  88  88  VAL VAL B . n 
B 2 89  ALA 89  89  89  ALA ALA B . n 
B 2 90  ASP 90  90  90  ASP ASP B . n 
B 2 91  GLY 91  91  91  GLY GLY B . n 
B 2 92  LYS 92  92  92  LYS LYS B . n 
B 2 93  PHE 93  93  93  PHE PHE B . n 
B 2 94  GLY 94  94  94  GLY GLY B . n 
B 2 95  THR 95  95  95  THR THR B . n 
B 2 96  GLN 96  96  96  GLN GLN B . n 
B 2 97  GLU 97  97  97  GLU GLU B . n 
B 2 98  ARG 98  98  98  ARG ALA B . n 
B 2 99  VAL 99  99  99  VAL VAL B . n 
B 2 100 ASN 100 100 ?   ?   ?   B . n 
B 2 101 ASN 101 101 ?   ?   ?   B . n 
B 2 102 SER 102 102 ?   ?   ?   B . n 
B 2 103 ASN 103 103 103 ASN ALA B . n 
B 2 104 LYS 104 104 104 LYS ALA B . n 
B 2 105 LYS 105 105 105 LYS LYS B . n 
B 2 106 GLU 106 106 106 GLU ALA B . n 
B 2 107 TRP 107 107 107 TRP TRP B . n 
B 2 108 ASN 108 108 108 ASN ASN B . n 
B 2 109 GLY 109 109 109 GLY GLY B . n 
B 2 110 MET 110 110 110 MET MET B . n 
B 2 111 MET 111 111 111 MET MET B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 GLU 113 113 113 GLU GLU B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 LEU 115 115 115 LEU LEU B . n 
B 2 116 SER 116 116 116 SER SER B . n 
B 2 117 GLY 117 117 117 GLY GLY B . n 
B 2 118 GLN 118 118 118 GLN GLN B . n 
B 2 119 ALA 119 119 119 ALA ALA B . n 
B 2 120 ASP 120 120 120 ASP ASP B . n 
B 2 121 MET 121 121 121 MET MET B . n 
B 2 122 ILE 122 122 122 ILE ILE B . n 
B 2 123 VAL 123 123 123 VAL VAL B . n 
B 2 124 ALA 124 124 124 ALA ALA B . n 
B 2 125 PRO 125 125 125 PRO PRO B . n 
B 2 126 LEU 126 126 126 LEU LEU B . n 
B 2 127 THR 127 127 127 THR THR B . n 
B 2 128 ILE 128 128 128 ILE ILE B . n 
B 2 129 ASN 129 129 129 ASN ASN B . n 
B 2 130 ASN 130 130 130 ASN ASN B . n 
B 2 131 GLU 131 131 131 GLU GLU B . n 
B 2 132 ARG 132 132 132 ARG ARG B . n 
B 2 133 ALA 133 133 133 ALA ALA B . n 
B 2 134 GLN 134 134 134 GLN GLN B . n 
B 2 135 TYR 135 135 135 TYR TYR B . n 
B 2 136 ILE 136 136 136 ILE ILE B . n 
B 2 137 GLU 137 137 137 GLU GLU B . n 
B 2 138 PHE 138 138 138 PHE PHE B . n 
B 2 139 SER 139 139 139 SER SER B . n 
B 2 140 LYS 140 140 140 LYS LYS B . n 
B 2 141 PRO 141 141 141 PRO PRO B . n 
B 2 142 PHE 142 142 142 PHE PHE B . n 
B 2 143 LYS 143 143 143 LYS LYS B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 GLY 146 146 146 GLY GLY B . n 
B 2 147 LEU 147 147 147 LEU LEU B . n 
B 2 148 THR 148 148 148 THR THR B . n 
B 2 149 ILE 149 149 149 ILE ILE B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 VAL 151 151 151 VAL VAL B . n 
B 2 152 LYS 152 152 152 LYS LYS B . n 
B 2 153 LYS 153 153 153 LYS LYS B . n 
B 2 154 GLY 154 154 154 GLY GLY B . n 
B 2 155 THR 155 155 155 THR THR B . n 
B 2 156 ARG 156 156 156 ARG ARG B . n 
B 2 157 ILE 157 157 157 ILE ILE B . n 
B 2 158 THR 158 158 158 THR THR B . n 
B 2 159 GLY 159 159 159 GLY GLY B . n 
B 2 160 ILE 160 160 160 ILE ILE B . n 
B 2 161 ASN 161 161 161 ASN ASN B . n 
B 2 162 ASP 162 162 162 ASP ASP B . n 
B 2 163 PRO 163 163 163 PRO PRO B . n 
B 2 164 ARG 164 164 164 ARG ARG B . n 
B 2 165 LEU 165 165 165 LEU LEU B . n 
B 2 166 ARG 166 166 166 ARG ARG B . n 
B 2 167 ASN 167 167 167 ASN ASN B . n 
B 2 168 PRO 168 168 168 PRO PRO B . n 
B 2 169 SER 169 169 169 SER SER B . n 
B 2 170 ASP 170 170 170 ASP ALA B . n 
B 2 171 LYS 171 171 171 LYS ALA B . n 
B 2 172 PHE 172 172 172 PHE PHE B . n 
B 2 173 ILE 173 173 173 ILE ILE B . n 
B 2 174 TYR 174 174 174 TYR TYR B . n 
B 2 175 ALA 175 175 175 ALA ALA B . n 
B 2 176 THR 176 176 176 THR THR B . n 
B 2 177 VAL 177 177 177 VAL VAL B . n 
B 2 178 LYS 178 178 178 LYS LYS B . n 
B 2 179 GLN 179 179 179 GLN GLN B . n 
B 2 180 SER 180 180 180 SER SER B . n 
B 2 181 SER 181 181 181 SER SER B . n 
B 2 182 VAL 182 182 182 VAL VAL B . n 
B 2 183 ASP 183 183 183 ASP ASP B . n 
B 2 184 ILE 184 184 184 ILE ILE B . n 
B 2 185 TYR 185 185 185 TYR TYR B . n 
B 2 186 PHE 186 186 186 PHE PHE B . n 
B 2 187 ARG 187 187 187 ARG ARG B . n 
B 2 188 ARG 188 188 188 ARG ARG B . n 
B 2 189 GLN 189 189 189 GLN GLN B . n 
B 2 190 VAL 190 190 190 VAL VAL B . n 
B 2 191 GLU 191 191 191 GLU GLU B . n 
B 2 192 LEU 192 192 192 LEU LEU B . n 
B 2 193 SER 193 193 193 SER SER B . n 
B 2 194 THR 194 194 194 THR THR B . n 
B 2 195 MET 195 195 195 MET MET B . n 
B 2 196 TYR 196 196 196 TYR TYR B . n 
B 2 197 ARG 197 197 197 ARG ARG B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 MET 199 199 199 MET MET B . n 
B 2 200 GLU 200 200 200 GLU GLU B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 HIS 202 202 202 HIS HIS B . n 
B 2 203 ASN 203 203 203 ASN ASN B . n 
B 2 204 TYR 204 204 204 TYR TYR B . n 
B 2 205 GLU 205 205 205 GLU GLU B . n 
B 2 206 SER 206 206 206 SER SER B . n 
B 2 207 ALA 207 207 207 ALA ALA B . n 
B 2 208 ALA 208 208 208 ALA ALA B . n 
B 2 209 GLU 209 209 209 GLU GLU B . n 
B 2 210 ALA 210 210 210 ALA ALA B . n 
B 2 211 ILE 211 211 211 ILE ILE B . n 
B 2 212 GLN 212 212 212 GLN GLN B . n 
B 2 213 ALA 213 213 213 ALA ALA B . n 
B 2 214 VAL 214 214 214 VAL VAL B . n 
B 2 215 ARG 215 215 215 ARG ARG B . n 
B 2 216 ASP 216 216 216 ASP ASP B . n 
B 2 217 ASN 217 217 217 ASN ASN B . n 
B 2 218 LYS 218 218 218 LYS LYS B . n 
B 2 219 LEU 219 219 219 LEU LEU B . n 
B 2 220 HIS 220 220 220 HIS HIS B . n 
B 2 221 ALA 221 221 221 ALA ALA B . n 
B 2 222 PHE 222 222 222 PHE PHE B . n 
B 2 223 ILE 223 223 223 ILE ILE B . n 
B 2 224 TRP 224 224 224 TRP TRP B . n 
B 2 225 ASP 225 225 225 ASP ASP B . n 
B 2 226 SER 226 226 226 SER SER B . n 
B 2 227 ALA 227 227 227 ALA ALA B . n 
B 2 228 VAL 228 228 228 VAL VAL B . n 
B 2 229 LEU 229 229 229 LEU LEU B . n 
B 2 230 GLU 230 230 230 GLU GLU B . n 
B 2 231 PHE 231 231 231 PHE PHE B . n 
B 2 232 GLU 232 232 232 GLU GLU B . n 
B 2 233 ALA 233 233 233 ALA ALA B . n 
B 2 234 SER 234 234 234 SER SER B . n 
B 2 235 GLN 235 235 235 GLN GLN B . n 
B 2 236 LYS 236 236 236 LYS LYS B . n 
B 2 237 CYS 237 237 237 CYS CYS B . n 
B 2 238 ASP 238 238 238 ASP ASP B . n 
B 2 239 LEU 239 239 239 LEU LEU B . n 
B 2 240 VAL 240 240 240 VAL VAL B . n 
B 2 241 THR 241 241 241 THR THR B . n 
B 2 242 THR 242 242 242 THR THR B . n 
B 2 243 GLY 243 243 243 GLY GLY B . n 
B 2 244 GLU 244 244 244 GLU ALA B . n 
B 2 245 LEU 245 245 245 LEU LEU B . n 
B 2 246 PHE 246 246 246 PHE PHE B . n 
B 2 247 PHE 247 247 247 PHE PHE B . n 
B 2 248 ARG 248 248 248 ARG ARG B . n 
B 2 249 SER 249 249 249 SER SER B . n 
B 2 250 GLY 250 250 250 GLY GLY B . n 
B 2 251 PHE 251 251 251 PHE PHE B . n 
B 2 252 GLY 252 252 252 GLY GLY B . n 
B 2 253 ILE 253 253 253 ILE ILE B . n 
B 2 254 GLY 254 254 254 GLY GLY B . n 
B 2 255 MET 255 255 255 MET MET B . n 
B 2 256 ARG 256 256 256 ARG ARG B . n 
B 2 257 LYS 257 257 257 LYS LYS B . n 
B 2 258 ASP 258 258 258 ASP ASP B . n 
B 2 259 SER 259 259 259 SER SER B . n 
B 2 260 PRO 260 260 260 PRO PRO B . n 
B 2 261 TRP 261 261 261 TRP TRP B . n 
B 2 262 LYS 262 262 262 LYS LYS B . n 
B 2 263 GLN 263 263 263 GLN GLN B . n 
B 2 264 ASN 264 264 264 ASN ASN B . n 
B 2 265 VAL 265 265 265 VAL VAL B . n 
B 2 266 SER 266 266 266 SER SER B . n 
B 2 267 LEU 267 267 267 LEU LEU B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 ILE 269 269 269 ILE ILE B . n 
B 2 270 LEU 270 270 270 LEU LEU B . n 
B 2 271 LYS 271 271 271 LYS LYS B . n 
B 2 272 SER 272 272 272 SER SER B . n 
B 2 273 HIS 273 273 273 HIS HIS B . n 
B 2 274 GLU 274 274 274 GLU GLU B . n 
B 2 275 ASN 275 275 275 ASN ASN B . n 
B 2 276 GLY 276 276 276 GLY GLY B . n 
B 2 277 PHE 277 277 277 PHE PHE B . n 
B 2 278 MET 278 278 278 MET MET B . n 
B 2 279 GLU 279 279 279 GLU GLU B . n 
B 2 280 ASP 280 280 280 ASP ASP B . n 
B 2 281 LEU 281 281 281 LEU LEU B . n 
B 2 282 ASP 282 282 282 ASP ASP B . n 
B 2 283 LYS 283 283 283 LYS LYS B . n 
B 2 284 THR 284 284 284 THR THR B . n 
B 2 285 TRP 285 285 285 TRP TRP B . n 
B 2 286 VAL 286 286 286 VAL VAL B . n 
B 2 287 ARG 287 287 287 ARG ARG B . n 
B 2 288 TYR 288 288 288 TYR TYR B . n 
B 2 289 GLN 289 289 289 GLN ALA B . n 
B 2 290 GLU 290 290 ?   ?   ?   B . n 
B 2 291 CYS 291 291 ?   ?   ?   B . n 
B 2 292 ASP 292 292 ?   ?   ?   B . n 
B 2 293 SER 293 293 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GLU 1  301 1   GLU GLU A . 
D 4 5YD 1  302 1   5YD DRG A . 
E 5 CA  1  301 1   CA  CA  B . 
F 6 GLY 1  302 1   GLY GLY B . 
G 7 HOH 1  401 8   HOH HOH A . 
G 7 HOH 2  402 6   HOH HOH A . 
G 7 HOH 3  403 77  HOH HOH A . 
G 7 HOH 4  404 61  HOH HOH A . 
G 7 HOH 5  405 44  HOH HOH A . 
G 7 HOH 6  406 103 HOH HOH A . 
G 7 HOH 7  407 18  HOH HOH A . 
G 7 HOH 8  408 23  HOH HOH A . 
G 7 HOH 9  409 7   HOH HOH A . 
G 7 HOH 10 410 95  HOH HOH A . 
G 7 HOH 11 411 30  HOH HOH A . 
G 7 HOH 12 412 4   HOH HOH A . 
G 7 HOH 13 413 27  HOH HOH A . 
G 7 HOH 14 414 106 HOH HOH A . 
G 7 HOH 15 415 2   HOH HOH A . 
G 7 HOH 16 416 57  HOH HOH A . 
G 7 HOH 17 417 37  HOH HOH A . 
G 7 HOH 18 418 92  HOH HOH A . 
G 7 HOH 19 419 11  HOH HOH A . 
G 7 HOH 20 420 28  HOH HOH A . 
G 7 HOH 21 421 16  HOH HOH A . 
G 7 HOH 22 422 80  HOH HOH A . 
G 7 HOH 23 423 13  HOH HOH A . 
G 7 HOH 24 424 55  HOH HOH A . 
G 7 HOH 25 425 87  HOH HOH A . 
G 7 HOH 26 426 72  HOH HOH A . 
G 7 HOH 27 427 36  HOH HOH A . 
G 7 HOH 28 428 12  HOH HOH A . 
G 7 HOH 29 429 50  HOH HOH A . 
G 7 HOH 30 430 20  HOH HOH A . 
G 7 HOH 31 431 120 HOH HOH A . 
G 7 HOH 32 432 38  HOH HOH A . 
G 7 HOH 33 433 48  HOH HOH A . 
G 7 HOH 34 434 17  HOH HOH A . 
G 7 HOH 35 435 111 HOH HOH A . 
G 7 HOH 36 436 135 HOH HOH A . 
G 7 HOH 37 437 35  HOH HOH A . 
G 7 HOH 38 438 1   HOH HOH A . 
G 7 HOH 39 439 82  HOH HOH A . 
G 7 HOH 40 440 110 HOH HOH A . 
G 7 HOH 41 441 121 HOH HOH A . 
G 7 HOH 42 442 109 HOH HOH A . 
G 7 HOH 43 443 133 HOH HOH A . 
G 7 HOH 44 444 53  HOH HOH A . 
G 7 HOH 45 445 93  HOH HOH A . 
G 7 HOH 46 446 42  HOH HOH A . 
G 7 HOH 47 447 74  HOH HOH A . 
G 7 HOH 48 448 102 HOH HOH A . 
G 7 HOH 49 449 134 HOH HOH A . 
G 7 HOH 50 450 21  HOH HOH A . 
G 7 HOH 51 451 19  HOH HOH A . 
G 7 HOH 52 452 118 HOH HOH A . 
G 7 HOH 53 453 54  HOH HOH A . 
G 7 HOH 54 454 125 HOH HOH A . 
G 7 HOH 55 455 46  HOH HOH A . 
G 7 HOH 56 456 63  HOH HOH A . 
G 7 HOH 57 457 47  HOH HOH A . 
G 7 HOH 58 458 94  HOH HOH A . 
G 7 HOH 59 459 117 HOH HOH A . 
G 7 HOH 60 460 33  HOH HOH A . 
G 7 HOH 61 461 132 HOH HOH A . 
G 7 HOH 62 462 90  HOH HOH A . 
G 7 HOH 63 463 136 HOH HOH A . 
G 7 HOH 64 464 59  HOH HOH A . 
G 7 HOH 65 465 115 HOH HOH A . 
G 7 HOH 66 466 64  HOH HOH A . 
G 7 HOH 67 467 119 HOH HOH A . 
G 7 HOH 68 468 116 HOH HOH A . 
G 7 HOH 69 469 126 HOH HOH A . 
G 7 HOH 70 470 137 HOH HOH A . 
G 7 HOH 71 471 85  HOH HOH A . 
G 7 HOH 72 472 99  HOH HOH A . 
H 7 HOH 1  401 31  HOH HOH B . 
H 7 HOH 2  402 71  HOH HOH B . 
H 7 HOH 3  403 112 HOH HOH B . 
H 7 HOH 4  404 41  HOH HOH B . 
H 7 HOH 5  405 15  HOH HOH B . 
H 7 HOH 6  406 40  HOH HOH B . 
H 7 HOH 7  407 49  HOH HOH B . 
H 7 HOH 8  408 114 HOH HOH B . 
H 7 HOH 9  409 83  HOH HOH B . 
H 7 HOH 10 410 62  HOH HOH B . 
H 7 HOH 11 411 130 HOH HOH B . 
H 7 HOH 12 412 34  HOH HOH B . 
H 7 HOH 13 413 97  HOH HOH B . 
H 7 HOH 14 414 26  HOH HOH B . 
H 7 HOH 15 415 105 HOH HOH B . 
H 7 HOH 16 416 52  HOH HOH B . 
H 7 HOH 17 417 25  HOH HOH B . 
H 7 HOH 18 418 66  HOH HOH B . 
H 7 HOH 19 419 5   HOH HOH B . 
H 7 HOH 20 420 39  HOH HOH B . 
H 7 HOH 21 421 84  HOH HOH B . 
H 7 HOH 22 422 79  HOH HOH B . 
H 7 HOH 23 423 14  HOH HOH B . 
H 7 HOH 24 424 65  HOH HOH B . 
H 7 HOH 25 425 108 HOH HOH B . 
H 7 HOH 26 426 43  HOH HOH B . 
H 7 HOH 27 427 101 HOH HOH B . 
H 7 HOH 28 428 122 HOH HOH B . 
H 7 HOH 29 429 88  HOH HOH B . 
H 7 HOH 30 430 67  HOH HOH B . 
H 7 HOH 31 431 91  HOH HOH B . 
H 7 HOH 32 432 78  HOH HOH B . 
H 7 HOH 33 433 89  HOH HOH B . 
H 7 HOH 34 434 70  HOH HOH B . 
H 7 HOH 35 435 22  HOH HOH B . 
H 7 HOH 36 436 56  HOH HOH B . 
H 7 HOH 37 437 3   HOH HOH B . 
H 7 HOH 38 438 45  HOH HOH B . 
H 7 HOH 39 439 32  HOH HOH B . 
H 7 HOH 40 440 60  HOH HOH B . 
H 7 HOH 41 441 51  HOH HOH B . 
H 7 HOH 42 442 10  HOH HOH B . 
H 7 HOH 43 443 131 HOH HOH B . 
H 7 HOH 44 444 24  HOH HOH B . 
H 7 HOH 45 445 9   HOH HOH B . 
H 7 HOH 46 446 124 HOH HOH B . 
H 7 HOH 47 447 96  HOH HOH B . 
H 7 HOH 48 448 113 HOH HOH B . 
H 7 HOH 49 449 29  HOH HOH B . 
H 7 HOH 50 450 81  HOH HOH B . 
H 7 HOH 51 451 100 HOH HOH B . 
H 7 HOH 52 452 107 HOH HOH B . 
H 7 HOH 53 453 68  HOH HOH B . 
H 7 HOH 54 454 76  HOH HOH B . 
H 7 HOH 55 455 75  HOH HOH B . 
H 7 HOH 56 456 98  HOH HOH B . 
H 7 HOH 57 457 73  HOH HOH B . 
H 7 HOH 58 458 127 HOH HOH B . 
H 7 HOH 59 459 129 HOH HOH B . 
H 7 HOH 60 460 69  HOH HOH B . 
H 7 HOH 61 461 86  HOH HOH B . 
H 7 HOH 62 462 104 HOH HOH B . 
H 7 HOH 63 463 138 HOH HOH B . 
H 7 HOH 64 464 123 HOH HOH B . 
H 7 HOH 65 465 128 HOH HOH B . 
H 7 HOH 66 466 58  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2680  ? 
1 MORE         -14   ? 
1 'SSA (A^2)'  24600 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-02-24 
2 'Structure model' 1 1 2018-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_CSD'                  
2 2 'Structure model' '_citation.journal_id_ISSN'                 
3 2 'Structure model' '_citation.page_first'                      
4 2 'Structure model' '_citation.page_last'                       
5 2 'Structure model' '_citation.pdbx_database_id_PubMed'         
6 2 'Structure model' '_citation.title'                           
7 2 'Structure model' '_citation_author.name'                     
8 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.5 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .      4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 15  ? ? -161.80 95.21   
2  1 THR A 30  ? ? -128.70 -157.84 
3  1 ARG A 33  ? ? 57.25   -125.04 
4  1 LYS A 74  ? ? 66.12   79.71   
5  1 LYS A 86  ? ? -112.68 -115.51 
6  1 ASN A 96  ? ? -101.60 -167.14 
7  1 SER A 127 ? ? -68.71  -178.47 
8  1 ASN A 170 ? ? 80.21   0.47    
9  1 SER A 235 ? ? -88.10  40.78   
10 1 GLN B 14  ? ? -174.25 90.58   
11 1 ASN B 80  ? ? 54.09   72.63   
12 1 GLN B 145 ? ? -160.55 -143.20 
13 1 THR B 176 ? ? -128.07 -163.87 
14 1 GLU B 244 ? ? -105.72 -137.83 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 25  ? CG  ? A ASP 25  CG  
2  1 Y 1 A ASP 25  ? OD1 ? A ASP 25  OD1 
3  1 Y 1 A ASP 25  ? OD2 ? A ASP 25  OD2 
4  1 Y 1 A GLU 29  ? CG  ? A GLU 29  CG  
5  1 Y 1 A GLU 29  ? CD  ? A GLU 29  CD  
6  1 Y 1 A GLU 29  ? OE1 ? A GLU 29  OE1 
7  1 Y 1 A GLU 29  ? OE2 ? A GLU 29  OE2 
8  1 Y 1 A ARG 33  ? CG  ? A ARG 33  CG  
9  1 Y 1 A ARG 33  ? CD  ? A ARG 33  CD  
10 1 Y 1 A ARG 33  ? NE  ? A ARG 33  NE  
11 1 Y 1 A ARG 33  ? CZ  ? A ARG 33  CZ  
12 1 Y 1 A ARG 33  ? NH1 ? A ARG 33  NH1 
13 1 Y 1 A ARG 33  ? NH2 ? A ARG 33  NH2 
14 1 Y 1 A GLN 144 ? CG  ? A GLN 144 CG  
15 1 Y 1 A GLN 144 ? CD  ? A GLN 144 CD  
16 1 Y 1 A GLN 144 ? OE1 ? A GLN 144 OE1 
17 1 Y 1 A GLN 144 ? NE2 ? A GLN 144 NE2 
18 1 Y 1 A SER 149 ? OG  ? A SER 149 OG  
19 1 Y 1 A LYS 151 ? CG  ? A LYS 151 CG  
20 1 Y 1 A LYS 151 ? CD  ? A LYS 151 CD  
21 1 Y 1 A LYS 151 ? CE  ? A LYS 151 CE  
22 1 Y 1 A LYS 151 ? NZ  ? A LYS 151 NZ  
23 1 Y 1 A LYS 194 ? CG  ? A LYS 194 CG  
24 1 Y 1 A LYS 194 ? CD  ? A LYS 194 CD  
25 1 Y 1 A LYS 194 ? CE  ? A LYS 194 CE  
26 1 Y 1 A LYS 194 ? NZ  ? A LYS 194 NZ  
27 1 Y 1 A GLU 226 ? CG  ? A GLU 226 CG  
28 1 Y 1 A GLU 226 ? CD  ? A GLU 226 CD  
29 1 Y 1 A GLU 226 ? OE1 ? A GLU 226 OE1 
30 1 Y 1 A GLU 226 ? OE2 ? A GLU 226 OE2 
31 1 Y 1 A LYS 229 ? CG  ? A LYS 229 CG  
32 1 Y 1 A LYS 229 ? CD  ? A LYS 229 CD  
33 1 Y 1 A LYS 229 ? CE  ? A LYS 229 CE  
34 1 Y 1 A LYS 229 ? NZ  ? A LYS 229 NZ  
35 1 Y 1 A SER 235 ? OG  ? A SER 235 OG  
36 1 Y 1 B THR 5   ? OG1 ? B THR 5   OG1 
37 1 Y 1 B THR 5   ? CG2 ? B THR 5   CG2 
38 1 Y 1 B ASP 50  ? CG  ? B ASP 50  CG  
39 1 Y 1 B ASP 50  ? OD1 ? B ASP 50  OD1 
40 1 Y 1 B ASP 50  ? OD2 ? B ASP 50  OD2 
41 1 Y 1 B THR 51  ? OG1 ? B THR 51  OG1 
42 1 Y 1 B THR 51  ? CG2 ? B THR 51  CG2 
43 1 Y 1 B ARG 77  ? CG  ? B ARG 77  CG  
44 1 Y 1 B ARG 77  ? CD  ? B ARG 77  CD  
45 1 Y 1 B ARG 77  ? NE  ? B ARG 77  NE  
46 1 Y 1 B ARG 77  ? CZ  ? B ARG 77  CZ  
47 1 Y 1 B ARG 77  ? NH1 ? B ARG 77  NH1 
48 1 Y 1 B ARG 77  ? NH2 ? B ARG 77  NH2 
49 1 Y 1 B ARG 98  ? CG  ? B ARG 98  CG  
50 1 Y 1 B ARG 98  ? CD  ? B ARG 98  CD  
51 1 Y 1 B ARG 98  ? NE  ? B ARG 98  NE  
52 1 Y 1 B ARG 98  ? CZ  ? B ARG 98  CZ  
53 1 Y 1 B ARG 98  ? NH1 ? B ARG 98  NH1 
54 1 Y 1 B ARG 98  ? NH2 ? B ARG 98  NH2 
55 1 Y 1 B ASN 103 ? CG  ? B ASN 103 CG  
56 1 Y 1 B ASN 103 ? OD1 ? B ASN 103 OD1 
57 1 Y 1 B ASN 103 ? ND2 ? B ASN 103 ND2 
58 1 Y 1 B LYS 104 ? CG  ? B LYS 104 CG  
59 1 Y 1 B LYS 104 ? CD  ? B LYS 104 CD  
60 1 Y 1 B LYS 104 ? CE  ? B LYS 104 CE  
61 1 Y 1 B LYS 104 ? NZ  ? B LYS 104 NZ  
62 1 Y 1 B GLU 106 ? CG  ? B GLU 106 CG  
63 1 Y 1 B GLU 106 ? CD  ? B GLU 106 CD  
64 1 Y 1 B GLU 106 ? OE1 ? B GLU 106 OE1 
65 1 Y 1 B GLU 106 ? OE2 ? B GLU 106 OE2 
66 1 Y 1 B ASP 170 ? CG  ? B ASP 170 CG  
67 1 Y 1 B ASP 170 ? OD1 ? B ASP 170 OD1 
68 1 Y 1 B ASP 170 ? OD2 ? B ASP 170 OD2 
69 1 Y 1 B LYS 171 ? CG  ? B LYS 171 CG  
70 1 Y 1 B LYS 171 ? CD  ? B LYS 171 CD  
71 1 Y 1 B LYS 171 ? CE  ? B LYS 171 CE  
72 1 Y 1 B LYS 171 ? NZ  ? B LYS 171 NZ  
73 1 Y 1 B GLU 244 ? CG  ? B GLU 244 CG  
74 1 Y 1 B GLU 244 ? CD  ? B GLU 244 CD  
75 1 Y 1 B GLU 244 ? OE1 ? B GLU 244 OE1 
76 1 Y 1 B GLU 244 ? OE2 ? B GLU 244 OE2 
77 1 Y 1 B GLN 289 ? CG  ? B GLN 289 CG  
78 1 Y 1 B GLN 289 ? CD  ? B GLN 289 CD  
79 1 Y 1 B GLN 289 ? OE1 ? B GLN 289 OE1 
80 1 Y 1 B GLN 289 ? NE2 ? B GLN 289 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1   ? A GLY 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A PRO 3   ? A PRO 3   
4  1 Y 1 A ASP 4   ? A ASP 4   
5  1 Y 1 A ASP 5   ? A ASP 5   
6  1 Y 1 A LEU 27  ? A LEU 27  
7  1 Y 1 A THR 28  ? A THR 28  
8  1 Y 1 A HIS 284 ? A HIS 284 
9  1 Y 1 A ASN 285 ? A ASN 285 
10 1 Y 1 B GLY 1   ? B GLY 1   
11 1 Y 1 B SER 2   ? B SER 2   
12 1 Y 1 B MET 3   ? B MET 3   
13 1 Y 1 B SER 4   ? B SER 4   
14 1 Y 1 B ASN 100 ? B ASN 100 
15 1 Y 1 B ASN 101 ? B ASN 101 
16 1 Y 1 B SER 102 ? B SER 102 
17 1 Y 1 B GLU 290 ? B GLU 290 
18 1 Y 1 B CYS 291 ? B CYS 291 
19 1 Y 1 B ASP 292 ? B ASP 292 
20 1 Y 1 B SER 293 ? B SER 293 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'GLUTAMIC ACID'                                                                GLU 
4 '4-[[(4-fluorophenyl)sulfonylamino]methyl]-~{N}-(pyridin-3-ylmethyl)benzamide' 5YD 
5 'CALCIUM ION'                                                                  CA  
6 GLYCINE                                                                        GLY 
7 water                                                                          HOH 
#