data_5HKZ
# 
_entry.id   5HKZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5HKZ         
WWPDB D_1000217224 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5HL0 PDB . 
unspecified 5HKW PDB . 
unspecified 5HKX PDB . 
unspecified 5HKY PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5HKZ 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lovell, S.'     1 
'Battaile, K.P.' 2 
'Mehzabeen, N.'  3 
'Zhang, N.'      4 
'Cooper, A.'     5 
'Gao, P.'        6 
'Perez, R.P.'    7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To be published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to 1.8 A Resolution (P21 form)' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, N.'        1 ? 
primary 'Ferris, D.'       2 ? 
primary 'Lovell, S.'       3 ? 
primary 'Smalter-Hall, A.' 4 ? 
primary 'Battaile, K.P.'   5 ? 
primary 'Anbanandam, A.'   6 ? 
primary 'Gao, P.'          7 ? 
primary 'Hanzlik, R.'      8 ? 
primary 'Perez, R.P.'      9 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   107.150 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5HKZ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     50.164 
_cell.length_a_esd                 ? 
_cell.length_b                     56.572 
_cell.length_b_esd                 ? 
_cell.length_c                     58.228 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5HKZ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'E3 ubiquitin-protein ligase CBL' 35702.219 1   6.3.2.- ? 
'Tyrosine kinase binding domain (TKBD), residues 47-351' ? 
2 polymer     syn 'Protein sprouty homolog 2'       2992.173  1   ?       ? 'unp residues 36-60' ? 
3 non-polymer syn 'SODIUM ION'                      22.990    1   ?       ? ? ? 
4 water       nat water                             18.015    206 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Casitas B-lineage lymphoma proto-oncogene,Proto-oncogene c-Cbl,RING finger protein 55,Signal transduction protein CBL' 
2 Spry-2                                                                                                                  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;SNAPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLM
KKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWK
SFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQK
FIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTG
;
;SNAPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLM
KKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWK
SFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQK
FIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTG
;
A ? 
2 'polypeptide(L)' no yes '(ACE)QQVHVLSLDQIRAIRNTNE(PTR)TEGPT' XQQVHVLSLDQIRAIRNTNEYTEGPT B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   PRO n 
1 5   PRO n 
1 6   GLY n 
1 7   THR n 
1 8   VAL n 
1 9   ASP n 
1 10  LYS n 
1 11  LYS n 
1 12  MET n 
1 13  VAL n 
1 14  GLU n 
1 15  LYS n 
1 16  CYS n 
1 17  TRP n 
1 18  LYS n 
1 19  LEU n 
1 20  MET n 
1 21  ASP n 
1 22  LYS n 
1 23  VAL n 
1 24  VAL n 
1 25  ARG n 
1 26  LEU n 
1 27  CYS n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  LYS n 
1 32  LEU n 
1 33  ALA n 
1 34  LEU n 
1 35  LYS n 
1 36  ASN n 
1 37  SER n 
1 38  PRO n 
1 39  PRO n 
1 40  TYR n 
1 41  ILE n 
1 42  LEU n 
1 43  ASP n 
1 44  LEU n 
1 45  LEU n 
1 46  PRO n 
1 47  ASP n 
1 48  THR n 
1 49  TYR n 
1 50  GLN n 
1 51  HIS n 
1 52  LEU n 
1 53  ARG n 
1 54  THR n 
1 55  ILE n 
1 56  LEU n 
1 57  SER n 
1 58  ARG n 
1 59  TYR n 
1 60  GLU n 
1 61  GLY n 
1 62  LYS n 
1 63  MET n 
1 64  GLU n 
1 65  THR n 
1 66  LEU n 
1 67  GLY n 
1 68  GLU n 
1 69  ASN n 
1 70  GLU n 
1 71  TYR n 
1 72  PHE n 
1 73  ARG n 
1 74  VAL n 
1 75  PHE n 
1 76  MET n 
1 77  GLU n 
1 78  ASN n 
1 79  LEU n 
1 80  MET n 
1 81  LYS n 
1 82  LYS n 
1 83  THR n 
1 84  LYS n 
1 85  GLN n 
1 86  THR n 
1 87  ILE n 
1 88  SER n 
1 89  LEU n 
1 90  PHE n 
1 91  LYS n 
1 92  GLU n 
1 93  GLY n 
1 94  LYS n 
1 95  GLU n 
1 96  ARG n 
1 97  MET n 
1 98  TYR n 
1 99  GLU n 
1 100 GLU n 
1 101 ASN n 
1 102 SER n 
1 103 GLN n 
1 104 PRO n 
1 105 ARG n 
1 106 ARG n 
1 107 ASN n 
1 108 LEU n 
1 109 THR n 
1 110 LYS n 
1 111 LEU n 
1 112 SER n 
1 113 LEU n 
1 114 ILE n 
1 115 PHE n 
1 116 SER n 
1 117 HIS n 
1 118 MET n 
1 119 LEU n 
1 120 ALA n 
1 121 GLU n 
1 122 LEU n 
1 123 LYS n 
1 124 GLY n 
1 125 ILE n 
1 126 PHE n 
1 127 PRO n 
1 128 SER n 
1 129 GLY n 
1 130 LEU n 
1 131 PHE n 
1 132 GLN n 
1 133 GLY n 
1 134 ASP n 
1 135 THR n 
1 136 PHE n 
1 137 ARG n 
1 138 ILE n 
1 139 THR n 
1 140 LYS n 
1 141 ALA n 
1 142 ASP n 
1 143 ALA n 
1 144 ALA n 
1 145 GLU n 
1 146 PHE n 
1 147 TRP n 
1 148 ARG n 
1 149 LYS n 
1 150 ALA n 
1 151 PHE n 
1 152 GLY n 
1 153 GLU n 
1 154 LYS n 
1 155 THR n 
1 156 ILE n 
1 157 VAL n 
1 158 PRO n 
1 159 TRP n 
1 160 LYS n 
1 161 SER n 
1 162 PHE n 
1 163 ARG n 
1 164 GLN n 
1 165 ALA n 
1 166 LEU n 
1 167 HIS n 
1 168 GLU n 
1 169 VAL n 
1 170 HIS n 
1 171 PRO n 
1 172 ILE n 
1 173 SER n 
1 174 SER n 
1 175 GLY n 
1 176 LEU n 
1 177 GLU n 
1 178 ALA n 
1 179 MET n 
1 180 ALA n 
1 181 LEU n 
1 182 LYS n 
1 183 SER n 
1 184 THR n 
1 185 ILE n 
1 186 ASP n 
1 187 LEU n 
1 188 THR n 
1 189 CYS n 
1 190 ASN n 
1 191 ASP n 
1 192 TYR n 
1 193 ILE n 
1 194 SER n 
1 195 VAL n 
1 196 PHE n 
1 197 GLU n 
1 198 PHE n 
1 199 ASP n 
1 200 ILE n 
1 201 PHE n 
1 202 THR n 
1 203 ARG n 
1 204 LEU n 
1 205 PHE n 
1 206 GLN n 
1 207 PRO n 
1 208 TRP n 
1 209 SER n 
1 210 SER n 
1 211 LEU n 
1 212 LEU n 
1 213 ARG n 
1 214 ASN n 
1 215 TRP n 
1 216 ASN n 
1 217 SER n 
1 218 LEU n 
1 219 ALA n 
1 220 VAL n 
1 221 THR n 
1 222 HIS n 
1 223 PRO n 
1 224 GLY n 
1 225 TYR n 
1 226 MET n 
1 227 ALA n 
1 228 PHE n 
1 229 LEU n 
1 230 THR n 
1 231 TYR n 
1 232 ASP n 
1 233 GLU n 
1 234 VAL n 
1 235 LYS n 
1 236 ALA n 
1 237 ARG n 
1 238 LEU n 
1 239 GLN n 
1 240 LYS n 
1 241 PHE n 
1 242 ILE n 
1 243 HIS n 
1 244 LYS n 
1 245 PRO n 
1 246 GLY n 
1 247 SER n 
1 248 TYR n 
1 249 ILE n 
1 250 PHE n 
1 251 ARG n 
1 252 LEU n 
1 253 SER n 
1 254 CYS n 
1 255 THR n 
1 256 ARG n 
1 257 LEU n 
1 258 GLY n 
1 259 GLN n 
1 260 TRP n 
1 261 ALA n 
1 262 ILE n 
1 263 GLY n 
1 264 TYR n 
1 265 VAL n 
1 266 THR n 
1 267 ALA n 
1 268 ASP n 
1 269 GLY n 
1 270 ASN n 
1 271 ILE n 
1 272 LEU n 
1 273 GLN n 
1 274 THR n 
1 275 ILE n 
1 276 PRO n 
1 277 HIS n 
1 278 ASN n 
1 279 LYS n 
1 280 PRO n 
1 281 LEU n 
1 282 PHE n 
1 283 GLN n 
1 284 ALA n 
1 285 LEU n 
1 286 ILE n 
1 287 ASP n 
1 288 GLY n 
1 289 PHE n 
1 290 ARG n 
1 291 GLU n 
1 292 GLY n 
1 293 PHE n 
1 294 TYR n 
1 295 LEU n 
1 296 PHE n 
1 297 PRO n 
1 298 ASP n 
1 299 GLY n 
1 300 ARG n 
1 301 ASN n 
1 302 GLN n 
1 303 ASN n 
1 304 PRO n 
1 305 ASP n 
1 306 LEU n 
1 307 THR n 
1 308 GLY n 
2 1   ACE n 
2 2   GLN n 
2 3   GLN n 
2 4   VAL n 
2 5   HIS n 
2 6   VAL n 
2 7   LEU n 
2 8   SER n 
2 9   LEU n 
2 10  ASP n 
2 11  GLN n 
2 12  ILE n 
2 13  ARG n 
2 14  ALA n 
2 15  ILE n 
2 16  ARG n 
2 17  ASN n 
2 18  THR n 
2 19  ASN n 
2 20  GLU n 
2 21  PTR n 
2 22  THR n 
2 23  GLU n 
2 24  GLY n 
2 25  PRO n 
2 26  THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   308 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CBL, CBL2, RNF55' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) pLyseS-RARE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTBSG 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       26 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'Synthesized by New England Peptide with an acetylated N-terminus' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CBL_HUMAN  P22681 ? 1 
;PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKT
KQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFR
QALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIH
KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTG
;
47 
2 UNP SPY2_HUMAN O43597 ? 2 QQVHVLSLDQIRAIRNTNEYTEGPT 36 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5HKZ A 4 ? 308 ? P22681 47 ? 351 ? 47 351 
2 2 5HKZ B 2 ? 26  ? O43597 36 ? 60  ? 36 60  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5HKZ SER A 1 ? UNP P22681 ? ? 'expression tag' 44 1 
1 5HKZ ASN A 2 ? UNP P22681 ? ? 'expression tag' 45 2 
1 5HKZ ALA A 3 ? UNP P22681 ? ? 'expression tag' 46 3 
2 5HKZ ACE B 1 ? UNP O43597 ? ? acetylation      35 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'    ?                 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'      ?                 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5HKZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.04 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         39.71 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% (w/v) PEG 2000 MME, 0.1M HEPES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-04-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            22.550 
_reflns.entry_id                         5HKZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.800 
_reflns.d_resolution_low                 43.150 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       28815 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.400 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.300 
_reflns.pdbx_Rmerge_I_obs                0.054 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             2 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         95633 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.800 1.840  ? 1.900  5436 ? ? 1673 ? 99.400 ? ? ? ? 0.665 ? ? ? ? ? ? ? ? 3.200 ? ? ? ? ? ? 0 1 1 0.652 ? 
9.000 43.150 ? 58.100 816  ? ? 250  ? 97.100 ? ? ? ? 0.018 ? ? ? ? ? ? ? ? 3.300 ? ? ? ? ? ? 0 2 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                70.550 
_refine.B_iso_mean                               25.0576 
_refine.B_iso_min                                9.700 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5HKZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8000 
_refine.ls_d_res_low                             39.6680 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28798 
_refine.ls_number_reflns_R_free                  1401 
_refine.ls_number_reflns_R_work                  27397 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.2900 
_refine.ls_percent_reflns_R_free                 4.8600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1642 
_refine.ls_R_factor_R_free                       0.2126 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1618 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.080 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3BUM 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.2800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.8000 
_refine_hist.d_res_low                        39.6680 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             206 
_refine_hist.number_atoms_total               2781 
_refine_hist.pdbx_number_residues_total       328 
_refine_hist.pdbx_B_iso_mean_ligand           17.24 
_refine_hist.pdbx_B_iso_mean_solvent          32.21 
_refine_hist.pdbx_number_atoms_protein        2574 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  ? 2659 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.996  ? 3620 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.052  ? 403  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 459  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.740 ? 956  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8001 1.8644  2830 . 123 2707 99.0000  . . . 0.3110 . 0.2477 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.8644 1.9391  2891 . 158 2733 99.0000  . . . 0.2635 . 0.2276 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.9391 2.0273  2830 . 136 2694 99.0000  . . . 0.2737 . 0.1884 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.0273 2.1342  2873 . 123 2750 99.0000  . . . 0.2645 . 0.1698 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.1342 2.2679  2873 . 152 2721 100.0000 . . . 0.2288 . 0.1643 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.2679 2.4430  2896 . 156 2740 100.0000 . . . 0.2221 . 0.1562 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.4430 2.6888  2896 . 150 2746 100.0000 . . . 0.2294 . 0.1531 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.6888 3.0777  2880 . 127 2753 100.0000 . . . 0.2248 . 0.1568 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.0777 3.8771  2896 . 149 2747 99.0000  . . . 0.1747 . 0.1465 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.8771 39.6777 2933 . 127 2806 98.0000  . . . 0.1762 . 0.1527 . . . . . . 10 . . . 
# 
_struct.entry_id                     5HKZ 
_struct.title                        
'Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to 1.8 A Resolution (P21 form)' 
_struct.pdbx_descriptor              'E3 ubiquitin-protein ligase CBL (E.C.6.3.2.-), Protein sprouty homolog 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5HKZ 
_struct_keywords.text            'SPRY2, Cbl, Protein-protein interaction, anticancer target, LIGASE' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 9   ? CYS A 27  ? ASP A 52  CYS A 70  1 ? 19 
HELX_P HELX_P2  AA2 TYR A 40  ? TYR A 59  ? TYR A 83  TYR A 102 1 ? 20 
HELX_P HELX_P3  AA3 LYS A 62  ? ASN A 69  ? LYS A 105 ASN A 112 1 ? 8  
HELX_P HELX_P4  AA4 ASN A 69  ? LYS A 94  ? ASN A 112 LYS A 137 1 ? 26 
HELX_P HELX_P5  AA5 GLU A 95  ? GLU A 99  ? GLU A 138 GLU A 142 5 ? 5  
HELX_P HELX_P6  AA6 SER A 102 ? PHE A 126 ? SER A 145 PHE A 169 1 ? 25 
HELX_P HELX_P7  AA7 GLN A 132 ? PHE A 136 ? GLN A 175 PHE A 179 5 ? 5  
HELX_P HELX_P8  AA8 LYS A 140 ? GLY A 152 ? LYS A 183 GLY A 195 1 ? 13 
HELX_P HELX_P9  AA9 TRP A 159 ? GLU A 168 ? TRP A 202 GLU A 211 1 ? 10 
HELX_P HELX_P10 AB1 GLY A 175 ? ASP A 186 ? GLY A 218 ASP A 229 1 ? 12 
HELX_P HELX_P11 AB2 VAL A 195 ? PHE A 205 ? VAL A 238 PHE A 248 1 ? 11 
HELX_P HELX_P12 AB3 PRO A 207 ? SER A 209 ? PRO A 250 SER A 252 5 ? 3  
HELX_P HELX_P13 AB4 SER A 210 ? VAL A 220 ? SER A 253 VAL A 263 1 ? 11 
HELX_P HELX_P14 AB5 THR A 230 ? LYS A 240 ? THR A 273 LYS A 283 1 ? 11 
HELX_P HELX_P15 AB6 PRO A 280 ? GLU A 291 ? PRO A 323 GLU A 334 1 ? 12 
HELX_P HELX_P16 AB7 SER B 8   ? ILE B 12  ? SER B 42  ILE B 46  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ?    ? A ASP 186 OD1 ? ? ? 1_555 C NA  .  NA ? ? A ASP 229 A NA  401 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc2 metalc ?    ? A THR 188 OG1 ? ? ? 1_555 C NA  .  NA ? ? A THR 231 A NA  401 1_555 ? ? ? ? ? ? ? 2.894 ? 
metalc3 metalc ?    ? A ASN 190 OD1 ? ? ? 1_555 C NA  .  NA ? ? A ASN 233 A NA  401 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc4 metalc ?    ? A TYR 192 O   ? ? ? 1_555 C NA  .  NA ? ? A TYR 235 A NA  401 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc5 metalc ?    ? A GLU 197 OE1 ? ? ? 1_555 C NA  .  NA ? ? A GLU 240 A NA  401 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc6 metalc ?    ? A GLU 197 OE2 ? ? ? 1_555 C NA  .  NA ? ? A GLU 240 A NA  401 1_555 ? ? ? ? ? ? ? 2.457 ? 
covale1 covale both ? B ACE 1   C   ? ? ? 1_555 B GLN 2  N  ? ? B ACE 35  B GLN 36  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale both ? B GLU 20  C   ? ? ? 1_555 B PTR 21 N  ? ? B GLU 54  B PTR 55  1_555 ? ? ? ? ? ? ? 1.340 ? 
covale3 covale both ? B PTR 21  C   ? ? ? 1_555 B THR 22 N  ? ? B PTR 55  B THR 56  1_555 ? ? ? ? ? ? ? 1.322 ? 
metalc7 metalc ?    ? C NA  .   NA  ? ? ? 1_555 D HOH .  O  ? ? A NA  401 A HOH 558 1_555 ? ? ? ? ? ? ? 2.934 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 38  A . ? PRO 81  A PRO 39  A ? PRO 82  A 1 3.72 
2 GLN 206 A . ? GLN 249 A PRO 207 A ? PRO 250 A 1 1.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 156 ? PRO A 158 ? ILE A 199 PRO A 201 
AA1 2 TYR A 192 ? SER A 194 ? TYR A 235 SER A 237 
AA2 1 ILE A 271 ? THR A 274 ? ILE A 314 THR A 317 
AA2 2 TRP A 260 ? VAL A 265 ? TRP A 303 VAL A 308 
AA2 3 SER A 247 ? LEU A 252 ? SER A 290 LEU A 295 
AA2 4 PHE A 296 ? PRO A 297 ? PHE A 339 PRO A 340 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 157 ? N VAL A 200 O ILE A 193 ? O ILE A 236 
AA2 1 2 O THR A 274 ? O THR A 317 N ILE A 262 ? N ILE A 305 
AA2 2 3 O GLY A 263 ? O GLY A 306 N ILE A 249 ? N ILE A 292 
AA2 3 4 N TYR A 248 ? N TYR A 291 O PHE A 296 ? O PHE A 339 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NA 
_struct_site.pdbx_auth_seq_id     401 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue NA A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 ASP A 186 ? ASP A 229 . ? 1_555 ? 
2 AC1 6 THR A 188 ? THR A 231 . ? 1_555 ? 
3 AC1 6 ASN A 190 ? ASN A 233 . ? 1_555 ? 
4 AC1 6 TYR A 192 ? TYR A 235 . ? 1_555 ? 
5 AC1 6 GLU A 197 ? GLU A 240 . ? 1_555 ? 
6 AC1 6 HOH D .   ? HOH A 558 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5HKZ 
_atom_sites.fract_transf_matrix[1][1]   0.019935 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006153 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017677 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017973 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 5   ? -9.843  4.981   -42.075 1.00 51.97 ? 48  PRO A N   1 
ATOM   2    C  CA  . PRO A 1 5   ? -8.763  4.387   -42.873 1.00 51.12 ? 48  PRO A CA  1 
ATOM   3    C  C   . PRO A 1 5   ? -9.258  3.631   -44.094 1.00 40.24 ? 48  PRO A C   1 
ATOM   4    O  O   . PRO A 1 5   ? -10.314 2.988   -44.067 1.00 39.23 ? 48  PRO A O   1 
ATOM   5    C  CB  . PRO A 1 5   ? -8.087  3.411   -41.896 1.00 37.09 ? 48  PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 5   ? -8.897  3.448   -40.628 1.00 41.31 ? 48  PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 5   ? -10.200 4.112   -40.945 1.00 54.60 ? 48  PRO A CD  1 
ATOM   8    N  N   . GLY A 1 6   ? -8.459  3.672   -45.146 1.00 39.54 ? 49  GLY A N   1 
ATOM   9    C  CA  . GLY A 1 6   ? -8.878  3.120   -46.411 1.00 37.62 ? 49  GLY A CA  1 
ATOM   10   C  C   . GLY A 1 6   ? -8.926  1.604   -46.418 1.00 49.16 ? 49  GLY A C   1 
ATOM   11   O  O   . GLY A 1 6   ? -8.337  0.917   -45.578 1.00 42.05 ? 49  GLY A O   1 
ATOM   12   N  N   . THR A 1 7   ? -9.655  1.082   -47.412 1.00 41.57 ? 50  THR A N   1 
ATOM   13   C  CA  . THR A 1 7   ? -9.661  -0.348  -47.693 1.00 35.19 ? 50  THR A CA  1 
ATOM   14   C  C   . THR A 1 7   ? -8.236  -0.848  -47.912 1.00 33.39 ? 50  THR A C   1 
ATOM   15   O  O   . THR A 1 7   ? -7.383  -0.139  -48.454 1.00 29.60 ? 50  THR A O   1 
ATOM   16   C  CB  . THR A 1 7   ? -10.528 -0.638  -48.925 1.00 37.96 ? 50  THR A CB  1 
ATOM   17   O  OG1 . THR A 1 7   ? -11.888 -0.265  -48.653 1.00 42.23 ? 50  THR A OG1 1 
ATOM   18   C  CG2 . THR A 1 7   ? -10.498 -2.129  -49.283 1.00 47.94 ? 50  THR A CG2 1 
ATOM   19   N  N   . VAL A 1 8   ? -7.987  -2.076  -47.471 1.00 27.76 ? 51  VAL A N   1 
ATOM   20   C  CA  . VAL A 1 8   ? -6.689  -2.726  -47.596 1.00 29.36 ? 51  VAL A CA  1 
ATOM   21   C  C   . VAL A 1 8   ? -6.798  -3.693  -48.759 1.00 22.70 ? 51  VAL A C   1 
ATOM   22   O  O   . VAL A 1 8   ? -7.694  -4.546  -48.770 1.00 30.76 ? 51  VAL A O   1 
ATOM   23   C  CB  . VAL A 1 8   ? -6.302  -3.480  -46.307 1.00 26.65 ? 51  VAL A CB  1 
ATOM   24   C  CG1 . VAL A 1 8   ? -4.980  -4.231  -46.492 1.00 32.17 ? 51  VAL A CG1 1 
ATOM   25   C  CG2 . VAL A 1 8   ? -6.223  -2.542  -45.130 1.00 30.26 ? 51  VAL A CG2 1 
ATOM   26   N  N   . ASP A 1 9   ? -5.915  -3.562  -49.747 1.00 28.90 ? 52  ASP A N   1 
ATOM   27   C  CA  . ASP A 1 9   ? -5.822  -4.571  -50.785 1.00 30.37 ? 52  ASP A CA  1 
ATOM   28   C  C   . ASP A 1 9   ? -4.441  -5.199  -50.702 1.00 33.58 ? 52  ASP A C   1 
ATOM   29   O  O   . ASP A 1 9   ? -3.584  -4.761  -49.931 1.00 24.67 ? 52  ASP A O   1 
ATOM   30   C  CB  . ASP A 1 9   ? -6.114  -4.000  -52.184 1.00 29.99 ? 52  ASP A CB  1 
ATOM   31   C  CG  . ASP A 1 9   ? -5.204  -2.860  -52.573 1.00 38.73 ? 52  ASP A CG  1 
ATOM   32   O  OD1 . ASP A 1 9   ? -4.236  -2.558  -51.840 1.00 34.31 ? 52  ASP A OD1 1 
ATOM   33   O  OD2 . ASP A 1 9   ? -5.460  -2.263  -53.638 1.00 44.01 ? 52  ASP A OD2 1 
ATOM   34   N  N   . LYS A 1 10  ? -4.246  -6.257  -51.488 1.00 30.27 ? 53  LYS A N   1 
ATOM   35   C  CA  . LYS A 1 10  ? -2.990  -6.991  -51.428 1.00 33.56 ? 53  LYS A CA  1 
ATOM   36   C  C   . LYS A 1 10  ? -1.807  -6.084  -51.738 1.00 29.67 ? 53  LYS A C   1 
ATOM   37   O  O   . LYS A 1 10  ? -0.734  -6.253  -51.151 1.00 29.90 ? 53  LYS A O   1 
ATOM   38   C  CB  . LYS A 1 10  ? -3.035  -8.189  -52.383 1.00 33.43 ? 53  LYS A CB  1 
ATOM   39   N  N   . LYS A 1 11  ? -1.988  -5.102  -52.625 1.00 30.14 ? 54  LYS A N   1 
ATOM   40   C  CA  . LYS A 1 11  ? -0.901  -4.196  -52.996 1.00 30.86 ? 54  LYS A CA  1 
ATOM   41   C  C   . LYS A 1 11  ? -0.466  -3.297  -51.835 1.00 26.06 ? 54  LYS A C   1 
ATOM   42   O  O   . LYS A 1 11  ? 0.714   -2.924  -51.741 1.00 25.42 ? 54  LYS A O   1 
ATOM   43   C  CB  . LYS A 1 11  ? -1.332  -3.344  -54.189 1.00 38.27 ? 54  LYS A CB  1 
ATOM   44   N  N   . MET A 1 12  ? -1.395  -2.911  -50.962 1.00 26.56 ? 55  MET A N   1 
ATOM   45   C  CA  . MET A 1 12  ? -1.021  -2.134  -49.789 1.00 23.54 ? 55  MET A CA  1 
ATOM   46   C  C   . MET A 1 12  ? -0.213  -2.982  -48.815 1.00 23.59 ? 55  MET A C   1 
ATOM   47   O  O   . MET A 1 12  ? 0.741   -2.497  -48.190 1.00 22.91 ? 55  MET A O   1 
ATOM   48   C  CB  . MET A 1 12  ? -2.268  -1.576  -49.088 1.00 24.39 ? 55  MET A CB  1 
ATOM   49   C  CG  . MET A 1 12  ? -1.916  -0.859  -47.784 1.00 34.88 ? 55  MET A CG  1 
ATOM   50   S  SD  . MET A 1 12  ? -3.323  -0.310  -46.809 1.00 42.81 ? 55  MET A SD  1 
ATOM   51   C  CE  . MET A 1 12  ? -2.458  0.362   -45.380 1.00 36.57 ? 55  MET A CE  1 
ATOM   52   N  N   . VAL A 1 13  ? -0.612  -4.242  -48.647 1.00 25.58 ? 56  VAL A N   1 
ATOM   53   C  CA  . VAL A 1 13  ? 0.070   -5.111  -47.699 1.00 18.93 ? 56  VAL A CA  1 
ATOM   54   C  C   . VAL A 1 13  ? 1.486   -5.357  -48.180 1.00 24.87 ? 56  VAL A C   1 
ATOM   55   O  O   . VAL A 1 13  ? 2.444   -5.294  -47.402 1.00 24.92 ? 56  VAL A O   1 
ATOM   56   C  CB  . VAL A 1 13  ? -0.708  -6.434  -47.512 1.00 26.66 ? 56  VAL A CB  1 
ATOM   57   C  CG1 . VAL A 1 13  ? 0.086   -7.397  -46.594 1.00 23.80 ? 56  VAL A CG1 1 
ATOM   58   C  CG2 . VAL A 1 13  ? -2.127  -6.191  -46.946 1.00 23.54 ? 56  VAL A CG2 1 
ATOM   59   N  N   . GLU A 1 14  ? 1.648   -5.593  -49.481 1.00 27.22 ? 57  GLU A N   1 
ATOM   60   C  CA  . GLU A 1 14  ? 2.979   -5.852  -50.014 1.00 28.58 ? 57  GLU A CA  1 
ATOM   61   C  C   . GLU A 1 14  ? 3.855   -4.612  -49.955 1.00 26.10 ? 57  GLU A C   1 
ATOM   62   O  O   . GLU A 1 14  ? 5.075   -4.725  -49.777 1.00 25.91 ? 57  GLU A O   1 
ATOM   63   C  CB  . GLU A 1 14  ? 2.860   -6.401  -51.438 1.00 32.71 ? 57  GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 14  ? 2.187   -7.771  -51.460 1.00 44.48 ? 57  GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 14  ? 2.352   -8.512  -52.774 1.00 59.37 ? 57  GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 14  ? 3.136   -9.490  -52.813 1.00 70.55 ? 57  GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 14  ? 1.689   -8.123  -53.759 1.00 52.98 ? 57  GLU A OE2 1 
ATOM   68   N  N   . LYS A 1 15  ? 3.265   -3.425  -50.082 1.00 22.09 ? 58  LYS A N   1 
ATOM   69   C  CA  . LYS A 1 15  ? 4.045   -2.210  -49.898 1.00 22.90 ? 58  LYS A CA  1 
ATOM   70   C  C   . LYS A 1 15  ? 4.504   -2.080  -48.453 1.00 24.85 ? 58  LYS A C   1 
ATOM   71   O  O   . LYS A 1 15  ? 5.634   -1.660  -48.184 1.00 24.15 ? 58  LYS A O   1 
ATOM   72   C  CB  . LYS A 1 15  ? 3.233   -0.981  -50.279 1.00 24.44 ? 58  LYS A CB  1 
ATOM   73   C  CG  . LYS A 1 15  ? 3.944   0.315   -49.960 1.00 29.88 ? 58  LYS A CG  1 
ATOM   74   C  CD  . LYS A 1 15  ? 3.031   1.522   -50.085 1.00 47.88 ? 58  LYS A CD  1 
ATOM   75   C  CE  . LYS A 1 15  ? 3.814   2.821   -49.862 1.00 47.96 ? 58  LYS A CE  1 
ATOM   76   N  NZ  . LYS A 1 15  ? 2.923   3.994   -49.659 1.00 54.72 ? 58  LYS A NZ  1 
ATOM   77   N  N   . CYS A 1 16  ? 3.616   -2.396  -47.511 1.00 21.04 ? 59  CYS A N   1 
ATOM   78   C  CA  . CYS A 1 16  ? 3.997   -2.395  -46.109 1.00 19.44 ? 59  CYS A CA  1 
ATOM   79   C  C   . CYS A 1 16  ? 5.137   -3.391  -45.847 1.00 14.33 ? 59  CYS A C   1 
ATOM   80   O  O   . CYS A 1 16  ? 6.104   -3.070  -45.148 1.00 19.06 ? 59  CYS A O   1 
ATOM   81   C  CB  . CYS A 1 16  ? 2.770   -2.701  -45.266 1.00 22.60 ? 59  CYS A CB  1 
ATOM   82   S  SG  . CYS A 1 16  ? 3.029   -2.376  -43.546 1.00 31.28 ? 59  CYS A SG  1 
ATOM   83   N  N   . TRP A 1 17  ? 5.057   -4.586  -46.434 1.00 17.04 ? 60  TRP A N   1 
ATOM   84   C  CA  . TRP A 1 17  ? 6.132   -5.569  -46.274 1.00 19.63 ? 60  TRP A CA  1 
ATOM   85   C  C   . TRP A 1 17  ? 7.470   -5.047  -46.803 1.00 18.51 ? 60  TRP A C   1 
ATOM   86   O  O   . TRP A 1 17  ? 8.521   -5.285  -46.201 1.00 19.90 ? 60  TRP A O   1 
ATOM   87   C  CB  . TRP A 1 17  ? 5.759   -6.858  -46.993 1.00 20.26 ? 60  TRP A CB  1 
ATOM   88   C  CG  . TRP A 1 17  ? 4.681   -7.674  -46.347 1.00 16.82 ? 60  TRP A CG  1 
ATOM   89   C  CD1 . TRP A 1 17  ? 4.184   -7.540  -45.084 1.00 18.30 ? 60  TRP A CD1 1 
ATOM   90   C  CD2 . TRP A 1 17  ? 3.968   -8.768  -46.946 1.00 16.88 ? 60  TRP A CD2 1 
ATOM   91   N  NE1 . TRP A 1 17  ? 3.196   -8.481  -44.866 1.00 18.16 ? 60  TRP A NE1 1 
ATOM   92   C  CE2 . TRP A 1 17  ? 3.063   -9.255  -45.987 1.00 15.22 ? 60  TRP A CE2 1 
ATOM   93   C  CE3 . TRP A 1 17  ? 4.015   -9.384  -48.196 1.00 20.91 ? 60  TRP A CE3 1 
ATOM   94   C  CZ2 . TRP A 1 17  ? 2.210   -10.314 -46.248 1.00 20.53 ? 60  TRP A CZ2 1 
ATOM   95   C  CZ3 . TRP A 1 17  ? 3.173   -10.447 -48.445 1.00 22.24 ? 60  TRP A CZ3 1 
ATOM   96   C  CH2 . TRP A 1 17  ? 2.278   -10.894 -47.486 1.00 21.28 ? 60  TRP A CH2 1 
ATOM   97   N  N   . LYS A 1 18  ? 7.461   -4.359  -47.942 1.00 18.30 ? 61  LYS A N   1 
ATOM   98   C  CA  . LYS A 1 18  ? 8.683   -3.750  -48.449 1.00 26.64 ? 61  LYS A CA  1 
ATOM   99   C  C   . LYS A 1 18  ? 9.268   -2.742  -47.465 1.00 18.99 ? 61  LYS A C   1 
ATOM   100  O  O   . LYS A 1 18  ? 10.488  -2.703  -47.269 1.00 18.47 ? 61  LYS A O   1 
ATOM   101  C  CB  . LYS A 1 18  ? 8.414   -3.083  -49.803 1.00 29.08 ? 61  LYS A CB  1 
ATOM   102  C  CG  . LYS A 1 18  ? 8.336   -4.078  -50.947 1.00 29.19 ? 61  LYS A CG  1 
ATOM   103  N  N   . LEU A 1 19  ? 8.428   -1.895  -46.867 1.00 19.23 ? 62  LEU A N   1 
ATOM   104  C  CA  . LEU A 1 19  ? 8.916   -0.919  -45.894 1.00 21.83 ? 62  LEU A CA  1 
ATOM   105  C  C   . LEU A 1 19  ? 9.450   -1.620  -44.646 1.00 19.29 ? 62  LEU A C   1 
ATOM   106  O  O   . LEU A 1 19  ? 10.467  -1.203  -44.076 1.00 15.23 ? 62  LEU A O   1 
ATOM   107  C  CB  . LEU A 1 19  ? 7.803   0.071   -45.527 1.00 20.21 ? 62  LEU A CB  1 
ATOM   108  C  CG  . LEU A 1 19  ? 7.267   0.930   -46.679 1.00 23.13 ? 62  LEU A CG  1 
ATOM   109  C  CD1 . LEU A 1 19  ? 5.980   1.639   -46.294 1.00 27.45 ? 62  LEU A CD1 1 
ATOM   110  C  CD2 . LEU A 1 19  ? 8.320   1.940   -47.029 1.00 31.92 ? 62  LEU A CD2 1 
ATOM   111  N  N   . MET A 1 20  ? 8.796   -2.710  -44.244 1.00 17.64 ? 63  MET A N   1 
ATOM   112  C  CA  . MET A 1 20  ? 9.252   -3.485  -43.092 1.00 19.36 ? 63  MET A CA  1 
ATOM   113  C  C   . MET A 1 20  ? 10.598  -4.139  -43.386 1.00 15.58 ? 63  MET A C   1 
ATOM   114  O  O   . MET A 1 20  ? 11.488  -4.180  -42.523 1.00 14.12 ? 63  MET A O   1 
ATOM   115  C  CB  . MET A 1 20  ? 8.203   -4.549  -42.727 1.00 19.01 ? 63  MET A CB  1 
ATOM   116  C  CG  . MET A 1 20  ? 6.915   -4.005  -42.163 1.00 16.17 ? 63  MET A CG  1 
ATOM   117  S  SD  . MET A 1 20  ? 5.583   -5.212  -42.211 1.00 19.77 ? 63  MET A SD  1 
ATOM   118  C  CE  . MET A 1 20  ? 6.068   -6.223  -40.843 1.00 19.86 ? 63  MET A CE  1 
ATOM   119  N  N   . ASP A 1 21  ? 10.768  -4.628  -44.609 1.00 14.81 ? 64  ASP A N   1 
ATOM   120  C  CA  . ASP A 1 21  ? 12.064  -5.174  -45.012 1.00 19.87 ? 64  ASP A CA  1 
ATOM   121  C  C   . ASP A 1 21  ? 13.143  -4.104  -44.959 1.00 19.47 ? 64  ASP A C   1 
ATOM   122  O  O   . ASP A 1 21  ? 14.271  -4.367  -44.524 1.00 16.12 ? 64  ASP A O   1 
ATOM   123  C  CB  . ASP A 1 21  ? 11.979  -5.787  -46.412 1.00 17.44 ? 64  ASP A CB  1 
ATOM   124  C  CG  . ASP A 1 21  ? 13.289  -6.493  -46.820 1.00 26.64 ? 64  ASP A CG  1 
ATOM   125  O  OD1 . ASP A 1 21  ? 13.710  -7.435  -46.116 1.00 25.94 ? 64  ASP A OD1 1 
ATOM   126  O  OD2 . ASP A 1 21  ? 13.937  -6.089  -47.813 1.00 26.39 ? 64  ASP A OD2 1 
ATOM   127  N  N   . LYS A 1 22  ? 12.815  -2.867  -45.351 1.00 17.82 ? 65  LYS A N   1 
ATOM   128  C  CA  . LYS A 1 22  ? 13.824  -1.822  -45.261 1.00 15.92 ? 65  LYS A CA  1 
ATOM   129  C  C   . LYS A 1 22  ? 14.239  -1.574  -43.819 1.00 17.25 ? 65  LYS A C   1 
ATOM   130  O  O   . LYS A 1 22  ? 15.432  -1.415  -43.532 1.00 17.67 ? 65  LYS A O   1 
ATOM   131  C  CB  . LYS A 1 22  ? 13.328  -0.539  -45.930 1.00 20.04 ? 65  LYS A CB  1 
ATOM   132  C  CG  . LYS A 1 22  ? 14.326  0.592   -45.874 1.00 32.16 ? 65  LYS A CG  1 
ATOM   133  N  N   . VAL A 1 23  ? 13.284  -1.597  -42.888 1.00 14.64 ? 66  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 23  ? 13.606  -1.430  -41.473 1.00 16.47 ? 66  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 23  ? 14.528  -2.548  -40.982 1.00 14.11 ? 66  VAL A C   1 
ATOM   136  O  O   . VAL A 1 23  ? 15.564  -2.284  -40.354 1.00 14.13 ? 66  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 23  ? 12.315  -1.343  -40.638 1.00 17.48 ? 66  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 23  ? 12.610  -1.354  -39.132 1.00 16.61 ? 66  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 23  ? 11.549  -0.067  -40.947 1.00 20.66 ? 66  VAL A CG2 1 
ATOM   140  N  N   . VAL A 1 24  ? 14.179  -3.814  -41.251 1.00 13.58 ? 67  VAL A N   1 
ATOM   141  C  CA  . VAL A 1 24  ? 15.008  -4.873  -40.686 1.00 12.75 ? 67  VAL A CA  1 
ATOM   142  C  C   . VAL A 1 24  ? 16.405  -4.838  -41.296 1.00 15.71 ? 67  VAL A C   1 
ATOM   143  O  O   . VAL A 1 24  ? 17.373  -5.210  -40.634 1.00 16.54 ? 67  VAL A O   1 
ATOM   144  C  CB  . VAL A 1 24  ? 14.349  -6.269  -40.817 1.00 17.76 ? 67  VAL A CB  1 
ATOM   145  C  CG1 . VAL A 1 24  ? 12.991  -6.303  -40.113 1.00 15.45 ? 67  VAL A CG1 1 
ATOM   146  C  CG2 . VAL A 1 24  ? 14.247  -6.715  -42.245 1.00 20.18 ? 67  VAL A CG2 1 
ATOM   147  N  N   . ARG A 1 25  ? 16.554  -4.357  -42.541 1.00 14.89 ? 68  ARG A N   1 
ATOM   148  C  CA  . ARG A 1 25  ? 17.900  -4.203  -43.086 1.00 15.75 ? 68  ARG A CA  1 
ATOM   149  C  C   . ARG A 1 25  ? 18.655  -3.069  -42.398 1.00 18.58 ? 68  ARG A C   1 
ATOM   150  O  O   . ARG A 1 25  ? 19.842  -3.219  -42.079 1.00 17.96 ? 68  ARG A O   1 
ATOM   151  C  CB  . ARG A 1 25  ? 17.839  -3.987  -44.602 1.00 18.44 ? 68  ARG A CB  1 
ATOM   152  C  CG  . ARG A 1 25  ? 17.326  -5.212  -45.342 1.00 17.14 ? 68  ARG A CG  1 
ATOM   153  C  CD  . ARG A 1 25  ? 17.299  -5.021  -46.851 1.00 23.08 ? 68  ARG A CD  1 
ATOM   154  N  NE  . ARG A 1 25  ? 16.892  -6.264  -47.499 1.00 29.61 ? 68  ARG A NE  1 
ATOM   155  C  CZ  . ARG A 1 25  ? 17.733  -7.245  -47.822 1.00 25.61 ? 68  ARG A CZ  1 
ATOM   156  N  NH1 . ARG A 1 25  ? 19.044  -7.131  -47.585 1.00 20.66 ? 68  ARG A NH1 1 
ATOM   157  N  NH2 . ARG A 1 25  ? 17.254  -8.335  -48.388 1.00 32.64 ? 68  ARG A NH2 1 
ATOM   158  N  N   . LEU A 1 26  ? 18.000  -1.927  -42.170 1.00 16.47 ? 69  LEU A N   1 
ATOM   159  C  CA  . LEU A 1 26  ? 18.659  -0.824  -41.477 1.00 19.78 ? 69  LEU A CA  1 
ATOM   160  C  C   . LEU A 1 26  ? 19.109  -1.246  -40.089 1.00 19.71 ? 69  LEU A C   1 
ATOM   161  O  O   . LEU A 1 26  ? 20.179  -0.829  -39.621 1.00 18.38 ? 69  LEU A O   1 
ATOM   162  C  CB  . LEU A 1 26  ? 17.732  0.394   -41.387 1.00 20.24 ? 69  LEU A CB  1 
ATOM   163  C  CG  . LEU A 1 26  ? 17.488  1.179   -42.680 1.00 20.27 ? 69  LEU A CG  1 
ATOM   164  C  CD1 . LEU A 1 26  ? 16.200  2.019   -42.575 1.00 23.79 ? 69  LEU A CD1 1 
ATOM   165  C  CD2 . LEU A 1 26  ? 18.720  2.048   -42.973 1.00 24.73 ? 69  LEU A CD2 1 
ATOM   166  N  N   . CYS A 1 27  ? 18.321  -2.095  -39.428 1.00 17.79 ? 70  CYS A N   1 
ATOM   167  C  CA  . CYS A 1 27  ? 18.598  -2.506  -38.069 1.00 15.87 ? 70  CYS A CA  1 
ATOM   168  C  C   . CYS A 1 27  ? 19.684  -3.569  -37.970 1.00 18.75 ? 70  CYS A C   1 
ATOM   169  O  O   . CYS A 1 27  ? 20.086  -3.904  -36.854 1.00 19.26 ? 70  CYS A O   1 
ATOM   170  C  CB  . CYS A 1 27  ? 17.311  -3.030  -37.406 1.00 18.86 ? 70  CYS A CB  1 
ATOM   171  S  SG  . CYS A 1 27  ? 16.081  -1.762  -36.980 1.00 20.07 ? 70  CYS A SG  1 
ATOM   172  N  N   . GLN A 1 28  ? 20.124  -4.141  -39.087 1.00 16.15 ? 71  GLN A N   1 
ATOM   173  C  CA  . GLN A 1 28  ? 21.232  -5.089  -39.086 1.00 18.62 ? 71  GLN A CA  1 
ATOM   174  C  C   . GLN A 1 28  ? 22.576  -4.427  -39.358 1.00 27.52 ? 71  GLN A C   1 
ATOM   175  O  O   . GLN A 1 28  ? 23.580  -5.124  -39.512 1.00 26.00 ? 71  GLN A O   1 
ATOM   176  C  CB  . GLN A 1 28  ? 20.970  -6.185  -40.100 1.00 17.62 ? 71  GLN A CB  1 
ATOM   177  C  CG  . GLN A 1 28  ? 19.898  -7.166  -39.578 1.00 19.37 ? 71  GLN A CG  1 
ATOM   178  C  CD  . GLN A 1 28  ? 19.515  -8.190  -40.609 1.00 20.70 ? 71  GLN A CD  1 
ATOM   179  O  OE1 . GLN A 1 28  ? 20.233  -9.171  -40.835 1.00 20.71 ? 71  GLN A OE1 1 
ATOM   180  N  NE2 . GLN A 1 28  ? 18.382  -7.977  -41.242 1.00 17.90 ? 71  GLN A NE2 1 
ATOM   181  N  N   . ASN A 1 29  ? 22.613  -3.112  -39.428 1.00 22.87 ? 72  ASN A N   1 
ATOM   182  C  CA  . ASN A 1 29  ? 23.873  -2.383  -39.514 1.00 22.01 ? 72  ASN A CA  1 
ATOM   183  C  C   . ASN A 1 29  ? 24.766  -2.773  -38.343 1.00 20.16 ? 72  ASN A C   1 
ATOM   184  O  O   . ASN A 1 29  ? 24.370  -2.560  -37.180 1.00 23.75 ? 72  ASN A O   1 
ATOM   185  C  CB  . ASN A 1 29  ? 23.569  -0.888  -39.478 1.00 25.79 ? 72  ASN A CB  1 
ATOM   186  C  CG  . ASN A 1 29  ? 24.800  -0.023  -39.728 1.00 32.10 ? 72  ASN A CG  1 
ATOM   187  O  OD1 . ASN A 1 29  ? 25.941  -0.459  -39.561 1.00 24.99 ? 72  ASN A OD1 1 
ATOM   188  N  ND2 . ASN A 1 29  ? 24.559  1.225   -40.120 1.00 30.59 ? 72  ASN A ND2 1 
ATOM   189  N  N   . PRO A 1 30  ? 25.960  -3.334  -38.579 1.00 27.13 ? 73  PRO A N   1 
ATOM   190  C  CA  . PRO A 1 30  ? 26.775  -3.786  -37.440 1.00 31.24 ? 73  PRO A CA  1 
ATOM   191  C  C   . PRO A 1 30  ? 27.192  -2.663  -36.507 1.00 33.48 ? 73  PRO A C   1 
ATOM   192  O  O   . PRO A 1 30  ? 27.455  -2.916  -35.325 1.00 31.72 ? 73  PRO A O   1 
ATOM   193  C  CB  . PRO A 1 30  ? 27.997  -4.435  -38.098 1.00 32.69 ? 73  PRO A CB  1 
ATOM   194  C  CG  . PRO A 1 30  ? 27.722  -4.487  -39.552 1.00 37.70 ? 73  PRO A CG  1 
ATOM   195  C  CD  . PRO A 1 30  ? 26.659  -3.499  -39.860 1.00 29.13 ? 73  PRO A CD  1 
ATOM   196  N  N   . LYS A 1 31  ? 27.268  -1.425  -36.994 1.00 30.02 ? 74  LYS A N   1 
ATOM   197  C  CA  . LYS A 1 31  ? 27.547  -0.319  -36.085 1.00 33.54 ? 74  LYS A CA  1 
ATOM   198  C  C   . LYS A 1 31  ? 26.445  -0.146  -35.051 1.00 26.74 ? 74  LYS A C   1 
ATOM   199  O  O   . LYS A 1 31  ? 26.685  0.457   -34.003 1.00 32.52 ? 74  LYS A O   1 
ATOM   200  C  CB  . LYS A 1 31  ? 27.729  0.986   -36.865 1.00 35.49 ? 74  LYS A CB  1 
ATOM   201  C  CG  . LYS A 1 31  ? 28.969  1.029   -37.740 1.00 34.38 ? 74  LYS A CG  1 
ATOM   202  N  N   . LEU A 1 32  ? 25.244  -0.670  -35.318 1.00 24.21 ? 75  LEU A N   1 
ATOM   203  C  CA  . LEU A 1 32  ? 24.096  -0.459  -34.443 1.00 27.72 ? 75  LEU A CA  1 
ATOM   204  C  C   . LEU A 1 32  ? 24.158  -1.345  -33.202 1.00 34.79 ? 75  LEU A C   1 
ATOM   205  O  O   . LEU A 1 32  ? 23.974  -0.869  -32.076 1.00 29.81 ? 75  LEU A O   1 
ATOM   206  C  CB  . LEU A 1 32  ? 22.823  -0.718  -35.247 1.00 33.54 ? 75  LEU A CB  1 
ATOM   207  C  CG  . LEU A 1 32  ? 21.466  -0.290  -34.706 1.00 38.32 ? 75  LEU A CG  1 
ATOM   208  C  CD1 . LEU A 1 32  ? 21.480  1.141   -34.279 1.00 42.15 ? 75  LEU A CD1 1 
ATOM   209  C  CD2 . LEU A 1 32  ? 20.436  -0.507  -35.805 1.00 36.40 ? 75  LEU A CD2 1 
ATOM   210  N  N   . ALA A 1 33  ? 24.403  -2.641  -33.387 1.00 35.55 ? 76  ALA A N   1 
ATOM   211  C  CA  . ALA A 1 33  ? 24.671  -3.541  -32.267 1.00 41.33 ? 76  ALA A CA  1 
ATOM   212  C  C   . ALA A 1 33  ? 23.472  -3.610  -31.331 1.00 27.41 ? 76  ALA A C   1 
ATOM   213  O  O   . ALA A 1 33  ? 23.611  -3.528  -30.106 1.00 24.55 ? 76  ALA A O   1 
ATOM   214  C  CB  . ALA A 1 33  ? 25.928  -3.122  -31.501 1.00 37.61 ? 76  ALA A CB  1 
ATOM   215  N  N   . LEU A 1 34  ? 22.288  -3.742  -31.923 1.00 30.13 ? 77  LEU A N   1 
ATOM   216  C  CA  . LEU A 1 34  ? 21.071  -3.900  -31.152 1.00 24.93 ? 77  LEU A CA  1 
ATOM   217  C  C   . LEU A 1 34  ? 21.124  -5.172  -30.341 1.00 22.68 ? 77  LEU A C   1 
ATOM   218  O  O   . LEU A 1 34  ? 21.401  -6.246  -30.870 1.00 22.94 ? 77  LEU A O   1 
ATOM   219  C  CB  . LEU A 1 34  ? 19.848  -3.972  -32.061 1.00 28.26 ? 77  LEU A CB  1 
ATOM   220  C  CG  . LEU A 1 34  ? 19.394  -2.773  -32.855 1.00 34.63 ? 77  LEU A CG  1 
ATOM   221  C  CD1 . LEU A 1 34  ? 18.109  -3.179  -33.538 1.00 30.93 ? 77  LEU A CD1 1 
ATOM   222  C  CD2 . LEU A 1 34  ? 19.190  -1.566  -31.934 1.00 37.23 ? 77  LEU A CD2 1 
ATOM   223  N  N   . LYS A 1 35  ? 20.775  -5.071  -29.075 1.00 20.16 ? 78  LYS A N   1 
ATOM   224  C  CA  . LYS A 1 35  ? 20.678  -6.268  -28.270 1.00 17.41 ? 78  LYS A CA  1 
ATOM   225  C  C   . LYS A 1 35  ? 19.366  -6.992  -28.573 1.00 21.10 ? 78  LYS A C   1 
ATOM   226  O  O   . LYS A 1 35  ? 18.366  -6.381  -28.966 1.00 23.91 ? 78  LYS A O   1 
ATOM   227  C  CB  . LYS A 1 35  ? 20.776  -5.929  -26.785 1.00 28.64 ? 78  LYS A CB  1 
ATOM   228  C  CG  . LYS A 1 35  ? 21.980  -5.056  -26.417 1.00 34.07 ? 78  LYS A CG  1 
ATOM   229  N  N   . ASN A 1 36  ? 19.376  -8.303  -28.354 1.00 20.36 ? 79  ASN A N   1 
ATOM   230  C  CA  A ASN A 1 36  ? 18.297  -9.214  -28.707 0.50 21.02 ? 79  ASN A CA  1 
ATOM   231  C  CA  B ASN A 1 36  ? 18.250  -9.156  -28.734 0.50 20.99 ? 79  ASN A CA  1 
ATOM   232  C  C   . ASN A 1 36  ? 17.212  -9.323  -27.621 1.00 25.38 ? 79  ASN A C   1 
ATOM   233  O  O   . ASN A 1 36  ? 16.421  -10.273 -27.647 1.00 41.70 ? 79  ASN A O   1 
ATOM   234  C  CB  A ASN A 1 36  ? 18.920  -10.584 -29.011 0.50 29.89 ? 79  ASN A CB  1 
ATOM   235  C  CB  B ASN A 1 36  ? 18.766  -10.519 -29.204 0.50 29.14 ? 79  ASN A CB  1 
ATOM   236  C  CG  A ASN A 1 36  ? 17.998  -11.514 -29.759 0.50 26.65 ? 79  ASN A CG  1 
ATOM   237  C  CG  B ASN A 1 36  ? 19.235  -11.420 -28.057 0.50 32.95 ? 79  ASN A CG  1 
ATOM   238  O  OD1 A ASN A 1 36  ? 16.787  -11.440 -29.640 0.50 31.23 ? 79  ASN A OD1 1 
ATOM   239  O  OD1 B ASN A 1 36  ? 19.490  -12.596 -28.275 0.50 30.71 ? 79  ASN A OD1 1 
ATOM   240  N  ND2 A ASN A 1 36  ? 18.582  -12.427 -30.522 0.50 27.32 ? 79  ASN A ND2 1 
ATOM   241  N  ND2 B ASN A 1 36  ? 19.355  -10.879 -26.845 0.50 36.29 ? 79  ASN A ND2 1 
ATOM   242  N  N   . SER A 1 37  ? 17.137  -8.443  -26.737 1.00 22.47 ? 80  SER A N   1 
ATOM   243  C  CA  . SER A 1 37  ? 16.164  -8.695  -25.675 1.00 18.73 ? 80  SER A CA  1 
ATOM   244  C  C   . SER A 1 37  ? 14.772  -8.168  -26.059 1.00 17.58 ? 80  SER A C   1 
ATOM   245  O  O   . SER A 1 37  ? 14.655  -7.099  -26.676 1.00 16.60 ? 80  SER A O   1 
ATOM   246  C  CB  . SER A 1 37  ? 16.610  -8.037  -24.381 1.00 27.72 ? 80  SER A CB  1 
ATOM   247  O  OG  . SER A 1 37  ? 17.349  -6.908  -24.675 1.00 37.46 ? 80  SER A OG  1 
ATOM   248  N  N   . PRO A 1 38  ? 13.704  -8.871  -25.704 1.00 17.44 ? 81  PRO A N   1 
ATOM   249  C  CA  . PRO A 1 38  ? 12.352  -8.335  -25.983 1.00 16.68 ? 81  PRO A CA  1 
ATOM   250  C  C   . PRO A 1 38  ? 12.144  -6.964  -25.324 1.00 15.88 ? 81  PRO A C   1 
ATOM   251  O  O   . PRO A 1 38  ? 12.494  -6.779  -24.152 1.00 17.82 ? 81  PRO A O   1 
ATOM   252  C  CB  . PRO A 1 38  ? 11.425  -9.419  -25.394 1.00 15.33 ? 81  PRO A CB  1 
ATOM   253  C  CG  . PRO A 1 38  ? 12.240  -10.670 -25.464 1.00 17.57 ? 81  PRO A CG  1 
ATOM   254  C  CD  . PRO A 1 38  ? 13.646  -10.243 -25.166 1.00 17.33 ? 81  PRO A CD  1 
ATOM   255  N  N   . PRO A 1 39  ? 11.571  -5.986  -26.055 1.00 15.65 ? 82  PRO A N   1 
ATOM   256  C  CA  . PRO A 1 39  ? 11.035  -6.066  -27.411 1.00 13.09 ? 82  PRO A CA  1 
ATOM   257  C  C   . PRO A 1 39  ? 12.164  -5.862  -28.416 1.00 17.28 ? 82  PRO A C   1 
ATOM   258  O  O   . PRO A 1 39  ? 12.913  -4.866  -28.330 1.00 17.42 ? 82  PRO A O   1 
ATOM   259  C  CB  . PRO A 1 39  ? 9.989   -4.929  -27.442 1.00 18.03 ? 82  PRO A CB  1 
ATOM   260  C  CG  . PRO A 1 39  ? 10.595  -3.896  -26.563 1.00 14.00 ? 82  PRO A CG  1 
ATOM   261  C  CD  . PRO A 1 39  ? 11.370  -4.649  -25.476 1.00 16.73 ? 82  PRO A CD  1 
ATOM   262  N  N   . TYR A 1 40  ? 12.300  -6.807  -29.354 1.00 16.87 ? 83  TYR A N   1 
ATOM   263  C  CA  . TYR A 1 40  ? 13.408  -6.844  -30.306 1.00 15.64 ? 83  TYR A CA  1 
ATOM   264  C  C   . TYR A 1 40  ? 12.833  -6.670  -31.703 1.00 15.25 ? 83  TYR A C   1 
ATOM   265  O  O   . TYR A 1 40  ? 12.148  -7.554  -32.205 1.00 16.32 ? 83  TYR A O   1 
ATOM   266  C  CB  . TYR A 1 40  ? 14.151  -8.169  -30.187 1.00 21.28 ? 83  TYR A CB  1 
ATOM   267  C  CG  . TYR A 1 40  ? 15.377  -8.359  -31.053 1.00 17.97 ? 83  TYR A CG  1 
ATOM   268  C  CD1 . TYR A 1 40  ? 16.297  -7.342  -31.242 1.00 16.97 ? 83  TYR A CD1 1 
ATOM   269  C  CD2 . TYR A 1 40  ? 15.683  -9.629  -31.568 1.00 21.57 ? 83  TYR A CD2 1 
ATOM   270  C  CE1 . TYR A 1 40  ? 17.468  -7.557  -31.975 1.00 19.24 ? 83  TYR A CE1 1 
ATOM   271  C  CE2 . TYR A 1 40  ? 16.844  -9.851  -32.312 1.00 19.02 ? 83  TYR A CE2 1 
ATOM   272  C  CZ  . TYR A 1 40  ? 17.732  -8.812  -32.505 1.00 21.72 ? 83  TYR A CZ  1 
ATOM   273  O  OH  . TYR A 1 40  ? 18.899  -9.002  -33.218 1.00 20.48 ? 83  TYR A OH  1 
ATOM   274  N  N   . ILE A 1 41  ? 13.120  -5.539  -32.342 1.00 15.60 ? 84  ILE A N   1 
ATOM   275  C  CA  . ILE A 1 41  ? 12.475  -5.234  -33.611 1.00 16.66 ? 84  ILE A CA  1 
ATOM   276  C  C   . ILE A 1 41  ? 12.801  -6.260  -34.685 1.00 16.40 ? 84  ILE A C   1 
ATOM   277  O  O   . ILE A 1 41  ? 11.981  -6.515  -35.578 1.00 15.29 ? 84  ILE A O   1 
ATOM   278  C  CB  . ILE A 1 41  ? 12.852  -3.808  -34.037 1.00 18.38 ? 84  ILE A CB  1 
ATOM   279  C  CG1 . ILE A 1 41  ? 11.962  -3.352  -35.195 1.00 22.62 ? 84  ILE A CG1 1 
ATOM   280  C  CG2 . ILE A 1 41  ? 14.374  -3.675  -34.307 1.00 22.55 ? 84  ILE A CG2 1 
ATOM   281  C  CD1 . ILE A 1 41  ? 11.951  -1.837  -35.331 1.00 26.57 ? 84  ILE A CD1 1 
ATOM   282  N  N   . LEU A 1 42  ? 13.983  -6.881  -34.615 1.00 17.06 ? 85  LEU A N   1 
ATOM   283  C  CA  . LEU A 1 42  ? 14.376  -7.860  -35.629 1.00 14.20 ? 85  LEU A CA  1 
ATOM   284  C  C   . LEU A 1 42  ? 13.700  -9.213  -35.434 1.00 18.10 ? 85  LEU A C   1 
ATOM   285  O  O   . LEU A 1 42  ? 13.761  -10.047 -36.332 1.00 15.60 ? 85  LEU A O   1 
ATOM   286  C  CB  . LEU A 1 42  ? 15.917  -8.025  -35.634 1.00 16.04 ? 85  LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 42  ? 16.668  -6.795  -36.159 1.00 14.72 ? 85  LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 42  ? 18.196  -6.935  -35.941 1.00 18.67 ? 85  LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 42  ? 16.363  -6.620  -37.638 1.00 15.68 ? 85  LEU A CD2 1 
ATOM   290  N  N   . ASP A 1 43  ? 13.090  -9.454  -34.281 1.00 12.87 ? 86  ASP A N   1 
ATOM   291  C  CA  . ASP A 1 43  ? 12.103  -10.527 -34.087 1.00 14.58 ? 86  ASP A CA  1 
ATOM   292  C  C   . ASP A 1 43  ? 10.696  -10.091 -34.491 1.00 16.80 ? 86  ASP A C   1 
ATOM   293  O  O   . ASP A 1 43  ? 9.967   -10.844 -35.143 1.00 14.16 ? 86  ASP A O   1 
ATOM   294  C  CB  . ASP A 1 43  ? 12.078  -10.957 -32.615 1.00 16.90 ? 86  ASP A CB  1 
ATOM   295  C  CG  . ASP A 1 43  ? 13.080  -12.057 -32.282 1.00 37.47 ? 86  ASP A CG  1 
ATOM   296  O  OD1 . ASP A 1 43  ? 13.928  -12.399 -33.143 1.00 35.03 ? 86  ASP A OD1 1 
ATOM   297  O  OD2 . ASP A 1 43  ? 13.005  -12.586 -31.141 1.00 39.73 ? 86  ASP A OD2 1 
ATOM   298  N  N   . LEU A 1 44  ? 10.303  -8.879  -34.090 1.00 17.14 ? 87  LEU A N   1 
ATOM   299  C  CA  . LEU A 1 44  ? 8.910   -8.465  -34.157 1.00 11.76 ? 87  LEU A CA  1 
ATOM   300  C  C   . LEU A 1 44  ? 8.446   -8.188  -35.583 1.00 12.01 ? 87  LEU A C   1 
ATOM   301  O  O   . LEU A 1 44  ? 7.326   -8.549  -35.953 1.00 16.29 ? 87  LEU A O   1 
ATOM   302  C  CB  . LEU A 1 44  ? 8.713   -7.219  -33.281 1.00 11.51 ? 87  LEU A CB  1 
ATOM   303  C  CG  . LEU A 1 44  ? 8.858   -7.510  -31.777 1.00 16.58 ? 87  LEU A CG  1 
ATOM   304  C  CD1 . LEU A 1 44  ? 8.934   -6.182  -30.998 1.00 17.32 ? 87  LEU A CD1 1 
ATOM   305  C  CD2 . LEU A 1 44  ? 7.740   -8.389  -31.262 1.00 19.31 ? 87  LEU A CD2 1 
ATOM   306  N  N   . LEU A 1 45  ? 9.272   -7.561  -36.409 1.00 14.48 ? 88  LEU A N   1 
ATOM   307  C  CA  . LEU A 1 45  ? 8.780   -7.230  -37.745 1.00 12.58 ? 88  LEU A CA  1 
ATOM   308  C  C   . LEU A 1 45  ? 8.734   -8.490  -38.609 1.00 12.07 ? 88  LEU A C   1 
ATOM   309  O  O   . LEU A 1 45  ? 7.723   -8.731  -39.288 1.00 12.75 ? 88  LEU A O   1 
ATOM   310  C  CB  . LEU A 1 45  ? 9.608   -6.105  -38.372 1.00 17.07 ? 88  LEU A CB  1 
ATOM   311  C  CG  . LEU A 1 45  ? 9.309   -4.707  -37.777 1.00 19.62 ? 88  LEU A CG  1 
ATOM   312  C  CD1 . LEU A 1 45  ? 10.082  -3.654  -38.566 1.00 20.98 ? 88  LEU A CD1 1 
ATOM   313  C  CD2 . LEU A 1 45  ? 7.840   -4.310  -37.758 1.00 20.06 ? 88  LEU A CD2 1 
ATOM   314  N  N   . PRO A 1 46  ? 9.738   -9.369  -38.560 1.00 13.22 ? 89  PRO A N   1 
ATOM   315  C  CA  . PRO A 1 46  ? 9.545   -10.676 -39.220 1.00 14.69 ? 89  PRO A CA  1 
ATOM   316  C  C   . PRO A 1 46  ? 8.333   -11.468 -38.711 1.00 12.78 ? 89  PRO A C   1 
ATOM   317  O  O   . PRO A 1 46  ? 7.610   -12.046 -39.528 1.00 12.83 ? 89  PRO A O   1 
ATOM   318  C  CB  . PRO A 1 46  ? 10.879  -11.390 -38.952 1.00 14.88 ? 89  PRO A CB  1 
ATOM   319  C  CG  . PRO A 1 46  ? 11.839  -10.287 -38.787 1.00 12.98 ? 89  PRO A CG  1 
ATOM   320  C  CD  . PRO A 1 46  ? 11.099  -9.249  -38.014 1.00 12.98 ? 89  PRO A CD  1 
ATOM   321  N  N   . ASP A 1 47  ? 8.086   -11.537 -37.397 1.00 11.02 ? 90  ASP A N   1 
ATOM   322  C  CA  . ASP A 1 47  ? 6.918   -12.270 -36.903 1.00 16.47 ? 90  ASP A CA  1 
ATOM   323  C  C   . ASP A 1 47  ? 5.621   -11.634 -37.389 1.00 16.66 ? 90  ASP A C   1 
ATOM   324  O  O   . ASP A 1 47  ? 4.633   -12.334 -37.668 1.00 11.77 ? 90  ASP A O   1 
ATOM   325  C  CB  . ASP A 1 47  ? 6.923   -12.295 -35.376 1.00 15.94 ? 90  ASP A CB  1 
ATOM   326  C  CG  . ASP A 1 47  ? 7.291   -13.656 -34.810 1.00 48.63 ? 90  ASP A CG  1 
ATOM   327  O  OD1 . ASP A 1 47  ? 6.920   -14.678 -35.441 1.00 45.51 ? 90  ASP A OD1 1 
ATOM   328  O  OD2 . ASP A 1 47  ? 7.937   -13.700 -33.728 1.00 42.96 ? 90  ASP A OD2 1 
ATOM   329  N  N   . THR A 1 48  ? 5.591   -10.299 -37.433 1.00 14.11 ? 91  THR A N   1 
ATOM   330  C  CA  . THR A 1 48  ? 4.415   -9.605  -37.945 1.00 13.72 ? 91  THR A CA  1 
ATOM   331  C  C   . THR A 1 48  ? 4.186   -9.939  -39.404 1.00 16.53 ? 91  THR A C   1 
ATOM   332  O  O   . THR A 1 48  ? 3.060   -10.228 -39.816 1.00 14.20 ? 91  THR A O   1 
ATOM   333  C  CB  . THR A 1 48  ? 4.574   -8.098  -37.778 1.00 16.32 ? 91  THR A CB  1 
ATOM   334  O  OG1 . THR A 1 48  ? 4.808   -7.810  -36.400 1.00 13.10 ? 91  THR A OG1 1 
ATOM   335  C  CG2 . THR A 1 48  ? 3.312   -7.345  -38.251 1.00 19.45 ? 91  THR A CG2 1 
ATOM   336  N  N   . TYR A 1 49  ? 5.251   -9.887  -40.196 1.00 13.09 ? 92  TYR A N   1 
ATOM   337  C  CA  . TYR A 1 49  ? 5.199   -10.321 -41.590 1.00 12.00 ? 92  TYR A CA  1 
ATOM   338  C  C   . TYR A 1 49  ? 4.644   -11.742 -41.715 1.00 12.96 ? 92  TYR A C   1 
ATOM   339  O  O   . TYR A 1 49  ? 3.740   -12.003 -42.510 1.00 15.54 ? 92  TYR A O   1 
ATOM   340  C  CB  . TYR A 1 49  ? 6.593   -10.242 -42.186 1.00 18.17 ? 92  TYR A CB  1 
ATOM   341  C  CG  . TYR A 1 49  ? 6.740   -10.965 -43.497 1.00 11.94 ? 92  TYR A CG  1 
ATOM   342  C  CD1 . TYR A 1 49  ? 6.251   -10.426 -44.667 1.00 16.84 ? 92  TYR A CD1 1 
ATOM   343  C  CD2 . TYR A 1 49  ? 7.426   -12.166 -43.558 1.00 18.57 ? 92  TYR A CD2 1 
ATOM   344  C  CE1 . TYR A 1 49  ? 6.430   -11.088 -45.878 1.00 19.06 ? 92  TYR A CE1 1 
ATOM   345  C  CE2 . TYR A 1 49  ? 7.603   -12.822 -44.749 1.00 18.47 ? 92  TYR A CE2 1 
ATOM   346  C  CZ  . TYR A 1 49  ? 7.105   -12.280 -45.901 1.00 24.71 ? 92  TYR A CZ  1 
ATOM   347  O  OH  . TYR A 1 49  ? 7.279   -12.950 -47.086 1.00 24.10 ? 92  TYR A OH  1 
ATOM   348  N  N   . GLN A 1 50  ? 5.177   -12.681 -40.925 1.00 15.36 ? 93  GLN A N   1 
ATOM   349  C  CA  . GLN A 1 50  ? 4.726   -14.069 -41.042 1.00 16.06 ? 93  GLN A CA  1 
ATOM   350  C  C   . GLN A 1 50  ? 3.250   -14.207 -40.657 1.00 15.71 ? 93  GLN A C   1 
ATOM   351  O  O   . GLN A 1 50  ? 2.511   -14.989 -41.265 1.00 11.64 ? 93  GLN A O   1 
ATOM   352  C  CB  . GLN A 1 50  ? 5.593   -14.983 -40.173 1.00 17.12 ? 93  GLN A CB  1 
ATOM   353  C  CG  . GLN A 1 50  ? 7.060   -15.122 -40.642 1.00 17.57 ? 93  GLN A CG  1 
ATOM   354  C  CD  . GLN A 1 50  ? 7.186   -15.827 -41.969 1.00 20.97 ? 93  GLN A CD  1 
ATOM   355  O  OE1 . GLN A 1 50  ? 6.257   -16.477 -42.436 1.00 21.76 ? 93  GLN A OE1 1 
ATOM   356  N  NE2 . GLN A 1 50  ? 8.359   -15.721 -42.571 1.00 21.24 ? 93  GLN A NE2 1 
ATOM   357  N  N   . HIS A 1 51  ? 2.809   -13.482 -39.637 1.00 13.41 ? 94  HIS A N   1 
ATOM   358  C  CA  . HIS A 1 51  ? 1.408   -13.606 -39.241 1.00 11.82 ? 94  HIS A CA  1 
ATOM   359  C  C   . HIS A 1 51  ? 0.484   -12.986 -40.287 1.00 15.86 ? 94  HIS A C   1 
ATOM   360  O  O   . HIS A 1 51  ? -0.588  -13.534 -40.571 1.00 12.52 ? 94  HIS A O   1 
ATOM   361  C  CB  . HIS A 1 51  ? 1.169   -12.990 -37.859 1.00 11.45 ? 94  HIS A CB  1 
ATOM   362  C  CG  . HIS A 1 51  ? -0.079  -13.500 -37.228 1.00 16.11 ? 94  HIS A CG  1 
ATOM   363  N  ND1 . HIS A 1 51  ? -0.204  -14.812 -36.832 1.00 17.25 ? 94  HIS A ND1 1 
ATOM   364  C  CD2 . HIS A 1 51  ? -1.294  -12.922 -37.029 1.00 19.19 ? 94  HIS A CD2 1 
ATOM   365  C  CE1 . HIS A 1 51  ? -1.433  -15.014 -36.376 1.00 20.71 ? 94  HIS A CE1 1 
ATOM   366  N  NE2 . HIS A 1 51  ? -2.109  -13.880 -36.477 1.00 19.76 ? 94  HIS A NE2 1 
ATOM   367  N  N   . LEU A 1 52  ? 0.886   -11.850 -40.872 1.00 12.09 ? 95  LEU A N   1 
ATOM   368  C  CA  . LEU A 1 52  ? 0.157   -11.273 -42.002 1.00 18.03 ? 95  LEU A CA  1 
ATOM   369  C  C   . LEU A 1 52  ? 0.113   -12.214 -43.208 1.00 15.05 ? 95  LEU A C   1 
ATOM   370  O  O   . LEU A 1 52  ? -0.912  -12.297 -43.893 1.00 15.47 ? 95  LEU A O   1 
ATOM   371  C  CB  . LEU A 1 52  ? 0.767   -9.917  -42.384 1.00 16.92 ? 95  LEU A CB  1 
ATOM   372  C  CG  . LEU A 1 52  ? 0.536   -8.813  -41.340 1.00 16.90 ? 95  LEU A CG  1 
ATOM   373  C  CD1 . LEU A 1 52  ? 1.403   -7.591  -41.636 1.00 16.46 ? 95  LEU A CD1 1 
ATOM   374  C  CD2 . LEU A 1 52  ? -0.945  -8.414  -41.277 1.00 18.59 ? 95  LEU A CD2 1 
ATOM   375  N  N   . ARG A 1 53  ? 1.186   -12.961 -43.477 1.00 15.02 ? 96  ARG A N   1 
ATOM   376  C  CA  . ARG A 1 53  ? 1.099   -13.964 -44.540 1.00 18.11 ? 96  ARG A CA  1 
ATOM   377  C  C   . ARG A 1 53  ? 0.044   -15.009 -44.213 1.00 14.28 ? 96  ARG A C   1 
ATOM   378  O  O   . ARG A 1 53  ? -0.699  -15.454 -45.094 1.00 16.67 ? 96  ARG A O   1 
ATOM   379  C  CB  . ARG A 1 53  ? 2.433   -14.682 -44.764 1.00 21.22 ? 96  ARG A CB  1 
ATOM   380  C  CG  . ARG A 1 53  ? 3.431   -13.986 -45.636 1.00 24.17 ? 96  ARG A CG  1 
ATOM   381  C  CD  . ARG A 1 53  ? 4.641   -14.926 -45.863 1.00 28.25 ? 96  ARG A CD  1 
ATOM   382  N  NE  . ARG A 1 53  ? 4.237   -16.158 -46.546 1.00 31.14 ? 96  ARG A NE  1 
ATOM   383  C  CZ  . ARG A 1 53  ? 4.550   -17.415 -46.178 1.00 41.02 ? 96  ARG A CZ  1 
ATOM   384  N  NH1 . ARG A 1 53  ? 5.314   -17.690 -45.110 1.00 30.29 ? 96  ARG A NH1 1 
ATOM   385  N  NH2 . ARG A 1 53  ? 4.097   -18.432 -46.905 1.00 29.88 ? 96  ARG A NH2 1 
ATOM   386  N  N   . THR A 1 54  ? 0.024   -15.474 -42.965 1.00 14.27 ? 97  THR A N   1 
ATOM   387  C  CA  . THR A 1 54  ? -0.991  -16.434 -42.556 1.00 13.87 ? 97  THR A CA  1 
ATOM   388  C  C   . THR A 1 54  ? -2.396  -15.874 -42.742 1.00 17.56 ? 97  THR A C   1 
ATOM   389  O  O   . THR A 1 54  ? -3.277  -16.563 -43.283 1.00 14.27 ? 97  THR A O   1 
ATOM   390  C  CB  . THR A 1 54  ? -0.719  -16.860 -41.110 1.00 18.16 ? 97  THR A CB  1 
ATOM   391  O  OG1 . THR A 1 54  ? 0.540   -17.552 -41.101 1.00 22.95 ? 97  THR A OG1 1 
ATOM   392  C  CG2 . THR A 1 54  ? -1.810  -17.757 -40.565 1.00 19.89 ? 97  THR A CG2 1 
ATOM   393  N  N   . ILE A 1 55  ? -2.617  -14.619 -42.336 1.00 16.95 ? 98  ILE A N   1 
ATOM   394  C  CA  . ILE A 1 55  ? -3.930  -14.006 -42.518 1.00 13.82 ? 98  ILE A CA  1 
ATOM   395  C  C   . ILE A 1 55  ? -4.304  -13.966 -43.996 1.00 18.12 ? 98  ILE A C   1 
ATOM   396  O  O   . ILE A 1 55  ? -5.395  -14.396 -44.373 1.00 15.07 ? 98  ILE A O   1 
ATOM   397  C  CB  . ILE A 1 55  ? -3.971  -12.608 -41.874 1.00 12.76 ? 98  ILE A CB  1 
ATOM   398  C  CG1 . ILE A 1 55  ? -3.856  -12.735 -40.355 1.00 15.14 ? 98  ILE A CG1 1 
ATOM   399  C  CG2 . ILE A 1 55  ? -5.282  -11.859 -42.292 1.00 17.24 ? 98  ILE A CG2 1 
ATOM   400  C  CD1 . ILE A 1 55  ? -3.592  -11.385 -39.623 1.00 16.59 ? 98  ILE A CD1 1 
ATOM   401  N  N   . LEU A 1 56  ? -3.413  -13.450 -44.860 1.00 17.22 ? 99  LEU A N   1 
ATOM   402  C  CA  . LEU A 1 56  ? -3.734  -13.399 -46.285 1.00 16.49 ? 99  LEU A CA  1 
ATOM   403  C  C   . LEU A 1 56  ? -4.057  -14.784 -46.847 1.00 18.04 ? 99  LEU A C   1 
ATOM   404  O  O   . LEU A 1 56  ? -4.994  -14.927 -47.637 1.00 18.13 ? 99  LEU A O   1 
ATOM   405  C  CB  . LEU A 1 56  ? -2.597  -12.744 -47.064 1.00 20.57 ? 99  LEU A CB  1 
ATOM   406  C  CG  . LEU A 1 56  ? -2.563  -11.224 -46.931 1.00 26.66 ? 99  LEU A CG  1 
ATOM   407  C  CD1 . LEU A 1 56  ? -1.331  -10.686 -47.631 1.00 31.44 ? 99  LEU A CD1 1 
ATOM   408  C  CD2 . LEU A 1 56  ? -3.724  -10.622 -47.567 1.00 31.30 ? 99  LEU A CD2 1 
ATOM   409  N  N   . SER A 1 57  ? -3.369  -15.832 -46.392 1.00 15.36 ? 100 SER A N   1 
ATOM   410  C  CA  A SER A 1 57  ? -3.676  -17.171 -46.886 0.50 19.66 ? 100 SER A CA  1 
ATOM   411  C  CA  B SER A 1 57  ? -3.679  -17.167 -46.893 0.50 19.67 ? 100 SER A CA  1 
ATOM   412  C  C   . SER A 1 57  ? -5.071  -17.630 -46.459 1.00 22.79 ? 100 SER A C   1 
ATOM   413  O  O   . SER A 1 57  ? -5.789  -18.269 -47.242 1.00 20.05 ? 100 SER A O   1 
ATOM   414  C  CB  A SER A 1 57  ? -2.607  -18.155 -46.415 0.50 19.84 ? 100 SER A CB  1 
ATOM   415  C  CB  B SER A 1 57  ? -2.600  -18.153 -46.448 0.50 19.85 ? 100 SER A CB  1 
ATOM   416  O  OG  A SER A 1 57  ? -2.355  -17.990 -45.034 0.50 29.06 ? 100 SER A OG  1 
ATOM   417  O  OG  B SER A 1 57  ? -1.358  -17.818 -47.046 0.50 18.44 ? 100 SER A OG  1 
ATOM   418  N  N   . ARG A 1 58  ? -5.489  -17.315 -45.228 1.00 18.71 ? 101 ARG A N   1 
ATOM   419  C  CA  . ARG A 1 58  ? -6.838  -17.696 -44.794 1.00 17.32 ? 101 ARG A CA  1 
ATOM   420  C  C   . ARG A 1 58  ? -7.907  -17.009 -45.637 1.00 21.58 ? 101 ARG A C   1 
ATOM   421  O  O   . ARG A 1 58  ? -9.003  -17.552 -45.805 1.00 23.59 ? 101 ARG A O   1 
ATOM   422  C  CB  . ARG A 1 58  ? -7.056  -17.359 -43.306 1.00 16.86 ? 101 ARG A CB  1 
ATOM   423  C  CG  . ARG A 1 58  ? -6.129  -18.075 -42.325 1.00 21.17 ? 101 ARG A CG  1 
ATOM   424  C  CD  . ARG A 1 58  ? -6.247  -19.586 -42.363 1.00 21.32 ? 101 ARG A CD  1 
ATOM   425  N  NE  . ARG A 1 58  ? -7.595  -20.110 -42.115 1.00 18.13 ? 101 ARG A NE  1 
ATOM   426  C  CZ  . ARG A 1 58  ? -8.120  -20.344 -40.913 1.00 20.67 ? 101 ARG A CZ  1 
ATOM   427  N  NH1 . ARG A 1 58  ? -7.447  -20.074 -39.807 1.00 16.44 ? 101 ARG A NH1 1 
ATOM   428  N  NH2 . ARG A 1 58  ? -9.341  -20.861 -40.822 1.00 23.83 ? 101 ARG A NH2 1 
ATOM   429  N  N   . TYR A 1 59  ? -7.606  -15.821 -46.176 1.00 17.25 ? 102 TYR A N   1 
ATOM   430  C  CA  . TYR A 1 59  ? -8.546  -15.022 -46.956 1.00 19.60 ? 102 TYR A CA  1 
ATOM   431  C  C   . TYR A 1 59  ? -8.281  -15.106 -48.457 1.00 26.88 ? 102 TYR A C   1 
ATOM   432  O  O   . TYR A 1 59  ? -8.781  -14.273 -49.220 1.00 21.78 ? 102 TYR A O   1 
ATOM   433  C  CB  . TYR A 1 59  ? -8.528  -13.576 -46.471 1.00 23.20 ? 102 TYR A CB  1 
ATOM   434  C  CG  . TYR A 1 59  ? -9.187  -13.442 -45.111 1.00 17.18 ? 102 TYR A CG  1 
ATOM   435  C  CD1 . TYR A 1 59  ? -10.558 -13.209 -45.003 1.00 17.33 ? 102 TYR A CD1 1 
ATOM   436  C  CD2 . TYR A 1 59  ? -8.450  -13.578 -43.950 1.00 18.01 ? 102 TYR A CD2 1 
ATOM   437  C  CE1 . TYR A 1 59  ? -11.161 -13.103 -43.775 1.00 21.52 ? 102 TYR A CE1 1 
ATOM   438  C  CE2 . TYR A 1 59  ? -9.041  -13.489 -42.704 1.00 16.28 ? 102 TYR A CE2 1 
ATOM   439  C  CZ  . TYR A 1 59  ? -10.412 -13.235 -42.630 1.00 21.04 ? 102 TYR A CZ  1 
ATOM   440  O  OH  . TYR A 1 59  ? -11.043 -13.139 -41.423 1.00 19.63 ? 102 TYR A OH  1 
ATOM   441  N  N   . GLU A 1 60  ? -7.562  -16.135 -48.894 1.00 24.90 ? 103 GLU A N   1 
ATOM   442  C  CA  . GLU A 1 60  ? -7.390  -16.399 -50.319 1.00 26.92 ? 103 GLU A CA  1 
ATOM   443  C  C   . GLU A 1 60  ? -8.745  -16.449 -51.024 1.00 29.57 ? 103 GLU A C   1 
ATOM   444  O  O   . GLU A 1 60  ? -9.630  -17.214 -50.634 1.00 28.83 ? 103 GLU A O   1 
ATOM   445  C  CB  . GLU A 1 60  ? -6.651  -17.725 -50.491 1.00 26.09 ? 103 GLU A CB  1 
ATOM   446  C  CG  . GLU A 1 60  ? -6.156  -17.993 -51.891 1.00 39.83 ? 103 GLU A CG  1 
ATOM   447  C  CD  . GLU A 1 60  ? -4.737  -17.549 -52.047 1.00 54.88 ? 103 GLU A CD  1 
ATOM   448  O  OE1 . GLU A 1 60  ? -3.835  -18.397 -51.863 1.00 62.77 ? 103 GLU A OE1 1 
ATOM   449  O  OE2 . GLU A 1 60  ? -4.522  -16.348 -52.319 1.00 55.99 ? 103 GLU A OE2 1 
ATOM   450  N  N   . GLY A 1 61  ? -8.915  -15.633 -52.063 1.00 33.73 ? 104 GLY A N   1 
ATOM   451  C  CA  . GLY A 1 61  ? -10.176 -15.597 -52.781 1.00 35.12 ? 104 GLY A CA  1 
ATOM   452  C  C   . GLY A 1 61  ? -11.287 -14.827 -52.099 1.00 40.46 ? 104 GLY A C   1 
ATOM   453  O  O   . GLY A 1 61  ? -12.409 -14.793 -52.623 1.00 36.29 ? 104 GLY A O   1 
ATOM   454  N  N   . LYS A 1 62  ? -11.023 -14.210 -50.949 1.00 31.48 ? 105 LYS A N   1 
ATOM   455  C  CA  . LYS A 1 62  ? -11.994 -13.339 -50.293 1.00 31.69 ? 105 LYS A CA  1 
ATOM   456  C  C   . LYS A 1 62  ? -11.285 -12.156 -49.657 1.00 31.26 ? 105 LYS A C   1 
ATOM   457  O  O   . LYS A 1 62  ? -11.591 -11.748 -48.532 1.00 28.44 ? 105 LYS A O   1 
ATOM   458  C  CB  . LYS A 1 62  ? -12.842 -14.109 -49.272 1.00 36.78 ? 105 LYS A CB  1 
ATOM   459  C  CG  . LYS A 1 62  ? -12.089 -15.014 -48.295 1.00 29.07 ? 105 LYS A CG  1 
ATOM   460  C  CD  . LYS A 1 62  ? -13.058 -15.620 -47.254 1.00 38.35 ? 105 LYS A CD  1 
ATOM   461  C  CE  . LYS A 1 62  ? -12.346 -16.435 -46.160 1.00 35.97 ? 105 LYS A CE  1 
ATOM   462  N  NZ  . LYS A 1 62  ? -13.304 -16.844 -45.072 1.00 39.43 ? 105 LYS A NZ  1 
ATOM   463  N  N   . MET A 1 63  ? -10.335 -11.576 -50.392 1.00 29.33 ? 106 MET A N   1 
ATOM   464  C  CA  . MET A 1 63  ? -9.554  -10.458 -49.870 1.00 30.64 ? 106 MET A CA  1 
ATOM   465  C  C   . MET A 1 63  ? -10.403 -9.227  -49.593 1.00 28.43 ? 106 MET A C   1 
ATOM   466  O  O   . MET A 1 63  ? -10.042 -8.410  -48.739 1.00 30.91 ? 106 MET A O   1 
ATOM   467  C  CB  . MET A 1 63  ? -8.432  -10.115 -50.847 1.00 31.41 ? 106 MET A CB  1 
ATOM   468  C  CG  . MET A 1 63  ? -7.167  -10.837 -50.559 1.00 48.17 ? 106 MET A CG  1 
ATOM   469  S  SD  . MET A 1 63  ? -6.579  -10.434 -48.907 1.00 64.22 ? 106 MET A SD  1 
ATOM   470  C  CE  . MET A 1 63  ? -6.249  -8.696  -49.020 1.00 31.54 ? 106 MET A CE  1 
ATOM   471  N  N   . GLU A 1 64  ? -11.527 -9.069  -50.295 1.00 33.94 ? 107 GLU A N   1 
ATOM   472  C  CA  . GLU A 1 64  ? -12.388 -7.907  -50.064 1.00 37.81 ? 107 GLU A CA  1 
ATOM   473  C  C   . GLU A 1 64  ? -12.987 -7.948  -48.667 1.00 35.22 ? 107 GLU A C   1 
ATOM   474  O  O   . GLU A 1 64  ? -13.190 -6.911  -48.021 1.00 32.94 ? 107 GLU A O   1 
ATOM   475  C  CB  . GLU A 1 64  ? -13.500 -7.866  -51.112 1.00 36.35 ? 107 GLU A CB  1 
ATOM   476  N  N   . THR A 1 65  ? -13.300 -9.151  -48.201 1.00 34.15 ? 108 THR A N   1 
ATOM   477  C  CA  . THR A 1 65  ? -13.803 -9.336  -46.851 1.00 22.74 ? 108 THR A CA  1 
ATOM   478  C  C   . THR A 1 65  ? -12.772 -8.877  -45.826 1.00 27.14 ? 108 THR A C   1 
ATOM   479  O  O   . THR A 1 65  ? -13.073 -8.077  -44.934 1.00 27.21 ? 108 THR A O   1 
ATOM   480  C  CB  . THR A 1 65  ? -14.154 -10.809 -46.681 1.00 30.06 ? 108 THR A CB  1 
ATOM   481  O  OG1 . THR A 1 65  ? -15.148 -11.151 -47.652 1.00 30.43 ? 108 THR A OG1 1 
ATOM   482  C  CG2 . THR A 1 65  ? -14.665 -11.127 -45.282 1.00 28.23 ? 108 THR A CG2 1 
ATOM   483  N  N   . LEU A 1 66  ? -11.538 -9.361  -45.955 1.00 23.56 ? 109 LEU A N   1 
ATOM   484  C  CA  . LEU A 1 66  ? -10.464 -8.932  -45.065 1.00 27.89 ? 109 LEU A CA  1 
ATOM   485  C  C   . LEU A 1 66  ? -10.234 -7.426  -45.154 1.00 26.50 ? 109 LEU A C   1 
ATOM   486  O  O   . LEU A 1 66  ? -10.112 -6.740  -44.134 1.00 21.43 ? 109 LEU A O   1 
ATOM   487  C  CB  . LEU A 1 66  ? -9.178  -9.685  -45.416 1.00 21.08 ? 109 LEU A CB  1 
ATOM   488  C  CG  . LEU A 1 66  ? -7.977  -9.306  -44.580 1.00 23.15 ? 109 LEU A CG  1 
ATOM   489  C  CD1 . LEU A 1 66  ? -8.214  -9.637  -43.130 1.00 22.55 ? 109 LEU A CD1 1 
ATOM   490  C  CD2 . LEU A 1 66  ? -6.769  -10.056 -45.107 1.00 23.66 ? 109 LEU A CD2 1 
ATOM   491  N  N   . GLY A 1 67  ? -10.155 -6.894  -46.375 1.00 27.95 ? 110 GLY A N   1 
ATOM   492  C  CA  . GLY A 1 67  ? -9.695  -5.527  -46.562 1.00 32.48 ? 110 GLY A CA  1 
ATOM   493  C  C   . GLY A 1 67  ? -10.697 -4.467  -46.156 1.00 30.89 ? 110 GLY A C   1 
ATOM   494  O  O   . GLY A 1 67  ? -10.320 -3.299  -46.007 1.00 30.20 ? 110 GLY A O   1 
ATOM   495  N  N   . GLU A 1 68  ? -11.963 -4.844  -46.000 1.00 23.54 ? 111 GLU A N   1 
ATOM   496  C  CA  . GLU A 1 68  ? -13.005 -3.954  -45.517 1.00 25.94 ? 111 GLU A CA  1 
ATOM   497  C  C   . GLU A 1 68  ? -13.190 -4.030  -44.002 1.00 36.83 ? 111 GLU A C   1 
ATOM   498  O  O   . GLU A 1 68  ? -13.916 -3.201  -43.436 1.00 26.73 ? 111 GLU A O   1 
ATOM   499  C  CB  . GLU A 1 68  ? -14.339 -4.301  -46.196 1.00 30.79 ? 111 GLU A CB  1 
ATOM   500  C  CG  . GLU A 1 68  ? -14.346 -4.182  -47.716 1.00 36.98 ? 111 GLU A CG  1 
ATOM   501  N  N   . ASN A 1 69  ? -12.576 -5.016  -43.342 1.00 20.25 ? 112 ASN A N   1 
ATOM   502  C  CA  . ASN A 1 69  ? -12.732 -5.177  -41.901 1.00 19.59 ? 112 ASN A CA  1 
ATOM   503  C  C   . ASN A 1 69  ? -12.153 -3.976  -41.178 1.00 17.41 ? 112 ASN A C   1 
ATOM   504  O  O   . ASN A 1 69  ? -11.023 -3.570  -41.445 1.00 18.08 ? 112 ASN A O   1 
ATOM   505  C  CB  . ASN A 1 69  ? -12.031 -6.460  -41.445 1.00 22.17 ? 112 ASN A CB  1 
ATOM   506  C  CG  . ASN A 1 69  ? -12.038 -6.617  -39.958 1.00 22.09 ? 112 ASN A CG  1 
ATOM   507  O  OD1 . ASN A 1 69  ? -11.131 -6.148  -39.262 1.00 19.66 ? 112 ASN A OD1 1 
ATOM   508  N  ND2 . ASN A 1 69  ? -13.074 -7.260  -39.448 1.00 30.83 ? 112 ASN A ND2 1 
ATOM   509  N  N   . GLU A 1 70  ? -12.925 -3.381  -40.257 1.00 18.35 ? 113 GLU A N   1 
ATOM   510  C  CA  . GLU A 1 70  ? -12.483 -2.104  -39.693 1.00 21.71 ? 113 GLU A CA  1 
ATOM   511  C  C   . GLU A 1 70  ? -11.201 -2.262  -38.882 1.00 21.30 ? 113 GLU A C   1 
ATOM   512  O  O   . GLU A 1 70  ? -10.284 -1.448  -38.997 1.00 20.40 ? 113 GLU A O   1 
ATOM   513  C  CB  . GLU A 1 70  ? -13.568 -1.462  -38.828 1.00 24.12 ? 113 GLU A CB  1 
ATOM   514  C  CG  . GLU A 1 70  ? -13.142 -0.099  -38.256 1.00 29.84 ? 113 GLU A CG  1 
ATOM   515  C  CD  . GLU A 1 70  ? -14.251 0.607   -37.493 1.00 33.99 ? 113 GLU A CD  1 
ATOM   516  O  OE1 . GLU A 1 70  ? -15.358 0.049   -37.376 1.00 38.43 ? 113 GLU A OE1 1 
ATOM   517  O  OE2 . GLU A 1 70  ? -14.011 1.738   -37.029 1.00 35.01 ? 113 GLU A OE2 1 
ATOM   518  N  N   . TYR A 1 71  ? -11.137 -3.267  -38.010 1.00 17.12 ? 114 TYR A N   1 
ATOM   519  C  CA  . TYR A 1 71  ? -9.931  -3.474  -37.221 1.00 17.47 ? 114 TYR A CA  1 
ATOM   520  C  C   . TYR A 1 71  ? -8.704  -3.616  -38.131 1.00 16.06 ? 114 TYR A C   1 
ATOM   521  O  O   . TYR A 1 71  ? -7.671  -2.988  -37.895 1.00 16.44 ? 114 TYR A O   1 
ATOM   522  C  CB  . TYR A 1 71  ? -10.079 -4.706  -36.304 1.00 13.96 ? 114 TYR A CB  1 
ATOM   523  C  CG  . TYR A 1 71  ? -8.743  -5.055  -35.689 1.00 18.83 ? 114 TYR A CG  1 
ATOM   524  C  CD1 . TYR A 1 71  ? -8.261  -4.365  -34.601 1.00 15.65 ? 114 TYR A CD1 1 
ATOM   525  C  CD2 . TYR A 1 71  ? -7.913  -6.004  -36.278 1.00 18.74 ? 114 TYR A CD2 1 
ATOM   526  C  CE1 . TYR A 1 71  ? -7.006  -4.636  -34.074 1.00 17.47 ? 114 TYR A CE1 1 
ATOM   527  C  CE2 . TYR A 1 71  ? -6.672  -6.264  -35.784 1.00 17.19 ? 114 TYR A CE2 1 
ATOM   528  C  CZ  . TYR A 1 71  ? -6.207  -5.592  -34.683 1.00 17.04 ? 114 TYR A CZ  1 
ATOM   529  O  OH  . TYR A 1 71  ? -4.948  -5.905  -34.203 1.00 19.84 ? 114 TYR A OH  1 
ATOM   530  N  N   . PHE A 1 72  ? -8.815  -4.426  -39.186 1.00 18.22 ? 115 PHE A N   1 
ATOM   531  C  CA  . PHE A 1 72  ? -7.672  -4.657  -40.074 1.00 16.27 ? 115 PHE A CA  1 
ATOM   532  C  C   . PHE A 1 72  ? -7.265  -3.386  -40.822 1.00 17.60 ? 115 PHE A C   1 
ATOM   533  O  O   . PHE A 1 72  ? -6.072  -3.111  -40.985 1.00 17.98 ? 115 PHE A O   1 
ATOM   534  C  CB  . PHE A 1 72  ? -7.994  -5.787  -41.058 1.00 17.44 ? 115 PHE A CB  1 
ATOM   535  C  CG  . PHE A 1 72  ? -6.772  -6.343  -41.752 1.00 19.75 ? 115 PHE A CG  1 
ATOM   536  C  CD1 . PHE A 1 72  ? -5.803  -7.027  -41.025 1.00 21.26 ? 115 PHE A CD1 1 
ATOM   537  C  CD2 . PHE A 1 72  ? -6.602  -6.218  -43.123 1.00 18.79 ? 115 PHE A CD2 1 
ATOM   538  C  CE1 . PHE A 1 72  ? -4.663  -7.552  -41.668 1.00 19.85 ? 115 PHE A CE1 1 
ATOM   539  C  CE2 . PHE A 1 72  ? -5.481  -6.749  -43.761 1.00 19.70 ? 115 PHE A CE2 1 
ATOM   540  C  CZ  . PHE A 1 72  ? -4.517  -7.392  -43.045 1.00 24.48 ? 115 PHE A CZ  1 
ATOM   541  N  N   . ARG A 1 73  ? -8.243  -2.590  -41.268 1.00 17.54 ? 116 ARG A N   1 
ATOM   542  C  CA  . ARG A 1 73  ? -7.947  -1.311  -41.907 1.00 18.43 ? 116 ARG A CA  1 
ATOM   543  C  C   . ARG A 1 73  ? -7.158  -0.391  -40.980 1.00 14.67 ? 116 ARG A C   1 
ATOM   544  O  O   . ARG A 1 73  ? -6.175  0.230   -41.392 1.00 18.93 ? 116 ARG A O   1 
ATOM   545  C  CB  . ARG A 1 73  ? -9.260  -0.648  -42.351 1.00 22.25 ? 116 ARG A CB  1 
ATOM   546  C  CG  . ARG A 1 73  ? -9.935  -1.340  -43.546 1.00 24.83 ? 116 ARG A CG  1 
ATOM   547  C  CD  . ARG A 1 73  ? -11.001 -0.443  -44.220 1.00 33.92 ? 116 ARG A CD  1 
ATOM   548  N  NE  . ARG A 1 73  ? -11.709 0.399   -43.276 1.00 40.02 ? 116 ARG A NE  1 
ATOM   549  C  CZ  . ARG A 1 73  ? -12.942 0.179   -42.833 1.00 43.87 ? 116 ARG A CZ  1 
ATOM   550  N  NH1 . ARG A 1 73  ? -13.645 -0.856  -43.267 1.00 51.09 ? 116 ARG A NH1 1 
ATOM   551  N  NH2 . ARG A 1 73  ? -13.484 1.012   -41.952 1.00 46.75 ? 116 ARG A NH2 1 
ATOM   552  N  N   . VAL A 1 74  ? -7.585  -0.283  -39.720 1.00 18.14 ? 117 VAL A N   1 
ATOM   553  C  CA  . VAL A 1 74  ? -6.886  0.550   -38.750 1.00 19.23 ? 117 VAL A CA  1 
ATOM   554  C  C   . VAL A 1 74  ? -5.498  -0.019  -38.482 1.00 23.84 ? 117 VAL A C   1 
ATOM   555  O  O   . VAL A 1 74  ? -4.503  0.716   -38.439 1.00 17.57 ? 117 VAL A O   1 
ATOM   556  C  CB  . VAL A 1 74  ? -7.727  0.649   -37.453 1.00 20.72 ? 117 VAL A CB  1 
ATOM   557  C  CG1 . VAL A 1 74  ? -6.988  1.328   -36.348 1.00 24.80 ? 117 VAL A CG1 1 
ATOM   558  C  CG2 . VAL A 1 74  ? -9.045  1.381   -37.689 1.00 18.75 ? 117 VAL A CG2 1 
ATOM   559  N  N   . PHE A 1 75  ? -5.414  -1.338  -38.296 1.00 16.77 ? 118 PHE A N   1 
ATOM   560  C  CA  . PHE A 1 75  ? -4.131  -1.966  -38.005 1.00 19.14 ? 118 PHE A CA  1 
ATOM   561  C  C   . PHE A 1 75  ? -3.118  -1.712  -39.121 1.00 15.26 ? 118 PHE A C   1 
ATOM   562  O  O   . PHE A 1 75  ? -1.988  -1.290  -38.864 1.00 17.20 ? 118 PHE A O   1 
ATOM   563  C  CB  . PHE A 1 75  ? -4.307  -3.467  -37.816 1.00 21.87 ? 118 PHE A CB  1 
ATOM   564  C  CG  . PHE A 1 75  ? -3.041  -4.135  -37.458 1.00 17.53 ? 118 PHE A CG  1 
ATOM   565  C  CD1 . PHE A 1 75  ? -2.668  -4.273  -36.131 1.00 18.62 ? 118 PHE A CD1 1 
ATOM   566  C  CD2 . PHE A 1 75  ? -2.190  -4.597  -38.451 1.00 19.06 ? 118 PHE A CD2 1 
ATOM   567  C  CE1 . PHE A 1 75  ? -1.442  -4.885  -35.819 1.00 13.78 ? 118 PHE A CE1 1 
ATOM   568  C  CE2 . PHE A 1 75  ? -0.984  -5.196  -38.127 1.00 16.71 ? 118 PHE A CE2 1 
ATOM   569  C  CZ  . PHE A 1 75  ? -0.623  -5.323  -36.815 1.00 13.59 ? 118 PHE A CZ  1 
ATOM   570  N  N   . MET A 1 76  ? -3.514  -1.971  -40.367 1.00 16.32 ? 119 MET A N   1 
ATOM   571  C  CA  . MET A 1 76  ? -2.599  -1.810  -41.489 1.00 14.93 ? 119 MET A CA  1 
ATOM   572  C  C   . MET A 1 76  ? -2.193  -0.346  -41.693 1.00 20.51 ? 119 MET A C   1 
ATOM   573  O  O   . MET A 1 76  ? -1.028  -0.049  -41.995 1.00 18.51 ? 119 MET A O   1 
ATOM   574  C  CB  . MET A 1 76  ? -3.244  -2.404  -42.736 1.00 14.67 ? 119 MET A CB  1 
ATOM   575  C  CG  . MET A 1 76  ? -3.286  -3.926  -42.726 1.00 18.56 ? 119 MET A CG  1 
ATOM   576  S  SD  . MET A 1 76  ? -1.639  -4.673  -42.580 1.00 19.39 ? 119 MET A SD  1 
ATOM   577  C  CE  . MET A 1 76  ? -0.693  -3.798  -43.805 1.00 23.66 ? 119 MET A CE  1 
ATOM   578  N  N   . GLU A 1 77  ? -3.124  0.590   -41.513 1.00 21.25 ? 120 GLU A N   1 
ATOM   579  C  CA  . GLU A 1 77  ? -2.746  1.997   -41.592 1.00 14.14 ? 120 GLU A CA  1 
ATOM   580  C  C   . GLU A 1 77  ? -1.714  2.350   -40.522 1.00 17.49 ? 120 GLU A C   1 
ATOM   581  O  O   . GLU A 1 77  ? -0.734  3.062   -40.793 1.00 17.72 ? 120 GLU A O   1 
ATOM   582  C  CB  . GLU A 1 77  ? -4.008  2.864   -41.481 1.00 19.39 ? 120 GLU A CB  1 
ATOM   583  C  CG  . GLU A 1 77  ? -3.759  4.376   -41.557 1.00 31.69 ? 120 GLU A CG  1 
ATOM   584  C  CD  . GLU A 1 77  ? -5.001  5.177   -41.185 1.00 51.58 ? 120 GLU A CD  1 
ATOM   585  O  OE1 . GLU A 1 77  ? -5.539  5.889   -42.063 1.00 48.26 ? 120 GLU A OE1 1 
ATOM   586  O  OE2 . GLU A 1 77  ? -5.448  5.077   -40.015 1.00 54.49 ? 120 GLU A OE2 1 
ATOM   587  N  N   . ASN A 1 78  ? -1.891  1.823   -39.303 1.00 17.96 ? 121 ASN A N   1 
ATOM   588  C  CA  . ASN A 1 78  ? -0.981  2.127   -38.203 1.00 15.94 ? 121 ASN A CA  1 
ATOM   589  C  C   . ASN A 1 78  ? 0.384   1.479   -38.423 1.00 17.32 ? 121 ASN A C   1 
ATOM   590  O  O   . ASN A 1 78  ? 1.427   2.079   -38.114 1.00 15.72 ? 121 ASN A O   1 
ATOM   591  C  CB  . ASN A 1 78  ? -1.618  1.652   -36.889 1.00 17.97 ? 121 ASN A CB  1 
ATOM   592  C  CG  . ASN A 1 78  ? -0.947  2.219   -35.649 1.00 27.64 ? 121 ASN A CG  1 
ATOM   593  O  OD1 . ASN A 1 78  ? -0.707  3.431   -35.584 1.00 25.57 ? 121 ASN A OD1 1 
ATOM   594  N  ND2 . ASN A 1 78  ? -0.697  1.351   -34.610 1.00 18.14 ? 121 ASN A ND2 1 
ATOM   595  N  N   . LEU A 1 79  ? 0.388   0.234   -38.907 1.00 18.11 ? 122 LEU A N   1 
ATOM   596  C  CA  . LEU A 1 79  ? 1.645   -0.460  -39.170 1.00 17.80 ? 122 LEU A CA  1 
ATOM   597  C  C   . LEU A 1 79  ? 2.431   0.250   -40.259 1.00 20.06 ? 122 LEU A C   1 
ATOM   598  O  O   . LEU A 1 79  ? 3.640   0.447   -40.141 1.00 19.51 ? 122 LEU A O   1 
ATOM   599  C  CB  . LEU A 1 79  ? 1.356   -1.913  -39.574 1.00 21.12 ? 122 LEU A CB  1 
ATOM   600  C  CG  . LEU A 1 79  ? 2.576   -2.792  -39.907 1.00 17.11 ? 122 LEU A CG  1 
ATOM   601  C  CD1 . LEU A 1 79  ? 3.473   -2.941  -38.723 1.00 22.43 ? 122 LEU A CD1 1 
ATOM   602  C  CD2 . LEU A 1 79  ? 2.124   -4.193  -40.415 1.00 21.85 ? 122 LEU A CD2 1 
ATOM   603  N  N   . MET A 1 80  ? 1.755   0.670   -41.317 1.00 19.23 ? 123 MET A N   1 
ATOM   604  C  CA  . MET A 1 80  ? 2.446   1.436   -42.338 1.00 19.68 ? 123 MET A CA  1 
ATOM   605  C  C   . MET A 1 80  ? 3.007   2.739   -41.760 1.00 19.45 ? 123 MET A C   1 
ATOM   606  O  O   . MET A 1 80  ? 4.189   3.050   -41.947 1.00 20.56 ? 123 MET A O   1 
ATOM   607  C  CB  . MET A 1 80  ? 1.505   1.699   -43.510 1.00 22.45 ? 123 MET A CB  1 
ATOM   608  C  CG  . MET A 1 80  ? 2.157   2.560   -44.583 1.00 40.09 ? 123 MET A CG  1 
ATOM   609  S  SD  . MET A 1 80  ? 1.260   2.554   -46.143 1.00 64.22 ? 123 MET A SD  1 
ATOM   610  C  CE  . MET A 1 80  ? 1.525   0.855   -46.637 1.00 34.79 ? 123 MET A CE  1 
ATOM   611  N  N   . LYS A 1 81  ? 2.182   3.502   -41.026 1.00 21.97 ? 124 LYS A N   1 
ATOM   612  C  CA  . LYS A 1 81  ? 2.651   4.765   -40.449 1.00 23.53 ? 124 LYS A CA  1 
ATOM   613  C  C   . LYS A 1 81  ? 3.866   4.552   -39.546 1.00 21.73 ? 124 LYS A C   1 
ATOM   614  O  O   . LYS A 1 81  ? 4.885   5.241   -39.676 1.00 20.46 ? 124 LYS A O   1 
ATOM   615  C  CB  . LYS A 1 81  ? 1.513   5.448   -39.665 1.00 19.56 ? 124 LYS A CB  1 
ATOM   616  N  N   . LYS A 1 82  ? 3.783   3.590   -38.624 1.00 20.60 ? 125 LYS A N   1 
ATOM   617  C  CA  . LYS A 1 82  ? 4.866   3.375   -37.671 1.00 20.35 ? 125 LYS A CA  1 
ATOM   618  C  C   . LYS A 1 82  ? 6.126   2.830   -38.356 1.00 16.20 ? 125 LYS A C   1 
ATOM   619  O  O   . LYS A 1 82  ? 7.241   3.143   -37.924 1.00 17.23 ? 125 LYS A O   1 
ATOM   620  C  CB  . LYS A 1 82  ? 4.390   2.441   -36.541 1.00 25.31 ? 125 LYS A CB  1 
ATOM   621  C  CG  . LYS A 1 82  ? 3.190   2.945   -35.730 1.00 25.80 ? 125 LYS A CG  1 
ATOM   622  C  CD  . LYS A 1 82  ? 3.581   3.760   -34.538 1.00 32.53 ? 125 LYS A CD  1 
ATOM   623  C  CE  . LYS A 1 82  ? 2.375   3.938   -33.604 1.00 29.71 ? 125 LYS A CE  1 
ATOM   624  N  NZ  . LYS A 1 82  ? 1.264   4.706   -34.257 1.00 22.51 ? 125 LYS A NZ  1 
ATOM   625  N  N   . THR A 1 83  ? 5.978   2.036   -39.419 1.00 18.09 ? 126 THR A N   1 
ATOM   626  C  CA  . THR A 1 83  ? 7.153   1.577   -40.160 1.00 16.15 ? 126 THR A CA  1 
ATOM   627  C  C   . THR A 1 83  ? 7.843   2.760   -40.852 1.00 18.32 ? 126 THR A C   1 
ATOM   628  O  O   . THR A 1 83  ? 9.075   2.888   -40.805 1.00 15.72 ? 126 THR A O   1 
ATOM   629  C  CB  . THR A 1 83  ? 6.745   0.480   -41.160 1.00 23.20 ? 126 THR A CB  1 
ATOM   630  O  OG1 . THR A 1 83  ? 6.120   -0.610  -40.471 1.00 18.89 ? 126 THR A OG1 1 
ATOM   631  C  CG2 . THR A 1 83  ? 7.967   -0.096  -41.875 1.00 22.76 ? 126 THR A CG2 1 
ATOM   632  N  N   . LYS A 1 84  ? 7.058   3.675   -41.425 1.00 18.62 ? 127 LYS A N   1 
ATOM   633  C  CA  . LYS A 1 84  ? 7.638   4.876   -42.041 1.00 21.34 ? 127 LYS A CA  1 
ATOM   634  C  C   . LYS A 1 84  ? 8.336   5.758   -41.012 1.00 17.56 ? 127 LYS A C   1 
ATOM   635  O  O   . LYS A 1 84  ? 9.395   6.331   -41.296 1.00 20.38 ? 127 LYS A O   1 
ATOM   636  C  CB  . LYS A 1 84  ? 6.552   5.670   -42.789 1.00 17.69 ? 127 LYS A CB  1 
ATOM   637  C  CG  . LYS A 1 84  ? 6.116   5.059   -44.092 1.00 24.33 ? 127 LYS A CG  1 
ATOM   638  C  CD  . LYS A 1 84  ? 4.933   5.852   -44.710 1.00 28.97 ? 127 LYS A CD  1 
ATOM   639  C  CE  . LYS A 1 84  ? 4.505   5.272   -46.042 1.00 36.49 ? 127 LYS A CE  1 
ATOM   640  N  NZ  . LYS A 1 84  ? 3.323   5.975   -46.610 1.00 40.65 ? 127 LYS A NZ  1 
ATOM   641  N  N   . GLN A 1 85  ? 7.752   5.908   -39.816 1.00 17.98 ? 128 GLN A N   1 
ATOM   642  C  CA  . GLN A 1 85  ? 8.430   6.644   -38.758 1.00 17.95 ? 128 GLN A CA  1 
ATOM   643  C  C   . GLN A 1 85  ? 9.760   6.004   -38.396 1.00 18.94 ? 128 GLN A C   1 
ATOM   644  O  O   . GLN A 1 85  ? 10.710  6.706   -38.050 1.00 19.57 ? 128 GLN A O   1 
ATOM   645  C  CB  . GLN A 1 85  ? 7.555   6.742   -37.503 1.00 21.10 ? 128 GLN A CB  1 
ATOM   646  C  CG  . GLN A 1 85  ? 6.293   7.575   -37.683 1.00 24.82 ? 128 GLN A CG  1 
ATOM   647  C  CD  . GLN A 1 85  ? 5.280   7.323   -36.582 1.00 37.19 ? 128 GLN A CD  1 
ATOM   648  O  OE1 . GLN A 1 85  ? 4.072   7.330   -36.822 1.00 46.48 ? 128 GLN A OE1 1 
ATOM   649  N  NE2 . GLN A 1 85  ? 5.768   7.111   -35.365 1.00 31.13 ? 128 GLN A NE2 1 
ATOM   650  N  N   . THR A 1 86  ? 9.839   4.665   -38.411 1.00 16.31 ? 129 THR A N   1 
ATOM   651  C  CA  . THR A 1 86  ? 11.093  4.021   -38.032 1.00 17.70 ? 129 THR A CA  1 
ATOM   652  C  C   . THR A 1 86  ? 12.166  4.292   -39.087 1.00 17.30 ? 129 THR A C   1 
ATOM   653  O  O   . THR A 1 86  ? 13.336  4.537   -38.760 1.00 20.73 ? 129 THR A O   1 
ATOM   654  C  CB  . THR A 1 86  ? 10.873  2.507   -37.835 1.00 16.88 ? 129 THR A CB  1 
ATOM   655  O  OG1 . THR A 1 86  ? 9.787   2.266   -36.914 1.00 18.67 ? 129 THR A OG1 1 
ATOM   656  C  CG2 . THR A 1 86  ? 12.102  1.862   -37.247 1.00 18.21 ? 129 THR A CG2 1 
ATOM   657  N  N   . ILE A 1 87  ? 11.783  4.229   -40.360 1.00 19.67 ? 130 ILE A N   1 
ATOM   658  C  CA  . ILE A 1 87  ? 12.705  4.582   -41.435 1.00 24.06 ? 130 ILE A CA  1 
ATOM   659  C  C   . ILE A 1 87  ? 13.184  6.017   -41.256 1.00 23.27 ? 130 ILE A C   1 
ATOM   660  O  O   . ILE A 1 87  ? 14.386  6.291   -41.279 1.00 20.45 ? 130 ILE A O   1 
ATOM   661  C  CB  . ILE A 1 87  ? 12.030  4.366   -42.806 1.00 21.47 ? 130 ILE A CB  1 
ATOM   662  C  CG1 . ILE A 1 87  ? 11.805  2.879   -43.086 1.00 18.38 ? 130 ILE A CG1 1 
ATOM   663  C  CG2 . ILE A 1 87  ? 12.897  4.888   -43.939 1.00 23.28 ? 130 ILE A CG2 1 
ATOM   664  C  CD1 . ILE A 1 87  ? 10.808  2.652   -44.169 1.00 20.10 ? 130 ILE A CD1 1 
ATOM   665  N  N   . SER A 1 88  ? 12.248  6.948   -41.022 1.00 23.68 ? 131 SER A N   1 
ATOM   666  C  CA  . SER A 1 88  ? 12.625  8.359   -40.891 1.00 25.03 ? 131 SER A CA  1 
ATOM   667  C  C   . SER A 1 88  ? 13.593  8.568   -39.745 1.00 24.54 ? 131 SER A C   1 
ATOM   668  O  O   . SER A 1 88  ? 14.448  9.458   -39.801 1.00 25.96 ? 131 SER A O   1 
ATOM   669  C  CB  . SER A 1 88  ? 11.392  9.231   -40.681 1.00 24.24 ? 131 SER A CB  1 
ATOM   670  O  OG  . SER A 1 88  ? 10.578  9.217   -41.831 1.00 34.07 ? 131 SER A OG  1 
ATOM   671  N  N   . LEU A 1 89  ? 13.466  7.758   -38.693 1.00 20.80 ? 132 LEU A N   1 
ATOM   672  C  CA  . LEU A 1 89  ? 14.376  7.836   -37.570 1.00 20.23 ? 132 LEU A CA  1 
ATOM   673  C  C   . LEU A 1 89  ? 15.814  7.563   -37.998 1.00 24.97 ? 132 LEU A C   1 
ATOM   674  O  O   . LEU A 1 89  ? 16.749  8.203   -37.509 1.00 21.01 ? 132 LEU A O   1 
ATOM   675  C  CB  . LEU A 1 89  ? 13.910  6.837   -36.509 1.00 21.30 ? 132 LEU A CB  1 
ATOM   676  C  CG  . LEU A 1 89  ? 14.063  7.057   -35.047 1.00 33.87 ? 132 LEU A CG  1 
ATOM   677  C  CD1 . LEU A 1 89  ? 13.427  8.376   -34.662 1.00 36.61 ? 132 LEU A CD1 1 
ATOM   678  C  CD2 . LEU A 1 89  ? 13.323  5.881   -34.403 1.00 23.39 ? 132 LEU A CD2 1 
ATOM   679  N  N   . PHE A 1 90  ? 16.014  6.597   -38.897 1.00 24.48 ? 133 PHE A N   1 
ATOM   680  C  CA  . PHE A 1 90  ? 17.360  6.301   -39.370 1.00 23.29 ? 133 PHE A CA  1 
ATOM   681  C  C   . PHE A 1 90  ? 17.873  7.392   -40.302 1.00 25.59 ? 133 PHE A C   1 
ATOM   682  O  O   . PHE A 1 90  ? 19.054  7.760   -40.252 1.00 29.40 ? 133 PHE A O   1 
ATOM   683  C  CB  . PHE A 1 90  ? 17.374  4.952   -40.073 1.00 23.51 ? 133 PHE A CB  1 
ATOM   684  C  CG  . PHE A 1 90  ? 17.426  3.792   -39.132 1.00 19.79 ? 133 PHE A CG  1 
ATOM   685  C  CD1 . PHE A 1 90  ? 18.643  3.323   -38.685 1.00 25.70 ? 133 PHE A CD1 1 
ATOM   686  C  CD2 . PHE A 1 90  ? 16.270  3.175   -38.697 1.00 23.33 ? 133 PHE A CD2 1 
ATOM   687  C  CE1 . PHE A 1 90  ? 18.721  2.242   -37.820 1.00 22.65 ? 133 PHE A CE1 1 
ATOM   688  C  CE2 . PHE A 1 90  ? 16.334  2.087   -37.811 1.00 24.20 ? 133 PHE A CE2 1 
ATOM   689  C  CZ  . PHE A 1 90  ? 17.578  1.635   -37.375 1.00 22.92 ? 133 PHE A CZ  1 
ATOM   690  N  N   . LYS A 1 91  ? 16.999  7.929   -41.146 1.00 24.83 ? 134 LYS A N   1 
ATOM   691  C  CA  . LYS A 1 91  ? 17.441  8.936   -42.099 1.00 29.93 ? 134 LYS A CA  1 
ATOM   692  C  C   . LYS A 1 91  ? 17.696  10.272  -41.414 1.00 32.14 ? 134 LYS A C   1 
ATOM   693  O  O   . LYS A 1 91  ? 18.611  11.005  -41.804 1.00 29.24 ? 134 LYS A O   1 
ATOM   694  C  CB  . LYS A 1 91  ? 16.417  9.053   -43.220 1.00 30.96 ? 134 LYS A CB  1 
ATOM   695  C  CG  . LYS A 1 91  ? 16.198  7.711   -43.898 1.00 32.14 ? 134 LYS A CG  1 
ATOM   696  C  CD  . LYS A 1 91  ? 15.820  7.813   -45.358 1.00 45.52 ? 134 LYS A CD  1 
ATOM   697  C  CE  . LYS A 1 91  ? 14.371  8.186   -45.545 1.00 44.56 ? 134 LYS A CE  1 
ATOM   698  N  NZ  . LYS A 1 91  ? 13.959  7.991   -46.963 1.00 58.77 ? 134 LYS A NZ  1 
ATOM   699  N  N   . GLU A 1 92  ? 16.921  10.605  -40.387 1.00 32.73 ? 135 GLU A N   1 
ATOM   700  C  CA  . GLU A 1 92  ? 17.195  11.826  -39.642 1.00 34.85 ? 135 GLU A CA  1 
ATOM   701  C  C   . GLU A 1 92  ? 18.295  11.616  -38.619 1.00 35.03 ? 135 GLU A C   1 
ATOM   702  O  O   . GLU A 1 92  ? 19.056  12.549  -38.336 1.00 40.05 ? 135 GLU A O   1 
ATOM   703  C  CB  . GLU A 1 92  ? 15.918  12.328  -38.973 1.00 31.61 ? 135 GLU A CB  1 
ATOM   704  C  CG  . GLU A 1 92  ? 14.814  12.720  -39.974 1.00 38.12 ? 135 GLU A CG  1 
ATOM   705  C  CD  . GLU A 1 92  ? 13.436  12.851  -39.331 1.00 38.73 ? 135 GLU A CD  1 
ATOM   706  O  OE1 . GLU A 1 92  ? 13.361  12.805  -38.089 1.00 38.09 ? 135 GLU A OE1 1 
ATOM   707  O  OE2 . GLU A 1 92  ? 12.424  12.977  -40.055 1.00 44.28 ? 135 GLU A OE2 1 
ATOM   708  N  N   . GLY A 1 93  ? 18.420  10.400  -38.081 1.00 31.00 ? 136 GLY A N   1 
ATOM   709  C  CA  . GLY A 1 93  ? 19.373  10.163  -37.012 1.00 24.94 ? 136 GLY A CA  1 
ATOM   710  C  C   . GLY A 1 93  ? 20.800  9.965   -37.478 1.00 33.33 ? 136 GLY A C   1 
ATOM   711  O  O   . GLY A 1 93  ? 21.740  10.359  -36.780 1.00 36.38 ? 136 GLY A O   1 
ATOM   712  N  N   . LYS A 1 94  ? 20.989  9.346   -38.634 1.00 33.29 ? 137 LYS A N   1 
ATOM   713  C  CA  . LYS A 1 94  ? 22.321  9.094   -39.190 1.00 40.25 ? 137 LYS A CA  1 
ATOM   714  C  C   . LYS A 1 94  ? 23.210  8.456   -38.115 1.00 43.41 ? 137 LYS A C   1 
ATOM   715  O  O   . LYS A 1 94  ? 22.806  7.464   -37.488 1.00 29.43 ? 137 LYS A O   1 
ATOM   716  C  CB  . LYS A 1 94  ? 22.822  10.411  -39.773 1.00 46.37 ? 137 LYS A CB  1 
ATOM   717  N  N   . GLU A 1 95  ? 24.419  8.974   -37.869 1.00 41.43 ? 138 GLU A N   1 
ATOM   718  C  CA  . GLU A 1 95  ? 25.349  8.340   -36.937 1.00 35.70 ? 138 GLU A CA  1 
ATOM   719  C  C   . GLU A 1 95  ? 24.874  8.394   -35.492 1.00 30.24 ? 138 GLU A C   1 
ATOM   720  O  O   . GLU A 1 95  ? 25.404  7.652   -34.654 1.00 30.02 ? 138 GLU A O   1 
ATOM   721  C  CB  . GLU A 1 95  ? 26.730  9.003   -37.042 1.00 41.45 ? 138 GLU A CB  1 
ATOM   722  N  N   . ARG A 1 96  ? 23.910  9.267   -35.171 1.00 31.20 ? 139 ARG A N   1 
ATOM   723  C  CA  . ARG A 1 96  ? 23.395  9.323   -33.809 1.00 35.21 ? 139 ARG A CA  1 
ATOM   724  C  C   . ARG A 1 96  ? 22.723  8.007   -33.420 1.00 35.77 ? 139 ARG A C   1 
ATOM   725  O  O   . ARG A 1 96  ? 22.648  7.661   -32.234 1.00 36.83 ? 139 ARG A O   1 
ATOM   726  C  CB  . ARG A 1 96  ? 22.424  10.496  -33.678 1.00 34.10 ? 139 ARG A CB  1 
ATOM   727  N  N   . MET A 1 97  ? 22.246  7.255   -34.405 1.00 33.96 ? 140 MET A N   1 
ATOM   728  C  CA  . MET A 1 97  ? 21.657  5.950   -34.139 1.00 38.33 ? 140 MET A CA  1 
ATOM   729  C  C   . MET A 1 97  ? 22.639  4.985   -33.483 1.00 36.87 ? 140 MET A C   1 
ATOM   730  O  O   . MET A 1 97  ? 22.210  4.048   -32.804 1.00 39.51 ? 140 MET A O   1 
ATOM   731  C  CB  . MET A 1 97  ? 21.139  5.374   -35.453 1.00 31.53 ? 140 MET A CB  1 
ATOM   732  C  CG  . MET A 1 97  ? 19.801  5.942   -35.895 1.00 34.53 ? 140 MET A CG  1 
ATOM   733  S  SD  . MET A 1 97  ? 18.350  5.429   -34.914 1.00 45.34 ? 140 MET A SD  1 
ATOM   734  C  CE  . MET A 1 97  ? 18.966  4.062   -34.027 1.00 32.88 ? 140 MET A CE  1 
ATOM   735  N  N   . TYR A 1 98  ? 23.946  5.181   -33.668 1.00 38.14 ? 141 TYR A N   1 
ATOM   736  C  CA  . TYR A 1 98  ? 24.923  4.288   -33.056 1.00 36.54 ? 141 TYR A CA  1 
ATOM   737  C  C   . TYR A 1 98  ? 25.211  4.621   -31.601 1.00 39.45 ? 141 TYR A C   1 
ATOM   738  O  O   . TYR A 1 98  ? 25.858  3.820   -30.922 1.00 46.30 ? 141 TYR A O   1 
ATOM   739  C  CB  . TYR A 1 98  ? 26.243  4.310   -33.820 1.00 41.90 ? 141 TYR A CB  1 
ATOM   740  C  CG  . TYR A 1 98  ? 26.111  4.157   -35.313 1.00 40.76 ? 141 TYR A CG  1 
ATOM   741  C  CD1 . TYR A 1 98  ? 25.017  3.513   -35.881 1.00 41.85 ? 141 TYR A CD1 1 
ATOM   742  C  CD2 . TYR A 1 98  ? 27.095  4.652   -36.158 1.00 40.25 ? 141 TYR A CD2 1 
ATOM   743  C  CE1 . TYR A 1 98  ? 24.902  3.381   -37.252 1.00 46.94 ? 141 TYR A CE1 1 
ATOM   744  C  CE2 . TYR A 1 98  ? 26.994  4.521   -37.528 1.00 49.25 ? 141 TYR A CE2 1 
ATOM   745  C  CZ  . TYR A 1 98  ? 25.896  3.885   -38.069 1.00 48.59 ? 141 TYR A CZ  1 
ATOM   746  O  OH  . TYR A 1 98  ? 25.801  3.758   -39.434 1.00 57.88 ? 141 TYR A OH  1 
ATOM   747  N  N   . GLU A 1 99  ? 24.763  5.767   -31.104 1.00 39.38 ? 142 GLU A N   1 
ATOM   748  C  CA  . GLU A 1 99  ? 24.926  6.097   -29.695 1.00 46.36 ? 142 GLU A CA  1 
ATOM   749  C  C   . GLU A 1 99  ? 23.728  5.570   -28.916 1.00 39.25 ? 142 GLU A C   1 
ATOM   750  O  O   . GLU A 1 99  ? 22.581  5.877   -29.251 1.00 36.60 ? 142 GLU A O   1 
ATOM   751  C  CB  . GLU A 1 99  ? 25.075  7.609   -29.504 1.00 46.68 ? 142 GLU A CB  1 
ATOM   752  N  N   . GLU A 1 100 ? 24.011  4.814   -27.852 1.00 49.05 ? 143 GLU A N   1 
ATOM   753  C  CA  . GLU A 1 100 ? 22.996  4.023   -27.156 1.00 39.04 ? 143 GLU A CA  1 
ATOM   754  C  C   . GLU A 1 100 ? 21.857  4.879   -26.599 1.00 45.88 ? 143 GLU A C   1 
ATOM   755  O  O   . GLU A 1 100 ? 20.687  4.487   -26.688 1.00 49.00 ? 143 GLU A O   1 
ATOM   756  C  CB  . GLU A 1 100 ? 23.655  3.228   -26.026 1.00 47.70 ? 143 GLU A CB  1 
ATOM   757  N  N   . ASN A 1 101 ? 22.167  6.032   -25.990 1.00 43.65 ? 144 ASN A N   1 
ATOM   758  C  CA  . ASN A 1 101 ? 21.158  6.826   -25.289 1.00 36.80 ? 144 ASN A CA  1 
ATOM   759  C  C   . ASN A 1 101 ? 20.725  8.058   -26.071 1.00 39.07 ? 144 ASN A C   1 
ATOM   760  O  O   . ASN A 1 101 ? 20.178  8.995   -25.483 1.00 34.45 ? 144 ASN A O   1 
ATOM   761  C  CB  . ASN A 1 101 ? 21.653  7.241   -23.904 1.00 44.41 ? 144 ASN A CB  1 
ATOM   762  N  N   . SER A 1 102 ? 20.928  8.062   -27.383 1.00 34.18 ? 145 SER A N   1 
ATOM   763  C  CA  . SER A 1 102 ? 20.550  9.190   -28.209 1.00 30.95 ? 145 SER A CA  1 
ATOM   764  C  C   . SER A 1 102 ? 19.032  9.252   -28.396 1.00 28.08 ? 145 SER A C   1 
ATOM   765  O  O   . SER A 1 102 ? 18.319  8.259   -28.231 1.00 27.40 ? 145 SER A O   1 
ATOM   766  C  CB  . SER A 1 102 ? 21.223  9.069   -29.563 1.00 35.06 ? 145 SER A CB  1 
ATOM   767  O  OG  . SER A 1 102 ? 20.684  7.948   -30.233 1.00 33.11 ? 145 SER A OG  1 
ATOM   768  N  N   . GLN A 1 103 ? 18.546  10.427  -28.803 1.00 33.59 ? 146 GLN A N   1 
ATOM   769  C  CA  . GLN A 1 103 ? 17.112  10.588  -29.034 1.00 24.09 ? 146 GLN A CA  1 
ATOM   770  C  C   . GLN A 1 103 ? 16.591  9.578   -30.042 1.00 29.81 ? 146 GLN A C   1 
ATOM   771  O  O   . GLN A 1 103 ? 15.564  8.935   -29.765 1.00 24.05 ? 146 GLN A O   1 
ATOM   772  C  CB  . GLN A 1 103 ? 16.799  12.024  -29.486 1.00 31.35 ? 146 GLN A CB  1 
ATOM   773  N  N   . PRO A 1 104 ? 17.222  9.381   -31.205 1.00 28.67 ? 147 PRO A N   1 
ATOM   774  C  CA  . PRO A 1 104 ? 16.690  8.382   -32.143 1.00 24.94 ? 147 PRO A CA  1 
ATOM   775  C  C   . PRO A 1 104 ? 16.720  6.967   -31.582 1.00 22.67 ? 147 PRO A C   1 
ATOM   776  O  O   . PRO A 1 104 ? 15.806  6.196   -31.888 1.00 19.77 ? 147 PRO A O   1 
ATOM   777  C  CB  . PRO A 1 104 ? 17.578  8.541   -33.394 1.00 23.28 ? 147 PRO A CB  1 
ATOM   778  C  CG  . PRO A 1 104 ? 18.321  9.835   -33.208 1.00 37.63 ? 147 PRO A CG  1 
ATOM   779  C  CD  . PRO A 1 104 ? 18.411  10.074  -31.733 1.00 30.29 ? 147 PRO A CD  1 
ATOM   780  N  N   . ARG A 1 105 ? 17.705  6.601   -30.756 1.00 25.02 ? 148 ARG A N   1 
ATOM   781  C  CA  . ARG A 1 105 ? 17.713  5.239   -30.219 1.00 25.62 ? 148 ARG A CA  1 
ATOM   782  C  C   . ARG A 1 105 ? 16.622  5.050   -29.170 1.00 24.53 ? 148 ARG A C   1 
ATOM   783  O  O   . ARG A 1 105 ? 16.011  3.973   -29.088 1.00 20.24 ? 148 ARG A O   1 
ATOM   784  C  CB  . ARG A 1 105 ? 19.083  4.887   -29.635 1.00 29.04 ? 148 ARG A CB  1 
ATOM   785  C  CG  . ARG A 1 105 ? 20.065  4.351   -30.654 1.00 33.96 ? 148 ARG A CG  1 
ATOM   786  C  CD  . ARG A 1 105 ? 19.638  2.961   -31.182 1.00 28.08 ? 148 ARG A CD  1 
ATOM   787  N  NE  . ARG A 1 105 ? 19.997  1.860   -30.307 1.00 30.43 ? 148 ARG A NE  1 
ATOM   788  C  CZ  . ARG A 1 105 ? 21.229  1.378   -30.176 1.00 32.07 ? 148 ARG A CZ  1 
ATOM   789  N  NH1 . ARG A 1 105 ? 22.251  1.916   -30.848 1.00 40.16 ? 148 ARG A NH1 1 
ATOM   790  N  NH2 . ARG A 1 105 ? 21.435  0.341   -29.382 1.00 35.70 ? 148 ARG A NH2 1 
ATOM   791  N  N   . ARG A 1 106 ? 16.368  6.077   -28.345 1.00 24.03 ? 149 ARG A N   1 
ATOM   792  C  CA  . ARG A 1 106 ? 15.233  6.008   -27.427 1.00 23.49 ? 149 ARG A CA  1 
ATOM   793  C  C   . ARG A 1 106 ? 13.927  5.924   -28.202 1.00 21.21 ? 149 ARG A C   1 
ATOM   794  O  O   . ARG A 1 106 ? 13.053  5.116   -27.868 1.00 23.58 ? 149 ARG A O   1 
ATOM   795  C  CB  . ARG A 1 106 ? 15.240  7.200   -26.467 1.00 23.65 ? 149 ARG A CB  1 
ATOM   796  C  CG  . ARG A 1 106 ? 16.540  7.299   -25.666 1.00 38.84 ? 149 ARG A CG  1 
ATOM   797  N  N   . ASN A 1 107 ? 13.795  6.691   -29.288 1.00 18.27 ? 150 ASN A N   1 
ATOM   798  C  CA  . ASN A 1 107 ? 12.589  6.587   -30.097 1.00 18.56 ? 150 ASN A CA  1 
ATOM   799  C  C   . ASN A 1 107 ? 12.457  5.202   -30.721 1.00 23.36 ? 150 ASN A C   1 
ATOM   800  O  O   . ASN A 1 107 ? 11.337  4.682   -30.837 1.00 19.25 ? 150 ASN A O   1 
ATOM   801  C  CB  . ASN A 1 107 ? 12.576  7.675   -31.161 1.00 22.07 ? 150 ASN A CB  1 
ATOM   802  C  CG  . ASN A 1 107 ? 12.411  9.051   -30.565 1.00 32.27 ? 150 ASN A CG  1 
ATOM   803  O  OD1 . ASN A 1 107 ? 11.962  9.188   -29.431 1.00 34.75 ? 150 ASN A OD1 1 
ATOM   804  N  ND2 . ASN A 1 107 ? 12.765  10.074  -31.322 1.00 39.21 ? 150 ASN A ND2 1 
ATOM   805  N  N   . LEU A 1 108 ? 13.583  4.572   -31.073 1.00 17.04 ? 151 LEU A N   1 
ATOM   806  C  CA  . LEU A 1 108 ? 13.545  3.233   -31.688 1.00 17.12 ? 151 LEU A CA  1 
ATOM   807  C  C   . LEU A 1 108 ? 13.081  2.193   -30.681 1.00 19.81 ? 151 LEU A C   1 
ATOM   808  O  O   . LEU A 1 108 ? 12.356  1.252   -31.026 1.00 17.15 ? 151 LEU A O   1 
ATOM   809  C  CB  . LEU A 1 108 ? 14.922  2.832   -32.238 1.00 18.13 ? 151 LEU A CB  1 
ATOM   810  C  CG  . LEU A 1 108 ? 15.045  1.436   -32.909 1.00 16.33 ? 151 LEU A CG  1 
ATOM   811  C  CD1 . LEU A 1 108 ? 14.138  1.270   -34.083 1.00 17.81 ? 151 LEU A CD1 1 
ATOM   812  C  CD2 . LEU A 1 108 ? 16.485  1.124   -33.315 1.00 17.31 ? 151 LEU A CD2 1 
ATOM   813  N  N   . THR A 1 109 ? 13.479  2.358   -29.431 1.00 16.75 ? 152 THR A N   1 
ATOM   814  C  CA  . THR A 1 109 ? 13.016  1.462   -28.379 1.00 17.07 ? 152 THR A CA  1 
ATOM   815  C  C   . THR A 1 109 ? 11.528  1.622   -28.140 1.00 19.29 ? 152 THR A C   1 
ATOM   816  O  O   . THR A 1 109 ? 10.815  0.627   -28.003 1.00 19.40 ? 152 THR A O   1 
ATOM   817  C  CB  . THR A 1 109 ? 13.808  1.713   -27.095 1.00 24.07 ? 152 THR A CB  1 
ATOM   818  O  OG1 . THR A 1 109 ? 15.194  1.418   -27.343 1.00 23.25 ? 152 THR A OG1 1 
ATOM   819  C  CG2 . THR A 1 109 ? 13.280  0.826   -25.935 1.00 23.38 ? 152 THR A CG2 1 
ATOM   820  N  N   . LYS A 1 110 ? 11.033  2.865   -28.073 1.00 19.16 ? 153 LYS A N   1 
ATOM   821  C  CA  . LYS A 1 110 ? 9.597   3.057   -27.913 1.00 19.54 ? 153 LYS A CA  1 
ATOM   822  C  C   . LYS A 1 110 ? 8.829   2.437   -29.072 1.00 19.34 ? 153 LYS A C   1 
ATOM   823  O  O   . LYS A 1 110 ? 7.797   1.796   -28.867 1.00 21.04 ? 153 LYS A O   1 
ATOM   824  C  CB  . LYS A 1 110 ? 9.269   4.552   -27.786 1.00 22.60 ? 153 LYS A CB  1 
ATOM   825  C  CG  . LYS A 1 110 ? 7.758   4.851   -27.744 1.00 30.25 ? 153 LYS A CG  1 
ATOM   826  C  CD  . LYS A 1 110 ? 7.433   5.923   -26.678 1.00 46.34 ? 153 LYS A CD  1 
ATOM   827  C  CE  . LYS A 1 110 ? 5.949   6.276   -26.589 1.00 37.54 ? 153 LYS A CE  1 
ATOM   828  N  NZ  . LYS A 1 110 ? 5.076   5.119   -26.888 1.00 41.27 ? 153 LYS A NZ  1 
ATOM   829  N  N   . LEU A 1 111 ? 9.312   2.618   -30.302 1.00 15.74 ? 154 LEU A N   1 
ATOM   830  C  CA  . LEU A 1 111 ? 8.652   1.998   -31.443 1.00 17.39 ? 154 LEU A CA  1 
ATOM   831  C  C   . LEU A 1 111 ? 8.721   0.476   -31.365 1.00 16.02 ? 154 LEU A C   1 
ATOM   832  O  O   . LEU A 1 111 ? 7.772   -0.225  -31.751 1.00 14.71 ? 154 LEU A O   1 
ATOM   833  C  CB  . LEU A 1 111 ? 9.278   2.502   -32.742 1.00 17.55 ? 154 LEU A CB  1 
ATOM   834  C  CG  . LEU A 1 111 ? 8.805   3.878   -33.159 1.00 19.78 ? 154 LEU A CG  1 
ATOM   835  C  CD1 . LEU A 1 111 ? 9.797   4.513   -34.070 1.00 23.84 ? 154 LEU A CD1 1 
ATOM   836  C  CD2 . LEU A 1 111 ? 7.438   3.718   -33.825 1.00 25.32 ? 154 LEU A CD2 1 
ATOM   837  N  N   . SER A 1 112 ? 9.838   -0.056  -30.885 1.00 12.17 ? 155 SER A N   1 
ATOM   838  C  CA  . SER A 1 112 ? 9.945   -1.505  -30.743 1.00 14.07 ? 155 SER A CA  1 
ATOM   839  C  C   . SER A 1 112 ? 8.883   -2.030  -29.788 1.00 17.59 ? 155 SER A C   1 
ATOM   840  O  O   . SER A 1 112 ? 8.250   -3.064  -30.045 1.00 13.11 ? 155 SER A O   1 
ATOM   841  C  CB  . SER A 1 112 ? 11.345  -1.890  -30.245 1.00 18.89 ? 155 SER A CB  1 
ATOM   842  O  OG  . SER A 1 112 ? 12.362  -1.501  -31.159 1.00 21.69 ? 155 SER A OG  1 
ATOM   843  N  N   . LEU A 1 113 ? 8.661   -1.315  -28.687 1.00 15.31 ? 156 LEU A N   1 
ATOM   844  C  CA  . LEU A 1 113 ? 7.615   -1.703  -27.753 1.00 18.36 ? 156 LEU A CA  1 
ATOM   845  C  C   . LEU A 1 113 ? 6.242   -1.611  -28.404 1.00 17.49 ? 156 LEU A C   1 
ATOM   846  O  O   . LEU A 1 113 ? 5.401   -2.505  -28.226 1.00 14.69 ? 156 LEU A O   1 
ATOM   847  C  CB  . LEU A 1 113 ? 7.717   -0.821  -26.509 1.00 18.38 ? 156 LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 113 ? 6.994   -1.135  -25.218 1.00 28.42 ? 156 LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 113 ? 7.350   -2.485  -24.692 1.00 26.53 ? 156 LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 113 ? 7.393   -0.089  -24.213 1.00 31.26 ? 156 LEU A CD2 1 
ATOM   851  N  N   . ILE A 1 114 ? 5.999   -0.547  -29.187 1.00 16.47 ? 157 ILE A N   1 
ATOM   852  C  CA  . ILE A 1 114 ? 4.720   -0.416  -29.877 1.00 13.88 ? 157 ILE A CA  1 
ATOM   853  C  C   . ILE A 1 114 ? 4.527   -1.563  -30.870 1.00 16.31 ? 157 ILE A C   1 
ATOM   854  O  O   . ILE A 1 114 ? 3.437   -2.125  -30.962 1.00 14.23 ? 157 ILE A O   1 
ATOM   855  C  CB  . ILE A 1 114 ? 4.592   0.969   -30.557 1.00 20.61 ? 157 ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 114 ? 4.586   2.104   -29.519 1.00 22.07 ? 157 ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 114 ? 3.302   1.064   -31.343 1.00 17.43 ? 157 ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 114 ? 4.644   3.492   -30.153 1.00 20.87 ? 157 ILE A CD1 1 
ATOM   859  N  N   . PHE A 1 115 ? 5.581   -1.956  -31.603 1.00 19.08 ? 158 PHE A N   1 
ATOM   860  C  CA  . PHE A 1 115 ? 5.417   -3.062  -32.538 1.00 15.48 ? 158 PHE A CA  1 
ATOM   861  C  C   . PHE A 1 115 ? 5.097   -4.349  -31.792 1.00 13.08 ? 158 PHE A C   1 
ATOM   862  O  O   . PHE A 1 115 ? 4.331   -5.185  -32.297 1.00 13.85 ? 158 PHE A O   1 
ATOM   863  C  CB  . PHE A 1 115 ? 6.656   -3.269  -33.397 1.00 16.41 ? 158 PHE A CB  1 
ATOM   864  C  CG  . PHE A 1 115 ? 6.832   -2.233  -34.513 1.00 15.87 ? 158 PHE A CG  1 
ATOM   865  C  CD1 . PHE A 1 115 ? 5.847   -2.016  -35.467 1.00 17.80 ? 158 PHE A CD1 1 
ATOM   866  C  CD2 . PHE A 1 115 ? 8.018   -1.521  -34.615 1.00 18.58 ? 158 PHE A CD2 1 
ATOM   867  C  CE1 . PHE A 1 115 ? 6.038   -1.053  -36.497 1.00 20.52 ? 158 PHE A CE1 1 
ATOM   868  C  CE2 . PHE A 1 115 ? 8.208   -0.585  -35.633 1.00 15.54 ? 158 PHE A CE2 1 
ATOM   869  C  CZ  . PHE A 1 115 ? 7.227   -0.356  -36.563 1.00 18.39 ? 158 PHE A CZ  1 
ATOM   870  N  N   . SER A 1 116 ? 5.628   -4.500  -30.577 1.00 12.67 ? 159 SER A N   1 
ATOM   871  C  CA  . SER A 1 116 ? 5.360   -5.706  -29.788 1.00 17.23 ? 159 SER A CA  1 
ATOM   872  C  C   . SER A 1 116 ? 3.885   -5.768  -29.386 1.00 16.84 ? 159 SER A C   1 
ATOM   873  O  O   . SER A 1 116 ? 3.239   -6.821  -29.473 1.00 13.10 ? 159 SER A O   1 
ATOM   874  C  CB  . SER A 1 116 ? 6.242   -5.711  -28.535 1.00 15.35 ? 159 SER A CB  1 
ATOM   875  O  OG  . SER A 1 116 ? 6.086   -6.910  -27.784 1.00 16.69 ? 159 SER A OG  1 
ATOM   876  N  N   . HIS A 1 117 ? 3.346   -4.637  -28.940 1.00 13.68 ? 160 HIS A N   1 
ATOM   877  C  CA  . HIS A 1 117 ? 1.932   -4.550  -28.585 1.00 13.44 ? 160 HIS A CA  1 
ATOM   878  C  C   . HIS A 1 117 ? 1.032   -4.796  -29.781 1.00 13.38 ? 160 HIS A C   1 
ATOM   879  O  O   . HIS A 1 117 ? -0.008  -5.457  -29.661 1.00 13.83 ? 160 HIS A O   1 
ATOM   880  C  CB  . HIS A 1 117 ? 1.647   -3.184  -27.992 1.00 12.38 ? 160 HIS A CB  1 
ATOM   881  C  CG  . HIS A 1 117 ? 2.412   -2.888  -26.754 1.00 15.90 ? 160 HIS A CG  1 
ATOM   882  N  ND1 . HIS A 1 117 ? 2.934   -3.865  -25.938 1.00 21.20 ? 160 HIS A ND1 1 
ATOM   883  C  CD2 . HIS A 1 117 ? 2.696   -1.705  -26.156 1.00 15.96 ? 160 HIS A CD2 1 
ATOM   884  C  CE1 . HIS A 1 117 ? 3.518   -3.298  -24.898 1.00 24.37 ? 160 HIS A CE1 1 
ATOM   885  N  NE2 . HIS A 1 117 ? 3.387   -1.988  -25.009 1.00 17.46 ? 160 HIS A NE2 1 
ATOM   886  N  N   . MET A 1 118 ? 1.403   -4.233  -30.944 1.00 12.56 ? 161 MET A N   1 
ATOM   887  C  CA  . MET A 1 118 ? 0.640   -4.423  -32.166 1.00 11.25 ? 161 MET A CA  1 
ATOM   888  C  C   . MET A 1 118 ? 0.580   -5.889  -32.573 1.00 13.45 ? 161 MET A C   1 
ATOM   889  O  O   . MET A 1 118 ? -0.493  -6.405  -32.947 1.00 11.91 ? 161 MET A O   1 
ATOM   890  C  CB  . MET A 1 118 ? 1.254   -3.576  -33.283 1.00 16.19 ? 161 MET A CB  1 
ATOM   891  C  CG  . MET A 1 118 ? 0.980   -2.100  -33.085 1.00 16.66 ? 161 MET A CG  1 
ATOM   892  S  SD  . MET A 1 118 ? 1.953   -1.101  -34.221 1.00 26.04 ? 161 MET A SD  1 
ATOM   893  C  CE  . MET A 1 118 ? 1.263   -1.613  -35.748 1.00 20.25 ? 161 MET A CE  1 
ATOM   894  N  N   . LEU A 1 119 ? 1.730   -6.569  -32.531 1.00 14.89 ? 162 LEU A N   1 
ATOM   895  C  CA  . LEU A 1 119 ? 1.780   -7.993  -32.861 1.00 13.18 ? 162 LEU A CA  1 
ATOM   896  C  C   . LEU A 1 119 ? 0.896   -8.802  -31.918 1.00 12.93 ? 162 LEU A C   1 
ATOM   897  O  O   . LEU A 1 119 ? 0.146   -9.679  -32.361 1.00 14.56 ? 162 LEU A O   1 
ATOM   898  C  CB  . LEU A 1 119 ? 3.219   -8.505  -32.793 1.00 10.96 ? 162 LEU A CB  1 
ATOM   899  C  CG  . LEU A 1 119 ? 3.391   -9.985  -33.194 1.00 12.08 ? 162 LEU A CG  1 
ATOM   900  C  CD1 . LEU A 1 119 ? 2.900   -10.265 -34.575 1.00 17.57 ? 162 LEU A CD1 1 
ATOM   901  C  CD2 . LEU A 1 119 ? 4.850   -10.440 -33.004 1.00 18.07 ? 162 LEU A CD2 1 
ATOM   902  N  N   . ALA A 1 120 ? 0.988   -8.538  -30.614 1.00 10.99 ? 163 ALA A N   1 
ATOM   903  C  CA  . ALA A 1 120 ? 0.168   -9.283  -29.663 1.00 13.91 ? 163 ALA A CA  1 
ATOM   904  C  C   . ALA A 1 120 ? -1.316  -9.092  -29.965 1.00 16.06 ? 163 ALA A C   1 
ATOM   905  O  O   . ALA A 1 120 ? -2.095  -10.051 -29.943 1.00 12.67 ? 163 ALA A O   1 
ATOM   906  C  CB  . ALA A 1 120 ? 0.484   -8.854  -28.235 1.00 15.79 ? 163 ALA A CB  1 
ATOM   907  N  N   . GLU A 1 121 ? -1.719  -7.853  -30.246 1.00 17.53 ? 164 GLU A N   1 
ATOM   908  C  CA  . GLU A 1 121 ? -3.109  -7.561  -30.573 1.00 12.93 ? 164 GLU A CA  1 
ATOM   909  C  C   . GLU A 1 121 ? -3.553  -8.288  -31.825 1.00 13.12 ? 164 GLU A C   1 
ATOM   910  O  O   . GLU A 1 121 ? -4.628  -8.905  -31.862 1.00 15.05 ? 164 GLU A O   1 
ATOM   911  C  CB  . GLU A 1 121 ? -3.278  -6.051  -30.757 1.00 13.11 ? 164 GLU A CB  1 
ATOM   912  C  CG  . GLU A 1 121 ? -4.704  -5.598  -30.898 1.00 17.64 ? 164 GLU A CG  1 
ATOM   913  C  CD  . GLU A 1 121 ? -4.773  -4.149  -31.364 1.00 26.09 ? 164 GLU A CD  1 
ATOM   914  O  OE1 . GLU A 1 121 ? -4.307  -3.878  -32.492 1.00 22.55 ? 164 GLU A OE1 1 
ATOM   915  O  OE2 . GLU A 1 121 ? -5.255  -3.289  -30.598 1.00 19.15 ? 164 GLU A OE2 1 
ATOM   916  N  N   . LEU A 1 122 ? -2.743  -8.198  -32.877 1.00 14.59 ? 165 LEU A N   1 
ATOM   917  C  CA  . LEU A 1 122 ? -3.060  -8.878  -34.124 1.00 15.20 ? 165 LEU A CA  1 
ATOM   918  C  C   . LEU A 1 122 ? -3.299  -10.368 -33.901 1.00 17.31 ? 165 LEU A C   1 
ATOM   919  O  O   . LEU A 1 122 ? -4.254  -10.937 -34.445 1.00 14.56 ? 165 LEU A O   1 
ATOM   920  C  CB  . LEU A 1 122 ? -1.923  -8.661  -35.120 1.00 16.20 ? 165 LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 122 ? -2.189  -9.254  -36.504 1.00 14.08 ? 165 LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 122 ? -3.272  -8.412  -37.182 1.00 18.71 ? 165 LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 122 ? -0.922  -9.245  -37.342 1.00 17.36 ? 165 LEU A CD2 1 
ATOM   924  N  N   . LYS A 1 123 ? -2.436  -11.010 -33.100 1.00 15.44 ? 166 LYS A N   1 
ATOM   925  C  CA  . LYS A 1 123 ? -2.612  -12.429 -32.797 1.00 17.15 ? 166 LYS A CA  1 
ATOM   926  C  C   . LYS A 1 123 ? -3.822  -12.685 -31.906 1.00 15.09 ? 166 LYS A C   1 
ATOM   927  O  O   . LYS A 1 123 ? -4.457  -13.738 -32.026 1.00 17.99 ? 166 LYS A O   1 
ATOM   928  C  CB  . LYS A 1 123 ? -1.347  -12.988 -32.158 1.00 21.89 ? 166 LYS A CB  1 
ATOM   929  C  CG  . LYS A 1 123 ? -0.178  -13.060 -33.131 1.00 20.59 ? 166 LYS A CG  1 
ATOM   930  C  CD  . LYS A 1 123 ? 1.020   -13.722 -32.524 1.00 23.72 ? 166 LYS A CD  1 
ATOM   931  C  CE  . LYS A 1 123 ? 2.100   -13.930 -33.558 1.00 30.23 ? 166 LYS A CE  1 
ATOM   932  N  NZ  . LYS A 1 123 ? 3.406   -14.342 -32.969 1.00 41.47 ? 166 LYS A NZ  1 
ATOM   933  N  N   . GLY A 1 124 ? -4.178  -11.744 -31.024 1.00 13.78 ? 167 GLY A N   1 
ATOM   934  C  CA  . GLY A 1 124 ? -5.377  -11.927 -30.218 1.00 17.29 ? 167 GLY A CA  1 
ATOM   935  C  C   . GLY A 1 124 ? -6.642  -11.886 -31.050 1.00 17.31 ? 167 GLY A C   1 
ATOM   936  O  O   . GLY A 1 124 ? -7.605  -12.608 -30.782 1.00 18.07 ? 167 GLY A O   1 
ATOM   937  N  N   . ILE A 1 125 ? -6.654  -11.048 -32.080 1.00 14.05 ? 168 ILE A N   1 
ATOM   938  C  CA  . ILE A 1 125 ? -7.827  -10.888 -32.934 1.00 15.85 ? 168 ILE A CA  1 
ATOM   939  C  C   . ILE A 1 125 ? -7.843  -11.907 -34.079 1.00 16.25 ? 168 ILE A C   1 
ATOM   940  O  O   . ILE A 1 125 ? -8.927  -12.339 -34.480 1.00 12.40 ? 168 ILE A O   1 
ATOM   941  C  CB  . ILE A 1 125 ? -7.869  -9.452  -33.481 1.00 15.71 ? 168 ILE A CB  1 
ATOM   942  C  CG1 . ILE A 1 125 ? -7.878  -8.444  -32.338 1.00 17.81 ? 168 ILE A CG1 1 
ATOM   943  C  CG2 . ILE A 1 125 ? -9.053  -9.254  -34.418 1.00 16.53 ? 168 ILE A CG2 1 
ATOM   944  C  CD1 . ILE A 1 125 ? -8.914  -8.668  -31.307 1.00 19.93 ? 168 ILE A CD1 1 
ATOM   945  N  N   . PHE A 1 126 ? -6.669  -12.299 -34.605 1.00 13.37 ? 169 PHE A N   1 
ATOM   946  C  CA  . PHE A 1 126 ? -6.542  -13.288 -35.683 1.00 13.05 ? 169 PHE A CA  1 
ATOM   947  C  C   . PHE A 1 126 ? -5.685  -14.474 -35.210 1.00 20.84 ? 169 PHE A C   1 
ATOM   948  O  O   . PHE A 1 126 ? -4.589  -14.700 -35.746 1.00 16.68 ? 169 PHE A O   1 
ATOM   949  C  CB  . PHE A 1 126 ? -5.891  -12.695 -36.932 1.00 16.24 ? 169 PHE A CB  1 
ATOM   950  C  CG  . PHE A 1 126 ? -6.710  -11.669 -37.677 1.00 16.73 ? 169 PHE A CG  1 
ATOM   951  C  CD1 . PHE A 1 126 ? -6.699  -10.340 -37.287 1.00 13.28 ? 169 PHE A CD1 1 
ATOM   952  C  CD2 . PHE A 1 126 ? -7.411  -12.013 -38.829 1.00 14.32 ? 169 PHE A CD2 1 
ATOM   953  C  CE1 . PHE A 1 126 ? -7.390  -9.382  -38.004 1.00 17.02 ? 169 PHE A CE1 1 
ATOM   954  C  CE2 . PHE A 1 126 ? -8.098  -11.075 -39.541 1.00 14.24 ? 169 PHE A CE2 1 
ATOM   955  C  CZ  . PHE A 1 126 ? -8.106  -9.737  -39.117 1.00 16.20 ? 169 PHE A CZ  1 
ATOM   956  N  N   . PRO A 1 127 ? -6.131  -15.238 -34.201 1.00 15.59 ? 170 PRO A N   1 
ATOM   957  C  CA  . PRO A 1 127 ? -5.187  -16.193 -33.572 1.00 19.08 ? 170 PRO A CA  1 
ATOM   958  C  C   . PRO A 1 127 ? -4.638  -17.250 -34.521 1.00 17.02 ? 170 PRO A C   1 
ATOM   959  O  O   . PRO A 1 127 ? -3.451  -17.576 -34.407 1.00 18.96 ? 170 PRO A O   1 
ATOM   960  C  CB  . PRO A 1 127 ? -5.988  -16.800 -32.408 1.00 20.38 ? 170 PRO A CB  1 
ATOM   961  C  CG  . PRO A 1 127 ? -7.422  -16.488 -32.697 1.00 23.29 ? 170 PRO A CG  1 
ATOM   962  C  CD  . PRO A 1 127 ? -7.447  -15.230 -33.532 1.00 17.97 ? 170 PRO A CD  1 
ATOM   963  N  N   . SER A 1 128 ? -5.431  -17.786 -35.452 1.00 15.09 ? 171 SER A N   1 
ATOM   964  C  CA  . SER A 1 128 ? -4.901  -18.682 -36.481 1.00 15.59 ? 171 SER A CA  1 
ATOM   965  C  C   . SER A 1 128 ? -5.002  -18.085 -37.873 1.00 11.77 ? 171 SER A C   1 
ATOM   966  O  O   . SER A 1 128 ? -5.014  -18.827 -38.865 1.00 16.70 ? 171 SER A O   1 
ATOM   967  C  CB  . SER A 1 128 ? -5.605  -20.040 -36.440 1.00 17.68 ? 171 SER A CB  1 
ATOM   968  O  OG  . SER A 1 128 ? -5.462  -20.646 -35.175 1.00 24.40 ? 171 SER A OG  1 
ATOM   969  N  N   . GLY A 1 129 ? -5.055  -16.746 -37.967 1.00 16.76 ? 172 GLY A N   1 
ATOM   970  C  CA  . GLY A 1 129 ? -5.111  -16.033 -39.219 1.00 18.19 ? 172 GLY A CA  1 
ATOM   971  C  C   . GLY A 1 129 ? -6.511  -15.646 -39.655 1.00 14.93 ? 172 GLY A C   1 
ATOM   972  O  O   . GLY A 1 129 ? -6.644  -14.900 -40.620 1.00 16.23 ? 172 GLY A O   1 
ATOM   973  N  N   . LEU A 1 130 ? -7.545  -16.168 -39.006 1.00 15.83 ? 173 LEU A N   1 
ATOM   974  C  CA  . LEU A 1 130 ? -8.922  -15.846 -39.351 1.00 14.52 ? 173 LEU A CA  1 
ATOM   975  C  C   . LEU A 1 130 ? -9.472  -14.902 -38.292 1.00 9.70  ? 173 LEU A C   1 
ATOM   976  O  O   . LEU A 1 130 ? -9.195  -15.058 -37.098 1.00 14.94 ? 173 LEU A O   1 
ATOM   977  C  CB  . LEU A 1 130 ? -9.769  -17.116 -39.455 1.00 14.63 ? 173 LEU A CB  1 
ATOM   978  C  CG  . LEU A 1 130 ? -11.190 -16.923 -40.011 1.00 15.06 ? 173 LEU A CG  1 
ATOM   979  C  CD1 . LEU A 1 130 ? -11.127 -16.638 -41.514 1.00 22.10 ? 173 LEU A CD1 1 
ATOM   980  C  CD2 . LEU A 1 130 ? -11.977 -18.183 -39.708 1.00 17.61 ? 173 LEU A CD2 1 
ATOM   981  N  N   . PHE A 1 131 ? -10.233 -13.912 -38.729 1.00 15.26 ? 174 PHE A N   1 
ATOM   982  C  CA  . PHE A 1 131 ? -10.790 -12.924 -37.800 1.00 14.56 ? 174 PHE A CA  1 
ATOM   983  C  C   . PHE A 1 131 ? -11.705 -13.570 -36.754 1.00 14.63 ? 174 PHE A C   1 
ATOM   984  O  O   . PHE A 1 131 ? -12.705 -14.219 -37.094 1.00 15.30 ? 174 PHE A O   1 
ATOM   985  C  CB  . PHE A 1 131 ? -11.559 -11.868 -38.596 1.00 15.47 ? 174 PHE A CB  1 
ATOM   986  C  CG  . PHE A 1 131 ? -12.148 -10.779 -37.738 1.00 18.92 ? 174 PHE A CG  1 
ATOM   987  C  CD1 . PHE A 1 131 ? -11.324 -9.806  -37.203 1.00 20.66 ? 174 PHE A CD1 1 
ATOM   988  C  CD2 . PHE A 1 131 ? -13.513 -10.734 -37.455 1.00 20.48 ? 174 PHE A CD2 1 
ATOM   989  C  CE1 . PHE A 1 131 ? -11.851 -8.778  -36.413 1.00 20.63 ? 174 PHE A CE1 1 
ATOM   990  C  CE2 . PHE A 1 131 ? -14.053 -9.704  -36.664 1.00 19.42 ? 174 PHE A CE2 1 
ATOM   991  C  CZ  . PHE A 1 131 ? -13.216 -8.736  -36.136 1.00 20.22 ? 174 PHE A CZ  1 
ATOM   992  N  N   . GLN A 1 132 ? -11.390 -13.353 -35.473 1.00 12.30 ? 175 GLN A N   1 
ATOM   993  C  CA  . GLN A 1 132 ? -12.150 -13.922 -34.363 1.00 16.03 ? 175 GLN A CA  1 
ATOM   994  C  C   . GLN A 1 132 ? -12.621 -12.834 -33.402 1.00 17.34 ? 175 GLN A C   1 
ATOM   995  O  O   . GLN A 1 132 ? -12.967 -13.118 -32.251 1.00 17.62 ? 175 GLN A O   1 
ATOM   996  C  CB  . GLN A 1 132 ? -11.324 -14.982 -33.632 1.00 16.94 ? 175 GLN A CB  1 
ATOM   997  C  CG  . GLN A 1 132 ? -11.103 -16.264 -34.475 1.00 17.85 ? 175 GLN A CG  1 
ATOM   998  C  CD  . GLN A 1 132 ? -12.305 -17.217 -34.444 1.00 24.70 ? 175 GLN A CD  1 
ATOM   999  O  OE1 . GLN A 1 132 ? -13.398 -16.839 -34.029 1.00 23.57 ? 175 GLN A OE1 1 
ATOM   1000 N  NE2 . GLN A 1 132 ? -12.091 -18.464 -34.861 1.00 19.46 ? 175 GLN A NE2 1 
ATOM   1001 N  N   . GLY A 1 133 ? -12.674 -11.597 -33.868 1.00 18.65 ? 176 GLY A N   1 
ATOM   1002 C  CA  . GLY A 1 133 ? -13.064 -10.494 -32.996 1.00 24.88 ? 176 GLY A CA  1 
ATOM   1003 C  C   . GLY A 1 133 ? -14.435 -10.648 -32.369 1.00 22.97 ? 176 GLY A C   1 
ATOM   1004 O  O   . GLY A 1 133 ? -14.630 -10.252 -31.216 1.00 25.54 ? 176 GLY A O   1 
ATOM   1005 N  N   . ASP A 1 134 ? -15.396 -11.243 -33.095 1.00 24.28 ? 177 ASP A N   1 
ATOM   1006 C  CA  . ASP A 1 134 ? -16.774 -11.308 -32.608 1.00 27.78 ? 177 ASP A CA  1 
ATOM   1007 C  C   . ASP A 1 134 ? -16.936 -12.220 -31.405 1.00 30.34 ? 177 ASP A C   1 
ATOM   1008 O  O   . ASP A 1 134 ? -17.916 -12.089 -30.667 1.00 37.06 ? 177 ASP A O   1 
ATOM   1009 C  CB  . ASP A 1 134 ? -17.706 -11.762 -33.736 1.00 39.09 ? 177 ASP A CB  1 
ATOM   1010 C  CG  . ASP A 1 134 ? -17.587 -10.885 -34.978 1.00 35.90 ? 177 ASP A CG  1 
ATOM   1011 O  OD1 . ASP A 1 134 ? -17.459 -9.662  -34.822 1.00 41.24 ? 177 ASP A OD1 1 
ATOM   1012 O  OD2 . ASP A 1 134 ? -17.588 -11.413 -36.119 1.00 56.01 ? 177 ASP A OD2 1 
ATOM   1013 N  N   . THR A 1 135 ? -16.005 -13.145 -31.188 1.00 23.77 ? 178 THR A N   1 
ATOM   1014 C  CA  . THR A 1 135 ? -16.040 -14.029 -30.034 1.00 28.23 ? 178 THR A CA  1 
ATOM   1015 C  C   . THR A 1 135 ? -14.859 -13.801 -29.101 1.00 20.81 ? 178 THR A C   1 
ATOM   1016 O  O   . THR A 1 135 ? -14.517 -14.693 -28.314 1.00 22.64 ? 178 THR A O   1 
ATOM   1017 C  CB  . THR A 1 135 ? -16.095 -15.488 -30.490 1.00 25.94 ? 178 THR A CB  1 
ATOM   1018 O  OG1 . THR A 1 135 ? -15.043 -15.744 -31.435 1.00 27.40 ? 178 THR A OG1 1 
ATOM   1019 C  CG2 . THR A 1 135 ? -17.452 -15.778 -31.152 1.00 29.29 ? 178 THR A CG2 1 
ATOM   1020 N  N   . PHE A 1 136 ? -14.226 -12.632 -29.163 1.00 20.93 ? 179 PHE A N   1 
ATOM   1021 C  CA  . PHE A 1 136 ? -13.087 -12.365 -28.285 1.00 22.06 ? 179 PHE A CA  1 
ATOM   1022 C  C   . PHE A 1 136 ? -13.530 -12.464 -26.835 1.00 22.62 ? 179 PHE A C   1 
ATOM   1023 O  O   . PHE A 1 136 ? -14.543 -11.872 -26.460 1.00 22.82 ? 179 PHE A O   1 
ATOM   1024 C  CB  . PHE A 1 136 ? -12.513 -10.972 -28.568 1.00 15.93 ? 179 PHE A CB  1 
ATOM   1025 C  CG  . PHE A 1 136 ? -11.247 -10.677 -27.821 1.00 18.71 ? 179 PHE A CG  1 
ATOM   1026 C  CD1 . PHE A 1 136 ? -11.268 -10.188 -26.527 1.00 16.62 ? 179 PHE A CD1 1 
ATOM   1027 C  CD2 . PHE A 1 136 ? -10.027 -10.887 -28.429 1.00 21.40 ? 179 PHE A CD2 1 
ATOM   1028 C  CE1 . PHE A 1 136 ? -10.080 -9.929  -25.850 1.00 18.27 ? 179 PHE A CE1 1 
ATOM   1029 C  CE2 . PHE A 1 136 ? -8.844  -10.634 -27.755 1.00 24.27 ? 179 PHE A CE2 1 
ATOM   1030 C  CZ  . PHE A 1 136 ? -8.874  -10.155 -26.472 1.00 20.66 ? 179 PHE A CZ  1 
ATOM   1031 N  N   . ARG A 1 137 ? -12.797 -13.251 -26.037 1.00 18.33 ? 180 ARG A N   1 
ATOM   1032 C  CA  . ARG A 1 137 ? -13.098 -13.446 -24.616 1.00 20.28 ? 180 ARG A CA  1 
ATOM   1033 C  C   . ARG A 1 137 ? -12.317 -12.443 -23.776 1.00 20.23 ? 180 ARG A C   1 
ATOM   1034 O  O   . ARG A 1 137 ? -11.098 -12.564 -23.617 1.00 18.64 ? 180 ARG A O   1 
ATOM   1035 C  CB  . ARG A 1 137 ? -12.773 -14.875 -24.166 1.00 29.81 ? 180 ARG A CB  1 
ATOM   1036 C  CG  . ARG A 1 137 ? -13.702 -15.935 -24.735 1.00 48.84 ? 180 ARG A CG  1 
ATOM   1037 N  N   . ILE A 1 138 ? -13.031 -11.471 -23.210 1.00 19.99 ? 181 ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 138 ? -12.461 -10.581 -22.201 1.00 19.17 ? 181 ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 138 ? -12.315 -11.349 -20.895 1.00 22.82 ? 181 ILE A C   1 
ATOM   1040 O  O   . ILE A 1 138 ? -13.240 -12.042 -20.469 1.00 21.24 ? 181 ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 138 ? -13.355 -9.341  -22.049 1.00 22.03 ? 181 ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 138 ? -13.302 -8.520  -23.348 1.00 20.09 ? 181 ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 138 ? -12.972 -8.484  -20.842 1.00 19.24 ? 181 ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 138 ? -14.484 -7.523  -23.501 1.00 18.38 ? 181 ILE A CD1 1 
ATOM   1045 N  N   . THR A 1 139 ? -11.138 -11.230 -20.267 1.00 21.02 ? 182 THR A N   1 
ATOM   1046 C  CA  . THR A 1 139 ? -10.761 -12.064 -19.121 1.00 24.56 ? 182 THR A CA  1 
ATOM   1047 C  C   . THR A 1 139 ? -11.625 -11.794 -17.883 1.00 21.62 ? 182 THR A C   1 
ATOM   1048 O  O   . THR A 1 139 ? -12.170 -12.731 -17.282 1.00 19.56 ? 182 THR A O   1 
ATOM   1049 C  CB  . THR A 1 139 ? -9.272  -11.840 -18.803 1.00 21.59 ? 182 THR A CB  1 
ATOM   1050 O  OG1 . THR A 1 139 ? -8.484  -12.259 -19.914 1.00 23.18 ? 182 THR A OG1 1 
ATOM   1051 C  CG2 . THR A 1 139 ? -8.812  -12.615 -17.548 1.00 24.32 ? 182 THR A CG2 1 
ATOM   1052 N  N   . LYS A 1 140 ? -11.740 -10.535 -17.452 1.00 17.45 ? 183 LYS A N   1 
ATOM   1053 C  CA  . LYS A 1 140 ? -12.483 -10.227 -16.222 1.00 19.62 ? 183 LYS A CA  1 
ATOM   1054 C  C   . LYS A 1 140 ? -13.978 -10.057 -16.496 1.00 20.09 ? 183 LYS A C   1 
ATOM   1055 O  O   . LYS A 1 140 ? -14.380 -9.246  -17.333 1.00 20.12 ? 183 LYS A O   1 
ATOM   1056 C  CB  . LYS A 1 140 ? -11.946 -8.969  -15.535 1.00 20.30 ? 183 LYS A CB  1 
ATOM   1057 C  CG  . LYS A 1 140 ? -10.451 -8.990  -15.185 1.00 19.96 ? 183 LYS A CG  1 
ATOM   1058 C  CD  . LYS A 1 140 ? -10.035 -10.180 -14.289 1.00 22.18 ? 183 LYS A CD  1 
ATOM   1059 C  CE  . LYS A 1 140 ? -10.681 -10.170 -12.964 1.00 29.76 ? 183 LYS A CE  1 
ATOM   1060 N  NZ  . LYS A 1 140 ? -9.928  -11.047 -12.003 1.00 41.95 ? 183 LYS A NZ  1 
ATOM   1061 N  N   . ALA A 1 141 ? -14.812 -10.776 -15.725 1.00 26.03 ? 184 ALA A N   1 
ATOM   1062 C  CA  . ALA A 1 141 ? -16.252 -10.837 -16.014 1.00 22.11 ? 184 ALA A CA  1 
ATOM   1063 C  C   . ALA A 1 141 ? -16.921 -9.471  -15.978 1.00 22.85 ? 184 ALA A C   1 
ATOM   1064 O  O   . ALA A 1 141 ? -17.790 -9.174  -16.806 1.00 21.10 ? 184 ALA A O   1 
ATOM   1065 C  CB  . ALA A 1 141 ? -16.954 -11.765 -15.018 1.00 23.18 ? 184 ALA A CB  1 
ATOM   1066 N  N   . ASP A 1 142 ? -16.589 -8.650  -14.992 1.00 21.43 ? 185 ASP A N   1 
ATOM   1067 C  CA  . ASP A 1 142 ? -17.218 -7.336  -14.891 1.00 26.33 ? 185 ASP A CA  1 
ATOM   1068 C  C   . ASP A 1 142 ? -16.822 -6.445  -16.058 1.00 24.51 ? 185 ASP A C   1 
ATOM   1069 O  O   . ASP A 1 142 ? -17.632 -5.645  -16.534 1.00 18.75 ? 185 ASP A O   1 
ATOM   1070 C  CB  . ASP A 1 142 ? -16.820 -6.668  -13.585 1.00 25.72 ? 185 ASP A CB  1 
ATOM   1071 C  CG  . ASP A 1 142 ? -17.434 -7.333  -12.368 1.00 33.88 ? 185 ASP A CG  1 
ATOM   1072 O  OD1 . ASP A 1 142 ? -18.243 -8.266  -12.526 1.00 36.64 ? 185 ASP A OD1 1 
ATOM   1073 O  OD2 . ASP A 1 142 ? -17.109 -6.905  -11.247 1.00 38.09 ? 185 ASP A OD2 1 
ATOM   1074 N  N   . ALA A 1 143 ? -15.592 -6.593  -16.544 1.00 19.45 ? 186 ALA A N   1 
ATOM   1075 C  CA  . ALA A 1 143 ? -15.147 -5.817  -17.701 1.00 21.43 ? 186 ALA A CA  1 
ATOM   1076 C  C   . ALA A 1 143 ? -15.787 -6.334  -18.981 1.00 15.54 ? 186 ALA A C   1 
ATOM   1077 O  O   . ALA A 1 143 ? -16.210 -5.546  -19.832 1.00 13.91 ? 186 ALA A O   1 
ATOM   1078 C  CB  . ALA A 1 143 ? -13.622 -5.854  -17.789 1.00 20.99 ? 186 ALA A CB  1 
ATOM   1079 N  N   . ALA A 1 144 ? -15.918 -7.654  -19.106 1.00 18.11 ? 187 ALA A N   1 
ATOM   1080 C  CA  . ALA A 1 144 ? -16.633 -8.231  -20.236 1.00 22.87 ? 187 ALA A CA  1 
ATOM   1081 C  C   . ALA A 1 144 ? -18.057 -7.701  -20.304 1.00 18.67 ? 187 ALA A C   1 
ATOM   1082 O  O   . ALA A 1 144 ? -18.545 -7.353  -21.386 1.00 16.90 ? 187 ALA A O   1 
ATOM   1083 C  CB  . ALA A 1 144 ? -16.630 -9.759  -20.137 1.00 20.64 ? 187 ALA A CB  1 
ATOM   1084 N  N   . GLU A 1 145 ? -18.728 -7.591  -19.158 1.00 18.25 ? 188 GLU A N   1 
ATOM   1085 C  CA  . GLU A 1 145 ? -20.104 -7.112  -19.205 1.00 25.84 ? 188 GLU A CA  1 
ATOM   1086 C  C   . GLU A 1 145 ? -20.155 -5.655  -19.642 1.00 24.33 ? 188 GLU A C   1 
ATOM   1087 O  O   . GLU A 1 145 ? -21.065 -5.263  -20.380 1.00 20.52 ? 188 GLU A O   1 
ATOM   1088 C  CB  . GLU A 1 145 ? -20.797 -7.306  -17.852 1.00 24.73 ? 188 GLU A CB  1 
ATOM   1089 C  CG  . GLU A 1 145 ? -21.813 -8.455  -17.825 1.00 49.92 ? 188 GLU A CG  1 
ATOM   1090 C  CD  . GLU A 1 145 ? -22.870 -8.351  -18.939 1.00 56.88 ? 188 GLU A CD  1 
ATOM   1091 O  OE1 . GLU A 1 145 ? -23.623 -7.349  -18.976 1.00 60.36 ? 188 GLU A OE1 1 
ATOM   1092 O  OE2 . GLU A 1 145 ? -22.936 -9.267  -19.788 1.00 53.51 ? 188 GLU A OE2 1 
ATOM   1093 N  N   . PHE A 1 146 ? -19.183 -4.840  -19.210 1.00 22.41 ? 189 PHE A N   1 
ATOM   1094 C  CA  . PHE A 1 146 ? -19.131 -3.450  -19.652 1.00 20.30 ? 189 PHE A CA  1 
ATOM   1095 C  C   . PHE A 1 146 ? -19.020 -3.363  -21.161 1.00 20.97 ? 189 PHE A C   1 
ATOM   1096 O  O   . PHE A 1 146 ? -19.726 -2.573  -21.802 1.00 15.95 ? 189 PHE A O   1 
ATOM   1097 C  CB  . PHE A 1 146 ? -17.939 -2.701  -19.020 1.00 17.47 ? 189 PHE A CB  1 
ATOM   1098 C  CG  . PHE A 1 146 ? -17.652 -1.369  -19.674 1.00 17.46 ? 189 PHE A CG  1 
ATOM   1099 C  CD1 . PHE A 1 146 ? -16.706 -1.258  -20.707 1.00 15.47 ? 189 PHE A CD1 1 
ATOM   1100 C  CD2 . PHE A 1 146 ? -18.294 -0.220  -19.261 1.00 18.48 ? 189 PHE A CD2 1 
ATOM   1101 C  CE1 . PHE A 1 146 ? -16.464 -0.040  -21.323 1.00 14.44 ? 189 PHE A CE1 1 
ATOM   1102 C  CE2 . PHE A 1 146 ? -18.037 1.006   -19.874 1.00 16.36 ? 189 PHE A CE2 1 
ATOM   1103 C  CZ  . PHE A 1 146 ? -17.124 1.091   -20.904 1.00 23.43 ? 189 PHE A CZ  1 
ATOM   1104 N  N   . TRP A 1 147 ? -18.100 -4.141  -21.748 1.00 18.45 ? 190 TRP A N   1 
ATOM   1105 C  CA  . TRP A 1 147 ? -17.888 -4.030  -23.183 1.00 17.84 ? 190 TRP A CA  1 
ATOM   1106 C  C   . TRP A 1 147 ? -19.112 -4.525  -23.937 1.00 19.32 ? 190 TRP A C   1 
ATOM   1107 O  O   . TRP A 1 147 ? -19.511 -3.922  -24.929 1.00 17.70 ? 190 TRP A O   1 
ATOM   1108 C  CB  . TRP A 1 147 ? -16.630 -4.799  -23.593 1.00 18.15 ? 190 TRP A CB  1 
ATOM   1109 C  CG  . TRP A 1 147 ? -16.212 -4.587  -25.022 1.00 15.67 ? 190 TRP A CG  1 
ATOM   1110 C  CD1 . TRP A 1 147 ? -16.655 -5.264  -26.099 1.00 15.64 ? 190 TRP A CD1 1 
ATOM   1111 C  CD2 . TRP A 1 147 ? -15.251 -3.641  -25.507 1.00 17.36 ? 190 TRP A CD2 1 
ATOM   1112 N  NE1 . TRP A 1 147 ? -16.050 -4.796  -27.246 1.00 18.78 ? 190 TRP A NE1 1 
ATOM   1113 C  CE2 . TRP A 1 147 ? -15.176 -3.801  -26.905 1.00 16.24 ? 190 TRP A CE2 1 
ATOM   1114 C  CE3 . TRP A 1 147 ? -14.456 -2.668  -24.895 1.00 17.85 ? 190 TRP A CE3 1 
ATOM   1115 C  CZ2 . TRP A 1 147 ? -14.330 -3.040  -27.704 1.00 17.37 ? 190 TRP A CZ2 1 
ATOM   1116 C  CZ3 . TRP A 1 147 ? -13.624 -1.895  -25.693 1.00 19.72 ? 190 TRP A CZ3 1 
ATOM   1117 C  CH2 . TRP A 1 147 ? -13.562 -2.089  -27.081 1.00 19.81 ? 190 TRP A CH2 1 
ATOM   1118 N  N   . ARG A 1 148 ? -19.705 -5.630  -23.484 1.00 16.75 ? 191 ARG A N   1 
ATOM   1119 C  CA  . ARG A 1 148 ? -20.873 -6.176  -24.167 1.00 18.96 ? 191 ARG A CA  1 
ATOM   1120 C  C   . ARG A 1 148 ? -22.004 -5.163  -24.162 1.00 21.47 ? 191 ARG A C   1 
ATOM   1121 O  O   . ARG A 1 148 ? -22.641 -4.920  -25.195 1.00 21.90 ? 191 ARG A O   1 
ATOM   1122 C  CB  . ARG A 1 148 ? -21.295 -7.489  -23.492 1.00 21.57 ? 191 ARG A CB  1 
ATOM   1123 C  CG  . ARG A 1 148 ? -22.464 -8.201  -24.163 1.00 33.08 ? 191 ARG A CG  1 
ATOM   1124 C  CD  . ARG A 1 148 ? -22.750 -9.547  -23.514 1.00 34.32 ? 191 ARG A CD  1 
ATOM   1125 N  N   . LYS A 1 149 ? -22.223 -4.511  -23.022 1.00 22.47 ? 192 LYS A N   1 
ATOM   1126 C  CA  . LYS A 1 149 ? -23.309 -3.549  -22.932 1.00 19.96 ? 192 LYS A CA  1 
ATOM   1127 C  C   . LYS A 1 149 ? -23.041 -2.324  -23.796 1.00 27.81 ? 192 LYS A C   1 
ATOM   1128 O  O   . LYS A 1 149 ? -23.928 -1.875  -24.527 1.00 21.81 ? 192 LYS A O   1 
ATOM   1129 C  CB  . LYS A 1 149 ? -23.532 -3.148  -21.474 1.00 25.43 ? 192 LYS A CB  1 
ATOM   1130 C  CG  . LYS A 1 149 ? -24.601 -2.089  -21.293 1.00 40.40 ? 192 LYS A CG  1 
ATOM   1131 N  N   . ALA A 1 150 ? -21.815 -1.786  -23.751 1.00 18.05 ? 193 ALA A N   1 
ATOM   1132 C  CA  . ALA A 1 150 ? -21.528 -0.544  -24.457 1.00 20.91 ? 193 ALA A CA  1 
ATOM   1133 C  C   . ALA A 1 150 ? -21.342 -0.765  -25.946 1.00 19.49 ? 193 ALA A C   1 
ATOM   1134 O  O   . ALA A 1 150 ? -21.782 0.070   -26.741 1.00 18.87 ? 193 ALA A O   1 
ATOM   1135 C  CB  . ALA A 1 150 ? -20.261 0.116   -23.898 1.00 21.49 ? 193 ALA A CB  1 
ATOM   1136 N  N   . PHE A 1 151 ? -20.684 -1.877  -26.338 1.00 19.71 ? 194 PHE A N   1 
ATOM   1137 C  CA  . PHE A 1 151 ? -20.178 -2.057  -27.708 1.00 19.45 ? 194 PHE A CA  1 
ATOM   1138 C  C   . PHE A 1 151 ? -20.539 -3.378  -28.381 1.00 18.26 ? 194 PHE A C   1 
ATOM   1139 O  O   . PHE A 1 151 ? -20.057 -3.634  -29.488 1.00 23.01 ? 194 PHE A O   1 
ATOM   1140 C  CB  . PHE A 1 151 ? -18.642 -1.904  -27.712 1.00 18.08 ? 194 PHE A CB  1 
ATOM   1141 C  CG  . PHE A 1 151 ? -18.179 -0.575  -27.187 1.00 17.57 ? 194 PHE A CG  1 
ATOM   1142 C  CD1 . PHE A 1 151 ? -18.551 0.590   -27.837 1.00 22.50 ? 194 PHE A CD1 1 
ATOM   1143 C  CD2 . PHE A 1 151 ? -17.379 -0.490  -26.057 1.00 21.51 ? 194 PHE A CD2 1 
ATOM   1144 C  CE1 . PHE A 1 151 ? -18.151 1.818   -27.364 1.00 21.96 ? 194 PHE A CE1 1 
ATOM   1145 C  CE2 . PHE A 1 151 ? -16.982 0.740   -25.577 1.00 17.42 ? 194 PHE A CE2 1 
ATOM   1146 C  CZ  . PHE A 1 151 ? -17.366 1.891   -26.240 1.00 16.83 ? 194 PHE A CZ  1 
ATOM   1147 N  N   . GLY A 1 152 ? -21.334 -4.230  -27.754 1.00 22.73 ? 195 GLY A N   1 
ATOM   1148 C  CA  . GLY A 1 152 ? -21.719 -5.471  -28.422 1.00 24.41 ? 195 GLY A CA  1 
ATOM   1149 C  C   . GLY A 1 152 ? -20.508 -6.351  -28.644 1.00 24.59 ? 195 GLY A C   1 
ATOM   1150 O  O   . GLY A 1 152 ? -19.717 -6.583  -27.731 1.00 25.26 ? 195 GLY A O   1 
ATOM   1151 N  N   . GLU A 1 153 ? -20.369 -6.851  -29.873 1.00 21.40 ? 196 GLU A N   1 
ATOM   1152 C  CA  . GLU A 1 153 ? -19.258 -7.693  -30.287 1.00 25.18 ? 196 GLU A CA  1 
ATOM   1153 C  C   . GLU A 1 153 ? -18.221 -6.911  -31.068 1.00 25.11 ? 196 GLU A C   1 
ATOM   1154 O  O   . GLU A 1 153 ? -17.397 -7.509  -31.760 1.00 21.28 ? 196 GLU A O   1 
ATOM   1155 C  CB  . GLU A 1 153 ? -19.772 -8.875  -31.122 1.00 27.52 ? 196 GLU A CB  1 
ATOM   1156 C  CG  . GLU A 1 153 ? -20.681 -9.816  -30.361 1.00 33.10 ? 196 GLU A CG  1 
ATOM   1157 C  CD  . GLU A 1 153 ? -21.245 -10.938 -31.248 1.00 39.07 ? 196 GLU A CD  1 
ATOM   1158 O  OE1 . GLU A 1 153 ? -21.138 -10.843 -32.494 1.00 43.38 ? 196 GLU A OE1 1 
ATOM   1159 O  OE2 . GLU A 1 153 ? -21.796 -11.911 -30.693 1.00 50.80 ? 196 GLU A OE2 1 
ATOM   1160 N  N   . LYS A 1 154 ? -18.259 -5.583  -30.984 1.00 18.82 ? 197 LYS A N   1 
ATOM   1161 C  CA  . LYS A 1 154 ? -17.300 -4.763  -31.692 1.00 21.29 ? 197 LYS A CA  1 
ATOM   1162 C  C   . LYS A 1 154 ? -15.877 -5.070  -31.233 1.00 18.31 ? 197 LYS A C   1 
ATOM   1163 O  O   . LYS A 1 154 ? -15.620 -5.326  -30.055 1.00 22.57 ? 197 LYS A O   1 
ATOM   1164 C  CB  . LYS A 1 154 ? -17.615 -3.283  -31.491 1.00 18.50 ? 197 LYS A CB  1 
ATOM   1165 C  CG  . LYS A 1 154 ? -18.865 -2.843  -32.233 1.00 24.99 ? 197 LYS A CG  1 
ATOM   1166 C  CD  . LYS A 1 154 ? -19.198 -1.383  -31.956 1.00 29.63 ? 197 LYS A CD  1 
ATOM   1167 C  CE  . LYS A 1 154 ? -20.538 -1.023  -32.566 1.00 34.26 ? 197 LYS A CE  1 
ATOM   1168 N  NZ  . LYS A 1 154 ? -20.871 0.391   -32.375 1.00 30.40 ? 197 LYS A NZ  1 
ATOM   1169 N  N   . THR A 1 155 ? -14.955 -5.049  -32.186 1.00 17.50 ? 198 THR A N   1 
ATOM   1170 C  CA  . THR A 1 155 ? -13.539 -5.237  -31.890 1.00 16.68 ? 198 THR A CA  1 
ATOM   1171 C  C   . THR A 1 155 ? -12.767 -3.938  -31.644 1.00 19.40 ? 198 THR A C   1 
ATOM   1172 O  O   . THR A 1 155 ? -11.743 -3.962  -30.959 1.00 14.88 ? 198 THR A O   1 
ATOM   1173 C  CB  . THR A 1 155 ? -12.903 -6.008  -33.053 1.00 18.61 ? 198 THR A CB  1 
ATOM   1174 O  OG1 . THR A 1 155 ? -13.488 -7.317  -33.086 1.00 20.17 ? 198 THR A OG1 1 
ATOM   1175 C  CG2 . THR A 1 155 ? -11.427 -6.150  -32.879 1.00 19.59 ? 198 THR A CG2 1 
ATOM   1176 N  N   . ILE A 1 156 ? -13.173 -2.816  -32.226 1.00 17.14 ? 199 ILE A N   1 
ATOM   1177 C  CA  . ILE A 1 156 ? -12.376 -1.596  -32.132 1.00 17.93 ? 199 ILE A CA  1 
ATOM   1178 C  C   . ILE A 1 156 ? -13.312 -0.391  -32.102 1.00 23.01 ? 199 ILE A C   1 
ATOM   1179 O  O   . ILE A 1 156 ? -14.325 -0.360  -32.805 1.00 18.71 ? 199 ILE A O   1 
ATOM   1180 C  CB  . ILE A 1 156 ? -11.360 -1.530  -33.296 1.00 23.40 ? 199 ILE A CB  1 
ATOM   1181 C  CG1 . ILE A 1 156 ? -10.410 -0.364  -33.104 1.00 21.64 ? 199 ILE A CG1 1 
ATOM   1182 C  CG2 . ILE A 1 156 ? -12.046 -1.450  -34.659 1.00 19.66 ? 199 ILE A CG2 1 
ATOM   1183 C  CD1 . ILE A 1 156 ? -9.058  -0.576  -33.738 1.00 22.10 ? 199 ILE A CD1 1 
ATOM   1184 N  N   . VAL A 1 157 ? -12.996 0.584   -31.252 1.00 19.31 ? 200 VAL A N   1 
ATOM   1185 C  CA  . VAL A 1 157 ? -13.799 1.812   -31.196 1.00 15.29 ? 200 VAL A CA  1 
ATOM   1186 C  C   . VAL A 1 157 ? -12.880 3.006   -31.095 1.00 19.74 ? 200 VAL A C   1 
ATOM   1187 O  O   . VAL A 1 157 ? -11.760 2.922   -30.572 1.00 16.45 ? 200 VAL A O   1 
ATOM   1188 C  CB  . VAL A 1 157 ? -14.800 1.814   -30.018 1.00 23.51 ? 200 VAL A CB  1 
ATOM   1189 C  CG1 . VAL A 1 157 ? -15.632 0.522   -30.021 1.00 29.02 ? 200 VAL A CG1 1 
ATOM   1190 C  CG2 . VAL A 1 157 ? -14.121 1.997   -28.713 1.00 25.76 ? 200 VAL A CG2 1 
ATOM   1191 N  N   . PRO A 1 158 ? -13.305 4.147   -31.655 1.00 19.99 ? 201 PRO A N   1 
ATOM   1192 C  CA  . PRO A 1 158 ? -12.484 5.345   -31.517 1.00 21.00 ? 201 PRO A CA  1 
ATOM   1193 C  C   . PRO A 1 158 ? -12.371 5.741   -30.049 1.00 16.65 ? 201 PRO A C   1 
ATOM   1194 O  O   . PRO A 1 158 ? -13.282 5.505   -29.246 1.00 14.19 ? 201 PRO A O   1 
ATOM   1195 C  CB  . PRO A 1 158 ? -13.234 6.409   -32.336 1.00 23.48 ? 201 PRO A CB  1 
ATOM   1196 C  CG  . PRO A 1 158 ? -14.279 5.704   -33.112 1.00 22.04 ? 201 PRO A CG  1 
ATOM   1197 C  CD  . PRO A 1 158 ? -14.571 4.412   -32.379 1.00 19.88 ? 201 PRO A CD  1 
ATOM   1198 N  N   . TRP A 1 159 ? -11.243 6.380   -29.708 1.00 16.22 ? 202 TRP A N   1 
ATOM   1199 C  CA  . TRP A 1 159 ? -10.999 6.757   -28.323 1.00 16.54 ? 202 TRP A CA  1 
ATOM   1200 C  C   . TRP A 1 159 ? -12.162 7.565   -27.752 1.00 14.61 ? 202 TRP A C   1 
ATOM   1201 O  O   . TRP A 1 159 ? -12.560 7.363   -26.600 1.00 16.13 ? 202 TRP A O   1 
ATOM   1202 C  CB  . TRP A 1 159 ? -9.683  7.562   -28.180 1.00 18.75 ? 202 TRP A CB  1 
ATOM   1203 C  CG  . TRP A 1 159 ? -9.610  8.359   -26.878 1.00 16.65 ? 202 TRP A CG  1 
ATOM   1204 C  CD1 . TRP A 1 159 ? -9.732  9.699   -26.748 1.00 20.11 ? 202 TRP A CD1 1 
ATOM   1205 C  CD2 . TRP A 1 159 ? -9.476  7.841   -25.536 1.00 14.86 ? 202 TRP A CD2 1 
ATOM   1206 N  NE1 . TRP A 1 159 ? -9.666  10.058  -25.427 1.00 22.21 ? 202 TRP A NE1 1 
ATOM   1207 C  CE2 . TRP A 1 159 ? -9.512  8.933   -24.664 1.00 17.65 ? 202 TRP A CE2 1 
ATOM   1208 C  CE3 . TRP A 1 159 ? -9.317  6.559   -24.996 1.00 18.27 ? 202 TRP A CE3 1 
ATOM   1209 C  CZ2 . TRP A 1 159 ? -9.400  8.789   -23.281 1.00 20.32 ? 202 TRP A CZ2 1 
ATOM   1210 C  CZ3 . TRP A 1 159 ? -9.205  6.422   -23.648 1.00 19.60 ? 202 TRP A CZ3 1 
ATOM   1211 C  CH2 . TRP A 1 159 ? -9.242  7.525   -22.796 1.00 16.79 ? 202 TRP A CH2 1 
ATOM   1212 N  N   . LYS A 1 160 ? -12.698 8.520   -28.521 1.00 19.29 ? 203 LYS A N   1 
ATOM   1213 C  CA  . LYS A 1 160 ? -13.705 9.409   -27.944 1.00 16.09 ? 203 LYS A CA  1 
ATOM   1214 C  C   . LYS A 1 160 ? -14.962 8.636   -27.569 1.00 20.44 ? 203 LYS A C   1 
ATOM   1215 O  O   . LYS A 1 160 ? -15.560 8.896   -26.523 1.00 17.63 ? 203 LYS A O   1 
ATOM   1216 C  CB  . LYS A 1 160 ? -14.042 10.543  -28.911 1.00 22.15 ? 203 LYS A CB  1 
ATOM   1217 C  CG  . LYS A 1 160 ? -12.881 11.497  -29.134 1.00 28.16 ? 203 LYS A CG  1 
ATOM   1218 N  N   . SER A 1 161 ? -15.355 7.654   -28.388 1.00 14.25 ? 204 SER A N   1 
ATOM   1219 C  CA  . SER A 1 161 ? -16.500 6.820   -28.026 1.00 18.61 ? 204 SER A CA  1 
ATOM   1220 C  C   . SER A 1 161 ? -16.189 5.970   -26.813 1.00 22.83 ? 204 SER A C   1 
ATOM   1221 O  O   . SER A 1 161 ? -17.053 5.776   -25.951 1.00 15.80 ? 204 SER A O   1 
ATOM   1222 C  CB  . SER A 1 161 ? -16.918 5.913   -29.185 1.00 21.81 ? 204 SER A CB  1 
ATOM   1223 O  OG  . SER A 1 161 ? -17.124 6.653   -30.364 1.00 26.27 ? 204 SER A OG  1 
ATOM   1224 N  N   . PHE A 1 162 ? -14.964 5.436   -26.732 1.00 16.26 ? 205 PHE A N   1 
ATOM   1225 C  CA  . PHE A 1 162 ? -14.613 4.625   -25.568 1.00 15.33 ? 205 PHE A CA  1 
ATOM   1226 C  C   . PHE A 1 162 ? -14.652 5.458   -24.293 1.00 13.76 ? 205 PHE A C   1 
ATOM   1227 O  O   . PHE A 1 162 ? -15.197 5.012   -23.269 1.00 16.64 ? 205 PHE A O   1 
ATOM   1228 C  CB  . PHE A 1 162 ? -13.229 3.983   -25.732 1.00 16.06 ? 205 PHE A CB  1 
ATOM   1229 C  CG  . PHE A 1 162 ? -12.821 3.202   -24.533 1.00 12.66 ? 205 PHE A CG  1 
ATOM   1230 C  CD1 . PHE A 1 162 ? -13.307 1.918   -24.344 1.00 13.65 ? 205 PHE A CD1 1 
ATOM   1231 C  CD2 . PHE A 1 162 ? -12.008 3.760   -23.559 1.00 19.47 ? 205 PHE A CD2 1 
ATOM   1232 C  CE1 . PHE A 1 162 ? -12.972 1.181   -23.201 1.00 16.45 ? 205 PHE A CE1 1 
ATOM   1233 C  CE2 . PHE A 1 162 ? -11.662 3.030   -22.407 1.00 20.33 ? 205 PHE A CE2 1 
ATOM   1234 C  CZ  . PHE A 1 162 ? -12.147 1.748   -22.232 1.00 15.47 ? 205 PHE A CZ  1 
ATOM   1235 N  N   . ARG A 1 163 ? -14.084 6.665   -24.345 1.00 14.82 ? 206 ARG A N   1 
ATOM   1236 C  CA  . ARG A 1 163 ? -14.055 7.553   -23.191 1.00 16.15 ? 206 ARG A CA  1 
ATOM   1237 C  C   . ARG A 1 163 ? -15.469 7.857   -22.702 1.00 16.30 ? 206 ARG A C   1 
ATOM   1238 O  O   . ARG A 1 163 ? -15.757 7.792   -21.497 1.00 18.20 ? 206 ARG A O   1 
ATOM   1239 C  CB  . ARG A 1 163 ? -13.330 8.852   -23.565 1.00 15.25 ? 206 ARG A CB  1 
ATOM   1240 C  CG  . ARG A 1 163 ? -13.388 9.927   -22.474 1.00 16.15 ? 206 ARG A CG  1 
ATOM   1241 C  CD  . ARG A 1 163 ? -12.560 11.153  -22.817 1.00 17.45 ? 206 ARG A CD  1 
ATOM   1242 N  NE  . ARG A 1 163 ? -12.752 12.186  -21.813 1.00 20.03 ? 206 ARG A NE  1 
ATOM   1243 C  CZ  . ARG A 1 163 ? -12.380 13.454  -21.958 1.00 23.47 ? 206 ARG A CZ  1 
ATOM   1244 N  NH1 . ARG A 1 163 ? -11.753 13.847  -23.054 1.00 27.23 ? 206 ARG A NH1 1 
ATOM   1245 N  NH2 . ARG A 1 163 ? -12.633 14.324  -20.987 1.00 30.98 ? 206 ARG A NH2 1 
ATOM   1246 N  N   . GLN A 1 164 ? -16.354 8.212   -23.628 1.00 18.29 ? 207 GLN A N   1 
ATOM   1247 C  CA  . GLN A 1 164 ? -17.734 8.542   -23.268 1.00 18.05 ? 207 GLN A CA  1 
ATOM   1248 C  C   . GLN A 1 164 ? -18.423 7.373   -22.554 1.00 20.27 ? 207 GLN A C   1 
ATOM   1249 O  O   . GLN A 1 164 ? -19.045 7.551   -21.500 1.00 20.62 ? 207 GLN A O   1 
ATOM   1250 C  CB  . GLN A 1 164 ? -18.480 8.971   -24.526 1.00 20.51 ? 207 GLN A CB  1 
ATOM   1251 C  CG  . GLN A 1 164 ? -19.971 9.220   -24.331 1.00 33.52 ? 207 GLN A CG  1 
ATOM   1252 C  CD  . GLN A 1 164 ? -20.527 10.151  -25.395 1.00 37.85 ? 207 GLN A CD  1 
ATOM   1253 O  OE1 . GLN A 1 164 ? -20.179 11.334  -25.455 1.00 38.74 ? 207 GLN A OE1 1 
ATOM   1254 N  NE2 . GLN A 1 164 ? -21.382 9.613   -26.249 1.00 49.37 ? 207 GLN A NE2 1 
ATOM   1255 N  N   . ALA A 1 165 ? -18.287 6.164   -23.099 1.00 18.11 ? 208 ALA A N   1 
ATOM   1256 C  CA  . ALA A 1 165 ? -18.863 4.968   -22.483 1.00 16.28 ? 208 ALA A CA  1 
ATOM   1257 C  C   . ALA A 1 165 ? -18.249 4.673   -21.117 1.00 19.50 ? 208 ALA A C   1 
ATOM   1258 O  O   . ALA A 1 165 ? -18.955 4.307   -20.177 1.00 17.78 ? 208 ALA A O   1 
ATOM   1259 C  CB  . ALA A 1 165 ? -18.658 3.766   -23.408 1.00 20.19 ? 208 ALA A CB  1 
ATOM   1260 N  N   . LEU A 1 166 ? -16.930 4.764   -20.991 1.00 15.50 ? 209 LEU A N   1 
ATOM   1261 C  CA  . LEU A 1 166 ? -16.322 4.416   -19.714 1.00 17.07 ? 209 LEU A CA  1 
ATOM   1262 C  C   . LEU A 1 166 ? -16.686 5.435   -18.644 1.00 14.81 ? 209 LEU A C   1 
ATOM   1263 O  O   . LEU A 1 166 ? -16.878 5.083   -17.480 1.00 15.57 ? 209 LEU A O   1 
ATOM   1264 C  CB  . LEU A 1 166 ? -14.795 4.327   -19.865 1.00 17.27 ? 209 LEU A CB  1 
ATOM   1265 C  CG  . LEU A 1 166 ? -14.040 3.907   -18.601 1.00 17.86 ? 209 LEU A CG  1 
ATOM   1266 C  CD1 . LEU A 1 166 ? -14.581 2.592   -18.036 1.00 18.64 ? 209 LEU A CD1 1 
ATOM   1267 C  CD2 . LEU A 1 166 ? -12.501 3.812   -18.835 1.00 18.19 ? 209 LEU A CD2 1 
ATOM   1268 N  N   . HIS A 1 167 ? -16.751 6.706   -19.033 1.00 13.20 ? 210 HIS A N   1 
ATOM   1269 C  CA  . HIS A 1 167 ? -17.095 7.779   -18.119 1.00 14.87 ? 210 HIS A CA  1 
ATOM   1270 C  C   . HIS A 1 167 ? -18.440 7.526   -17.426 1.00 18.82 ? 210 HIS A C   1 
ATOM   1271 O  O   . HIS A 1 167 ? -18.615 7.911   -16.266 1.00 14.86 ? 210 HIS A O   1 
ATOM   1272 C  CB  . HIS A 1 167 ? -17.087 9.079   -18.921 1.00 18.01 ? 210 HIS A CB  1 
ATOM   1273 C  CG  . HIS A 1 167 ? -17.468 10.297  -18.155 1.00 14.94 ? 210 HIS A CG  1 
ATOM   1274 N  ND1 . HIS A 1 167 ? -16.668 10.861  -17.187 1.00 26.30 ? 210 HIS A ND1 1 
ATOM   1275 C  CD2 . HIS A 1 167 ? -18.550 11.105  -18.268 1.00 12.31 ? 210 HIS A CD2 1 
ATOM   1276 C  CE1 . HIS A 1 167 ? -17.259 11.940  -16.702 1.00 26.25 ? 210 HIS A CE1 1 
ATOM   1277 N  NE2 . HIS A 1 167 ? -18.399 12.114  -17.344 1.00 18.72 ? 210 HIS A NE2 1 
ATOM   1278 N  N   . GLU A 1 168 ? -19.368 6.830   -18.104 1.00 17.47 ? 211 GLU A N   1 
ATOM   1279 C  CA  . GLU A 1 168 ? -20.685 6.518   -17.530 1.00 21.73 ? 211 GLU A CA  1 
ATOM   1280 C  C   . GLU A 1 168 ? -20.596 5.613   -16.313 1.00 21.65 ? 211 GLU A C   1 
ATOM   1281 O  O   . GLU A 1 168 ? -21.489 5.648   -15.464 1.00 21.39 ? 211 GLU A O   1 
ATOM   1282 C  CB  . GLU A 1 168 ? -21.588 5.841   -18.566 1.00 18.16 ? 211 GLU A CB  1 
ATOM   1283 C  CG  . GLU A 1 168 ? -22.155 6.745   -19.603 1.00 22.31 ? 211 GLU A CG  1 
ATOM   1284 C  CD  . GLU A 1 168 ? -23.130 7.746   -19.035 1.00 24.34 ? 211 GLU A CD  1 
ATOM   1285 O  OE1 . GLU A 1 168 ? -23.712 7.458   -17.959 1.00 21.84 ? 211 GLU A OE1 1 
ATOM   1286 O  OE2 . GLU A 1 168 ? -23.309 8.817   -19.665 1.00 19.44 ? 211 GLU A OE2 1 
ATOM   1287 N  N   . VAL A 1 169 ? -19.569 4.766   -16.237 1.00 19.10 ? 212 VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 169 ? -19.389 3.837   -15.128 1.00 15.74 ? 212 VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 169 ? -18.306 4.316   -14.169 1.00 20.56 ? 212 VAL A C   1 
ATOM   1290 O  O   . VAL A 1 169 ? -18.478 4.237   -12.953 1.00 23.24 ? 212 VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 169 ? -19.066 2.426   -15.674 1.00 23.76 ? 212 VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 169 ? -18.740 1.451   -14.530 1.00 29.95 ? 212 VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 169 ? -20.246 1.878   -16.492 1.00 29.79 ? 212 VAL A CG2 1 
ATOM   1294 N  N   . HIS A 1 170 ? -17.203 4.833   -14.712 1.00 17.18 ? 213 HIS A N   1 
ATOM   1295 C  CA  . HIS A 1 170 ? -16.034 5.287   -13.960 1.00 19.16 ? 213 HIS A CA  1 
ATOM   1296 C  C   . HIS A 1 170 ? -15.713 6.699   -14.442 1.00 16.54 ? 213 HIS A C   1 
ATOM   1297 O  O   . HIS A 1 170 ? -15.079 6.866   -15.497 1.00 17.41 ? 213 HIS A O   1 
ATOM   1298 C  CB  . HIS A 1 170 ? -14.839 4.354   -14.186 1.00 16.76 ? 213 HIS A CB  1 
ATOM   1299 C  CG  . HIS A 1 170 ? -15.018 2.990   -13.611 1.00 20.29 ? 213 HIS A CG  1 
ATOM   1300 N  ND1 . HIS A 1 170 ? -15.085 2.761   -12.254 1.00 24.05 ? 213 HIS A ND1 1 
ATOM   1301 C  CD2 . HIS A 1 170 ? -15.149 1.782   -14.206 1.00 18.03 ? 213 HIS A CD2 1 
ATOM   1302 C  CE1 . HIS A 1 170 ? -15.265 1.472   -12.041 1.00 24.95 ? 213 HIS A CE1 1 
ATOM   1303 N  NE2 . HIS A 1 170 ? -15.305 0.860   -13.209 1.00 21.04 ? 213 HIS A NE2 1 
ATOM   1304 N  N   . PRO A 1 171 ? -16.129 7.744   -13.725 1.00 20.23 ? 214 PRO A N   1 
ATOM   1305 C  CA  . PRO A 1 171 ? -15.956 9.102   -14.257 1.00 21.03 ? 214 PRO A CA  1 
ATOM   1306 C  C   . PRO A 1 171 ? -14.488 9.478   -14.435 1.00 20.10 ? 214 PRO A C   1 
ATOM   1307 O  O   . PRO A 1 171 ? -13.636 9.136   -13.619 1.00 25.35 ? 214 PRO A O   1 
ATOM   1308 C  CB  . PRO A 1 171 ? -16.631 9.999   -13.203 1.00 25.13 ? 214 PRO A CB  1 
ATOM   1309 C  CG  . PRO A 1 171 ? -17.430 9.101   -12.360 1.00 29.10 ? 214 PRO A CG  1 
ATOM   1310 C  CD  . PRO A 1 171 ? -16.770 7.758   -12.397 1.00 28.51 ? 214 PRO A CD  1 
ATOM   1311 N  N   . ILE A 1 172 ? -14.227 10.217  -15.507 1.00 18.11 ? 215 ILE A N   1 
ATOM   1312 C  CA  . ILE A 1 172 ? -12.899 10.578  -15.969 1.00 30.37 ? 215 ILE A CA  1 
ATOM   1313 C  C   . ILE A 1 172 ? -12.765 12.085  -15.858 1.00 37.19 ? 215 ILE A C   1 
ATOM   1314 O  O   . ILE A 1 172 ? -13.645 12.817  -16.332 1.00 34.65 ? 215 ILE A O   1 
ATOM   1315 C  CB  . ILE A 1 172 ? -12.704 10.122  -17.427 1.00 24.89 ? 215 ILE A CB  1 
ATOM   1316 C  CG1 . ILE A 1 172 ? -12.749 8.598   -17.511 1.00 21.64 ? 215 ILE A CG1 1 
ATOM   1317 C  CG2 . ILE A 1 172 ? -11.461 10.716  -18.037 1.00 27.19 ? 215 ILE A CG2 1 
ATOM   1318 C  CD1 . ILE A 1 172 ? -13.003 8.066   -18.898 1.00 20.02 ? 215 ILE A CD1 1 
ATOM   1319 N  N   . SER A 1 173 ? -11.666 12.546  -15.251 1.00 31.10 ? 216 SER A N   1 
ATOM   1320 C  CA  . SER A 1 173 ? -11.375 13.977  -15.201 1.00 31.05 ? 216 SER A CA  1 
ATOM   1321 C  C   . SER A 1 173 ? -10.917 14.496  -16.553 1.00 34.85 ? 216 SER A C   1 
ATOM   1322 O  O   . SER A 1 173 ? -9.976  13.963  -17.156 1.00 32.05 ? 216 SER A O   1 
ATOM   1323 C  CB  . SER A 1 173 ? -10.293 14.280  -14.156 1.00 42.95 ? 216 SER A CB  1 
ATOM   1324 O  OG  . SER A 1 173 ? -10.723 13.968  -12.840 1.00 58.92 ? 216 SER A OG  1 
ATOM   1325 N  N   . SER A 1 174 ? -11.537 15.577  -17.010 1.00 29.58 ? 217 SER A N   1 
ATOM   1326 C  CA  . SER A 1 174 ? -11.044 16.204  -18.210 1.00 30.09 ? 217 SER A CA  1 
ATOM   1327 C  C   . SER A 1 174 ? -9.646  16.765  -17.956 1.00 26.13 ? 217 SER A C   1 
ATOM   1328 O  O   . SER A 1 174 ? -9.246  17.003  -16.815 1.00 29.39 ? 217 SER A O   1 
ATOM   1329 C  CB  . SER A 1 174 ? -11.945 17.336  -18.661 1.00 28.63 ? 217 SER A CB  1 
ATOM   1330 O  OG  . SER A 1 174 ? -11.675 17.632  -20.008 1.00 43.87 ? 217 SER A OG  1 
ATOM   1331 N  N   . GLY A 1 175 ? -8.922  16.990  -19.038 1.00 22.77 ? 218 GLY A N   1 
ATOM   1332 C  CA  . GLY A 1 175 ? -7.574  17.532  -18.956 1.00 28.33 ? 218 GLY A CA  1 
ATOM   1333 C  C   . GLY A 1 175 ? -6.474  16.485  -19.007 1.00 29.34 ? 218 GLY A C   1 
ATOM   1334 O  O   . GLY A 1 175 ? -6.528  15.539  -19.794 1.00 20.30 ? 218 GLY A O   1 
ATOM   1335 N  N   . LEU A 1 176 ? -5.449  16.653  -18.176 1.00 20.28 ? 219 LEU A N   1 
ATOM   1336 C  CA  . LEU A 1 176 ? -4.307  15.756  -18.264 1.00 19.35 ? 219 LEU A CA  1 
ATOM   1337 C  C   . LEU A 1 176 ? -4.624  14.351  -17.762 1.00 17.02 ? 219 LEU A C   1 
ATOM   1338 O  O   . LEU A 1 176 ? -3.966  13.399  -18.187 1.00 15.53 ? 219 LEU A O   1 
ATOM   1339 C  CB  . LEU A 1 176 ? -3.102  16.317  -17.500 1.00 20.91 ? 219 LEU A CB  1 
ATOM   1340 C  CG  . LEU A 1 176 ? -2.358  17.492  -18.135 1.00 19.79 ? 219 LEU A CG  1 
ATOM   1341 C  CD1 . LEU A 1 176 ? -1.131  17.790  -17.301 1.00 20.22 ? 219 LEU A CD1 1 
ATOM   1342 C  CD2 . LEU A 1 176 ? -1.957  17.192  -19.557 1.00 20.42 ? 219 LEU A CD2 1 
ATOM   1343 N  N   . GLU A 1 177 ? -5.602  14.174  -16.874 1.00 17.07 ? 220 GLU A N   1 
ATOM   1344 C  CA  . GLU A 1 177 ? -5.914  12.819  -16.439 1.00 22.87 ? 220 GLU A CA  1 
ATOM   1345 C  C   . GLU A 1 177 ? -6.463  11.985  -17.594 1.00 19.77 ? 220 GLU A C   1 
ATOM   1346 O  O   . GLU A 1 177 ? -6.079  10.814  -17.781 1.00 17.29 ? 220 GLU A O   1 
ATOM   1347 C  CB  . GLU A 1 177 ? -6.914  12.856  -15.276 1.00 27.98 ? 220 GLU A CB  1 
ATOM   1348 C  CG  . GLU A 1 177 ? -7.245  11.469  -14.760 1.00 32.00 ? 220 GLU A CG  1 
ATOM   1349 C  CD  . GLU A 1 177 ? -8.265  11.501  -13.643 1.00 43.86 ? 220 GLU A CD  1 
ATOM   1350 O  OE1 . GLU A 1 177 ? -7.843  11.712  -12.489 1.00 44.57 ? 220 GLU A OE1 1 
ATOM   1351 O  OE2 . GLU A 1 177 ? -9.471  11.319  -13.932 1.00 45.39 ? 220 GLU A OE2 1 
ATOM   1352 N  N   . ALA A 1 178 ? -7.403  12.558  -18.348 1.00 17.86 ? 221 ALA A N   1 
ATOM   1353 C  CA  . ALA A 1 178 ? -7.930  11.907  -19.543 1.00 21.36 ? 221 ALA A CA  1 
ATOM   1354 C  C   . ALA A 1 178 ? -6.833  11.600  -20.554 1.00 20.51 ? 221 ALA A C   1 
ATOM   1355 O  O   . ALA A 1 178 ? -6.856  10.541  -21.190 1.00 17.46 ? 221 ALA A O   1 
ATOM   1356 C  CB  . ALA A 1 178 ? -8.985  12.784  -20.200 1.00 31.32 ? 221 ALA A CB  1 
ATOM   1357 N  N   . MET A 1 179 ? -5.881  12.523  -20.741 1.00 18.92 ? 222 MET A N   1 
ATOM   1358 C  CA  . MET A 1 179 ? -4.762  12.250  -21.637 1.00 21.89 ? 222 MET A CA  1 
ATOM   1359 C  C   . MET A 1 179 ? -3.902  11.107  -21.122 1.00 16.45 ? 222 MET A C   1 
ATOM   1360 O  O   . MET A 1 179 ? -3.457  10.262  -21.907 1.00 17.23 ? 222 MET A O   1 
ATOM   1361 C  CB  . MET A 1 179 ? -3.892  13.499  -21.829 1.00 17.95 ? 222 MET A CB  1 
ATOM   1362 C  CG  . MET A 1 179 ? -4.524  14.604  -22.707 1.00 28.57 ? 222 MET A CG  1 
ATOM   1363 S  SD  . MET A 1 179 ? -3.514  16.143  -22.774 1.00 32.95 ? 222 MET A SD  1 
ATOM   1364 C  CE  . MET A 1 179 ? -4.839  17.361  -22.748 1.00 42.32 ? 222 MET A CE  1 
ATOM   1365 N  N   . ALA A 1 180 ? -3.639  11.076  -19.818 1.00 12.67 ? 223 ALA A N   1 
ATOM   1366 C  CA  . ALA A 1 180 ? -2.816  10.014  -19.246 1.00 17.15 ? 223 ALA A CA  1 
ATOM   1367 C  C   . ALA A 1 180 ? -3.533  8.678   -19.338 1.00 18.93 ? 223 ALA A C   1 
ATOM   1368 O  O   . ALA A 1 180 ? -2.908  7.634   -19.592 1.00 12.15 ? 223 ALA A O   1 
ATOM   1369 C  CB  . ALA A 1 180 ? -2.462  10.341  -17.800 1.00 15.88 ? 223 ALA A CB  1 
ATOM   1370 N  N   . LEU A 1 181 ? -4.853  8.687   -19.162 1.00 12.79 ? 224 LEU A N   1 
ATOM   1371 C  CA  . LEU A 1 181 ? -5.618  7.449   -19.283 1.00 12.73 ? 224 LEU A CA  1 
ATOM   1372 C  C   . LEU A 1 181 ? -5.512  6.884   -20.691 1.00 11.22 ? 224 LEU A C   1 
ATOM   1373 O  O   . LEU A 1 181 ? -5.251  5.691   -20.882 1.00 15.97 ? 224 LEU A O   1 
ATOM   1374 C  CB  . LEU A 1 181 ? -7.079  7.698   -18.901 1.00 12.73 ? 224 LEU A CB  1 
ATOM   1375 C  CG  . LEU A 1 181 ? -7.945  6.469   -19.001 1.00 13.84 ? 224 LEU A CG  1 
ATOM   1376 C  CD1 . LEU A 1 181 ? -7.418  5.277   -18.170 1.00 14.09 ? 224 LEU A CD1 1 
ATOM   1377 C  CD2 . LEU A 1 181 ? -9.318  6.854   -18.524 1.00 14.82 ? 224 LEU A CD2 1 
ATOM   1378 N  N   . LYS A 1 182 ? -5.675  7.739   -21.684 1.00 11.16 ? 225 LYS A N   1 
ATOM   1379 C  CA  . LYS A 1 182 ? -5.536  7.317   -23.072 1.00 15.57 ? 225 LYS A CA  1 
ATOM   1380 C  C   . LYS A 1 182 ? -4.151  6.745   -23.340 1.00 16.22 ? 225 LYS A C   1 
ATOM   1381 O  O   . LYS A 1 182 ? -4.016  5.730   -24.032 1.00 16.19 ? 225 LYS A O   1 
ATOM   1382 C  CB  . LYS A 1 182 ? -5.778  8.488   -24.010 1.00 14.73 ? 225 LYS A CB  1 
ATOM   1383 C  CG  . LYS A 1 182 ? -5.652  8.108   -25.492 1.00 17.82 ? 225 LYS A CG  1 
ATOM   1384 C  CD  . LYS A 1 182 ? -5.961  9.288   -26.444 1.00 24.23 ? 225 LYS A CD  1 
ATOM   1385 C  CE  . LYS A 1 182 ? -5.373  9.065   -27.827 1.00 38.46 ? 225 LYS A CE  1 
ATOM   1386 N  NZ  . LYS A 1 182 ? -6.360  9.372   -28.876 1.00 45.59 ? 225 LYS A NZ  1 
ATOM   1387 N  N   . SER A 1 183 ? -3.102  7.432   -22.868 1.00 15.14 ? 226 SER A N   1 
ATOM   1388 C  CA  A SER A 1 183 ? -1.757  6.938   -23.130 0.50 16.87 ? 226 SER A CA  1 
ATOM   1389 C  CA  B SER A 1 183 ? -1.748  6.948   -23.105 0.50 16.87 ? 226 SER A CA  1 
ATOM   1390 C  C   . SER A 1 183 ? -1.539  5.571   -22.494 1.00 17.50 ? 226 SER A C   1 
ATOM   1391 O  O   . SER A 1 183 ? -0.782  4.761   -23.029 1.00 17.01 ? 226 SER A O   1 
ATOM   1392 C  CB  A SER A 1 183 ? -0.703  7.928   -22.628 0.50 19.73 ? 226 SER A CB  1 
ATOM   1393 C  CB  B SER A 1 183 ? -0.725  7.932   -22.537 0.50 19.71 ? 226 SER A CB  1 
ATOM   1394 O  OG  A SER A 1 183 ? -0.775  8.067   -21.230 0.50 27.35 ? 226 SER A OG  1 
ATOM   1395 O  OG  B SER A 1 183 ? -0.838  9.179   -23.188 0.50 20.27 ? 226 SER A OG  1 
ATOM   1396 N  N   . THR A 1 184 ? -2.191  5.298   -21.370 1.00 14.31 ? 227 THR A N   1 
ATOM   1397 C  CA  . THR A 1 184 ? -2.030  4.009   -20.706 1.00 16.76 ? 227 THR A CA  1 
ATOM   1398 C  C   . THR A 1 184 ? -2.717  2.892   -21.474 1.00 15.77 ? 227 THR A C   1 
ATOM   1399 O  O   . THR A 1 184 ? -2.142  1.810   -21.641 1.00 15.33 ? 227 THR A O   1 
ATOM   1400 C  CB  . THR A 1 184 ? -2.583  4.078   -19.271 1.00 17.34 ? 227 THR A CB  1 
ATOM   1401 O  OG1 . THR A 1 184 ? -2.058  5.223   -18.594 1.00 16.48 ? 227 THR A OG1 1 
ATOM   1402 C  CG2 . THR A 1 184 ? -2.198  2.833   -18.517 1.00 21.02 ? 227 THR A CG2 1 
ATOM   1403 N  N   . ILE A 1 185 ? -3.964  3.116   -21.926 1.00 13.59 ? 228 ILE A N   1 
ATOM   1404 C  CA  . ILE A 1 185 ? -4.743  2.038   -22.542 1.00 13.43 ? 228 ILE A CA  1 
ATOM   1405 C  C   . ILE A 1 185 ? -4.428  1.872   -24.036 1.00 17.84 ? 228 ILE A C   1 
ATOM   1406 O  O   . ILE A 1 185 ? -4.452  0.747   -24.555 1.00 16.79 ? 228 ILE A O   1 
ATOM   1407 C  CB  . ILE A 1 185 ? -6.260  2.245   -22.277 1.00 16.94 ? 228 ILE A CB  1 
ATOM   1408 C  CG1 . ILE A 1 185 ? -7.047  1.026   -22.755 1.00 16.93 ? 228 ILE A CG1 1 
ATOM   1409 C  CG2 . ILE A 1 185 ? -6.799  3.463   -22.960 1.00 24.65 ? 228 ILE A CG2 1 
ATOM   1410 C  CD1 . ILE A 1 185 ? -8.454  0.868   -22.123 1.00 19.15 ? 228 ILE A CD1 1 
ATOM   1411 N  N   . ASP A 1 186 ? -4.073  2.947   -24.739 1.00 17.51 ? 229 ASP A N   1 
ATOM   1412 C  CA  . ASP A 1 186 ? -3.809  2.904   -26.178 1.00 17.17 ? 229 ASP A CA  1 
ATOM   1413 C  C   . ASP A 1 186 ? -2.386  2.386   -26.425 1.00 16.63 ? 229 ASP A C   1 
ATOM   1414 O  O   . ASP A 1 186 ? -1.473  3.097   -26.851 1.00 18.78 ? 229 ASP A O   1 
ATOM   1415 C  CB  . ASP A 1 186 ? -4.035  4.298   -26.758 1.00 21.66 ? 229 ASP A CB  1 
ATOM   1416 C  CG  . ASP A 1 186 ? -3.923  4.358   -28.265 1.00 22.20 ? 229 ASP A CG  1 
ATOM   1417 O  OD1 . ASP A 1 186 ? -3.827  3.309   -28.930 1.00 18.44 ? 229 ASP A OD1 1 
ATOM   1418 O  OD2 . ASP A 1 186 ? -3.965  5.496   -28.783 1.00 19.57 ? 229 ASP A OD2 1 
ATOM   1419 N  N   . LEU A 1 187 ? -2.193  1.094   -26.136 1.00 13.70 ? 230 LEU A N   1 
ATOM   1420 C  CA  . LEU A 1 187 ? -0.872  0.482   -26.290 1.00 14.68 ? 230 LEU A CA  1 
ATOM   1421 C  C   . LEU A 1 187 ? -0.329  0.573   -27.716 1.00 16.11 ? 230 LEU A C   1 
ATOM   1422 O  O   . LEU A 1 187 ? 0.898   0.617   -27.905 1.00 19.22 ? 230 LEU A O   1 
ATOM   1423 C  CB  . LEU A 1 187 ? -0.918  -0.984  -25.902 1.00 16.20 ? 230 LEU A CB  1 
ATOM   1424 C  CG  . LEU A 1 187 ? -1.302  -1.279  -24.446 1.00 20.88 ? 230 LEU A CG  1 
ATOM   1425 C  CD1 . LEU A 1 187 ? -1.330  -2.798  -24.248 1.00 25.53 ? 230 LEU A CD1 1 
ATOM   1426 C  CD2 . LEU A 1 187 ? -0.347  -0.644  -23.484 1.00 28.62 ? 230 LEU A CD2 1 
ATOM   1427 N  N   . THR A 1 188 ? -1.192  0.486   -28.724 1.00 17.88 ? 231 THR A N   1 
ATOM   1428 C  CA  . THR A 1 188 ? -0.716  0.505   -30.109 1.00 15.48 ? 231 THR A CA  1 
ATOM   1429 C  C   . THR A 1 188 ? -0.635  1.917   -30.668 1.00 18.92 ? 231 THR A C   1 
ATOM   1430 O  O   . THR A 1 188 ? -0.302  2.083   -31.846 1.00 15.32 ? 231 THR A O   1 
ATOM   1431 C  CB  . THR A 1 188 ? -1.610  -0.370  -30.991 1.00 14.45 ? 231 THR A CB  1 
ATOM   1432 O  OG1 . THR A 1 188 ? -2.948  0.146   -31.003 1.00 18.48 ? 231 THR A OG1 1 
ATOM   1433 C  CG2 . THR A 1 188 ? -1.640  -1.808  -30.471 1.00 19.03 ? 231 THR A CG2 1 
ATOM   1434 N  N   . CYS A 1 189 ? -0.910  2.926   -29.837 1.00 16.90 ? 232 CYS A N   1 
ATOM   1435 C  CA  . CYS A 1 189 ? -0.720  4.356   -30.163 1.00 19.34 ? 232 CYS A CA  1 
ATOM   1436 C  C   . CYS A 1 189 ? -1.391  4.734   -31.476 1.00 18.73 ? 232 CYS A C   1 
ATOM   1437 O  O   . CYS A 1 189 ? -0.770  5.327   -32.365 1.00 17.55 ? 232 CYS A O   1 
ATOM   1438 C  CB  . CYS A 1 189 ? 0.774   4.725   -30.191 1.00 17.32 ? 232 CYS A CB  1 
ATOM   1439 S  SG  . CYS A 1 189 ? 1.518   4.552   -28.574 1.00 21.39 ? 232 CYS A SG  1 
ATOM   1440 N  N   . ASN A 1 190 ? -2.678  4.380   -31.598 1.00 17.34 ? 233 ASN A N   1 
ATOM   1441 C  CA  . ASN A 1 190 ? -3.425  4.591   -32.833 1.00 18.58 ? 233 ASN A CA  1 
ATOM   1442 C  C   . ASN A 1 190 ? -4.755  5.338   -32.652 1.00 16.80 ? 233 ASN A C   1 
ATOM   1443 O  O   . ASN A 1 190 ? -5.505  5.444   -33.619 1.00 16.06 ? 233 ASN A O   1 
ATOM   1444 C  CB  . ASN A 1 190 ? -3.665  3.244   -33.542 1.00 16.68 ? 233 ASN A CB  1 
ATOM   1445 C  CG  . ASN A 1 190 ? -4.633  2.332   -32.802 1.00 16.88 ? 233 ASN A CG  1 
ATOM   1446 O  OD1 . ASN A 1 190 ? -5.141  2.674   -31.746 1.00 16.84 ? 233 ASN A OD1 1 
ATOM   1447 N  ND2 . ASN A 1 190 ? -4.903  1.169   -33.374 1.00 18.76 ? 233 ASN A ND2 1 
ATOM   1448 N  N   . ASP A 1 191 ? -5.043  5.883   -31.465 1.00 17.20 ? 234 ASP A N   1 
ATOM   1449 C  CA  . ASP A 1 191 ? -6.257  6.666   -31.166 1.00 19.10 ? 234 ASP A CA  1 
ATOM   1450 C  C   . ASP A 1 191 ? -7.544  5.850   -31.217 1.00 20.64 ? 234 ASP A C   1 
ATOM   1451 O  O   . ASP A 1 191 ? -8.657  6.415   -31.296 1.00 16.60 ? 234 ASP A O   1 
ATOM   1452 C  CB  . ASP A 1 191 ? -6.395  7.874   -32.098 1.00 20.23 ? 234 ASP A CB  1 
ATOM   1453 C  CG  . ASP A 1 191 ? -5.183  8.800   -32.041 1.00 30.02 ? 234 ASP A CG  1 
ATOM   1454 O  OD1 . ASP A 1 191 ? -4.620  8.995   -30.944 1.00 29.20 ? 234 ASP A OD1 1 
ATOM   1455 O  OD2 . ASP A 1 191 ? -4.789  9.337   -33.103 1.00 43.95 ? 234 ASP A OD2 1 
ATOM   1456 N  N   . TYR A 1 192 ? -7.420  4.536   -31.149 1.00 17.71 ? 235 TYR A N   1 
ATOM   1457 C  CA  . TYR A 1 192 ? -8.536  3.614   -31.069 1.00 18.84 ? 235 TYR A CA  1 
ATOM   1458 C  C   . TYR A 1 192 ? -8.291  2.737   -29.858 1.00 15.26 ? 235 TYR A C   1 
ATOM   1459 O  O   . TYR A 1 192 ? -7.155  2.572   -29.423 1.00 16.01 ? 235 TYR A O   1 
ATOM   1460 C  CB  . TYR A 1 192 ? -8.661  2.728   -32.318 1.00 16.94 ? 235 TYR A CB  1 
ATOM   1461 C  CG  . TYR A 1 192 ? -9.195  3.408   -33.547 1.00 17.09 ? 235 TYR A CG  1 
ATOM   1462 C  CD1 . TYR A 1 192 ? -8.363  4.129   -34.392 1.00 20.58 ? 235 TYR A CD1 1 
ATOM   1463 C  CD2 . TYR A 1 192 ? -10.519 3.264   -33.903 1.00 16.57 ? 235 TYR A CD2 1 
ATOM   1464 C  CE1 . TYR A 1 192 ? -8.863  4.730   -35.543 1.00 21.61 ? 235 TYR A CE1 1 
ATOM   1465 C  CE2 . TYR A 1 192 ? -11.023 3.859   -35.039 1.00 21.69 ? 235 TYR A CE2 1 
ATOM   1466 C  CZ  . TYR A 1 192 ? -10.196 4.595   -35.848 1.00 22.15 ? 235 TYR A CZ  1 
ATOM   1467 O  OH  . TYR A 1 192 ? -10.715 5.164   -36.993 1.00 28.98 ? 235 TYR A OH  1 
ATOM   1468 N  N   . ILE A 1 193 ? -9.367  2.187   -29.309 1.00 14.16 ? 236 ILE A N   1 
ATOM   1469 C  CA  . ILE A 1 193 ? -9.279  1.195   -28.235 1.00 15.17 ? 236 ILE A CA  1 
ATOM   1470 C  C   . ILE A 1 193 ? -9.844  -0.108  -28.792 1.00 17.61 ? 236 ILE A C   1 
ATOM   1471 O  O   . ILE A 1 193 ? -11.022 -0.159  -29.159 1.00 15.76 ? 236 ILE A O   1 
ATOM   1472 C  CB  . ILE A 1 193 ? -10.054 1.644   -26.977 1.00 17.42 ? 236 ILE A CB  1 
ATOM   1473 C  CG1 . ILE A 1 193 ? -9.563  3.013   -26.468 1.00 17.15 ? 236 ILE A CG1 1 
ATOM   1474 C  CG2 . ILE A 1 193 ? -9.963  0.602   -25.886 1.00 16.52 ? 236 ILE A CG2 1 
ATOM   1475 C  CD1 . ILE A 1 193 ? -8.080  3.092   -26.138 1.00 15.10 ? 236 ILE A CD1 1 
ATOM   1476 N  N   . SER A 1 194 ? -9.009  -1.145  -28.883 1.00 14.41 ? 237 SER A N   1 
ATOM   1477 C  CA  . SER A 1 194 ? -9.499  -2.468  -29.261 1.00 15.34 ? 237 SER A CA  1 
ATOM   1478 C  C   . SER A 1 194 ? -9.948  -3.242  -28.035 1.00 13.94 ? 237 SER A C   1 
ATOM   1479 O  O   . SER A 1 194 ? -9.562  -2.945  -26.904 1.00 14.62 ? 237 SER A O   1 
ATOM   1480 C  CB  . SER A 1 194 ? -8.444  -3.296  -29.993 1.00 15.55 ? 237 SER A CB  1 
ATOM   1481 O  OG  . SER A 1 194 ? -7.355  -3.602  -29.159 1.00 17.74 ? 237 SER A OG  1 
ATOM   1482 N  N   . VAL A 1 195 ? -10.782 -4.257  -28.280 1.00 13.23 ? 238 VAL A N   1 
ATOM   1483 C  CA  . VAL A 1 195 ? -11.231 -5.112  -27.186 1.00 14.16 ? 238 VAL A CA  1 
ATOM   1484 C  C   . VAL A 1 195 ? -10.043 -5.811  -26.523 1.00 11.68 ? 238 VAL A C   1 
ATOM   1485 O  O   . VAL A 1 195 ? -10.091 -6.139  -25.329 1.00 15.01 ? 238 VAL A O   1 
ATOM   1486 C  CB  . VAL A 1 195 ? -12.292 -6.103  -27.718 1.00 19.59 ? 238 VAL A CB  1 
ATOM   1487 C  CG1 . VAL A 1 195 ? -11.700 -7.028  -28.733 1.00 16.78 ? 238 VAL A CG1 1 
ATOM   1488 C  CG2 . VAL A 1 195 ? -12.935 -6.861  -26.603 1.00 15.14 ? 238 VAL A CG2 1 
ATOM   1489 N  N   . PHE A 1 196 ? -8.975  -6.058  -27.285 1.00 16.03 ? 239 PHE A N   1 
ATOM   1490 C  CA  . PHE A 1 196 ? -7.725  -6.608  -26.751 1.00 14.88 ? 239 PHE A CA  1 
ATOM   1491 C  C   . PHE A 1 196 ? -7.036  -5.625  -25.805 1.00 14.74 ? 239 PHE A C   1 
ATOM   1492 O  O   . PHE A 1 196 ? -6.656  -5.984  -24.675 1.00 13.85 ? 239 PHE A O   1 
ATOM   1493 C  CB  . PHE A 1 196 ? -6.810  -6.986  -27.923 1.00 15.50 ? 239 PHE A CB  1 
ATOM   1494 C  CG  . PHE A 1 196 ? -5.469  -7.511  -27.510 1.00 15.84 ? 239 PHE A CG  1 
ATOM   1495 C  CD1 . PHE A 1 196 ? -4.416  -6.658  -27.276 1.00 15.05 ? 239 PHE A CD1 1 
ATOM   1496 C  CD2 . PHE A 1 196 ? -5.271  -8.864  -27.360 1.00 17.01 ? 239 PHE A CD2 1 
ATOM   1497 C  CE1 . PHE A 1 196 ? -3.155  -7.158  -26.893 1.00 18.10 ? 239 PHE A CE1 1 
ATOM   1498 C  CE2 . PHE A 1 196 ? -4.041  -9.362  -26.973 1.00 18.56 ? 239 PHE A CE2 1 
ATOM   1499 C  CZ  . PHE A 1 196 ? -2.985  -8.505  -26.736 1.00 17.54 ? 239 PHE A CZ  1 
ATOM   1500 N  N   . GLU A 1 197 ? -6.874  -4.373  -26.236 1.00 15.17 ? 240 GLU A N   1 
ATOM   1501 C  CA  . GLU A 1 197 ? -6.286  -3.366  -25.348 1.00 11.57 ? 240 GLU A CA  1 
ATOM   1502 C  C   . GLU A 1 197 ? -7.139  -3.179  -24.098 1.00 15.73 ? 240 GLU A C   1 
ATOM   1503 O  O   . GLU A 1 197 ? -6.609  -2.979  -23.004 1.00 14.29 ? 240 GLU A O   1 
ATOM   1504 C  CB  . GLU A 1 197 ? -6.121  -2.026  -26.082 1.00 14.43 ? 240 GLU A CB  1 
ATOM   1505 C  CG  . GLU A 1 197 ? -4.991  -2.008  -27.135 1.00 16.38 ? 240 GLU A CG  1 
ATOM   1506 C  CD  . GLU A 1 197 ? -5.095  -0.797  -28.066 1.00 23.83 ? 240 GLU A CD  1 
ATOM   1507 O  OE1 . GLU A 1 197 ? -6.215  -0.447  -28.499 1.00 18.60 ? 240 GLU A OE1 1 
ATOM   1508 O  OE2 . GLU A 1 197 ? -4.053  -0.203  -28.352 1.00 18.81 ? 240 GLU A OE2 1 
ATOM   1509 N  N   . PHE A 1 198 ? -8.465  -3.246  -24.248 1.00 17.64 ? 241 PHE A N   1 
ATOM   1510 C  CA  . PHE A 1 198 ? -9.352  -3.158  -23.095 1.00 14.51 ? 241 PHE A CA  1 
ATOM   1511 C  C   . PHE A 1 198 ? -9.138  -4.333  -22.135 1.00 14.18 ? 241 PHE A C   1 
ATOM   1512 O  O   . PHE A 1 198 ? -9.099  -4.151  -20.914 1.00 12.66 ? 241 PHE A O   1 
ATOM   1513 C  CB  . PHE A 1 198 ? -10.809 -3.102  -23.583 1.00 13.68 ? 241 PHE A CB  1 
ATOM   1514 C  CG  . PHE A 1 198 ? -11.833 -3.108  -22.484 1.00 14.95 ? 241 PHE A CG  1 
ATOM   1515 C  CD1 . PHE A 1 198 ? -12.095 -1.966  -21.752 1.00 12.52 ? 241 PHE A CD1 1 
ATOM   1516 C  CD2 . PHE A 1 198 ? -12.566 -4.259  -22.196 1.00 20.38 ? 241 PHE A CD2 1 
ATOM   1517 C  CE1 . PHE A 1 198 ? -13.024 -1.968  -20.747 1.00 14.56 ? 241 PHE A CE1 1 
ATOM   1518 C  CE2 . PHE A 1 198 ? -13.525 -4.254  -21.193 1.00 14.39 ? 241 PHE A CE2 1 
ATOM   1519 C  CZ  . PHE A 1 198 ? -13.758 -3.124  -20.475 1.00 15.46 ? 241 PHE A CZ  1 
ATOM   1520 N  N   . ASP A 1 199 ? -8.989  -5.542  -22.683 1.00 13.33 ? 242 ASP A N   1 
ATOM   1521 C  CA  . ASP A 1 199 ? -8.700  -6.722  -21.873 1.00 14.39 ? 242 ASP A CA  1 
ATOM   1522 C  C   . ASP A 1 199 ? -7.418  -6.520  -21.084 1.00 16.42 ? 242 ASP A C   1 
ATOM   1523 O  O   . ASP A 1 199 ? -7.376  -6.739  -19.876 1.00 13.75 ? 242 ASP A O   1 
ATOM   1524 C  CB  . ASP A 1 199 ? -8.602  -7.962  -22.774 1.00 16.98 ? 242 ASP A CB  1 
ATOM   1525 C  CG  . ASP A 1 199 ? -8.376  -9.263  -21.980 1.00 18.88 ? 242 ASP A CG  1 
ATOM   1526 O  OD1 . ASP A 1 199 ? -9.118  -9.489  -21.007 1.00 21.68 ? 242 ASP A OD1 1 
ATOM   1527 O  OD2 . ASP A 1 199 ? -7.424  -10.013 -22.295 1.00 25.60 ? 242 ASP A OD2 1 
ATOM   1528 N  N   . ILE A 1 200 ? -6.370  -6.040  -21.739 1.00 11.82 ? 243 ILE A N   1 
ATOM   1529 C  CA  . ILE A 1 200 ? -5.096  -5.863  -21.035 1.00 10.92 ? 243 ILE A CA  1 
ATOM   1530 C  C   . ILE A 1 200 ? -5.252  -4.856  -19.903 1.00 16.02 ? 243 ILE A C   1 
ATOM   1531 O  O   . ILE A 1 200 ? -4.849  -5.112  -18.757 1.00 12.93 ? 243 ILE A O   1 
ATOM   1532 C  CB  . ILE A 1 200 ? -3.994  -5.429  -22.016 1.00 17.72 ? 243 ILE A CB  1 
ATOM   1533 C  CG1 . ILE A 1 200 ? -3.769  -6.504  -23.086 1.00 17.27 ? 243 ILE A CG1 1 
ATOM   1534 C  CG2 . ILE A 1 200 ? -2.716  -5.142  -21.260 1.00 11.61 ? 243 ILE A CG2 1 
ATOM   1535 C  CD1 . ILE A 1 200 ? -3.476  -7.879  -22.578 1.00 23.82 ? 243 ILE A CD1 1 
ATOM   1536 N  N   . PHE A 1 201 ? -5.839  -3.696  -20.213 1.00 13.62 ? 244 PHE A N   1 
ATOM   1537 C  CA  . PHE A 1 201 ? -5.963  -2.644  -19.215 1.00 17.92 ? 244 PHE A CA  1 
ATOM   1538 C  C   . PHE A 1 201 ? -6.767  -3.118  -18.005 1.00 14.66 ? 244 PHE A C   1 
ATOM   1539 O  O   . PHE A 1 201 ? -6.423  -2.806  -16.851 1.00 16.68 ? 244 PHE A O   1 
ATOM   1540 C  CB  . PHE A 1 201 ? -6.611  -1.407  -19.853 1.00 12.79 ? 244 PHE A CB  1 
ATOM   1541 C  CG  . PHE A 1 201 ? -6.745  -0.244  -18.915 1.00 15.83 ? 244 PHE A CG  1 
ATOM   1542 C  CD1 . PHE A 1 201 ? -5.707  0.656   -18.757 1.00 14.09 ? 244 PHE A CD1 1 
ATOM   1543 C  CD2 . PHE A 1 201 ? -7.898  -0.052  -18.184 1.00 17.85 ? 244 PHE A CD2 1 
ATOM   1544 C  CE1 . PHE A 1 201 ? -5.817  1.728   -17.884 1.00 17.58 ? 244 PHE A CE1 1 
ATOM   1545 C  CE2 . PHE A 1 201 ? -8.014  1.005   -17.324 1.00 17.46 ? 244 PHE A CE2 1 
ATOM   1546 C  CZ  . PHE A 1 201 ? -6.956  1.895   -17.158 1.00 14.57 ? 244 PHE A CZ  1 
ATOM   1547 N  N   . THR A 1 202 ? -7.882  -3.808  -18.241 1.00 14.72 ? 245 THR A N   1 
ATOM   1548 C  CA  . THR A 1 202 ? -8.718  -4.207  -17.108 1.00 13.20 ? 245 THR A CA  1 
ATOM   1549 C  C   . THR A 1 202 ? -8.100  -5.367  -16.329 1.00 17.23 ? 245 THR A C   1 
ATOM   1550 O  O   . THR A 1 202 ? -8.429  -5.556  -15.150 1.00 17.60 ? 245 THR A O   1 
ATOM   1551 C  CB  . THR A 1 202 ? -10.138 -4.551  -17.574 1.00 15.17 ? 245 THR A CB  1 
ATOM   1552 O  OG1 . THR A 1 202 ? -10.101 -5.566  -18.570 1.00 14.13 ? 245 THR A OG1 1 
ATOM   1553 C  CG2 . THR A 1 202 ? -10.830 -3.325  -18.138 1.00 14.36 ? 245 THR A CG2 1 
ATOM   1554 N  N   . ARG A 1 203 ? -7.210  -6.151  -16.949 1.00 15.78 ? 246 ARG A N   1 
ATOM   1555 C  CA  . ARG A 1 203 ? -6.428  -7.115  -16.178 1.00 14.27 ? 246 ARG A CA  1 
ATOM   1556 C  C   . ARG A 1 203 ? -5.402  -6.404  -15.291 1.00 18.56 ? 246 ARG A C   1 
ATOM   1557 O  O   . ARG A 1 203 ? -5.295  -6.685  -14.090 1.00 16.88 ? 246 ARG A O   1 
ATOM   1558 C  CB  . ARG A 1 203 ? -5.774  -8.126  -17.126 1.00 15.37 ? 246 ARG A CB  1 
ATOM   1559 C  CG  . ARG A 1 203 ? -6.808  -9.027  -17.767 1.00 19.20 ? 246 ARG A CG  1 
ATOM   1560 C  CD  . ARG A 1 203 ? -6.255  -9.819  -18.895 1.00 28.87 ? 246 ARG A CD  1 
ATOM   1561 N  NE  . ARG A 1 203 ? -5.075  -10.556 -18.488 1.00 28.12 ? 246 ARG A NE  1 
ATOM   1562 C  CZ  . ARG A 1 203 ? -4.209  -11.080 -19.341 1.00 33.87 ? 246 ARG A CZ  1 
ATOM   1563 N  NH1 . ARG A 1 203 ? -4.377  -10.938 -20.656 1.00 35.02 ? 246 ARG A NH1 1 
ATOM   1564 N  NH2 . ARG A 1 203 ? -3.169  -11.724 -18.869 1.00 37.61 ? 246 ARG A NH2 1 
ATOM   1565 N  N   . LEU A 1 204 ? -4.687  -5.431  -15.850 1.00 16.85 ? 247 LEU A N   1 
ATOM   1566 C  CA  . LEU A 1 204 ? -3.636  -4.751  -15.094 1.00 17.65 ? 247 LEU A CA  1 
ATOM   1567 C  C   . LEU A 1 204 ? -4.191  -3.987  -13.896 1.00 18.19 ? 247 LEU A C   1 
ATOM   1568 O  O   . LEU A 1 204 ? -3.580  -3.980  -12.818 1.00 15.27 ? 247 LEU A O   1 
ATOM   1569 C  CB  . LEU A 1 204 ? -2.887  -3.803  -16.033 1.00 13.29 ? 247 LEU A CB  1 
ATOM   1570 C  CG  . LEU A 1 204 ? -1.992  -4.488  -17.056 1.00 15.76 ? 247 LEU A CG  1 
ATOM   1571 C  CD1 . LEU A 1 204 ? -1.627  -3.455  -18.136 1.00 20.53 ? 247 LEU A CD1 1 
ATOM   1572 C  CD2 . LEU A 1 204 ? -0.748  -5.081  -16.417 1.00 20.47 ? 247 LEU A CD2 1 
ATOM   1573 N  N   . PHE A 1 205 ? -5.350  -3.333  -14.062 1.00 13.74 ? 248 PHE A N   1 
ATOM   1574 C  CA  . PHE A 1 205 ? -5.874  -2.408  -13.067 1.00 14.79 ? 248 PHE A CA  1 
ATOM   1575 C  C   . PHE A 1 205 ? -7.150  -2.939  -12.404 1.00 18.07 ? 248 PHE A C   1 
ATOM   1576 O  O   . PHE A 1 205 ? -7.949  -2.163  -11.869 1.00 14.41 ? 248 PHE A O   1 
ATOM   1577 C  CB  . PHE A 1 205 ? -6.082  -1.033  -13.715 1.00 19.81 ? 248 PHE A CB  1 
ATOM   1578 C  CG  . PHE A 1 205 ? -4.781  -0.409  -14.187 1.00 15.18 ? 248 PHE A CG  1 
ATOM   1579 C  CD1 . PHE A 1 205 ? -3.913  0.133   -13.265 1.00 19.21 ? 248 PHE A CD1 1 
ATOM   1580 C  CD2 . PHE A 1 205 ? -4.416  -0.405  -15.545 1.00 15.42 ? 248 PHE A CD2 1 
ATOM   1581 C  CE1 . PHE A 1 205 ? -2.679  0.671   -13.662 1.00 13.23 ? 248 PHE A CE1 1 
ATOM   1582 C  CE2 . PHE A 1 205 ? -3.200  0.129   -15.949 1.00 17.98 ? 248 PHE A CE2 1 
ATOM   1583 C  CZ  . PHE A 1 205 ? -2.333  0.675   -15.002 1.00 18.03 ? 248 PHE A CZ  1 
ATOM   1584 N  N   . GLN A 1 206 ? -7.329  -4.256  -12.409 1.00 18.21 ? 249 GLN A N   1 
ATOM   1585 C  CA  . GLN A 1 206 ? -8.405  -4.899  -11.661 1.00 22.75 ? 249 GLN A CA  1 
ATOM   1586 C  C   . GLN A 1 206 ? -8.261  -4.583  -10.174 1.00 21.94 ? 249 GLN A C   1 
ATOM   1587 O  O   . GLN A 1 206 ? -7.147  -4.359  -9.705  1.00 19.78 ? 249 GLN A O   1 
ATOM   1588 C  CB  . GLN A 1 206 ? -8.364  -6.408  -11.891 1.00 18.73 ? 249 GLN A CB  1 
ATOM   1589 C  CG  . GLN A 1 206 ? -7.139  -7.071  -11.314 1.00 21.15 ? 249 GLN A CG  1 
ATOM   1590 C  CD  . GLN A 1 206 ? -7.129  -8.554  -11.603 1.00 25.58 ? 249 GLN A CD  1 
ATOM   1591 O  OE1 . GLN A 1 206 ? -7.813  -9.323  -10.925 1.00 28.23 ? 249 GLN A OE1 1 
ATOM   1592 N  NE2 . GLN A 1 206 ? -6.384  -8.968  -12.640 1.00 23.71 ? 249 GLN A NE2 1 
ATOM   1593 N  N   . PRO A 1 207 ? -9.374  -4.607  -9.414  1.00 21.01 ? 250 PRO A N   1 
ATOM   1594 C  CA  . PRO A 1 207 ? -10.744 -4.936  -9.822  1.00 23.61 ? 250 PRO A CA  1 
ATOM   1595 C  C   . PRO A 1 207 ? -11.520 -3.815  -10.509 1.00 20.83 ? 250 PRO A C   1 
ATOM   1596 O  O   . PRO A 1 207 ? -11.386 -2.615  -10.187 1.00 17.59 ? 250 PRO A O   1 
ATOM   1597 C  CB  . PRO A 1 207 ? -11.414 -5.293  -8.496  1.00 27.45 ? 250 PRO A CB  1 
ATOM   1598 C  CG  . PRO A 1 207 ? -10.731 -4.429  -7.527  1.00 21.23 ? 250 PRO A CG  1 
ATOM   1599 C  CD  . PRO A 1 207 ? -9.293  -4.416  -7.955  1.00 20.66 ? 250 PRO A CD  1 
ATOM   1600 N  N   . TRP A 1 208 ? -12.372 -4.262  -11.440 1.00 18.56 ? 251 TRP A N   1 
ATOM   1601 C  CA  . TRP A 1 208 ? -13.245 -3.371  -12.204 1.00 18.09 ? 251 TRP A CA  1 
ATOM   1602 C  C   . TRP A 1 208 ? -14.020 -2.417  -11.312 1.00 19.47 ? 251 TRP A C   1 
ATOM   1603 O  O   . TRP A 1 208 ? -14.238 -1.254  -11.669 1.00 17.00 ? 251 TRP A O   1 
ATOM   1604 C  CB  . TRP A 1 208 ? -14.228 -4.193  -13.034 1.00 20.29 ? 251 TRP A CB  1 
ATOM   1605 C  CG  . TRP A 1 208 ? -15.193 -3.325  -13.764 1.00 18.16 ? 251 TRP A CG  1 
ATOM   1606 C  CD1 . TRP A 1 208 ? -16.473 -3.009  -13.398 1.00 21.21 ? 251 TRP A CD1 1 
ATOM   1607 C  CD2 . TRP A 1 208 ? -14.944 -2.618  -14.992 1.00 19.98 ? 251 TRP A CD2 1 
ATOM   1608 N  NE1 . TRP A 1 208 ? -17.040 -2.174  -14.332 1.00 22.38 ? 251 TRP A NE1 1 
ATOM   1609 C  CE2 . TRP A 1 208 ? -16.128 -1.921  -15.323 1.00 22.95 ? 251 TRP A CE2 1 
ATOM   1610 C  CE3 . TRP A 1 208 ? -13.854 -2.537  -15.854 1.00 17.65 ? 251 TRP A CE3 1 
ATOM   1611 C  CZ2 . TRP A 1 208 ? -16.232 -1.124  -16.459 1.00 25.32 ? 251 TRP A CZ2 1 
ATOM   1612 C  CZ3 . TRP A 1 208 ? -13.957 -1.733  -16.997 1.00 20.69 ? 251 TRP A CZ3 1 
ATOM   1613 C  CH2 . TRP A 1 208 ? -15.142 -1.049  -17.288 1.00 21.64 ? 251 TRP A CH2 1 
ATOM   1614 N  N   . SER A 1 209 ? -14.452 -2.894  -10.145 1.00 20.29 ? 252 SER A N   1 
ATOM   1615 C  CA  . SER A 1 209 ? -15.321 -2.093  -9.299  1.00 22.29 ? 252 SER A CA  1 
ATOM   1616 C  C   . SER A 1 209 ? -14.679 -0.772  -8.912  1.00 21.53 ? 252 SER A C   1 
ATOM   1617 O  O   . SER A 1 209 ? -15.388 0.214   -8.705  1.00 22.27 ? 252 SER A O   1 
ATOM   1618 C  CB  . SER A 1 209 ? -15.699 -2.899  -8.055  1.00 22.55 ? 252 SER A CB  1 
ATOM   1619 O  OG  . SER A 1 209 ? -14.552 -3.294  -7.343  1.00 27.53 ? 252 SER A OG  1 
ATOM   1620 N  N   . SER A 1 210 ? -13.345 -0.716  -8.835  1.00 17.53 ? 253 SER A N   1 
ATOM   1621 C  CA  . SER A 1 210 ? -12.615 0.513   -8.528  1.00 21.18 ? 253 SER A CA  1 
ATOM   1622 C  C   . SER A 1 210 ? -11.592 0.882   -9.611  1.00 19.76 ? 253 SER A C   1 
ATOM   1623 O  O   . SER A 1 210 ? -10.612 1.573   -9.323  1.00 17.43 ? 253 SER A O   1 
ATOM   1624 C  CB  . SER A 1 210 ? -11.936 0.388   -7.159  1.00 23.26 ? 253 SER A CB  1 
ATOM   1625 O  OG  . SER A 1 210 ? -11.125 -0.775  -7.050  1.00 20.88 ? 253 SER A OG  1 
ATOM   1626 N  N   . LEU A 1 211 ? -11.860 0.488   -10.866 1.00 17.17 ? 254 LEU A N   1 
ATOM   1627 C  CA  . LEU A 1 211 ? -10.888 0.523   -11.964 1.00 15.41 ? 254 LEU A CA  1 
ATOM   1628 C  C   . LEU A 1 211 ? -10.029 1.779   -12.004 1.00 14.83 ? 254 LEU A C   1 
ATOM   1629 O  O   . LEU A 1 211 ? -8.789  1.703   -11.995 1.00 15.22 ? 254 LEU A O   1 
ATOM   1630 C  CB  . LEU A 1 211 ? -11.621 0.353   -13.299 1.00 16.91 ? 254 LEU A CB  1 
ATOM   1631 C  CG  . LEU A 1 211 ? -10.728 0.261   -14.556 1.00 19.03 ? 254 LEU A CG  1 
ATOM   1632 C  CD1 . LEU A 1 211 ? -10.120 -1.135  -14.674 1.00 15.79 ? 254 LEU A CD1 1 
ATOM   1633 C  CD2 . LEU A 1 211 ? -11.463 0.610   -15.843 1.00 16.39 ? 254 LEU A CD2 1 
ATOM   1634 N  N   . LEU A 1 212 ? -10.657 2.948   -12.078 1.00 16.77 ? 255 LEU A N   1 
ATOM   1635 C  CA  . LEU A 1 212 ? -9.870  4.143   -12.301 1.00 18.05 ? 255 LEU A CA  1 
ATOM   1636 C  C   . LEU A 1 212 ? -9.269  4.708   -11.015 1.00 20.13 ? 255 LEU A C   1 
ATOM   1637 O  O   . LEU A 1 212 ? -8.269  5.431   -11.087 1.00 19.48 ? 255 LEU A O   1 
ATOM   1638 C  CB  . LEU A 1 212 ? -10.714 5.188   -13.050 1.00 19.65 ? 255 LEU A CB  1 
ATOM   1639 C  CG  . LEU A 1 212 ? -11.117 4.796   -14.476 1.00 18.51 ? 255 LEU A CG  1 
ATOM   1640 C  CD1 . LEU A 1 212 ? -11.690 6.003   -15.194 1.00 21.76 ? 255 LEU A CD1 1 
ATOM   1641 C  CD2 . LEU A 1 212 ? -9.969  4.237   -15.305 1.00 22.08 ? 255 LEU A CD2 1 
ATOM   1642 N  N   . ARG A 1 213 ? -9.815  4.368   -9.842  1.00 17.79 ? 256 ARG A N   1 
ATOM   1643 C  CA  . ARG A 1 213 ? -9.094  4.614   -8.593  1.00 23.81 ? 256 ARG A CA  1 
ATOM   1644 C  C   . ARG A 1 213 ? -7.837  3.744   -8.494  1.00 22.81 ? 256 ARG A C   1 
ATOM   1645 O  O   . ARG A 1 213 ? -6.786  4.208   -8.022  1.00 19.72 ? 256 ARG A O   1 
ATOM   1646 C  CB  . ARG A 1 213 ? -10.028 4.377   -7.390  1.00 23.50 ? 256 ARG A CB  1 
ATOM   1647 C  CG  . ARG A 1 213 ? -11.116 5.442   -7.230  1.00 34.85 ? 256 ARG A CG  1 
ATOM   1648 C  CD  . ARG A 1 213 ? -11.903 5.255   -5.916  1.00 38.14 ? 256 ARG A CD  1 
ATOM   1649 N  N   . ASN A 1 214 ? -7.915  2.483   -8.931  1.00 16.88 ? 257 ASN A N   1 
ATOM   1650 C  CA  . ASN A 1 214 ? -6.717  1.643   -8.958  1.00 16.76 ? 257 ASN A CA  1 
ATOM   1651 C  C   . ASN A 1 214 ? -5.677  2.241   -9.896  1.00 19.99 ? 257 ASN A C   1 
ATOM   1652 O  O   . ASN A 1 214 ? -4.496  2.318   -9.562  1.00 18.05 ? 257 ASN A O   1 
ATOM   1653 C  CB  . ASN A 1 214 ? -7.039  0.221   -9.417  1.00 18.73 ? 257 ASN A CB  1 
ATOM   1654 C  CG  . ASN A 1 214 ? -8.213  -0.414  -8.669  1.00 23.18 ? 257 ASN A CG  1 
ATOM   1655 O  OD1 . ASN A 1 214 ? -8.487  -0.111  -7.483  1.00 19.87 ? 257 ASN A OD1 1 
ATOM   1656 N  ND2 . ASN A 1 214 ? -8.948  -1.263  -9.387  1.00 19.00 ? 257 ASN A ND2 1 
ATOM   1657 N  N   . TRP A 1 215 ? -6.114  2.648   -11.086 1.00 18.11 ? 258 TRP A N   1 
ATOM   1658 C  CA  . TRP A 1 215 ? -5.204  3.205   -12.089 1.00 16.88 ? 258 TRP A CA  1 
ATOM   1659 C  C   . TRP A 1 215 ? -4.571  4.496   -11.586 1.00 18.17 ? 258 TRP A C   1 
ATOM   1660 O  O   . TRP A 1 215 ? -3.372  4.740   -11.778 1.00 17.04 ? 258 TRP A O   1 
ATOM   1661 C  CB  . TRP A 1 215 ? -5.969  3.429   -13.402 1.00 19.48 ? 258 TRP A CB  1 
ATOM   1662 C  CG  . TRP A 1 215 ? -5.232  4.295   -14.372 1.00 19.26 ? 258 TRP A CG  1 
ATOM   1663 C  CD1 . TRP A 1 215 ? -4.188  3.929   -15.183 1.00 17.97 ? 258 TRP A CD1 1 
ATOM   1664 C  CD2 . TRP A 1 215 ? -5.459  5.682   -14.613 1.00 16.99 ? 258 TRP A CD2 1 
ATOM   1665 N  NE1 . TRP A 1 215 ? -3.757  5.011   -15.911 1.00 19.75 ? 258 TRP A NE1 1 
ATOM   1666 C  CE2 . TRP A 1 215 ? -4.514  6.103   -15.573 1.00 16.19 ? 258 TRP A CE2 1 
ATOM   1667 C  CE3 . TRP A 1 215 ? -6.380  6.619   -14.110 1.00 14.62 ? 258 TRP A CE3 1 
ATOM   1668 C  CZ2 . TRP A 1 215 ? -4.466  7.418   -16.047 1.00 14.47 ? 258 TRP A CZ2 1 
ATOM   1669 C  CZ3 . TRP A 1 215 ? -6.328  7.913   -14.577 1.00 16.83 ? 258 TRP A CZ3 1 
ATOM   1670 C  CH2 . TRP A 1 215 ? -5.381  8.305   -15.546 1.00 18.82 ? 258 TRP A CH2 1 
ATOM   1671 N  N   . ASN A 1 216 ? -5.355  5.324   -10.911 1.00 17.15 ? 259 ASN A N   1 
ATOM   1672 C  CA  . ASN A 1 216 ? -4.809  6.564   -10.383 1.00 22.04 ? 259 ASN A CA  1 
ATOM   1673 C  C   . ASN A 1 216 ? -3.775  6.299   -9.293  1.00 21.50 ? 259 ASN A C   1 
ATOM   1674 O  O   . ASN A 1 216 ? -2.742  6.976   -9.237  1.00 23.36 ? 259 ASN A O   1 
ATOM   1675 C  CB  . ASN A 1 216 ? -5.939  7.437   -9.857  1.00 21.87 ? 259 ASN A CB  1 
ATOM   1676 C  CG  . ASN A 1 216 ? -5.436  8.777   -9.393  1.00 30.32 ? 259 ASN A CG  1 
ATOM   1677 O  OD1 . ASN A 1 216 ? -5.068  9.623   -10.206 1.00 32.44 ? 259 ASN A OD1 1 
ATOM   1678 N  ND2 . ASN A 1 216 ? -5.364  8.955   -8.086  1.00 32.24 ? 259 ASN A ND2 1 
ATOM   1679 N  N   . SER A 1 217 ? -4.031  5.312   -8.426  1.00 21.89 ? 260 SER A N   1 
ATOM   1680 C  CA  . SER A 1 217 ? -3.134  4.995   -7.320  1.00 24.34 ? 260 SER A CA  1 
ATOM   1681 C  C   . SER A 1 217 ? -1.885  4.258   -7.766  1.00 30.11 ? 260 SER A C   1 
ATOM   1682 O  O   . SER A 1 217 ? -0.838  4.392   -7.119  1.00 22.99 ? 260 SER A O   1 
ATOM   1683 C  CB  . SER A 1 217 ? -3.843  4.127   -6.276  1.00 25.76 ? 260 SER A CB  1 
ATOM   1684 O  OG  . SER A 1 217 ? -4.859  4.866   -5.647  1.00 32.08 ? 260 SER A OG  1 
ATOM   1685 N  N   . LEU A 1 218 ? -1.985  3.448   -8.824  1.00 19.22 ? 261 LEU A N   1 
ATOM   1686 C  CA  . LEU A 1 218 ? -0.850  2.653   -9.268  1.00 21.00 ? 261 LEU A CA  1 
ATOM   1687 C  C   . LEU A 1 218 ? -0.070  3.281   -10.416 1.00 24.10 ? 261 LEU A C   1 
ATOM   1688 O  O   . LEU A 1 218 ? 1.107   2.930   -10.593 1.00 27.59 ? 261 LEU A O   1 
ATOM   1689 C  CB  . LEU A 1 218 ? -1.322  1.250   -9.680  1.00 20.71 ? 261 LEU A CB  1 
ATOM   1690 C  CG  . LEU A 1 218 ? -2.007  0.433   -8.586  1.00 23.62 ? 261 LEU A CG  1 
ATOM   1691 C  CD1 . LEU A 1 218 ? -2.771  -0.721  -9.176  1.00 26.37 ? 261 LEU A CD1 1 
ATOM   1692 C  CD2 . LEU A 1 218 ? -0.959  -0.094  -7.576  1.00 30.49 ? 261 LEU A CD2 1 
ATOM   1693 N  N   . ALA A 1 219 ? -0.666  4.200   -11.190 1.00 20.43 ? 262 ALA A N   1 
ATOM   1694 C  CA  . ALA A 1 219 ? -0.040  4.724   -12.412 1.00 22.52 ? 262 ALA A CA  1 
ATOM   1695 C  C   . ALA A 1 219 ? 0.071   6.240   -12.500 1.00 30.45 ? 262 ALA A C   1 
ATOM   1696 O  O   . ALA A 1 219 ? 0.907   6.718   -13.278 1.00 43.53 ? 262 ALA A O   1 
ATOM   1697 C  CB  . ALA A 1 219 ? -0.795  4.271   -13.654 1.00 22.10 ? 262 ALA A CB  1 
ATOM   1698 N  N   . VAL A 1 220 ? -0.748  7.011   -11.798 1.00 20.10 ? 263 VAL A N   1 
ATOM   1699 C  CA  . VAL A 1 220 ? -0.644  8.477   -11.835 1.00 18.52 ? 263 VAL A CA  1 
ATOM   1700 C  C   . VAL A 1 220 ? 0.134   8.998   -10.639 1.00 19.92 ? 263 VAL A C   1 
ATOM   1701 O  O   . VAL A 1 220 ? 1.129   9.699   -10.796 1.00 22.94 ? 263 VAL A O   1 
ATOM   1702 C  CB  . VAL A 1 220 ? -2.047  9.124   -11.929 1.00 20.42 ? 263 VAL A CB  1 
ATOM   1703 C  CG1 . VAL A 1 220 ? -1.982  10.652  -11.805 1.00 26.41 ? 263 VAL A CG1 1 
ATOM   1704 C  CG2 . VAL A 1 220 ? -2.701  8.751   -13.226 1.00 20.33 ? 263 VAL A CG2 1 
ATOM   1705 N  N   . THR A 1 221 ? -0.269  8.620   -9.436  1.00 21.13 ? 264 THR A N   1 
ATOM   1706 C  CA  . THR A 1 221 ? 0.315   9.183   -8.231  1.00 22.11 ? 264 THR A CA  1 
ATOM   1707 C  C   . THR A 1 221 ? 1.385   8.281   -7.636  1.00 23.04 ? 264 THR A C   1 
ATOM   1708 O  O   . THR A 1 221 ? 1.894   8.575   -6.552  1.00 25.35 ? 264 THR A O   1 
ATOM   1709 C  CB  . THR A 1 221 ? -0.779  9.474   -7.200  1.00 21.13 ? 264 THR A CB  1 
ATOM   1710 O  OG1 . THR A 1 221 ? -1.359  8.253   -6.714  1.00 21.50 ? 264 THR A OG1 1 
ATOM   1711 C  CG2 . THR A 1 221 ? -1.864  10.307  -7.818  1.00 27.16 ? 264 THR A CG2 1 
ATOM   1712 N  N   . HIS A 1 222 ? 1.719   7.183   -8.310  1.00 19.45 ? 265 HIS A N   1 
ATOM   1713 C  CA  . HIS A 1 222 ? 2.790   6.309   -7.865  1.00 19.45 ? 265 HIS A CA  1 
ATOM   1714 C  C   . HIS A 1 222 ? 4.079   6.588   -8.622  1.00 23.46 ? 265 HIS A C   1 
ATOM   1715 O  O   . HIS A 1 222 ? 4.189   6.221   -9.804  1.00 18.79 ? 265 HIS A O   1 
ATOM   1716 C  CB  . HIS A 1 222 ? 2.404   4.847   -8.022  1.00 19.66 ? 265 HIS A CB  1 
ATOM   1717 C  CG  . HIS A 1 222 ? 3.141   3.961   -7.077  1.00 19.91 ? 265 HIS A CG  1 
ATOM   1718 N  ND1 . HIS A 1 222 ? 4.509   4.011   -6.944  1.00 17.88 ? 265 HIS A ND1 1 
ATOM   1719 C  CD2 . HIS A 1 222 ? 2.705   3.057   -6.167  1.00 24.71 ? 265 HIS A CD2 1 
ATOM   1720 C  CE1 . HIS A 1 222 ? 4.890   3.154   -6.016  1.00 24.59 ? 265 HIS A CE1 1 
ATOM   1721 N  NE2 . HIS A 1 222 ? 3.814   2.565   -5.526  1.00 25.66 ? 265 HIS A NE2 1 
ATOM   1722 N  N   . PRO A 1 223 ? 5.112   7.131   -7.975  1.00 21.04 ? 266 PRO A N   1 
ATOM   1723 C  CA  . PRO A 1 223 ? 6.357   7.426   -8.706  1.00 26.65 ? 266 PRO A CA  1 
ATOM   1724 C  C   . PRO A 1 223 ? 7.112   6.185   -9.166  1.00 20.79 ? 266 PRO A C   1 
ATOM   1725 O  O   . PRO A 1 223 ? 7.986   6.310   -10.027 1.00 20.11 ? 266 PRO A O   1 
ATOM   1726 C  CB  . PRO A 1 223 ? 7.180   8.243   -7.702  1.00 23.92 ? 266 PRO A CB  1 
ATOM   1727 C  CG  . PRO A 1 223 ? 6.606   7.963   -6.377  1.00 24.95 ? 266 PRO A CG  1 
ATOM   1728 C  CD  . PRO A 1 223 ? 5.176   7.509   -6.552  1.00 19.81 ? 266 PRO A CD  1 
ATOM   1729 N  N   . GLY A 1 224 ? 6.784   4.994   -8.655  1.00 16.41 ? 267 GLY A N   1 
ATOM   1730 C  CA  . GLY A 1 224 ? 7.392   3.770   -9.135  1.00 19.06 ? 267 GLY A CA  1 
ATOM   1731 C  C   . GLY A 1 224 ? 6.932   3.328   -10.522 1.00 15.41 ? 267 GLY A C   1 
ATOM   1732 O  O   . GLY A 1 224 ? 7.607   2.517   -11.155 1.00 14.75 ? 267 GLY A O   1 
ATOM   1733 N  N   . TYR A 1 225 ? 5.798   3.824   -10.999 1.00 13.65 ? 268 TYR A N   1 
ATOM   1734 C  CA  . TYR A 1 225 ? 5.247   3.345   -12.259 1.00 23.60 ? 268 TYR A CA  1 
ATOM   1735 C  C   . TYR A 1 225 ? 5.981   3.980   -13.434 1.00 16.55 ? 268 TYR A C   1 
ATOM   1736 O  O   . TYR A 1 225 ? 6.161   5.207   -13.475 1.00 17.52 ? 268 TYR A O   1 
ATOM   1737 C  CB  . TYR A 1 225 ? 3.759   3.672   -12.350 1.00 20.41 ? 268 TYR A CB  1 
ATOM   1738 C  CG  . TYR A 1 225 ? 3.199   3.434   -13.731 1.00 17.22 ? 268 TYR A CG  1 
ATOM   1739 C  CD1 . TYR A 1 225 ? 2.974   2.142   -14.200 1.00 24.32 ? 268 TYR A CD1 1 
ATOM   1740 C  CD2 . TYR A 1 225 ? 2.911   4.495   -14.573 1.00 19.38 ? 268 TYR A CD2 1 
ATOM   1741 C  CE1 . TYR A 1 225 ? 2.481   1.921   -15.458 1.00 19.71 ? 268 TYR A CE1 1 
ATOM   1742 C  CE2 . TYR A 1 225 ? 2.415   4.282   -15.841 1.00 24.42 ? 268 TYR A CE2 1 
ATOM   1743 C  CZ  . TYR A 1 225 ? 2.190   3.005   -16.272 1.00 27.15 ? 268 TYR A CZ  1 
ATOM   1744 O  OH  . TYR A 1 225 ? 1.701   2.808   -17.531 1.00 29.28 ? 268 TYR A OH  1 
ATOM   1745 N  N   . MET A 1 226 ? 6.364   3.147   -14.403 1.00 14.17 ? 269 MET A N   1 
ATOM   1746 C  CA  . MET A 1 226 ? 7.118   3.567   -15.584 1.00 18.13 ? 269 MET A CA  1 
ATOM   1747 C  C   . MET A 1 226 ? 6.305   3.241   -16.830 1.00 20.25 ? 269 MET A C   1 
ATOM   1748 O  O   . MET A 1 226 ? 6.017   2.072   -17.103 1.00 21.60 ? 269 MET A O   1 
ATOM   1749 C  CB  . MET A 1 226 ? 8.483   2.877   -15.649 1.00 15.78 ? 269 MET A CB  1 
ATOM   1750 C  CG  . MET A 1 226 ? 9.374   3.122   -14.435 1.00 25.26 ? 269 MET A CG  1 
ATOM   1751 S  SD  . MET A 1 226 ? 9.987   4.817   -14.428 1.00 25.15 ? 269 MET A SD  1 
ATOM   1752 C  CE  . MET A 1 226 ? 9.594   5.368   -12.765 1.00 20.67 ? 269 MET A CE  1 
ATOM   1753 N  N   . ALA A 1 227 ? 5.932   4.272   -17.581 1.00 16.09 ? 270 ALA A N   1 
ATOM   1754 C  CA  . ALA A 1 227 ? 5.225   4.082   -18.842 1.00 21.77 ? 270 ALA A CA  1 
ATOM   1755 C  C   . ALA A 1 227 ? 6.196   3.774   -19.980 1.00 14.82 ? 270 ALA A C   1 
ATOM   1756 O  O   . ALA A 1 227 ? 7.249   4.403   -20.099 1.00 16.03 ? 270 ALA A O   1 
ATOM   1757 C  CB  . ALA A 1 227 ? 4.416   5.338   -19.184 1.00 17.35 ? 270 ALA A CB  1 
ATOM   1758 N  N   . PHE A 1 228 ? 5.805   2.821   -20.844 1.00 16.87 ? 271 PHE A N   1 
ATOM   1759 C  CA  . PHE A 1 228 ? 6.546   2.448   -22.056 1.00 20.38 ? 271 PHE A CA  1 
ATOM   1760 C  C   . PHE A 1 228 ? 8.042   2.250   -21.789 1.00 18.62 ? 271 PHE A C   1 
ATOM   1761 O  O   . PHE A 1 228 ? 8.902   2.853   -22.433 1.00 19.02 ? 271 PHE A O   1 
ATOM   1762 C  CB  . PHE A 1 228 ? 6.317   3.478   -23.173 1.00 20.33 ? 271 PHE A CB  1 
ATOM   1763 C  CG  . PHE A 1 228 ? 4.947   3.410   -23.761 1.00 23.76 ? 271 PHE A CG  1 
ATOM   1764 C  CD1 . PHE A 1 228 ? 4.607   2.395   -24.635 1.00 29.55 ? 271 PHE A CD1 1 
ATOM   1765 C  CD2 . PHE A 1 228 ? 3.984   4.357   -23.431 1.00 27.62 ? 271 PHE A CD2 1 
ATOM   1766 C  CE1 . PHE A 1 228 ? 3.335   2.320   -25.175 1.00 26.98 ? 271 PHE A CE1 1 
ATOM   1767 C  CE2 . PHE A 1 228 ? 2.712   4.282   -23.986 1.00 24.38 ? 271 PHE A CE2 1 
ATOM   1768 C  CZ  . PHE A 1 228 ? 2.399   3.252   -24.856 1.00 25.61 ? 271 PHE A CZ  1 
ATOM   1769 N  N   . LEU A 1 229 ? 8.344   1.382   -20.827 1.00 14.73 ? 272 LEU A N   1 
ATOM   1770 C  CA  . LEU A 1 229 ? 9.704   1.051   -20.449 1.00 13.19 ? 272 LEU A CA  1 
ATOM   1771 C  C   . LEU A 1 229 ? 9.929   -0.436  -20.657 1.00 16.78 ? 272 LEU A C   1 
ATOM   1772 O  O   . LEU A 1 229 ? 9.015   -1.240  -20.460 1.00 18.04 ? 272 LEU A O   1 
ATOM   1773 C  CB  . LEU A 1 229 ? 9.977   1.433   -18.992 1.00 19.74 ? 272 LEU A CB  1 
ATOM   1774 C  CG  . LEU A 1 229 ? 11.364  2.020   -18.722 1.00 24.90 ? 272 LEU A CG  1 
ATOM   1775 C  CD1 . LEU A 1 229 ? 11.534  3.379   -19.394 1.00 30.33 ? 272 LEU A CD1 1 
ATOM   1776 C  CD2 . LEU A 1 229 ? 11.630  2.138   -17.224 1.00 27.29 ? 272 LEU A CD2 1 
ATOM   1777 N  N   . THR A 1 230 ? 11.121  -0.781  -21.152 1.00 16.54 ? 273 THR A N   1 
ATOM   1778 C  CA  . THR A 1 230 ? 11.479  -2.172  -21.393 1.00 17.09 ? 273 THR A CA  1 
ATOM   1779 C  C   . THR A 1 230 ? 12.316  -2.734  -20.246 1.00 18.46 ? 273 THR A C   1 
ATOM   1780 O  O   . THR A 1 230 ? 12.822  -2.022  -19.369 1.00 15.26 ? 273 THR A O   1 
ATOM   1781 C  CB  . THR A 1 230 ? 12.238  -2.309  -22.714 1.00 17.73 ? 273 THR A CB  1 
ATOM   1782 O  OG1 . THR A 1 230 ? 13.551  -1.745  -22.565 1.00 16.59 ? 273 THR A OG1 1 
ATOM   1783 C  CG2 . THR A 1 230 ? 11.459  -1.629  -23.851 1.00 16.35 ? 273 THR A CG2 1 
ATOM   1784 N  N   . TYR A 1 231 ? 12.438  -4.060  -20.269 1.00 15.83 ? 274 TYR A N   1 
ATOM   1785 C  CA  . TYR A 1 231 ? 13.250  -4.789  -19.307 1.00 15.52 ? 274 TYR A CA  1 
ATOM   1786 C  C   . TYR A 1 231 ? 14.666  -4.221  -19.194 1.00 15.54 ? 274 TYR A C   1 
ATOM   1787 O  O   . TYR A 1 231 ? 15.157  -3.972  -18.090 1.00 17.65 ? 274 TYR A O   1 
ATOM   1788 C  CB  . TYR A 1 231 ? 13.291  -6.265  -19.726 1.00 13.85 ? 274 TYR A CB  1 
ATOM   1789 C  CG  . TYR A 1 231 ? 14.094  -7.172  -18.814 1.00 16.43 ? 274 TYR A CG  1 
ATOM   1790 C  CD1 . TYR A 1 231 ? 15.502  -7.200  -18.867 1.00 20.00 ? 274 TYR A CD1 1 
ATOM   1791 C  CD2 . TYR A 1 231 ? 13.456  -7.991  -17.902 1.00 18.35 ? 274 TYR A CD2 1 
ATOM   1792 C  CE1 . TYR A 1 231 ? 16.214  -8.014  -18.028 1.00 17.78 ? 274 TYR A CE1 1 
ATOM   1793 C  CE2 . TYR A 1 231 ? 14.160  -8.812  -17.072 1.00 19.67 ? 274 TYR A CE2 1 
ATOM   1794 C  CZ  . TYR A 1 231 ? 15.527  -8.828  -17.126 1.00 22.87 ? 274 TYR A CZ  1 
ATOM   1795 O  OH  . TYR A 1 231 ? 16.199  -9.669  -16.258 1.00 26.57 ? 274 TYR A OH  1 
ATOM   1796 N  N   . ASP A 1 232 ? 15.340  -4.012  -20.333 1.00 17.13 ? 275 ASP A N   1 
ATOM   1797 C  CA  . ASP A 1 232 ? 16.702  -3.477  -20.309 1.00 20.19 ? 275 ASP A CA  1 
ATOM   1798 C  C   . ASP A 1 232 ? 16.748  -2.024  -19.845 1.00 21.37 ? 275 ASP A C   1 
ATOM   1799 O  O   . ASP A 1 232 ? 17.722  -1.613  -19.199 1.00 20.49 ? 275 ASP A O   1 
ATOM   1800 C  CB  . ASP A 1 232 ? 17.341  -3.608  -21.692 1.00 17.83 ? 275 ASP A CB  1 
ATOM   1801 C  CG  . ASP A 1 232 ? 17.874  -4.998  -21.952 1.00 25.25 ? 275 ASP A CG  1 
ATOM   1802 O  OD1 . ASP A 1 232 ? 17.911  -5.811  -21.007 1.00 28.93 ? 275 ASP A OD1 1 
ATOM   1803 O  OD2 . ASP A 1 232 ? 18.288  -5.274  -23.101 1.00 29.99 ? 275 ASP A OD2 1 
ATOM   1804 N  N   . GLU A 1 233 ? 15.711  -1.235  -20.144 1.00 18.27 ? 276 GLU A N   1 
ATOM   1805 C  CA  . GLU A 1 233 ? 15.662  0.132   -19.630 1.00 16.61 ? 276 GLU A CA  1 
ATOM   1806 C  C   . GLU A 1 233 ? 15.463  0.161   -18.122 1.00 19.36 ? 276 GLU A C   1 
ATOM   1807 O  O   . GLU A 1 233 ? 15.963  1.073   -17.464 1.00 14.86 ? 276 GLU A O   1 
ATOM   1808 C  CB  . GLU A 1 233 ? 14.552  0.930   -20.319 1.00 21.38 ? 276 GLU A CB  1 
ATOM   1809 C  CG  . GLU A 1 233 ? 14.830  1.185   -21.771 1.00 23.28 ? 276 GLU A CG  1 
ATOM   1810 C  CD  . GLU A 1 233 ? 13.713  1.922   -22.469 1.00 29.86 ? 276 GLU A CD  1 
ATOM   1811 O  OE1 . GLU A 1 233 ? 12.536  1.471   -22.423 1.00 17.49 ? 276 GLU A OE1 1 
ATOM   1812 O  OE2 . GLU A 1 233 ? 14.028  2.962   -23.100 1.00 34.06 ? 276 GLU A OE2 1 
ATOM   1813 N  N   . VAL A 1 234 ? 14.738  -0.818  -17.560 1.00 16.57 ? 277 VAL A N   1 
ATOM   1814 C  CA  . VAL A 1 234 ? 14.602  -0.917  -16.106 1.00 18.36 ? 277 VAL A CA  1 
ATOM   1815 C  C   . VAL A 1 234 ? 15.964  -1.188  -15.465 1.00 19.72 ? 277 VAL A C   1 
ATOM   1816 O  O   . VAL A 1 234 ? 16.339  -0.535  -14.486 1.00 23.09 ? 277 VAL A O   1 
ATOM   1817 C  CB  . VAL A 1 234 ? 13.574  -2.001  -15.732 1.00 17.60 ? 277 VAL A CB  1 
ATOM   1818 C  CG1 . VAL A 1 234 ? 13.697  -2.428  -14.256 1.00 22.63 ? 277 VAL A CG1 1 
ATOM   1819 C  CG2 . VAL A 1 234 ? 12.138  -1.494  -16.037 1.00 15.69 ? 277 VAL A CG2 1 
ATOM   1820 N  N   . LYS A 1 235 ? 16.725  -2.148  -16.012 1.00 21.06 ? 278 LYS A N   1 
ATOM   1821 C  CA  . LYS A 1 235 ? 18.072  -2.405  -15.491 1.00 27.46 ? 278 LYS A CA  1 
ATOM   1822 C  C   . LYS A 1 235 ? 18.926  -1.147  -15.527 1.00 24.91 ? 278 LYS A C   1 
ATOM   1823 O  O   . LYS A 1 235 ? 19.668  -0.861  -14.576 1.00 24.73 ? 278 LYS A O   1 
ATOM   1824 C  CB  . LYS A 1 235 ? 18.775  -3.502  -16.288 1.00 28.33 ? 278 LYS A CB  1 
ATOM   1825 C  CG  . LYS A 1 235 ? 18.283  -4.899  -16.002 1.00 31.86 ? 278 LYS A CG  1 
ATOM   1826 N  N   . ALA A 1 236 ? 18.858  -0.403  -16.636 1.00 20.31 ? 279 ALA A N   1 
ATOM   1827 C  CA  . ALA A 1 236 ? 19.640  0.818   -16.788 1.00 21.01 ? 279 ALA A CA  1 
ATOM   1828 C  C   . ALA A 1 236 ? 19.214  1.875   -15.785 1.00 25.94 ? 279 ALA A C   1 
ATOM   1829 O  O   . ALA A 1 236 ? 20.054  2.555   -15.182 1.00 23.90 ? 279 ALA A O   1 
ATOM   1830 C  CB  . ALA A 1 236 ? 19.486  1.333   -18.214 1.00 23.88 ? 279 ALA A CB  1 
ATOM   1831 N  N   . ARG A 1 237 ? 17.906  2.029   -15.598 1.00 18.95 ? 280 ARG A N   1 
ATOM   1832 C  CA  . ARG A 1 237 ? 17.395  3.079   -14.744 1.00 17.36 ? 280 ARG A CA  1 
ATOM   1833 C  C   . ARG A 1 237 ? 17.709  2.826   -13.275 1.00 22.65 ? 280 ARG A C   1 
ATOM   1834 O  O   . ARG A 1 237 ? 17.910  3.777   -12.507 1.00 19.69 ? 280 ARG A O   1 
ATOM   1835 C  CB  . ARG A 1 237 ? 15.881  3.204   -14.938 1.00 17.52 ? 280 ARG A CB  1 
ATOM   1836 C  CG  . ARG A 1 237 ? 15.322  4.449   -14.321 1.00 18.95 ? 280 ARG A CG  1 
ATOM   1837 C  CD  . ARG A 1 237 ? 13.856  4.600   -14.577 1.00 21.57 ? 280 ARG A CD  1 
ATOM   1838 N  NE  . ARG A 1 237 ? 13.289  5.770   -13.907 1.00 21.93 ? 280 ARG A NE  1 
ATOM   1839 C  CZ  . ARG A 1 237 ? 13.119  6.960   -14.476 1.00 33.92 ? 280 ARG A CZ  1 
ATOM   1840 N  NH1 . ARG A 1 237 ? 13.470  7.154   -15.735 1.00 34.15 ? 280 ARG A NH1 1 
ATOM   1841 N  NH2 . ARG A 1 237 ? 12.592  7.962   -13.786 1.00 25.93 ? 280 ARG A NH2 1 
ATOM   1842 N  N   . LEU A 1 238 ? 17.718  1.569   -12.860 1.00 15.81 ? 281 LEU A N   1 
ATOM   1843 C  CA  . LEU A 1 238 ? 17.967  1.239   -11.471 1.00 23.19 ? 281 LEU A CA  1 
ATOM   1844 C  C   . LEU A 1 238 ? 19.462  1.138   -11.185 1.00 22.51 ? 281 LEU A C   1 
ATOM   1845 O  O   . LEU A 1 238 ? 19.860  1.091   -10.019 1.00 18.46 ? 281 LEU A O   1 
ATOM   1846 C  CB  . LEU A 1 238 ? 17.258  -0.064  -11.100 1.00 22.20 ? 281 LEU A CB  1 
ATOM   1847 C  CG  . LEU A 1 238 ? 15.732  -0.038  -10.962 1.00 16.01 ? 281 LEU A CG  1 
ATOM   1848 C  CD1 . LEU A 1 238 ? 15.255  -1.464  -10.688 1.00 24.10 ? 281 LEU A CD1 1 
ATOM   1849 C  CD2 . LEU A 1 238 ? 15.214  0.923   -9.868  1.00 19.34 ? 281 LEU A CD2 1 
ATOM   1850 N  N   . GLN A 1 239 ? 20.294  1.157   -12.224 1.00 19.70 ? 282 GLN A N   1 
ATOM   1851 C  CA  . GLN A 1 239 ? 21.735  1.092   -11.994 1.00 21.45 ? 282 GLN A CA  1 
ATOM   1852 C  C   . GLN A 1 239 ? 22.216  2.257   -11.130 1.00 24.48 ? 282 GLN A C   1 
ATOM   1853 O  O   . GLN A 1 239 ? 23.115  2.080   -10.298 1.00 22.22 ? 282 GLN A O   1 
ATOM   1854 C  CB  . GLN A 1 239 ? 22.485  1.051   -13.326 1.00 24.19 ? 282 GLN A CB  1 
ATOM   1855 C  CG  . GLN A 1 239 ? 23.995  0.978   -13.177 1.00 30.38 ? 282 GLN A CG  1 
ATOM   1856 C  CD  . GLN A 1 239 ? 24.461  -0.309  -12.539 1.00 40.06 ? 282 GLN A CD  1 
ATOM   1857 O  OE1 . GLN A 1 239 ? 23.846  -1.358  -12.718 1.00 29.06 ? 282 GLN A OE1 1 
ATOM   1858 N  NE2 . GLN A 1 239 ? 25.558  -0.238  -11.792 1.00 44.29 ? 282 GLN A NE2 1 
ATOM   1859 N  N   . LYS A 1 240 ? 21.614  3.438   -11.264 1.00 22.87 ? 283 LYS A N   1 
ATOM   1860 C  CA  . LYS A 1 240 ? 22.097  4.545   -10.439 1.00 27.84 ? 283 LYS A CA  1 
ATOM   1861 C  C   . LYS A 1 240 ? 21.682  4.408   -8.980  1.00 24.69 ? 283 LYS A C   1 
ATOM   1862 O  O   . LYS A 1 240 ? 22.172  5.179   -8.152  1.00 21.49 ? 283 LYS A O   1 
ATOM   1863 C  CB  . LYS A 1 240 ? 21.641  5.891   -10.994 1.00 32.36 ? 283 LYS A CB  1 
ATOM   1864 C  CG  . LYS A 1 240 ? 20.165  6.118   -11.131 1.00 27.32 ? 283 LYS A CG  1 
ATOM   1865 C  CD  . LYS A 1 240 ? 19.931  7.396   -11.980 1.00 25.03 ? 283 LYS A CD  1 
ATOM   1866 C  CE  . LYS A 1 240 ? 18.484  7.670   -12.176 1.00 29.11 ? 283 LYS A CE  1 
ATOM   1867 N  NZ  . LYS A 1 240 ? 17.880  6.541   -12.935 1.00 29.33 ? 283 LYS A NZ  1 
ATOM   1868 N  N   . PHE A 1 241 ? 20.853  3.414   -8.642  1.00 23.57 ? 284 PHE A N   1 
ATOM   1869 C  CA  . PHE A 1 241 ? 20.437  3.147   -7.264  1.00 20.67 ? 284 PHE A CA  1 
ATOM   1870 C  C   . PHE A 1 241 ? 21.008  1.853   -6.733  1.00 25.05 ? 284 PHE A C   1 
ATOM   1871 O  O   . PHE A 1 241 ? 20.555  1.367   -5.691  1.00 27.35 ? 284 PHE A O   1 
ATOM   1872 C  CB  . PHE A 1 241 ? 18.909  3.133   -7.157  1.00 19.53 ? 284 PHE A CB  1 
ATOM   1873 C  CG  . PHE A 1 241 ? 18.278  4.403   -7.626  1.00 23.04 ? 284 PHE A CG  1 
ATOM   1874 C  CD1 . PHE A 1 241 ? 18.565  5.606   -7.010  1.00 25.55 ? 284 PHE A CD1 1 
ATOM   1875 C  CD2 . PHE A 1 241 ? 17.409  4.397   -8.692  1.00 25.28 ? 284 PHE A CD2 1 
ATOM   1876 C  CE1 . PHE A 1 241 ? 17.992  6.784   -7.459  1.00 28.49 ? 284 PHE A CE1 1 
ATOM   1877 C  CE2 . PHE A 1 241 ? 16.829  5.579   -9.138  1.00 31.89 ? 284 PHE A CE2 1 
ATOM   1878 C  CZ  . PHE A 1 241 ? 17.122  6.767   -8.511  1.00 22.45 ? 284 PHE A CZ  1 
ATOM   1879 N  N   . ILE A 1 242 ? 22.011  1.290   -7.407  1.00 26.21 ? 285 ILE A N   1 
ATOM   1880 C  CA  . ILE A 1 242 ? 22.595  0.021   -6.968  1.00 29.94 ? 285 ILE A CA  1 
ATOM   1881 C  C   . ILE A 1 242 ? 23.119  0.101   -5.527  1.00 28.93 ? 285 ILE A C   1 
ATOM   1882 O  O   . ILE A 1 242 ? 23.225  -0.925  -4.849  1.00 34.95 ? 285 ILE A O   1 
ATOM   1883 C  CB  . ILE A 1 242 ? 23.692  -0.399  -7.979  1.00 30.69 ? 285 ILE A CB  1 
ATOM   1884 C  CG1 . ILE A 1 242 ? 23.760  -1.906  -8.107  1.00 33.95 ? 285 ILE A CG1 1 
ATOM   1885 C  CG2 . ILE A 1 242 ? 25.058  0.185   -7.636  1.00 30.98 ? 285 ILE A CG2 1 
ATOM   1886 C  CD1 . ILE A 1 242 ? 22.673  -2.468  -8.956  1.00 38.70 ? 285 ILE A CD1 1 
ATOM   1887 N  N   . HIS A 1 243 ? 23.406  1.301   -5.029  1.00 34.57 ? 286 HIS A N   1 
ATOM   1888 C  CA  . HIS A 1 243 ? 23.842  1.520   -3.651  1.00 37.99 ? 286 HIS A CA  1 
ATOM   1889 C  C   . HIS A 1 243 ? 22.691  1.700   -2.672  1.00 42.51 ? 286 HIS A C   1 
ATOM   1890 O  O   . HIS A 1 243 ? 22.940  1.926   -1.488  1.00 39.41 ? 286 HIS A O   1 
ATOM   1891 C  CB  . HIS A 1 243 ? 24.704  2.773   -3.576  1.00 35.82 ? 286 HIS A CB  1 
ATOM   1892 C  CG  . HIS A 1 243 ? 23.948  4.012   -3.931  1.00 43.95 ? 286 HIS A CG  1 
ATOM   1893 N  ND1 . HIS A 1 243 ? 23.636  4.343   -5.233  1.00 35.30 ? 286 HIS A ND1 1 
ATOM   1894 C  CD2 . HIS A 1 243 ? 23.378  4.964   -3.152  1.00 53.41 ? 286 HIS A CD2 1 
ATOM   1895 C  CE1 . HIS A 1 243 ? 22.939  5.467   -5.241  1.00 49.59 ? 286 HIS A CE1 1 
ATOM   1896 N  NE2 . HIS A 1 243 ? 22.767  5.864   -3.992  1.00 53.86 ? 286 HIS A NE2 1 
ATOM   1897 N  N   . LYS A 1 244 ? 21.444  1.659   -3.141  1.00 30.01 ? 287 LYS A N   1 
ATOM   1898 C  CA  . LYS A 1 244 ? 20.266  1.923   -2.327  1.00 33.03 ? 287 LYS A CA  1 
ATOM   1899 C  C   . LYS A 1 244 ? 19.363  0.702   -2.454  1.00 28.99 ? 287 LYS A C   1 
ATOM   1900 O  O   . LYS A 1 244 ? 18.332  0.746   -3.140  1.00 25.12 ? 287 LYS A O   1 
ATOM   1901 C  CB  . LYS A 1 244 ? 19.555  3.206   -2.762  1.00 24.45 ? 287 LYS A CB  1 
ATOM   1902 C  CG  . LYS A 1 244 ? 18.564  3.711   -1.775  1.00 27.42 ? 287 LYS A CG  1 
ATOM   1903 C  CD  . LYS A 1 244 ? 17.892  4.954   -2.265  1.00 26.54 ? 287 LYS A CD  1 
ATOM   1904 C  CE  . LYS A 1 244 ? 17.214  5.640   -1.143  1.00 31.56 ? 287 LYS A CE  1 
ATOM   1905 N  NZ  . LYS A 1 244 ? 16.706  6.942   -1.576  1.00 40.75 ? 287 LYS A NZ  1 
ATOM   1906 N  N   . PRO A 1 245 ? 19.748  -0.416  -1.834  1.00 31.99 ? 288 PRO A N   1 
ATOM   1907 C  CA  . PRO A 1 245 ? 18.868  -1.589  -1.797  1.00 30.04 ? 288 PRO A CA  1 
ATOM   1908 C  C   . PRO A 1 245 ? 17.448  -1.191  -1.434  1.00 30.99 ? 288 PRO A C   1 
ATOM   1909 O  O   . PRO A 1 245 ? 17.225  -0.339  -0.572  1.00 25.54 ? 288 PRO A O   1 
ATOM   1910 C  CB  . PRO A 1 245 ? 19.490  -2.476  -0.712  1.00 35.58 ? 288 PRO A CB  1 
ATOM   1911 C  CG  . PRO A 1 245 ? 20.918  -2.053  -0.612  1.00 34.26 ? 288 PRO A CG  1 
ATOM   1912 C  CD  . PRO A 1 245 ? 21.016  -0.637  -1.111  1.00 41.96 ? 288 PRO A CD  1 
ATOM   1913 N  N   . GLY A 1 246 ? 16.483  -1.829  -2.096  1.00 25.41 ? 289 GLY A N   1 
ATOM   1914 C  CA  . GLY A 1 246 ? 15.086  -1.538  -1.880  1.00 21.95 ? 289 GLY A CA  1 
ATOM   1915 C  C   . GLY A 1 246 ? 14.510  -0.538  -2.857  1.00 21.88 ? 289 GLY A C   1 
ATOM   1916 O  O   . GLY A 1 246 ? 13.298  -0.270  -2.816  1.00 21.41 ? 289 GLY A O   1 
ATOM   1917 N  N   . SER A 1 247 ? 15.348  0.042   -3.710  1.00 20.94 ? 290 SER A N   1 
ATOM   1918 C  CA  . SER A 1 247 ? 14.859  0.871   -4.796  1.00 22.42 ? 290 SER A CA  1 
ATOM   1919 C  C   . SER A 1 247 ? 14.167  -0.011  -5.820  1.00 17.93 ? 290 SER A C   1 
ATOM   1920 O  O   . SER A 1 247 ? 14.659  -1.092  -6.158  1.00 20.69 ? 290 SER A O   1 
ATOM   1921 C  CB  . SER A 1 247 ? 16.010  1.616   -5.442  1.00 21.42 ? 290 SER A CB  1 
ATOM   1922 O  OG  . SER A 1 247 ? 16.678  2.440   -4.483  1.00 25.03 ? 290 SER A OG  1 
ATOM   1923 N  N   . TYR A 1 248 ? 13.019  0.446   -6.310  1.00 17.99 ? 291 TYR A N   1 
ATOM   1924 C  CA  . TYR A 1 248 ? 12.227  -0.400  -7.197  1.00 19.87 ? 291 TYR A CA  1 
ATOM   1925 C  C   . TYR A 1 248 ? 11.403  0.467   -8.131  1.00 14.55 ? 291 TYR A C   1 
ATOM   1926 O  O   . TYR A 1 248 ? 11.074  1.613   -7.814  1.00 15.55 ? 291 TYR A O   1 
ATOM   1927 C  CB  . TYR A 1 248 ? 11.281  -1.328  -6.413  1.00 19.02 ? 291 TYR A CB  1 
ATOM   1928 C  CG  . TYR A 1 248 ? 10.055  -0.637  -5.829  1.00 17.98 ? 291 TYR A CG  1 
ATOM   1929 C  CD1 . TYR A 1 248 ? 10.142  0.132   -4.673  1.00 16.18 ? 291 TYR A CD1 1 
ATOM   1930 C  CD2 . TYR A 1 248 ? 8.806   -0.754  -6.426  1.00 16.01 ? 291 TYR A CD2 1 
ATOM   1931 C  CE1 . TYR A 1 248 ? 9.044   0.764   -4.137  1.00 18.82 ? 291 TYR A CE1 1 
ATOM   1932 C  CE2 . TYR A 1 248 ? 7.691   -0.116  -5.903  1.00 18.57 ? 291 TYR A CE2 1 
ATOM   1933 C  CZ  . TYR A 1 248 ? 7.799   0.636   -4.759  1.00 17.29 ? 291 TYR A CZ  1 
ATOM   1934 O  OH  . TYR A 1 248 ? 6.668   1.257   -4.259  1.00 18.63 ? 291 TYR A OH  1 
ATOM   1935 N  N   . ILE A 1 249 ? 11.049  -0.126  -9.281  1.00 15.99 ? 292 ILE A N   1 
ATOM   1936 C  CA  . ILE A 1 249 ? 10.094  0.443   -10.229 1.00 15.94 ? 292 ILE A CA  1 
ATOM   1937 C  C   . ILE A 1 249 ? 9.277   -0.697  -10.834 1.00 17.00 ? 292 ILE A C   1 
ATOM   1938 O  O   . ILE A 1 249 ? 9.650   -1.872  -10.743 1.00 17.72 ? 292 ILE A O   1 
ATOM   1939 C  CB  . ILE A 1 249 ? 10.818  1.247   -11.324 1.00 15.73 ? 292 ILE A CB  1 
ATOM   1940 C  CG1 . ILE A 1 249 ? 11.930  0.406   -11.986 1.00 20.75 ? 292 ILE A CG1 1 
ATOM   1941 C  CG2 . ILE A 1 249 ? 11.394  2.524   -10.715 1.00 19.84 ? 292 ILE A CG2 1 
ATOM   1942 C  CD1 . ILE A 1 249 ? 12.702  1.132   -13.115 1.00 23.68 ? 292 ILE A CD1 1 
ATOM   1943 N  N   . PHE A 1 250 ? 8.141   -0.350  -11.444 1.00 16.11 ? 293 PHE A N   1 
ATOM   1944 C  CA  . PHE A 1 250 ? 7.321   -1.374  -12.092 1.00 18.06 ? 293 PHE A CA  1 
ATOM   1945 C  C   . PHE A 1 250 ? 6.696   -0.809  -13.372 1.00 18.28 ? 293 PHE A C   1 
ATOM   1946 O  O   . PHE A 1 250 ? 6.614   0.403   -13.584 1.00 17.78 ? 293 PHE A O   1 
ATOM   1947 C  CB  . PHE A 1 250 ? 6.259   -1.913  -11.127 1.00 16.76 ? 293 PHE A CB  1 
ATOM   1948 C  CG  . PHE A 1 250 ? 5.375   -0.843  -10.557 1.00 15.19 ? 293 PHE A CG  1 
ATOM   1949 C  CD1 . PHE A 1 250 ? 5.745   -0.163  -9.414  1.00 20.30 ? 293 PHE A CD1 1 
ATOM   1950 C  CD2 . PHE A 1 250 ? 4.183   -0.499  -11.183 1.00 18.50 ? 293 PHE A CD2 1 
ATOM   1951 C  CE1 . PHE A 1 250 ? 4.961   0.838   -8.906  1.00 16.56 ? 293 PHE A CE1 1 
ATOM   1952 C  CE2 . PHE A 1 250 ? 3.384   0.511   -10.680 1.00 16.97 ? 293 PHE A CE2 1 
ATOM   1953 C  CZ  . PHE A 1 250 ? 3.771   1.183   -9.533  1.00 18.80 ? 293 PHE A CZ  1 
ATOM   1954 N  N   . ARG A 1 251 ? 6.282   -1.734  -14.238 1.00 19.40 ? 294 ARG A N   1 
ATOM   1955 C  CA  . ARG A 1 251 ? 5.895   -1.454  -15.612 1.00 17.62 ? 294 ARG A CA  1 
ATOM   1956 C  C   . ARG A 1 251 ? 5.122   -2.663  -16.128 1.00 20.28 ? 294 ARG A C   1 
ATOM   1957 O  O   . ARG A 1 251 ? 5.100   -3.731  -15.506 1.00 17.80 ? 294 ARG A O   1 
ATOM   1958 C  CB  . ARG A 1 251 ? 7.132   -1.189  -16.483 1.00 16.17 ? 294 ARG A CB  1 
ATOM   1959 C  CG  . ARG A 1 251 ? 8.064   -2.404  -16.410 1.00 23.72 ? 294 ARG A CG  1 
ATOM   1960 C  CD  . ARG A 1 251 ? 9.014   -2.538  -17.501 1.00 23.10 ? 294 ARG A CD  1 
ATOM   1961 N  NE  . ARG A 1 251 ? 9.837   -3.730  -17.289 1.00 17.76 ? 294 ARG A NE  1 
ATOM   1962 C  CZ  . ARG A 1 251 ? 9.736   -4.861  -17.987 1.00 16.72 ? 294 ARG A CZ  1 
ATOM   1963 N  NH1 . ARG A 1 251 ? 8.847   -5.008  -18.968 1.00 19.39 ? 294 ARG A NH1 1 
ATOM   1964 N  NH2 . ARG A 1 251 ? 10.555  -5.858  -17.698 1.00 14.99 ? 294 ARG A NH2 1 
ATOM   1965 N  N   . LEU A 1 252 ? 4.522   -2.500  -17.294 1.00 18.31 ? 295 LEU A N   1 
ATOM   1966 C  CA  . LEU A 1 252 ? 3.952   -3.644  -18.002 1.00 20.72 ? 295 LEU A CA  1 
ATOM   1967 C  C   . LEU A 1 252 ? 5.033   -4.580  -18.524 1.00 20.23 ? 295 LEU A C   1 
ATOM   1968 O  O   . LEU A 1 252 ? 5.964   -4.145  -19.201 1.00 15.86 ? 295 LEU A O   1 
ATOM   1969 C  CB  . LEU A 1 252 ? 3.131   -3.177  -19.191 1.00 20.42 ? 295 LEU A CB  1 
ATOM   1970 C  CG  . LEU A 1 252 ? 1.717   -2.685  -18.987 1.00 24.63 ? 295 LEU A CG  1 
ATOM   1971 C  CD1 . LEU A 1 252 ? 1.691   -1.464  -18.054 1.00 25.01 ? 295 LEU A CD1 1 
ATOM   1972 C  CD2 . LEU A 1 252 ? 1.174   -2.351  -20.375 1.00 28.77 ? 295 LEU A CD2 1 
ATOM   1973 N  N   . SER A 1 253 ? 4.851   -5.883  -18.306 1.00 18.65 ? 296 SER A N   1 
ATOM   1974 C  CA  . SER A 1 253 ? 5.625   -6.869  -19.036 1.00 17.90 ? 296 SER A CA  1 
ATOM   1975 C  C   . SER A 1 253 ? 5.283   -6.762  -20.512 1.00 18.15 ? 296 SER A C   1 
ATOM   1976 O  O   . SER A 1 253 ? 4.115   -6.633  -20.881 1.00 16.53 ? 296 SER A O   1 
ATOM   1977 C  CB  . SER A 1 253 ? 5.303   -8.281  -18.523 1.00 15.01 ? 296 SER A CB  1 
ATOM   1978 O  OG  . SER A 1 253 ? 5.683   -9.263  -19.445 1.00 19.59 ? 296 SER A OG  1 
ATOM   1979 N  N   . CYS A 1 254 ? 6.296   -6.781  -21.359 1.00 17.76 ? 297 CYS A N   1 
ATOM   1980 C  CA  A CYS A 1 254 ? 6.021   -6.692  -22.789 0.50 18.67 ? 297 CYS A CA  1 
ATOM   1981 C  CA  B CYS A 1 254 ? 6.091   -6.694  -22.796 0.50 18.69 ? 297 CYS A CA  1 
ATOM   1982 C  C   . CYS A 1 254 ? 5.762   -8.056  -23.408 1.00 17.89 ? 297 CYS A C   1 
ATOM   1983 O  O   . CYS A 1 254 ? 4.981   -8.141  -24.361 1.00 19.88 ? 297 CYS A O   1 
ATOM   1984 C  CB  A CYS A 1 254 ? 7.162   -5.973  -23.535 0.50 21.54 ? 297 CYS A CB  1 
ATOM   1985 C  CB  B CYS A 1 254 ? 7.352   -6.087  -23.412 0.50 21.59 ? 297 CYS A CB  1 
ATOM   1986 S  SG  A CYS A 1 254 ? 8.484   -6.995  -24.190 0.50 21.11 ? 297 CYS A SG  1 
ATOM   1987 S  SG  B CYS A 1 254 ? 7.450   -6.158  -25.136 0.50 28.05 ? 297 CYS A SG  1 
ATOM   1988 N  N   . THR A 1 255 ? 6.338   -9.137  -22.857 1.00 20.45 ? 298 THR A N   1 
ATOM   1989 C  CA  . THR A 1 255 ? 6.150   -10.483 -23.397 1.00 19.09 ? 298 THR A CA  1 
ATOM   1990 C  C   . THR A 1 255 ? 5.017   -11.257 -22.726 1.00 20.28 ? 298 THR A C   1 
ATOM   1991 O  O   . THR A 1 255 ? 4.576   -12.267 -23.278 1.00 21.79 ? 298 THR A O   1 
ATOM   1992 C  CB  . THR A 1 255 ? 7.429   -11.328 -23.272 1.00 19.17 ? 298 THR A CB  1 
ATOM   1993 O  OG1 . THR A 1 255 ? 7.697   -11.596 -21.902 1.00 17.04 ? 298 THR A OG1 1 
ATOM   1994 C  CG2 . THR A 1 255 ? 8.620   -10.610 -23.896 1.00 20.50 ? 298 THR A CG2 1 
ATOM   1995 N  N   . ARG A 1 256 ? 4.580   -10.852 -21.544 1.00 20.41 ? 299 ARG A N   1 
ATOM   1996 C  CA  . ARG A 1 256 ? 3.409   -11.433 -20.888 1.00 21.34 ? 299 ARG A CA  1 
ATOM   1997 C  C   . ARG A 1 256 ? 2.377   -10.331 -20.674 1.00 22.74 ? 299 ARG A C   1 
ATOM   1998 O  O   . ARG A 1 256 ? 2.133   -9.868  -19.548 1.00 20.17 ? 299 ARG A O   1 
ATOM   1999 C  CB  . ARG A 1 256 ? 3.828   -12.123 -19.579 1.00 23.69 ? 299 ARG A CB  1 
ATOM   2000 C  CG  . ARG A 1 256 ? 4.621   -13.408 -19.852 1.00 30.73 ? 299 ARG A CG  1 
ATOM   2001 C  CD  . ARG A 1 256 ? 6.059   -13.372 -19.366 1.00 33.91 ? 299 ARG A CD  1 
ATOM   2002 N  NE  . ARG A 1 256 ? 6.259   -14.166 -18.161 1.00 38.53 ? 299 ARG A NE  1 
ATOM   2003 C  CZ  . ARG A 1 256 ? 7.422   -14.707 -17.792 1.00 41.82 ? 299 ARG A CZ  1 
ATOM   2004 N  NH1 . ARG A 1 256 ? 8.506   -14.557 -18.538 1.00 49.27 ? 299 ARG A NH1 1 
ATOM   2005 N  NH2 . ARG A 1 256 ? 7.499   -15.410 -16.669 1.00 44.63 ? 299 ARG A NH2 1 
ATOM   2006 N  N   . LEU A 1 257 ? 1.765   -9.898  -21.781 1.00 20.84 ? 300 LEU A N   1 
ATOM   2007 C  CA  . LEU A 1 257 ? 0.865   -8.748  -21.738 1.00 19.21 ? 300 LEU A CA  1 
ATOM   2008 C  C   . LEU A 1 257 ? -0.314  -8.995  -20.822 1.00 21.08 ? 300 LEU A C   1 
ATOM   2009 O  O   . LEU A 1 257 ? -0.972  -10.039 -20.885 1.00 19.95 ? 300 LEU A O   1 
ATOM   2010 C  CB  . LEU A 1 257 ? 0.348   -8.399  -23.131 1.00 30.70 ? 300 LEU A CB  1 
ATOM   2011 C  CG  . LEU A 1 257 ? 1.065   -7.310  -23.898 1.00 27.99 ? 300 LEU A CG  1 
ATOM   2012 C  CD1 . LEU A 1 257 ? 0.230   -6.991  -25.163 1.00 29.33 ? 300 LEU A CD1 1 
ATOM   2013 C  CD2 . LEU A 1 257 ? 1.339   -6.016  -23.091 1.00 18.91 ? 300 LEU A CD2 1 
ATOM   2014 N  N   . GLY A 1 258 ? -0.602  -7.998  -19.993 1.00 19.22 ? 301 GLY A N   1 
ATOM   2015 C  CA  . GLY A 1 258 ? -1.553  -8.127  -18.915 1.00 20.74 ? 301 GLY A CA  1 
ATOM   2016 C  C   . GLY A 1 258 ? -0.928  -8.442  -17.578 1.00 22.10 ? 301 GLY A C   1 
ATOM   2017 O  O   . GLY A 1 258 ? -1.654  -8.483  -16.580 1.00 22.49 ? 301 GLY A O   1 
ATOM   2018 N  N   . GLN A 1 259 ? 0.388   -8.688  -17.534 1.00 17.60 ? 302 GLN A N   1 
ATOM   2019 C  CA  . GLN A 1 259 ? 1.123   -8.928  -16.299 1.00 21.60 ? 302 GLN A CA  1 
ATOM   2020 C  C   . GLN A 1 259 ? 2.038   -7.739  -16.018 1.00 22.59 ? 302 GLN A C   1 
ATOM   2021 O  O   . GLN A 1 259 ? 2.504   -7.062  -16.943 1.00 14.16 ? 302 GLN A O   1 
ATOM   2022 C  CB  . GLN A 1 259 ? 1.995   -10.198 -16.367 1.00 20.67 ? 302 GLN A CB  1 
ATOM   2023 C  CG  . GLN A 1 259 ? 1.278   -11.514 -16.717 1.00 28.91 ? 302 GLN A CG  1 
ATOM   2024 C  CD  . GLN A 1 259 ? 0.479   -12.067 -15.560 1.00 38.90 ? 302 GLN A CD  1 
ATOM   2025 O  OE1 . GLN A 1 259 ? 0.722   -11.732 -14.394 1.00 34.89 ? 302 GLN A OE1 1 
ATOM   2026 N  NE2 . GLN A 1 259 ? -0.474  -12.933 -15.873 1.00 39.08 ? 302 GLN A NE2 1 
ATOM   2027 N  N   . TRP A 1 260 ? 2.282   -7.503  -14.734 1.00 18.47 ? 303 TRP A N   1 
ATOM   2028 C  CA  . TRP A 1 260 ? 3.194   -6.467  -14.261 1.00 18.62 ? 303 TRP A CA  1 
ATOM   2029 C  C   . TRP A 1 260 ? 4.587   -7.049  -14.112 1.00 18.87 ? 303 TRP A C   1 
ATOM   2030 O  O   . TRP A 1 260 ? 4.747   -8.246  -13.882 1.00 21.16 ? 303 TRP A O   1 
ATOM   2031 C  CB  . TRP A 1 260 ? 2.718   -5.929  -12.905 1.00 16.76 ? 303 TRP A CB  1 
ATOM   2032 C  CG  . TRP A 1 260 ? 1.505   -5.120  -12.980 1.00 15.69 ? 303 TRP A CG  1 
ATOM   2033 C  CD1 . TRP A 1 260 ? 0.235   -5.516  -12.715 1.00 19.40 ? 303 TRP A CD1 1 
ATOM   2034 C  CD2 . TRP A 1 260 ? 1.433   -3.747  -13.370 1.00 17.59 ? 303 TRP A CD2 1 
ATOM   2035 N  NE1 . TRP A 1 260 ? -0.636  -4.472  -12.916 1.00 18.35 ? 303 TRP A NE1 1 
ATOM   2036 C  CE2 . TRP A 1 260 ? 0.075   -3.368  -13.310 1.00 17.52 ? 303 TRP A CE2 1 
ATOM   2037 C  CE3 . TRP A 1 260 ? 2.390   -2.795  -13.763 1.00 19.25 ? 303 TRP A CE3 1 
ATOM   2038 C  CZ2 . TRP A 1 260 ? -0.352  -2.069  -13.610 1.00 21.78 ? 303 TRP A CZ2 1 
ATOM   2039 C  CZ3 . TRP A 1 260 ? 1.960   -1.504  -14.044 1.00 18.01 ? 303 TRP A CZ3 1 
ATOM   2040 C  CH2 . TRP A 1 260 ? 0.605   -1.162  -13.978 1.00 18.21 ? 303 TRP A CH2 1 
ATOM   2041 N  N   . ALA A 1 261 ? 5.602   -6.189  -14.240 1.00 14.11 ? 304 ALA A N   1 
ATOM   2042 C  CA  . ALA A 1 261 ? 6.997   -6.573  -13.993 1.00 17.34 ? 304 ALA A CA  1 
ATOM   2043 C  C   . ALA A 1 261 ? 7.585   -5.587  -12.992 1.00 19.09 ? 304 ALA A C   1 
ATOM   2044 O  O   . ALA A 1 261 ? 7.584   -4.381  -13.248 1.00 18.46 ? 304 ALA A O   1 
ATOM   2045 C  CB  . ALA A 1 261 ? 7.803   -6.598  -15.295 1.00 20.10 ? 304 ALA A CB  1 
ATOM   2046 N  N   . ILE A 1 262 ? 8.018   -6.082  -11.831 1.00 18.03 ? 305 ILE A N   1 
ATOM   2047 C  CA  . ILE A 1 262 ? 8.626   -5.246  -10.791 1.00 16.39 ? 305 ILE A CA  1 
ATOM   2048 C  C   . ILE A 1 262 ? 10.139  -5.454  -10.801 1.00 22.34 ? 305 ILE A C   1 
ATOM   2049 O  O   . ILE A 1 262 ? 10.614  -6.585  -10.664 1.00 19.48 ? 305 ILE A O   1 
ATOM   2050 C  CB  . ILE A 1 262 ? 8.047   -5.567  -9.405  1.00 16.40 ? 305 ILE A CB  1 
ATOM   2051 C  CG1 . ILE A 1 262 ? 6.535   -5.405  -9.408  1.00 19.34 ? 305 ILE A CG1 1 
ATOM   2052 C  CG2 . ILE A 1 262 ? 8.604   -4.620  -8.357  1.00 20.28 ? 305 ILE A CG2 1 
ATOM   2053 C  CD1 . ILE A 1 262 ? 5.875   -5.957  -8.168  1.00 23.23 ? 305 ILE A CD1 1 
ATOM   2054 N  N   . GLY A 1 263 ? 10.894  -4.372  -10.983 1.00 18.12 ? 306 GLY A N   1 
ATOM   2055 C  CA  . GLY A 1 263 ? 12.353  -4.399  -10.870 1.00 16.32 ? 306 GLY A CA  1 
ATOM   2056 C  C   . GLY A 1 263 ? 12.813  -3.784  -9.556  1.00 15.77 ? 306 GLY A C   1 
ATOM   2057 O  O   . GLY A 1 263 ? 12.286  -2.760  -9.127  1.00 17.50 ? 306 GLY A O   1 
ATOM   2058 N  N   . TYR A 1 264 ? 13.797  -4.423  -8.920  1.00 18.23 ? 307 TYR A N   1 
ATOM   2059 C  CA  . TYR A 1 264 ? 14.247  -3.932  -7.627  1.00 15.98 ? 307 TYR A CA  1 
ATOM   2060 C  C   . TYR A 1 264 ? 15.726  -4.222  -7.428  1.00 18.50 ? 307 TYR A C   1 
ATOM   2061 O  O   . TYR A 1 264 ? 16.304  -5.129  -8.042  1.00 19.64 ? 307 TYR A O   1 
ATOM   2062 C  CB  . TYR A 1 264 ? 13.417  -4.536  -6.490  1.00 18.90 ? 307 TYR A CB  1 
ATOM   2063 C  CG  . TYR A 1 264 ? 13.515  -6.048  -6.399  1.00 21.91 ? 307 TYR A CG  1 
ATOM   2064 C  CD1 . TYR A 1 264 ? 12.840  -6.871  -7.302  1.00 23.27 ? 307 TYR A CD1 1 
ATOM   2065 C  CD2 . TYR A 1 264 ? 14.290  -6.654  -5.421  1.00 26.39 ? 307 TYR A CD2 1 
ATOM   2066 C  CE1 . TYR A 1 264 ? 12.945  -8.240  -7.233  1.00 29.96 ? 307 TYR A CE1 1 
ATOM   2067 C  CE2 . TYR A 1 264 ? 14.390  -8.022  -5.347  1.00 26.17 ? 307 TYR A CE2 1 
ATOM   2068 C  CZ  . TYR A 1 264 ? 13.715  -8.808  -6.246  1.00 29.94 ? 307 TYR A CZ  1 
ATOM   2069 O  OH  . TYR A 1 264 ? 13.807  -10.174 -6.170  1.00 29.79 ? 307 TYR A OH  1 
ATOM   2070 N  N   . VAL A 1 265 ? 16.323  -3.395  -6.579  1.00 22.99 ? 308 VAL A N   1 
ATOM   2071 C  CA  . VAL A 1 265 ? 17.721  -3.524  -6.180  1.00 23.45 ? 308 VAL A CA  1 
ATOM   2072 C  C   . VAL A 1 265 ? 17.769  -4.382  -4.920  1.00 23.11 ? 308 VAL A C   1 
ATOM   2073 O  O   . VAL A 1 265 ? 17.202  -3.997  -3.892  1.00 23.66 ? 308 VAL A O   1 
ATOM   2074 C  CB  . VAL A 1 265 ? 18.349  -2.151  -5.909  1.00 21.52 ? 308 VAL A CB  1 
ATOM   2075 C  CG1 . VAL A 1 265 ? 19.834  -2.314  -5.493  1.00 24.08 ? 308 VAL A CG1 1 
ATOM   2076 C  CG2 . VAL A 1 265 ? 18.199  -1.240  -7.105  1.00 22.25 ? 308 VAL A CG2 1 
ATOM   2077 N  N   . THR A 1 266 ? 18.497  -5.499  -4.985  1.00 26.35 ? 309 THR A N   1 
ATOM   2078 C  CA  . THR A 1 266 ? 18.624  -6.404  -3.856  1.00 32.17 ? 309 THR A CA  1 
ATOM   2079 C  C   . THR A 1 266 ? 19.700  -5.920  -2.889  1.00 39.23 ? 309 THR A C   1 
ATOM   2080 O  O   . THR A 1 266 ? 20.497  -5.025  -3.187  1.00 33.19 ? 309 THR A O   1 
ATOM   2081 C  CB  . THR A 1 266 ? 18.982  -7.813  -4.326  1.00 36.25 ? 309 THR A CB  1 
ATOM   2082 O  OG1 . THR A 1 266 ? 20.319  -7.815  -4.835  1.00 33.93 ? 309 THR A OG1 1 
ATOM   2083 C  CG2 . THR A 1 266 ? 18.026  -8.297  -5.405  1.00 37.95 ? 309 THR A CG2 1 
ATOM   2084 N  N   . ALA A 1 267 ? 19.736  -6.566  -1.724  1.00 39.66 ? 310 ALA A N   1 
ATOM   2085 C  CA  . ALA A 1 267 ? 20.691  -6.191  -0.690  1.00 35.97 ? 310 ALA A CA  1 
ATOM   2086 C  C   . ALA A 1 267 ? 22.121  -6.418  -1.140  1.00 38.52 ? 310 ALA A C   1 
ATOM   2087 O  O   . ALA A 1 267 ? 23.013  -5.655  -0.758  1.00 47.15 ? 310 ALA A O   1 
ATOM   2088 C  CB  . ALA A 1 267 ? 20.405  -6.977  0.589   1.00 47.43 ? 310 ALA A CB  1 
ATOM   2089 N  N   . ASP A 1 268 ? 22.368  -7.446  -1.953  1.00 45.20 ? 311 ASP A N   1 
ATOM   2090 C  CA  . ASP A 1 268 ? 23.711  -7.688  -2.470  1.00 40.54 ? 311 ASP A CA  1 
ATOM   2091 C  C   . ASP A 1 268 ? 23.966  -6.956  -3.788  1.00 45.00 ? 311 ASP A C   1 
ATOM   2092 O  O   . ASP A 1 268 ? 24.833  -7.366  -4.570  1.00 43.00 ? 311 ASP A O   1 
ATOM   2093 C  CB  . ASP A 1 268 ? 23.989  -9.194  -2.593  1.00 39.02 ? 311 ASP A CB  1 
ATOM   2094 C  CG  . ASP A 1 268 ? 23.010  -9.932  -3.488  1.00 55.74 ? 311 ASP A CG  1 
ATOM   2095 O  OD1 . ASP A 1 268 ? 22.019  -9.336  -3.963  1.00 51.93 ? 311 ASP A OD1 1 
ATOM   2096 O  OD2 . ASP A 1 268 ? 23.236  -11.148 -3.699  1.00 54.44 ? 311 ASP A OD2 1 
ATOM   2097 N  N   . GLY A 1 269 ? 23.249  -5.863  -4.029  1.00 39.51 ? 312 GLY A N   1 
ATOM   2098 C  CA  . GLY A 1 269 ? 23.520  -4.970  -5.146  1.00 42.97 ? 312 GLY A CA  1 
ATOM   2099 C  C   . GLY A 1 269 ? 23.282  -5.561  -6.519  1.00 42.86 ? 312 GLY A C   1 
ATOM   2100 O  O   . GLY A 1 269 ? 24.019  -5.244  -7.459  1.00 46.82 ? 312 GLY A O   1 
ATOM   2101 N  N   . ASN A 1 270 ? 22.289  -6.430  -6.652  1.00 35.16 ? 313 ASN A N   1 
ATOM   2102 C  CA  . ASN A 1 270 ? 21.807  -6.907  -7.936  1.00 33.49 ? 313 ASN A CA  1 
ATOM   2103 C  C   . ASN A 1 270 ? 20.474  -6.241  -8.266  1.00 26.73 ? 313 ASN A C   1 
ATOM   2104 O  O   . ASN A 1 270 ? 19.773  -5.728  -7.387  1.00 26.87 ? 313 ASN A O   1 
ATOM   2105 C  CB  . ASN A 1 270 ? 21.636  -8.424  -7.923  1.00 31.28 ? 313 ASN A CB  1 
ATOM   2106 C  CG  . ASN A 1 270 ? 22.936  -9.144  -7.696  1.00 51.28 ? 313 ASN A CG  1 
ATOM   2107 O  OD1 . ASN A 1 270 ? 23.103  -9.859  -6.705  1.00 53.56 ? 313 ASN A OD1 1 
ATOM   2108 N  ND2 . ASN A 1 270 ? 23.879  -8.951  -8.612  1.00 48.50 ? 313 ASN A ND2 1 
ATOM   2109 N  N   . ILE A 1 271 ? 20.153  -6.227  -9.557  1.00 26.53 ? 314 ILE A N   1 
ATOM   2110 C  CA  . ILE A 1 271 ? 18.871  -5.744  -10.061 1.00 25.13 ? 314 ILE A CA  1 
ATOM   2111 C  C   . ILE A 1 271 ? 18.114  -6.934  -10.615 1.00 24.92 ? 314 ILE A C   1 
ATOM   2112 O  O   . ILE A 1 271 ? 18.526  -7.531  -11.619 1.00 29.48 ? 314 ILE A O   1 
ATOM   2113 C  CB  . ILE A 1 271 ? 19.051  -4.671  -11.145 1.00 22.54 ? 314 ILE A CB  1 
ATOM   2114 C  CG1 . ILE A 1 271 ? 19.635  -3.414  -10.527 1.00 23.34 ? 314 ILE A CG1 1 
ATOM   2115 C  CG2 . ILE A 1 271 ? 17.720  -4.311  -11.831 1.00 24.31 ? 314 ILE A CG2 1 
ATOM   2116 C  CD1 . ILE A 1 271 ? 20.307  -2.527  -11.571 1.00 26.19 ? 314 ILE A CD1 1 
ATOM   2117 N  N   . LEU A 1 272 ? 16.992  -7.245  -9.994  1.00 20.87 ? 315 LEU A N   1 
ATOM   2118 C  CA  . LEU A 1 272 ? 16.175  -8.374  -10.393 1.00 24.00 ? 315 LEU A CA  1 
ATOM   2119 C  C   . LEU A 1 272 ? 14.818  -7.864  -10.843 1.00 16.51 ? 315 LEU A C   1 
ATOM   2120 O  O   . LEU A 1 272 ? 14.383  -6.786  -10.430 1.00 20.49 ? 315 LEU A O   1 
ATOM   2121 C  CB  . LEU A 1 272 ? 16.005  -9.372  -9.241  1.00 23.40 ? 315 LEU A CB  1 
ATOM   2122 C  CG  . LEU A 1 272 ? 17.287  -10.042 -8.738  1.00 21.38 ? 315 LEU A CG  1 
ATOM   2123 C  CD1 . LEU A 1 272 ? 16.921  -10.981 -7.614  1.00 34.30 ? 315 LEU A CD1 1 
ATOM   2124 C  CD2 . LEU A 1 272 ? 18.014  -10.775 -9.854  1.00 22.65 ? 315 LEU A CD2 1 
ATOM   2125 N  N   . GLN A 1 273 ? 14.166  -8.638  -11.709 1.00 21.96 ? 316 GLN A N   1 
ATOM   2126 C  CA  . GLN A 1 273 ? 12.817  -8.329  -12.159 1.00 20.94 ? 316 GLN A CA  1 
ATOM   2127 C  C   . GLN A 1 273 ? 11.930  -9.552  -12.015 1.00 18.94 ? 316 GLN A C   1 
ATOM   2128 O  O   . GLN A 1 273 ? 12.323  -10.659 -12.393 1.00 22.23 ? 316 GLN A O   1 
ATOM   2129 C  CB  . GLN A 1 273 ? 12.834  -7.827  -13.602 1.00 23.73 ? 316 GLN A CB  1 
ATOM   2130 C  CG  . GLN A 1 273 ? 13.530  -6.473  -13.692 1.00 19.82 ? 316 GLN A CG  1 
ATOM   2131 C  CD  . GLN A 1 273 ? 13.533  -5.906  -15.091 1.00 19.13 ? 316 GLN A CD  1 
ATOM   2132 O  OE1 . GLN A 1 273 ? 12.479  -5.614  -15.664 1.00 19.03 ? 316 GLN A OE1 1 
ATOM   2133 N  NE2 . GLN A 1 273 ? 14.725  -5.767  -15.666 1.00 19.96 ? 316 GLN A NE2 1 
ATOM   2134 N  N   . THR A 1 274 ? 10.735  -9.338  -11.480 1.00 20.60 ? 317 THR A N   1 
ATOM   2135 C  CA  . THR A 1 274 ? 9.830   -10.418 -11.148 1.00 19.13 ? 317 THR A CA  1 
ATOM   2136 C  C   . THR A 1 274 ? 8.420   -10.058 -11.592 1.00 20.03 ? 317 THR A C   1 
ATOM   2137 O  O   . THR A 1 274 ? 8.008   -8.882  -11.582 1.00 18.17 ? 317 THR A O   1 
ATOM   2138 C  CB  . THR A 1 274 ? 9.854   -10.727 -9.623  1.00 25.39 ? 317 THR A CB  1 
ATOM   2139 O  OG1 . THR A 1 274 ? 8.941   -11.801 -9.318  1.00 27.61 ? 317 THR A OG1 1 
ATOM   2140 C  CG2 . THR A 1 274 ? 9.456   -9.538  -8.836  1.00 22.24 ? 317 THR A CG2 1 
ATOM   2141 N  N   . ILE A 1 275 ? 7.681   -11.094 -11.980 1.00 20.80 ? 318 ILE A N   1 
ATOM   2142 C  CA  . ILE A 1 275 ? 6.295   -10.970 -12.407 1.00 16.11 ? 318 ILE A CA  1 
ATOM   2143 C  C   . ILE A 1 275 ? 5.414   -11.551 -11.305 1.00 29.69 ? 318 ILE A C   1 
ATOM   2144 O  O   . ILE A 1 275 ? 5.452   -12.765 -11.064 1.00 30.13 ? 318 ILE A O   1 
ATOM   2145 C  CB  . ILE A 1 275 ? 6.053   -11.667 -13.751 1.00 20.44 ? 318 ILE A CB  1 
ATOM   2146 C  CG1 . ILE A 1 275 ? 6.858   -10.896 -14.820 1.00 22.88 ? 318 ILE A CG1 1 
ATOM   2147 C  CG2 . ILE A 1 275 ? 4.557   -11.710 -14.066 1.00 21.75 ? 318 ILE A CG2 1 
ATOM   2148 C  CD1 . ILE A 1 275 ? 6.714   -11.371 -16.191 1.00 33.38 ? 318 ILE A CD1 1 
ATOM   2149 N  N   . PRO A 1 276 ? 4.608   -10.727 -10.611 1.00 20.66 ? 319 PRO A N   1 
ATOM   2150 C  CA  . PRO A 1 276 ? 3.765   -11.230 -9.501  1.00 29.94 ? 319 PRO A CA  1 
ATOM   2151 C  C   . PRO A 1 276 ? 2.434   -11.784 -10.002 1.00 41.53 ? 319 PRO A C   1 
ATOM   2152 O  O   . PRO A 1 276 ? 1.356   -11.189 -9.832  1.00 46.50 ? 319 PRO A O   1 
ATOM   2153 C  CB  . PRO A 1 276 ? 3.592   -9.985  -8.634  1.00 29.64 ? 319 PRO A CB  1 
ATOM   2154 C  CG  . PRO A 1 276 ? 3.597   -8.855  -9.624  1.00 28.68 ? 319 PRO A CG  1 
ATOM   2155 C  CD  . PRO A 1 276 ? 4.511   -9.262  -10.749 1.00 20.89 ? 319 PRO A CD  1 
ATOM   2156 N  N   . HIS A 1 277 ? 2.496   -12.940 -10.652 1.00 38.84 ? 320 HIS A N   1 
ATOM   2157 C  CA  . HIS A 1 277 ? 1.268   -13.560 -11.124 1.00 39.75 ? 320 HIS A CA  1 
ATOM   2158 C  C   . HIS A 1 277 ? 0.474   -14.210 -9.991  1.00 52.10 ? 320 HIS A C   1 
ATOM   2159 O  O   . HIS A 1 277 ? -0.712  -14.505 -10.183 1.00 50.27 ? 320 HIS A O   1 
ATOM   2160 C  CB  . HIS A 1 277 ? 1.578   -14.585 -12.231 1.00 41.53 ? 320 HIS A CB  1 
ATOM   2161 C  CG  . HIS A 1 277 ? 2.722   -15.504 -11.922 1.00 39.48 ? 320 HIS A CG  1 
ATOM   2162 N  ND1 . HIS A 1 277 ? 3.769   -15.710 -12.799 1.00 43.77 ? 320 HIS A ND1 1 
ATOM   2163 C  CD2 . HIS A 1 277 ? 2.980   -16.278 -10.840 1.00 45.93 ? 320 HIS A CD2 1 
ATOM   2164 C  CE1 . HIS A 1 277 ? 4.629   -16.561 -12.263 1.00 48.05 ? 320 HIS A CE1 1 
ATOM   2165 N  NE2 . HIS A 1 277 ? 4.170   -16.928 -11.078 1.00 48.20 ? 320 HIS A NE2 1 
ATOM   2166 N  N   . ASN A 1 278 ? 1.079   -14.389 -8.807  1.00 49.36 ? 321 ASN A N   1 
ATOM   2167 C  CA  . ASN A 1 278 ? 0.397   -15.018 -7.681  1.00 39.44 ? 321 ASN A CA  1 
ATOM   2168 C  C   . ASN A 1 278 ? -0.627  -14.115 -6.989  1.00 47.42 ? 321 ASN A C   1 
ATOM   2169 O  O   . ASN A 1 278 ? -1.481  -14.635 -6.261  1.00 53.02 ? 321 ASN A O   1 
ATOM   2170 C  CB  . ASN A 1 278 ? 1.422   -15.485 -6.648  1.00 46.13 ? 321 ASN A CB  1 
ATOM   2171 N  N   . LYS A 1 279 ? -0.572  -12.797 -7.174  1.00 44.07 ? 322 LYS A N   1 
ATOM   2172 C  CA  . LYS A 1 279 ? -1.416  -11.892 -6.397  1.00 43.92 ? 322 LYS A CA  1 
ATOM   2173 C  C   . LYS A 1 279 ? -1.550  -10.579 -7.153  1.00 43.77 ? 322 LYS A C   1 
ATOM   2174 O  O   . LYS A 1 279 ? -0.823  -10.335 -8.123  1.00 43.05 ? 322 LYS A O   1 
ATOM   2175 C  CB  . LYS A 1 279 ? -0.832  -11.657 -4.994  1.00 40.96 ? 322 LYS A CB  1 
ATOM   2176 C  CG  . LYS A 1 279 ? 0.636   -11.278 -4.983  1.00 44.30 ? 322 LYS A CG  1 
ATOM   2177 C  CD  . LYS A 1 279 ? 1.119   -11.041 -3.566  1.00 37.77 ? 322 LYS A CD  1 
ATOM   2178 C  CE  . LYS A 1 279 ? 2.583   -11.331 -3.381  1.00 41.61 ? 322 LYS A CE  1 
ATOM   2179 N  NZ  . LYS A 1 279 ? 2.897   -11.533 -1.930  1.00 46.99 ? 322 LYS A NZ  1 
ATOM   2180 N  N   . PRO A 1 280 ? -2.473  -9.711  -6.741  1.00 35.27 ? 323 PRO A N   1 
ATOM   2181 C  CA  . PRO A 1 280 ? -2.627  -8.423  -7.434  1.00 40.66 ? 323 PRO A CA  1 
ATOM   2182 C  C   . PRO A 1 280 ? -1.475  -7.475  -7.120  1.00 32.58 ? 323 PRO A C   1 
ATOM   2183 O  O   . PRO A 1 280 ? -0.777  -7.617  -6.111  1.00 26.95 ? 323 PRO A O   1 
ATOM   2184 C  CB  . PRO A 1 280 ? -3.956  -7.870  -6.904  1.00 39.76 ? 323 PRO A CB  1 
ATOM   2185 C  CG  . PRO A 1 280 ? -4.533  -8.932  -6.009  1.00 38.60 ? 323 PRO A CG  1 
ATOM   2186 C  CD  . PRO A 1 280 ? -3.414  -9.848  -5.620  1.00 37.54 ? 323 PRO A CD  1 
ATOM   2187 N  N   . LEU A 1 281 ? -1.293  -6.486  -8.008  1.00 34.21 ? 324 LEU A N   1 
ATOM   2188 C  CA  . LEU A 1 281 ? -0.146  -5.583  -7.897  1.00 28.41 ? 324 LEU A CA  1 
ATOM   2189 C  C   . LEU A 1 281 ? -0.164  -4.825  -6.580  1.00 30.00 ? 324 LEU A C   1 
ATOM   2190 O  O   . LEU A 1 281 ? 0.858   -4.740  -5.896  1.00 27.04 ? 324 LEU A O   1 
ATOM   2191 C  CB  . LEU A 1 281 ? -0.120  -4.584  -9.056  1.00 24.29 ? 324 LEU A CB  1 
ATOM   2192 C  CG  . LEU A 1 281 ? 1.062   -3.604  -8.975  1.00 23.26 ? 324 LEU A CG  1 
ATOM   2193 C  CD1 . LEU A 1 281 ? 2.397   -4.350  -9.089  1.00 25.18 ? 324 LEU A CD1 1 
ATOM   2194 C  CD2 . LEU A 1 281 ? 0.965   -2.501  -10.020 1.00 21.60 ? 324 LEU A CD2 1 
ATOM   2195 N  N   . PHE A 1 282 ? -1.299  -4.194  -6.257  1.00 23.91 ? 325 PHE A N   1 
ATOM   2196 C  CA  . PHE A 1 282 ? -1.523  -3.613  -4.931  1.00 30.70 ? 325 PHE A CA  1 
ATOM   2197 C  C   . PHE A 1 282 ? -0.925  -4.472  -3.826  1.00 28.95 ? 325 PHE A C   1 
ATOM   2198 O  O   . PHE A 1 282 ? -0.189  -3.980  -2.961  1.00 27.56 ? 325 PHE A O   1 
ATOM   2199 C  CB  . PHE A 1 282 ? -3.023  -3.454  -4.672  1.00 36.58 ? 325 PHE A CB  1 
ATOM   2200 C  CG  . PHE A 1 282 ? -3.556  -2.076  -4.943  1.00 44.54 ? 325 PHE A CG  1 
ATOM   2201 C  CD1 . PHE A 1 282 ? -3.257  -1.024  -4.091  1.00 46.44 ? 325 PHE A CD1 1 
ATOM   2202 C  CD2 . PHE A 1 282 ? -4.392  -1.841  -6.023  1.00 49.22 ? 325 PHE A CD2 1 
ATOM   2203 C  CE1 . PHE A 1 282 ? -3.762  0.250   -4.326  1.00 52.06 ? 325 PHE A CE1 1 
ATOM   2204 C  CE2 . PHE A 1 282 ? -4.899  -0.572  -6.265  1.00 49.15 ? 325 PHE A CE2 1 
ATOM   2205 C  CZ  . PHE A 1 282 ? -4.581  0.476   -5.413  1.00 54.31 ? 325 PHE A CZ  1 
ATOM   2206 N  N   . GLN A 1 283 ? -1.253  -5.768  -3.827  1.00 28.06 ? 326 GLN A N   1 
ATOM   2207 C  CA  . GLN A 1 283 ? -0.815  -6.630  -2.741  1.00 29.07 ? 326 GLN A CA  1 
ATOM   2208 C  C   . GLN A 1 283 ? 0.669   -6.930  -2.846  1.00 24.52 ? 326 GLN A C   1 
ATOM   2209 O  O   . GLN A 1 283 ? 1.361   -7.024  -1.828  1.00 28.53 ? 326 GLN A O   1 
ATOM   2210 C  CB  . GLN A 1 283 ? -1.621  -7.930  -2.726  1.00 32.45 ? 326 GLN A CB  1 
ATOM   2211 C  CG  . GLN A 1 283 ? -1.534  -8.679  -1.402  1.00 39.40 ? 326 GLN A CG  1 
ATOM   2212 C  CD  . GLN A 1 283 ? -2.177  -7.906  -0.255  1.00 44.20 ? 326 GLN A CD  1 
ATOM   2213 O  OE1 . GLN A 1 283 ? -3.286  -7.386  -0.390  1.00 41.91 ? 326 GLN A OE1 1 
ATOM   2214 N  NE2 . GLN A 1 283 ? -1.471  -7.805  0.869   1.00 43.03 ? 326 GLN A NE2 1 
ATOM   2215 N  N   . ALA A 1 284 ? 1.175   -7.105  -4.070  1.00 28.22 ? 327 ALA A N   1 
ATOM   2216 C  CA  . ALA A 1 284 ? 2.604   -7.345  -4.242  1.00 22.42 ? 327 ALA A CA  1 
ATOM   2217 C  C   . ALA A 1 284 ? 3.413   -6.183  -3.702  1.00 24.48 ? 327 ALA A C   1 
ATOM   2218 O  O   . ALA A 1 284 ? 4.467   -6.378  -3.079  1.00 23.12 ? 327 ALA A O   1 
ATOM   2219 C  CB  . ALA A 1 284 ? 2.933   -7.549  -5.719  1.00 21.96 ? 327 ALA A CB  1 
ATOM   2220 N  N   . LEU A 1 285 ? 2.942   -4.964  -3.960  1.00 24.11 ? 328 LEU A N   1 
ATOM   2221 C  CA  . LEU A 1 285 ? 3.666   -3.783  -3.522  1.00 24.54 ? 328 LEU A CA  1 
ATOM   2222 C  C   . LEU A 1 285 ? 3.559   -3.614  -2.015  1.00 25.22 ? 328 LEU A C   1 
ATOM   2223 O  O   . LEU A 1 285 ? 4.540   -3.256  -1.353  1.00 20.61 ? 328 LEU A O   1 
ATOM   2224 C  CB  . LEU A 1 285 ? 3.120   -2.562  -4.251  1.00 19.40 ? 328 LEU A CB  1 
ATOM   2225 C  CG  . LEU A 1 285 ? 3.398   -2.534  -5.761  1.00 17.94 ? 328 LEU A CG  1 
ATOM   2226 C  CD1 . LEU A 1 285 ? 2.652   -1.376  -6.372  1.00 25.03 ? 328 LEU A CD1 1 
ATOM   2227 C  CD2 . LEU A 1 285 ? 4.881   -2.417  -5.996  1.00 23.26 ? 328 LEU A CD2 1 
ATOM   2228 N  N   . ILE A 1 286 ? 2.377   -3.883  -1.460  1.00 21.85 ? 329 ILE A N   1 
ATOM   2229 C  CA  . ILE A 1 286 ? 2.196   -3.809  -0.008  1.00 21.50 ? 329 ILE A CA  1 
ATOM   2230 C  C   . ILE A 1 286 ? 3.087   -4.838  0.678   1.00 25.18 ? 329 ILE A C   1 
ATOM   2231 O  O   . ILE A 1 286 ? 3.908   -4.500  1.539   1.00 27.07 ? 329 ILE A O   1 
ATOM   2232 C  CB  . ILE A 1 286 ? 0.707   -3.989  0.346   1.00 27.98 ? 329 ILE A CB  1 
ATOM   2233 C  CG1 . ILE A 1 286 ? -0.041  -2.685  0.059   1.00 28.27 ? 329 ILE A CG1 1 
ATOM   2234 C  CG2 . ILE A 1 286 ? 0.484   -4.401  1.818   1.00 27.18 ? 329 ILE A CG2 1 
ATOM   2235 C  CD1 . ILE A 1 286 ? -1.553  -2.889  -0.156  1.00 31.62 ? 329 ILE A CD1 1 
ATOM   2236 N  N   . ASP A 1 287 ? 2.970   -6.100  0.266   1.00 25.91 ? 330 ASP A N   1 
ATOM   2237 C  CA  . ASP A 1 287 ? 3.802   -7.152  0.833   1.00 29.01 ? 330 ASP A CA  1 
ATOM   2238 C  C   . ASP A 1 287 ? 5.286   -6.857  0.666   1.00 36.62 ? 330 ASP A C   1 
ATOM   2239 O  O   . ASP A 1 287 ? 6.076   -7.076  1.589   1.00 29.15 ? 330 ASP A O   1 
ATOM   2240 C  CB  . ASP A 1 287 ? 3.466   -8.492  0.189   1.00 24.60 ? 330 ASP A CB  1 
ATOM   2241 C  CG  . ASP A 1 287 ? 2.019   -8.931  0.428   1.00 37.49 ? 330 ASP A CG  1 
ATOM   2242 O  OD1 . ASP A 1 287 ? 1.300   -8.291  1.233   1.00 35.90 ? 330 ASP A OD1 1 
ATOM   2243 O  OD2 . ASP A 1 287 ? 1.598   -9.927  -0.202  1.00 35.09 ? 330 ASP A OD2 1 
ATOM   2244 N  N   . GLY A 1 288 ? 5.701   -6.387  -0.512  1.00 26.54 ? 331 GLY A N   1 
ATOM   2245 C  CA  . GLY A 1 288 ? 7.116   -6.148  -0.725  1.00 25.97 ? 331 GLY A CA  1 
ATOM   2246 C  C   . GLY A 1 288 ? 7.658   -5.035  0.140   1.00 22.98 ? 331 GLY A C   1 
ATOM   2247 O  O   . GLY A 1 288 ? 8.833   -5.045  0.511   1.00 31.59 ? 331 GLY A O   1 
ATOM   2248 N  N   . PHE A 1 289 ? 6.827   -4.059  0.458   1.00 21.30 ? 332 PHE A N   1 
ATOM   2249 C  CA  . PHE A 1 289 ? 7.273   -3.013  1.357   1.00 26.88 ? 332 PHE A CA  1 
ATOM   2250 C  C   . PHE A 1 289 ? 7.405   -3.555  2.771   1.00 30.71 ? 332 PHE A C   1 
ATOM   2251 O  O   . PHE A 1 289 ? 8.378   -3.267  3.467   1.00 29.37 ? 332 PHE A O   1 
ATOM   2252 C  CB  . PHE A 1 289 ? 6.305   -1.855  1.346   1.00 26.35 ? 332 PHE A CB  1 
ATOM   2253 C  CG  . PHE A 1 289 ? 6.684   -0.786  2.305   1.00 29.77 ? 332 PHE A CG  1 
ATOM   2254 C  CD1 . PHE A 1 289 ? 7.643   0.145   1.962   1.00 25.88 ? 332 PHE A CD1 1 
ATOM   2255 C  CD2 . PHE A 1 289 ? 6.126   -0.740  3.570   1.00 32.87 ? 332 PHE A CD2 1 
ATOM   2256 C  CE1 . PHE A 1 289 ? 8.019   1.124   2.854   1.00 33.20 ? 332 PHE A CE1 1 
ATOM   2257 C  CE2 . PHE A 1 289 ? 6.498   0.235   4.455   1.00 34.63 ? 332 PHE A CE2 1 
ATOM   2258 C  CZ  . PHE A 1 289 ? 7.448   1.168   4.098   1.00 36.75 ? 332 PHE A CZ  1 
ATOM   2259 N  N   . ARG A 1 290 ? 6.436   -4.352  3.196   1.00 31.07 ? 333 ARG A N   1 
ATOM   2260 C  CA  . ARG A 1 290 ? 6.444   -4.855  4.565   1.00 33.04 ? 333 ARG A CA  1 
ATOM   2261 C  C   . ARG A 1 290 ? 7.600   -5.805  4.791   1.00 35.38 ? 333 ARG A C   1 
ATOM   2262 O  O   . ARG A 1 290 ? 8.146   -5.860  5.900   1.00 34.27 ? 333 ARG A O   1 
ATOM   2263 C  CB  . ARG A 1 290 ? 5.122   -5.538  4.859   1.00 30.20 ? 333 ARG A CB  1 
ATOM   2264 C  CG  . ARG A 1 290 ? 3.952   -4.601  4.866   1.00 30.84 ? 333 ARG A CG  1 
ATOM   2265 C  CD  . ARG A 1 290 ? 2.670   -5.358  4.955   1.00 27.66 ? 333 ARG A CD  1 
ATOM   2266 N  NE  . ARG A 1 290 ? 1.557   -4.491  5.300   1.00 33.41 ? 333 ARG A NE  1 
ATOM   2267 C  CZ  . ARG A 1 290 ? 0.287   -4.839  5.171   1.00 31.39 ? 333 ARG A CZ  1 
ATOM   2268 N  NH1 . ARG A 1 290 ? -0.040  -6.030  4.682   1.00 35.82 ? 333 ARG A NH1 1 
ATOM   2269 N  NH2 . ARG A 1 290 ? -0.654  -3.982  5.501   1.00 32.85 ? 333 ARG A NH2 1 
ATOM   2270 N  N   . GLU A 1 291 ? 8.001   -6.530  3.746   1.00 36.56 ? 334 GLU A N   1 
ATOM   2271 C  CA  . GLU A 1 291 ? 9.093   -7.489  3.801   1.00 32.15 ? 334 GLU A CA  1 
ATOM   2272 C  C   . GLU A 1 291 ? 10.441  -6.866  3.492   1.00 34.41 ? 334 GLU A C   1 
ATOM   2273 O  O   . GLU A 1 291 ? 11.451  -7.572  3.535   1.00 31.42 ? 334 GLU A O   1 
ATOM   2274 C  CB  . GLU A 1 291 ? 8.832   -8.646  2.835   1.00 32.37 ? 334 GLU A CB  1 
ATOM   2275 C  CG  . GLU A 1 291 ? 7.593   -9.428  3.190   1.00 46.05 ? 334 GLU A CG  1 
ATOM   2276 C  CD  . GLU A 1 291 ? 7.319   -10.555 2.220   1.00 61.45 ? 334 GLU A CD  1 
ATOM   2277 O  OE1 . GLU A 1 291 ? 6.192   -10.610 1.683   1.00 64.40 ? 334 GLU A OE1 1 
ATOM   2278 O  OE2 . GLU A 1 291 ? 8.224   -11.394 2.007   1.00 69.55 ? 334 GLU A OE2 1 
ATOM   2279 N  N   . GLY A 1 292 ? 10.482  -5.570  3.195   1.00 29.25 ? 335 GLY A N   1 
ATOM   2280 C  CA  . GLY A 1 292 ? 11.731  -4.855  3.062   1.00 29.47 ? 335 GLY A CA  1 
ATOM   2281 C  C   . GLY A 1 292 ? 12.330  -4.830  1.673   1.00 31.37 ? 335 GLY A C   1 
ATOM   2282 O  O   . GLY A 1 292 ? 13.494  -4.439  1.531   1.00 28.61 ? 335 GLY A O   1 
ATOM   2283 N  N   . PHE A 1 293 ? 11.586  -5.234  0.647   1.00 25.76 ? 336 PHE A N   1 
ATOM   2284 C  CA  . PHE A 1 293 ? 12.121  -5.323  -0.707  1.00 22.88 ? 336 PHE A CA  1 
ATOM   2285 C  C   . PHE A 1 293 ? 11.751  -4.142  -1.595  1.00 26.35 ? 336 PHE A C   1 
ATOM   2286 O  O   . PHE A 1 293 ? 12.540  -3.771  -2.469  1.00 24.04 ? 336 PHE A O   1 
ATOM   2287 C  CB  . PHE A 1 293 ? 11.641  -6.603  -1.381  1.00 24.76 ? 336 PHE A CB  1 
ATOM   2288 C  CG  . PHE A 1 293 ? 12.047  -7.849  -0.652  1.00 31.62 ? 336 PHE A CG  1 
ATOM   2289 C  CD1 . PHE A 1 293 ? 13.392  -8.128  -0.437  1.00 39.08 ? 336 PHE A CD1 1 
ATOM   2290 C  CD2 . PHE A 1 293 ? 11.094  -8.741  -0.182  1.00 36.26 ? 336 PHE A CD2 1 
ATOM   2291 C  CE1 . PHE A 1 293 ? 13.776  -9.282  0.241   1.00 38.15 ? 336 PHE A CE1 1 
ATOM   2292 C  CE2 . PHE A 1 293 ? 11.473  -9.892  0.484   1.00 37.41 ? 336 PHE A CE2 1 
ATOM   2293 C  CZ  . PHE A 1 293 ? 12.814  -10.159 0.696   1.00 35.98 ? 336 PHE A CZ  1 
ATOM   2294 N  N   . TYR A 1 294 ? 10.552  -3.589  -1.436  1.00 22.55 ? 337 TYR A N   1 
ATOM   2295 C  CA  . TYR A 1 294 ? 10.053  -2.507  -2.291  1.00 23.20 ? 337 TYR A CA  1 
ATOM   2296 C  C   . TYR A 1 294 ? 9.842   -1.277  -1.415  1.00 18.69 ? 337 TYR A C   1 
ATOM   2297 O  O   . TYR A 1 294 ? 8.723   -0.990  -0.969  1.00 24.21 ? 337 TYR A O   1 
ATOM   2298 C  CB  . TYR A 1 294 ? 8.754   -2.927  -3.017  1.00 19.93 ? 337 TYR A CB  1 
ATOM   2299 C  CG  . TYR A 1 294 ? 8.794   -4.219  -3.803  1.00 18.20 ? 337 TYR A CG  1 
ATOM   2300 C  CD1 . TYR A 1 294 ? 9.966   -4.702  -4.363  1.00 19.55 ? 337 TYR A CD1 1 
ATOM   2301 C  CD2 . TYR A 1 294 ? 7.624   -4.939  -4.016  1.00 23.65 ? 337 TYR A CD2 1 
ATOM   2302 C  CE1 . TYR A 1 294 ? 9.982   -5.884  -5.081  1.00 24.61 ? 337 TYR A CE1 1 
ATOM   2303 C  CE2 . TYR A 1 294 ? 7.627   -6.118  -4.731  1.00 20.19 ? 337 TYR A CE2 1 
ATOM   2304 C  CZ  . TYR A 1 294 ? 8.803   -6.581  -5.265  1.00 26.12 ? 337 TYR A CZ  1 
ATOM   2305 O  OH  . TYR A 1 294 ? 8.801   -7.748  -5.967  1.00 26.80 ? 337 TYR A OH  1 
ATOM   2306 N  N   . LEU A 1 295 ? 10.927  -0.533  -1.187  1.00 20.84 ? 338 LEU A N   1 
ATOM   2307 C  CA  . LEU A 1 295 ? 10.971  0.583   -0.246  1.00 18.75 ? 338 LEU A CA  1 
ATOM   2308 C  C   . LEU A 1 295 ? 11.021  1.960   -0.888  1.00 21.39 ? 338 LEU A C   1 
ATOM   2309 O  O   . LEU A 1 295 ? 10.392  2.890   -0.370  1.00 20.93 ? 338 LEU A O   1 
ATOM   2310 C  CB  . LEU A 1 295 ? 12.200  0.448   0.660   1.00 24.92 ? 338 LEU A CB  1 
ATOM   2311 C  CG  . LEU A 1 295 ? 12.387  -0.884  1.370   1.00 26.79 ? 338 LEU A CG  1 
ATOM   2312 C  CD1 . LEU A 1 295 ? 13.614  -0.800  2.264   1.00 26.32 ? 338 LEU A CD1 1 
ATOM   2313 C  CD2 . LEU A 1 295 ? 11.141  -1.190  2.180   1.00 32.24 ? 338 LEU A CD2 1 
ATOM   2314 N  N   . PHE A 1 296 ? 11.769  2.119   -1.987  1.00 21.42 ? 339 PHE A N   1 
ATOM   2315 C  CA  . PHE A 1 296 ? 12.120  3.428   -2.532  1.00 21.35 ? 339 PHE A CA  1 
ATOM   2316 C  C   . PHE A 1 296 ? 11.707  3.502   -3.998  1.00 18.89 ? 339 PHE A C   1 
ATOM   2317 O  O   . PHE A 1 296 ? 12.472  3.113   -4.891  1.00 20.38 ? 339 PHE A O   1 
ATOM   2318 C  CB  . PHE A 1 296 ? 13.616  3.684   -2.355  1.00 16.00 ? 339 PHE A CB  1 
ATOM   2319 C  CG  . PHE A 1 296 ? 14.090  3.454   -0.955  1.00 19.97 ? 339 PHE A CG  1 
ATOM   2320 C  CD1 . PHE A 1 296 ? 13.591  4.224   0.081   1.00 26.43 ? 339 PHE A CD1 1 
ATOM   2321 C  CD2 . PHE A 1 296 ? 15.009  2.456   -0.658  1.00 27.30 ? 339 PHE A CD2 1 
ATOM   2322 C  CE1 . PHE A 1 296 ? 14.002  4.008   1.394   1.00 29.44 ? 339 PHE A CE1 1 
ATOM   2323 C  CE2 . PHE A 1 296 ? 15.435  2.249   0.654   1.00 33.32 ? 339 PHE A CE2 1 
ATOM   2324 C  CZ  . PHE A 1 296 ? 14.924  3.021   1.678   1.00 30.13 ? 339 PHE A CZ  1 
ATOM   2325 N  N   . PRO A 1 297 ? 10.504  4.000   -4.287  1.00 18.86 ? 340 PRO A N   1 
ATOM   2326 C  CA  . PRO A 1 297 ? 10.014  3.936   -5.668  1.00 18.67 ? 340 PRO A CA  1 
ATOM   2327 C  C   . PRO A 1 297 ? 10.803  4.896   -6.537  1.00 20.62 ? 340 PRO A C   1 
ATOM   2328 O  O   . PRO A 1 297 ? 10.862  6.094   -6.258  1.00 18.57 ? 340 PRO A O   1 
ATOM   2329 C  CB  . PRO A 1 297 ? 8.554   4.357   -5.545  1.00 18.09 ? 340 PRO A CB  1 
ATOM   2330 C  CG  . PRO A 1 297 ? 8.553   5.270   -4.366  1.00 17.97 ? 340 PRO A CG  1 
ATOM   2331 C  CD  . PRO A 1 297 ? 9.574   4.742   -3.430  1.00 20.16 ? 340 PRO A CD  1 
ATOM   2332 N  N   . ASP A 1 298 ? 11.402  4.363   -7.593  1.00 19.78 ? 341 ASP A N   1 
ATOM   2333 C  CA  . ASP A 1 298 ? 12.277  5.148   -8.444  1.00 20.46 ? 341 ASP A CA  1 
ATOM   2334 C  C   . ASP A 1 298 ? 13.350  5.824   -7.588  1.00 22.19 ? 341 ASP A C   1 
ATOM   2335 O  O   . ASP A 1 298 ? 13.790  6.935   -7.872  1.00 22.20 ? 341 ASP A O   1 
ATOM   2336 C  CB  . ASP A 1 298 ? 11.461  6.171   -9.251  1.00 20.83 ? 341 ASP A CB  1 
ATOM   2337 C  CG  . ASP A 1 298 ? 12.211  6.692   -10.498 1.00 25.58 ? 341 ASP A CG  1 
ATOM   2338 O  OD1 . ASP A 1 298 ? 13.190  6.056   -10.940 1.00 21.39 ? 341 ASP A OD1 1 
ATOM   2339 O  OD2 . ASP A 1 298 ? 11.789  7.735   -11.033 1.00 24.99 ? 341 ASP A OD2 1 
ATOM   2340 N  N   . GLY A 1 299 ? 13.733  5.166   -6.490  1.00 20.59 ? 342 GLY A N   1 
ATOM   2341 C  CA  . GLY A 1 299 ? 14.808  5.633   -5.631  1.00 22.74 ? 342 GLY A CA  1 
ATOM   2342 C  C   . GLY A 1 299 ? 14.426  6.697   -4.626  1.00 23.70 ? 342 GLY A C   1 
ATOM   2343 O  O   . GLY A 1 299 ? 15.290  7.114   -3.835  1.00 24.64 ? 342 GLY A O   1 
ATOM   2344 N  N   . ARG A 1 300 ? 13.178  7.148   -4.633  1.00 20.54 ? 343 ARG A N   1 
ATOM   2345 C  CA  . ARG A 1 300 ? 12.711  8.155   -3.691  1.00 22.97 ? 343 ARG A CA  1 
ATOM   2346 C  C   . ARG A 1 300 ? 12.568  7.600   -2.279  1.00 24.56 ? 343 ARG A C   1 
ATOM   2347 O  O   . ARG A 1 300 ? 12.221  6.438   -2.072  1.00 22.04 ? 343 ARG A O   1 
ATOM   2348 C  CB  . ARG A 1 300 ? 11.373  8.699   -4.137  1.00 22.46 ? 343 ARG A CB  1 
ATOM   2349 C  CG  . ARG A 1 300 ? 11.395  9.384   -5.454  1.00 24.49 ? 343 ARG A CG  1 
ATOM   2350 C  CD  . ARG A 1 300 ? 10.006  9.624   -5.899  1.00 30.19 ? 343 ARG A CD  1 
ATOM   2351 N  NE  . ARG A 1 300 ? 9.991   10.366  -7.152  1.00 39.63 ? 343 ARG A NE  1 
ATOM   2352 C  CZ  . ARG A 1 300 ? 9.494   11.587  -7.307  1.00 45.58 ? 343 ARG A CZ  1 
ATOM   2353 N  NH1 . ARG A 1 300 ? 9.534   12.153  -8.500  1.00 29.93 ? 343 ARG A NH1 1 
ATOM   2354 N  NH2 . ARG A 1 300 ? 8.953   12.242  -6.287  1.00 45.45 ? 343 ARG A NH2 1 
ATOM   2355 N  N   . ASN A 1 301 ? 12.778  8.474   -1.292  1.00 29.08 ? 344 ASN A N   1 
ATOM   2356 C  CA  . ASN A 1 301 ? 12.720  8.044   0.104   1.00 24.75 ? 344 ASN A CA  1 
ATOM   2357 C  C   . ASN A 1 301 ? 11.297  7.797   0.595   1.00 25.32 ? 344 ASN A C   1 
ATOM   2358 O  O   . ASN A 1 301 ? 11.088  6.909   1.434   1.00 31.41 ? 344 ASN A O   1 
ATOM   2359 C  CB  . ASN A 1 301 ? 13.405  9.082   0.991   1.00 28.61 ? 344 ASN A CB  1 
ATOM   2360 C  CG  . ASN A 1 301 ? 14.907  9.138   0.781   1.00 37.48 ? 344 ASN A CG  1 
ATOM   2361 O  OD1 . ASN A 1 301 ? 15.567  8.110   0.591   1.00 41.40 ? 344 ASN A OD1 1 
ATOM   2362 N  ND2 . ASN A 1 301 ? 15.457  10.344  0.817   1.00 46.16 ? 344 ASN A ND2 1 
ATOM   2363 N  N   . GLN A 1 302 ? 10.312  8.537   0.099   1.00 23.07 ? 345 GLN A N   1 
ATOM   2364 C  CA  . GLN A 1 302 ? 8.927   8.350   0.519   1.00 27.93 ? 345 GLN A CA  1 
ATOM   2365 C  C   . GLN A 1 302 ? 8.243   7.356   -0.413  1.00 29.76 ? 345 GLN A C   1 
ATOM   2366 O  O   . GLN A 1 302 ? 8.353   7.469   -1.632  1.00 27.80 ? 345 GLN A O   1 
ATOM   2367 C  CB  . GLN A 1 302 ? 8.172   9.681   0.523   1.00 34.19 ? 345 GLN A CB  1 
ATOM   2368 N  N   . ASN A 1 303 ? 7.534   6.393   0.161   1.00 28.34 ? 346 ASN A N   1 
ATOM   2369 C  CA  . ASN A 1 303 ? 6.809   5.360   -0.585  1.00 21.43 ? 346 ASN A CA  1 
ATOM   2370 C  C   . ASN A 1 303 ? 5.294   5.549   -0.400  1.00 30.25 ? 346 ASN A C   1 
ATOM   2371 O  O   . ASN A 1 303 ? 4.850   5.822   0.721   1.00 30.20 ? 346 ASN A O   1 
ATOM   2372 C  CB  . ASN A 1 303 ? 7.232   3.972   -0.085  1.00 27.10 ? 346 ASN A CB  1 
ATOM   2373 C  CG  . ASN A 1 303 ? 6.730   2.831   -0.969  1.00 26.68 ? 346 ASN A CG  1 
ATOM   2374 O  OD1 . ASN A 1 303 ? 7.025   2.776   -2.163  1.00 26.33 ? 346 ASN A OD1 1 
ATOM   2375 N  ND2 . ASN A 1 303 ? 6.026   1.880   -0.363  1.00 25.79 ? 346 ASN A ND2 1 
ATOM   2376 N  N   . PRO A 1 304 ? 4.484   5.461   -1.466  1.00 24.83 ? 347 PRO A N   1 
ATOM   2377 C  CA  . PRO A 1 304 ? 3.026   5.618   -1.306  1.00 28.93 ? 347 PRO A CA  1 
ATOM   2378 C  C   . PRO A 1 304 ? 2.446   4.592   -0.344  1.00 26.80 ? 347 PRO A C   1 
ATOM   2379 O  O   . PRO A 1 304 ? 2.937   3.469   -0.235  1.00 28.38 ? 347 PRO A O   1 
ATOM   2380 C  CB  . PRO A 1 304 ? 2.480   5.391   -2.724  1.00 29.27 ? 347 PRO A CB  1 
ATOM   2381 C  CG  . PRO A 1 304 ? 3.615   5.560   -3.612  1.00 24.03 ? 347 PRO A CG  1 
ATOM   2382 C  CD  . PRO A 1 304 ? 4.853   5.208   -2.871  1.00 27.25 ? 347 PRO A CD  1 
ATOM   2383 N  N   . ASP A 1 305 ? 1.374   4.993   0.343   1.00 34.00 ? 348 ASP A N   1 
ATOM   2384 C  CA  . ASP A 1 305 ? 0.628   4.112   1.242   1.00 38.77 ? 348 ASP A CA  1 
ATOM   2385 C  C   . ASP A 1 305 ? -0.599  3.607   0.493   1.00 33.47 ? 348 ASP A C   1 
ATOM   2386 O  O   . ASP A 1 305 ? -1.611  4.306   0.398   1.00 42.55 ? 348 ASP A O   1 
ATOM   2387 C  CB  . ASP A 1 305 ? 0.222   4.840   2.515   1.00 43.02 ? 348 ASP A CB  1 
ATOM   2388 C  CG  . ASP A 1 305 ? -0.352  3.896   3.570   1.00 59.38 ? 348 ASP A CG  1 
ATOM   2389 O  OD1 . ASP A 1 305 ? -0.741  2.750   3.222   1.00 51.52 ? 348 ASP A OD1 1 
ATOM   2390 O  OD2 . ASP A 1 305 ? -0.412  4.308   4.750   1.00 59.59 ? 348 ASP A OD2 1 
ATOM   2391 N  N   . LEU A 1 306 ? -0.513  2.383   -0.025  1.00 27.59 ? 349 LEU A N   1 
ATOM   2392 C  CA  . LEU A 1 306 ? -1.597  1.781   -0.784  1.00 39.66 ? 349 LEU A CA  1 
ATOM   2393 C  C   . LEU A 1 306 ? -2.634  1.116   0.111   1.00 45.35 ? 349 LEU A C   1 
ATOM   2394 O  O   . LEU A 1 306 ? -3.477  0.366   -0.393  1.00 48.24 ? 349 LEU A O   1 
ATOM   2395 C  CB  . LEU A 1 306 ? -1.034  0.761   -1.779  1.00 39.11 ? 349 LEU A CB  1 
ATOM   2396 C  CG  . LEU A 1 306 ? -0.085  1.342   -2.833  1.00 35.19 ? 349 LEU A CG  1 
ATOM   2397 C  CD1 . LEU A 1 306 ? 0.454   0.244   -3.739  1.00 29.09 ? 349 LEU A CD1 1 
ATOM   2398 C  CD2 . LEU A 1 306 ? -0.789  2.410   -3.643  1.00 38.58 ? 349 LEU A CD2 1 
ATOM   2399 N  N   . THR A 1 307 ? -2.583  1.384   1.414   1.00 52.09 ? 350 THR A N   1 
ATOM   2400 C  CA  . THR A 1 307 ? -3.613  0.950   2.351   1.00 58.15 ? 350 THR A CA  1 
ATOM   2401 C  C   . THR A 1 307 ? -4.658  2.045   2.546   1.00 53.11 ? 350 THR A C   1 
ATOM   2402 O  O   . THR A 1 307 ? -5.646  2.109   1.814   1.00 56.15 ? 350 THR A O   1 
ATOM   2403 C  CB  . THR A 1 307 ? -3.006  0.580   3.710   1.00 40.92 ? 350 THR A CB  1 
ATOM   2404 O  OG1 . THR A 1 307 ? -1.962  -0.382  3.515   1.00 48.54 ? 350 THR A OG1 1 
ATOM   2405 C  CG2 . THR A 1 307 ? -4.072  -0.021  4.619   1.00 66.32 ? 350 THR A CG2 1 
HETATM 2406 C  C   . ACE B 2 1   ? 36.424  -11.360 -41.598 1.00 28.20 ? 35  ACE B C   1 
HETATM 2407 O  O   . ACE B 2 1   ? 36.632  -12.573 -41.601 1.00 24.86 ? 35  ACE B O   1 
HETATM 2408 C  CH3 . ACE B 2 1   ? 37.550  -10.358 -41.610 1.00 32.51 ? 35  ACE B CH3 1 
ATOM   2409 N  N   . GLN B 2 2   ? 35.188  -10.863 -41.585 1.00 30.72 ? 36  GLN B N   1 
ATOM   2410 C  CA  . GLN B 2 2   ? 34.028  -11.758 -41.635 1.00 36.14 ? 36  GLN B CA  1 
ATOM   2411 C  C   . GLN B 2 2   ? 32.916  -11.161 -42.504 1.00 40.40 ? 36  GLN B C   1 
ATOM   2412 O  O   . GLN B 2 2   ? 32.806  -9.940  -42.628 1.00 36.02 ? 36  GLN B O   1 
ATOM   2413 C  CB  . GLN B 2 2   ? 33.509  -12.035 -40.221 1.00 28.92 ? 36  GLN B CB  1 
ATOM   2414 N  N   . GLN B 2 3   ? 32.115  -12.029 -43.125 1.00 36.30 ? 37  GLN B N   1 
ATOM   2415 C  CA  . GLN B 2 3   ? 30.888  -11.579 -43.765 1.00 44.99 ? 37  GLN B CA  1 
ATOM   2416 C  C   . GLN B 2 3   ? 29.917  -11.102 -42.694 1.00 36.01 ? 37  GLN B C   1 
ATOM   2417 O  O   . GLN B 2 3   ? 29.916  -11.613 -41.566 1.00 35.89 ? 37  GLN B O   1 
ATOM   2418 C  CB  . GLN B 2 3   ? 30.253  -12.708 -44.581 1.00 41.03 ? 37  GLN B CB  1 
ATOM   2419 N  N   . VAL B 2 4   ? 29.150  -10.060 -43.025 1.00 49.71 ? 38  VAL B N   1 
ATOM   2420 C  CA  . VAL B 2 4   ? 27.936  -9.689  -42.280 1.00 32.70 ? 38  VAL B CA  1 
ATOM   2421 C  C   . VAL B 2 4   ? 26.786  -9.842  -43.262 1.00 31.28 ? 38  VAL B C   1 
ATOM   2422 O  O   . VAL B 2 4   ? 26.462  -8.930  -44.030 1.00 34.31 ? 38  VAL B O   1 
ATOM   2423 C  CB  . VAL B 2 4   ? 27.982  -8.276  -41.702 1.00 30.31 ? 38  VAL B CB  1 
ATOM   2424 C  CG1 . VAL B 2 4   ? 26.617  -7.923  -41.132 1.00 40.81 ? 38  VAL B CG1 1 
ATOM   2425 C  CG2 . VAL B 2 4   ? 29.022  -8.184  -40.617 1.00 43.88 ? 38  VAL B CG2 1 
ATOM   2426 N  N   . HIS B 2 5   ? 26.197  -11.025 -43.272 1.00 22.97 ? 39  HIS B N   1 
ATOM   2427 C  CA  . HIS B 2 5   ? 25.075  -11.317 -44.140 1.00 27.08 ? 39  HIS B CA  1 
ATOM   2428 C  C   . HIS B 2 5   ? 23.843  -10.653 -43.540 1.00 23.96 ? 39  HIS B C   1 
ATOM   2429 O  O   . HIS B 2 5   ? 23.518  -10.869 -42.363 1.00 23.10 ? 39  HIS B O   1 
ATOM   2430 C  CB  . HIS B 2 5   ? 24.887  -12.829 -44.284 1.00 26.56 ? 39  HIS B CB  1 
ATOM   2431 N  N   . VAL B 2 6   ? 23.191  -9.811  -44.323 1.00 19.98 ? 40  VAL B N   1 
ATOM   2432 C  CA  . VAL B 2 6   ? 21.960  -9.155  -43.890 1.00 22.89 ? 40  VAL B CA  1 
ATOM   2433 C  C   . VAL B 2 6   ? 20.807  -10.039 -44.346 1.00 25.16 ? 40  VAL B C   1 
ATOM   2434 O  O   . VAL B 2 6   ? 20.683  -10.338 -45.537 1.00 20.33 ? 40  VAL B O   1 
ATOM   2435 C  CB  . VAL B 2 6   ? 21.839  -7.739  -44.479 1.00 22.36 ? 40  VAL B CB  1 
ATOM   2436 C  CG1 . VAL B 2 6   ? 20.444  -7.148  -44.157 1.00 19.94 ? 40  VAL B CG1 1 
ATOM   2437 C  CG2 . VAL B 2 6   ? 22.946  -6.821  -43.958 1.00 24.27 ? 40  VAL B CG2 1 
ATOM   2438 N  N   . LEU B 2 7   ? 19.991  -10.496 -43.403 1.00 21.72 ? 41  LEU B N   1 
ATOM   2439 C  CA  . LEU B 2 7   ? 18.864  -11.351 -43.728 1.00 16.57 ? 41  LEU B CA  1 
ATOM   2440 C  C   . LEU B 2 7   ? 17.659  -10.498 -44.080 1.00 18.73 ? 41  LEU B C   1 
ATOM   2441 O  O   . LEU B 2 7   ? 17.454  -9.417  -43.511 1.00 17.50 ? 41  LEU B O   1 
ATOM   2442 C  CB  . LEU B 2 7   ? 18.525  -12.274 -42.556 1.00 16.91 ? 41  LEU B CB  1 
ATOM   2443 C  CG  . LEU B 2 7   ? 19.682  -13.116 -42.023 1.00 25.80 ? 41  LEU B CG  1 
ATOM   2444 C  CD1 . LEU B 2 7   ? 19.117  -14.213 -41.120 1.00 21.57 ? 41  LEU B CD1 1 
ATOM   2445 C  CD2 . LEU B 2 7   ? 20.506  -13.694 -43.124 1.00 29.30 ? 41  LEU B CD2 1 
ATOM   2446 N  N   . SER B 2 8   ? 16.887  -10.969 -45.047 1.00 19.57 ? 42  SER B N   1 
ATOM   2447 C  CA  . SER B 2 8   ? 15.676  -10.266 -45.436 1.00 16.51 ? 42  SER B CA  1 
ATOM   2448 C  C   . SER B 2 8   ? 14.536  -10.603 -44.480 1.00 18.49 ? 42  SER B C   1 
ATOM   2449 O  O   . SER B 2 8   ? 14.597  -11.570 -43.715 1.00 18.71 ? 42  SER B O   1 
ATOM   2450 C  CB  . SER B 2 8   ? 15.271  -10.621 -46.853 1.00 23.57 ? 42  SER B CB  1 
ATOM   2451 O  OG  . SER B 2 8   ? 14.784  -11.940 -46.902 1.00 34.06 ? 42  SER B OG  1 
ATOM   2452 N  N   . LEU B 2 9   ? 13.482  -9.777  -44.555 1.00 16.57 ? 43  LEU B N   1 
ATOM   2453 C  CA  . LEU B 2 9   ? 12.306  -9.920  -43.716 1.00 17.11 ? 43  LEU B CA  1 
ATOM   2454 C  C   . LEU B 2 9   ? 11.804  -11.350 -43.697 1.00 16.01 ? 43  LEU B C   1 
ATOM   2455 O  O   . LEU B 2 9   ? 11.430  -11.869 -42.642 1.00 21.57 ? 43  LEU B O   1 
ATOM   2456 C  CB  . LEU B 2 9   ? 11.204  -8.978  -44.234 1.00 19.21 ? 43  LEU B CB  1 
ATOM   2457 C  CG  . LEU B 2 9   ? 9.898   -8.848  -43.460 1.00 17.94 ? 43  LEU B CG  1 
ATOM   2458 C  CD1 . LEU B 2 9   ? 10.123  -8.203  -42.121 1.00 17.54 ? 43  LEU B CD1 1 
ATOM   2459 C  CD2 . LEU B 2 9   ? 8.876   -7.998  -44.213 1.00 16.38 ? 43  LEU B CD2 1 
ATOM   2460 N  N   . ASP B 2 10  ? 11.781  -11.997 -44.851 1.00 16.87 ? 44  ASP B N   1 
ATOM   2461 C  CA  . ASP B 2 10  ? 11.175  -13.320 -44.960 1.00 21.02 ? 44  ASP B CA  1 
ATOM   2462 C  C   . ASP B 2 10  ? 12.131  -14.447 -44.625 1.00 22.33 ? 44  ASP B C   1 
ATOM   2463 O  O   . ASP B 2 10  ? 11.722  -15.605 -44.646 1.00 26.34 ? 44  ASP B O   1 
ATOM   2464 C  CB  . ASP B 2 10  ? 10.594  -13.530 -46.355 1.00 22.87 ? 44  ASP B CB  1 
ATOM   2465 C  CG  . ASP B 2 10  ? 11.625  -13.461 -47.450 1.00 33.48 ? 44  ASP B CG  1 
ATOM   2466 O  OD1 . ASP B 2 10  ? 11.326  -13.989 -48.534 1.00 47.22 ? 44  ASP B OD1 1 
ATOM   2467 O  OD2 . ASP B 2 10  ? 12.717  -12.895 -47.258 1.00 32.77 ? 44  ASP B OD2 1 
ATOM   2468 N  N   . GLN B 2 11  ? 13.368  -14.134 -44.262 1.00 23.42 ? 45  GLN B N   1 
ATOM   2469 C  CA  . GLN B 2 11  ? 14.377  -15.128 -43.921 1.00 20.19 ? 45  GLN B CA  1 
ATOM   2470 C  C   . GLN B 2 11  ? 14.631  -15.236 -42.423 1.00 29.29 ? 45  GLN B C   1 
ATOM   2471 O  O   . GLN B 2 11  ? 15.300  -16.176 -41.985 1.00 28.27 ? 45  GLN B O   1 
ATOM   2472 C  CB  . GLN B 2 11  ? 15.687  -14.775 -44.619 1.00 18.52 ? 45  GLN B CB  1 
ATOM   2473 C  CG  . GLN B 2 11  ? 15.598  -14.882 -46.103 1.00 14.40 ? 45  GLN B CG  1 
ATOM   2474 C  CD  . GLN B 2 11  ? 16.852  -14.395 -46.807 1.00 29.55 ? 45  GLN B CD  1 
ATOM   2475 O  OE1 . GLN B 2 11  ? 17.655  -13.619 -46.254 1.00 22.73 ? 45  GLN B OE1 1 
ATOM   2476 N  NE2 . GLN B 2 11  ? 17.018  -14.839 -48.044 1.00 28.47 ? 45  GLN B NE2 1 
ATOM   2477 N  N   . ILE B 2 12  ? 14.151  -14.282 -41.640 1.00 20.56 ? 46  ILE B N   1 
ATOM   2478 C  CA  . ILE B 2 12  ? 14.446  -14.221 -40.219 1.00 17.55 ? 46  ILE B CA  1 
ATOM   2479 C  C   . ILE B 2 12  ? 13.385  -15.033 -39.495 1.00 25.39 ? 46  ILE B C   1 
ATOM   2480 O  O   . ILE B 2 12  ? 12.197  -14.707 -39.561 1.00 21.72 ? 46  ILE B O   1 
ATOM   2481 C  CB  . ILE B 2 12  ? 14.454  -12.769 -39.723 1.00 17.55 ? 46  ILE B CB  1 
ATOM   2482 C  CG1 . ILE B 2 12  ? 15.555  -11.949 -40.402 1.00 21.24 ? 46  ILE B CG1 1 
ATOM   2483 C  CG2 . ILE B 2 12  ? 14.619  -12.732 -38.220 1.00 17.68 ? 46  ILE B CG2 1 
ATOM   2484 C  CD1 . ILE B 2 12  ? 15.414  -10.456 -40.248 1.00 19.79 ? 46  ILE B CD1 1 
ATOM   2485 N  N   . ARG B 2 13  ? 13.811  -16.068 -38.797 1.00 18.84 ? 47  ARG B N   1 
ATOM   2486 C  CA  . ARG B 2 13  ? 12.959  -16.783 -37.858 1.00 24.79 ? 47  ARG B CA  1 
ATOM   2487 C  C   . ARG B 2 13  ? 13.263  -16.198 -36.489 1.00 42.71 ? 47  ARG B C   1 
ATOM   2488 O  O   . ARG B 2 13  ? 14.394  -16.316 -36.004 1.00 40.56 ? 47  ARG B O   1 
ATOM   2489 C  CB  . ARG B 2 13  ? 13.211  -18.282 -37.880 1.00 32.56 ? 47  ARG B CB  1 
ATOM   2490 C  CG  . ARG B 2 13  ? 12.470  -18.997 -38.978 1.00 41.68 ? 47  ARG B CG  1 
ATOM   2491 C  CD  . ARG B 2 13  ? 13.133  -18.799 -40.322 1.00 39.46 ? 47  ARG B CD  1 
ATOM   2492 N  NE  . ARG B 2 13  ? 12.645  -19.783 -41.280 1.00 31.41 ? 47  ARG B NE  1 
ATOM   2493 C  CZ  . ARG B 2 13  ? 13.134  -19.955 -42.498 1.00 31.97 ? 47  ARG B CZ  1 
ATOM   2494 N  NH1 . ARG B 2 13  ? 14.137  -19.188 -42.950 1.00 33.76 ? 47  ARG B NH1 1 
ATOM   2495 N  NH2 . ARG B 2 13  ? 12.599  -20.887 -43.268 1.00 27.51 ? 47  ARG B NH2 1 
ATOM   2496 N  N   . ALA B 2 14  ? 12.280  -15.509 -35.900 1.00 43.08 ? 48  ALA B N   1 
ATOM   2497 C  CA  . ALA B 2 14  ? 12.513  -14.790 -34.653 1.00 31.30 ? 48  ALA B CA  1 
ATOM   2498 C  C   . ALA B 2 14  ? 13.242  -15.685 -33.654 1.00 48.63 ? 48  ALA B C   1 
ATOM   2499 O  O   . ALA B 2 14  ? 12.884  -16.850 -33.455 1.00 44.20 ? 48  ALA B O   1 
ATOM   2500 C  CB  . ALA B 2 14  ? 11.197  -14.287 -34.071 1.00 37.05 ? 48  ALA B CB  1 
ATOM   2501 N  N   . ILE B 2 15  ? 14.319  -15.146 -33.084 1.00 54.09 ? 49  ILE B N   1 
ATOM   2502 C  CA  . ILE B 2 15  ? 15.094  -15.874 -32.091 1.00 48.42 ? 49  ILE B CA  1 
ATOM   2503 C  C   . ILE B 2 15  ? 14.272  -16.069 -30.829 1.00 56.63 ? 49  ILE B C   1 
ATOM   2504 O  O   . ILE B 2 15  ? 14.408  -17.087 -30.135 1.00 52.76 ? 49  ILE B O   1 
ATOM   2505 C  CB  . ILE B 2 15  ? 16.408  -15.112 -31.846 1.00 34.55 ? 49  ILE B CB  1 
ATOM   2506 C  CG1 . ILE B 2 15  ? 17.209  -15.147 -33.153 1.00 48.84 ? 49  ILE B CG1 1 
ATOM   2507 C  CG2 . ILE B 2 15  ? 17.206  -15.723 -30.699 1.00 50.05 ? 49  ILE B CG2 1 
ATOM   2508 C  CD1 . ILE B 2 15  ? 18.006  -13.904 -33.421 1.00 56.60 ? 49  ILE B CD1 1 
ATOM   2509 N  N   . ARG B 2 16  ? 13.379  -15.128 -30.534 1.00 48.41 ? 50  ARG B N   1 
ATOM   2510 C  CA  . ARG B 2 16  ? 12.490  -15.222 -29.387 1.00 52.99 ? 50  ARG B CA  1 
ATOM   2511 C  C   . ARG B 2 16  ? 13.272  -15.343 -28.083 1.00 53.15 ? 50  ARG B C   1 
ATOM   2512 O  O   . ARG B 2 16  ? 12.755  -15.890 -27.095 1.00 47.08 ? 50  ARG B O   1 
ATOM   2513 C  CB  . ARG B 2 16  ? 11.507  -16.396 -29.545 1.00 46.98 ? 50  ARG B CB  1 
ATOM   2514 N  N   . ASN B 2 17  ? 14.521  -14.856 -28.094 1.00 46.35 ? 51  ASN B N   1 
ATOM   2515 C  CA  . ASN B 2 17  ? 15.340  -14.678 -26.895 1.00 44.74 ? 51  ASN B CA  1 
ATOM   2516 C  C   . ASN B 2 17  ? 14.484  -14.112 -25.773 1.00 38.63 ? 51  ASN B C   1 
ATOM   2517 O  O   . ASN B 2 17  ? 13.565  -13.336 -26.041 1.00 36.89 ? 51  ASN B O   1 
ATOM   2518 C  CB  . ASN B 2 17  ? 16.511  -13.745 -27.203 1.00 40.94 ? 51  ASN B CB  1 
ATOM   2519 C  CG  . ASN B 2 17  ? 17.823  -14.219 -26.601 1.00 51.23 ? 51  ASN B CG  1 
ATOM   2520 O  OD1 . ASN B 2 17  ? 18.670  -14.841 -27.281 1.00 32.57 ? 51  ASN B OD1 1 
ATOM   2521 N  ND2 . ASN B 2 17  ? 18.006  -13.925 -25.315 1.00 51.50 ? 51  ASN B ND2 1 
ATOM   2522 N  N   . THR B 2 18  ? 14.777  -14.460 -24.519 1.00 35.03 ? 52  THR B N   1 
ATOM   2523 C  CA  . THR B 2 18  ? 13.861  -14.203 -23.412 1.00 30.72 ? 52  THR B CA  1 
ATOM   2524 C  C   . THR B 2 18  ? 14.579  -13.543 -22.244 1.00 28.11 ? 52  THR B C   1 
ATOM   2525 O  O   . THR B 2 18  ? 15.698  -13.926 -21.896 1.00 25.33 ? 52  THR B O   1 
ATOM   2526 C  CB  . THR B 2 18  ? 13.219  -15.490 -22.956 1.00 44.39 ? 52  THR B CB  1 
ATOM   2527 O  OG1 . THR B 2 18  ? 12.646  -16.140 -24.100 1.00 39.39 ? 52  THR B OG1 1 
ATOM   2528 C  CG2 . THR B 2 18  ? 12.142  -15.210 -21.916 1.00 39.37 ? 52  THR B CG2 1 
ATOM   2529 N  N   . ASN B 2 19  ? 13.941  -12.530 -21.658 1.00 23.59 ? 53  ASN B N   1 
ATOM   2530 C  CA  . ASN B 2 19  ? 14.531  -11.812 -20.534 1.00 25.26 ? 53  ASN B CA  1 
ATOM   2531 C  C   . ASN B 2 19  ? 14.360  -12.607 -19.241 1.00 24.92 ? 53  ASN B C   1 
ATOM   2532 O  O   . ASN B 2 19  ? 13.368  -13.314 -19.050 1.00 27.03 ? 53  ASN B O   1 
ATOM   2533 C  CB  . ASN B 2 19  ? 13.882  -10.430 -20.392 1.00 22.33 ? 53  ASN B CB  1 
ATOM   2534 C  CG  . ASN B 2 19  ? 14.217  -9.513  -21.541 1.00 18.02 ? 53  ASN B CG  1 
ATOM   2535 O  OD1 . ASN B 2 19  ? 15.361  -9.462  -21.979 1.00 19.11 ? 53  ASN B OD1 1 
ATOM   2536 N  ND2 . ASN B 2 19  ? 13.207  -8.794  -22.057 1.00 18.41 ? 53  ASN B ND2 1 
ATOM   2537 N  N   . GLU B 2 20  ? 15.320  -12.471 -18.328 1.00 25.82 ? 54  GLU B N   1 
ATOM   2538 C  CA  . GLU B 2 20  ? 15.278  -13.287 -17.102 1.00 27.57 ? 54  GLU B CA  1 
ATOM   2539 C  C   . GLU B 2 20  ? 14.348  -12.709 -16.041 1.00 24.48 ? 54  GLU B C   1 
ATOM   2540 O  O   . GLU B 2 20  ? 14.673  -11.697 -15.442 1.00 23.75 ? 54  GLU B O   1 
ATOM   2541 C  CB  . GLU B 2 20  ? 16.693  -13.436 -16.515 1.00 34.22 ? 54  GLU B CB  1 
ATOM   2542 C  CG  . GLU B 2 20  ? 16.722  -14.085 -15.121 1.00 42.06 ? 54  GLU B CG  1 
ATOM   2543 C  CD  . GLU B 2 20  ? 17.809  -15.139 -14.964 1.00 56.11 ? 54  GLU B CD  1 
ATOM   2544 O  OE1 . GLU B 2 20  ? 17.470  -16.284 -14.583 1.00 53.08 ? 54  GLU B OE1 1 
ATOM   2545 O  OE2 . GLU B 2 20  ? 18.994  -14.822 -15.206 1.00 58.37 ? 54  GLU B OE2 1 
HETATM 2546 N  N   . PTR B 2 21  ? 13.199  -13.357 -15.803 1.00 23.74 ? 55  PTR B N   1 
HETATM 2547 C  CA  . PTR B 2 21  ? 12.282  -12.971 -14.726 1.00 19.79 ? 55  PTR B CA  1 
HETATM 2548 C  C   . PTR B 2 21  ? 12.441  -13.995 -13.604 1.00 27.59 ? 55  PTR B C   1 
HETATM 2549 O  O   . PTR B 2 21  ? 12.460  -15.194 -13.856 1.00 30.16 ? 55  PTR B O   1 
HETATM 2550 C  CB  . PTR B 2 21  ? 10.824  -12.904 -15.214 1.00 23.84 ? 55  PTR B CB  1 
HETATM 2551 C  CG  . PTR B 2 21  ? 10.549  -11.756 -16.191 1.00 21.91 ? 55  PTR B CG  1 
HETATM 2552 C  CD1 . PTR B 2 21  ? 10.458  -10.453 -15.734 1.00 21.87 ? 55  PTR B CD1 1 
HETATM 2553 C  CD2 . PTR B 2 21  ? 10.409  -11.978 -17.562 1.00 23.11 ? 55  PTR B CD2 1 
HETATM 2554 C  CE1 . PTR B 2 21  ? 10.214  -9.394  -16.601 1.00 19.80 ? 55  PTR B CE1 1 
HETATM 2555 C  CE2 . PTR B 2 21  ? 10.161  -10.918 -18.445 1.00 20.46 ? 55  PTR B CE2 1 
HETATM 2556 C  CZ  . PTR B 2 21  ? 10.071  -9.626  -17.951 1.00 20.09 ? 55  PTR B CZ  1 
HETATM 2557 O  OH  . PTR B 2 21  ? 9.820   -8.575  -18.731 1.00 17.87 ? 55  PTR B OH  1 
HETATM 2558 P  P   . PTR B 2 21  ? 9.393   -8.649  -20.289 1.00 17.94 ? 55  PTR B P   1 
HETATM 2559 O  O1P . PTR B 2 21  ? 10.493  -9.256  -21.036 1.00 17.68 ? 55  PTR B O1P 1 
HETATM 2560 O  O2P . PTR B 2 21  ? 9.184   -7.170  -20.680 1.00 17.42 ? 55  PTR B O2P 1 
HETATM 2561 O  O3P . PTR B 2 21  ? 8.088   -9.451  -20.466 1.00 17.76 ? 55  PTR B O3P 1 
ATOM   2562 N  N   . THR B 2 22  ? 12.585  -13.522 -12.378 1.00 25.63 ? 56  THR B N   1 
ATOM   2563 C  CA  . THR B 2 22  ? 12.895  -14.401 -11.251 1.00 27.39 ? 56  THR B CA  1 
ATOM   2564 C  C   . THR B 2 22  ? 11.743  -14.441 -10.264 1.00 29.13 ? 56  THR B C   1 
ATOM   2565 O  O   . THR B 2 22  ? 10.829  -13.613 -10.306 1.00 24.49 ? 56  THR B O   1 
ATOM   2566 C  CB  . THR B 2 22  ? 14.199  -13.956 -10.554 1.00 25.73 ? 56  THR B CB  1 
ATOM   2567 O  OG1 . THR B 2 22  ? 14.186  -12.527 -10.360 1.00 28.88 ? 56  THR B OG1 1 
ATOM   2568 C  CG2 . THR B 2 22  ? 15.426  -14.358 -11.410 1.00 28.09 ? 56  THR B CG2 1 
ATOM   2569 N  N   . GLU B 2 23  ? 11.773  -15.437 -9.382  1.00 30.66 ? 57  GLU B N   1 
ATOM   2570 C  CA  . GLU B 2 23  ? 10.723  -15.589 -8.385  1.00 34.79 ? 57  GLU B CA  1 
ATOM   2571 C  C   . GLU B 2 23  ? 10.708  -14.396 -7.441  1.00 34.89 ? 57  GLU B C   1 
ATOM   2572 O  O   . GLU B 2 23  ? 11.749  -13.808 -7.132  1.00 34.17 ? 57  GLU B O   1 
ATOM   2573 C  CB  . GLU B 2 23  ? 10.928  -16.877 -7.584  1.00 44.85 ? 57  GLU B CB  1 
ATOM   2574 C  CG  . GLU B 2 23  ? 10.464  -18.114 -8.328  1.00 41.99 ? 57  GLU B CG  1 
ATOM   2575 C  CD  . GLU B 2 23  ? 11.151  -19.397 -7.872  1.00 61.85 ? 57  GLU B CD  1 
ATOM   2576 O  OE1 . GLU B 2 23  ? 10.706  -20.487 -8.294  1.00 58.95 ? 57  GLU B OE1 1 
ATOM   2577 O  OE2 . GLU B 2 23  ? 12.138  -19.323 -7.106  1.00 66.84 ? 57  GLU B OE2 1 
ATOM   2578 N  N   . GLY B 2 24  ? 9.508   -14.031 -6.999  1.00 34.10 ? 58  GLY B N   1 
ATOM   2579 C  CA  . GLY B 2 24  ? 9.342   -12.930 -6.073  1.00 40.67 ? 58  GLY B CA  1 
ATOM   2580 C  C   . GLY B 2 24  ? 10.280  -13.048 -4.885  1.00 40.34 ? 58  GLY B C   1 
ATOM   2581 O  O   . GLY B 2 24  ? 10.554  -14.150 -4.403  1.00 36.07 ? 58  GLY B O   1 
ATOM   2582 N  N   . PRO B 2 25  ? 10.813  -11.913 -4.395  1.00 40.46 ? 59  PRO B N   1 
ATOM   2583 C  CA  . PRO B 2 25  ? 11.772  -11.953 -3.279  1.00 42.50 ? 59  PRO B CA  1 
ATOM   2584 C  C   . PRO B 2 25  ? 11.175  -12.492 -1.976  1.00 40.55 ? 59  PRO B C   1 
ATOM   2585 O  O   . PRO B 2 25  ? 9.971   -12.322 -1.788  1.00 41.90 ? 59  PRO B O   1 
ATOM   2586 C  CB  . PRO B 2 25  ? 12.184  -10.484 -3.118  1.00 37.60 ? 59  PRO B CB  1 
ATOM   2587 C  CG  . PRO B 2 25  ? 11.052  -9.701  -3.722  1.00 41.32 ? 59  PRO B CG  1 
ATOM   2588 C  CD  . PRO B 2 25  ? 10.567  -10.535 -4.859  1.00 36.67 ? 59  PRO B CD  1 
HETATM 2589 NA NA  . NA  C 3 .   ? -5.091  1.579   -29.687 1.00 17.24 ? 401 NA  A NA  1 
HETATM 2590 O  O   . HOH D 4 .   ? 2.188   6.913   -35.366 1.00 31.58 ? 501 HOH A O   1 
HETATM 2591 O  O   . HOH D 4 .   ? 6.491   -2.804  -21.144 1.00 34.27 ? 502 HOH A O   1 
HETATM 2592 O  O   . HOH D 4 .   ? -5.214  -1.267  -0.830  1.00 45.24 ? 503 HOH A O   1 
HETATM 2593 O  O   . HOH D 4 .   ? -16.076 -7.812  -34.040 1.00 26.66 ? 504 HOH A O   1 
HETATM 2594 O  O   . HOH D 4 .   ? 15.487  -12.095 -34.997 1.00 32.65 ? 505 HOH A O   1 
HETATM 2595 O  O   . HOH D 4 .   ? 12.422  10.974  -36.754 1.00 35.69 ? 506 HOH A O   1 
HETATM 2596 O  O   . HOH D 4 .   ? -4.884  -11.738 -22.980 1.00 49.46 ? 507 HOH A O   1 
HETATM 2597 O  O   . HOH D 4 .   ? 12.949  -11.535 -8.099  1.00 36.42 ? 508 HOH A O   1 
HETATM 2598 O  O   . HOH D 4 .   ? 20.894  4.662   -14.003 1.00 35.76 ? 509 HOH A O   1 
HETATM 2599 O  O   . HOH D 4 .   ? 23.824  -7.475  -38.534 1.00 26.78 ? 510 HOH A O   1 
HETATM 2600 O  O   . HOH D 4 .   ? 8.075   -12.107 -31.727 1.00 35.55 ? 511 HOH A O   1 
HETATM 2601 O  O   . HOH D 4 .   ? -3.459  -1.620  -33.368 1.00 24.98 ? 512 HOH A O   1 
HETATM 2602 O  O   . HOH D 4 .   ? -7.106  -13.900 -52.638 1.00 45.50 ? 513 HOH A O   1 
HETATM 2603 O  O   . HOH D 4 .   ? 28.089  -0.297  -40.966 1.00 37.25 ? 514 HOH A O   1 
HETATM 2604 O  O   . HOH D 4 .   ? -11.718 -11.653 -10.241 1.00 34.05 ? 515 HOH A O   1 
HETATM 2605 O  O   . HOH D 4 .   ? -9.971  -18.358 -48.330 1.00 35.31 ? 516 HOH A O   1 
HETATM 2606 O  O   . HOH D 4 .   ? 20.231  -2.217  -19.491 1.00 32.49 ? 517 HOH A O   1 
HETATM 2607 O  O   . HOH D 4 .   ? 15.193  -2.379  -24.486 1.00 28.53 ? 518 HOH A O   1 
HETATM 2608 O  O   . HOH D 4 .   ? 9.378   8.679   -10.706 1.00 34.51 ? 519 HOH A O   1 
HETATM 2609 O  O   . HOH D 4 .   ? -25.085 5.235   -18.171 1.00 31.73 ? 520 HOH A O   1 
HETATM 2610 O  O   . HOH D 4 .   ? 16.452  -5.327  -27.385 1.00 29.58 ? 521 HOH A O   1 
HETATM 2611 O  O   . HOH D 4 .   ? 15.312  7.275   -11.892 1.00 29.25 ? 522 HOH A O   1 
HETATM 2612 O  O   . HOH D 4 .   ? 3.966   -6.577  -26.269 1.00 17.96 ? 523 HOH A O   1 
HETATM 2613 O  O   . HOH D 4 .   ? -9.319  -8.208  -9.083  1.00 30.20 ? 524 HOH A O   1 
HETATM 2614 O  O   . HOH D 4 .   ? 2.541   -5.774  -54.609 1.00 47.36 ? 525 HOH A O   1 
HETATM 2615 O  O   . HOH D 4 .   ? 21.639  -4.810  -34.918 1.00 31.59 ? 526 HOH A O   1 
HETATM 2616 O  O   . HOH D 4 .   ? -1.499  -16.646 -32.886 1.00 27.62 ? 527 HOH A O   1 
HETATM 2617 O  O   . HOH D 4 .   ? 4.771   0.151   -18.429 1.00 18.41 ? 528 HOH A O   1 
HETATM 2618 O  O   . HOH D 4 .   ? 20.832  -7.194  -33.300 1.00 21.70 ? 529 HOH A O   1 
HETATM 2619 O  O   . HOH D 4 .   ? -15.693 -15.519 -34.186 1.00 21.21 ? 530 HOH A O   1 
HETATM 2620 O  O   . HOH D 4 .   ? 7.177   7.405   -14.575 1.00 40.93 ? 531 HOH A O   1 
HETATM 2621 O  O   . HOH D 4 .   ? -10.115 7.917   -32.947 1.00 26.28 ? 532 HOH A O   1 
HETATM 2622 O  O   . HOH D 4 .   ? 18.276  6.604   -15.574 1.00 29.66 ? 533 HOH A O   1 
HETATM 2623 O  O   . HOH D 4 .   ? -19.714 -4.282  -15.545 1.00 29.56 ? 534 HOH A O   1 
HETATM 2624 O  O   . HOH D 4 .   ? -4.523  -4.077  -10.205 1.00 26.44 ? 535 HOH A O   1 
HETATM 2625 O  O   . HOH D 4 .   ? 23.183  -8.223  -30.508 1.00 40.56 ? 536 HOH A O   1 
HETATM 2626 O  O   . HOH D 4 .   ? -7.942  -17.346 -36.408 1.00 17.30 ? 537 HOH A O   1 
HETATM 2627 O  O   . HOH D 4 .   ? 1.346   -8.256  3.931   1.00 38.71 ? 538 HOH A O   1 
HETATM 2628 O  O   . HOH D 4 .   ? -4.270  -1.633  -22.948 1.00 17.36 ? 539 HOH A O   1 
HETATM 2629 O  O   . HOH D 4 .   ? -0.133  6.321   -5.282  1.00 27.18 ? 540 HOH A O   1 
HETATM 2630 O  O   . HOH D 4 .   ? 20.954  6.087   -38.895 1.00 40.53 ? 541 HOH A O   1 
HETATM 2631 O  O   . HOH D 4 .   ? 3.654   -17.301 -42.078 1.00 25.09 ? 542 HOH A O   1 
HETATM 2632 O  O   . HOH D 4 .   ? -0.724  -12.854 -19.151 1.00 29.25 ? 543 HOH A O   1 
HETATM 2633 O  O   . HOH D 4 .   ? 1.228   -9.490  -12.949 1.00 28.81 ? 544 HOH A O   1 
HETATM 2634 O  O   . HOH D 4 .   ? 23.804  8.078   -25.277 1.00 47.51 ? 545 HOH A O   1 
HETATM 2635 O  O   . HOH D 4 .   ? 1.790   -6.326  -19.470 1.00 16.71 ? 546 HOH A O   1 
HETATM 2636 O  O   . HOH D 4 .   ? 10.274  -14.085 -41.516 1.00 23.45 ? 547 HOH A O   1 
HETATM 2637 O  O   . HOH D 4 .   ? 22.676  -9.614  -39.687 1.00 18.10 ? 548 HOH A O   1 
HETATM 2638 O  O   . HOH D 4 .   ? 6.474   -9.190  -5.995  1.00 28.27 ? 549 HOH A O   1 
HETATM 2639 O  O   . HOH D 4 .   ? 2.080   -18.808 -48.718 1.00 39.15 ? 550 HOH A O   1 
HETATM 2640 O  O   . HOH D 4 .   ? 16.343  3.557   -18.565 1.00 30.87 ? 551 HOH A O   1 
HETATM 2641 O  O   . HOH D 4 .   ? 25.566  3.294   -10.049 1.00 43.83 ? 552 HOH A O   1 
HETATM 2642 O  O   . HOH D 4 .   ? -5.808  1.115   -43.967 1.00 30.44 ? 553 HOH A O   1 
HETATM 2643 O  O   . HOH D 4 .   ? -22.621 2.683   -26.564 1.00 40.42 ? 554 HOH A O   1 
HETATM 2644 O  O   . HOH D 4 .   ? -15.035 -8.147  -29.493 1.00 19.62 ? 555 HOH A O   1 
HETATM 2645 O  O   . HOH D 4 .   ? 8.172   -8.664  -27.407 1.00 17.13 ? 556 HOH A O   1 
HETATM 2646 O  O   . HOH D 4 .   ? -1.610  -12.082 -28.149 1.00 17.35 ? 557 HOH A O   1 
HETATM 2647 O  O   . HOH D 4 .   ? -6.035  -0.727  -31.237 1.00 21.58 ? 558 HOH A O   1 
HETATM 2648 O  O   . HOH D 4 .   ? -3.615  -4.266  -7.747  1.00 29.43 ? 559 HOH A O   1 
HETATM 2649 O  O   . HOH D 4 .   ? 23.988  7.195   -8.674  1.00 39.11 ? 560 HOH A O   1 
HETATM 2650 O  O   . HOH D 4 .   ? -13.060 3.857   -10.722 1.00 26.36 ? 561 HOH A O   1 
HETATM 2651 O  O   . HOH D 4 .   ? 0.798   5.117   -18.769 1.00 24.39 ? 562 HOH A O   1 
HETATM 2652 O  O   . HOH D 4 .   ? -12.488 3.494   -38.540 1.00 36.38 ? 563 HOH A O   1 
HETATM 2653 O  O   . HOH D 4 .   ? 14.456  -5.144  -23.068 1.00 16.08 ? 564 HOH A O   1 
HETATM 2654 O  O   . HOH D 4 .   ? -2.773  10.885  -24.526 1.00 32.48 ? 565 HOH A O   1 
HETATM 2655 O  O   . HOH D 4 .   ? -0.286  5.364   -25.696 1.00 18.27 ? 566 HOH A O   1 
HETATM 2656 O  O   . HOH D 4 .   ? -10.227 -8.343  -18.573 1.00 19.14 ? 567 HOH A O   1 
HETATM 2657 O  O   . HOH D 4 .   ? 3.592   9.927   -9.521  1.00 29.04 ? 568 HOH A O   1 
HETATM 2658 O  O   . HOH D 4 .   ? -9.983  12.903  -24.984 1.00 33.64 ? 569 HOH A O   1 
HETATM 2659 O  O   . HOH D 4 .   ? -7.775  -13.991 -28.365 1.00 31.24 ? 570 HOH A O   1 
HETATM 2660 O  O   . HOH D 4 .   ? -23.223 3.747   -14.376 1.00 29.84 ? 571 HOH A O   1 
HETATM 2661 O  O   . HOH D 4 .   ? -6.689  6.860   -6.341  1.00 28.74 ? 572 HOH A O   1 
HETATM 2662 O  O   . HOH D 4 .   ? 22.334  -2.528  -43.160 1.00 42.51 ? 573 HOH A O   1 
HETATM 2663 O  O   . HOH D 4 .   ? 11.429  3.769   -23.786 1.00 37.26 ? 574 HOH A O   1 
HETATM 2664 O  O   . HOH D 4 .   ? -9.526  -5.614  -50.614 1.00 44.14 ? 575 HOH A O   1 
HETATM 2665 O  O   . HOH D 4 .   ? 14.025  -2.684  -26.948 1.00 30.00 ? 576 HOH A O   1 
HETATM 2666 O  O   . HOH D 4 .   ? 21.524  1.401   -40.682 1.00 23.04 ? 577 HOH A O   1 
HETATM 2667 O  O   . HOH D 4 .   ? 1.358   0.770   1.323   1.00 37.24 ? 578 HOH A O   1 
HETATM 2668 O  O   . HOH D 4 .   ? -5.071  5.415   -36.403 1.00 35.51 ? 579 HOH A O   1 
HETATM 2669 O  O   . HOH D 4 .   ? 8.073   11.064  -10.650 1.00 24.39 ? 580 HOH A O   1 
HETATM 2670 O  O   . HOH D 4 .   ? -8.340  1.619   -5.261  1.00 36.02 ? 581 HOH A O   1 
HETATM 2671 O  O   . HOH D 4 .   ? 10.417  4.242   2.106   1.00 27.47 ? 582 HOH A O   1 
HETATM 2672 O  O   . HOH D 4 .   ? 9.894   7.096   -43.967 1.00 40.29 ? 583 HOH A O   1 
HETATM 2673 O  O   . HOH D 4 .   ? 10.731  -12.035 -29.560 1.00 32.57 ? 584 HOH A O   1 
HETATM 2674 O  O   . HOH D 4 .   ? 19.138  11.613  -25.270 1.00 32.08 ? 585 HOH A O   1 
HETATM 2675 O  O   . HOH D 4 .   ? -3.553  -21.065 -39.782 1.00 28.09 ? 586 HOH A O   1 
HETATM 2676 O  O   . HOH D 4 .   ? 10.409  -4.062  -14.523 1.00 21.84 ? 587 HOH A O   1 
HETATM 2677 O  O   . HOH D 4 .   ? 14.443  5.627   -17.912 1.00 32.03 ? 588 HOH A O   1 
HETATM 2678 O  O   . HOH D 4 .   ? 2.169   -16.373 -36.932 1.00 38.91 ? 589 HOH A O   1 
HETATM 2679 O  O   . HOH D 4 .   ? 5.889   -0.852  -2.060  1.00 25.22 ? 590 HOH A O   1 
HETATM 2680 O  O   . HOH D 4 .   ? -1.353  -18.548 -49.799 1.00 47.75 ? 591 HOH A O   1 
HETATM 2681 O  O   . HOH D 4 .   ? -5.944  -5.340  -7.312  1.00 38.77 ? 592 HOH A O   1 
HETATM 2682 O  O   . HOH D 4 .   ? 6.353   -7.087  -50.742 1.00 31.63 ? 593 HOH A O   1 
HETATM 2683 O  O   . HOH D 4 .   ? 19.045  -9.889  -16.408 1.00 41.94 ? 594 HOH A O   1 
HETATM 2684 O  O   . HOH D 4 .   ? -14.846 -5.893  -9.822  1.00 27.97 ? 595 HOH A O   1 
HETATM 2685 O  O   . HOH D 4 .   ? -15.245 -12.954 -35.557 1.00 20.51 ? 596 HOH A O   1 
HETATM 2686 O  O   . HOH D 4 .   ? 4.190   -9.450  -28.856 1.00 20.54 ? 597 HOH A O   1 
HETATM 2687 O  O   . HOH D 4 .   ? -19.836 5.635   -26.620 1.00 34.22 ? 598 HOH A O   1 
HETATM 2688 O  O   . HOH D 4 .   ? -16.247 -9.745  -27.354 1.00 32.33 ? 599 HOH A O   1 
HETATM 2689 O  O   . HOH D 4 .   ? 10.432  9.423   -37.171 1.00 29.79 ? 600 HOH A O   1 
HETATM 2690 O  O   . HOH D 4 .   ? 9.269   -13.963 -21.251 1.00 34.33 ? 601 HOH A O   1 
HETATM 2691 O  O   . HOH D 4 .   ? -19.987 7.323   -13.665 1.00 27.04 ? 602 HOH A O   1 
HETATM 2692 O  O   . HOH D 4 .   ? 10.651  -9.163  -29.145 1.00 18.65 ? 603 HOH A O   1 
HETATM 2693 O  O   . HOH D 4 .   ? -15.958 -12.947 -20.808 1.00 38.26 ? 604 HOH A O   1 
HETATM 2694 O  O   . HOH D 4 .   ? -19.602 2.695   -31.190 1.00 46.37 ? 605 HOH A O   1 
HETATM 2695 O  O   . HOH D 4 .   ? -10.689 -21.555 -43.277 1.00 29.22 ? 606 HOH A O   1 
HETATM 2696 O  O   . HOH D 4 .   ? -4.223  -15.368 -29.652 1.00 25.77 ? 607 HOH A O   1 
HETATM 2697 O  O   . HOH D 4 .   ? -8.168  -21.344 -44.666 1.00 26.94 ? 608 HOH A O   1 
HETATM 2698 O  O   . HOH D 4 .   ? 3.908   0.916   -3.153  1.00 25.27 ? 609 HOH A O   1 
HETATM 2699 O  O   . HOH D 4 .   ? -17.815 -9.004  -23.647 1.00 28.74 ? 610 HOH A O   1 
HETATM 2700 O  O   . HOH D 4 .   ? 3.689   -9.989  -26.178 1.00 23.17 ? 611 HOH A O   1 
HETATM 2701 O  O   . HOH D 4 .   ? 4.189   -14.989 -36.358 1.00 35.69 ? 612 HOH A O   1 
HETATM 2702 O  O   . HOH D 4 .   ? -3.000  -6.792  -10.331 1.00 33.57 ? 613 HOH A O   1 
HETATM 2703 O  O   . HOH D 4 .   ? -10.614 -14.592 -27.395 1.00 31.81 ? 614 HOH A O   1 
HETATM 2704 O  O   . HOH D 4 .   ? -13.411 7.220   -11.451 1.00 35.20 ? 615 HOH A O   1 
HETATM 2705 O  O   . HOH D 4 .   ? 14.603  -3.333  -30.943 1.00 18.35 ? 616 HOH A O   1 
HETATM 2706 O  O   . HOH D 4 .   ? 6.137   -0.820  -20.417 1.00 34.16 ? 617 HOH A O   1 
HETATM 2707 O  O   . HOH D 4 .   ? -23.444 -12.090 -33.756 1.00 38.26 ? 618 HOH A O   1 
HETATM 2708 O  O   . HOH D 4 .   ? 0.271   -15.122 -47.820 1.00 29.92 ? 619 HOH A O   1 
HETATM 2709 O  O   . HOH D 4 .   ? 3.941   -5.127  -35.183 1.00 20.73 ? 620 HOH A O   1 
HETATM 2710 O  O   . HOH D 4 .   ? 17.126  1.104   -29.504 1.00 38.12 ? 621 HOH A O   1 
HETATM 2711 O  O   . HOH D 4 .   ? -4.407  3.482   -37.518 1.00 31.26 ? 622 HOH A O   1 
HETATM 2712 O  O   . HOH D 4 .   ? 7.249   6.849   -17.180 1.00 35.58 ? 623 HOH A O   1 
HETATM 2713 O  O   . HOH D 4 .   ? -15.095 11.849  -20.087 1.00 24.60 ? 624 HOH A O   1 
HETATM 2714 O  O   . HOH D 4 .   ? -11.580 9.514   -31.041 1.00 21.16 ? 625 HOH A O   1 
HETATM 2715 O  O   . HOH D 4 .   ? 4.403   -0.462  -22.714 1.00 26.58 ? 626 HOH A O   1 
HETATM 2716 O  O   . HOH D 4 .   ? -18.433 -8.656  -26.088 1.00 27.14 ? 627 HOH A O   1 
HETATM 2717 O  O   . HOH D 4 .   ? -11.192 -5.206  -14.204 1.00 20.44 ? 628 HOH A O   1 
HETATM 2718 O  O   . HOH D 4 .   ? 15.239  -5.213  -2.057  1.00 28.88 ? 629 HOH A O   1 
HETATM 2719 O  O   . HOH D 4 .   ? -15.597 -4.322  -39.429 1.00 30.08 ? 630 HOH A O   1 
HETATM 2720 O  O   . HOH D 4 .   ? -15.960 -11.341 -23.562 1.00 23.32 ? 631 HOH A O   1 
HETATM 2721 O  O   . HOH D 4 .   ? 22.000  -9.645  -28.113 1.00 38.14 ? 632 HOH A O   1 
HETATM 2722 O  O   . HOH D 4 .   ? -15.170 -3.447  -34.663 1.00 24.93 ? 633 HOH A O   1 
HETATM 2723 O  O   . HOH D 4 .   ? 6.673   -11.499 -49.599 1.00 41.79 ? 634 HOH A O   1 
HETATM 2724 O  O   . HOH D 4 .   ? 8.389   -16.566 -33.105 1.00 38.79 ? 635 HOH A O   1 
HETATM 2725 O  O   . HOH D 4 .   ? -4.424  -20.227 -49.019 1.00 39.24 ? 636 HOH A O   1 
HETATM 2726 O  O   . HOH D 4 .   ? -19.653 -1.510  -13.072 1.00 39.36 ? 637 HOH A O   1 
HETATM 2727 O  O   . HOH D 4 .   ? 20.839  -4.861  -46.886 1.00 36.09 ? 638 HOH A O   1 
HETATM 2728 O  O   . HOH D 4 .   ? 16.904  -7.382  -14.427 1.00 23.00 ? 639 HOH A O   1 
HETATM 2729 O  O   . HOH D 4 .   ? 4.581   2.608   2.144   1.00 36.38 ? 640 HOH A O   1 
HETATM 2730 O  O   . HOH D 4 .   ? -21.339 2.573   -20.708 1.00 22.60 ? 641 HOH A O   1 
HETATM 2731 O  O   . HOH D 4 .   ? -1.874  -1.354  -35.144 1.00 31.39 ? 642 HOH A O   1 
HETATM 2732 O  O   . HOH D 4 .   ? 4.742   -14.325 -48.884 1.00 46.66 ? 643 HOH A O   1 
HETATM 2733 O  O   . HOH D 4 .   ? -13.580 -12.635 -13.689 1.00 33.54 ? 644 HOH A O   1 
HETATM 2734 O  O   . HOH D 4 .   ? -21.296 -0.421  -20.375 1.00 24.75 ? 645 HOH A O   1 
HETATM 2735 O  O   . HOH D 4 .   ? 3.203   1.273   -20.871 1.00 27.12 ? 646 HOH A O   1 
HETATM 2736 O  O   . HOH D 4 .   ? -3.065  -0.870  -20.510 1.00 22.89 ? 647 HOH A O   1 
HETATM 2737 O  O   . HOH D 4 .   ? 5.570   -9.201  -3.505  1.00 33.62 ? 648 HOH A O   1 
HETATM 2738 O  O   . HOH D 4 .   ? -2.361  -8.949  -13.636 1.00 44.85 ? 649 HOH A O   1 
HETATM 2739 O  O   . HOH D 4 .   ? 16.447  3.237   -25.197 1.00 37.97 ? 650 HOH A O   1 
HETATM 2740 O  O   . HOH D 4 .   ? -12.201 -19.531 -44.038 1.00 39.36 ? 651 HOH A O   1 
HETATM 2741 O  O   . HOH D 4 .   ? 27.514  1.853   -12.939 1.00 33.00 ? 652 HOH A O   1 
HETATM 2742 O  O   . HOH D 4 .   ? 9.259   6.975   -30.849 1.00 45.39 ? 653 HOH A O   1 
HETATM 2743 O  O   . HOH D 4 .   ? 20.390  12.620  -29.974 1.00 27.86 ? 654 HOH A O   1 
HETATM 2744 O  O   . HOH D 4 .   ? -14.715 -1.353  -4.889  1.00 43.04 ? 655 HOH A O   1 
HETATM 2745 O  O   . HOH D 4 .   ? 2.788   0.359   -0.607  1.00 38.16 ? 656 HOH A O   1 
HETATM 2746 O  O   . HOH D 4 .   ? 5.270   -12.560 -26.327 1.00 37.32 ? 657 HOH A O   1 
HETATM 2747 O  O   . HOH D 4 .   ? -14.680 -9.290  -12.580 1.00 32.15 ? 658 HOH A O   1 
HETATM 2748 O  O   . HOH D 4 .   ? 1.586   5.874   -43.992 1.00 40.10 ? 659 HOH A O   1 
HETATM 2749 O  O   . HOH D 4 .   ? 11.310  8.623   -44.845 1.00 43.89 ? 660 HOH A O   1 
HETATM 2750 O  O   . HOH D 4 .   ? -2.619  -11.986 -23.087 1.00 43.79 ? 661 HOH A O   1 
HETATM 2751 O  O   . HOH D 4 .   ? -12.326 -7.354  -12.248 1.00 10.09 ? 662 HOH A O   1 
HETATM 2752 O  O   . HOH D 4 .   ? 1.045   2.175   -21.545 1.00 32.48 ? 663 HOH A O   1 
HETATM 2753 O  O   . HOH D 4 .   ? 16.280  -1.287  -28.703 1.00 46.77 ? 664 HOH A O   1 
HETATM 2754 O  O   . HOH D 4 .   ? -13.683 -4.982  -36.947 1.00 21.84 ? 665 HOH A O   1 
HETATM 2755 O  O   . HOH D 4 .   ? 1.601   -11.277 -24.740 1.00 27.19 ? 666 HOH A O   1 
HETATM 2756 O  O   . HOH D 4 .   ? -20.198 -1.790  -15.884 1.00 33.31 ? 667 HOH A O   1 
HETATM 2757 O  O   . HOH D 4 .   ? -1.875  -15.222 -50.167 1.00 45.96 ? 668 HOH A O   1 
HETATM 2758 O  O   . HOH D 4 .   ? 18.277  -11.038 -13.585 1.00 37.71 ? 669 HOH A O   1 
HETATM 2759 O  O   . HOH D 4 .   ? 9.162   -18.006 -19.959 1.00 44.31 ? 670 HOH A O   1 
HETATM 2760 O  O   . HOH D 4 .   ? -10.672 8.351   -10.433 1.00 49.33 ? 671 HOH A O   1 
HETATM 2761 O  O   . HOH D 4 .   ? 16.291  12.187  -26.231 1.00 38.68 ? 672 HOH A O   1 
HETATM 2762 O  O   . HOH D 4 .   ? 22.208  0.478   -43.194 1.00 37.45 ? 673 HOH A O   1 
HETATM 2763 O  O   . HOH D 4 .   ? 3.099   -11.836 -29.907 1.00 30.58 ? 674 HOH A O   1 
HETATM 2764 O  O   . HOH D 4 .   ? -10.889 2.051   -4.123  1.00 43.35 ? 675 HOH A O   1 
HETATM 2765 O  O   . HOH D 4 .   ? 17.276  -0.532  -24.410 1.00 44.03 ? 676 HOH A O   1 
HETATM 2766 O  O   . HOH D 4 .   ? -3.385  -13.658 -27.495 1.00 27.70 ? 677 HOH A O   1 
HETATM 2767 O  O   . HOH D 4 .   ? 23.406  11.544  -27.087 1.00 38.45 ? 678 HOH A O   1 
HETATM 2768 O  O   . HOH D 4 .   ? -9.502  8.848   -35.002 1.00 45.74 ? 679 HOH A O   1 
HETATM 2769 O  O   . HOH D 4 .   ? 7.609   8.720   -18.909 1.00 44.07 ? 680 HOH A O   1 
HETATM 2770 O  O   . HOH D 4 .   ? -1.015  -11.099 -25.645 1.00 25.32 ? 681 HOH A O   1 
HETATM 2771 O  O   . HOH D 4 .   ? 1.084   -13.050 -28.463 1.00 27.37 ? 682 HOH A O   1 
HETATM 2772 O  O   . HOH D 4 .   ? -5.879  -12.402 -26.483 1.00 27.82 ? 683 HOH A O   1 
HETATM 2773 O  O   . HOH D 4 .   ? -21.769 -1.198  -17.824 1.00 36.90 ? 684 HOH A O   1 
HETATM 2774 O  O   . HOH D 4 .   ? -13.501 10.580  -32.745 1.00 39.27 ? 685 HOH A O   1 
HETATM 2775 O  O   . HOH D 4 .   ? 11.197  2.876   4.388   1.00 38.32 ? 686 HOH A O   1 
HETATM 2776 O  O   . HOH E 4 .   ? 10.197  -16.442 -35.592 1.00 34.62 ? 101 HOH B O   1 
HETATM 2777 O  O   . HOH E 4 .   ? 24.413  -12.290 -40.519 1.00 24.76 ? 102 HOH B O   1 
HETATM 2778 O  O   . HOH E 4 .   ? 17.696  -8.923  -21.082 1.00 29.23 ? 103 HOH B O   1 
HETATM 2779 O  O   . HOH E 4 .   ? 14.279  -12.692 -49.381 1.00 44.68 ? 104 HOH B O   1 
HETATM 2780 O  O   . HOH E 4 .   ? 10.955  -5.681  -22.033 1.00 15.50 ? 105 HOH B O   1 
HETATM 2781 O  O   . HOH E 4 .   ? 17.569  -11.112 -19.021 1.00 32.44 ? 106 HOH B O   1 
HETATM 2782 O  O   . HOH E 4 .   ? 12.453  -15.453 -17.383 1.00 35.23 ? 107 HOH B O   1 
HETATM 2783 O  O   . HOH E 4 .   ? 10.971  -11.799 -22.073 1.00 24.11 ? 108 HOH B O   1 
HETATM 2784 O  O   . HOH E 4 .   ? 15.101  -16.610 -49.318 1.00 34.01 ? 109 HOH B O   1 
HETATM 2785 O  O   . HOH E 4 .   ? 8.845   -13.814 -12.423 1.00 26.86 ? 110 HOH B O   1 
HETATM 2786 O  O   . HOH E 4 .   ? 34.764  -7.998  -41.290 1.00 40.35 ? 111 HOH B O   1 
HETATM 2787 O  O   . HOH E 4 .   ? 15.525  -11.093 -12.525 1.00 23.59 ? 112 HOH B O   1 
HETATM 2788 O  O   . HOH E 4 .   ? 16.769  -16.810 -39.530 1.00 31.69 ? 113 HOH B O   1 
HETATM 2789 O  O   . HOH E 4 .   ? 9.732   -14.951 -37.354 1.00 35.95 ? 114 HOH B O   1 
HETATM 2790 O  O   . HOH E 4 .   ? 24.162  -9.192  -47.081 1.00 36.17 ? 115 HOH B O   1 
HETATM 2791 O  O   . HOH E 4 .   ? 6.927   -15.415 -7.722  1.00 44.79 ? 116 HOH B O   1 
HETATM 2792 O  O   . HOH E 4 .   ? 10.510  -14.430 -25.591 1.00 37.77 ? 117 HOH B O   1 
HETATM 2793 O  O   . HOH E 4 .   ? 10.621  -13.308 -27.420 1.00 37.04 ? 118 HOH B O   1 
HETATM 2794 O  O   . HOH E 4 .   ? 16.392  -12.002 -49.989 1.00 40.05 ? 119 HOH B O   1 
HETATM 2795 O  O   . HOH E 4 .   ? 7.073   -21.926 -9.369  1.00 47.75 ? 120 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   44  ?   ?   ?   A . n 
A 1 2   ASN 2   45  ?   ?   ?   A . n 
A 1 3   ALA 3   46  ?   ?   ?   A . n 
A 1 4   PRO 4   47  ?   ?   ?   A . n 
A 1 5   PRO 5   48  48  PRO PRO A . n 
A 1 6   GLY 6   49  49  GLY GLY A . n 
A 1 7   THR 7   50  50  THR THR A . n 
A 1 8   VAL 8   51  51  VAL VAL A . n 
A 1 9   ASP 9   52  52  ASP ASP A . n 
A 1 10  LYS 10  53  53  LYS LYS A . n 
A 1 11  LYS 11  54  54  LYS LYS A . n 
A 1 12  MET 12  55  55  MET MET A . n 
A 1 13  VAL 13  56  56  VAL VAL A . n 
A 1 14  GLU 14  57  57  GLU GLU A . n 
A 1 15  LYS 15  58  58  LYS LYS A . n 
A 1 16  CYS 16  59  59  CYS CYS A . n 
A 1 17  TRP 17  60  60  TRP TRP A . n 
A 1 18  LYS 18  61  61  LYS LYS A . n 
A 1 19  LEU 19  62  62  LEU LEU A . n 
A 1 20  MET 20  63  63  MET MET A . n 
A 1 21  ASP 21  64  64  ASP ASP A . n 
A 1 22  LYS 22  65  65  LYS LYS A . n 
A 1 23  VAL 23  66  66  VAL VAL A . n 
A 1 24  VAL 24  67  67  VAL VAL A . n 
A 1 25  ARG 25  68  68  ARG ARG A . n 
A 1 26  LEU 26  69  69  LEU LEU A . n 
A 1 27  CYS 27  70  70  CYS CYS A . n 
A 1 28  GLN 28  71  71  GLN GLN A . n 
A 1 29  ASN 29  72  72  ASN ASN A . n 
A 1 30  PRO 30  73  73  PRO PRO A . n 
A 1 31  LYS 31  74  74  LYS LYS A . n 
A 1 32  LEU 32  75  75  LEU LEU A . n 
A 1 33  ALA 33  76  76  ALA ALA A . n 
A 1 34  LEU 34  77  77  LEU LEU A . n 
A 1 35  LYS 35  78  78  LYS LYS A . n 
A 1 36  ASN 36  79  79  ASN ASN A . n 
A 1 37  SER 37  80  80  SER SER A . n 
A 1 38  PRO 38  81  81  PRO PRO A . n 
A 1 39  PRO 39  82  82  PRO PRO A . n 
A 1 40  TYR 40  83  83  TYR TYR A . n 
A 1 41  ILE 41  84  84  ILE ILE A . n 
A 1 42  LEU 42  85  85  LEU LEU A . n 
A 1 43  ASP 43  86  86  ASP ASP A . n 
A 1 44  LEU 44  87  87  LEU LEU A . n 
A 1 45  LEU 45  88  88  LEU LEU A . n 
A 1 46  PRO 46  89  89  PRO PRO A . n 
A 1 47  ASP 47  90  90  ASP ASP A . n 
A 1 48  THR 48  91  91  THR THR A . n 
A 1 49  TYR 49  92  92  TYR TYR A . n 
A 1 50  GLN 50  93  93  GLN GLN A . n 
A 1 51  HIS 51  94  94  HIS HIS A . n 
A 1 52  LEU 52  95  95  LEU LEU A . n 
A 1 53  ARG 53  96  96  ARG ARG A . n 
A 1 54  THR 54  97  97  THR THR A . n 
A 1 55  ILE 55  98  98  ILE ILE A . n 
A 1 56  LEU 56  99  99  LEU LEU A . n 
A 1 57  SER 57  100 100 SER SER A . n 
A 1 58  ARG 58  101 101 ARG ARG A . n 
A 1 59  TYR 59  102 102 TYR TYR A . n 
A 1 60  GLU 60  103 103 GLU GLU A . n 
A 1 61  GLY 61  104 104 GLY GLY A . n 
A 1 62  LYS 62  105 105 LYS LYS A . n 
A 1 63  MET 63  106 106 MET MET A . n 
A 1 64  GLU 64  107 107 GLU GLU A . n 
A 1 65  THR 65  108 108 THR THR A . n 
A 1 66  LEU 66  109 109 LEU LEU A . n 
A 1 67  GLY 67  110 110 GLY GLY A . n 
A 1 68  GLU 68  111 111 GLU GLU A . n 
A 1 69  ASN 69  112 112 ASN ASN A . n 
A 1 70  GLU 70  113 113 GLU GLU A . n 
A 1 71  TYR 71  114 114 TYR TYR A . n 
A 1 72  PHE 72  115 115 PHE PHE A . n 
A 1 73  ARG 73  116 116 ARG ARG A . n 
A 1 74  VAL 74  117 117 VAL VAL A . n 
A 1 75  PHE 75  118 118 PHE PHE A . n 
A 1 76  MET 76  119 119 MET MET A . n 
A 1 77  GLU 77  120 120 GLU GLU A . n 
A 1 78  ASN 78  121 121 ASN ASN A . n 
A 1 79  LEU 79  122 122 LEU LEU A . n 
A 1 80  MET 80  123 123 MET MET A . n 
A 1 81  LYS 81  124 124 LYS LYS A . n 
A 1 82  LYS 82  125 125 LYS LYS A . n 
A 1 83  THR 83  126 126 THR THR A . n 
A 1 84  LYS 84  127 127 LYS LYS A . n 
A 1 85  GLN 85  128 128 GLN GLN A . n 
A 1 86  THR 86  129 129 THR THR A . n 
A 1 87  ILE 87  130 130 ILE ILE A . n 
A 1 88  SER 88  131 131 SER SER A . n 
A 1 89  LEU 89  132 132 LEU LEU A . n 
A 1 90  PHE 90  133 133 PHE PHE A . n 
A 1 91  LYS 91  134 134 LYS LYS A . n 
A 1 92  GLU 92  135 135 GLU GLU A . n 
A 1 93  GLY 93  136 136 GLY GLY A . n 
A 1 94  LYS 94  137 137 LYS LYS A . n 
A 1 95  GLU 95  138 138 GLU GLU A . n 
A 1 96  ARG 96  139 139 ARG ARG A . n 
A 1 97  MET 97  140 140 MET MET A . n 
A 1 98  TYR 98  141 141 TYR TYR A . n 
A 1 99  GLU 99  142 142 GLU GLU A . n 
A 1 100 GLU 100 143 143 GLU GLU A . n 
A 1 101 ASN 101 144 144 ASN ASN A . n 
A 1 102 SER 102 145 145 SER SER A . n 
A 1 103 GLN 103 146 146 GLN GLN A . n 
A 1 104 PRO 104 147 147 PRO PRO A . n 
A 1 105 ARG 105 148 148 ARG ARG A . n 
A 1 106 ARG 106 149 149 ARG ARG A . n 
A 1 107 ASN 107 150 150 ASN ASN A . n 
A 1 108 LEU 108 151 151 LEU LEU A . n 
A 1 109 THR 109 152 152 THR THR A . n 
A 1 110 LYS 110 153 153 LYS LYS A . n 
A 1 111 LEU 111 154 154 LEU LEU A . n 
A 1 112 SER 112 155 155 SER SER A . n 
A 1 113 LEU 113 156 156 LEU LEU A . n 
A 1 114 ILE 114 157 157 ILE ILE A . n 
A 1 115 PHE 115 158 158 PHE PHE A . n 
A 1 116 SER 116 159 159 SER SER A . n 
A 1 117 HIS 117 160 160 HIS HIS A . n 
A 1 118 MET 118 161 161 MET MET A . n 
A 1 119 LEU 119 162 162 LEU LEU A . n 
A 1 120 ALA 120 163 163 ALA ALA A . n 
A 1 121 GLU 121 164 164 GLU GLU A . n 
A 1 122 LEU 122 165 165 LEU LEU A . n 
A 1 123 LYS 123 166 166 LYS LYS A . n 
A 1 124 GLY 124 167 167 GLY GLY A . n 
A 1 125 ILE 125 168 168 ILE ILE A . n 
A 1 126 PHE 126 169 169 PHE PHE A . n 
A 1 127 PRO 127 170 170 PRO PRO A . n 
A 1 128 SER 128 171 171 SER SER A . n 
A 1 129 GLY 129 172 172 GLY GLY A . n 
A 1 130 LEU 130 173 173 LEU LEU A . n 
A 1 131 PHE 131 174 174 PHE PHE A . n 
A 1 132 GLN 132 175 175 GLN GLN A . n 
A 1 133 GLY 133 176 176 GLY GLY A . n 
A 1 134 ASP 134 177 177 ASP ASP A . n 
A 1 135 THR 135 178 178 THR THR A . n 
A 1 136 PHE 136 179 179 PHE PHE A . n 
A 1 137 ARG 137 180 180 ARG ARG A . n 
A 1 138 ILE 138 181 181 ILE ILE A . n 
A 1 139 THR 139 182 182 THR THR A . n 
A 1 140 LYS 140 183 183 LYS LYS A . n 
A 1 141 ALA 141 184 184 ALA ALA A . n 
A 1 142 ASP 142 185 185 ASP ASP A . n 
A 1 143 ALA 143 186 186 ALA ALA A . n 
A 1 144 ALA 144 187 187 ALA ALA A . n 
A 1 145 GLU 145 188 188 GLU GLU A . n 
A 1 146 PHE 146 189 189 PHE PHE A . n 
A 1 147 TRP 147 190 190 TRP TRP A . n 
A 1 148 ARG 148 191 191 ARG ARG A . n 
A 1 149 LYS 149 192 192 LYS LYS A . n 
A 1 150 ALA 150 193 193 ALA ALA A . n 
A 1 151 PHE 151 194 194 PHE PHE A . n 
A 1 152 GLY 152 195 195 GLY GLY A . n 
A 1 153 GLU 153 196 196 GLU GLU A . n 
A 1 154 LYS 154 197 197 LYS LYS A . n 
A 1 155 THR 155 198 198 THR THR A . n 
A 1 156 ILE 156 199 199 ILE ILE A . n 
A 1 157 VAL 157 200 200 VAL VAL A . n 
A 1 158 PRO 158 201 201 PRO PRO A . n 
A 1 159 TRP 159 202 202 TRP TRP A . n 
A 1 160 LYS 160 203 203 LYS LYS A . n 
A 1 161 SER 161 204 204 SER SER A . n 
A 1 162 PHE 162 205 205 PHE PHE A . n 
A 1 163 ARG 163 206 206 ARG ARG A . n 
A 1 164 GLN 164 207 207 GLN GLN A . n 
A 1 165 ALA 165 208 208 ALA ALA A . n 
A 1 166 LEU 166 209 209 LEU LEU A . n 
A 1 167 HIS 167 210 210 HIS HIS A . n 
A 1 168 GLU 168 211 211 GLU GLU A . n 
A 1 169 VAL 169 212 212 VAL VAL A . n 
A 1 170 HIS 170 213 213 HIS HIS A . n 
A 1 171 PRO 171 214 214 PRO PRO A . n 
A 1 172 ILE 172 215 215 ILE ILE A . n 
A 1 173 SER 173 216 216 SER SER A . n 
A 1 174 SER 174 217 217 SER SER A . n 
A 1 175 GLY 175 218 218 GLY GLY A . n 
A 1 176 LEU 176 219 219 LEU LEU A . n 
A 1 177 GLU 177 220 220 GLU GLU A . n 
A 1 178 ALA 178 221 221 ALA ALA A . n 
A 1 179 MET 179 222 222 MET MET A . n 
A 1 180 ALA 180 223 223 ALA ALA A . n 
A 1 181 LEU 181 224 224 LEU LEU A . n 
A 1 182 LYS 182 225 225 LYS LYS A . n 
A 1 183 SER 183 226 226 SER SER A . n 
A 1 184 THR 184 227 227 THR THR A . n 
A 1 185 ILE 185 228 228 ILE ILE A . n 
A 1 186 ASP 186 229 229 ASP ASP A . n 
A 1 187 LEU 187 230 230 LEU LEU A . n 
A 1 188 THR 188 231 231 THR THR A . n 
A 1 189 CYS 189 232 232 CYS CYS A . n 
A 1 190 ASN 190 233 233 ASN ASN A . n 
A 1 191 ASP 191 234 234 ASP ASP A . n 
A 1 192 TYR 192 235 235 TYR TYR A . n 
A 1 193 ILE 193 236 236 ILE ILE A . n 
A 1 194 SER 194 237 237 SER SER A . n 
A 1 195 VAL 195 238 238 VAL VAL A . n 
A 1 196 PHE 196 239 239 PHE PHE A . n 
A 1 197 GLU 197 240 240 GLU GLU A . n 
A 1 198 PHE 198 241 241 PHE PHE A . n 
A 1 199 ASP 199 242 242 ASP ASP A . n 
A 1 200 ILE 200 243 243 ILE ILE A . n 
A 1 201 PHE 201 244 244 PHE PHE A . n 
A 1 202 THR 202 245 245 THR THR A . n 
A 1 203 ARG 203 246 246 ARG ARG A . n 
A 1 204 LEU 204 247 247 LEU LEU A . n 
A 1 205 PHE 205 248 248 PHE PHE A . n 
A 1 206 GLN 206 249 249 GLN GLN A . n 
A 1 207 PRO 207 250 250 PRO PRO A . n 
A 1 208 TRP 208 251 251 TRP TRP A . n 
A 1 209 SER 209 252 252 SER SER A . n 
A 1 210 SER 210 253 253 SER SER A . n 
A 1 211 LEU 211 254 254 LEU LEU A . n 
A 1 212 LEU 212 255 255 LEU LEU A . n 
A 1 213 ARG 213 256 256 ARG ARG A . n 
A 1 214 ASN 214 257 257 ASN ASN A . n 
A 1 215 TRP 215 258 258 TRP TRP A . n 
A 1 216 ASN 216 259 259 ASN ASN A . n 
A 1 217 SER 217 260 260 SER SER A . n 
A 1 218 LEU 218 261 261 LEU LEU A . n 
A 1 219 ALA 219 262 262 ALA ALA A . n 
A 1 220 VAL 220 263 263 VAL VAL A . n 
A 1 221 THR 221 264 264 THR THR A . n 
A 1 222 HIS 222 265 265 HIS HIS A . n 
A 1 223 PRO 223 266 266 PRO PRO A . n 
A 1 224 GLY 224 267 267 GLY GLY A . n 
A 1 225 TYR 225 268 268 TYR TYR A . n 
A 1 226 MET 226 269 269 MET MET A . n 
A 1 227 ALA 227 270 270 ALA ALA A . n 
A 1 228 PHE 228 271 271 PHE PHE A . n 
A 1 229 LEU 229 272 272 LEU LEU A . n 
A 1 230 THR 230 273 273 THR THR A . n 
A 1 231 TYR 231 274 274 TYR TYR A . n 
A 1 232 ASP 232 275 275 ASP ASP A . n 
A 1 233 GLU 233 276 276 GLU GLU A . n 
A 1 234 VAL 234 277 277 VAL VAL A . n 
A 1 235 LYS 235 278 278 LYS LYS A . n 
A 1 236 ALA 236 279 279 ALA ALA A . n 
A 1 237 ARG 237 280 280 ARG ARG A . n 
A 1 238 LEU 238 281 281 LEU LEU A . n 
A 1 239 GLN 239 282 282 GLN GLN A . n 
A 1 240 LYS 240 283 283 LYS LYS A . n 
A 1 241 PHE 241 284 284 PHE PHE A . n 
A 1 242 ILE 242 285 285 ILE ILE A . n 
A 1 243 HIS 243 286 286 HIS HIS A . n 
A 1 244 LYS 244 287 287 LYS LYS A . n 
A 1 245 PRO 245 288 288 PRO PRO A . n 
A 1 246 GLY 246 289 289 GLY GLY A . n 
A 1 247 SER 247 290 290 SER SER A . n 
A 1 248 TYR 248 291 291 TYR TYR A . n 
A 1 249 ILE 249 292 292 ILE ILE A . n 
A 1 250 PHE 250 293 293 PHE PHE A . n 
A 1 251 ARG 251 294 294 ARG ARG A . n 
A 1 252 LEU 252 295 295 LEU LEU A . n 
A 1 253 SER 253 296 296 SER SER A . n 
A 1 254 CYS 254 297 297 CYS CYS A . n 
A 1 255 THR 255 298 298 THR THR A . n 
A 1 256 ARG 256 299 299 ARG ARG A . n 
A 1 257 LEU 257 300 300 LEU LEU A . n 
A 1 258 GLY 258 301 301 GLY GLY A . n 
A 1 259 GLN 259 302 302 GLN GLN A . n 
A 1 260 TRP 260 303 303 TRP TRP A . n 
A 1 261 ALA 261 304 304 ALA ALA A . n 
A 1 262 ILE 262 305 305 ILE ILE A . n 
A 1 263 GLY 263 306 306 GLY GLY A . n 
A 1 264 TYR 264 307 307 TYR TYR A . n 
A 1 265 VAL 265 308 308 VAL VAL A . n 
A 1 266 THR 266 309 309 THR THR A . n 
A 1 267 ALA 267 310 310 ALA ALA A . n 
A 1 268 ASP 268 311 311 ASP ASP A . n 
A 1 269 GLY 269 312 312 GLY GLY A . n 
A 1 270 ASN 270 313 313 ASN ASN A . n 
A 1 271 ILE 271 314 314 ILE ILE A . n 
A 1 272 LEU 272 315 315 LEU LEU A . n 
A 1 273 GLN 273 316 316 GLN GLN A . n 
A 1 274 THR 274 317 317 THR THR A . n 
A 1 275 ILE 275 318 318 ILE ILE A . n 
A 1 276 PRO 276 319 319 PRO PRO A . n 
A 1 277 HIS 277 320 320 HIS HIS A . n 
A 1 278 ASN 278 321 321 ASN ASN A . n 
A 1 279 LYS 279 322 322 LYS LYS A . n 
A 1 280 PRO 280 323 323 PRO PRO A . n 
A 1 281 LEU 281 324 324 LEU LEU A . n 
A 1 282 PHE 282 325 325 PHE PHE A . n 
A 1 283 GLN 283 326 326 GLN GLN A . n 
A 1 284 ALA 284 327 327 ALA ALA A . n 
A 1 285 LEU 285 328 328 LEU LEU A . n 
A 1 286 ILE 286 329 329 ILE ILE A . n 
A 1 287 ASP 287 330 330 ASP ASP A . n 
A 1 288 GLY 288 331 331 GLY GLY A . n 
A 1 289 PHE 289 332 332 PHE PHE A . n 
A 1 290 ARG 290 333 333 ARG ARG A . n 
A 1 291 GLU 291 334 334 GLU GLU A . n 
A 1 292 GLY 292 335 335 GLY GLY A . n 
A 1 293 PHE 293 336 336 PHE PHE A . n 
A 1 294 TYR 294 337 337 TYR TYR A . n 
A 1 295 LEU 295 338 338 LEU LEU A . n 
A 1 296 PHE 296 339 339 PHE PHE A . n 
A 1 297 PRO 297 340 340 PRO PRO A . n 
A 1 298 ASP 298 341 341 ASP ASP A . n 
A 1 299 GLY 299 342 342 GLY GLY A . n 
A 1 300 ARG 300 343 343 ARG ARG A . n 
A 1 301 ASN 301 344 344 ASN ASN A . n 
A 1 302 GLN 302 345 345 GLN GLN A . n 
A 1 303 ASN 303 346 346 ASN ASN A . n 
A 1 304 PRO 304 347 347 PRO PRO A . n 
A 1 305 ASP 305 348 348 ASP ASP A . n 
A 1 306 LEU 306 349 349 LEU LEU A . n 
A 1 307 THR 307 350 350 THR THR A . n 
A 1 308 GLY 308 351 ?   ?   ?   A . n 
B 2 1   ACE 1   35  35  ACE ACE B . n 
B 2 2   GLN 2   36  36  GLN GLN B . n 
B 2 3   GLN 3   37  37  GLN GLN B . n 
B 2 4   VAL 4   38  38  VAL VAL B . n 
B 2 5   HIS 5   39  39  HIS HIS B . n 
B 2 6   VAL 6   40  40  VAL VAL B . n 
B 2 7   LEU 7   41  41  LEU LEU B . n 
B 2 8   SER 8   42  42  SER SER B . n 
B 2 9   LEU 9   43  43  LEU LEU B . n 
B 2 10  ASP 10  44  44  ASP ASP B . n 
B 2 11  GLN 11  45  45  GLN GLN B . n 
B 2 12  ILE 12  46  46  ILE ILE B . n 
B 2 13  ARG 13  47  47  ARG ARG B . n 
B 2 14  ALA 14  48  48  ALA ALA B . n 
B 2 15  ILE 15  49  49  ILE ILE B . n 
B 2 16  ARG 16  50  50  ARG ARG B . n 
B 2 17  ASN 17  51  51  ASN ASN B . n 
B 2 18  THR 18  52  52  THR THR B . n 
B 2 19  ASN 19  53  53  ASN ASN B . n 
B 2 20  GLU 20  54  54  GLU GLU B . n 
B 2 21  PTR 21  55  55  PTR PTR B . n 
B 2 22  THR 22  56  56  THR THR B . n 
B 2 23  GLU 23  57  57  GLU GLU B . n 
B 2 24  GLY 24  58  58  GLY GLY B . n 
B 2 25  PRO 25  59  59  PRO PRO B . n 
B 2 26  THR 26  60  ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NA  1   401 1   NA  NA  A . 
D 4 HOH 1   501 112 HOH HOH A . 
D 4 HOH 2   502 103 HOH HOH A . 
D 4 HOH 3   503 177 HOH HOH A . 
D 4 HOH 4   504 46  HOH HOH A . 
D 4 HOH 5   505 181 HOH HOH A . 
D 4 HOH 6   506 200 HOH HOH A . 
D 4 HOH 7   507 189 HOH HOH A . 
D 4 HOH 8   508 24  HOH HOH A . 
D 4 HOH 9   509 184 HOH HOH A . 
D 4 HOH 10  510 25  HOH HOH A . 
D 4 HOH 11  511 95  HOH HOH A . 
D 4 HOH 12  512 70  HOH HOH A . 
D 4 HOH 13  513 142 HOH HOH A . 
D 4 HOH 14  514 173 HOH HOH A . 
D 4 HOH 15  515 100 HOH HOH A . 
D 4 HOH 16  516 110 HOH HOH A . 
D 4 HOH 17  517 48  HOH HOH A . 
D 4 HOH 18  518 130 HOH HOH A . 
D 4 HOH 19  519 202 HOH HOH A . 
D 4 HOH 20  520 139 HOH HOH A . 
D 4 HOH 21  521 98  HOH HOH A . 
D 4 HOH 22  522 93  HOH HOH A . 
D 4 HOH 23  523 2   HOH HOH A . 
D 4 HOH 24  524 109 HOH HOH A . 
D 4 HOH 25  525 125 HOH HOH A . 
D 4 HOH 26  526 5   HOH HOH A . 
D 4 HOH 27  527 71  HOH HOH A . 
D 4 HOH 28  528 42  HOH HOH A . 
D 4 HOH 29  529 9   HOH HOH A . 
D 4 HOH 30  530 40  HOH HOH A . 
D 4 HOH 31  531 68  HOH HOH A . 
D 4 HOH 32  532 44  HOH HOH A . 
D 4 HOH 33  533 171 HOH HOH A . 
D 4 HOH 34  534 161 HOH HOH A . 
D 4 HOH 35  535 53  HOH HOH A . 
D 4 HOH 36  536 151 HOH HOH A . 
D 4 HOH 37  537 41  HOH HOH A . 
D 4 HOH 38  538 126 HOH HOH A . 
D 4 HOH 39  539 8   HOH HOH A . 
D 4 HOH 40  540 19  HOH HOH A . 
D 4 HOH 41  541 179 HOH HOH A . 
D 4 HOH 42  542 90  HOH HOH A . 
D 4 HOH 43  543 67  HOH HOH A . 
D 4 HOH 44  544 58  HOH HOH A . 
D 4 HOH 45  545 89  HOH HOH A . 
D 4 HOH 46  546 11  HOH HOH A . 
D 4 HOH 47  547 20  HOH HOH A . 
D 4 HOH 48  548 10  HOH HOH A . 
D 4 HOH 49  549 143 HOH HOH A . 
D 4 HOH 50  550 205 HOH HOH A . 
D 4 HOH 51  551 85  HOH HOH A . 
D 4 HOH 52  552 129 HOH HOH A . 
D 4 HOH 53  553 123 HOH HOH A . 
D 4 HOH 54  554 186 HOH HOH A . 
D 4 HOH 55  555 15  HOH HOH A . 
D 4 HOH 56  556 16  HOH HOH A . 
D 4 HOH 57  557 3   HOH HOH A . 
D 4 HOH 58  558 13  HOH HOH A . 
D 4 HOH 59  559 197 HOH HOH A . 
D 4 HOH 60  560 79  HOH HOH A . 
D 4 HOH 61  561 21  HOH HOH A . 
D 4 HOH 62  562 72  HOH HOH A . 
D 4 HOH 63  563 120 HOH HOH A . 
D 4 HOH 64  564 7   HOH HOH A . 
D 4 HOH 65  565 135 HOH HOH A . 
D 4 HOH 66  566 6   HOH HOH A . 
D 4 HOH 67  567 4   HOH HOH A . 
D 4 HOH 68  568 51  HOH HOH A . 
D 4 HOH 69  569 131 HOH HOH A . 
D 4 HOH 70  570 159 HOH HOH A . 
D 4 HOH 71  571 165 HOH HOH A . 
D 4 HOH 72  572 147 HOH HOH A . 
D 4 HOH 73  573 32  HOH HOH A . 
D 4 HOH 74  574 29  HOH HOH A . 
D 4 HOH 75  575 157 HOH HOH A . 
D 4 HOH 76  576 153 HOH HOH A . 
D 4 HOH 77  577 56  HOH HOH A . 
D 4 HOH 78  578 119 HOH HOH A . 
D 4 HOH 79  579 204 HOH HOH A . 
D 4 HOH 80  580 52  HOH HOH A . 
D 4 HOH 81  581 84  HOH HOH A . 
D 4 HOH 82  582 62  HOH HOH A . 
D 4 HOH 83  583 105 HOH HOH A . 
D 4 HOH 84  584 199 HOH HOH A . 
D 4 HOH 85  585 133 HOH HOH A . 
D 4 HOH 86  586 94  HOH HOH A . 
D 4 HOH 87  587 49  HOH HOH A . 
D 4 HOH 88  588 115 HOH HOH A . 
D 4 HOH 89  589 57  HOH HOH A . 
D 4 HOH 90  590 63  HOH HOH A . 
D 4 HOH 91  591 132 HOH HOH A . 
D 4 HOH 92  592 101 HOH HOH A . 
D 4 HOH 93  593 148 HOH HOH A . 
D 4 HOH 94  594 122 HOH HOH A . 
D 4 HOH 95  595 78  HOH HOH A . 
D 4 HOH 96  596 30  HOH HOH A . 
D 4 HOH 97  597 22  HOH HOH A . 
D 4 HOH 98  598 106 HOH HOH A . 
D 4 HOH 99  599 99  HOH HOH A . 
D 4 HOH 100 600 155 HOH HOH A . 
D 4 HOH 101 601 192 HOH HOH A . 
D 4 HOH 102 602 107 HOH HOH A . 
D 4 HOH 103 603 23  HOH HOH A . 
D 4 HOH 104 604 185 HOH HOH A . 
D 4 HOH 105 605 176 HOH HOH A . 
D 4 HOH 106 606 59  HOH HOH A . 
D 4 HOH 107 607 114 HOH HOH A . 
D 4 HOH 108 608 39  HOH HOH A . 
D 4 HOH 109 609 31  HOH HOH A . 
D 4 HOH 110 610 73  HOH HOH A . 
D 4 HOH 111 611 55  HOH HOH A . 
D 4 HOH 112 612 47  HOH HOH A . 
D 4 HOH 113 613 104 HOH HOH A . 
D 4 HOH 114 614 65  HOH HOH A . 
D 4 HOH 115 615 83  HOH HOH A . 
D 4 HOH 116 616 12  HOH HOH A . 
D 4 HOH 117 617 166 HOH HOH A . 
D 4 HOH 118 618 145 HOH HOH A . 
D 4 HOH 119 619 34  HOH HOH A . 
D 4 HOH 120 620 43  HOH HOH A . 
D 4 HOH 121 621 175 HOH HOH A . 
D 4 HOH 122 622 187 HOH HOH A . 
D 4 HOH 123 623 170 HOH HOH A . 
D 4 HOH 124 624 54  HOH HOH A . 
D 4 HOH 125 625 33  HOH HOH A . 
D 4 HOH 126 626 37  HOH HOH A . 
D 4 HOH 127 627 26  HOH HOH A . 
D 4 HOH 128 628 28  HOH HOH A . 
D 4 HOH 129 629 35  HOH HOH A . 
D 4 HOH 130 630 75  HOH HOH A . 
D 4 HOH 131 631 36  HOH HOH A . 
D 4 HOH 132 632 82  HOH HOH A . 
D 4 HOH 133 633 64  HOH HOH A . 
D 4 HOH 134 634 144 HOH HOH A . 
D 4 HOH 135 635 163 HOH HOH A . 
D 4 HOH 136 636 172 HOH HOH A . 
D 4 HOH 137 637 96  HOH HOH A . 
D 4 HOH 138 638 160 HOH HOH A . 
D 4 HOH 139 639 18  HOH HOH A . 
D 4 HOH 140 640 111 HOH HOH A . 
D 4 HOH 141 641 76  HOH HOH A . 
D 4 HOH 142 642 128 HOH HOH A . 
D 4 HOH 143 643 124 HOH HOH A . 
D 4 HOH 144 644 134 HOH HOH A . 
D 4 HOH 145 645 87  HOH HOH A . 
D 4 HOH 146 646 92  HOH HOH A . 
D 4 HOH 147 647 77  HOH HOH A . 
D 4 HOH 148 648 141 HOH HOH A . 
D 4 HOH 149 649 118 HOH HOH A . 
D 4 HOH 150 650 50  HOH HOH A . 
D 4 HOH 151 651 178 HOH HOH A . 
D 4 HOH 152 652 183 HOH HOH A . 
D 4 HOH 153 653 116 HOH HOH A . 
D 4 HOH 154 654 201 HOH HOH A . 
D 4 HOH 155 655 190 HOH HOH A . 
D 4 HOH 156 656 203 HOH HOH A . 
D 4 HOH 157 657 162 HOH HOH A . 
D 4 HOH 158 658 66  HOH HOH A . 
D 4 HOH 159 659 174 HOH HOH A . 
D 4 HOH 160 660 156 HOH HOH A . 
D 4 HOH 161 661 152 HOH HOH A . 
D 4 HOH 162 662 1   HOH HOH A . 
D 4 HOH 163 663 140 HOH HOH A . 
D 4 HOH 164 664 69  HOH HOH A . 
D 4 HOH 165 665 194 HOH HOH A . 
D 4 HOH 166 666 80  HOH HOH A . 
D 4 HOH 167 667 196 HOH HOH A . 
D 4 HOH 168 668 117 HOH HOH A . 
D 4 HOH 169 669 154 HOH HOH A . 
D 4 HOH 170 670 188 HOH HOH A . 
D 4 HOH 171 671 164 HOH HOH A . 
D 4 HOH 172 672 81  HOH HOH A . 
D 4 HOH 173 673 149 HOH HOH A . 
D 4 HOH 174 674 97  HOH HOH A . 
D 4 HOH 175 675 191 HOH HOH A . 
D 4 HOH 176 676 168 HOH HOH A . 
D 4 HOH 177 677 86  HOH HOH A . 
D 4 HOH 178 678 138 HOH HOH A . 
D 4 HOH 179 679 195 HOH HOH A . 
D 4 HOH 180 680 193 HOH HOH A . 
D 4 HOH 181 681 61  HOH HOH A . 
D 4 HOH 182 682 60  HOH HOH A . 
D 4 HOH 183 683 91  HOH HOH A . 
D 4 HOH 184 684 146 HOH HOH A . 
D 4 HOH 185 685 74  HOH HOH A . 
D 4 HOH 186 686 182 HOH HOH A . 
E 4 HOH 1   101 150 HOH HOH B . 
E 4 HOH 2   102 38  HOH HOH B . 
E 4 HOH 3   103 121 HOH HOH B . 
E 4 HOH 4   104 167 HOH HOH B . 
E 4 HOH 5   105 14  HOH HOH B . 
E 4 HOH 6   106 88  HOH HOH B . 
E 4 HOH 7   107 206 HOH HOH B . 
E 4 HOH 8   108 17  HOH HOH B . 
E 4 HOH 9   109 137 HOH HOH B . 
E 4 HOH 10  110 45  HOH HOH B . 
E 4 HOH 11  111 102 HOH HOH B . 
E 4 HOH 12  112 27  HOH HOH B . 
E 4 HOH 13  113 108 HOH HOH B . 
E 4 HOH 14  114 127 HOH HOH B . 
E 4 HOH 15  115 113 HOH HOH B . 
E 4 HOH 16  116 136 HOH HOH B . 
E 4 HOH 17  117 158 HOH HOH B . 
E 4 HOH 18  118 198 HOH HOH B . 
E 4 HOH 19  119 169 HOH HOH B . 
E 4 HOH 20  120 180 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     21 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      55 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2400  ? 
1 MORE         -29   ? 
1 'SSA (A^2)'  15030 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OG1 ? A THR 188 ? A THR 231 ? 1_555 96.7  ? 
2  OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 87.1  ? 
3  OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 81.2  ? 
4  OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? A TYR 192 ? A TYR 235 ? 1_555 97.6  ? 
5  OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? A TYR 192 ? A TYR 235 ? 1_555 158.1 ? 
6  OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? A TYR 192 ? A TYR 235 ? 1_555 83.1  ? 
7  OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 132.9 ? 
8  OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 98.2  ? 
9  OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 139.4 ? 
10 O   ? A TYR 192 ? A TYR 235 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 84.1  ? 
11 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 97.8  ? 
12 OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 64.9  ? 
13 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 146.0 ? 
14 O   ? A TYR 192 ? A TYR 235 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 128.9 ? 
15 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 51.0  ? 
16 OD1 ? A ASP 186 ? A ASP 229 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? D HOH .   ? A HOH 558 ? 1_555 162.4 ? 
17 OG1 ? A THR 188 ? A THR 231 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? D HOH .   ? A HOH 558 ? 1_555 67.0  ? 
18 OD1 ? A ASN 190 ? A ASN 233 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? D HOH .   ? A HOH 558 ? 1_555 84.0  ? 
19 O   ? A TYR 192 ? A TYR 235 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? D HOH .   ? A HOH 558 ? 1_555 96.4  ? 
20 OE1 ? A GLU 197 ? A GLU 240 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? D HOH .   ? A HOH 558 ? 1_555 59.4  ? 
21 OE2 ? A GLU 197 ? A GLU 240 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O   ? D HOH .   ? A HOH 558 ? 1_555 81.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-01-18 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support 
2 3 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization' 
2 3 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.2.17 1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.5.6  2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .      3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15   4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .      5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 502 ? ? O A HOH 617 ? ? 2.14 
2 1 O B HOH 117 ? ? O B HOH 118 ? ? 2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 105 ? ? -142.73 43.43   
2 1 LYS A 137 ? ? 49.56   -129.43 
3 1 ARG A 299 ? ? -119.94 71.68   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 53  ? CG  ? A LYS 10  CG  
2   1 Y 1 A LYS 53  ? CD  ? A LYS 10  CD  
3   1 Y 1 A LYS 53  ? CE  ? A LYS 10  CE  
4   1 Y 1 A LYS 53  ? NZ  ? A LYS 10  NZ  
5   1 Y 1 A LYS 54  ? CG  ? A LYS 11  CG  
6   1 Y 1 A LYS 54  ? CD  ? A LYS 11  CD  
7   1 Y 1 A LYS 54  ? CE  ? A LYS 11  CE  
8   1 Y 1 A LYS 54  ? NZ  ? A LYS 11  NZ  
9   1 Y 1 A LYS 61  ? CD  ? A LYS 18  CD  
10  1 Y 1 A LYS 61  ? CE  ? A LYS 18  CE  
11  1 Y 1 A LYS 61  ? NZ  ? A LYS 18  NZ  
12  1 Y 1 A LYS 65  ? CD  ? A LYS 22  CD  
13  1 Y 1 A LYS 65  ? CE  ? A LYS 22  CE  
14  1 Y 1 A LYS 65  ? NZ  ? A LYS 22  NZ  
15  1 Y 1 A LYS 74  ? CD  ? A LYS 31  CD  
16  1 Y 1 A LYS 74  ? CE  ? A LYS 31  CE  
17  1 Y 1 A LYS 74  ? NZ  ? A LYS 31  NZ  
18  1 Y 1 A LYS 78  ? CD  ? A LYS 35  CD  
19  1 Y 1 A LYS 78  ? CE  ? A LYS 35  CE  
20  1 Y 1 A LYS 78  ? NZ  ? A LYS 35  NZ  
21  1 Y 1 A GLU 107 ? CG  ? A GLU 64  CG  
22  1 Y 1 A GLU 107 ? CD  ? A GLU 64  CD  
23  1 Y 1 A GLU 107 ? OE1 ? A GLU 64  OE1 
24  1 Y 1 A GLU 107 ? OE2 ? A GLU 64  OE2 
25  1 Y 1 A GLU 111 ? CD  ? A GLU 68  CD  
26  1 Y 1 A GLU 111 ? OE1 ? A GLU 68  OE1 
27  1 Y 1 A GLU 111 ? OE2 ? A GLU 68  OE2 
28  1 Y 1 A LYS 124 ? CG  ? A LYS 81  CG  
29  1 Y 1 A LYS 124 ? CD  ? A LYS 81  CD  
30  1 Y 1 A LYS 124 ? CE  ? A LYS 81  CE  
31  1 Y 1 A LYS 124 ? NZ  ? A LYS 81  NZ  
32  1 Y 1 A LYS 137 ? CG  ? A LYS 94  CG  
33  1 Y 1 A LYS 137 ? CD  ? A LYS 94  CD  
34  1 Y 1 A LYS 137 ? CE  ? A LYS 94  CE  
35  1 Y 1 A LYS 137 ? NZ  ? A LYS 94  NZ  
36  1 Y 1 A GLU 138 ? CG  ? A GLU 95  CG  
37  1 Y 1 A GLU 138 ? CD  ? A GLU 95  CD  
38  1 Y 1 A GLU 138 ? OE1 ? A GLU 95  OE1 
39  1 Y 1 A GLU 138 ? OE2 ? A GLU 95  OE2 
40  1 Y 1 A ARG 139 ? CG  ? A ARG 96  CG  
41  1 Y 1 A ARG 139 ? CD  ? A ARG 96  CD  
42  1 Y 1 A ARG 139 ? NE  ? A ARG 96  NE  
43  1 Y 1 A ARG 139 ? CZ  ? A ARG 96  CZ  
44  1 Y 1 A ARG 139 ? NH1 ? A ARG 96  NH1 
45  1 Y 1 A ARG 139 ? NH2 ? A ARG 96  NH2 
46  1 Y 1 A GLU 142 ? CG  ? A GLU 99  CG  
47  1 Y 1 A GLU 142 ? CD  ? A GLU 99  CD  
48  1 Y 1 A GLU 142 ? OE1 ? A GLU 99  OE1 
49  1 Y 1 A GLU 142 ? OE2 ? A GLU 99  OE2 
50  1 Y 1 A GLU 143 ? CG  ? A GLU 100 CG  
51  1 Y 1 A GLU 143 ? CD  ? A GLU 100 CD  
52  1 Y 1 A GLU 143 ? OE1 ? A GLU 100 OE1 
53  1 Y 1 A GLU 143 ? OE2 ? A GLU 100 OE2 
54  1 Y 1 A ASN 144 ? CG  ? A ASN 101 CG  
55  1 Y 1 A ASN 144 ? OD1 ? A ASN 101 OD1 
56  1 Y 1 A ASN 144 ? ND2 ? A ASN 101 ND2 
57  1 Y 1 A GLN 146 ? CG  ? A GLN 103 CG  
58  1 Y 1 A GLN 146 ? CD  ? A GLN 103 CD  
59  1 Y 1 A GLN 146 ? OE1 ? A GLN 103 OE1 
60  1 Y 1 A GLN 146 ? NE2 ? A GLN 103 NE2 
61  1 Y 1 A ARG 149 ? CD  ? A ARG 106 CD  
62  1 Y 1 A ARG 149 ? NE  ? A ARG 106 NE  
63  1 Y 1 A ARG 149 ? CZ  ? A ARG 106 CZ  
64  1 Y 1 A ARG 149 ? NH1 ? A ARG 106 NH1 
65  1 Y 1 A ARG 149 ? NH2 ? A ARG 106 NH2 
66  1 Y 1 A ARG 180 ? CD  ? A ARG 137 CD  
67  1 Y 1 A ARG 180 ? NE  ? A ARG 137 NE  
68  1 Y 1 A ARG 180 ? CZ  ? A ARG 137 CZ  
69  1 Y 1 A ARG 180 ? NH1 ? A ARG 137 NH1 
70  1 Y 1 A ARG 180 ? NH2 ? A ARG 137 NH2 
71  1 Y 1 A ARG 191 ? NE  ? A ARG 148 NE  
72  1 Y 1 A ARG 191 ? CZ  ? A ARG 148 CZ  
73  1 Y 1 A ARG 191 ? NH1 ? A ARG 148 NH1 
74  1 Y 1 A ARG 191 ? NH2 ? A ARG 148 NH2 
75  1 Y 1 A LYS 192 ? CD  ? A LYS 149 CD  
76  1 Y 1 A LYS 192 ? CE  ? A LYS 149 CE  
77  1 Y 1 A LYS 192 ? NZ  ? A LYS 149 NZ  
78  1 Y 1 A LYS 203 ? CD  ? A LYS 160 CD  
79  1 Y 1 A LYS 203 ? CE  ? A LYS 160 CE  
80  1 Y 1 A LYS 203 ? NZ  ? A LYS 160 NZ  
81  1 Y 1 A ARG 256 ? NE  ? A ARG 213 NE  
82  1 Y 1 A ARG 256 ? CZ  ? A ARG 213 CZ  
83  1 Y 1 A ARG 256 ? NH1 ? A ARG 213 NH1 
84  1 Y 1 A ARG 256 ? NH2 ? A ARG 213 NH2 
85  1 Y 1 A LYS 278 ? CD  ? A LYS 235 CD  
86  1 Y 1 A LYS 278 ? CE  ? A LYS 235 CE  
87  1 Y 1 A LYS 278 ? NZ  ? A LYS 235 NZ  
88  1 Y 1 A ASN 321 ? CG  ? A ASN 278 CG  
89  1 Y 1 A ASN 321 ? OD1 ? A ASN 278 OD1 
90  1 Y 1 A ASN 321 ? ND2 ? A ASN 278 ND2 
91  1 Y 1 A GLN 345 ? CG  ? A GLN 302 CG  
92  1 Y 1 A GLN 345 ? CD  ? A GLN 302 CD  
93  1 Y 1 A GLN 345 ? OE1 ? A GLN 302 OE1 
94  1 Y 1 A GLN 345 ? NE2 ? A GLN 302 NE2 
95  1 Y 1 B GLN 36  ? CG  ? B GLN 2   CG  
96  1 Y 1 B GLN 36  ? CD  ? B GLN 2   CD  
97  1 Y 1 B GLN 36  ? OE1 ? B GLN 2   OE1 
98  1 Y 1 B GLN 36  ? NE2 ? B GLN 2   NE2 
99  1 Y 1 B GLN 37  ? CG  ? B GLN 3   CG  
100 1 Y 1 B GLN 37  ? CD  ? B GLN 3   CD  
101 1 Y 1 B GLN 37  ? OE1 ? B GLN 3   OE1 
102 1 Y 1 B GLN 37  ? NE2 ? B GLN 3   NE2 
103 1 Y 1 B HIS 39  ? CG  ? B HIS 5   CG  
104 1 Y 1 B HIS 39  ? ND1 ? B HIS 5   ND1 
105 1 Y 1 B HIS 39  ? CD2 ? B HIS 5   CD2 
106 1 Y 1 B HIS 39  ? CE1 ? B HIS 5   CE1 
107 1 Y 1 B HIS 39  ? NE2 ? B HIS 5   NE2 
108 1 Y 1 B ARG 50  ? CG  ? B ARG 16  CG  
109 1 Y 1 B ARG 50  ? CD  ? B ARG 16  CD  
110 1 Y 1 B ARG 50  ? NE  ? B ARG 16  NE  
111 1 Y 1 B ARG 50  ? CZ  ? B ARG 16  CZ  
112 1 Y 1 B ARG 50  ? NH1 ? B ARG 16  NH1 
113 1 Y 1 B ARG 50  ? NH2 ? B ARG 16  NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 44  ? A SER 1   
2 1 Y 1 A ASN 45  ? A ASN 2   
3 1 Y 1 A ALA 46  ? A ALA 3   
4 1 Y 1 A PRO 47  ? A PRO 4   
5 1 Y 1 A GLY 351 ? A GLY 308 
6 1 Y 1 B THR 60  ? B THR 26  
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           '5P20RR017708-10 / 8P20GM103420-10' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SODIUM ION' NA  
4 water        HOH 
#