data_5J1T
# 
_entry.id   5J1T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5J1T         
WWPDB D_1000219790 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5J1S 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5J1T 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Demircioglu, F.E.' 1 
'Schwartz, T.U.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Structures of TorsinA and its disease-mutant complexed with an activator reveal the molecular basis for primary dystonia.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.17983 
_citation.pdbx_database_id_PubMed   27490483 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Demircioglu, F.E.' 1 ? 
primary 'Sosa, B.A.'        2 ? 
primary 'Ingram, J.'        3 ? 
primary 'Ploegh, H.L.'      4 ? 
primary 'Schwartz, T.U.'    5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5J1T 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     75.435 
_cell.length_a_esd                 ? 
_cell.length_b                     88.445 
_cell.length_b_esd                 ? 
_cell.length_c                     105.331 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5J1T 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Torsin-1A                                                          32614.311 1   3.6.4.- 'E171Q, deltaE302/303' 
? ? 
2 polymer     man 'Torsin-1A-interacting protein 2'                                  26729.896 1   ?       ?                      
? ? 
3 polymer     man 'VHH domain BS-2'                                                  13296.745 1   ?       ?                      
? ? 
4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                                        507.181   1   ?       ?                      
? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                    24.305    1   ?       ?                      
? ? 
6 non-polymer syn 'CHLORIDE ION'                                                     35.453    1   ?       ?                      
? ? 
7 non-polymer syn '2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' 209.240   2   ?       ?                      
? ? 
8 water       nat water                                                              18.015    631 ?       ?                      
? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Dystonia 1 protein,Torsin ATPase-1A,Torsin family 1 member A' 
2 'Lumenal domain-like LAP1'                                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPGQKRSLSREALQKDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDY
VHLFVATLHFPHASNITLYKDQLQLWIRGNVSACARSIFIFDQMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSN
AGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSR
GYEIDEDIVSRVAEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
;
;GPGQKRSLSREALQKDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDY
VHLFVATLHFPHASNITLYKDQLQLWIRGNVSACARSIFIFDQMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSN
AGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSR
GYEIDEDIVSRVAEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
;
A ? 
2 'polypeptide(L)' no no 
;MSSVNSYYSSPAQQVPKNPALEAFLAQFSQLEDKFPGQSSFLWQRGRKFLQKHLNASNPTEPATIIFTAAREGRETLKCL
SHHVADAYTSSQKVSPIQIDGAGRTWQDSDTVKLLVDLELSYGFENGQKAAVVHHFESFPAGSTLIFYKYCDHENAAFKD
VALVLTVLLEEETLEASVGPRETEEKVRDLLWAKFTNSDTPTSFNHMDSDKLSGLWSRISHLVLPVQPVSSIEEQGCLF
;
;MSSVNSYYSSPAQQVPKNPALEAFLAQFSQLEDKFPGQSSFLWQRGRKFLQKHLNASNPTEPATIIFTAAREGRETLKCL
SHHVADAYTSSQKVSPIQIDGAGRTWQDSDTVKLLVDLELSYGFENGQKAAVVHHFESFPAGSTLIFYKYCDHENAAFKD
VALVLTVLLEEETLEASVGPRETEEKVRDLLWAKFTNSDTPTSFNHMDSDKLSGLWSRISHLVLPVQPVSSIEEQGCLF
;
B ? 
3 'polypeptide(L)' no no 
;MQVQLVETGGGLVQAGGSLRLSCAASGNIFSFNVMGWYRQAPGKQRELVAAITSGDTTTYADSVQGRFTISRDNAKNAVY
LQMNSLTPEDTAVYFCNARRNPINGPYYTTAYWGQGTQVTVSS
;
;MQVQLVETGGGLVQAGGSLRLSCAASGNIFSFNVMGWYRQAPGKQRELVAAITSGDTTTYADSVQGRFTISRDNAKNAVY
LQMNSLTPEDTAVYFCNARRNPINGPYYTTAYWGQGTQVTVSS
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   GLN n 
1 5   LYS n 
1 6   ARG n 
1 7   SER n 
1 8   LEU n 
1 9   SER n 
1 10  ARG n 
1 11  GLU n 
1 12  ALA n 
1 13  LEU n 
1 14  GLN n 
1 15  LYS n 
1 16  ASP n 
1 17  LEU n 
1 18  ASP n 
1 19  ASP n 
1 20  ASN n 
1 21  LEU n 
1 22  PHE n 
1 23  GLY n 
1 24  GLN n 
1 25  HIS n 
1 26  LEU n 
1 27  ALA n 
1 28  LYS n 
1 29  LYS n 
1 30  ILE n 
1 31  ILE n 
1 32  LEU n 
1 33  ASN n 
1 34  ALA n 
1 35  VAL n 
1 36  PHE n 
1 37  GLY n 
1 38  PHE n 
1 39  ILE n 
1 40  ASN n 
1 41  ASN n 
1 42  PRO n 
1 43  LYS n 
1 44  PRO n 
1 45  LYS n 
1 46  LYS n 
1 47  PRO n 
1 48  LEU n 
1 49  THR n 
1 50  LEU n 
1 51  SER n 
1 52  LEU n 
1 53  HIS n 
1 54  GLY n 
1 55  TRP n 
1 56  THR n 
1 57  GLY n 
1 58  THR n 
1 59  GLY n 
1 60  LYS n 
1 61  ASN n 
1 62  PHE n 
1 63  VAL n 
1 64  SER n 
1 65  LYS n 
1 66  ILE n 
1 67  ILE n 
1 68  ALA n 
1 69  GLU n 
1 70  ASN n 
1 71  ILE n 
1 72  TYR n 
1 73  GLU n 
1 74  GLY n 
1 75  GLY n 
1 76  LEU n 
1 77  ASN n 
1 78  SER n 
1 79  ASP n 
1 80  TYR n 
1 81  VAL n 
1 82  HIS n 
1 83  LEU n 
1 84  PHE n 
1 85  VAL n 
1 86  ALA n 
1 87  THR n 
1 88  LEU n 
1 89  HIS n 
1 90  PHE n 
1 91  PRO n 
1 92  HIS n 
1 93  ALA n 
1 94  SER n 
1 95  ASN n 
1 96  ILE n 
1 97  THR n 
1 98  LEU n 
1 99  TYR n 
1 100 LYS n 
1 101 ASP n 
1 102 GLN n 
1 103 LEU n 
1 104 GLN n 
1 105 LEU n 
1 106 TRP n 
1 107 ILE n 
1 108 ARG n 
1 109 GLY n 
1 110 ASN n 
1 111 VAL n 
1 112 SER n 
1 113 ALA n 
1 114 CYS n 
1 115 ALA n 
1 116 ARG n 
1 117 SER n 
1 118 ILE n 
1 119 PHE n 
1 120 ILE n 
1 121 PHE n 
1 122 ASP n 
1 123 GLN n 
1 124 MET n 
1 125 ASP n 
1 126 LYS n 
1 127 MET n 
1 128 HIS n 
1 129 ALA n 
1 130 GLY n 
1 131 LEU n 
1 132 ILE n 
1 133 ASP n 
1 134 ALA n 
1 135 ILE n 
1 136 LYS n 
1 137 PRO n 
1 138 PHE n 
1 139 LEU n 
1 140 ASP n 
1 141 TYR n 
1 142 TYR n 
1 143 ASP n 
1 144 LEU n 
1 145 VAL n 
1 146 ASP n 
1 147 GLY n 
1 148 VAL n 
1 149 SER n 
1 150 TYR n 
1 151 GLN n 
1 152 LYS n 
1 153 ALA n 
1 154 MET n 
1 155 PHE n 
1 156 ILE n 
1 157 PHE n 
1 158 LEU n 
1 159 SER n 
1 160 ASN n 
1 161 ALA n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 ARG n 
1 166 ILE n 
1 167 THR n 
1 168 ASP n 
1 169 VAL n 
1 170 ALA n 
1 171 LEU n 
1 172 ASP n 
1 173 PHE n 
1 174 TRP n 
1 175 ARG n 
1 176 SER n 
1 177 GLY n 
1 178 LYS n 
1 179 GLN n 
1 180 ARG n 
1 181 GLU n 
1 182 ASP n 
1 183 ILE n 
1 184 LYS n 
1 185 LEU n 
1 186 LYS n 
1 187 ASP n 
1 188 ILE n 
1 189 GLU n 
1 190 HIS n 
1 191 ALA n 
1 192 LEU n 
1 193 SER n 
1 194 VAL n 
1 195 SER n 
1 196 VAL n 
1 197 PHE n 
1 198 ASN n 
1 199 ASN n 
1 200 LYS n 
1 201 ASN n 
1 202 SER n 
1 203 GLY n 
1 204 PHE n 
1 205 TRP n 
1 206 HIS n 
1 207 SER n 
1 208 SER n 
1 209 LEU n 
1 210 ILE n 
1 211 ASP n 
1 212 ARG n 
1 213 ASN n 
1 214 LEU n 
1 215 ILE n 
1 216 ASP n 
1 217 TYR n 
1 218 PHE n 
1 219 VAL n 
1 220 PRO n 
1 221 PHE n 
1 222 LEU n 
1 223 PRO n 
1 224 LEU n 
1 225 GLU n 
1 226 TYR n 
1 227 LYS n 
1 228 HIS n 
1 229 LEU n 
1 230 LYS n 
1 231 MET n 
1 232 CYS n 
1 233 ILE n 
1 234 ARG n 
1 235 VAL n 
1 236 GLU n 
1 237 MET n 
1 238 GLN n 
1 239 SER n 
1 240 ARG n 
1 241 GLY n 
1 242 TYR n 
1 243 GLU n 
1 244 ILE n 
1 245 ASP n 
1 246 GLU n 
1 247 ASP n 
1 248 ILE n 
1 249 VAL n 
1 250 SER n 
1 251 ARG n 
1 252 VAL n 
1 253 ALA n 
1 254 GLU n 
1 255 MET n 
1 256 THR n 
1 257 PHE n 
1 258 PHE n 
1 259 PRO n 
1 260 LYS n 
1 261 GLU n 
1 262 GLU n 
1 263 ARG n 
1 264 VAL n 
1 265 PHE n 
1 266 SER n 
1 267 ASP n 
1 268 LYS n 
1 269 GLY n 
1 270 CYS n 
1 271 LYS n 
1 272 THR n 
1 273 VAL n 
1 274 PHE n 
1 275 THR n 
1 276 LYS n 
1 277 LEU n 
1 278 ASP n 
1 279 TYR n 
1 280 TYR n 
1 281 TYR n 
1 282 ASP n 
1 283 ASP n 
2 1   MET n 
2 2   SER n 
2 3   SER n 
2 4   VAL n 
2 5   ASN n 
2 6   SER n 
2 7   TYR n 
2 8   TYR n 
2 9   SER n 
2 10  SER n 
2 11  PRO n 
2 12  ALA n 
2 13  GLN n 
2 14  GLN n 
2 15  VAL n 
2 16  PRO n 
2 17  LYS n 
2 18  ASN n 
2 19  PRO n 
2 20  ALA n 
2 21  LEU n 
2 22  GLU n 
2 23  ALA n 
2 24  PHE n 
2 25  LEU n 
2 26  ALA n 
2 27  GLN n 
2 28  PHE n 
2 29  SER n 
2 30  GLN n 
2 31  LEU n 
2 32  GLU n 
2 33  ASP n 
2 34  LYS n 
2 35  PHE n 
2 36  PRO n 
2 37  GLY n 
2 38  GLN n 
2 39  SER n 
2 40  SER n 
2 41  PHE n 
2 42  LEU n 
2 43  TRP n 
2 44  GLN n 
2 45  ARG n 
2 46  GLY n 
2 47  ARG n 
2 48  LYS n 
2 49  PHE n 
2 50  LEU n 
2 51  GLN n 
2 52  LYS n 
2 53  HIS n 
2 54  LEU n 
2 55  ASN n 
2 56  ALA n 
2 57  SER n 
2 58  ASN n 
2 59  PRO n 
2 60  THR n 
2 61  GLU n 
2 62  PRO n 
2 63  ALA n 
2 64  THR n 
2 65  ILE n 
2 66  ILE n 
2 67  PHE n 
2 68  THR n 
2 69  ALA n 
2 70  ALA n 
2 71  ARG n 
2 72  GLU n 
2 73  GLY n 
2 74  ARG n 
2 75  GLU n 
2 76  THR n 
2 77  LEU n 
2 78  LYS n 
2 79  CYS n 
2 80  LEU n 
2 81  SER n 
2 82  HIS n 
2 83  HIS n 
2 84  VAL n 
2 85  ALA n 
2 86  ASP n 
2 87  ALA n 
2 88  TYR n 
2 89  THR n 
2 90  SER n 
2 91  SER n 
2 92  GLN n 
2 93  LYS n 
2 94  VAL n 
2 95  SER n 
2 96  PRO n 
2 97  ILE n 
2 98  GLN n 
2 99  ILE n 
2 100 ASP n 
2 101 GLY n 
2 102 ALA n 
2 103 GLY n 
2 104 ARG n 
2 105 THR n 
2 106 TRP n 
2 107 GLN n 
2 108 ASP n 
2 109 SER n 
2 110 ASP n 
2 111 THR n 
2 112 VAL n 
2 113 LYS n 
2 114 LEU n 
2 115 LEU n 
2 116 VAL n 
2 117 ASP n 
2 118 LEU n 
2 119 GLU n 
2 120 LEU n 
2 121 SER n 
2 122 TYR n 
2 123 GLY n 
2 124 PHE n 
2 125 GLU n 
2 126 ASN n 
2 127 GLY n 
2 128 GLN n 
2 129 LYS n 
2 130 ALA n 
2 131 ALA n 
2 132 VAL n 
2 133 VAL n 
2 134 HIS n 
2 135 HIS n 
2 136 PHE n 
2 137 GLU n 
2 138 SER n 
2 139 PHE n 
2 140 PRO n 
2 141 ALA n 
2 142 GLY n 
2 143 SER n 
2 144 THR n 
2 145 LEU n 
2 146 ILE n 
2 147 PHE n 
2 148 TYR n 
2 149 LYS n 
2 150 TYR n 
2 151 CYS n 
2 152 ASP n 
2 153 HIS n 
2 154 GLU n 
2 155 ASN n 
2 156 ALA n 
2 157 ALA n 
2 158 PHE n 
2 159 LYS n 
2 160 ASP n 
2 161 VAL n 
2 162 ALA n 
2 163 LEU n 
2 164 VAL n 
2 165 LEU n 
2 166 THR n 
2 167 VAL n 
2 168 LEU n 
2 169 LEU n 
2 170 GLU n 
2 171 GLU n 
2 172 GLU n 
2 173 THR n 
2 174 LEU n 
2 175 GLU n 
2 176 ALA n 
2 177 SER n 
2 178 VAL n 
2 179 GLY n 
2 180 PRO n 
2 181 ARG n 
2 182 GLU n 
2 183 THR n 
2 184 GLU n 
2 185 GLU n 
2 186 LYS n 
2 187 VAL n 
2 188 ARG n 
2 189 ASP n 
2 190 LEU n 
2 191 LEU n 
2 192 TRP n 
2 193 ALA n 
2 194 LYS n 
2 195 PHE n 
2 196 THR n 
2 197 ASN n 
2 198 SER n 
2 199 ASP n 
2 200 THR n 
2 201 PRO n 
2 202 THR n 
2 203 SER n 
2 204 PHE n 
2 205 ASN n 
2 206 HIS n 
2 207 MET n 
2 208 ASP n 
2 209 SER n 
2 210 ASP n 
2 211 LYS n 
2 212 LEU n 
2 213 SER n 
2 214 GLY n 
2 215 LEU n 
2 216 TRP n 
2 217 SER n 
2 218 ARG n 
2 219 ILE n 
2 220 SER n 
2 221 HIS n 
2 222 LEU n 
2 223 VAL n 
2 224 LEU n 
2 225 PRO n 
2 226 VAL n 
2 227 GLN n 
2 228 PRO n 
2 229 VAL n 
2 230 SER n 
2 231 SER n 
2 232 ILE n 
2 233 GLU n 
2 234 GLU n 
2 235 GLN n 
2 236 GLY n 
2 237 CYS n 
2 238 LEU n 
2 239 PHE n 
3 1   MET n 
3 2   GLN n 
3 3   VAL n 
3 4   GLN n 
3 5   LEU n 
3 6   VAL n 
3 7   GLU n 
3 8   THR n 
3 9   GLY n 
3 10  GLY n 
3 11  GLY n 
3 12  LEU n 
3 13  VAL n 
3 14  GLN n 
3 15  ALA n 
3 16  GLY n 
3 17  GLY n 
3 18  SER n 
3 19  LEU n 
3 20  ARG n 
3 21  LEU n 
3 22  SER n 
3 23  CYS n 
3 24  ALA n 
3 25  ALA n 
3 26  SER n 
3 27  GLY n 
3 28  ASN n 
3 29  ILE n 
3 30  PHE n 
3 31  SER n 
3 32  PHE n 
3 33  ASN n 
3 34  VAL n 
3 35  MET n 
3 36  GLY n 
3 37  TRP n 
3 38  TYR n 
3 39  ARG n 
3 40  GLN n 
3 41  ALA n 
3 42  PRO n 
3 43  GLY n 
3 44  LYS n 
3 45  GLN n 
3 46  ARG n 
3 47  GLU n 
3 48  LEU n 
3 49  VAL n 
3 50  ALA n 
3 51  ALA n 
3 52  ILE n 
3 53  THR n 
3 54  SER n 
3 55  GLY n 
3 56  ASP n 
3 57  THR n 
3 58  THR n 
3 59  THR n 
3 60  TYR n 
3 61  ALA n 
3 62  ASP n 
3 63  SER n 
3 64  VAL n 
3 65  GLN n 
3 66  GLY n 
3 67  ARG n 
3 68  PHE n 
3 69  THR n 
3 70  ILE n 
3 71  SER n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  ALA n 
3 76  LYS n 
3 77  ASN n 
3 78  ALA n 
3 79  VAL n 
3 80  TYR n 
3 81  LEU n 
3 82  GLN n 
3 83  MET n 
3 84  ASN n 
3 85  SER n 
3 86  LEU n 
3 87  THR n 
3 88  PRO n 
3 89  GLU n 
3 90  ASP n 
3 91  THR n 
3 92  ALA n 
3 93  VAL n 
3 94  TYR n 
3 95  PHE n 
3 96  CYS n 
3 97  ASN n 
3 98  ALA n 
3 99  ARG n 
3 100 ARG n 
3 101 ASN n 
3 102 PRO n 
3 103 ILE n 
3 104 ASN n 
3 105 GLY n 
3 106 PRO n 
3 107 TYR n 
3 108 TYR n 
3 109 THR n 
3 110 THR n 
3 111 ALA n 
3 112 TYR n 
3 113 TRP n 
3 114 GLY n 
3 115 GLN n 
3 116 GLY n 
3 117 THR n 
3 118 GLN n 
3 119 VAL n 
3 120 THR n 
3 121 VAL n 
3 122 SER n 
3 123 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 283 Human ? 'TOR1A, DQ2, DYT1, TA, TORA' ? ? ? ? ? ? 'Homo sapiens'  9606  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? LOBSTR ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 239 Human ? 'TOR1AIP2, IFRG15, LULL1'    ? ? ? ? ? ? 'Homo sapiens'  9606  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? LOBSTR ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 123 ?     ? ?                            ? ? ? ? ? ? 'Vicugna pacos' 30538 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? LOBSTR ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TOR1A_HUMAN O14656 ? 1 
;GQKRSLSREALQKDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDYVH
LFVATLHFPHASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSNAG
AERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGY
EIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD
;
51  
2 UNP TOIP2_HUMAN Q8NFQ8 ? 2 
;SSVNSYYSSPAQQVPKNPALEAFLAQFSQLEDKFPGQSSFLWQRGRKFLQKHLNASNPTEPATIIFTAAREGRETLKCLS
HHVADAYTSSQKVSPIQIDGAGRTWQDSDTVKLLVDLELSYGFENGQKAAVVHHFESFPAGSTLIFYKYCDHENAAFKDV
ALVLTVLLEEETLEASVGPRETEEKVRDLLWAKFTNSDTPTSFNHMDSDKLSGLWSRISHLVLPVQPVSSIEEQGCLF
;
233 
3 PDB 5J1T        5J1T   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5J1T A 3 ? 283 ? O14656 51  ? 332 ? 51  331 
2 2 5J1T B 2 ? 239 ? Q8NFQ8 233 ? 470 ? 233 470 
3 3 5J1T C 1 ? 123 ? 5J1T   1   ? 123 ? 1   123 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5J1T GLY A 1   ? UNP O14656 ?   ?   'expression tag'        49  1 
1 5J1T PRO A 2   ? UNP O14656 ?   ?   'expression tag'        50  2 
1 5J1T GLN A 123 ? UNP O14656 GLU 171 'engineered mutation'   171 3 
1 5J1T ?   A ?   ? UNP O14656 GLU 302 deletion                ?   4 
2 5J1T MET B 1   ? UNP Q8NFQ8 ?   ?   'initiating methionine' 232 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                            ?                 'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking' y ARGININE                                                           ?                 'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                         ?                 'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                    ?                 'C4 H7 N O4'        
133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"                                        ?                 'C10 H16 N5 O13 P3' 
507.181 
BTB non-polymer         . '2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' 'BIS-TRIS BUFFER' 'C8 H19 N O5'       
209.240 
CL  non-polymer         . 'CHLORIDE ION'                                                     ?                 'Cl -1'             
35.453  
CYS 'L-peptide linking' y CYSTEINE                                                           ?                 'C3 H7 N O2 S'      
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                          ?                 'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                    ?                 'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                                            ?                 'C2 H5 N O2'        
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                          ?                 'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                                                              ?                 'H2 O'              
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                         ?                 'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                                            ?                 'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                                             ?                 'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                                         ?                 'C5 H11 N O2 S'     
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                    ?                 'Mg 2'              
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                      ?                 'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                                            ?                 'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                                             ?                 'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                                                          ?                 'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                         ?                 'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                                                           ?                 'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                                                             ?                 'C5 H11 N O2'       
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5J1T 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.42 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.14 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;19 % PEG3350
200 mM ammonium sulfate
100 mM Bis-Tris/HCl pH 6.5
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-22 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            16.72 
_reflns.entry_id                         5J1T 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.402 
_reflns.d_resolution_low                 67.733 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       134334 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.06 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.10 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            30.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                64.790 
_refine.B_iso_mean                               25.3491 
_refine.B_iso_min                                10.840 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5J1T 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.4020 
_refine.ls_d_res_low                             67.7330 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     134334 
_refine.ls_number_reflns_R_free                  2182 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.0600 
_refine.ls_percent_reflns_R_free                 1.6200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1485 
_refine.ls_R_factor_R_free                       0.1768 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1480 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.0000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.4020 
_refine_hist.d_res_low                        67.7330 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             631 
_refine_hist.number_atoms_total               5716 
_refine_hist.pdbx_number_residues_total       633 
_refine_hist.pdbx_B_iso_mean_ligand           20.65 
_refine_hist.pdbx_B_iso_mean_solvent          35.47 
_refine_hist.pdbx_number_atoms_protein        5024 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.017  ? 5496 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.708  ? 7485 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.089  ? 806  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.009  ? 963  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.672 ? 2013 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.4015 1.4320  7099 . 114 6985 83.0000 . . . 0.2917 . 0.2759 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.4320 1.4653  8272 . 134 8138 97.0000 . . . 0.2605 . 0.2422 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.4653 1.5020  8320 . 135 8185 97.0000 . . . 0.2641 . 0.2101 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.5020 1.5426  8339 . 137 8202 97.0000 . . . 0.2287 . 0.1865 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.5426 1.5880  8296 . 136 8160 97.0000 . . . 0.2000 . 0.1697 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.5880 1.6392  8398 . 134 8264 98.0000 . . . 0.1972 . 0.1440 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.6392 1.6978  8409 . 136 8273 98.0000 . . . 0.1676 . 0.1344 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.6978 1.7658  8456 . 137 8319 98.0000 . . . 0.1928 . 0.1272 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.7658 1.8462  8468 . 138 8330 98.0000 . . . 0.1855 . 0.1163 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.8462 1.9435  8390 . 137 8253 97.0000 . . . 0.1576 . 0.1139 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 1.9435 2.0653  8535 . 139 8396 99.0000 . . . 0.1557 . 0.1177 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 2.0653 2.2248  8546 . 140 8406 99.0000 . . . 0.1549 . 0.1226 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 2.2248 2.4486  8493 . 137 8356 98.0000 . . . 0.1760 . 0.1336 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 2.4486 2.8030  8678 . 139 8539 99.0000 . . . 0.2018 . 0.1516 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 2.8030 3.5314  8655 . 143 8512 98.0000 . . . 0.1481 . 0.1537 . . . . . . 16 . . . 
'X-RAY DIFFRACTION' 3.5314 67.8124 8980 . 146 8834 99.0000 . . . 0.1736 . 0.1574 . . . . . . 16 . . . 
# 
_struct.entry_id                     5J1T 
_struct.title                        'TorsinAdeltaE-LULL1 complex, H. sapiens, bound to VHH-BS2' 
_struct.pdbx_descriptor              'Torsin-1A (E.C.3.6.4.-), Torsin-1A-interacting protein 2, VHH domain BS-2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5J1T 
_struct_keywords.text            'AAA+ ATPase, Torsin, endoplasmic reticulum, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
K N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 9   ? LEU A 21  ? SER A 57  LEU A 69  1 ? 13 
HELX_P HELX_P2  AA2 GLN A 24  ? ASN A 40  ? GLN A 72  ASN A 88  1 ? 17 
HELX_P HELX_P3  AA3 GLY A 59  ? TYR A 72  ? GLY A 107 TYR A 120 1 ? 14 
HELX_P HELX_P4  AA4 GLY A 74  ? SER A 78  ? GLY A 122 SER A 126 5 ? 5  
HELX_P HELX_P5  AA5 ALA A 86  ? PHE A 90  ? ALA A 134 PHE A 138 1 ? 5  
HELX_P HELX_P6  AA6 HIS A 92  ? SER A 94  ? HIS A 140 SER A 142 5 ? 3  
HELX_P HELX_P7  AA7 ASN A 95  ? CYS A 114 ? ASN A 143 CYS A 162 1 ? 20 
HELX_P HELX_P8  AA8 GLN A 123 ? MET A 127 ? GLN A 171 MET A 175 5 ? 5  
HELX_P HELX_P9  AA9 HIS A 128 ? ASP A 140 ? HIS A 176 ASP A 188 1 ? 13 
HELX_P HELX_P10 AB1 GLY A 162 ? SER A 176 ? GLY A 210 SER A 224 1 ? 15 
HELX_P HELX_P11 AB2 GLN A 179 ? ILE A 183 ? GLN A 227 ILE A 231 5 ? 5  
HELX_P HELX_P12 AB3 LYS A 184 ? SER A 193 ? LYS A 232 SER A 241 1 ? 10 
HELX_P HELX_P13 AB4 ASN A 198 ? TRP A 205 ? ASN A 246 TRP A 253 1 ? 8  
HELX_P HELX_P14 AB5 GLU A 225 ? ARG A 240 ? GLU A 273 ARG A 288 1 ? 16 
HELX_P HELX_P15 AB6 ASP A 245 ? ALA A 253 ? ASP A 293 ALA A 301 1 ? 9  
HELX_P HELX_P16 AB7 VAL A 273 ? TYR A 280 ? VAL A 321 TYR A 328 5 ? 8  
HELX_P HELX_P17 AB8 SER B 10  ? GLN B 14  ? SER B 241 GLN B 245 5 ? 5  
HELX_P HELX_P18 AB9 ASN B 18  ? PHE B 35  ? ASN B 249 PHE B 266 1 ? 18 
HELX_P HELX_P19 AC1 SER B 39  ? ASN B 55  ? SER B 270 ASN B 286 1 ? 17 
HELX_P HELX_P20 AC2 GLY B 73  ? TYR B 88  ? GLY B 304 TYR B 319 1 ? 16 
HELX_P HELX_P21 AC3 ASP B 108 ? ASN B 126 ? ASP B 339 ASN B 357 1 ? 19 
HELX_P HELX_P22 AC4 HIS B 135 ? PHE B 139 ? HIS B 366 PHE B 370 5 ? 5  
HELX_P HELX_P23 AC5 PRO B 140 ? THR B 144 ? PRO B 371 THR B 375 5 ? 5  
HELX_P HELX_P24 AC6 LEU B 145 ? ASP B 152 ? LEU B 376 ASP B 383 1 ? 8  
HELX_P HELX_P25 AC7 GLY B 179 ? THR B 196 ? GLY B 410 THR B 427 1 ? 18 
HELX_P HELX_P26 AC8 ASP B 208 ? SER B 220 ? ASP B 439 SER B 451 1 ? 13 
HELX_P HELX_P27 AC9 VAL B 229 ? GLY B 236 ? VAL B 460 GLY B 467 1 ? 8  
HELX_P HELX_P28 AD1 ASP C 62  ? GLN C 65  ? ASP C 62  GLN C 65  5 ? 4  
HELX_P HELX_P29 AD2 THR C 87  ? THR C 91  ? THR C 87  THR C 91  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 79 SG  ? ? ? 1_555 B CYS 237 SG ? ? B CYS 310 B CYS 468 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc1 metalc ? ? A ASN 61 OD1 ? ? ? 1_555 E MG  .   MG ? ? A ASN 109 A MG  402 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc2 metalc ? ? D ATP .  O2G ? ? ? 1_555 E MG  .   MG ? ? A ATP 401 A MG  402 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc3 metalc ? ? D ATP .  O2B ? ? ? 1_555 E MG  .   MG ? ? A ATP 401 A MG  402 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc4 metalc ? ? E MG  .  MG  ? ? ? 1_555 I HOH .   O  ? ? A MG  402 A HOH 573 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc5 metalc ? ? E MG  .  MG  ? ? ? 1_555 I HOH .   O  ? ? A MG  402 A HOH 548 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc6 metalc ? ? E MG  .  MG  ? ? ? 1_555 I HOH .   O  ? ? A MG  402 A HOH 537 1_555 ? ? ? ? ? ? ? 2.093 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PHE 
_struct_mon_prot_cis.label_seq_id           258 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PHE 
_struct_mon_prot_cis.auth_seq_id            306 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    259 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     307 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -13.46 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 4 ? 
AA5 ? 6 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 81  ? VAL A 85  ? VAL A 129 VAL A 133 
AA1 2 ILE A 118 ? ASP A 122 ? ILE A 166 ASP A 170 
AA1 3 MET A 154 ? SER A 159 ? MET A 202 SER A 207 
AA1 4 LEU A 48  ? GLY A 54  ? LEU A 96  GLY A 102 
AA1 5 TYR A 217 ? PHE A 221 ? TYR A 265 PHE A 269 
AA2 1 PHE A 257 ? PHE A 258 ? PHE A 305 PHE A 306 
AA2 2 PHE A 265 ? SER A 266 ? PHE A 313 SER A 314 
AA3 1 ILE B 97  ? ASP B 100 ? ILE B 328 ASP B 331 
AA3 2 ALA B 130 ? HIS B 134 ? ALA B 361 HIS B 365 
AA3 3 ALA B 162 ? LEU B 168 ? ALA B 393 LEU B 399 
AA3 4 ALA B 63  ? ALA B 69  ? ALA B 294 ALA B 300 
AA3 5 VAL B 223 ? VAL B 226 ? VAL B 454 VAL B 457 
AA4 1 LEU C 5   ? THR C 8   ? LEU C 5   THR C 8   
AA4 2 LEU C 19  ? ALA C 25  ? LEU C 19  ALA C 25  
AA4 3 ALA C 78  ? MET C 83  ? ALA C 78  MET C 83  
AA4 4 PHE C 68  ? ASP C 73  ? PHE C 68  ASP C 73  
AA5 1 GLY C 11  ? GLN C 14  ? GLY C 11  GLN C 14  
AA5 2 THR C 117 ? SER C 122 ? THR C 117 SER C 122 
AA5 3 ALA C 92  ? ARG C 100 ? ALA C 92  ARG C 100 
AA5 4 VAL C 34  ? GLN C 40  ? VAL C 34  GLN C 40  
AA5 5 GLU C 47  ? THR C 53  ? GLU C 47  THR C 53  
AA5 6 THR C 58  ? TYR C 60  ? THR C 58  TYR C 60  
AA6 1 GLY C 11  ? GLN C 14  ? GLY C 11  GLN C 14  
AA6 2 THR C 117 ? SER C 122 ? THR C 117 SER C 122 
AA6 3 ALA C 92  ? ARG C 100 ? ALA C 92  ARG C 100 
AA6 4 THR C 110 ? TRP C 113 ? THR C 110 TRP C 113 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 84  ? N PHE A 132 O ILE A 120 ? O ILE A 168 
AA1 2 3 N PHE A 121 ? N PHE A 169 O ILE A 156 ? O ILE A 204 
AA1 3 4 O PHE A 157 ? O PHE A 205 N LEU A 52  ? N LEU A 100 
AA1 4 5 N SER A 51  ? N SER A 99  O VAL A 219 ? O VAL A 267 
AA2 1 2 N PHE A 258 ? N PHE A 306 O PHE A 265 ? O PHE A 313 
AA3 1 2 N ILE B 97  ? N ILE B 328 O VAL B 132 ? O VAL B 363 
AA3 2 3 N VAL B 133 ? N VAL B 364 O VAL B 164 ? O VAL B 395 
AA3 3 4 O LEU B 165 ? O LEU B 396 N ILE B 65  ? N ILE B 296 
AA3 4 5 N ILE B 66  ? N ILE B 297 O LEU B 224 ? O LEU B 455 
AA4 1 2 N THR C 8   ? N THR C 8   O SER C 22  ? O SER C 22  
AA4 2 3 N LEU C 19  ? N LEU C 19  O MET C 83  ? O MET C 83  
AA4 3 4 O GLN C 82  ? O GLN C 82  N THR C 69  ? N THR C 69  
AA5 1 2 N VAL C 13  ? N VAL C 13  O SER C 122 ? O SER C 122 
AA5 2 3 O THR C 117 ? O THR C 117 N TYR C 94  ? N TYR C 94  
AA5 3 4 O PHE C 95  ? O PHE C 95  N TYR C 38  ? N TYR C 38  
AA5 4 5 N TRP C 37  ? N TRP C 37  O VAL C 49  ? O VAL C 49  
AA5 5 6 N ALA C 51  ? N ALA C 51  O THR C 59  ? O THR C 59  
AA6 1 2 N VAL C 13  ? N VAL C 13  O SER C 122 ? O SER C 122 
AA6 2 3 O THR C 117 ? O THR C 117 N TYR C 94  ? N TYR C 94  
AA6 3 4 N ARG C 100 ? N ARG C 100 O THR C 110 ? O THR C 110 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ATP 401 ? 26 'binding site for residue ATP A 401' 
AC2 Software A MG  402 ? 5  'binding site for residue MG A 402'  
AC3 Software A CL  403 ? 3  'binding site for residue CL A 403'  
AC4 Software A BTB 404 ? 11 'binding site for residue BTB A 404' 
AC5 Software A BTB 405 ? 10 'binding site for residue BTB A 405' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 ASN A 20  ? ASN A 68  . ? 1_555 ? 
2  AC1 26 LEU A 21  ? LEU A 69  . ? 1_555 ? 
3  AC1 26 PHE A 22  ? PHE A 70  . ? 1_555 ? 
4  AC1 26 THR A 56  ? THR A 104 . ? 1_555 ? 
5  AC1 26 GLY A 57  ? GLY A 105 . ? 1_555 ? 
6  AC1 26 THR A 58  ? THR A 106 . ? 1_555 ? 
7  AC1 26 GLY A 59  ? GLY A 107 . ? 1_555 ? 
8  AC1 26 LYS A 60  ? LYS A 108 . ? 1_555 ? 
9  AC1 26 ASN A 61  ? ASN A 109 . ? 1_555 ? 
10 AC1 26 PHE A 62  ? PHE A 110 . ? 1_555 ? 
11 AC1 26 GLN A 123 ? GLN A 171 . ? 1_555 ? 
12 AC1 26 ASN A 160 ? ASN A 208 . ? 1_555 ? 
13 AC1 26 CYS A 232 ? CYS A 280 . ? 1_555 ? 
14 AC1 26 CYS A 270 ? CYS A 318 . ? 1_555 ? 
15 AC1 26 LYS A 271 ? LYS A 319 . ? 1_555 ? 
16 AC1 26 MG  E .   ? MG  A 402 . ? 1_555 ? 
17 AC1 26 HOH I .   ? HOH A 510 . ? 1_555 ? 
18 AC1 26 HOH I .   ? HOH A 537 . ? 1_555 ? 
19 AC1 26 HOH I .   ? HOH A 548 . ? 1_555 ? 
20 AC1 26 HOH I .   ? HOH A 573 . ? 1_555 ? 
21 AC1 26 HOH I .   ? HOH A 626 . ? 1_555 ? 
22 AC1 26 HOH I .   ? HOH A 633 . ? 1_555 ? 
23 AC1 26 HOH I .   ? HOH A 679 . ? 1_555 ? 
24 AC1 26 HOH I .   ? HOH A 685 . ? 1_555 ? 
25 AC1 26 HIS B 153 ? HIS B 384 . ? 1_555 ? 
26 AC1 26 ARG B 218 ? ARG B 449 . ? 1_555 ? 
27 AC2 5  ASN A 61  ? ASN A 109 . ? 1_555 ? 
28 AC2 5  ATP D .   ? ATP A 401 . ? 1_555 ? 
29 AC2 5  HOH I .   ? HOH A 537 . ? 1_555 ? 
30 AC2 5  HOH I .   ? HOH A 548 . ? 1_555 ? 
31 AC2 5  HOH I .   ? HOH A 573 . ? 1_555 ? 
32 AC3 3  ASN A 95  ? ASN A 143 . ? 1_555 ? 
33 AC3 3  TYR A 99  ? TYR A 147 . ? 1_555 ? 
34 AC3 3  ASN C 33  ? ASN C 33  . ? 1_555 ? 
35 AC4 11 TRP A 55  ? TRP A 103 . ? 1_555 ? 
36 AC4 11 GLU A 164 ? GLU A 212 . ? 1_555 ? 
37 AC4 11 PHE A 258 ? PHE A 306 . ? 1_555 ? 
38 AC4 11 ASP A 267 ? ASP A 315 . ? 1_555 ? 
39 AC4 11 HOH I .   ? HOH A 587 . ? 1_555 ? 
40 AC4 11 HOH I .   ? HOH A 604 . ? 1_555 ? 
41 AC4 11 HOH I .   ? HOH A 637 . ? 1_555 ? 
42 AC4 11 ARG B 188 ? ARG B 419 . ? 1_555 ? 
43 AC4 11 TRP B 192 ? TRP B 423 . ? 1_555 ? 
44 AC4 11 SER B 209 ? SER B 440 . ? 1_555 ? 
45 AC4 11 HOH J .   ? HOH B 538 . ? 1_555 ? 
46 AC5 10 TYR A 226 ? TYR A 274 . ? 1_555 ? 
47 AC5 10 GLU A 254 ? GLU A 302 . ? 1_555 ? 
48 AC5 10 PHE A 257 ? PHE A 305 . ? 1_555 ? 
49 AC5 10 GLU A 262 ? GLU A 310 . ? 1_555 ? 
50 AC5 10 ARG A 263 ? ARG A 311 . ? 1_555 ? 
51 AC5 10 VAL A 264 ? VAL A 312 . ? 1_555 ? 
52 AC5 10 HOH I .   ? HOH A 505 . ? 1_555 ? 
53 AC5 10 HOH I .   ? HOH A 544 . ? 1_555 ? 
54 AC5 10 HOH I .   ? HOH A 717 . ? 1_555 ? 
55 AC5 10 HOH I .   ? HOH A 737 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5J1T 
_atom_sites.fract_transf_matrix[1][1]   0.013256 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011306 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009494 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 6   ? -43.450 8.048   -9.858  1.00 30.00 ?  54  ARG A N     1 
ATOM   2    C  CA    . ARG A 1 6   ? -44.564 8.798   -9.287  1.00 30.00 ?  54  ARG A CA    1 
ATOM   3    C  C     . ARG A 1 6   ? -45.723 7.830   -8.903  1.00 30.00 ?  54  ARG A C     1 
ATOM   4    O  O     . ARG A 1 6   ? -46.276 7.947   -7.838  1.00 30.00 ?  54  ARG A O     1 
ATOM   5    C  CB    . ARG A 1 6   ? -45.062 9.861   -10.269 1.00 30.00 ?  54  ARG A CB    1 
ATOM   6    N  N     . SER A 1 7   ? -46.060 6.851   -9.732  1.00 46.59 ?  55  SER A N     1 
ATOM   7    C  CA    . SER A 1 7   ? -47.091 5.864   -9.357  1.00 46.04 ?  55  SER A CA    1 
ATOM   8    C  C     . SER A 1 7   ? -46.574 4.460   -9.613  1.00 44.81 ?  55  SER A C     1 
ATOM   9    O  O     . SER A 1 7   ? -46.484 4.027   -10.741 1.00 44.86 ?  55  SER A O     1 
ATOM   10   C  CB    . SER A 1 7   ? -48.402 6.071   -10.094 1.00 47.00 ?  55  SER A CB    1 
ATOM   11   O  OG    . SER A 1 7   ? -49.388 6.508   -9.198  1.00 48.44 ?  55  SER A OG    1 
ATOM   12   N  N     . LEU A 1 8   ? -46.213 3.765   -8.549  1.00 43.19 ?  56  LEU A N     1 
ATOM   13   C  CA    . LEU A 1 8   ? -45.639 2.461   -8.667  1.00 40.90 ?  56  LEU A CA    1 
ATOM   14   C  C     . LEU A 1 8   ? -46.529 1.458   -9.337  1.00 40.57 ?  56  LEU A C     1 
ATOM   15   O  O     . LEU A 1 8   ? -47.640 1.298   -8.940  1.00 41.51 ?  56  LEU A O     1 
ATOM   16   C  CB    . LEU A 1 8   ? -45.325 1.934   -7.274  1.00 38.94 ?  56  LEU A CB    1 
ATOM   17   C  CG    . LEU A 1 8   ? -44.684 0.557   -7.325  1.00 37.65 ?  56  LEU A CG    1 
ATOM   18   C  CD1   . LEU A 1 8   ? -43.255 0.682   -7.813  1.00 37.77 ?  56  LEU A CD1   1 
ATOM   19   C  CD2   . LEU A 1 8   ? -44.773 -0.149  -5.989  1.00 36.36 ?  56  LEU A CD2   1 
ATOM   20   N  N     . SER A 1 9   ? -46.022 0.755   -10.333 1.00 39.46 ?  57  SER A N     1 
ATOM   21   C  CA    . SER A 1 9   ? -46.784 -0.295  -10.949 1.00 37.66 ?  57  SER A CA    1 
ATOM   22   C  C     . SER A 1 9   ? -45.909 -1.539  -10.907 1.00 35.71 ?  57  SER A C     1 
ATOM   23   O  O     . SER A 1 9   ? -44.734 -1.446  -11.041 1.00 35.40 ?  57  SER A O     1 
ATOM   24   C  CB    . SER A 1 9   ? -47.203 0.096   -12.352 1.00 38.01 ?  57  SER A CB    1 
ATOM   25   O  OG    . SER A 1 9   ? -46.341 -0.379  -13.307 1.00 37.66 ?  57  SER A OG    1 
ATOM   26   N  N     . ARG A 1 10  ? -46.495 -2.690  -10.676 1.00 35.02 ?  58  ARG A N     1 
ATOM   27   C  CA    . ARG A 1 10  ? -45.722 -3.934  -10.597 1.00 34.43 ?  58  ARG A CA    1 
ATOM   28   C  C     . ARG A 1 10  ? -44.956 -4.144  -11.900 1.00 33.72 ?  58  ARG A C     1 
ATOM   29   O  O     . ARG A 1 10  ? -43.788 -4.534  -11.892 1.00 34.09 ?  58  ARG A O     1 
ATOM   30   C  CB    . ARG A 1 10  ? -46.606 -5.153  -10.299 1.00 34.68 ?  58  ARG A CB    1 
ATOM   31   C  CG    . ARG A 1 10  ? -45.856 -6.419  -9.848  1.00 36.09 ?  58  ARG A CG    1 
ATOM   32   C  CD    . ARG A 1 10  ? -46.778 -7.614  -9.530  1.00 37.77 ?  58  ARG A CD    1 
ATOM   33   N  NE    . ARG A 1 10  ? -46.059 -8.745  -8.921  1.00 39.78 ?  58  ARG A NE    1 
ATOM   34   C  CZ    . ARG A 1 10  ? -45.364 -9.643  -9.618  1.00 40.64 ?  58  ARG A CZ    1 
ATOM   35   N  NH1   . ARG A 1 10  ? -45.280 -9.533  -10.948 1.00 42.11 ?  58  ARG A NH1   1 
ATOM   36   N  NH2   . ARG A 1 10  ? -44.761 -10.650 -9.001  1.00 39.74 ?  58  ARG A NH2   1 
ATOM   37   N  N     . GLU A 1 11  ? -45.613 -3.864  -13.019 1.00 33.73 ?  59  GLU A N     1 
ATOM   38   C  CA    . GLU A 1 11  ? -45.000 -4.079  -14.310 1.00 34.76 ?  59  GLU A CA    1 
ATOM   39   C  C     . GLU A 1 11  ? -43.762 -3.214  -14.512 1.00 32.27 ?  59  GLU A C     1 
ATOM   40   O  O     . GLU A 1 11  ? -42.743 -3.694  -15.011 1.00 30.89 ?  59  GLU A O     1 
ATOM   41   C  CB    . GLU A 1 11  ? -46.040 -3.799  -15.411 1.00 39.34 ?  59  GLU A CB    1 
ATOM   42   C  CG    . GLU A 1 11  ? -47.191 -4.836  -15.459 1.00 44.84 ?  59  GLU A CG    1 
ATOM   43   C  CD    . GLU A 1 11  ? -48.110 -4.866  -14.199 1.00 49.43 ?  59  GLU A CD    1 
ATOM   44   O  OE1   . GLU A 1 11  ? -48.305 -3.816  -13.555 1.00 51.12 ?  59  GLU A OE1   1 
ATOM   45   O  OE2   . GLU A 1 11  ? -48.649 -5.951  -13.852 1.00 51.91 ?  59  GLU A OE2   1 
ATOM   46   N  N     . ALA A 1 12  ? -43.837 -1.941  -14.147 1.00 31.13 ?  60  ALA A N     1 
ATOM   47   C  CA    . ALA A 1 12  ? -42.669 -1.048  -14.307 1.00 30.10 ?  60  ALA A CA    1 
ATOM   48   C  C     . ALA A 1 12  ? -41.506 -1.391  -13.401 1.00 28.63 ?  60  ALA A C     1 
ATOM   49   O  O     . ALA A 1 12  ? -40.344 -1.313  -13.836 1.00 29.02 ?  60  ALA A O     1 
ATOM   50   C  CB    . ALA A 1 12  ? -43.069 0.386   -14.062 1.00 31.90 ?  60  ALA A CB    1 
ATOM   51   N  N     . LEU A 1 13  ? -41.809 -1.735  -12.154 1.00 27.27 ?  61  LEU A N     1 
ATOM   52   C  CA    . LEU A 1 13  ? -40.746 -2.176  -11.252 1.00 24.36 ?  61  LEU A CA    1 
ATOM   53   C  C     . LEU A 1 13  ? -40.125 -3.478  -11.746 1.00 23.43 ?  61  LEU A C     1 
ATOM   54   O  O     . LEU A 1 13  ? -38.886 -3.625  -11.772 1.00 23.93 ?  61  LEU A O     1 
ATOM   55   C  CB    . LEU A 1 13  ? -41.280 -2.334  -9.817  1.00 23.23 ?  61  LEU A CB    1 
ATOM   56   C  CG    . LEU A 1 13  ? -40.257 -2.829  -8.777  1.00 21.70 ?  61  LEU A CG    1 
ATOM   57   C  CD1   . LEU A 1 13  ? -39.044 -1.859  -8.691  1.00 22.25 ?  61  LEU A CD1   1 
ATOM   58   C  CD2   . LEU A 1 13  ? -40.952 -2.925  -7.419  1.00 23.01 ?  61  LEU A CD2   1 
ATOM   59   N  N     . GLN A 1 14  ? -40.968 -4.415  -12.194 1.00 24.34 ?  62  GLN A N     1 
ATOM   60   C  CA    . GLN A 1 14  ? -40.434 -5.678  -12.739 1.00 24.82 ?  62  GLN A CA    1 
ATOM   61   C  C     . GLN A 1 14  ? -39.514 -5.421  -13.948 1.00 24.43 ?  62  GLN A C     1 
ATOM   62   O  O     . GLN A 1 14  ? -38.409 -5.985  -14.049 1.00 24.80 ?  62  GLN A O     1 
ATOM   63   C  CB    . GLN A 1 14  ? -41.571 -6.640  -13.139 1.00 27.86 ?  62  GLN A CB    1 
ATOM   64   C  CG    . GLN A 1 14  ? -41.065 -8.048  -13.483 1.00 30.89 ?  62  GLN A CG    1 
ATOM   65   C  CD    . GLN A 1 14  ? -42.173 -9.019  -13.720 1.00 36.99 ?  62  GLN A CD    1 
ATOM   66   O  OE1   . GLN A 1 14  ? -43.115 -8.733  -14.456 1.00 38.77 ?  62  GLN A OE1   1 
ATOM   67   N  NE2   . GLN A 1 14  ? -42.046 -10.205 -13.146 1.00 39.65 ?  62  GLN A NE2   1 
ATOM   68   N  N     . LYS A 1 15  ? -39.945 -4.540  -14.850 1.00 24.13 ?  63  LYS A N     1 
ATOM   69   C  CA    . LYS A 1 15  ? -39.125 -4.259  -16.041 1.00 25.10 ?  63  LYS A CA    1 
ATOM   70   C  C     . LYS A 1 15  ? -37.806 -3.619  -15.650 1.00 23.45 ?  63  LYS A C     1 
ATOM   71   O  O     . LYS A 1 15  ? -36.752 -3.940  -16.216 1.00 22.94 ?  63  LYS A O     1 
ATOM   72   C  CB    . LYS A 1 15  ? -39.899 -3.351  -17.010 1.00 27.73 ?  63  LYS A CB    1 
ATOM   73   C  CG    . LYS A 1 15  ? -39.044 -2.919  -18.173 1.00 29.80 ?  63  LYS A CG    1 
ATOM   74   C  CD    . LYS A 1 15  ? -39.848 -2.218  -19.240 1.00 32.60 ?  63  LYS A CD    1 
ATOM   75   C  CE    . LYS A 1 15  ? -39.258 -2.574  -20.588 1.00 35.29 ?  63  LYS A CE    1 
ATOM   76   N  NZ    . LYS A 1 15  ? -38.060 -1.820  -20.882 1.00 37.04 ?  63  LYS A NZ    1 
ATOM   77   N  N     . ASP A 1 16  ? -37.847 -2.713  -14.676 1.00 22.47 ?  64  ASP A N     1 
ATOM   78   C  CA    . ASP A 1 16  ? -36.642 -1.978  -14.303 1.00 22.64 ?  64  ASP A CA    1 
ATOM   79   C  C     . ASP A 1 16  ? -35.633 -2.962  -13.705 1.00 21.76 ?  64  ASP A C     1 
ATOM   80   O  O     . ASP A 1 16  ? -34.456 -2.971  -14.051 1.00 21.99 ?  64  ASP A O     1 
ATOM   81   C  CB    . ASP A 1 16  ? -37.026 -0.880  -13.330 1.00 24.31 ?  64  ASP A CB    1 
ATOM   82   C  CG    . ASP A 1 16  ? -35.973 0.154   -13.170 1.00 28.02 ?  64  ASP A CG    1 
ATOM   83   O  OD1   . ASP A 1 16  ? -34.822 -0.012  -13.640 1.00 29.83 ?  64  ASP A OD1   1 
ATOM   84   O  OD2   . ASP A 1 16  ? -36.277 1.157   -12.535 1.00 29.96 ?  64  ASP A OD2   1 
ATOM   85   N  N     . LEU A 1 17  ? -36.101 -3.829  -12.828 1.00 21.25 ?  65  LEU A N     1 
ATOM   86   C  CA    . LEU A 1 17  ? -35.212 -4.827  -12.224 1.00 20.63 ?  65  LEU A CA    1 
ATOM   87   C  C     . LEU A 1 17  ? -34.704 -5.804  -13.283 1.00 21.31 ?  65  LEU A C     1 
ATOM   88   O  O     . LEU A 1 17  ? -33.504 -6.128  -13.319 1.00 21.62 ?  65  LEU A O     1 
ATOM   89   C  CB    . LEU A 1 17  ? -35.942 -5.590  -11.111 1.00 20.50 ?  65  LEU A CB    1 
ATOM   90   C  CG    . LEU A 1 17  ? -36.281 -4.775  -9.866  1.00 20.87 ?  65  LEU A CG    1 
ATOM   91   C  CD1   . LEU A 1 17  ? -37.364 -5.502  -9.062  1.00 22.19 ?  65  LEU A CD1   1 
ATOM   92   C  CD2   . LEU A 1 17  ? -34.960 -4.617  -9.070  1.00 22.57 ?  65  LEU A CD2   1 
ATOM   93   N  N     . ASP A 1 18  ? -35.602 -6.313  -14.131 1.00 22.25 ?  66  ASP A N     1 
ATOM   94   C  CA    . ASP A 1 18  ? -35.152 -7.279  -15.139 1.00 23.17 ?  66  ASP A CA    1 
ATOM   95   C  C     . ASP A 1 18  ? -34.158 -6.697  -16.126 1.00 22.69 ?  66  ASP A C     1 
ATOM   96   O  O     . ASP A 1 18  ? -33.172 -7.358  -16.503 1.00 23.28 ?  66  ASP A O     1 
ATOM   97   C  CB    . ASP A 1 18  ? -36.339 -7.810  -15.937 1.00 25.36 ?  66  ASP A CB    1 
ATOM   98   C  CG    . ASP A 1 18  ? -37.157 -8.830  -15.181 1.00 29.17 ?  66  ASP A CG    1 
ATOM   99   O  OD1   . ASP A 1 18  ? -36.679 -9.415  -14.189 1.00 30.47 ?  66  ASP A OD1   1 
ATOM   100  O  OD2   . ASP A 1 18  ? -38.296 -9.091  -15.633 1.00 31.06 ?  66  ASP A OD2   1 
ATOM   101  N  N     . ASP A 1 19  ? -34.415 -5.467  -16.582 1.00 22.52 ?  67  ASP A N     1 
ATOM   102  C  CA    . ASP A 1 19  ? -33.536 -4.863  -17.588 1.00 23.29 ?  67  ASP A CA    1 
ATOM   103  C  C     . ASP A 1 19  ? -32.183 -4.489  -17.013 1.00 22.40 ?  67  ASP A C     1 
ATOM   104  O  O     . ASP A 1 19  ? -31.174 -4.571  -17.708 1.00 23.82 ?  67  ASP A O     1 
ATOM   105  C  CB    . ASP A 1 19  ? -34.148 -3.603  -18.196 1.00 25.76 ?  67  ASP A CB    1 
ATOM   106  C  CG    . ASP A 1 19  ? -35.339 -3.881  -19.089 1.00 29.46 ?  67  ASP A CG    1 
ATOM   107  O  OD1   . ASP A 1 19  ? -35.575 -5.036  -19.472 1.00 31.20 ?  67  ASP A OD1   1 
ATOM   108  O  OD2   . ASP A 1 19  ? -36.021 -2.896  -19.413 1.00 31.80 ?  67  ASP A OD2   1 
ATOM   109  N  N     . ASN A 1 20  ? -32.124 -4.111  -15.733 1.00 19.76 ?  68  ASN A N     1 
ATOM   110  C  CA    . ASN A 1 20  ? -30.930 -3.425  -15.240 1.00 19.53 ?  68  ASN A CA    1 
ATOM   111  C  C     . ASN A 1 20  ? -30.124 -4.103  -14.131 1.00 17.40 ?  68  ASN A C     1 
ATOM   112  O  O     . ASN A 1 20  ? -28.982 -3.724  -13.936 1.00 16.39 ?  68  ASN A O     1 
ATOM   113  C  CB    . ASN A 1 20  ? -31.319 -2.015  -14.803 1.00 20.50 ?  68  ASN A CB    1 
ATOM   114  C  CG    . ASN A 1 20  ? -31.972 -1.239  -15.955 1.00 22.78 ?  68  ASN A CG    1 
ATOM   115  O  OD1   . ASN A 1 20  ? -31.379 -1.143  -17.032 1.00 26.34 ?  68  ASN A OD1   1 
ATOM   116  N  ND2   . ASN A 1 20  ? -33.201 -0.790  -15.785 1.00 22.54 ?  68  ASN A ND2   1 
ATOM   117  N  N     . LEU A 1 21  ? -30.714 -5.049  -13.372 1.00 17.57 ?  69  LEU A N     1 
ATOM   118  C  CA    . LEU A 1 21  ? -30.036 -5.680  -12.228 1.00 16.78 ?  69  LEU A CA    1 
ATOM   119  C  C     . LEU A 1 21  ? -29.537 -7.049  -12.643 1.00 16.80 ?  69  LEU A C     1 
ATOM   120  O  O     . LEU A 1 21  ? -30.364 -7.936  -12.972 1.00 19.10 ?  69  LEU A O     1 
ATOM   121  C  CB    . LEU A 1 21  ? -30.998 -5.796  -11.011 1.00 17.01 ?  69  LEU A CB    1 
ATOM   122  C  CG    . LEU A 1 21  ? -30.329 -6.448  -9.764  1.00 18.83 ?  69  LEU A CG    1 
ATOM   123  C  CD1   . LEU A 1 21  ? -29.250 -5.484  -9.190  1.00 20.49 ?  69  LEU A CD1   1 
ATOM   124  C  CD2   . LEU A 1 21  ? -31.362 -6.815  -8.711  1.00 21.30 ?  69  LEU A CD2   1 
ATOM   125  N  N     . PHE A 1 22  ? -28.214 -7.228  -12.701 1.00 16.50 ?  70  PHE A N     1 
ATOM   126  C  CA    . PHE A 1 22  ? -27.654 -8.462  -13.263 1.00 17.80 ?  70  PHE A CA    1 
ATOM   127  C  C     . PHE A 1 22  ? -27.215 -9.401  -12.149 1.00 17.25 ?  70  PHE A C     1 
ATOM   128  O  O     . PHE A 1 22  ? -26.738 -8.968  -11.099 1.00 17.31 ?  70  PHE A O     1 
ATOM   129  C  CB    . PHE A 1 22  ? -26.451 -8.142  -14.176 1.00 18.43 ?  70  PHE A CB    1 
ATOM   130  C  CG    . PHE A 1 22  ? -26.744 -7.091  -15.211 1.00 19.15 ?  70  PHE A CG    1 
ATOM   131  C  CD1   . PHE A 1 22  ? -27.915 -7.152  -15.974 1.00 20.65 ?  70  PHE A CD1   1 
ATOM   132  C  CD2   . PHE A 1 22  ? -25.866 -6.028  -15.414 1.00 19.03 ?  70  PHE A CD2   1 
ATOM   133  C  CE1   . PHE A 1 22  ? -28.198 -6.155  -16.918 1.00 20.85 ?  70  PHE A CE1   1 
ATOM   134  C  CE2   . PHE A 1 22  ? -26.139 -5.039  -16.367 1.00 18.80 ?  70  PHE A CE2   1 
ATOM   135  C  CZ    . PHE A 1 22  ? -27.298 -5.113  -17.151 1.00 20.55 ?  70  PHE A CZ    1 
ATOM   136  N  N     . GLY A 1 23  ? -27.360 -10.691 -12.379 1.00 17.67 ?  71  GLY A N     1 
ATOM   137  C  CA    . GLY A 1 23  ? -26.833 -11.704 -11.497 1.00 17.97 ?  71  GLY A CA    1 
ATOM   138  C  C     . GLY A 1 23  ? -27.391 -11.659 -10.094 1.00 16.93 ?  71  GLY A C     1 
ATOM   139  O  O     . GLY A 1 23  ? -26.669 -12.054 -9.175  1.00 18.58 ?  71  GLY A O     1 
ATOM   140  N  N     . GLN A 1 24  ? -28.659 -11.226 -9.900  1.00 15.78 ?  72  GLN A N     1 
ATOM   141  C  CA    . GLN A 1 24  ? -29.175 -11.271 -8.550  1.00 15.74 ?  72  GLN A CA    1 
ATOM   142  C  C     . GLN A 1 24  ? -30.589 -11.845 -8.622  1.00 16.53 ?  72  GLN A C     1 
ATOM   143  O  O     . GLN A 1 24  ? -31.570 -11.153 -8.273  1.00 18.18 ?  72  GLN A O     1 
ATOM   144  C  CB    . GLN A 1 24  ? -29.161 -9.877  -7.900  1.00 15.47 ?  72  GLN A CB    1 
ATOM   145  C  CG    . GLN A 1 24  ? -27.734 -9.301  -7.693  1.00 15.31 ?  72  GLN A CG    1 
ATOM   146  C  CD    . GLN A 1 24  ? -26.841 -10.116 -6.749  1.00 15.17 ?  72  GLN A CD    1 
ATOM   147  O  OE1   . GLN A 1 24  ? -27.268 -11.108 -6.134  1.00 16.42 ?  72  GLN A OE1   1 
ATOM   148  N  NE2   . GLN A 1 24  ? -25.573 -9.701  -6.645  1.00 15.14 ?  72  GLN A NE2   1 
ATOM   149  N  N     . HIS A 1 25  ? -30.704 -13.106 -9.046  1.00 17.37 ?  73  HIS A N     1 
ATOM   150  C  CA    . HIS A 1 25  ? -32.053 -13.670 -9.247  1.00 18.61 ?  73  HIS A CA    1 
ATOM   151  C  C     . HIS A 1 25  ? -32.856 -13.708 -7.956  1.00 19.33 ?  73  HIS A C     1 
ATOM   152  O  O     . HIS A 1 25  ? -34.079 -13.516 -8.001  1.00 21.66 ?  73  HIS A O     1 
ATOM   153  C  CB    . HIS A 1 25  ? -31.980 -15.087 -9.860  1.00 19.30 ?  73  HIS A CB    1 
ATOM   154  C  CG    . HIS A 1 25  ? -31.431 -16.140 -8.931  1.00 20.82 ?  73  HIS A CG    1 
ATOM   155  N  ND1   . HIS A 1 25  ? -30.083 -16.268 -8.660  1.00 21.77 ?  73  HIS A ND1   1 
ATOM   156  C  CD2   . HIS A 1 25  ? -32.050 -17.130 -8.228  1.00 22.14 ?  73  HIS A CD2   1 
ATOM   157  C  CE1   . HIS A 1 25  ? -29.900 -17.273 -7.818  1.00 22.37 ?  73  HIS A CE1   1 
ATOM   158  N  NE2   . HIS A 1 25  ? -31.077 -17.809 -7.536  1.00 22.20 ?  73  HIS A NE2   1 
ATOM   159  N  N     . LEU A 1 26  ? -32.204 -13.926 -6.811  1.00 19.46 ?  74  LEU A N     1 
ATOM   160  C  CA    . LEU A 1 26  ? -32.983 -14.028 -5.568  1.00 20.68 ?  74  LEU A CA    1 
ATOM   161  C  C     . LEU A 1 26  ? -33.476 -12.639 -5.179  1.00 20.33 ?  74  LEU A C     1 
ATOM   162  O  O     . LEU A 1 26  ? -34.662 -12.467 -4.807  1.00 21.27 ?  74  LEU A O     1 
ATOM   163  C  CB    . LEU A 1 26  ? -32.166 -14.639 -4.399  1.00 23.58 ?  74  LEU A CB    1 
ATOM   164  C  CG    . LEU A 1 26  ? -31.776 -16.086 -4.607  1.00 25.91 ?  74  LEU A CG    1 
ATOM   165  C  CD1   . LEU A 1 26  ? -30.810 -16.536 -3.511  1.00 26.48 ?  74  LEU A CD1   1 
ATOM   166  C  CD2   . LEU A 1 26  ? -33.060 -16.963 -4.647  1.00 28.03 ?  74  LEU A CD2   1 
ATOM   167  N  N     . ALA A 1 27  ? -32.572 -11.649 -5.224  1.00 19.27 ?  75  ALA A N     1 
ATOM   168  C  CA    . ALA A 1 27  ? -32.930 -10.312 -4.783  1.00 19.25 ?  75  ALA A CA    1 
ATOM   169  C  C     . ALA A 1 27  ? -34.061 -9.762  -5.662  1.00 18.80 ?  75  ALA A C     1 
ATOM   170  O  O     . ALA A 1 27  ? -35.003 -9.119  -5.132  1.00 20.12 ?  75  ALA A O     1 
ATOM   171  C  CB    . ALA A 1 27  ? -31.684 -9.372  -4.803  1.00 19.48 ?  75  ALA A CB    1 
ATOM   172  N  N     . LYS A 1 28  ? -34.014 -10.039 -6.975  1.00 18.92 ?  76  LYS A N     1 
ATOM   173  C  CA    . LYS A 1 28  ? -35.008 -9.437  -7.871  1.00 20.18 ?  76  LYS A CA    1 
ATOM   174  C  C     . LYS A 1 28  ? -36.401 -9.872  -7.428  1.00 20.93 ?  76  LYS A C     1 
ATOM   175  O  O     . LYS A 1 28  ? -37.350 -9.049  -7.347  1.00 22.31 ?  76  LYS A O     1 
ATOM   176  C  CB    . LYS A 1 28  ? -34.853 -9.868  -9.321  1.00 22.72 ?  76  LYS A CB    1 
ATOM   177  C  CG    . LYS A 1 28  ? -33.806 -9.145  -10.092 1.00 25.48 ?  76  LYS A CG    1 
ATOM   178  C  CD    . LYS A 1 28  ? -34.101 -9.260  -11.631 1.00 26.63 ?  76  LYS A CD    1 
ATOM   179  C  CE    . LYS A 1 28  ? -33.948 -10.672 -12.098 1.00 27.93 ?  76  LYS A CE    1 
ATOM   180  N  NZ    . LYS A 1 28  ? -34.012 -10.782 -13.610 1.00 27.15 ?  76  LYS A NZ    1 
ATOM   181  N  N     . LYS A 1 29  ? -36.542 -11.171 -7.188  1.00 20.39 ?  77  LYS A N     1 
ATOM   182  C  CA    . LYS A 1 29  ? -37.861 -11.714 -6.913  1.00 21.57 ?  77  LYS A CA    1 
ATOM   183  C  C     . LYS A 1 29  ? -38.352 -11.243 -5.543  1.00 20.49 ?  77  LYS A C     1 
ATOM   184  O  O     . LYS A 1 29  ? -39.514 -10.859 -5.385  1.00 21.85 ?  77  LYS A O     1 
ATOM   185  C  CB    . LYS A 1 29  ? -37.846 -13.248 -6.965  1.00 25.88 ?  77  LYS A CB    1 
ATOM   186  C  CG    . LYS A 1 29  ? -39.223 -13.853 -6.760  1.00 31.41 ?  77  LYS A CG    1 
ATOM   187  C  CD    . LYS A 1 29  ? -39.162 -15.392 -6.764  1.00 35.24 ?  77  LYS A CD    1 
ATOM   188  C  CE    . LYS A 1 29  ? -40.550 -16.009 -6.459  1.00 38.03 ?  77  LYS A CE    1 
ATOM   189  N  NZ    . LYS A 1 29  ? -40.496 -17.347 -5.742  1.00 40.16 ?  77  LYS A NZ    1 
ATOM   190  N  N     . ILE A 1 30  ? -37.476 -11.240 -4.548  1.00 19.37 ?  78  ILE A N     1 
ATOM   191  C  CA    . ILE A 1 30  ? -37.917 -10.854 -3.221  1.00 19.07 ?  78  ILE A CA    1 
ATOM   192  C  C     . ILE A 1 30  ? -38.313 -9.384  -3.194  1.00 18.18 ?  78  ILE A C     1 
ATOM   193  O  O     . ILE A 1 30  ? -39.350 -9.009  -2.649  1.00 19.10 ?  78  ILE A O     1 
ATOM   194  C  CB    . ILE A 1 30  ? -36.820 -11.119 -2.194  1.00 18.89 ?  78  ILE A CB    1 
ATOM   195  C  CG1   . ILE A 1 30  ? -36.562 -12.636 -2.099  1.00 19.28 ?  78  ILE A CG1   1 
ATOM   196  C  CG2   . ILE A 1 30  ? -37.234 -10.525 -0.826  1.00 19.34 ?  78  ILE A CG2   1 
ATOM   197  C  CD1   . ILE A 1 30  ? -35.190 -12.992 -1.396  1.00 20.36 ?  78  ILE A CD1   1 
ATOM   198  N  N     A ILE A 1 31  ? -37.465 -8.544  -3.777  0.35 17.84 ?  79  ILE A N     1 
ATOM   199  N  N     B ILE A 1 31  ? -37.461 -8.532  -3.743  0.65 16.93 ?  79  ILE A N     1 
ATOM   200  C  CA    A ILE A 1 31  ? -37.741 -7.106  -3.823  0.35 18.13 ?  79  ILE A CA    1 
ATOM   201  C  CA    B ILE A 1 31  ? -37.794 -7.099  -3.761  0.65 16.99 ?  79  ILE A CA    1 
ATOM   202  C  C     A ILE A 1 31  ? -39.042 -6.793  -4.563  0.35 18.58 ?  79  ILE A C     1 
ATOM   203  C  C     B ILE A 1 31  ? -39.076 -6.802  -4.550  0.65 17.85 ?  79  ILE A C     1 
ATOM   204  O  O     A ILE A 1 31  ? -39.852 -5.991  -4.091  0.35 19.21 ?  79  ILE A O     1 
ATOM   205  O  O     B ILE A 1 31  ? -39.910 -6.007  -4.102  0.65 18.60 ?  79  ILE A O     1 
ATOM   206  C  CB    A ILE A 1 31  ? -36.555 -6.358  -4.465  0.35 17.86 ?  79  ILE A CB    1 
ATOM   207  C  CB    B ILE A 1 31  ? -36.608 -6.298  -4.334  0.65 16.67 ?  79  ILE A CB    1 
ATOM   208  C  CG1   A ILE A 1 31  ? -35.358 -6.416  -3.525  0.35 17.75 ?  79  ILE A CG1   1 
ATOM   209  C  CG1   B ILE A 1 31  ? -35.474 -6.341  -3.328  0.65 16.71 ?  79  ILE A CG1   1 
ATOM   210  C  CG2   A ILE A 1 31  ? -36.921 -4.913  -4.842  0.35 18.23 ?  79  ILE A CG2   1 
ATOM   211  C  CG2   B ILE A 1 31  ? -36.999 -4.846  -4.742  0.65 17.73 ?  79  ILE A CG2   1 
ATOM   212  C  CD1   A ILE A 1 31  ? -35.596 -5.717  -2.241  0.35 18.00 ?  79  ILE A CD1   1 
ATOM   213  C  CD1   B ILE A 1 31  ? -34.185 -5.842  -3.927  0.65 17.46 ?  79  ILE A CD1   1 
ATOM   214  N  N     . LEU A 1 32  ? -39.244 -7.413  -5.723  1.00 19.12 ?  80  LEU A N     1 
ATOM   215  C  CA    . LEU A 1 32  ? -40.457 -7.147  -6.520  1.00 20.76 ?  80  LEU A CA    1 
ATOM   216  C  C     . LEU A 1 32  ? -41.717 -7.370  -5.685  1.00 22.27 ?  80  LEU A C     1 
ATOM   217  O  O     . LEU A 1 32  ? -42.601 -6.499  -5.575  1.00 23.23 ?  80  LEU A O     1 
ATOM   218  C  CB    . LEU A 1 32  ? -40.498 -8.064  -7.712  1.00 21.60 ?  80  LEU A CB    1 
ATOM   219  C  CG    . LEU A 1 32  ? -41.761 -7.889  -8.561  1.00 23.87 ?  80  LEU A CG    1 
ATOM   220  C  CD1   . LEU A 1 32  ? -41.906 -6.440  -9.088  1.00 24.80 ?  80  LEU A CD1   1 
ATOM   221  C  CD2   . LEU A 1 32  ? -41.715 -8.835  -9.728  1.00 26.05 ?  80  LEU A CD2   1 
ATOM   222  N  N     . ASN A 1 33  ? -41.791 -8.540  -5.068  1.00 21.97 ?  81  ASN A N     1 
ATOM   223  C  CA    . ASN A 1 33  ? -43.006 -8.874  -4.339  1.00 24.04 ?  81  ASN A CA    1 
ATOM   224  C  C     . ASN A 1 33  ? -43.142 -8.119  -3.038  1.00 22.35 ?  81  ASN A C     1 
ATOM   225  O  O     . ASN A 1 33  ? -44.258 -7.727  -2.686  1.00 23.07 ?  81  ASN A O     1 
ATOM   226  C  CB    . ASN A 1 33  ? -43.033 -10.360 -4.163  1.00 27.02 ?  81  ASN A CB    1 
ATOM   227  C  CG    . ASN A 1 33  ? -43.336 -11.052 -5.487  1.00 31.19 ?  81  ASN A CG    1 
ATOM   228  O  OD1   . ASN A 1 33  ? -44.367 -10.766 -6.149  1.00 34.31 ?  81  ASN A OD1   1 
ATOM   229  N  ND2   . ASN A 1 33  ? -42.440 -11.914 -5.923  1.00 32.74 ?  81  ASN A ND2   1 
ATOM   230  N  N     . ALA A 1 34  ? -42.053 -7.866  -2.327  1.00 21.06 ?  82  ALA A N     1 
ATOM   231  C  CA    . ALA A 1 34  ? -42.148 -7.128  -1.055  1.00 20.41 ?  82  ALA A CA    1 
ATOM   232  C  C     . ALA A 1 34  ? -42.566 -5.678  -1.294  1.00 19.65 ?  82  ALA A C     1 
ATOM   233  O  O     . ALA A 1 34  ? -43.430 -5.126  -0.594  1.00 20.56 ?  82  ALA A O     1 
ATOM   234  C  CB    . ALA A 1 34  ? -40.826 -7.162  -0.321  1.00 21.45 ?  82  ALA A CB    1 
ATOM   235  N  N     . VAL A 1 35  ? -41.924 -5.035  -2.273  1.00 20.22 ?  83  VAL A N     1 
ATOM   236  C  CA    . VAL A 1 35  ? -42.175 -3.606  -2.464  1.00 21.21 ?  83  VAL A CA    1 
ATOM   237  C  C     . VAL A 1 35  ? -43.542 -3.391  -3.063  1.00 24.53 ?  83  VAL A C     1 
ATOM   238  O  O     . VAL A 1 35  ? -44.336 -2.547  -2.558  1.00 26.08 ?  83  VAL A O     1 
ATOM   239  C  CB    . VAL A 1 35  ? -41.055 -2.932  -3.294  1.00 20.85 ?  83  VAL A CB    1 
ATOM   240  C  CG1   . VAL A 1 35  ? -41.445 -1.516  -3.574  1.00 22.79 ?  83  VAL A CG1   1 
ATOM   241  C  CG2   . VAL A 1 35  ? -39.758 -2.993  -2.452  1.00 20.65 ?  83  VAL A CG2   1 
ATOM   242  N  N     . PHE A 1 36  ? -43.879 -4.193  -4.053  1.00 23.74 ?  84  PHE A N     1 
ATOM   243  C  CA    . PHE A 1 36  ? -45.202 -3.972  -4.631  1.00 26.02 ?  84  PHE A CA    1 
ATOM   244  C  C     . PHE A 1 36  ? -46.321 -4.265  -3.637  1.00 25.75 ?  84  PHE A C     1 
ATOM   245  O  O     . PHE A 1 36  ? -47.295 -3.509  -3.592  1.00 26.38 ?  84  PHE A O     1 
ATOM   246  C  CB    . PHE A 1 36  ? -45.440 -4.779  -5.882  1.00 28.81 ?  84  PHE A CB    1 
ATOM   247  C  CG    . PHE A 1 36  ? -46.735 -4.429  -6.539  1.00 31.88 ?  84  PHE A CG    1 
ATOM   248  C  CD1   . PHE A 1 36  ? -46.898 -3.196  -7.167  1.00 33.99 ?  84  PHE A CD1   1 
ATOM   249  C  CD2   . PHE A 1 36  ? -47.797 -5.289  -6.464  1.00 32.80 ?  84  PHE A CD2   1 
ATOM   250  C  CE1   . PHE A 1 36  ? -48.119 -2.840  -7.761  1.00 35.34 ?  84  PHE A CE1   1 
ATOM   251  C  CE2   . PHE A 1 36  ? -49.013 -4.959  -7.068  1.00 34.47 ?  84  PHE A CE2   1 
ATOM   252  C  CZ    . PHE A 1 36  ? -49.165 -3.720  -7.710  1.00 35.77 ?  84  PHE A CZ    1 
ATOM   253  N  N     . GLY A 1 37  ? -46.154 -5.296  -2.805  1.00 24.07 ?  85  GLY A N     1 
ATOM   254  C  CA    . GLY A 1 37  ? -47.241 -5.619  -1.905  1.00 25.64 ?  85  GLY A CA    1 
ATOM   255  C  C     . GLY A 1 37  ? -47.437 -4.518  -0.889  1.00 27.04 ?  85  GLY A C     1 
ATOM   256  O  O     . GLY A 1 37  ? -48.543 -4.250  -0.441  1.00 30.10 ?  85  GLY A O     1 
ATOM   257  N  N     . PHE A 1 38  ? -46.373 -3.881  -0.475  1.00 26.13 ?  86  PHE A N     1 
ATOM   258  C  CA    . PHE A 1 38  ? -46.500 -2.953  0.665   1.00 23.99 ?  86  PHE A CA    1 
ATOM   259  C  C     . PHE A 1 38  ? -47.087 -1.592  0.235   1.00 23.37 ?  86  PHE A C     1 
ATOM   260  O  O     . PHE A 1 38  ? -47.955 -0.946  0.918   1.00 24.53 ?  86  PHE A O     1 
ATOM   261  C  CB    . PHE A 1 38  ? -45.123 -2.733  1.261   1.00 22.44 ?  86  PHE A CB    1 
ATOM   262  C  CG    . PHE A 1 38  ? -45.075 -1.682  2.350   1.00 20.81 ?  86  PHE A CG    1 
ATOM   263  C  CD1   . PHE A 1 38  ? -45.711 -1.926  3.564   1.00 21.14 ?  86  PHE A CD1   1 
ATOM   264  C  CD2   . PHE A 1 38  ? -44.391 -0.457  2.162   1.00 20.18 ?  86  PHE A CD2   1 
ATOM   265  C  CE1   . PHE A 1 38  ? -45.604 -1.039  4.629   1.00 22.74 ?  86  PHE A CE1   1 
ATOM   266  C  CE2   . PHE A 1 38  ? -44.348 0.461   3.221   1.00 20.01 ?  86  PHE A CE2   1 
ATOM   267  C  CZ    . PHE A 1 38  ? -44.981 0.149   4.501   1.00 20.18 ?  86  PHE A CZ    1 
ATOM   268  N  N     . ILE A 1 39  ? -46.542 -1.108  -0.891  1.00 24.05 ?  87  ILE A N     1 
ATOM   269  C  CA    . ILE A 1 39  ? -46.984 0.176   -1.382  1.00 24.81 ?  87  ILE A CA    1 
ATOM   270  C  C     . ILE A 1 39  ? -48.424 0.155   -1.897  1.00 26.65 ?  87  ILE A C     1 
ATOM   271  O  O     . ILE A 1 39  ? -49.141 1.157   -1.768  1.00 27.60 ?  87  ILE A O     1 
ATOM   272  C  CB    . ILE A 1 39  ? -45.982 0.668   -2.495  1.00 26.30 ?  87  ILE A CB    1 
ATOM   273  C  CG1   . ILE A 1 39  ? -44.575 0.824   -1.883  1.00 26.87 ?  87  ILE A CG1   1 
ATOM   274  C  CG2   . ILE A 1 39  ? -46.425 1.968   -3.175  1.00 28.28 ?  87  ILE A CG2   1 
ATOM   275  C  CD1   . ILE A 1 39  ? -44.412 1.926   -0.836  1.00 27.61 ?  87  ILE A CD1   1 
ATOM   276  N  N     . ASN A 1 40  ? -48.839 -0.991  -2.455  1.00 27.74 ?  88  ASN A N     1 
ATOM   277  C  CA    . ASN A 1 40  ? -50.211 -1.225  -2.942  1.00 29.94 ?  88  ASN A CA    1 
ATOM   278  C  C     . ASN A 1 40  ? -51.221 -1.482  -1.842  1.00 27.55 ?  88  ASN A C     1 
ATOM   279  O  O     . ASN A 1 40  ? -52.396 -1.640  -2.108  1.00 27.98 ?  88  ASN A O     1 
ATOM   280  C  CB    . ASN A 1 40  ? -50.210 -2.442  -3.865  1.00 32.97 ?  88  ASN A CB    1 
ATOM   281  C  CG    . ASN A 1 40  ? -51.420 -2.509  -4.746  1.00 36.98 ?  88  ASN A CG    1 
ATOM   282  O  OD1   . ASN A 1 40  ? -51.809 -1.519  -5.390  1.00 39.02 ?  88  ASN A OD1   1 
ATOM   283  N  ND2   . ASN A 1 40  ? -52.052 -3.684  -4.774  1.00 38.17 ?  88  ASN A ND2   1 
ATOM   284  N  N     . ASN A 1 41  ? -50.742 -1.611  -0.615  1.00 25.36 ?  89  ASN A N     1 
ATOM   285  C  CA    . ASN A 1 41  ? -51.592 -1.903  0.504   1.00 23.88 ?  89  ASN A CA    1 
ATOM   286  C  C     . ASN A 1 41  ? -51.873 -0.577  1.196   1.00 24.45 ?  89  ASN A C     1 
ATOM   287  O  O     . ASN A 1 41  ? -50.965 0.026   1.734   1.00 25.37 ?  89  ASN A O     1 
ATOM   288  C  CB    . ASN A 1 41  ? -50.885 -2.861  1.462   1.00 23.05 ?  89  ASN A CB    1 
ATOM   289  C  CG    . ASN A 1 41  ? -51.756 -3.226  2.642   1.00 24.87 ?  89  ASN A CG    1 
ATOM   290  O  OD1   . ASN A 1 41  ? -52.811 -2.622  2.860   1.00 24.93 ?  89  ASN A OD1   1 
ATOM   291  N  ND2   . ASN A 1 41  ? -51.318 -4.214  3.413   1.00 25.61 ?  89  ASN A ND2   1 
ATOM   292  N  N     . PRO A 1 42  ? -53.127 -0.106  1.196   1.00 25.74 ?  90  PRO A N     1 
ATOM   293  C  CA    . PRO A 1 42  ? -53.372 1.191   1.817   1.00 25.93 ?  90  PRO A CA    1 
ATOM   294  C  C     . PRO A 1 42  ? -53.409 1.127   3.342   1.00 27.44 ?  90  PRO A C     1 
ATOM   295  O  O     . PRO A 1 42  ? -53.426 2.142   4.025   1.00 29.90 ?  90  PRO A O     1 
ATOM   296  C  CB    . PRO A 1 42  ? -54.758 1.582   1.258   1.00 26.24 ?  90  PRO A CB    1 
ATOM   297  C  CG    . PRO A 1 42  ? -55.446 0.273   1.115   1.00 26.20 ?  90  PRO A CG    1 
ATOM   298  C  CD    . PRO A 1 42  ? -54.351 -0.652  0.586   1.00 25.37 ?  90  PRO A CD    1 
ATOM   299  N  N     . LYS A 1 43  ? -53.402 -0.072  3.894   1.00 26.30 ?  91  LYS A N     1 
ATOM   300  C  CA    . LYS A 1 43  ? -53.562 -0.260  5.345   1.00 28.18 ?  91  LYS A CA    1 
ATOM   301  C  C     . LYS A 1 43  ? -52.532 -1.234  5.885   1.00 25.53 ?  91  LYS A C     1 
ATOM   302  O  O     . LYS A 1 43  ? -52.878 -2.260  6.438   1.00 27.16 ?  91  LYS A O     1 
ATOM   303  C  CB    . LYS A 1 43  ? -54.995 -0.803  5.772   1.00 33.36 ?  91  LYS A CB    1 
ATOM   304  C  CG    . LYS A 1 43  ? -56.313 0.035   5.747   1.00 38.60 ?  91  LYS A CG    1 
ATOM   305  C  CD    . LYS A 1 43  ? -55.987 1.422   6.112   1.00 42.61 ?  91  LYS A CD    1 
ATOM   306  C  CE    . LYS A 1 43  ? -55.875 2.201   4.949   1.00 46.06 ?  91  LYS A CE    1 
ATOM   307  N  NZ    . LYS A 1 43  ? -55.378 3.523   5.259   1.00 48.51 ?  91  LYS A NZ    1 
ATOM   308  N  N     . PRO A 1 44  ? -51.235 -0.953  5.691   1.00 23.38 ?  92  PRO A N     1 
ATOM   309  C  CA    . PRO A 1 44  ? -50.240 -1.904  6.217   1.00 23.85 ?  92  PRO A CA    1 
ATOM   310  C  C     . PRO A 1 44  ? -50.200 -1.917  7.757   1.00 25.72 ?  92  PRO A C     1 
ATOM   311  O  O     . PRO A 1 44  ? -50.523 -0.920  8.396   1.00 27.92 ?  92  PRO A O     1 
ATOM   312  C  CB    . PRO A 1 44  ? -48.905 -1.398  5.606   1.00 24.58 ?  92  PRO A CB    1 
ATOM   313  C  CG    . PRO A 1 44  ? -49.158 0.061   5.257   1.00 25.29 ?  92  PRO A CG    1 
ATOM   314  C  CD    . PRO A 1 44  ? -50.646 0.238   5.066   1.00 23.96 ?  92  PRO A CD    1 
ATOM   315  N  N     . LYS A 1 45  ? -49.810 -3.043  8.329   1.00 25.51 ?  93  LYS A N     1 
ATOM   316  C  CA    . LYS A 1 45  ? -49.796 -3.157  9.775   1.00 27.05 ?  93  LYS A CA    1 
ATOM   317  C  C     . LYS A 1 45  ? -48.431 -2.938  10.379  1.00 24.80 ?  93  LYS A C     1 
ATOM   318  O  O     . LYS A 1 45  ? -48.312 -2.913  11.583  1.00 25.69 ?  93  LYS A O     1 
ATOM   319  C  CB    . LYS A 1 45  ? -50.320 -4.523  10.209  1.00 31.73 ?  93  LYS A CB    1 
ATOM   320  C  CG    . LYS A 1 45  ? -51.822 -4.796  9.928   1.00 35.73 ?  93  LYS A CG    1 
ATOM   321  C  CD    . LYS A 1 45  ? -52.660 -3.539  9.525   1.00 39.45 ?  93  LYS A CD    1 
ATOM   322  C  CE    . LYS A 1 45  ? -53.010 -2.570  10.686  1.00 42.27 ?  93  LYS A CE    1 
ATOM   323  N  NZ    . LYS A 1 45  ? -53.270 -1.179  10.124  1.00 44.06 ?  93  LYS A NZ    1 
ATOM   324  N  N     . LYS A 1 46  ? -47.401 -2.741  9.550   1.00 22.48 ?  94  LYS A N     1 
ATOM   325  C  CA    . LYS A 1 46  ? -46.029 -2.638  10.040  1.00 22.10 ?  94  LYS A CA    1 
ATOM   326  C  C     . LYS A 1 46  ? -45.241 -1.989  8.928   1.00 19.68 ?  94  LYS A C     1 
ATOM   327  O  O     . LYS A 1 46  ? -45.480 -2.325  7.768   1.00 20.26 ?  94  LYS A O     1 
ATOM   328  C  CB    . LYS A 1 46  ? -45.471 -4.029  10.313  1.00 23.81 ?  94  LYS A CB    1 
ATOM   329  C  CG    . LYS A 1 46  ? -44.006 -4.080  10.877  1.00 23.83 ?  94  LYS A CG    1 
ATOM   330  C  CD    . LYS A 1 46  ? -43.428 -5.451  10.766  1.00 23.17 ?  94  LYS A CD    1 
ATOM   331  C  CE    . LYS A 1 46  ? -41.991 -5.510  11.180  1.00 22.15 ?  94  LYS A CE    1 
ATOM   332  N  NZ    . LYS A 1 46  ? -41.159 -4.606  10.324  1.00 20.59 ?  94  LYS A NZ    1 
ATOM   333  N  N     . PRO A 1 47  ? -44.301 -1.086  9.247   1.00 18.98 ?  95  PRO A N     1 
ATOM   334  C  CA    . PRO A 1 47  ? -43.499 -0.556  8.127   1.00 19.14 ?  95  PRO A CA    1 
ATOM   335  C  C     . PRO A 1 47  ? -42.678 -1.659  7.471   1.00 18.62 ?  95  PRO A C     1 
ATOM   336  O  O     . PRO A 1 47  ? -42.105 -2.528  8.159   1.00 19.92 ?  95  PRO A O     1 
ATOM   337  C  CB    . PRO A 1 47  ? -42.563 0.460   8.809   1.00 20.39 ?  95  PRO A CB    1 
ATOM   338  C  CG    . PRO A 1 47  ? -42.424 -0.092  10.190  1.00 20.09 ?  95  PRO A CG    1 
ATOM   339  C  CD    . PRO A 1 47  ? -43.810 -0.570  10.557  1.00 20.03 ?  95  PRO A CD    1 
ATOM   340  N  N     . LEU A 1 48  ? -42.594 -1.610  6.151   1.00 18.16 ?  96  LEU A N     1 
ATOM   341  C  CA    . LEU A 1 48  ? -41.856 -2.622  5.430   1.00 17.06 ?  96  LEU A CA    1 
ATOM   342  C  C     . LEU A 1 48  ? -40.368 -2.461  5.748   1.00 15.57 ?  96  LEU A C     1 
ATOM   343  O  O     . LEU A 1 48  ? -39.820 -1.385  5.542   1.00 16.20 ?  96  LEU A O     1 
ATOM   344  C  CB    . LEU A 1 48  ? -42.092 -2.476  3.920   1.00 18.11 ?  96  LEU A CB    1 
ATOM   345  C  CG    . LEU A 1 48  ? -41.247 -3.450  3.074   1.00 18.02 ?  96  LEU A CG    1 
ATOM   346  C  CD1   . LEU A 1 48  ? -41.753 -4.853  3.277   1.00 19.13 ?  96  LEU A CD1   1 
ATOM   347  C  CD2   . LEU A 1 48  ? -41.313 -3.125  1.570   1.00 21.49 ?  96  LEU A CD2   1 
ATOM   348  N  N     . THR A 1 49  ? -39.756 -3.528  6.224   1.00 15.05 ?  97  THR A N     1 
ATOM   349  C  CA    . THR A 1 49  ? -38.364 -3.454  6.657   1.00 15.51 ?  97  THR A CA    1 
ATOM   350  C  C     . THR A 1 49  ? -37.544 -4.516  5.904   1.00 16.11 ?  97  THR A C     1 
ATOM   351  O  O     . THR A 1 49  ? -37.793 -5.746  6.014   1.00 17.80 ?  97  THR A O     1 
ATOM   352  C  CB    . THR A 1 49  ? -38.247 -3.649  8.207   1.00 16.56 ?  97  THR A CB    1 
ATOM   353  O  OG1   . THR A 1 49  ? -39.015 -2.626  8.853   1.00 17.78 ?  97  THR A OG1   1 
ATOM   354  C  CG2   . THR A 1 49  ? -36.773 -3.461  8.680   1.00 18.81 ?  97  THR A CG2   1 
ATOM   355  N  N     . LEU A 1 50  ? -36.626 -4.045  5.058   1.00 14.72 ?  98  LEU A N     1 
ATOM   356  C  CA    . LEU A 1 50  ? -35.790 -4.923  4.250   1.00 14.81 ?  98  LEU A CA    1 
ATOM   357  C  C     . LEU A 1 50  ? -34.354 -4.881  4.674   1.00 14.92 ?  98  LEU A C     1 
ATOM   358  O  O     . LEU A 1 50  ? -33.842 -3.811  4.946   1.00 17.05 ?  98  LEU A O     1 
ATOM   359  C  CB    . LEU A 1 50  ? -35.830 -4.465  2.799   1.00 16.32 ?  98  LEU A CB    1 
ATOM   360  C  CG    . LEU A 1 50  ? -37.206 -4.215  2.153   1.00 17.41 ?  98  LEU A CG    1 
ATOM   361  C  CD1   . LEU A 1 50  ? -37.081 -3.615  0.727   1.00 19.06 ?  98  LEU A CD1   1 
ATOM   362  C  CD2   . LEU A 1 50  ? -37.980 -5.524  2.136   1.00 20.92 ?  98  LEU A CD2   1 
ATOM   363  N  N     . SER A 1 51  ? -33.699 -6.024  4.705   1.00 14.35 ?  99  SER A N     1 
ATOM   364  C  CA    . SER A 1 51  ? -32.245 -6.047  4.985   1.00 15.76 ?  99  SER A CA    1 
ATOM   365  C  C     . SER A 1 51  ? -31.553 -6.656  3.782   1.00 15.08 ?  99  SER A C     1 
ATOM   366  O  O     . SER A 1 51  ? -31.692 -7.871  3.506   1.00 17.09 ?  99  SER A O     1 
ATOM   367  C  CB    . SER A 1 51  ? -31.934 -6.828  6.257   1.00 19.25 ?  99  SER A CB    1 
ATOM   368  O  OG    . SER A 1 51  ? -30.548 -6.696  6.505   1.00 23.25 ?  99  SER A OG    1 
ATOM   369  N  N     . LEU A 1 52  ? -30.840 -5.808  3.049   1.00 14.17 ?  100 LEU A N     1 
ATOM   370  C  CA    . LEU A 1 52  ? -30.102 -6.216  1.812   1.00 15.40 ?  100 LEU A CA    1 
ATOM   371  C  C     . LEU A 1 52  ? -28.675 -6.500  2.241   1.00 16.09 ?  100 LEU A C     1 
ATOM   372  O  O     . LEU A 1 52  ? -28.008 -5.585  2.744   1.00 17.23 ?  100 LEU A O     1 
ATOM   373  C  CB    . LEU A 1 52  ? -30.146 -5.109  0.772   1.00 16.94 ?  100 LEU A CB    1 
ATOM   374  C  CG    . LEU A 1 52  ? -31.457 -4.965  -0.016  1.00 17.32 ?  100 LEU A CG    1 
ATOM   375  C  CD1   . LEU A 1 52  ? -32.714 -4.826  0.838   1.00 19.19 ?  100 LEU A CD1   1 
ATOM   376  C  CD2   . LEU A 1 52  ? -31.330 -3.810  -0.987  1.00 18.06 ?  100 LEU A CD2   1 
ATOM   377  N  N     A HIS A 1 53  ? -28.210 -7.716  2.042   0.59 15.44 ?  101 HIS A N     1 
ATOM   378  N  N     B HIS A 1 53  ? -28.270 -7.773  2.138   0.41 15.71 ?  101 HIS A N     1 
ATOM   379  C  CA    A HIS A 1 53  ? -26.908 -8.041  2.578   0.59 15.47 ?  101 HIS A CA    1 
ATOM   380  C  CA    B HIS A 1 53  ? -26.967 -8.288  2.612   0.41 15.76 ?  101 HIS A CA    1 
ATOM   381  C  C     A HIS A 1 53  ? -26.153 -8.976  1.657   0.59 14.52 ?  101 HIS A C     1 
ATOM   382  C  C     B HIS A 1 53  ? -26.169 -8.924  1.506   0.41 14.93 ?  101 HIS A C     1 
ATOM   383  O  O     A HIS A 1 53  ? -26.715 -9.953  1.096   0.59 15.01 ?  101 HIS A O     1 
ATOM   384  O  O     B HIS A 1 53  ? -26.707 -9.735  0.727   0.41 15.75 ?  101 HIS A O     1 
ATOM   385  C  CB    A HIS A 1 53  ? -27.087 -8.631  3.993   0.59 17.66 ?  101 HIS A CB    1 
ATOM   386  C  CB    B HIS A 1 53  ? -27.105 -9.402  3.674   0.41 17.49 ?  101 HIS A CB    1 
ATOM   387  C  CG    A HIS A 1 53  ? -27.693 -10.001 4.002   0.59 19.21 ?  101 HIS A CG    1 
ATOM   388  C  CG    B HIS A 1 53  ? -27.636 -8.975  5.005   0.41 18.31 ?  101 HIS A CG    1 
ATOM   389  N  ND1   A HIS A 1 53  ? -29.042 -10.241 3.801   0.59 20.90 ?  101 HIS A ND1   1 
ATOM   390  N  ND1   B HIS A 1 53  ? -26.864 -8.997  6.150   0.41 19.30 ?  101 HIS A ND1   1 
ATOM   391  C  CD2   A HIS A 1 53  ? -27.112 -11.215 4.136   0.59 19.72 ?  101 HIS A CD2   1 
ATOM   392  C  CD2   B HIS A 1 53  ? -28.874 -8.596  5.396   0.41 18.94 ?  101 HIS A CD2   1 
ATOM   393  C  CE1   A HIS A 1 53  ? -29.264 -11.546 3.835   0.59 20.02 ?  101 HIS A CE1   1 
ATOM   394  C  CE1   B HIS A 1 53  ? -27.604 -8.641  7.189   0.41 20.65 ?  101 HIS A CE1   1 
ATOM   395  N  NE2   A HIS A 1 53  ? -28.110 -12.157 4.057   0.59 21.33 ?  101 HIS A NE2   1 
ATOM   396  N  NE2   B HIS A 1 53  ? -28.824 -8.384  6.759   0.41 20.51 ?  101 HIS A NE2   1 
ATOM   397  N  N     . GLY A 1 54  ? -24.863 -8.664  1.501   1.00 14.03 ?  102 GLY A N     1 
ATOM   398  C  CA    . GLY A 1 54  ? -23.990 -9.495  0.719   1.00 14.94 ?  102 GLY A CA    1 
ATOM   399  C  C     . GLY A 1 54  ? -22.810 -8.779  0.128   1.00 13.55 ?  102 GLY A C     1 
ATOM   400  O  O     . GLY A 1 54  ? -22.426 -7.688  0.571   1.00 15.00 ?  102 GLY A O     1 
ATOM   401  N  N     . TRP A 1 55  ? -22.264 -9.386  -0.909  1.00 14.20 ?  103 TRP A N     1 
ATOM   402  C  CA    . TRP A 1 55  ? -20.932 -9.044  -1.382  1.00 14.85 ?  103 TRP A CA    1 
ATOM   403  C  C     . TRP A 1 55  ? -20.784 -7.595  -1.803  1.00 13.87 ?  103 TRP A C     1 
ATOM   404  O  O     . TRP A 1 55  ? -21.673 -7.010  -2.437  1.00 14.19 ?  103 TRP A O     1 
ATOM   405  C  CB    . TRP A 1 55  ? -20.557 -9.979  -2.545  1.00 14.93 ?  103 TRP A CB    1 
ATOM   406  C  CG    . TRP A 1 55  ? -19.069 -10.100 -2.668  1.00 16.45 ?  103 TRP A CG    1 
ATOM   407  C  CD1   . TRP A 1 55  ? -18.235 -9.359  -3.490  1.00 18.10 ?  103 TRP A CD1   1 
ATOM   408  C  CD2   . TRP A 1 55  ? -18.228 -10.948 -1.900  1.00 17.85 ?  103 TRP A CD2   1 
ATOM   409  N  NE1   . TRP A 1 55  ? -16.920 -9.735  -3.278  1.00 18.80 ?  103 TRP A NE1   1 
ATOM   410  C  CE2   . TRP A 1 55  ? -16.891 -10.691 -2.298  1.00 19.27 ?  103 TRP A CE2   1 
ATOM   411  C  CE3   . TRP A 1 55  ? -18.470 -11.927 -0.917  1.00 18.88 ?  103 TRP A CE3   1 
ATOM   412  C  CZ2   . TRP A 1 55  ? -15.800 -11.369 -1.751  1.00 20.09 ?  103 TRP A CZ2   1 
ATOM   413  C  CZ3   . TRP A 1 55  ? -17.364 -12.577 -0.347  1.00 20.97 ?  103 TRP A CZ3   1 
ATOM   414  C  CH2   . TRP A 1 55  ? -16.057 -12.301 -0.767  1.00 20.57 ?  103 TRP A CH2   1 
ATOM   415  N  N     . THR A 1 56  ? -19.603 -7.013  -1.540  1.00 13.31 ?  104 THR A N     1 
ATOM   416  C  CA    . THR A 1 56  ? -19.354 -5.643  -1.959  1.00 12.63 ?  104 THR A CA    1 
ATOM   417  C  C     . THR A 1 56  ? -19.486 -5.492  -3.499  1.00 12.39 ?  104 THR A C     1 
ATOM   418  O  O     . THR A 1 56  ? -19.037 -6.355  -4.254  1.00 13.88 ?  104 THR A O     1 
ATOM   419  C  CB    . THR A 1 56  ? -17.963 -5.172  -1.493  1.00 13.27 ?  104 THR A CB    1 
ATOM   420  O  OG1   . THR A 1 56  ? -17.775 -3.814  -1.869  1.00 14.47 ?  104 THR A OG1   1 
ATOM   421  C  CG2   . THR A 1 56  ? -16.821 -6.050  -2.081  1.00 14.89 ?  104 THR A CG2   1 
ATOM   422  N  N     . GLY A 1 57  ? -20.069 -4.373  -3.961  1.00 11.99 ?  105 GLY A N     1 
ATOM   423  C  CA    . GLY A 1 57  ? -20.046 -4.075  -5.377  1.00 13.19 ?  105 GLY A CA    1 
ATOM   424  C  C     . GLY A 1 57  ? -21.028 -4.912  -6.169  1.00 12.58 ?  105 GLY A C     1 
ATOM   425  O  O     . GLY A 1 57  ? -20.849 -4.995  -7.391  1.00 13.25 ?  105 GLY A O     1 
ATOM   426  N  N     . THR A 1 58  ? -22.080 -5.469  -5.559  1.00 12.56 ?  106 THR A N     1 
ATOM   427  C  CA    . THR A 1 58  ? -22.922 -6.387  -6.305  1.00 12.85 ?  106 THR A CA    1 
ATOM   428  C  C     . THR A 1 58  ? -24.382 -5.950  -6.404  1.00 12.47 ?  106 THR A C     1 
ATOM   429  O  O     . THR A 1 58  ? -25.191 -6.719  -6.963  1.00 13.59 ?  106 THR A O     1 
ATOM   430  C  CB    . THR A 1 58  ? -22.862 -7.790  -5.764  1.00 15.36 ?  106 THR A CB    1 
ATOM   431  O  OG1   . THR A 1 58  ? -23.422 -7.890  -4.454  1.00 16.51 ?  106 THR A OG1   1 
ATOM   432  C  CG2   . THR A 1 58  ? -21.402 -8.337  -5.767  1.00 15.89 ?  106 THR A CG2   1 
ATOM   433  N  N     . GLY A 1 59  ? -24.716 -4.752  -5.912  1.00 12.45 ?  107 GLY A N     1 
ATOM   434  C  CA    . GLY A 1 59  ? -25.959 -4.098  -6.336  1.00 12.57 ?  107 GLY A CA    1 
ATOM   435  C  C     . GLY A 1 59  ? -26.871 -3.595  -5.249  1.00 12.78 ?  107 GLY A C     1 
ATOM   436  O  O     . GLY A 1 59  ? -28.017 -3.278  -5.524  1.00 13.29 ?  107 GLY A O     1 
ATOM   437  N  N     . LYS A 1 60  ? -26.388 -3.492  -3.988  1.00 12.38 ?  108 LYS A N     1 
ATOM   438  C  CA    . LYS A 1 60  ? -27.306 -3.107  -2.899  1.00 12.29 ?  108 LYS A CA    1 
ATOM   439  C  C     . LYS A 1 60  ? -27.724 -1.629  -2.956  1.00 13.14 ?  108 LYS A C     1 
ATOM   440  O  O     . LYS A 1 60  ? -28.928 -1.340  -3.003  1.00 13.15 ?  108 LYS A O     1 
ATOM   441  C  CB    . LYS A 1 60  ? -26.637 -3.421  -1.563  1.00 13.71 ?  108 LYS A CB    1 
ATOM   442  C  CG    . LYS A 1 60  ? -26.323 -4.915  -1.429  1.00 14.65 ?  108 LYS A CG    1 
ATOM   443  C  CD    . LYS A 1 60  ? -25.739 -5.357  -0.055  1.00 16.00 ?  108 LYS A CD    1 
ATOM   444  C  CE    . LYS A 1 60  ? -24.368 -4.644  0.166   1.00 16.42 ?  108 LYS A CE    1 
ATOM   445  N  NZ    . LYS A 1 60  ? -23.271 -5.087  -0.789  1.00 14.78 ?  108 LYS A NZ    1 
ATOM   446  N  N     . ASN A 1 61  ? -26.778 -0.686  -3.097  1.00 12.95 ?  109 ASN A N     1 
ATOM   447  C  CA    . ASN A 1 61  ? -27.195 0.717   -3.316  1.00 13.32 ?  109 ASN A CA    1 
ATOM   448  C  C     . ASN A 1 61  ? -27.882 0.857   -4.673  1.00 13.81 ?  109 ASN A C     1 
ATOM   449  O  O     . ASN A 1 61  ? -28.842 1.636   -4.824  1.00 15.02 ?  109 ASN A O     1 
ATOM   450  C  CB    . ASN A 1 61  ? -26.034 1.702   -3.244  1.00 13.38 ?  109 ASN A CB    1 
ATOM   451  C  CG    . ASN A 1 61  ? -25.591 1.958   -1.822  1.00 13.87 ?  109 ASN A CG    1 
ATOM   452  O  OD1   . ASN A 1 61  ? -24.978 1.094   -1.232  1.00 14.42 ?  109 ASN A OD1   1 
ATOM   453  N  ND2   . ASN A 1 61  ? -25.910 3.136   -1.260  1.00 16.83 ?  109 ASN A ND2   1 
ATOM   454  N  N     . PHE A 1 62  ? -27.411 0.093   -5.637  1.00 13.49 ?  110 PHE A N     1 
ATOM   455  C  CA    . PHE A 1 62  ? -27.999 0.153   -6.978  1.00 14.43 ?  110 PHE A CA    1 
ATOM   456  C  C     . PHE A 1 62  ? -29.467 -0.186  -6.944  1.00 14.77 ?  110 PHE A C     1 
ATOM   457  O  O     . PHE A 1 62  ? -30.289 0.527   -7.545  1.00 15.88 ?  110 PHE A O     1 
ATOM   458  C  CB    . PHE A 1 62  ? -27.204 -0.812  -7.884  1.00 14.85 ?  110 PHE A CB    1 
ATOM   459  C  CG    . PHE A 1 62  ? -27.608 -0.799  -9.334  1.00 17.32 ?  110 PHE A CG    1 
ATOM   460  C  CD1   . PHE A 1 62  ? -27.228 0.221   -10.165 1.00 19.67 ?  110 PHE A CD1   1 
ATOM   461  C  CD2   . PHE A 1 62  ? -28.276 -1.875  -9.840  1.00 19.40 ?  110 PHE A CD2   1 
ATOM   462  C  CE1   . PHE A 1 62  ? -27.597 0.201   -11.515 1.00 21.01 ?  110 PHE A CE1   1 
ATOM   463  C  CE2   . PHE A 1 62  ? -28.687 -1.926  -11.173 1.00 20.87 ?  110 PHE A CE2   1 
ATOM   464  C  CZ    . PHE A 1 62  ? -28.327 -0.914  -12.015 1.00 20.92 ?  110 PHE A CZ    1 
ATOM   465  N  N     A VAL A 1 63  ? -29.813 -1.290  -6.275  0.44 14.60 ?  111 VAL A N     1 
ATOM   466  N  N     B VAL A 1 63  ? -29.824 -1.259  -6.273  0.56 14.38 ?  111 VAL A N     1 
ATOM   467  C  CA    A VAL A 1 63  ? -31.222 -1.704  -6.121  0.44 15.11 ?  111 VAL A CA    1 
ATOM   468  C  CA    B VAL A 1 63  ? -31.230 -1.589  -6.297  0.56 14.75 ?  111 VAL A CA    1 
ATOM   469  C  C     A VAL A 1 63  ? -32.026 -0.674  -5.360  0.44 15.05 ?  111 VAL A C     1 
ATOM   470  C  C     B VAL A 1 63  ? -32.052 -0.711  -5.341  0.56 14.87 ?  111 VAL A C     1 
ATOM   471  O  O     A VAL A 1 63  ? -33.187 -0.383  -5.707  0.44 15.31 ?  111 VAL A O     1 
ATOM   472  O  O     B VAL A 1 63  ? -33.271 -0.533  -5.561  0.56 15.18 ?  111 VAL A O     1 
ATOM   473  C  CB    A VAL A 1 63  ? -31.345 -3.097  -5.429  0.44 15.35 ?  111 VAL A CB    1 
ATOM   474  C  CB    B VAL A 1 63  ? -31.438 -3.085  -6.038  0.56 14.31 ?  111 VAL A CB    1 
ATOM   475  C  CG1   A VAL A 1 63  ? -32.782 -3.373  -4.824  0.44 16.53 ?  111 VAL A CG1   1 
ATOM   476  C  CG1   B VAL A 1 63  ? -31.280 -3.414  -4.566  0.56 14.04 ?  111 VAL A CG1   1 
ATOM   477  C  CG2   A VAL A 1 63  ? -30.911 -4.193  -6.402  0.44 15.04 ?  111 VAL A CG2   1 
ATOM   478  C  CG2   B VAL A 1 63  ? -32.779 -3.545  -6.621  0.56 14.56 ?  111 VAL A CG2   1 
ATOM   479  N  N     . SER A 1 64  ? -31.423 -0.123  -4.311  1.00 15.20 ?  112 SER A N     1 
ATOM   480  C  CA    . SER A 1 64  ? -32.107 0.888   -3.471  1.00 15.10 ?  112 SER A CA    1 
ATOM   481  C  C     . SER A 1 64  ? -32.540 2.077   -4.318  1.00 14.23 ?  112 SER A C     1 
ATOM   482  O  O     . SER A 1 64  ? -33.643 2.619   -4.110  1.00 14.87 ?  112 SER A O     1 
ATOM   483  C  CB    . SER A 1 64  ? -31.222 1.339   -2.318  1.00 16.41 ?  112 SER A CB    1 
ATOM   484  O  OG    . SER A 1 64  ? -30.958 0.209   -1.566  1.00 18.15 ?  112 SER A OG    1 
ATOM   485  N  N     A LYS A 1 65  ? -31.700 2.481   -5.277  0.54 14.21 ?  113 LYS A N     1 
ATOM   486  N  N     B LYS A 1 65  ? -31.697 2.454   -5.271  0.46 14.18 ?  113 LYS A N     1 
ATOM   487  C  CA    A LYS A 1 65  ? -32.061 3.554   -6.203  0.54 15.26 ?  113 LYS A CA    1 
ATOM   488  C  CA    B LYS A 1 65  ? -32.015 3.540   -6.169  0.46 15.13 ?  113 LYS A CA    1 
ATOM   489  C  C     A LYS A 1 65  ? -33.229 3.148   -7.092  0.54 16.13 ?  113 LYS A C     1 
ATOM   490  C  C     B LYS A 1 65  ? -33.176 3.159   -7.108  0.46 16.01 ?  113 LYS A C     1 
ATOM   491  O  O     A LYS A 1 65  ? -34.141 3.927   -7.299  0.54 16.47 ?  113 LYS A O     1 
ATOM   492  O  O     B LYS A 1 65  ? -34.053 3.965   -7.334  0.46 16.39 ?  113 LYS A O     1 
ATOM   493  C  CB    A LYS A 1 65  ? -30.882 3.933   -7.109  0.54 15.37 ?  113 LYS A CB    1 
ATOM   494  C  CB    B LYS A 1 65  ? -30.768 3.915   -6.970  0.46 15.16 ?  113 LYS A CB    1 
ATOM   495  C  CG    A LYS A 1 65  ? -29.765 4.573   -6.389  0.54 17.48 ?  113 LYS A CG    1 
ATOM   496  C  CG    B LYS A 1 65  ? -30.975 5.025   -7.942  0.46 16.76 ?  113 LYS A CG    1 
ATOM   497  C  CD    A LYS A 1 65  ? -28.579 4.907   -7.270  0.54 20.59 ?  113 LYS A CD    1 
ATOM   498  C  CD    B LYS A 1 65  ? -29.628 5.528   -8.474  0.46 19.28 ?  113 LYS A CD    1 
ATOM   499  C  CE    A LYS A 1 65  ? -27.370 5.184   -6.364  0.54 22.25 ?  113 LYS A CE    1 
ATOM   500  C  CE    B LYS A 1 65  ? -29.818 6.547   -9.579  0.46 21.33 ?  113 LYS A CE    1 
ATOM   501  N  NZ    A LYS A 1 65  ? -26.375 4.105   -6.644  0.54 25.45 ?  113 LYS A NZ    1 
ATOM   502  N  NZ    B LYS A 1 65  ? -29.942 5.912   -10.911 0.46 23.90 ?  113 LYS A NZ    1 
ATOM   503  N  N     . ILE A 1 66  ? -33.205 1.914   -7.587  1.00 15.80 ?  114 ILE A N     1 
ATOM   504  C  CA    . ILE A 1 66  ? -34.318 1.432   -8.450  1.00 15.92 ?  114 ILE A CA    1 
ATOM   505  C  C     . ILE A 1 66  ? -35.616 1.490   -7.645  1.00 15.48 ?  114 ILE A C     1 
ATOM   506  O  O     . ILE A 1 66  ? -36.657 1.959   -8.122  1.00 16.40 ?  114 ILE A O     1 
ATOM   507  C  CB    . ILE A 1 66  ? -34.035 0.011   -8.959  1.00 16.44 ?  114 ILE A CB    1 
ATOM   508  C  CG1   . ILE A 1 66  ? -32.943 0.097   -10.011 1.00 18.82 ?  114 ILE A CG1   1 
ATOM   509  C  CG2   . ILE A 1 66  ? -35.304 -0.665  -9.584  1.00 17.84 ?  114 ILE A CG2   1 
ATOM   510  C  CD1   . ILE A 1 66  ? -32.423 -1.263  -10.436 1.00 20.26 ?  114 ILE A CD1   1 
ATOM   511  N  N     . ILE A 1 67  ? -35.577 1.026   -6.395  1.00 15.35 ?  115 ILE A N     1 
ATOM   512  C  CA    . ILE A 1 67  ? -36.791 1.073   -5.570  1.00 14.59 ?  115 ILE A CA    1 
ATOM   513  C  C     . ILE A 1 67  ? -37.256 2.516   -5.411  1.00 14.56 ?  115 ILE A C     1 
ATOM   514  O  O     . ILE A 1 67  ? -38.444 2.840   -5.629  1.00 15.59 ?  115 ILE A O     1 
ATOM   515  C  CB    . ILE A 1 67  ? -36.525 0.424   -4.164  1.00 15.26 ?  115 ILE A CB    1 
ATOM   516  C  CG1   . ILE A 1 67  ? -36.272 -1.089  -4.299  1.00 16.10 ?  115 ILE A CG1   1 
ATOM   517  C  CG2   . ILE A 1 67  ? -37.717 0.655   -3.195  1.00 17.41 ?  115 ILE A CG2   1 
ATOM   518  C  CD1   . ILE A 1 67  ? -35.684 -1.776  -3.019  1.00 17.29 ?  115 ILE A CD1   1 
ATOM   519  N  N     . ALA A 1 68  ? -36.372 3.382   -4.946  1.00 15.03 ?  116 ALA A N     1 
ATOM   520  C  CA    . ALA A 1 68  ? -36.749 4.784   -4.710  1.00 15.15 ?  116 ALA A CA    1 
ATOM   521  C  C     . ALA A 1 68  ? -37.327 5.429   -5.984  1.00 15.90 ?  116 ALA A C     1 
ATOM   522  O  O     . ALA A 1 68  ? -38.310 6.140   -5.912  1.00 16.57 ?  116 ALA A O     1 
ATOM   523  C  CB    . ALA A 1 68  ? -35.532 5.560   -4.227  1.00 14.64 ?  116 ALA A CB    1 
ATOM   524  N  N     . GLU A 1 69  ? -36.661 5.230   -7.131  1.00 16.18 ?  117 GLU A N     1 
ATOM   525  C  CA    . GLU A 1 69  ? -37.098 5.827   -8.407  1.00 19.49 ?  117 GLU A CA    1 
ATOM   526  C  C     . GLU A 1 69  ? -38.456 5.349   -8.806  1.00 20.07 ?  117 GLU A C     1 
ATOM   527  O  O     . GLU A 1 69  ? -39.190 6.093   -9.496  1.00 20.84 ?  117 GLU A O     1 
ATOM   528  C  CB    . GLU A 1 69  ? -36.127 5.450   -9.556  1.00 22.24 ?  117 GLU A CB    1 
ATOM   529  C  CG    . GLU A 1 69  ? -34.734 5.771   -9.347  1.00 28.82 ?  117 GLU A CG    1 
ATOM   530  C  CD    . GLU A 1 69  ? -33.743 5.161   -10.387 1.00 35.12 ?  117 GLU A CD    1 
ATOM   531  O  OE1   . GLU A 1 69  ? -34.058 4.190   -11.095 1.00 37.26 ?  117 GLU A OE1   1 
ATOM   532  O  OE2   . GLU A 1 69  ? -32.611 5.681   -10.498 1.00 40.41 ?  117 GLU A OE2   1 
ATOM   533  N  N     . ASN A 1 70  ? -38.780 4.096   -8.489  1.00 18.84 ?  118 ASN A N     1 
ATOM   534  C  CA    . ASN A 1 70  ? -40.088 3.577   -8.875  1.00 20.05 ?  118 ASN A CA    1 
ATOM   535  C  C     . ASN A 1 70  ? -41.211 4.077   -7.993  1.00 20.17 ?  118 ASN A C     1 
ATOM   536  O  O     . ASN A 1 70  ? -42.368 4.042   -8.409  1.00 23.81 ?  118 ASN A O     1 
ATOM   537  C  CB    . ASN A 1 70  ? -40.053 2.047   -8.900  1.00 20.03 ?  118 ASN A CB    1 
ATOM   538  C  CG    . ASN A 1 70  ? -39.564 1.518   -10.268 1.00 22.46 ?  118 ASN A CG    1 
ATOM   539  O  OD1   . ASN A 1 70  ? -40.373 1.301   -11.198 1.00 24.38 ?  118 ASN A OD1   1 
ATOM   540  N  ND2   . ASN A 1 70  ? -38.251 1.402   -10.433 1.00 21.06 ?  118 ASN A ND2   1 
ATOM   541  N  N     . ILE A 1 71  ? -40.897 4.588   -6.826  1.00 18.25 ?  119 ILE A N     1 
ATOM   542  C  CA    . ILE A 1 71  ? -41.919 5.108   -5.901  1.00 17.07 ?  119 ILE A CA    1 
ATOM   543  C  C     . ILE A 1 71  ? -42.040 6.626   -5.993  1.00 17.51 ?  119 ILE A C     1 
ATOM   544  O  O     . ILE A 1 71  ? -43.166 7.142   -5.971  1.00 19.82 ?  119 ILE A O     1 
ATOM   545  C  CB    . ILE A 1 71  ? -41.630 4.657   -4.450  1.00 16.88 ?  119 ILE A CB    1 
ATOM   546  C  CG1   . ILE A 1 71  ? -41.572 3.133   -4.415  1.00 18.62 ?  119 ILE A CG1   1 
ATOM   547  C  CG2   . ILE A 1 71  ? -42.667 5.283   -3.446  1.00 17.28 ?  119 ILE A CG2   1 
ATOM   548  C  CD1   . ILE A 1 71  ? -41.140 2.596   -3.124  1.00 20.19 ?  119 ILE A CD1   1 
ATOM   549  N  N     . TYR A 1 72  ? -40.908 7.322   -6.084  1.00 17.68 ?  120 TYR A N     1 
ATOM   550  C  CA    . TYR A 1 72  ? -40.891 8.783   -6.074  1.00 17.63 ?  120 TYR A CA    1 
ATOM   551  C  C     . TYR A 1 72  ? -40.089 9.393   -7.208  1.00 18.50 ?  120 TYR A C     1 
ATOM   552  O  O     . TYR A 1 72  ? -38.951 9.001   -7.445  1.00 19.30 ?  120 TYR A O     1 
ATOM   553  C  CB    . TYR A 1 72  ? -40.270 9.311   -4.759  1.00 17.05 ?  120 TYR A CB    1 
ATOM   554  C  CG    . TYR A 1 72  ? -41.175 9.143   -3.575  1.00 17.56 ?  120 TYR A CG    1 
ATOM   555  C  CD1   . TYR A 1 72  ? -42.353 9.849   -3.492  1.00 19.68 ?  120 TYR A CD1   1 
ATOM   556  C  CD2   . TYR A 1 72  ? -40.812 8.329   -2.500  1.00 17.17 ?  120 TYR A CD2   1 
ATOM   557  C  CE1   . TYR A 1 72  ? -43.199 9.727   -2.418  1.00 20.92 ?  120 TYR A CE1   1 
ATOM   558  C  CE2   . TYR A 1 72  ? -41.666 8.191   -1.387  1.00 18.69 ?  120 TYR A CE2   1 
ATOM   559  C  CZ    . TYR A 1 72  ? -42.855 8.922   -1.351  1.00 19.66 ?  120 TYR A CZ    1 
ATOM   560  O  OH    . TYR A 1 72  ? -43.727 8.825   -0.291  1.00 22.67 ?  120 TYR A OH    1 
ATOM   561  N  N     . GLU A 1 73  ? -40.634 10.434  -7.831  1.00 21.52 ?  121 GLU A N     1 
ATOM   562  C  CA    . GLU A 1 73  ? -39.856 11.210  -8.774  1.00 23.92 ?  121 GLU A CA    1 
ATOM   563  C  C     . GLU A 1 73  ? -38.606 11.766  -8.083  1.00 21.57 ?  121 GLU A C     1 
ATOM   564  O  O     . GLU A 1 73  ? -38.677 12.339  -6.998  1.00 22.12 ?  121 GLU A O     1 
ATOM   565  C  CB    . GLU A 1 73  ? -40.683 12.373  -9.329  1.00 28.83 ?  121 GLU A CB    1 
ATOM   566  C  CG    . GLU A 1 73  ? -41.711 12.037  -10.367 1.00 34.70 ?  121 GLU A CG    1 
ATOM   567  C  CD    . GLU A 1 73  ? -41.792 13.144  -11.432 1.00 37.84 ?  121 GLU A CD    1 
ATOM   568  O  OE1   . GLU A 1 73  ? -41.674 12.845  -12.650 1.00 39.12 ?  121 GLU A OE1   1 
ATOM   569  O  OE2   . GLU A 1 73  ? -41.910 14.326  -11.057 1.00 39.71 ?  121 GLU A OE2   1 
ATOM   570  N  N     . GLY A 1 74  ? -37.449 11.633  -8.714  1.00 21.26 ?  122 GLY A N     1 
ATOM   571  C  CA    . GLY A 1 74  ? -36.184 12.057  -8.117  1.00 19.12 ?  122 GLY A CA    1 
ATOM   572  C  C     . GLY A 1 74  ? -35.399 10.911  -7.500  1.00 18.96 ?  122 GLY A C     1 
ATOM   573  O  O     . GLY A 1 74  ? -34.205 11.060  -7.244  1.00 18.80 ?  122 GLY A O     1 
ATOM   574  N  N     . GLY A 1 75  ? -36.073 9.789   -7.201  1.00 16.71 ?  123 GLY A N     1 
ATOM   575  C  CA    . GLY A 1 75  ? -35.373 8.644   -6.611  1.00 17.23 ?  123 GLY A CA    1 
ATOM   576  C  C     . GLY A 1 75  ? -34.755 9.034   -5.265  1.00 16.39 ?  123 GLY A C     1 
ATOM   577  O  O     . GLY A 1 75  ? -35.440 9.560   -4.369  1.00 16.17 ?  123 GLY A O     1 
ATOM   578  N  N     . LEU A 1 76  ? -33.460 8.767   -5.086  1.00 16.03 ?  124 LEU A N     1 
ATOM   579  C  CA    . LEU A 1 76  ? -32.787 9.172   -3.826  1.00 15.75 ?  124 LEU A CA    1 
ATOM   580  C  C     . LEU A 1 76  ? -32.836 10.681  -3.622  1.00 15.59 ?  124 LEU A C     1 
ATOM   581  O  O     . LEU A 1 76  ? -32.705 11.145  -2.489  1.00 15.76 ?  124 LEU A O     1 
ATOM   582  C  CB    . LEU A 1 76  ? -31.313 8.726   -3.805  1.00 17.31 ?  124 LEU A CB    1 
ATOM   583  C  CG    . LEU A 1 76  ? -31.084 7.241   -3.998  1.00 18.05 ?  124 LEU A CG    1 
ATOM   584  C  CD1   . LEU A 1 76  ? -29.540 7.002   -3.969  1.00 20.91 ?  124 LEU A CD1   1 
ATOM   585  C  CD2   . LEU A 1 76  ? -31.785 6.391   -2.970  1.00 19.55 ?  124 LEU A CD2   1 
ATOM   586  N  N     . ASN A 1 77  ? -33.052 11.461  -4.684  1.00 15.27 ?  125 ASN A N     1 
ATOM   587  C  CA    . ASN A 1 77  ? -33.164 12.903  -4.519  1.00 16.00 ?  125 ASN A CA    1 
ATOM   588  C  C     . ASN A 1 77  ? -34.574 13.388  -4.266  1.00 15.75 ?  125 ASN A C     1 
ATOM   589  O  O     . ASN A 1 77  ? -34.796 14.612  -4.100  1.00 18.45 ?  125 ASN A O     1 
ATOM   590  C  CB    . ASN A 1 77  ? -32.552 13.612  -5.719  1.00 18.57 ?  125 ASN A CB    1 
ATOM   591  C  CG    . ASN A 1 77  ? -31.072 13.436  -5.754  1.00 23.02 ?  125 ASN A CG    1 
ATOM   592  O  OD1   . ASN A 1 77  ? -30.408 13.314  -4.690  1.00 25.35 ?  125 ASN A OD1   1 
ATOM   593  N  ND2   . ASN A 1 77  ? -30.516 13.456  -6.950  1.00 26.49 ?  125 ASN A ND2   1 
ATOM   594  N  N     . SER A 1 78  ? -35.514 12.463  -4.148  1.00 14.80 ?  126 SER A N     1 
ATOM   595  C  CA    . SER A 1 78  ? -36.834 12.836  -3.661  1.00 14.45 ?  126 SER A CA    1 
ATOM   596  C  C     . SER A 1 78  ? -36.754 13.445  -2.267  1.00 14.92 ?  126 SER A C     1 
ATOM   597  O  O     . SER A 1 78  ? -35.941 13.009  -1.448  1.00 15.29 ?  126 SER A O     1 
ATOM   598  C  CB    . SER A 1 78  ? -37.719 11.581  -3.585  1.00 14.47 ?  126 SER A CB    1 
ATOM   599  O  OG    . SER A 1 78  ? -38.975 11.884  -2.939  1.00 15.90 ?  126 SER A OG    1 
ATOM   600  N  N     . ASP A 1 79  ? -37.640 14.409  -2.001  1.00 15.05 ?  127 ASP A N     1 
ATOM   601  C  CA    . ASP A 1 79  ? -37.752 14.952  -0.648  1.00 15.73 ?  127 ASP A CA    1 
ATOM   602  C  C     . ASP A 1 79  ? -38.198 13.896  0.373   1.00 14.69 ?  127 ASP A C     1 
ATOM   603  O  O     . ASP A 1 79  ? -37.954 14.072  1.576   1.00 15.75 ?  127 ASP A O     1 
ATOM   604  C  CB    . ASP A 1 79  ? -38.761 16.117  -0.582  1.00 17.76 ?  127 ASP A CB    1 
ATOM   605  C  CG    . ASP A 1 79  ? -38.262 17.399  -1.255  1.00 20.82 ?  127 ASP A CG    1 
ATOM   606  O  OD1   . ASP A 1 79  ? -37.023 17.568  -1.397  1.00 23.53 ?  127 ASP A OD1   1 
ATOM   607  O  OD2   . ASP A 1 79  ? -39.123 18.244  -1.606  1.00 22.06 ?  127 ASP A OD2   1 
ATOM   608  N  N     . TYR A 1 80  ? -38.696 12.747  -0.090  1.00 13.92 ?  128 TYR A N     1 
ATOM   609  C  CA    . TYR A 1 80  ? -39.320 11.770  0.815   1.00 13.97 ?  128 TYR A CA    1 
ATOM   610  C  C     . TYR A 1 80  ? -38.485 10.495  0.950   1.00 13.36 ?  128 TYR A C     1 
ATOM   611  O  O     . TYR A 1 80  ? -38.912 9.534   1.584   1.00 14.24 ?  128 TYR A O     1 
ATOM   612  C  CB    . TYR A 1 80  ? -40.764 11.475  0.350   1.00 16.08 ?  128 TYR A CB    1 
ATOM   613  C  CG    . TYR A 1 80  ? -41.490 12.802  0.219   1.00 18.65 ?  128 TYR A CG    1 
ATOM   614  C  CD1   . TYR A 1 80  ? -41.678 13.632  1.326   1.00 20.54 ?  128 TYR A CD1   1 
ATOM   615  C  CD2   . TYR A 1 80  ? -41.870 13.295  -1.034  1.00 21.19 ?  128 TYR A CD2   1 
ATOM   616  C  CE1   . TYR A 1 80  ? -42.247 14.874  1.213   1.00 22.45 ?  128 TYR A CE1   1 
ATOM   617  C  CE2   . TYR A 1 80  ? -42.482 14.545  -1.151  1.00 21.85 ?  128 TYR A CE2   1 
ATOM   618  C  CZ    . TYR A 1 80  ? -42.665 15.332  -0.013  1.00 23.26 ?  128 TYR A CZ    1 
ATOM   619  O  OH    . TYR A 1 80  ? -43.245 16.586  -0.141  1.00 27.27 ?  128 TYR A OH    1 
ATOM   620  N  N     . VAL A 1 81  ? -37.253 10.522  0.451   1.00 13.36 ?  129 VAL A N     1 
ATOM   621  C  CA    . VAL A 1 81  ? -36.319 9.397   0.563   1.00 12.92 ?  129 VAL A CA    1 
ATOM   622  C  C     . VAL A 1 81  ? -35.080 9.920   1.302   1.00 13.20 ?  129 VAL A C     1 
ATOM   623  O  O     . VAL A 1 81  ? -34.505 10.931  0.890   1.00 14.77 ?  129 VAL A O     1 
ATOM   624  C  CB    . VAL A 1 81  ? -35.915 8.854   -0.849  1.00 13.71 ?  129 VAL A CB    1 
ATOM   625  C  CG1   . VAL A 1 81  ? -34.884 7.708   -0.689  1.00 14.95 ?  129 VAL A CG1   1 
ATOM   626  C  CG2   . VAL A 1 81  ? -37.176 8.321   -1.585  1.00 13.61 ?  129 VAL A CG2   1 
ATOM   627  N  N     . HIS A 1 82  ? -34.718 9.247   2.383   1.00 13.76 ?  130 HIS A N     1 
ATOM   628  C  CA    . HIS A 1 82  ? -33.677 9.735   3.310   1.00 13.50 ?  130 HIS A CA    1 
ATOM   629  C  C     . HIS A 1 82  ? -32.577 8.723   3.422   1.00 14.70 ?  130 HIS A C     1 
ATOM   630  O  O     . HIS A 1 82  ? -32.829 7.603   3.833   1.00 17.78 ?  130 HIS A O     1 
ATOM   631  C  CB    . HIS A 1 82  ? -34.268 10.004  4.703   1.00 15.21 ?  130 HIS A CB    1 
ATOM   632  C  CG    . HIS A 1 82  ? -35.403 10.975  4.636   1.00 15.32 ?  130 HIS A CG    1 
ATOM   633  N  ND1   . HIS A 1 82  ? -35.230 12.334  4.767   1.00 17.08 ?  130 HIS A ND1   1 
ATOM   634  C  CD2   . HIS A 1 82  ? -36.736 10.785  4.426   1.00 16.61 ?  130 HIS A CD2   1 
ATOM   635  C  CE1   . HIS A 1 82  ? -36.398 12.941  4.641   1.00 18.25 ?  130 HIS A CE1   1 
ATOM   636  N  NE2   . HIS A 1 82  ? -37.326 12.021  4.434   1.00 17.21 ?  130 HIS A NE2   1 
ATOM   637  N  N     . LEU A 1 83  ? -31.365 9.099   3.080   1.00 13.98 ?  131 LEU A N     1 
ATOM   638  C  CA    . LEU A 1 83  ? -30.240 8.179   3.151   1.00 14.14 ?  131 LEU A CA    1 
ATOM   639  C  C     . LEU A 1 83  ? -29.313 8.537   4.319   1.00 14.51 ?  131 LEU A C     1 
ATOM   640  O  O     . LEU A 1 83  ? -28.805 9.678   4.404   1.00 17.20 ?  131 LEU A O     1 
ATOM   641  C  CB    . LEU A 1 83  ? -29.450 8.263   1.843   1.00 15.03 ?  131 LEU A CB    1 
ATOM   642  C  CG    . LEU A 1 83  ? -28.152 7.450   1.783   1.00 14.82 ?  131 LEU A CG    1 
ATOM   643  C  CD1   . LEU A 1 83  ? -28.441 5.974   1.799   1.00 15.40 ?  131 LEU A CD1   1 
ATOM   644  C  CD2   . LEU A 1 83  ? -27.364 7.841   0.529   1.00 18.85 ?  131 LEU A CD2   1 
ATOM   645  N  N     . PHE A 1 84  ? -29.078 7.557   5.168   1.00 14.29 ?  132 PHE A N     1 
ATOM   646  C  CA    . PHE A 1 84  ? -28.079 7.685   6.245   1.00 14.43 ?  132 PHE A CA    1 
ATOM   647  C  C     . PHE A 1 84  ? -26.953 6.773   5.892   1.00 13.85 ?  132 PHE A C     1 
ATOM   648  O  O     . PHE A 1 84  ? -27.188 5.603   5.564   1.00 17.01 ?  132 PHE A O     1 
ATOM   649  C  CB    . PHE A 1 84  ? -28.644 7.291   7.614   1.00 16.04 ?  132 PHE A CB    1 
ATOM   650  C  CG    . PHE A 1 84  ? -29.846 8.081   7.978   1.00 17.81 ?  132 PHE A CG    1 
ATOM   651  C  CD1   . PHE A 1 84  ? -29.760 9.390   8.448   1.00 20.14 ?  132 PHE A CD1   1 
ATOM   652  C  CD2   . PHE A 1 84  ? -31.088 7.512   7.813   1.00 19.96 ?  132 PHE A CD2   1 
ATOM   653  C  CE1   . PHE A 1 84  ? -30.943 10.110  8.732   1.00 22.20 ?  132 PHE A CE1   1 
ATOM   654  C  CE2   . PHE A 1 84  ? -32.224 8.213   8.123   1.00 22.85 ?  132 PHE A CE2   1 
ATOM   655  C  CZ    . PHE A 1 84  ? -32.139 9.500   8.566   1.00 23.43 ?  132 PHE A CZ    1 
ATOM   656  N  N     . VAL A 1 85  ? -25.725 7.254   5.917   1.00 13.02 ?  133 VAL A N     1 
ATOM   657  C  CA    . VAL A 1 85  ? -24.595 6.403   5.555   1.00 13.17 ?  133 VAL A CA    1 
ATOM   658  C  C     . VAL A 1 85  ? -23.778 6.259   6.845   1.00 12.45 ?  133 VAL A C     1 
ATOM   659  O  O     . VAL A 1 85  ? -23.173 7.245   7.275   1.00 13.46 ?  133 VAL A O     1 
ATOM   660  C  CB    . VAL A 1 85  ? -23.760 7.029   4.429   1.00 14.81 ?  133 VAL A CB    1 
ATOM   661  C  CG1   . VAL A 1 85  ? -22.581 6.143   4.115   1.00 16.11 ?  133 VAL A CG1   1 
ATOM   662  C  CG2   . VAL A 1 85  ? -24.616 7.235   3.147   1.00 15.30 ?  133 VAL A CG2   1 
ATOM   663  N  N     . ALA A 1 86  ? -23.770 5.079   7.471   1.00 12.57 ?  134 ALA A N     1 
ATOM   664  C  CA    . ALA A 1 86  ? -23.244 5.000   8.859   1.00 13.18 ?  134 ALA A CA    1 
ATOM   665  C  C     . ALA A 1 86  ? -21.771 5.475   8.914   1.00 12.53 ?  134 ALA A C     1 
ATOM   666  O  O     . ALA A 1 86  ? -21.360 6.134   9.877   1.00 13.17 ?  134 ALA A O     1 
ATOM   667  C  CB    . ALA A 1 86  ? -23.378 3.603   9.414   1.00 15.06 ?  134 ALA A CB    1 
ATOM   668  N  N     . THR A 1 87  ? -20.976 5.126   7.907   1.00 13.29 ?  135 THR A N     1 
ATOM   669  C  CA    . THR A 1 87  ? -19.561 5.431   7.939   1.00 12.96 ?  135 THR A CA    1 
ATOM   670  C  C     . THR A 1 87  ? -19.269 6.933   7.705   1.00 13.03 ?  135 THR A C     1 
ATOM   671  O  O     . THR A 1 87  ? -18.156 7.381   7.966   1.00 15.64 ?  135 THR A O     1 
ATOM   672  C  CB    . THR A 1 87  ? -18.860 4.576   6.878   1.00 13.31 ?  135 THR A CB    1 
ATOM   673  O  OG1   . THR A 1 87  ? -19.701 4.479   5.710   1.00 14.18 ?  135 THR A OG1   1 
ATOM   674  C  CG2   . THR A 1 87  ? -18.693 3.132   7.378   1.00 14.54 ?  135 THR A CG2   1 
ATOM   675  N  N     . LEU A 1 88  ? -20.239 7.692   7.168   1.00 12.56 ?  136 LEU A N     1 
ATOM   676  C  CA    . LEU A 1 88  ? -20.121 9.135   6.924   1.00 12.73 ?  136 LEU A CA    1 
ATOM   677  C  C     . LEU A 1 88  ? -20.810 9.957   8.037   1.00 13.18 ?  136 LEU A C     1 
ATOM   678  O  O     . LEU A 1 88  ? -20.263 10.939  8.556   1.00 15.10 ?  136 LEU A O     1 
ATOM   679  C  CB    . LEU A 1 88  ? -20.783 9.474   5.567   1.00 13.96 ?  136 LEU A CB    1 
ATOM   680  C  CG    . LEU A 1 88  ? -20.912 10.938  5.220   1.00 15.14 ?  136 LEU A CG    1 
ATOM   681  C  CD1   . LEU A 1 88  ? -19.530 11.583  5.015   1.00 16.44 ?  136 LEU A CD1   1 
ATOM   682  C  CD2   . LEU A 1 88  ? -21.767 11.151  3.890   1.00 15.83 ?  136 LEU A CD2   1 
ATOM   683  N  N     . HIS A 1 89  ? -22.055 9.566   8.362   1.00 12.13 ?  137 HIS A N     1 
ATOM   684  C  CA    . HIS A 1 89  ? -22.919 10.298  9.295   1.00 12.22 ?  137 HIS A CA    1 
ATOM   685  C  C     . HIS A 1 89  ? -22.769 9.854   10.728  1.00 12.96 ?  137 HIS A C     1 
ATOM   686  O  O     . HIS A 1 89  ? -23.036 10.662  11.613  1.00 13.63 ?  137 HIS A O     1 
ATOM   687  C  CB    . HIS A 1 89  ? -24.389 10.136  8.846   1.00 13.32 ?  137 HIS A CB    1 
ATOM   688  C  CG    . HIS A 1 89  ? -24.625 10.762  7.504   1.00 14.39 ?  137 HIS A CG    1 
ATOM   689  N  ND1   . HIS A 1 89  ? -25.252 10.106  6.457   1.00 15.33 ?  137 HIS A ND1   1 
ATOM   690  C  CD2   . HIS A 1 89  ? -24.361 12.023  7.059   1.00 15.97 ?  137 HIS A CD2   1 
ATOM   691  C  CE1   . HIS A 1 89  ? -25.329 10.911  5.411   1.00 16.45 ?  137 HIS A CE1   1 
ATOM   692  N  NE2   . HIS A 1 89  ? -24.828 12.094  5.752   1.00 17.13 ?  137 HIS A NE2   1 
ATOM   693  N  N     . PHE A 1 90  ? -22.365 8.604   10.935  1.00 12.79 ?  138 PHE A N     1 
ATOM   694  C  CA    . PHE A 1 90  ? -22.219 8.066   12.313  1.00 13.13 ?  138 PHE A CA    1 
ATOM   695  C  C     . PHE A 1 90  ? -20.819 7.468   12.532  1.00 12.82 ?  138 PHE A C     1 
ATOM   696  O  O     . PHE A 1 90  ? -20.673 6.317   12.972  1.00 13.74 ?  138 PHE A O     1 
ATOM   697  C  CB    . PHE A 1 90  ? -23.268 6.972   12.601  1.00 13.84 ?  138 PHE A CB    1 
ATOM   698  C  CG    . PHE A 1 90  ? -24.672 7.318   12.171  1.00 14.03 ?  138 PHE A CG    1 
ATOM   699  C  CD1   . PHE A 1 90  ? -25.290 8.515   12.506  1.00 14.36 ?  138 PHE A CD1   1 
ATOM   700  C  CD2   . PHE A 1 90  ? -25.444 6.357   11.462  1.00 15.10 ?  138 PHE A CD2   1 
ATOM   701  C  CE1   . PHE A 1 90  ? -26.637 8.773   12.124  1.00 15.55 ?  138 PHE A CE1   1 
ATOM   702  C  CE2   . PHE A 1 90  ? -26.749 6.640   11.067  1.00 16.22 ?  138 PHE A CE2   1 
ATOM   703  C  CZ    . PHE A 1 90  ? -27.343 7.839   11.401  1.00 15.27 ?  138 PHE A CZ    1 
ATOM   704  N  N     . PRO A 1 91  ? -19.760 8.228   12.214  1.00 12.78 ?  139 PRO A N     1 
ATOM   705  C  CA    . PRO A 1 91  ? -18.449 7.565   12.166  1.00 14.30 ?  139 PRO A CA    1 
ATOM   706  C  C     . PRO A 1 91  ? -17.825 7.181   13.510  1.00 15.24 ?  139 PRO A C     1 
ATOM   707  O  O     . PRO A 1 91  ? -17.041 6.221   13.541  1.00 18.11 ?  139 PRO A O     1 
ATOM   708  C  CB    . PRO A 1 91  ? -17.570 8.614   11.485  1.00 14.64 ?  139 PRO A CB    1 
ATOM   709  C  CG    . PRO A 1 91  ? -18.218 9.964   11.820  1.00 14.11 ?  139 PRO A CG    1 
ATOM   710  C  CD    . PRO A 1 91  ? -19.713 9.648   11.772  1.00 13.49 ?  139 PRO A CD    1 
ATOM   711  N  N     . HIS A 1 92  ? -18.088 7.944   14.567  1.00 13.51 ?  140 HIS A N     1 
ATOM   712  C  CA    . HIS A 1 92  ? -17.324 7.759   15.820  1.00 13.82 ?  140 HIS A CA    1 
ATOM   713  C  C     . HIS A 1 92  ? -18.256 7.145   16.872  1.00 13.90 ?  140 HIS A C     1 
ATOM   714  O  O     . HIS A 1 92  ? -19.246 7.783   17.291  1.00 14.65 ?  140 HIS A O     1 
ATOM   715  C  CB    . HIS A 1 92  ? -16.720 9.091   16.324  1.00 14.44 ?  140 HIS A CB    1 
ATOM   716  C  CG    . HIS A 1 92  ? -15.699 9.606   15.379  1.00 13.96 ?  140 HIS A CG    1 
ATOM   717  N  ND1   . HIS A 1 92  ? -14.516 8.932   15.136  1.00 15.21 ?  140 HIS A ND1   1 
ATOM   718  C  CD2   . HIS A 1 92  ? -15.748 10.653  14.521  1.00 15.22 ?  140 HIS A CD2   1 
ATOM   719  C  CE1   . HIS A 1 92  ? -13.852 9.563   14.180  1.00 15.18 ?  140 HIS A CE1   1 
ATOM   720  N  NE2   . HIS A 1 92  ? -14.578 10.605  13.776  1.00 15.32 ?  140 HIS A NE2   1 
ATOM   721  N  N     . ALA A 1 93  ? -17.868 5.953   17.369  1.00 13.82 ?  141 ALA A N     1 
ATOM   722  C  CA    . ALA A 1 93  ? -18.761 5.205   18.270  1.00 14.14 ?  141 ALA A CA    1 
ATOM   723  C  C     . ALA A 1 93  ? -19.122 6.060   19.483  1.00 13.13 ?  141 ALA A C     1 
ATOM   724  O  O     . ALA A 1 93  ? -20.258 5.994   20.016  1.00 13.96 ?  141 ALA A O     1 
ATOM   725  C  CB    . ALA A 1 93  ? -18.052 3.909   18.755  1.00 16.29 ?  141 ALA A CB    1 
ATOM   726  N  N     . SER A 1 94  ? -18.156 6.837   19.973  1.00 13.48 ?  142 SER A N     1 
ATOM   727  C  CA    . SER A 1 94  ? -18.412 7.583   21.199  1.00 13.18 ?  142 SER A CA    1 
ATOM   728  C  C     . SER A 1 94  ? -19.376 8.741   21.097  1.00 13.53 ?  142 SER A C     1 
ATOM   729  O  O     . SER A 1 94  ? -19.829 9.251   22.109  1.00 14.61 ?  142 SER A O     1 
ATOM   730  C  CB    . SER A 1 94  ? -17.064 8.091   21.789  1.00 15.18 ?  142 SER A CB    1 
ATOM   731  O  OG    . SER A 1 94  ? -16.501 9.027   20.843  1.00 15.92 ?  142 SER A OG    1 
ATOM   732  N  N     . ASN A 1 95  ? -19.784 9.085   19.869  1.00 12.16 ?  143 ASN A N     1 
ATOM   733  C  CA    . ASN A 1 95  ? -20.787 10.134  19.662  1.00 12.66 ?  143 ASN A CA    1 
ATOM   734  C  C     . ASN A 1 95  ? -22.206 9.556   19.465  1.00 12.72 ?  143 ASN A C     1 
ATOM   735  O  O     . ASN A 1 95  ? -23.129 10.294  19.044  1.00 12.81 ?  143 ASN A O     1 
ATOM   736  C  CB    . ASN A 1 95  ? -20.409 11.043  18.458  1.00 13.85 ?  143 ASN A CB    1 
ATOM   737  C  CG    . ASN A 1 95  ? -19.536 12.194  18.880  1.00 14.74 ?  143 ASN A CG    1 
ATOM   738  O  OD1   . ASN A 1 95  ? -19.523 12.563  20.068  1.00 16.07 ?  143 ASN A OD1   1 
ATOM   739  N  ND2   . ASN A 1 95  ? -18.836 12.795  17.929  1.00 15.27 ?  143 ASN A ND2   1 
ATOM   740  N  N     A ILE A 1 96  ? -22.413 8.312   19.881  0.42 13.04 ?  144 ILE A N     1 
ATOM   741  N  N     B ILE A 1 96  ? -22.423 8.315   19.913  0.58 12.53 ?  144 ILE A N     1 
ATOM   742  C  CA    A ILE A 1 96  ? -23.735 7.701   19.761  0.42 13.50 ?  144 ILE A CA    1 
ATOM   743  C  CA    B ILE A 1 96  ? -23.741 7.684   19.758  0.58 12.63 ?  144 ILE A CA    1 
ATOM   744  C  C     A ILE A 1 96  ? -24.880 8.585   20.275  0.42 13.39 ?  144 ILE A C     1 
ATOM   745  C  C     B ILE A 1 96  ? -24.903 8.514   20.319  0.58 12.43 ?  144 ILE A C     1 
ATOM   746  O  O     A ILE A 1 96  ? -25.905 8.724   19.581  0.42 14.01 ?  144 ILE A O     1 
ATOM   747  O  O     B ILE A 1 96  ? -25.984 8.542   19.691  0.58 12.12 ?  144 ILE A O     1 
ATOM   748  C  CB    A ILE A 1 96  ? -23.767 6.328   20.450  0.42 13.77 ?  144 ILE A CB    1 
ATOM   749  C  CB    B ILE A 1 96  ? -23.760 6.219   20.338  0.58 12.31 ?  144 ILE A CB    1 
ATOM   750  C  CG1   A ILE A 1 96  ? -25.203 5.769   20.458  0.42 14.90 ?  144 ILE A CG1   1 
ATOM   751  C  CG1   B ILE A 1 96  ? -25.059 5.455   19.937  0.58 13.50 ?  144 ILE A CG1   1 
ATOM   752  C  CG2   A ILE A 1 96  ? -23.131 6.430   21.854  0.42 14.61 ?  144 ILE A CG2   1 
ATOM   753  C  CG2   B ILE A 1 96  ? -23.452 6.193   21.862  0.58 13.47 ?  144 ILE A CG2   1 
ATOM   754  C  CD1   A ILE A 1 96  ? -25.303 4.329   20.857  0.42 15.47 ?  144 ILE A CD1   1 
ATOM   755  C  CD1   B ILE A 1 96  ? -26.169 5.535   20.985  0.58 15.64 ?  144 ILE A CD1   1 
ATOM   756  N  N     . THR A 1 97  ? -24.749 9.179   21.460  1.00 13.22 ?  145 THR A N     1 
ATOM   757  C  CA    . THR A 1 97  ? -25.880 9.971   21.991  1.00 14.14 ?  145 THR A CA    1 
ATOM   758  C  C     . THR A 1 97  ? -26.268 11.145  21.062  1.00 15.19 ?  145 THR A C     1 
ATOM   759  O  O     . THR A 1 97  ? -27.451 11.396  20.806  1.00 15.43 ?  145 THR A O     1 
ATOM   760  C  CB    . THR A 1 97  ? -25.563 10.527  23.373  1.00 16.98 ?  145 THR A CB    1 
ATOM   761  O  OG1   . THR A 1 97  ? -25.374 9.437   24.281  1.00 18.08 ?  145 THR A OG1   1 
ATOM   762  C  CG2   . THR A 1 97  ? -26.743 11.403  23.847  1.00 20.03 ?  145 THR A CG2   1 
ATOM   763  N  N     . LEU A 1 98  ? -25.266 11.831  20.540  1.00 14.97 ?  146 LEU A N     1 
ATOM   764  C  CA    . LEU A 1 98  ? -25.482 12.942  19.620  1.00 16.05 ?  146 LEU A CA    1 
ATOM   765  C  C     . LEU A 1 98  ? -26.151 12.436  18.336  1.00 15.43 ?  146 LEU A C     1 
ATOM   766  O  O     . LEU A 1 98  ? -27.122 13.039  17.870  1.00 16.30 ?  146 LEU A O     1 
ATOM   767  C  CB    . LEU A 1 98  ? -24.128 13.613  19.304  1.00 19.32 ?  146 LEU A CB    1 
ATOM   768  C  CG    . LEU A 1 98  ? -24.101 14.855  18.429  1.00 23.34 ?  146 LEU A CG    1 
ATOM   769  C  CD1   . LEU A 1 98  ? -25.194 15.918  18.676  1.00 26.67 ?  146 LEU A CD1   1 
ATOM   770  C  CD2   . LEU A 1 98  ? -22.699 15.473  18.690  1.00 24.71 ?  146 LEU A CD2   1 
ATOM   771  N  N     . TYR A 1 99  ? -25.693 11.302  17.819  1.00 14.12 ?  147 TYR A N     1 
ATOM   772  C  CA    . TYR A 1 99  ? -26.319 10.742  16.615  1.00 14.05 ?  147 TYR A CA    1 
ATOM   773  C  C     . TYR A 1 99  ? -27.755 10.343  16.899  1.00 14.33 ?  147 TYR A C     1 
ATOM   774  O  O     . TYR A 1 99  ? -28.666 10.606  16.091  1.00 15.09 ?  147 TYR A O     1 
ATOM   775  C  CB    . TYR A 1 99  ? -25.585 9.508   16.115  1.00 13.73 ?  147 TYR A CB    1 
ATOM   776  C  CG    . TYR A 1 99  ? -24.095 9.735   15.783  1.00 12.61 ?  147 TYR A CG    1 
ATOM   777  C  CD1   . TYR A 1 99  ? -23.600 10.965  15.282  1.00 13.37 ?  147 TYR A CD1   1 
ATOM   778  C  CD2   . TYR A 1 99  ? -23.199 8.680   16.002  1.00 13.50 ?  147 TYR A CD2   1 
ATOM   779  C  CE1   . TYR A 1 99  ? -22.224 11.116  14.980  1.00 12.31 ?  147 TYR A CE1   1 
ATOM   780  C  CE2   . TYR A 1 99  ? -21.851 8.806   15.722  1.00 13.25 ?  147 TYR A CE2   1 
ATOM   781  C  CZ    . TYR A 1 99  ? -21.376 10.044  15.270  1.00 12.39 ?  147 TYR A CZ    1 
ATOM   782  O  OH    . TYR A 1 99  ? -20.025 10.141  14.987  1.00 13.81 ?  147 TYR A OH    1 
ATOM   783  N  N     . LYS A 1 100 ? -27.947 9.666   18.023  1.00 13.63 ?  148 LYS A N     1 
ATOM   784  C  CA    . LYS A 1 100 ? -29.254 9.133   18.392  1.00 13.69 ?  148 LYS A CA    1 
ATOM   785  C  C     . LYS A 1 100 ? -30.270 10.244  18.562  1.00 14.24 ?  148 LYS A C     1 
ATOM   786  O  O     . LYS A 1 100 ? -31.415 10.160  18.054  1.00 14.68 ?  148 LYS A O     1 
ATOM   787  C  CB    . LYS A 1 100 ? -29.138 8.337   19.687  1.00 15.26 ?  148 LYS A CB    1 
ATOM   788  C  CG    . LYS A 1 100 ? -30.471 7.880   20.269  1.00 17.02 ?  148 LYS A CG    1 
ATOM   789  C  CD    . LYS A 1 100 ? -30.170 7.115   21.582  1.00 19.35 ?  148 LYS A CD    1 
ATOM   790  C  CE    . LYS A 1 100 ? -31.445 6.699   22.291  1.00 21.20 ?  148 LYS A CE    1 
ATOM   791  N  NZ    . LYS A 1 100 ? -31.082 5.777   23.428  1.00 23.90 ?  148 LYS A NZ    1 
ATOM   792  N  N     . ASP A 1 101 ? -29.899 11.306  19.256  1.00 15.56 ?  149 ASP A N     1 
ATOM   793  C  CA    . ASP A 1 101 ? -30.870 12.377  19.491  1.00 16.86 ?  149 ASP A CA    1 
ATOM   794  C  C     . ASP A 1 101 ? -31.301 13.036  18.175  1.00 15.58 ?  149 ASP A C     1 
ATOM   795  O  O     . ASP A 1 101 ? -32.499 13.305  17.959  1.00 17.14 ?  149 ASP A O     1 
ATOM   796  C  CB    . ASP A 1 101 ? -30.281 13.427  20.441  1.00 20.50 ?  149 ASP A CB    1 
ATOM   797  C  CG    . ASP A 1 101 ? -30.121 12.924  21.879  1.00 26.31 ?  149 ASP A CG    1 
ATOM   798  O  OD1   . ASP A 1 101 ? -30.662 11.835  22.244  1.00 28.31 ?  149 ASP A OD1   1 
ATOM   799  O  OD2   . ASP A 1 101 ? -29.398 13.609  22.641  1.00 29.97 ?  149 ASP A OD2   1 
ATOM   800  N  N     . GLN A 1 102 ? -30.331 13.264  17.276  1.00 14.68 ?  150 GLN A N     1 
ATOM   801  C  CA    . GLN A 1 102 ? -30.669 13.838  15.975  1.00 14.38 ?  150 GLN A CA    1 
ATOM   802  C  C     . GLN A 1 102 ? -31.476 12.879  15.108  1.00 14.07 ?  150 GLN A C     1 
ATOM   803  O  O     . GLN A 1 102 ? -32.398 13.311  14.385  1.00 15.28 ?  150 GLN A O     1 
ATOM   804  C  CB    . GLN A 1 102 ? -29.406 14.216  15.240  1.00 16.02 ?  150 GLN A CB    1 
ATOM   805  C  CG    . GLN A 1 102 ? -28.679 15.367  15.864  1.00 18.66 ?  150 GLN A CG    1 
ATOM   806  C  CD    . GLN A 1 102 ? -27.402 15.591  15.096  1.00 21.87 ?  150 GLN A CD    1 
ATOM   807  O  OE1   . GLN A 1 102 ? -26.351 15.024  15.443  1.00 24.81 ?  150 GLN A OE1   1 
ATOM   808  N  NE2   . GLN A 1 102 ? -27.465 16.391  14.044  1.00 23.55 ?  150 GLN A NE2   1 
ATOM   809  N  N     . LEU A 1 103 ? -31.139 11.594  15.174  1.00 13.29 ?  151 LEU A N     1 
ATOM   810  C  CA    . LEU A 1 103 ? -31.771 10.611  14.303  1.00 13.80 ?  151 LEU A CA    1 
ATOM   811  C  C     . LEU A 1 103 ? -33.245 10.414  14.693  1.00 13.79 ?  151 LEU A C     1 
ATOM   812  O  O     . LEU A 1 103 ? -34.123 10.355  13.815  1.00 15.00 ?  151 LEU A O     1 
ATOM   813  C  CB    . LEU A 1 103 ? -31.027 9.293   14.385  1.00 14.65 ?  151 LEU A CB    1 
ATOM   814  C  CG    . LEU A 1 103 ? -31.561 8.186   13.478  1.00 15.42 ?  151 LEU A CG    1 
ATOM   815  C  CD1   . LEU A 1 103 ? -31.570 8.601   11.989  1.00 16.70 ?  151 LEU A CD1   1 
ATOM   816  C  CD2   . LEU A 1 103 ? -30.697 6.908   13.692  1.00 16.84 ?  151 LEU A CD2   1 
ATOM   817  N  N     . GLN A 1 104 ? -33.527 10.358  16.005  1.00 14.27 ?  152 GLN A N     1 
ATOM   818  C  CA    . GLN A 1 104 ? -34.906 10.235  16.469  1.00 14.76 ?  152 GLN A CA    1 
ATOM   819  C  C     . GLN A 1 104 ? -35.725 11.426  16.064  1.00 15.26 ?  152 GLN A C     1 
ATOM   820  O  O     . GLN A 1 104 ? -36.878 11.253  15.612  1.00 16.47 ?  152 GLN A O     1 
ATOM   821  C  CB    . GLN A 1 104 ? -34.943 10.059  17.979  1.00 17.62 ?  152 GLN A CB    1 
ATOM   822  C  CG    . GLN A 1 104 ? -34.406 8.705   18.378  1.00 20.49 ?  152 GLN A CG    1 
ATOM   823  C  CD    . GLN A 1 104 ? -34.303 8.550   19.880  1.00 25.62 ?  152 GLN A CD    1 
ATOM   824  O  OE1   . GLN A 1 104 ? -34.057 9.515   20.597  1.00 27.41 ?  152 GLN A OE1   1 
ATOM   825  N  NE2   . GLN A 1 104 ? -34.491 7.337   20.359  1.00 28.84 ?  152 GLN A NE2   1 
ATOM   826  N  N     . LEU A 1 105 ? -35.148 12.617  16.160  1.00 14.74 ?  153 LEU A N     1 
ATOM   827  C  CA    . LEU A 1 105 ? -35.891 13.825  15.732  1.00 14.79 ?  153 LEU A CA    1 
ATOM   828  C  C     . LEU A 1 105 ? -36.134 13.839  14.236  1.00 14.40 ?  153 LEU A C     1 
ATOM   829  O  O     . LEU A 1 105 ? -37.223 14.200  13.785  1.00 15.53 ?  153 LEU A O     1 
ATOM   830  C  CB    . LEU A 1 105 ? -35.150 15.126  16.105  1.00 16.94 ?  153 LEU A CB    1 
ATOM   831  C  CG    . LEU A 1 105 ? -35.168 15.488  17.577  1.00 19.05 ?  153 LEU A CG    1 
ATOM   832  C  CD1   . LEU A 1 105 ? -34.148 16.558  17.789  1.00 20.84 ?  153 LEU A CD1   1 
ATOM   833  C  CD2   . LEU A 1 105 ? -36.554 16.015  17.921  1.00 19.49 ?  153 LEU A CD2   1 
ATOM   834  N  N     . TRP A 1 106 ? -35.130 13.437  13.480  1.00 14.82 ?  154 TRP A N     1 
ATOM   835  C  CA    . TRP A 1 106 ? -35.256 13.476  12.030  1.00 14.37 ?  154 TRP A CA    1 
ATOM   836  C  C     . TRP A 1 106 ? -36.314 12.506  11.526  1.00 13.77 ?  154 TRP A C     1 
ATOM   837  O  O     . TRP A 1 106 ? -37.180 12.890  10.719  1.00 15.45 ?  154 TRP A O     1 
ATOM   838  C  CB    . TRP A 1 106 ? -33.878 13.180  11.390  1.00 15.20 ?  154 TRP A CB    1 
ATOM   839  C  CG    . TRP A 1 106 ? -33.919 13.420  9.904   1.00 15.93 ?  154 TRP A CG    1 
ATOM   840  C  CD1   . TRP A 1 106 ? -34.066 12.484  8.944   1.00 19.03 ?  154 TRP A CD1   1 
ATOM   841  C  CD2   . TRP A 1 106 ? -33.826 14.679  9.223   1.00 18.73 ?  154 TRP A CD2   1 
ATOM   842  N  NE1   . TRP A 1 106 ? -34.092 13.079  7.683   1.00 19.01 ?  154 TRP A NE1   1 
ATOM   843  C  CE2   . TRP A 1 106 ? -33.914 14.420  7.837   1.00 17.17 ?  154 TRP A CE2   1 
ATOM   844  C  CE3   . TRP A 1 106 ? -33.739 15.983  9.643   1.00 25.39 ?  154 TRP A CE3   1 
ATOM   845  C  CZ2   . TRP A 1 106 ? -33.930 15.422  6.866   1.00 20.49 ?  154 TRP A CZ2   1 
ATOM   846  C  CZ3   . TRP A 1 106 ? -33.667 16.978  8.678   1.00 27.66 ?  154 TRP A CZ3   1 
ATOM   847  C  CH2   . TRP A 1 106 ? -33.819 16.690  7.299   1.00 25.84 ?  154 TRP A CH2   1 
ATOM   848  N  N     . ILE A 1 107 ? -36.304 11.276  12.011  1.00 14.14 ?  155 ILE A N     1 
ATOM   849  C  CA    . ILE A 1 107 ? -37.297 10.287  11.585  1.00 14.52 ?  155 ILE A CA    1 
ATOM   850  C  C     . ILE A 1 107 ? -38.706 10.716  11.967  1.00 14.65 ?  155 ILE A C     1 
ATOM   851  O  O     . ILE A 1 107 ? -39.634 10.709  11.119  1.00 15.38 ?  155 ILE A O     1 
ATOM   852  C  CB    . ILE A 1 107 ? -36.934 8.906   12.146  1.00 15.35 ?  155 ILE A CB    1 
ATOM   853  C  CG1   . ILE A 1 107 ? -35.647 8.385   11.478  1.00 16.88 ?  155 ILE A CG1   1 
ATOM   854  C  CG2   . ILE A 1 107 ? -38.074 7.904   11.917  1.00 16.50 ?  155 ILE A CG2   1 
ATOM   855  C  CD1   . ILE A 1 107 ? -35.087 7.133   12.176  1.00 17.59 ?  155 ILE A CD1   1 
ATOM   856  N  N     . ARG A 1 108 ? -38.875 11.143  13.203  1.00 15.55 ?  156 ARG A N     1 
ATOM   857  C  CA    . ARG A 1 108 ? -40.223 11.494  13.659  1.00 15.76 ?  156 ARG A CA    1 
ATOM   858  C  C     . ARG A 1 108 ? -40.781 12.716  12.908  1.00 15.73 ?  156 ARG A C     1 
ATOM   859  O  O     . ARG A 1 108 ? -41.935 12.720  12.494  1.00 17.25 ?  156 ARG A O     1 
ATOM   860  C  CB    . ARG A 1 108 ? -40.225 11.788  15.162  1.00 17.51 ?  156 ARG A CB    1 
ATOM   861  C  CG    . ARG A 1 108 ? -41.621 12.212  15.679  1.00 21.38 ?  156 ARG A CG    1 
ATOM   862  C  CD    . ARG A 1 108 ? -41.723 11.968  17.189  1.00 23.84 ?  156 ARG A CD    1 
ATOM   863  N  NE    . ARG A 1 108 ? -43.117 12.078  17.692  1.00 25.31 ?  156 ARG A NE    1 
ATOM   864  C  CZ    . ARG A 1 108 ? -43.619 13.269  17.957  1.00 24.41 ?  156 ARG A CZ    1 
ATOM   865  N  NH1   . ARG A 1 108 ? -42.797 14.295  17.745  1.00 24.61 ?  156 ARG A NH1   1 
ATOM   866  N  NH2   . ARG A 1 108 ? -44.860 13.470  18.440  1.00 25.22 ?  156 ARG A NH2   1 
ATOM   867  N  N     . GLY A 1 109 ? -39.946 13.731  12.675  1.00 14.85 ?  157 GLY A N     1 
ATOM   868  C  CA    . GLY A 1 109 ? -40.405 14.915  11.964  1.00 15.42 ?  157 GLY A CA    1 
ATOM   869  C  C     . GLY A 1 109 ? -40.758 14.637  10.505  1.00 16.26 ?  157 GLY A C     1 
ATOM   870  O  O     . GLY A 1 109 ? -41.755 15.165  9.970   1.00 17.08 ?  157 GLY A O     1 
ATOM   871  N  N     . ASN A 1 110 ? -39.982 13.765  9.857   1.00 15.24 ?  158 ASN A N     1 
ATOM   872  C  CA    . ASN A 1 110 ? -40.274 13.482  8.451   1.00 14.50 ?  158 ASN A CA    1 
ATOM   873  C  C     . ASN A 1 110 ? -41.474 12.548  8.280   1.00 15.20 ?  158 ASN A C     1 
ATOM   874  O  O     . ASN A 1 110 ? -42.257 12.770  7.358   1.00 16.75 ?  158 ASN A O     1 
ATOM   875  C  CB    . ASN A 1 110 ? -39.051 12.958  7.780   1.00 15.69 ?  158 ASN A CB    1 
ATOM   876  C  CG    . ASN A 1 110 ? -38.152 14.090  7.433   1.00 16.20 ?  158 ASN A CG    1 
ATOM   877  O  OD1   . ASN A 1 110 ? -38.442 14.809  6.470   1.00 18.69 ?  158 ASN A OD1   1 
ATOM   878  N  ND2   . ASN A 1 110 ? -37.109 14.300  8.186   1.00 17.68 ?  158 ASN A ND2   1 
ATOM   879  N  N     . VAL A 1 111 ? -41.658 11.547  9.152   1.00 15.19 ?  159 VAL A N     1 
ATOM   880  C  CA    . VAL A 1 111 ? -42.877 10.730  9.058   1.00 15.79 ?  159 VAL A CA    1 
ATOM   881  C  C     . VAL A 1 111 ? -44.115 11.536  9.426   1.00 17.19 ?  159 VAL A C     1 
ATOM   882  O  O     . VAL A 1 111 ? -45.178 11.338  8.844   1.00 18.76 ?  159 VAL A O     1 
ATOM   883  C  CB    . VAL A 1 111 ? -42.735 9.449   9.921   1.00 16.67 ?  159 VAL A CB    1 
ATOM   884  C  CG1   . VAL A 1 111 ? -44.020 8.657   9.938   1.00 18.47 ?  159 VAL A CG1   1 
ATOM   885  C  CG2   . VAL A 1 111 ? -41.625 8.554   9.299   1.00 16.66 ?  159 VAL A CG2   1 
ATOM   886  N  N     . SER A 1 112 ? -43.990 12.438  10.392  1.00 17.76 ?  160 SER A N     1 
ATOM   887  C  CA    . SER A 1 112 ? -45.103 13.343  10.704  1.00 20.04 ?  160 SER A CA    1 
ATOM   888  C  C     . SER A 1 112 ? -45.544 14.102  9.450   1.00 21.98 ?  160 SER A C     1 
ATOM   889  O  O     . SER A 1 112 ? -46.733 14.315  9.229   1.00 24.47 ?  160 SER A O     1 
ATOM   890  C  CB    . SER A 1 112 ? -44.679 14.341  11.769  1.00 20.79 ?  160 SER A CB    1 
ATOM   891  O  OG    . SER A 1 112 ? -44.501 13.678  12.981  1.00 23.02 ?  160 SER A OG    1 
ATOM   892  N  N     . ALA A 1 113 ? -44.602 14.510  8.627   1.00 21.16 ?  161 ALA A N     1 
ATOM   893  C  CA    . ALA A 1 113 ? -44.907 15.293  7.448   1.00 22.14 ?  161 ALA A CA    1 
ATOM   894  C  C     . ALA A 1 113 ? -45.306 14.449  6.248   1.00 21.46 ?  161 ALA A C     1 
ATOM   895  O  O     . ALA A 1 113 ? -46.061 14.922  5.369   1.00 24.83 ?  161 ALA A O     1 
ATOM   896  C  CB    . ALA A 1 113 ? -43.746 16.154  7.130   1.00 23.68 ?  161 ALA A CB    1 
ATOM   897  N  N     . CYS A 1 114 ? -44.837 13.209  6.201   1.00 19.65 ?  162 CYS A N     1 
ATOM   898  C  CA    . CYS A 1 114 ? -45.062 12.306  5.069   1.00 18.63 ?  162 CYS A CA    1 
ATOM   899  C  C     . CYS A 1 114 ? -45.089 10.852  5.603   1.00 18.04 ?  162 CYS A C     1 
ATOM   900  O  O     . CYS A 1 114 ? -44.047 10.260  5.932   1.00 17.35 ?  162 CYS A O     1 
ATOM   901  C  CB    . CYS A 1 114 ? -43.967 12.455  4.015   1.00 19.49 ?  162 CYS A CB    1 
ATOM   902  S  SG    . CYS A 1 114 ? -44.143 11.231  2.662   1.00 22.82 ?  162 CYS A SG    1 
ATOM   903  N  N     . ALA A 1 115 ? -46.283 10.268  5.721   1.00 17.91 ?  163 ALA A N     1 
ATOM   904  C  CA    . ALA A 1 115 ? -46.415 8.905   6.223   1.00 18.06 ?  163 ALA A CA    1 
ATOM   905  C  C     . ALA A 1 115 ? -45.618 7.890   5.411   1.00 16.76 ?  163 ALA A C     1 
ATOM   906  O  O     . ALA A 1 115 ? -45.073 6.928   5.985   1.00 18.43 ?  163 ALA A O     1 
ATOM   907  C  CB    . ALA A 1 115 ? -47.922 8.496   6.270   1.00 18.64 ?  163 ALA A CB    1 
ATOM   908  N  N     . ARG A 1 116 ? -45.574 8.088   4.087   1.00 16.74 ?  164 ARG A N     1 
ATOM   909  C  CA    . ARG A 1 116 ? -44.902 7.165   3.163   1.00 17.04 ?  164 ARG A CA    1 
ATOM   910  C  C     . ARG A 1 116 ? -43.430 7.543   2.943   1.00 17.44 ?  164 ARG A C     1 
ATOM   911  O  O     . ARG A 1 116 ? -42.886 7.392   1.840   1.00 20.46 ?  164 ARG A O     1 
ATOM   912  C  CB    . ARG A 1 116 ? -45.665 7.140   1.813   1.00 17.23 ?  164 ARG A CB    1 
ATOM   913  C  CG    . ARG A 1 116 ? -46.978 6.411   1.918   1.00 19.01 ?  164 ARG A CG    1 
ATOM   914  C  CD    . ARG A 1 116 ? -46.793 4.897   1.893   1.00 20.18 ?  164 ARG A CD    1 
ATOM   915  N  NE    . ARG A 1 116 ? -48.110 4.222   1.873   1.00 22.04 ?  164 ARG A NE    1 
ATOM   916  C  CZ    . ARG A 1 116 ? -48.278 2.908   2.015   1.00 22.78 ?  164 ARG A CZ    1 
ATOM   917  N  NH1   . ARG A 1 116 ? -47.228 2.112   2.259   1.00 22.93 ?  164 ARG A NH1   1 
ATOM   918  N  NH2   . ARG A 1 116 ? -49.503 2.377   1.859   1.00 23.74 ?  164 ARG A NH2   1 
ATOM   919  N  N     . SER A 1 117 ? -42.741 7.950   3.999   1.00 15.55 ?  165 SER A N     1 
ATOM   920  C  CA    . SER A 1 117 ? -41.310 8.214   3.890   1.00 15.16 ?  165 SER A CA    1 
ATOM   921  C  C     . SER A 1 117 ? -40.514 6.926   3.748   1.00 15.28 ?  165 SER A C     1 
ATOM   922  O  O     . SER A 1 117 ? -40.921 5.855   4.237   1.00 17.26 ?  165 SER A O     1 
ATOM   923  C  CB    . SER A 1 117 ? -40.853 8.928   5.192   1.00 16.64 ?  165 SER A CB    1 
ATOM   924  O  OG    . SER A 1 117 ? -41.432 10.239  5.306   1.00 18.03 ?  165 SER A OG    1 
ATOM   925  N  N     . ILE A 1 118 ? -39.359 7.025   3.088   1.00 13.89 ?  166 ILE A N     1 
ATOM   926  C  CA    . ILE A 1 118 ? -38.447 5.891   2.940   1.00 13.98 ?  166 ILE A CA    1 
ATOM   927  C  C     . ILE A 1 118 ? -37.116 6.259   3.578   1.00 13.30 ?  166 ILE A C     1 
ATOM   928  O  O     . ILE A 1 118 ? -36.598 7.361   3.335   1.00 14.64 ?  166 ILE A O     1 
ATOM   929  C  CB    . ILE A 1 118 ? -38.250 5.531   1.462   1.00 15.08 ?  166 ILE A CB    1 
ATOM   930  C  CG1   . ILE A 1 118 ? -39.620 5.171   0.824   1.00 16.88 ?  166 ILE A CG1   1 
ATOM   931  C  CG2   . ILE A 1 118 ? -37.194 4.422   1.294   1.00 15.65 ?  166 ILE A CG2   1 
ATOM   932  C  CD1   . ILE A 1 118 ? -39.469 4.917   -0.701  1.00 17.96 ?  166 ILE A CD1   1 
ATOM   933  N  N     . PHE A 1 119 ? -36.630 5.395   4.474   1.00 13.10 ?  167 PHE A N     1 
ATOM   934  C  CA    . PHE A 1 119 ? -35.331 5.603   5.127   1.00 13.23 ?  167 PHE A CA    1 
ATOM   935  C  C     . PHE A 1 119 ? -34.399 4.479   4.752   1.00 13.36 ?  167 PHE A C     1 
ATOM   936  O  O     . PHE A 1 119 ? -34.739 3.299   4.911   1.00 14.98 ?  167 PHE A O     1 
ATOM   937  C  CB    . PHE A 1 119 ? -35.510 5.623   6.651   1.00 12.61 ?  167 PHE A CB    1 
ATOM   938  C  CG    . PHE A 1 119 ? -36.455 6.679   7.101   1.00 13.87 ?  167 PHE A CG    1 
ATOM   939  C  CD1   . PHE A 1 119 ? -36.016 7.980   7.289   1.00 14.25 ?  167 PHE A CD1   1 
ATOM   940  C  CD2   . PHE A 1 119 ? -37.789 6.383   7.304   1.00 14.71 ?  167 PHE A CD2   1 
ATOM   941  C  CE1   . PHE A 1 119 ? -36.883 9.032   7.660   1.00 15.19 ?  167 PHE A CE1   1 
ATOM   942  C  CE2   . PHE A 1 119 ? -38.697 7.424   7.695   1.00 16.23 ?  167 PHE A CE2   1 
ATOM   943  C  CZ    . PHE A 1 119 ? -38.246 8.762   7.881   1.00 15.98 ?  167 PHE A CZ    1 
ATOM   944  N  N     . ILE A 1 120 ? -33.227 4.843   4.260   1.00 13.04 ?  168 ILE A N     1 
ATOM   945  C  CA    . ILE A 1 120 ? -32.204 3.876   3.900   1.00 13.22 ?  168 ILE A CA    1 
ATOM   946  C  C     . ILE A 1 120 ? -31.003 4.038   4.833   1.00 13.50 ?  168 ILE A C     1 
ATOM   947  O  O     . ILE A 1 120 ? -30.466 5.150   4.969   1.00 13.52 ?  168 ILE A O     1 
ATOM   948  C  CB    . ILE A 1 120 ? -31.748 4.084   2.401   1.00 14.18 ?  168 ILE A CB    1 
ATOM   949  C  CG1   . ILE A 1 120 ? -32.941 3.950   1.448   1.00 15.61 ?  168 ILE A CG1   1 
ATOM   950  C  CG2   . ILE A 1 120 ? -30.655 3.079   2.040   1.00 15.40 ?  168 ILE A CG2   1 
ATOM   951  C  CD1   . ILE A 1 120 ? -32.661 4.647   0.139   1.00 16.64 ?  168 ILE A CD1   1 
ATOM   952  N  N     . PHE A 1 121 ? -30.624 2.951   5.487   1.00 12.95 ?  169 PHE A N     1 
ATOM   953  C  CA    . PHE A 1 121 ? -29.445 2.930   6.375   1.00 13.51 ?  169 PHE A CA    1 
ATOM   954  C  C     . PHE A 1 121 ? -28.350 2.135   5.724   1.00 13.15 ?  169 PHE A C     1 
ATOM   955  O  O     . PHE A 1 121 ? -28.388 0.898   5.706   1.00 14.43 ?  169 PHE A O     1 
ATOM   956  C  CB    . PHE A 1 121 ? -29.813 2.328   7.726   1.00 14.51 ?  169 PHE A CB    1 
ATOM   957  C  CG    . PHE A 1 121 ? -30.683 3.225   8.551   1.00 14.18 ?  169 PHE A CG    1 
ATOM   958  C  CD1   . PHE A 1 121 ? -30.109 4.134   9.443   1.00 17.08 ?  169 PHE A CD1   1 
ATOM   959  C  CD2   . PHE A 1 121 ? -32.057 3.207   8.407   1.00 15.73 ?  169 PHE A CD2   1 
ATOM   960  C  CE1   . PHE A 1 121 ? -30.908 4.980   10.220  1.00 18.48 ?  169 PHE A CE1   1 
ATOM   961  C  CE2   . PHE A 1 121 ? -32.899 4.058   9.222   1.00 17.43 ?  169 PHE A CE2   1 
ATOM   962  C  CZ    . PHE A 1 121 ? -32.310 4.947   10.088  1.00 18.19 ?  169 PHE A CZ    1 
ATOM   963  N  N     . ASP A 1 122 ? -27.406 2.845   5.127   1.00 13.64 ?  170 ASP A N     1 
ATOM   964  C  CA    . ASP A 1 122 ? -26.309 2.192   4.443   1.00 13.15 ?  170 ASP A CA    1 
ATOM   965  C  C     . ASP A 1 122 ? -25.183 1.866   5.447   1.00 13.41 ?  170 ASP A C     1 
ATOM   966  O  O     . ASP A 1 122 ? -25.000 2.592   6.440   1.00 14.74 ?  170 ASP A O     1 
ATOM   967  C  CB    . ASP A 1 122 ? -25.823 3.137   3.325   1.00 14.70 ?  170 ASP A CB    1 
ATOM   968  C  CG    . ASP A 1 122 ? -24.955 2.468   2.321   1.00 15.46 ?  170 ASP A CG    1 
ATOM   969  O  OD1   . ASP A 1 122 ? -24.813 1.247   2.364   1.00 16.14 ?  170 ASP A OD1   1 
ATOM   970  O  OD2   . ASP A 1 122 ? -24.472 3.206   1.433   1.00 17.18 ?  170 ASP A OD2   1 
ATOM   971  N  N     . GLN A 1 123 ? -24.428 0.818   5.133   1.00 12.80 ?  171 GLN A N     1 
ATOM   972  C  CA    . GLN A 1 123 ? -23.314 0.346   5.982   1.00 13.37 ?  171 GLN A CA    1 
ATOM   973  C  C     . GLN A 1 123 ? -23.805 0.049   7.386   1.00 15.01 ?  171 GLN A C     1 
ATOM   974  O  O     . GLN A 1 123 ? -23.114 0.402   8.376   1.00 14.22 ?  171 GLN A O     1 
ATOM   975  C  CB    . GLN A 1 123 ? -22.161 1.392   6.031   1.00 14.56 ?  171 GLN A CB    1 
ATOM   976  C  CG    . GLN A 1 123 ? -21.678 1.756   4.596   1.00 17.67 ?  171 GLN A CG    1 
ATOM   977  C  CD    . GLN A 1 123 ? -21.287 0.554   3.739   1.00 20.31 ?  171 GLN A CD    1 
ATOM   978  O  OE1   . GLN A 1 123 ? -21.151 -0.568  4.183   1.00 23.23 ?  171 GLN A OE1   1 
ATOM   979  N  NE2   . GLN A 1 123 ? -21.138 0.802   2.490   1.00 21.60 ?  171 GLN A NE2   1 
ATOM   980  N  N     A MET A 1 124 ? -24.947 -0.629  7.485   0.37 15.17 ?  172 MET A N     1 
ATOM   981  N  N     B MET A 1 124 ? -24.926 -0.641  7.511   0.63 14.86 ?  172 MET A N     1 
ATOM   982  C  CA    A MET A 1 124 ? -25.570 -0.968  8.769   0.37 16.12 ?  172 MET A CA    1 
ATOM   983  C  CA    B MET A 1 124 ? -25.489 -0.871  8.835   0.63 16.21 ?  172 MET A CA    1 
ATOM   984  C  C     A MET A 1 124 ? -24.636 -1.814  9.637   0.37 16.01 ?  172 MET A C     1 
ATOM   985  C  C     B MET A 1 124 ? -24.586 -1.788  9.666   0.63 16.04 ?  172 MET A C     1 
ATOM   986  O  O     A MET A 1 124 ? -24.711 -1.764  10.873  0.37 16.56 ?  172 MET A O     1 
ATOM   987  O  O     B MET A 1 124 ? -24.632 -1.771  10.909  0.63 16.96 ?  172 MET A O     1 
ATOM   988  C  CB    A MET A 1 124 ? -26.913 -1.693  8.515   0.37 17.88 ?  172 MET A CB    1 
ATOM   989  C  CB    B MET A 1 124 ? -26.889 -1.453  8.698   0.63 19.67 ?  172 MET A CB    1 
ATOM   990  C  CG    A MET A 1 124 ? -27.655 -2.149  9.805   0.37 19.67 ?  172 MET A CG    1 
ATOM   991  C  CG    B MET A 1 124 ? -27.490 -1.651  10.108  0.63 22.43 ?  172 MET A CG    1 
ATOM   992  S  SD    A MET A 1 124 ? -27.107 -3.793  10.283  0.37 22.52 ?  172 MET A SD    1 
ATOM   993  S  SD    B MET A 1 124 ? -29.167 -2.184  10.148  0.63 26.00 ?  172 MET A SD    1 
ATOM   994  C  CE    A MET A 1 124 ? -27.868 -4.154  11.837  0.37 24.38 ?  172 MET A CE    1 
ATOM   995  C  CE    B MET A 1 124 ? -29.986 -0.691  10.726  0.63 25.61 ?  172 MET A CE    1 
ATOM   996  N  N     . ASP A 1 125 ? -23.752 -2.583  9.011   1.00 15.70 ?  173 ASP A N     1 
ATOM   997  C  CA    . ASP A 1 125 ? -22.838 -3.411  9.769   1.00 16.09 ?  173 ASP A CA    1 
ATOM   998  C  C     . ASP A 1 125 ? -21.744 -2.596  10.446  1.00 15.16 ?  173 ASP A C     1 
ATOM   999  O  O     . ASP A 1 125 ? -21.005 -3.163  11.292  1.00 17.86 ?  173 ASP A O     1 
ATOM   1000 C  CB    . ASP A 1 125 ? -22.224 -4.547  8.923   1.00 18.11 ?  173 ASP A CB    1 
ATOM   1001 C  CG    . ASP A 1 125 ? -21.653 -4.106  7.577   1.00 21.79 ?  173 ASP A CG    1 
ATOM   1002 O  OD1   . ASP A 1 125 ? -22.207 -3.215  6.901   1.00 21.74 ?  173 ASP A OD1   1 
ATOM   1003 O  OD2   . ASP A 1 125 ? -20.639 -4.722  7.168   1.00 26.90 ?  173 ASP A OD2   1 
ATOM   1004 N  N     . LYS A 1 126 ? -21.645 -1.310  10.123  1.00 13.94 ?  174 LYS A N     1 
ATOM   1005 C  CA    . LYS A 1 126 ? -20.703 -0.417  10.795  1.00 14.80 ?  174 LYS A CA    1 
ATOM   1006 C  C     . LYS A 1 126 ? -21.406 0.560   11.760  1.00 16.34 ?  174 LYS A C     1 
ATOM   1007 O  O     . LYS A 1 126 ? -20.760 1.423   12.346  1.00 18.36 ?  174 LYS A O     1 
ATOM   1008 C  CB    . LYS A 1 126 ? -19.870 0.384   9.776   1.00 15.74 ?  174 LYS A CB    1 
ATOM   1009 C  CG    . LYS A 1 126 ? -18.876 -0.470  8.973   1.00 17.17 ?  174 LYS A CG    1 
ATOM   1010 C  CD    . LYS A 1 126 ? -19.610 -1.197  7.816   1.00 19.97 ?  174 LYS A CD    1 
ATOM   1011 C  CE    . LYS A 1 126 ? -18.758 -1.778  6.721   1.00 19.62 ?  174 LYS A CE    1 
ATOM   1012 N  NZ    . LYS A 1 126 ? -19.632 -2.380  5.685   1.00 19.91 ?  174 LYS A NZ    1 
ATOM   1013 N  N     . MET A 1 127 ? -22.715 0.380   11.967  1.00 15.43 ?  175 MET A N     1 
ATOM   1014 C  CA    . MET A 1 127 ? -23.494 1.273   12.797  1.00 16.09 ?  175 MET A CA    1 
ATOM   1015 C  C     . MET A 1 127 ? -23.521 0.785   14.246  1.00 15.75 ?  175 MET A C     1 
ATOM   1016 O  O     . MET A 1 127 ? -23.747 -0.417  14.464  1.00 16.50 ?  175 MET A O     1 
ATOM   1017 C  CB    . MET A 1 127 ? -24.906 1.318   12.237  1.00 19.66 ?  175 MET A CB    1 
ATOM   1018 C  CG    . MET A 1 127 ? -25.839 2.304   12.802  1.00 22.64 ?  175 MET A CG    1 
ATOM   1019 S  SD    . MET A 1 127 ? -27.275 2.371   11.627  1.00 25.07 ?  175 MET A SD    1 
ATOM   1020 C  CE    . MET A 1 127 ? -28.431 3.259   12.716  1.00 25.54 ?  175 MET A CE    1 
ATOM   1021 N  N     . HIS A 1 128 ? -23.318 1.692   15.194  1.00 15.08 ?  176 HIS A N     1 
ATOM   1022 C  CA    . HIS A 1 128 ? -23.404 1.318   16.599  1.00 14.91 ?  176 HIS A CA    1 
ATOM   1023 C  C     . HIS A 1 128 ? -24.679 0.523   16.918  1.00 15.32 ?  176 HIS A C     1 
ATOM   1024 O  O     . HIS A 1 128 ? -25.779 0.953   16.525  1.00 14.67 ?  176 HIS A O     1 
ATOM   1025 C  CB    . HIS A 1 128 ? -23.399 2.579   17.470  1.00 16.25 ?  176 HIS A CB    1 
ATOM   1026 C  CG    . HIS A 1 128 ? -22.907 2.347   18.863  1.00 17.51 ?  176 HIS A CG    1 
ATOM   1027 N  ND1   . HIS A 1 128 ? -23.513 1.458   19.724  1.00 17.91 ?  176 HIS A ND1   1 
ATOM   1028 C  CD2   . HIS A 1 128 ? -21.868 2.902   19.538  1.00 17.63 ?  176 HIS A CD2   1 
ATOM   1029 C  CE1   . HIS A 1 128 ? -22.858 1.473   20.875  1.00 19.80 ?  176 HIS A CE1   1 
ATOM   1030 N  NE2   . HIS A 1 128 ? -21.832 2.301   20.771  1.00 19.63 ?  176 HIS A NE2   1 
ATOM   1031 N  N     . ALA A 1 129 ? -24.550 -0.604  17.615  1.00 16.14 ?  177 ALA A N     1 
ATOM   1032 C  CA    . ALA A 1 129 ? -25.711 -1.380  18.043  1.00 17.27 ?  177 ALA A CA    1 
ATOM   1033 C  C     . ALA A 1 129 ? -26.710 -0.520  18.811  1.00 16.73 ?  177 ALA A C     1 
ATOM   1034 O  O     . ALA A 1 129 ? -27.933 -0.722  18.686  1.00 17.22 ?  177 ALA A O     1 
ATOM   1035 C  CB    . ALA A 1 129 ? -25.270 -2.572  18.930  1.00 19.75 ?  177 ALA A CB    1 
ATOM   1036 N  N     . GLY A 1 130 ? -26.209 0.432   19.604  1.00 16.12 ?  178 GLY A N     1 
ATOM   1037 C  CA    . GLY A 1 130 ? -27.110 1.286   20.377  1.00 17.14 ?  178 GLY A CA    1 
ATOM   1038 C  C     . GLY A 1 130 ? -27.886 2.255   19.494  1.00 16.79 ?  178 GLY A C     1 
ATOM   1039 O  O     . GLY A 1 130 ? -29.023 2.684   19.829  1.00 17.28 ?  178 GLY A O     1 
ATOM   1040 N  N     . LEU A 1 131 ? -27.300 2.623   18.360  1.00 16.21 ?  179 LEU A N     1 
ATOM   1041 C  CA    . LEU A 1 131 ? -28.042 3.482   17.440  1.00 16.91 ?  179 LEU A CA    1 
ATOM   1042 C  C     . LEU A 1 131 ? -29.128 2.675   16.699  1.00 18.15 ?  179 LEU A C     1 
ATOM   1043 O  O     . LEU A 1 131 ? -30.250 3.173   16.497  1.00 18.58 ?  179 LEU A O     1 
ATOM   1044 C  CB    . LEU A 1 131 ? -27.045 4.121   16.467  1.00 19.20 ?  179 LEU A CB    1 
ATOM   1045 C  CG    . LEU A 1 131 ? -27.554 5.311   15.700  1.00 21.17 ?  179 LEU A CG    1 
ATOM   1046 C  CD1   . LEU A 1 131 ? -27.977 6.411   16.652  1.00 21.94 ?  179 LEU A CD1   1 
ATOM   1047 C  CD2   . LEU A 1 131 ? -26.338 5.772   14.856  1.00 20.53 ?  179 LEU A CD2   1 
ATOM   1048 N  N     . ILE A 1 132 ? -28.855 1.403   16.387  1.00 16.42 ?  180 ILE A N     1 
ATOM   1049 C  CA    . ILE A 1 132 ? -29.885 0.532   15.818  1.00 17.38 ?  180 ILE A CA    1 
ATOM   1050 C  C     . ILE A 1 132 ? -31.012 0.344   16.854  1.00 16.57 ?  180 ILE A C     1 
ATOM   1051 O  O     . ILE A 1 132 ? -32.205 0.362   16.486  1.00 17.85 ?  180 ILE A O     1 
ATOM   1052 C  CB    . ILE A 1 132 ? -29.316 -0.767  15.393  1.00 18.24 ?  180 ILE A CB    1 
ATOM   1053 C  CG1   . ILE A 1 132 ? -28.197 -0.517  14.357  1.00 18.97 ?  180 ILE A CG1   1 
ATOM   1054 C  CG2   . ILE A 1 132 ? -30.470 -1.631  14.803  1.00 19.55 ?  180 ILE A CG2   1 
ATOM   1055 C  CD1   . ILE A 1 132 ? -27.491 -1.759  13.914  1.00 20.99 ?  180 ILE A CD1   1 
ATOM   1056 N  N     . ASP A 1 133 ? -30.652 0.157   18.126  1.00 16.69 ?  181 ASP A N     1 
ATOM   1057 C  CA    . ASP A 1 133 ? -31.670 0.003   19.176  1.00 18.23 ?  181 ASP A CA    1 
ATOM   1058 C  C     . ASP A 1 133 ? -32.601 1.194   19.190  1.00 18.76 ?  181 ASP A C     1 
ATOM   1059 O  O     . ASP A 1 133 ? -33.813 1.041   19.406  1.00 19.66 ?  181 ASP A O     1 
ATOM   1060 C  CB    . ASP A 1 133 ? -31.023 -0.127  20.579  1.00 19.85 ?  181 ASP A CB    1 
ATOM   1061 C  CG    . ASP A 1 133 ? -30.373 -1.438  20.833  1.00 23.05 ?  181 ASP A CG    1 
ATOM   1062 O  OD1   . ASP A 1 133 ? -30.669 -2.426  20.126  1.00 26.08 ?  181 ASP A OD1   1 
ATOM   1063 O  OD2   . ASP A 1 133 ? -29.537 -1.461  21.795  1.00 24.19 ?  181 ASP A OD2   1 
ATOM   1064 N  N     . ALA A 1 134 ? -32.066 2.378   18.899  1.00 18.03 ?  182 ALA A N     1 
ATOM   1065 C  CA    . ALA A 1 134 ? -32.870 3.605   18.926  1.00 18.77 ?  182 ALA A CA    1 
ATOM   1066 C  C     . ALA A 1 134 ? -33.911 3.662   17.847  1.00 19.55 ?  182 ALA A C     1 
ATOM   1067 O  O     . ALA A 1 134 ? -34.855 4.434   17.995  1.00 22.10 ?  182 ALA A O     1 
ATOM   1068 C  CB    . ALA A 1 134 ? -31.953 4.859   18.842  1.00 19.49 ?  182 ALA A CB    1 
ATOM   1069 N  N     . ILE A 1 135 ? -33.745 2.913   16.748  1.00 17.94 ?  183 ILE A N     1 
ATOM   1070 C  CA    . ILE A 1 135 ? -34.762 2.960   15.705  1.00 19.41 ?  183 ILE A CA    1 
ATOM   1071 C  C     . ILE A 1 135 ? -35.715 1.785   15.766  1.00 17.75 ?  183 ILE A C     1 
ATOM   1072 O  O     . ILE A 1 135 ? -36.727 1.804   15.077  1.00 17.15 ?  183 ILE A O     1 
ATOM   1073 C  CB    . ILE A 1 135 ? -34.160 3.068   14.341  1.00 21.74 ?  183 ILE A CB    1 
ATOM   1074 C  CG1   . ILE A 1 135 ? -33.439 1.794   13.909  1.00 22.85 ?  183 ILE A CG1   1 
ATOM   1075 C  CG2   . ILE A 1 135 ? -33.288 4.310   14.267  1.00 23.46 ?  183 ILE A CG2   1 
ATOM   1076 C  CD1   . ILE A 1 135 ? -33.073 1.705   12.359  1.00 25.55 ?  183 ILE A CD1   1 
ATOM   1077 N  N     . LYS A 1 136 ? -35.471 0.801   16.633  1.00 17.74 ?  184 LYS A N     1 
ATOM   1078 C  CA    . LYS A 1 136 ? -36.340 -0.389  16.663  1.00 17.89 ?  184 LYS A CA    1 
ATOM   1079 C  C     . LYS A 1 136 ? -37.833 -0.091  16.894  1.00 18.52 ?  184 LYS A C     1 
ATOM   1080 O  O     . LYS A 1 136 ? -38.657 -0.775  16.268  1.00 19.28 ?  184 LYS A O     1 
ATOM   1081 C  CB    . LYS A 1 136 ? -35.833 -1.390  17.715  1.00 19.50 ?  184 LYS A CB    1 
ATOM   1082 C  CG    . LYS A 1 136 ? -34.582 -2.131  17.252  1.00 19.69 ?  184 LYS A CG    1 
ATOM   1083 C  CD    . LYS A 1 136 ? -34.096 -3.128  18.336  1.00 21.82 ?  184 LYS A CD    1 
ATOM   1084 C  CE    . LYS A 1 136 ? -32.827 -3.790  17.958  1.00 23.39 ?  184 LYS A CE    1 
ATOM   1085 N  NZ    . LYS A 1 136 ? -32.250 -4.540  19.145  1.00 24.64 ?  184 LYS A NZ    1 
ATOM   1086 N  N     . PRO A 1 137 ? -38.194 0.914   17.728  1.00 19.69 ?  185 PRO A N     1 
ATOM   1087 C  CA    . PRO A 1 137 ? -39.637 1.134   17.897  1.00 19.36 ?  185 PRO A CA    1 
ATOM   1088 C  C     . PRO A 1 137 ? -40.316 1.538   16.583  1.00 19.84 ?  185 PRO A C     1 
ATOM   1089 O  O     . PRO A 1 137 ? -41.481 1.191   16.332  1.00 20.87 ?  185 PRO A O     1 
ATOM   1090 C  CB    . PRO A 1 137 ? -39.698 2.272   18.926  1.00 20.18 ?  185 PRO A CB    1 
ATOM   1091 C  CG    . PRO A 1 137 ? -38.429 2.115   19.729  1.00 21.21 ?  185 PRO A CG    1 
ATOM   1092 C  CD    . PRO A 1 137 ? -37.396 1.724   18.685  1.00 20.06 ?  185 PRO A CD    1 
ATOM   1093 N  N     . PHE A 1 138 ? -39.581 2.259   15.727  1.00 17.84 ?  186 PHE A N     1 
ATOM   1094 C  CA    . PHE A 1 138 ? -40.164 2.713   14.469  1.00 17.56 ?  186 PHE A CA    1 
ATOM   1095 C  C     . PHE A 1 138 ? -40.404 1.540   13.517  1.00 19.50 ?  186 PHE A C     1 
ATOM   1096 O  O     . PHE A 1 138 ? -41.176 1.680   12.588  1.00 22.57 ?  186 PHE A O     1 
ATOM   1097 C  CB    . PHE A 1 138 ? -39.202 3.699   13.757  1.00 17.40 ?  186 PHE A CB    1 
ATOM   1098 C  CG    . PHE A 1 138 ? -38.865 4.918   14.538  1.00 18.52 ?  186 PHE A CG    1 
ATOM   1099 C  CD1   . PHE A 1 138 ? -39.844 5.723   15.092  1.00 19.83 ?  186 PHE A CD1   1 
ATOM   1100 C  CD2   . PHE A 1 138 ? -37.541 5.293   14.662  1.00 19.73 ?  186 PHE A CD2   1 
ATOM   1101 C  CE1   . PHE A 1 138 ? -39.504 6.888   15.801  1.00 21.64 ?  186 PHE A CE1   1 
ATOM   1102 C  CE2   . PHE A 1 138 ? -37.203 6.431   15.343  1.00 21.55 ?  186 PHE A CE2   1 
ATOM   1103 C  CZ    . PHE A 1 138 ? -38.166 7.231   15.926  1.00 22.57 ?  186 PHE A CZ    1 
ATOM   1104 N  N     . LEU A 1 139 ? -39.736 0.401   13.733  1.00 17.96 ?  187 LEU A N     1 
ATOM   1105 C  CA    . LEU A 1 139 ? -39.828 -0.768  12.846  1.00 17.42 ?  187 LEU A CA    1 
ATOM   1106 C  C     . LEU A 1 139 ? -40.948 -1.746  13.189  1.00 19.29 ?  187 LEU A C     1 
ATOM   1107 O  O     . LEU A 1 139 ? -41.247 -2.673  12.422  1.00 20.28 ?  187 LEU A O     1 
ATOM   1108 C  CB    . LEU A 1 139 ? -38.513 -1.572  12.899  1.00 17.49 ?  187 LEU A CB    1 
ATOM   1109 C  CG    . LEU A 1 139 ? -37.245 -0.778  12.637  1.00 16.98 ?  187 LEU A CG    1 
ATOM   1110 C  CD1   . LEU A 1 139 ? -36.013 -1.778  12.739  1.00 17.65 ?  187 LEU A CD1   1 
ATOM   1111 C  CD2   . LEU A 1 139 ? -37.318 -0.043  11.271  1.00 16.68 ?  187 LEU A CD2   1 
ATOM   1112 N  N     . ASP A 1 140 ? -41.501 -1.589  14.392  1.00 19.37 ?  188 ASP A N     1 
ATOM   1113 C  CA    . ASP A 1 140 ? -42.328 -2.612  15.000  1.00 20.66 ?  188 ASP A CA    1 
ATOM   1114 C  C     . ASP A 1 140 ? -43.821 -2.500  14.613  1.00 22.13 ?  188 ASP A C     1 
ATOM   1115 O  O     . ASP A 1 140 ? -44.241 -1.644  13.797  1.00 22.56 ?  188 ASP A O     1 
ATOM   1116 C  CB    . ASP A 1 140 ? -42.107 -2.551  16.543  1.00 21.79 ?  188 ASP A CB    1 
ATOM   1117 C  CG    . ASP A 1 140 ? -42.182 -3.911  17.219  1.00 23.80 ?  188 ASP A CG    1 
ATOM   1118 O  OD1   . ASP A 1 140 ? -42.923 -4.798  16.745  1.00 25.67 ?  188 ASP A OD1   1 
ATOM   1119 O  OD2   . ASP A 1 140 ? -41.492 -4.089  18.253  1.00 24.50 ?  188 ASP A OD2   1 
ATOM   1120 N  N     . TYR A 1 141 ? -44.596 -3.426  15.178  1.00 23.52 ?  189 TYR A N     1 
ATOM   1121 C  CA    . TYR A 1 141 ? -46.047 -3.574  14.901  1.00 24.53 ?  189 TYR A CA    1 
ATOM   1122 C  C     . TYR A 1 141 ? -46.955 -2.591  15.672  1.00 25.52 ?  189 TYR A C     1 
ATOM   1123 O  O     . TYR A 1 141 ? -48.182 -2.768  15.706  1.00 28.25 ?  189 TYR A O     1 
ATOM   1124 C  CB    . TYR A 1 141 ? -46.455 -5.006  15.214  1.00 26.37 ?  189 TYR A CB    1 
ATOM   1125 C  CG    . TYR A 1 141 ? -45.943 -6.015  14.213  1.00 26.49 ?  189 TYR A CG    1 
ATOM   1126 C  CD1   . TYR A 1 141 ? -44.657 -6.591  14.336  1.00 26.80 ?  189 TYR A CD1   1 
ATOM   1127 C  CD2   . TYR A 1 141 ? -46.733 -6.390  13.139  1.00 26.94 ?  189 TYR A CD2   1 
ATOM   1128 C  CE1   . TYR A 1 141 ? -44.201 -7.533  13.394  1.00 26.99 ?  189 TYR A CE1   1 
ATOM   1129 C  CE2   . TYR A 1 141 ? -46.296 -7.331  12.199  1.00 27.12 ?  189 TYR A CE2   1 
ATOM   1130 C  CZ    . TYR A 1 141 ? -45.049 -7.892  12.319  1.00 27.28 ?  189 TYR A CZ    1 
ATOM   1131 O  OH    . TYR A 1 141 ? -44.663 -8.810  11.353  1.00 28.30 ?  189 TYR A OH    1 
ATOM   1132 N  N     . TYR A 1 142 ? -46.381 -1.559  16.281  1.00 25.63 ?  190 TYR A N     1 
ATOM   1133 C  CA    . TYR A 1 142 ? -47.168 -0.552  17.002  1.00 26.95 ?  190 TYR A CA    1 
ATOM   1134 C  C     . TYR A 1 142 ? -48.110 0.225   16.090  1.00 26.38 ?  190 TYR A C     1 
ATOM   1135 O  O     . TYR A 1 142 ? -47.724 0.567   14.976  1.00 26.24 ?  190 TYR A O     1 
ATOM   1136 C  CB    . TYR A 1 142 ? -46.247 0.479   17.671  1.00 28.35 ?  190 TYR A CB    1 
ATOM   1137 C  CG    . TYR A 1 142 ? -45.321 -0.068  18.721  1.00 29.71 ?  190 TYR A CG    1 
ATOM   1138 C  CD1   . TYR A 1 142 ? -45.815 -0.539  19.941  1.00 31.19 ?  190 TYR A CD1   1 
ATOM   1139 C  CD2   . TYR A 1 142 ? -43.941 -0.086  18.508  1.00 30.36 ?  190 TYR A CD2   1 
ATOM   1140 C  CE1   . TYR A 1 142 ? -44.969 -1.028  20.907  1.00 32.23 ?  190 TYR A CE1   1 
ATOM   1141 C  CE2   . TYR A 1 142 ? -43.079 -0.570  19.491  1.00 32.19 ?  190 TYR A CE2   1 
ATOM   1142 C  CZ    . TYR A 1 142 ? -43.602 -1.050  20.676  1.00 32.97 ?  190 TYR A CZ    1 
ATOM   1143 O  OH    . TYR A 1 142 ? -42.746 -1.512  21.644  1.00 34.51 ?  190 TYR A OH    1 
ATOM   1144 N  N     . ASP A 1 143 ? -49.323 0.547   16.558  1.00 26.71 ?  191 ASP A N     1 
ATOM   1145 C  CA    . ASP A 1 143 ? -50.144 1.458   15.772  1.00 27.22 ?  191 ASP A CA    1 
ATOM   1146 C  C     . ASP A 1 143 ? -49.673 2.910   15.874  1.00 25.75 ?  191 ASP A C     1 
ATOM   1147 O  O     . ASP A 1 143 ? -49.793 3.670   14.910  1.00 26.59 ?  191 ASP A O     1 
ATOM   1148 C  CB    . ASP A 1 143 ? -51.607 1.322   16.175  1.00 30.91 ?  191 ASP A CB    1 
ATOM   1149 C  CG    . ASP A 1 143 ? -52.127 -0.049  15.841  1.00 34.93 ?  191 ASP A CG    1 
ATOM   1150 O  OD1   . ASP A 1 143 ? -52.114 -0.451  14.648  1.00 36.14 ?  191 ASP A OD1   1 
ATOM   1151 O  OD2   . ASP A 1 143 ? -52.465 -0.764  16.792  1.00 37.61 ?  191 ASP A OD2   1 
ATOM   1152 N  N     . LEU A 1 144 ? -49.118 3.296   17.020  1.00 24.57 ?  192 LEU A N     1 
ATOM   1153 C  CA    . LEU A 1 144 ? -48.575 4.657   17.215  1.00 22.57 ?  192 LEU A CA    1 
ATOM   1154 C  C     . LEU A 1 144 ? -47.320 4.577   18.023  1.00 22.01 ?  192 LEU A C     1 
ATOM   1155 O  O     . LEU A 1 144 ? -47.207 3.740   18.914  1.00 23.55 ?  192 LEU A O     1 
ATOM   1156 C  CB    . LEU A 1 144 ? -49.570 5.569   17.917  1.00 24.70 ?  192 LEU A CB    1 
ATOM   1157 C  CG    . LEU A 1 144 ? -50.892 5.866   17.190  1.00 25.19 ?  192 LEU A CG    1 
ATOM   1158 C  CD1   . LEU A 1 144 ? -51.841 6.534   18.201  1.00 26.89 ?  192 LEU A CD1   1 
ATOM   1159 C  CD2   . LEU A 1 144 ? -50.635 6.756   15.974  1.00 26.63 ?  192 LEU A CD2   1 
ATOM   1160 N  N     . VAL A 1 145 ? -46.347 5.411   17.672  1.00 21.03 ?  193 VAL A N     1 
ATOM   1161 C  CA    . VAL A 1 145 ? -45.094 5.555   18.416  1.00 20.73 ?  193 VAL A CA    1 
ATOM   1162 C  C     . VAL A 1 145 ? -44.987 7.039   18.730  1.00 22.35 ?  193 VAL A C     1 
ATOM   1163 O  O     . VAL A 1 145 ? -44.865 7.859   17.818  1.00 21.65 ?  193 VAL A O     1 
ATOM   1164 C  CB    . VAL A 1 145 ? -43.884 5.031   17.600  1.00 20.92 ?  193 VAL A CB    1 
ATOM   1165 C  CG1   . VAL A 1 145 ? -42.553 5.253   18.360  1.00 22.76 ?  193 VAL A CG1   1 
ATOM   1166 C  CG2   . VAL A 1 145 ? -44.074 3.563   17.232  1.00 21.29 ?  193 VAL A CG2   1 
ATOM   1167 N  N     . ASP A 1 146 ? -45.085 7.407   20.012  1.00 24.79 ?  194 ASP A N     1 
ATOM   1168 C  CA    . ASP A 1 146 ? -45.241 8.809   20.417  1.00 25.54 ?  194 ASP A CA    1 
ATOM   1169 C  C     . ASP A 1 146 ? -46.247 9.553   19.540  1.00 24.97 ?  194 ASP A C     1 
ATOM   1170 O  O     . ASP A 1 146 ? -45.940 10.649  19.045  1.00 26.74 ?  194 ASP A O     1 
ATOM   1171 C  CB    . ASP A 1 146 ? -43.881 9.518   20.394  1.00 27.46 ?  194 ASP A CB    1 
ATOM   1172 C  CG    . ASP A 1 146 ? -42.975 8.970   21.473  1.00 29.13 ?  194 ASP A CG    1 
ATOM   1173 O  OD1   . ASP A 1 146 ? -43.499 8.754   22.600  1.00 30.56 ?  194 ASP A OD1   1 
ATOM   1174 O  OD2   . ASP A 1 146 ? -41.792 8.705   21.232  1.00 30.19 ?  194 ASP A OD2   1 
ATOM   1175 N  N     . GLY A 1 147 ? -47.399 8.931   19.299  1.00 23.41 ?  195 GLY A N     1 
ATOM   1176 C  CA    . GLY A 1 147 ? -48.501 9.573   18.608  1.00 24.18 ?  195 GLY A CA    1 
ATOM   1177 C  C     . GLY A 1 147 ? -48.429 9.608   17.092  1.00 24.54 ?  195 GLY A C     1 
ATOM   1178 O  O     . GLY A 1 147 ? -49.287 10.240  16.448  1.00 25.86 ?  195 GLY A O     1 
ATOM   1179 N  N     . VAL A 1 148 ? -47.384 8.988   16.510  1.00 22.48 ?  196 VAL A N     1 
ATOM   1180 C  CA    . VAL A 1 148 ? -47.218 8.967   15.052  1.00 21.72 ?  196 VAL A CA    1 
ATOM   1181 C  C     . VAL A 1 148 ? -47.228 7.542   14.572  1.00 20.99 ?  196 VAL A C     1 
ATOM   1182 O  O     . VAL A 1 148 ? -46.566 6.683   15.177  1.00 20.20 ?  196 VAL A O     1 
ATOM   1183 C  CB    . VAL A 1 148 ? -45.878 9.677   14.661  1.00 21.96 ?  196 VAL A CB    1 
ATOM   1184 C  CG1   . VAL A 1 148 ? -45.593 9.587   13.155  1.00 22.17 ?  196 VAL A CG1   1 
ATOM   1185 C  CG2   . VAL A 1 148 ? -45.896 11.119  15.122  1.00 23.45 ?  196 VAL A CG2   1 
ATOM   1186 N  N     . SER A 1 149 ? -47.934 7.270   13.481  1.00 20.29 ?  197 SER A N     1 
ATOM   1187 C  CA    . SER A 1 149 ? -47.911 5.912   12.889  1.00 19.44 ?  197 SER A CA    1 
ATOM   1188 C  C     . SER A 1 149 ? -46.763 5.788   11.899  1.00 18.95 ?  197 SER A C     1 
ATOM   1189 O  O     . SER A 1 149 ? -46.643 6.642   11.010  1.00 19.80 ?  197 SER A O     1 
ATOM   1190 C  CB    . SER A 1 149 ? -49.224 5.524   12.148  1.00 20.33 ?  197 SER A CB    1 
ATOM   1191 O  OG    . SER A 1 149 ? -49.037 4.246   11.484  1.00 21.89 ?  197 SER A OG    1 
ATOM   1192 N  N     . TYR A 1 150 ? -45.956 4.731   12.055  1.00 17.88 ?  198 TYR A N     1 
ATOM   1193 C  CA    . TYR A 1 150 ? -44.864 4.416   11.099  1.00 17.82 ?  198 TYR A CA    1 
ATOM   1194 C  C     . TYR A 1 150 ? -45.256 3.303   10.142  1.00 17.88 ?  198 TYR A C     1 
ATOM   1195 O  O     . TYR A 1 150 ? -44.437 2.853   9.374   1.00 17.98 ?  198 TYR A O     1 
ATOM   1196 C  CB    . TYR A 1 150 ? -43.571 4.042   11.896  1.00 17.36 ?  198 TYR A CB    1 
ATOM   1197 C  CG    . TYR A 1 150 ? -43.089 5.279   12.609  1.00 17.48 ?  198 TYR A CG    1 
ATOM   1198 C  CD1   . TYR A 1 150 ? -43.677 5.670   13.833  1.00 18.02 ?  198 TYR A CD1   1 
ATOM   1199 C  CD2   . TYR A 1 150 ? -42.146 6.134   12.023  1.00 18.56 ?  198 TYR A CD2   1 
ATOM   1200 C  CE1   . TYR A 1 150 ? -43.296 6.863   14.465  1.00 18.92 ?  198 TYR A CE1   1 
ATOM   1201 C  CE2   . TYR A 1 150 ? -41.759 7.319   12.617  1.00 19.73 ?  198 TYR A CE2   1 
ATOM   1202 C  CZ    . TYR A 1 150 ? -42.340 7.697   13.831  1.00 20.59 ?  198 TYR A CZ    1 
ATOM   1203 O  OH    . TYR A 1 150 ? -41.968 8.907   14.384  1.00 22.16 ?  198 TYR A OH    1 
ATOM   1204 N  N     . GLN A 1 151 ? -46.524 2.880   10.168  1.00 17.42 ?  199 GLN A N     1 
ATOM   1205 C  CA    . GLN A 1 151 ? -46.885 1.659   9.443   1.00 18.49 ?  199 GLN A CA    1 
ATOM   1206 C  C     . GLN A 1 151 ? -46.811 1.807   7.910   1.00 18.38 ?  199 GLN A C     1 
ATOM   1207 O  O     . GLN A 1 151 ? -46.734 0.801   7.234   1.00 19.95 ?  199 GLN A O     1 
ATOM   1208 C  CB    . GLN A 1 151 ? -48.286 1.200   9.842   1.00 20.39 ?  199 GLN A CB    1 
ATOM   1209 C  CG    . GLN A 1 151 ? -48.229 0.783   11.304  1.00 23.55 ?  199 GLN A CG    1 
ATOM   1210 C  CD    . GLN A 1 151 ? -49.581 0.704   11.925  1.00 27.55 ?  199 GLN A CD    1 
ATOM   1211 O  OE1   . GLN A 1 151 ? -50.319 1.693   11.921  1.00 29.92 ?  199 GLN A OE1   1 
ATOM   1212 N  NE2   . GLN A 1 151 ? -49.926 -0.456  12.476  1.00 27.96 ?  199 GLN A NE2   1 
ATOM   1213 N  N     . LYS A 1 152 ? -46.829 3.044   7.392   1.00 17.33 ?  200 LYS A N     1 
ATOM   1214 C  CA    . LYS A 1 152 ? -46.728 3.287   5.936   1.00 17.25 ?  200 LYS A CA    1 
ATOM   1215 C  C     . LYS A 1 152 ? -45.284 3.549   5.466   1.00 16.72 ?  200 LYS A C     1 
ATOM   1216 O  O     . LYS A 1 152 ? -45.021 3.680   4.281   1.00 17.02 ?  200 LYS A O     1 
ATOM   1217 C  CB    . LYS A 1 152 ? -47.642 4.452   5.546   1.00 17.33 ?  200 LYS A CB    1 
ATOM   1218 C  CG    . LYS A 1 152 ? -49.133 3.978   5.472   1.00 19.33 ?  200 LYS A CG    1 
ATOM   1219 C  CD    . LYS A 1 152 ? -49.982 5.121   5.037   1.00 20.83 ?  200 LYS A CD    1 
ATOM   1220 C  CE    . LYS A 1 152 ? -51.395 4.677   4.794   1.00 23.09 ?  200 LYS A CE    1 
ATOM   1221 N  NZ    . LYS A 1 152 ? -52.177 5.831   4.190   1.00 25.11 ?  200 LYS A NZ    1 
ATOM   1222 N  N     . ALA A 1 153 ? -44.354 3.644   6.411   1.00 15.89 ?  201 ALA A N     1 
ATOM   1223 C  CA    . ALA A 1 153 ? -42.968 4.004   6.093   1.00 15.95 ?  201 ALA A CA    1 
ATOM   1224 C  C     . ALA A 1 153 ? -42.244 2.761   5.625   1.00 16.34 ?  201 ALA A C     1 
ATOM   1225 O  O     . ALA A 1 153 ? -42.704 1.602   5.823   1.00 18.35 ?  201 ALA A O     1 
ATOM   1226 C  CB    . ALA A 1 153 ? -42.276 4.617   7.317   1.00 16.57 ?  201 ALA A CB    1 
ATOM   1227 N  N     . MET A 1 154 ? -41.081 2.982   5.025   1.00 15.99 ?  202 MET A N     1 
ATOM   1228 C  CA    . MET A 1 154 ? -40.252 1.872   4.583   1.00 15.57 ?  202 MET A CA    1 
ATOM   1229 C  C     . MET A 1 154 ? -38.844 2.079   5.131   1.00 15.50 ?  202 MET A C     1 
ATOM   1230 O  O     . MET A 1 154 ? -38.339 3.211   5.069   1.00 15.50 ?  202 MET A O     1 
ATOM   1231 C  CB    . MET A 1 154 ? -40.185 1.795   3.040   1.00 17.64 ?  202 MET A CB    1 
ATOM   1232 C  CG    . MET A 1 154 ? -39.443 0.576   2.540   1.00 18.45 ?  202 MET A CG    1 
ATOM   1233 S  SD    . MET A 1 154 ? -39.259 0.629   0.706   1.00 21.52 ?  202 MET A SD    1 
ATOM   1234 C  CE    . MET A 1 154 ? -40.969 0.911   0.257   1.00 24.01 ?  202 MET A CE    1 
ATOM   1235 N  N     . PHE A 1 155 ? -38.225 0.995   5.614   1.00 15.14 ?  203 PHE A N     1 
ATOM   1236 C  CA    . PHE A 1 155 ? -36.838 1.018   6.113   1.00 14.51 ?  203 PHE A CA    1 
ATOM   1237 C  C     . PHE A 1 155 ? -36.025 0.022   5.361   1.00 15.14 ?  203 PHE A C     1 
ATOM   1238 O  O     . PHE A 1 155 ? -36.401 -1.140  5.320   1.00 16.61 ?  203 PHE A O     1 
ATOM   1239 C  CB    . PHE A 1 155 ? -36.819 0.672   7.617   1.00 15.70 ?  203 PHE A CB    1 
ATOM   1240 C  CG    . PHE A 1 155 ? -37.449 1.737   8.476   1.00 15.37 ?  203 PHE A CG    1 
ATOM   1241 C  CD1   . PHE A 1 155 ? -38.817 1.795   8.657   1.00 15.55 ?  203 PHE A CD1   1 
ATOM   1242 C  CD2   . PHE A 1 155 ? -36.664 2.748   8.996   1.00 17.47 ?  203 PHE A CD2   1 
ATOM   1243 C  CE1   . PHE A 1 155 ? -39.379 2.795   9.456   1.00 16.32 ?  203 PHE A CE1   1 
ATOM   1244 C  CE2   . PHE A 1 155 ? -37.179 3.737   9.742   1.00 17.48 ?  203 PHE A CE2   1 
ATOM   1245 C  CZ    . PHE A 1 155 ? -38.570 3.780   9.980   1.00 16.76 ?  203 PHE A CZ    1 
ATOM   1246 N  N     . ILE A 1 156 ? -34.906 0.464   4.779   1.00 14.96 ?  204 ILE A N     1 
ATOM   1247 C  CA    . ILE A 1 156 ? -34.052 -0.403  3.969   1.00 14.27 ?  204 ILE A CA    1 
ATOM   1248 C  C     . ILE A 1 156 ? -32.661 -0.386  4.590   1.00 13.90 ?  204 ILE A C     1 
ATOM   1249 O  O     . ILE A 1 156 ? -32.076 0.685   4.714   1.00 15.24 ?  204 ILE A O     1 
ATOM   1250 C  CB    . ILE A 1 156 ? -33.994 0.091   2.484   1.00 15.12 ?  204 ILE A CB    1 
ATOM   1251 C  CG1   . ILE A 1 156 ? -35.423 0.194   1.918   1.00 16.09 ?  204 ILE A CG1   1 
ATOM   1252 C  CG2   . ILE A 1 156 ? -33.098 -0.853  1.677   1.00 16.19 ?  204 ILE A CG2   1 
ATOM   1253 C  CD1   . ILE A 1 156 ? -35.435 0.702   0.491   1.00 18.02 ?  204 ILE A CD1   1 
ATOM   1254 N  N     . PHE A 1 157 ? -32.164 -1.543  4.953   1.00 13.44 ?  205 PHE A N     1 
ATOM   1255 C  CA    . PHE A 1 157 ? -30.802 -1.650  5.558   1.00 13.08 ?  205 PHE A CA    1 
ATOM   1256 C  C     . PHE A 1 157 ? -29.857 -2.285  4.563   1.00 13.90 ?  205 PHE A C     1 
ATOM   1257 O  O     . PHE A 1 157 ? -30.226 -3.290  3.939   1.00 15.94 ?  205 PHE A O     1 
ATOM   1258 C  CB    . PHE A 1 157 ? -30.854 -2.523  6.834   1.00 15.01 ?  205 PHE A CB    1 
ATOM   1259 C  CG    . PHE A 1 157 ? -31.832 -2.049  7.870   1.00 17.80 ?  205 PHE A CG    1 
ATOM   1260 C  CD1   . PHE A 1 157 ? -32.218 -0.711  7.979   1.00 20.05 ?  205 PHE A CD1   1 
ATOM   1261 C  CD2   . PHE A 1 157 ? -32.457 -2.952  8.671   1.00 20.07 ?  205 PHE A CD2   1 
ATOM   1262 C  CE1   . PHE A 1 157 ? -33.166 -0.309  8.930   1.00 20.43 ?  205 PHE A CE1   1 
ATOM   1263 C  CE2   . PHE A 1 157 ? -33.376 -2.511  9.669   1.00 20.46 ?  205 PHE A CE2   1 
ATOM   1264 C  CZ    . PHE A 1 157 ? -33.695 -1.208  9.761   1.00 19.39 ?  205 PHE A CZ    1 
ATOM   1265 N  N     . LEU A 1 158 ? -28.680 -1.681  4.380   1.00 13.32 ?  206 LEU A N     1 
ATOM   1266 C  CA    . LEU A 1 158 ? -27.691 -2.232  3.446   1.00 12.73 ?  206 LEU A CA    1 
ATOM   1267 C  C     . LEU A 1 158 ? -26.444 -2.665  4.235   1.00 13.50 ?  206 LEU A C     1 
ATOM   1268 O  O     . LEU A 1 158 ? -25.970 -1.879  5.058   1.00 14.64 ?  206 LEU A O     1 
ATOM   1269 C  CB    . LEU A 1 158 ? -27.311 -1.192  2.398   1.00 13.11 ?  206 LEU A CB    1 
ATOM   1270 C  CG    . LEU A 1 158 ? -28.462 -0.480  1.685   1.00 14.88 ?  206 LEU A CG    1 
ATOM   1271 C  CD1   . LEU A 1 158 ? -27.839 0.481   0.639   1.00 15.88 ?  206 LEU A CD1   1 
ATOM   1272 C  CD2   . LEU A 1 158 ? -29.405 -1.471  1.000   1.00 14.94 ?  206 LEU A CD2   1 
ATOM   1273 N  N     . SER A 1 159 ? -25.943 -3.858  3.984   1.00 14.03 ?  207 SER A N     1 
ATOM   1274 C  CA    A SER A 1 159 ? -24.724 -4.268  4.686   0.58 14.87 ?  207 SER A CA    1 
ATOM   1275 C  CA    B SER A 1 159 ? -24.853 -4.426  4.807   0.42 14.85 ?  207 SER A CA    1 
ATOM   1276 C  C     . SER A 1 159 ? -24.019 -5.428  4.016   1.00 15.42 ?  207 SER A C     1 
ATOM   1277 O  O     . SER A 1 159 ? -24.558 -6.073  3.139   1.00 15.77 ?  207 SER A O     1 
ATOM   1278 C  CB    A SER A 1 159 ? -25.045 -4.688  6.105   0.58 15.88 ?  207 SER A CB    1 
ATOM   1279 C  CB    B SER A 1 159 ? -25.458 -5.120  6.050   0.42 15.21 ?  207 SER A CB    1 
ATOM   1280 O  OG    A SER A 1 159 ? -25.598 -5.976  6.048   0.58 15.92 ?  207 SER A OG    1 
ATOM   1281 O  OG    B SER A 1 159 ? -24.518 -5.769  6.896   0.42 15.73 ?  207 SER A OG    1 
ATOM   1282 N  N     . ASN A 1 160 ? -22.761 -5.631  4.436   1.00 15.10 ?  208 ASN A N     1 
ATOM   1283 C  CA    . ASN A 1 160 ? -21.978 -6.754  3.956   1.00 15.19 ?  208 ASN A CA    1 
ATOM   1284 C  C     . ASN A 1 160 ? -22.100 -7.981  4.848   1.00 17.66 ?  208 ASN A C     1 
ATOM   1285 O  O     . ASN A 1 160 ? -21.433 -8.975  4.619   1.00 17.48 ?  208 ASN A O     1 
ATOM   1286 C  CB    . ASN A 1 160 ? -20.513 -6.350  3.843   1.00 16.50 ?  208 ASN A CB    1 
ATOM   1287 C  CG    . ASN A 1 160 ? -20.298 -5.191  2.881   1.00 17.38 ?  208 ASN A CG    1 
ATOM   1288 O  OD1   . ASN A 1 160 ? -19.843 -4.120  3.276   1.00 19.11 ?  208 ASN A OD1   1 
ATOM   1289 N  ND2   . ASN A 1 160 ? -20.576 -5.411  1.611   1.00 16.60 ?  208 ASN A ND2   1 
ATOM   1290 N  N     . ALA A 1 161 ? -22.975 -7.955  5.848   1.00 20.64 ?  209 ALA A N     1 
ATOM   1291 C  CA    . ALA A 1 161 ? -22.917 -9.036  6.819   1.00 23.10 ?  209 ALA A CA    1 
ATOM   1292 C  C     . ALA A 1 161 ? -23.391 -10.320 6.168   1.00 21.55 ?  209 ALA A C     1 
ATOM   1293 O  O     . ALA A 1 161 ? -24.347 -10.347 5.453   1.00 23.86 ?  209 ALA A O     1 
ATOM   1294 C  CB    . ALA A 1 161 ? -23.710 -8.688  8.026   1.00 26.63 ?  209 ALA A CB    1 
ATOM   1295 N  N     . GLY A 1 162 ? -22.629 -11.390 6.334   1.00 20.85 ?  210 GLY A N     1 
ATOM   1296 C  CA    . GLY A 1 162 ? -23.004 -12.649 5.708   1.00 19.89 ?  210 GLY A CA    1 
ATOM   1297 C  C     . GLY A 1 162 ? -22.406 -12.921 4.347   1.00 18.52 ?  210 GLY A C     1 
ATOM   1298 O  O     . GLY A 1 162 ? -22.608 -14.004 3.791   1.00 20.04 ?  210 GLY A O     1 
ATOM   1299 N  N     . ALA A 1 163 ? -21.687 -11.941 3.814   1.00 17.26 ?  211 ALA A N     1 
ATOM   1300 C  CA    . ALA A 1 163 ? -21.189 -12.021 2.444   1.00 17.13 ?  211 ALA A CA    1 
ATOM   1301 C  C     . ALA A 1 163 ? -20.337 -13.268 2.212   1.00 18.10 ?  211 ALA A C     1 
ATOM   1302 O  O     . ALA A 1 163 ? -20.541 -13.966 1.186   1.00 18.78 ?  211 ALA A O     1 
ATOM   1303 C  CB    . ALA A 1 163 ? -20.435 -10.722 2.110   1.00 18.33 ?  211 ALA A CB    1 
ATOM   1304 N  N     . GLU A 1 164 ? -19.413 -13.592 3.114   1.00 18.80 ?  212 GLU A N     1 
ATOM   1305 C  CA    . GLU A 1 164 ? -18.557 -14.753 2.878   1.00 20.82 ?  212 GLU A CA    1 
ATOM   1306 C  C     . GLU A 1 164 ? -19.384 -16.056 2.878   1.00 21.34 ?  212 GLU A C     1 
ATOM   1307 O  O     . GLU A 1 164 ? -19.156 -16.945 2.014   1.00 22.10 ?  212 GLU A O     1 
ATOM   1308 C  CB    . GLU A 1 164 ? -17.413 -14.797 3.906   1.00 22.65 ?  212 GLU A CB    1 
ATOM   1309 C  CG    . GLU A 1 164 ? -16.347 -15.865 3.615   1.00 26.29 ?  212 GLU A CG    1 
ATOM   1310 C  CD    . GLU A 1 164 ? -15.337 -15.472 2.494   1.00 29.36 ?  212 GLU A CD    1 
ATOM   1311 O  OE1   . GLU A 1 164 ? -14.590 -16.371 2.001   1.00 31.93 ?  212 GLU A OE1   1 
ATOM   1312 O  OE2   . GLU A 1 164 ? -15.261 -14.284 2.122   1.00 29.09 ?  212 GLU A OE2   1 
ATOM   1313 N  N     . ARG A 1 165 ? -20.352 -16.185 3.796   1.00 20.18 ?  213 ARG A N     1 
ATOM   1314 C  CA    . ARG A 1 165 ? -21.155 -17.404 3.811   1.00 22.06 ?  213 ARG A CA    1 
ATOM   1315 C  C     . ARG A 1 165 ? -22.069 -17.558 2.581   1.00 20.50 ?  213 ARG A C     1 
ATOM   1316 O  O     . ARG A 1 165 ? -22.325 -18.684 2.116   1.00 21.60 ?  213 ARG A O     1 
ATOM   1317 C  CB    . ARG A 1 165 ? -21.986 -17.476 5.104   1.00 26.06 ?  213 ARG A CB    1 
ATOM   1318 C  CG    . ARG A 1 165 ? -21.159 -17.796 6.339   1.00 31.96 ?  213 ARG A CG    1 
ATOM   1319 C  CD    . ARG A 1 165 ? -20.427 -19.128 6.195   1.00 38.07 ?  213 ARG A CD    1 
ATOM   1320 N  NE    . ARG A 1 165 ? -21.307 -20.282 6.448   1.00 43.38 ?  213 ARG A NE    1 
ATOM   1321 C  CZ    . ARG A 1 165 ? -21.537 -21.281 5.583   1.00 46.88 ?  213 ARG A CZ    1 
ATOM   1322 N  NH1   . ARG A 1 165 ? -20.968 -21.288 4.379   1.00 48.10 ?  213 ARG A NH1   1 
ATOM   1323 N  NH2   . ARG A 1 165 ? -22.357 -22.275 5.913   1.00 47.72 ?  213 ARG A NH2   1 
ATOM   1324 N  N     . ILE A 1 166 ? -22.598 -16.443 2.069   1.00 19.00 ?  214 ILE A N     1 
ATOM   1325 C  CA    . ILE A 1 166 ? -23.404 -16.468 0.854   1.00 19.20 ?  214 ILE A CA    1 
ATOM   1326 C  C     . ILE A 1 166 ? -22.519 -16.956 -0.304  1.00 19.81 ?  214 ILE A C     1 
ATOM   1327 O  O     . ILE A 1 166 ? -22.923 -17.800 -1.123  1.00 20.28 ?  214 ILE A O     1 
ATOM   1328 C  CB    . ILE A 1 166 ? -23.969 -15.082 0.569   1.00 18.15 ?  214 ILE A CB    1 
ATOM   1329 C  CG1   . ILE A 1 166 ? -25.035 -14.666 1.608   1.00 19.31 ?  214 ILE A CG1   1 
ATOM   1330 C  CG2   . ILE A 1 166 ? -24.563 -14.999 -0.876  1.00 18.63 ?  214 ILE A CG2   1 
ATOM   1331 C  CD1   . ILE A 1 166 ? -25.398 -13.201 1.568   1.00 18.49 ?  214 ILE A CD1   1 
ATOM   1332 N  N     . THR A 1 167 ? -21.302 -16.434 -0.358  1.00 19.80 ?  215 THR A N     1 
ATOM   1333 C  CA    . THR A 1 167 ? -20.376 -16.860 -1.398  1.00 19.65 ?  215 THR A CA    1 
ATOM   1334 C  C     . THR A 1 167 ? -20.065 -18.337 -1.324  1.00 20.63 ?  215 THR A C     1 
ATOM   1335 O  O     . THR A 1 167 ? -19.929 -19.014 -2.359  1.00 20.80 ?  215 THR A O     1 
ATOM   1336 C  CB    . THR A 1 167 ? -19.137 -15.995 -1.326  1.00 21.92 ?  215 THR A CB    1 
ATOM   1337 O  OG1   . THR A 1 167 ? -19.558 -14.681 -1.748  1.00 23.59 ?  215 THR A OG1   1 
ATOM   1338 C  CG2   . THR A 1 167 ? -18.047 -16.501 -2.312  1.00 22.84 ?  215 THR A CG2   1 
ATOM   1339 N  N     . ASP A 1 168 ? -19.971 -18.880 -0.103  1.00 21.44 ?  216 ASP A N     1 
ATOM   1340 C  CA    . ASP A 1 168 ? -19.709 -20.320 0.059   1.00 24.06 ?  216 ASP A CA    1 
ATOM   1341 C  C     . ASP A 1 168 ? -20.782 -21.159 -0.645  1.00 23.34 ?  216 ASP A C     1 
ATOM   1342 O  O     . ASP A 1 168 ? -20.469 -22.175 -1.290  1.00 23.89 ?  216 ASP A O     1 
ATOM   1343 C  CB    . ASP A 1 168 ? -19.689 -20.709 1.521   1.00 27.78 ?  216 ASP A CB    1 
ATOM   1344 C  CG    . ASP A 1 168 ? -18.454 -20.232 2.252   1.00 33.65 ?  216 ASP A CG    1 
ATOM   1345 O  OD1   . ASP A 1 168 ? -17.421 -19.945 1.574   1.00 35.02 ?  216 ASP A OD1   1 
ATOM   1346 O  OD2   . ASP A 1 168 ? -18.546 -20.187 3.516   1.00 36.30 ?  216 ASP A OD2   1 
ATOM   1347 N  N     . VAL A 1 169 ? -22.050 -20.742 -0.502  1.00 23.15 ?  217 VAL A N     1 
ATOM   1348 C  CA    . VAL A 1 169 ? -23.156 -21.396 -1.218  1.00 22.67 ?  217 VAL A CA    1 
ATOM   1349 C  C     . VAL A 1 169 ? -22.965 -21.262 -2.741  1.00 22.31 ?  217 VAL A C     1 
ATOM   1350 O  O     . VAL A 1 169 ? -23.124 -22.232 -3.464  1.00 24.49 ?  217 VAL A O     1 
ATOM   1351 C  CB    . VAL A 1 169 ? -24.537 -20.810 -0.800  1.00 22.73 ?  217 VAL A CB    1 
ATOM   1352 C  CG1   . VAL A 1 169 ? -25.643 -21.438 -1.599  1.00 23.20 ?  217 VAL A CG1   1 
ATOM   1353 C  CG2   . VAL A 1 169 ? -24.784 -21.040 0.676   1.00 24.31 ?  217 VAL A CG2   1 
ATOM   1354 N  N     . ALA A 1 170 ? -22.726 -20.044 -3.246  1.00 20.74 ?  218 ALA A N     1 
ATOM   1355 C  CA    . ALA A 1 170 ? -22.575 -19.860 -4.701  1.00 20.39 ?  218 ALA A CA    1 
ATOM   1356 C  C     . ALA A 1 170 ? -21.421 -20.721 -5.219  1.00 21.60 ?  218 ALA A C     1 
ATOM   1357 O  O     . ALA A 1 170 ? -21.540 -21.314 -6.277  1.00 22.71 ?  218 ALA A O     1 
ATOM   1358 C  CB    . ALA A 1 170 ? -22.355 -18.385 -5.035  1.00 20.26 ?  218 ALA A CB    1 
ATOM   1359 N  N     . LEU A 1 171 ? -20.329 -20.802 -4.463  1.00 22.46 ?  219 LEU A N     1 
ATOM   1360 C  CA    . LEU A 1 171 ? -19.203 -21.650 -4.822  1.00 24.53 ?  219 LEU A CA    1 
ATOM   1361 C  C     . LEU A 1 171 ? -19.568 -23.152 -4.857  1.00 25.29 ?  219 LEU A C     1 
ATOM   1362 O  O     . LEU A 1 171 ? -19.171 -23.858 -5.791  1.00 25.68 ?  219 LEU A O     1 
ATOM   1363 C  CB    . LEU A 1 171 ? -18.030 -21.422 -3.855  1.00 25.96 ?  219 LEU A CB    1 
ATOM   1364 C  CG    . LEU A 1 171 ? -16.691 -22.008 -4.299  1.00 28.64 ?  219 LEU A CG    1 
ATOM   1365 C  CD1   . LEU A 1 171 ? -16.256 -21.423 -5.635  1.00 29.33 ?  219 LEU A CD1   1 
ATOM   1366 C  CD2   . LEU A 1 171 ? -15.645 -21.661 -3.232  1.00 29.61 ?  219 LEU A CD2   1 
ATOM   1367 N  N     . ASP A 1 172 ? -20.285 -23.626 -3.838  1.00 25.65 ?  220 ASP A N     1 
ATOM   1368 C  CA    . ASP A 1 172 ? -20.736 -25.013 -3.785  1.00 29.05 ?  220 ASP A CA    1 
ATOM   1369 C  C     . ASP A 1 172 ? -21.563 -25.351 -5.020  1.00 28.09 ?  220 ASP A C     1 
ATOM   1370 O  O     . ASP A 1 172 ? -21.323 -26.377 -5.663  1.00 28.64 ?  220 ASP A O     1 
ATOM   1371 C  CB    . ASP A 1 172 ? -21.561 -25.246 -2.536  1.00 34.37 ?  220 ASP A CB    1 
ATOM   1372 C  CG    . ASP A 1 172 ? -22.059 -26.669 -2.431  1.00 40.64 ?  220 ASP A CG    1 
ATOM   1373 O  OD1   . ASP A 1 172 ? -23.243 -26.843 -2.067  1.00 43.54 ?  220 ASP A OD1   1 
ATOM   1374 O  OD2   . ASP A 1 172 ? -21.279 -27.616 -2.692  1.00 43.67 ?  220 ASP A OD2   1 
ATOM   1375 N  N     . PHE A 1 173 ? -22.533 -24.492 -5.348  1.00 26.22 ?  221 PHE A N     1 
ATOM   1376 C  CA    . PHE A 1 173 ? -23.354 -24.728 -6.530  1.00 26.03 ?  221 PHE A CA    1 
ATOM   1377 C  C     . PHE A 1 173 ? -22.512 -24.730 -7.785  1.00 26.69 ?  221 PHE A C     1 
ATOM   1378 O  O     . PHE A 1 173 ? -22.726 -25.596 -8.654  1.00 28.72 ?  221 PHE A O     1 
ATOM   1379 C  CB    . PHE A 1 173 ? -24.485 -23.703 -6.650  1.00 26.06 ?  221 PHE A CB    1 
ATOM   1380 C  CG    . PHE A 1 173 ? -25.707 -24.080 -5.882  1.00 26.27 ?  221 PHE A CG    1 
ATOM   1381 C  CD1   . PHE A 1 173 ? -25.678 -24.138 -4.498  1.00 27.18 ?  221 PHE A CD1   1 
ATOM   1382 C  CD2   . PHE A 1 173 ? -26.891 -24.363 -6.533  1.00 26.77 ?  221 PHE A CD2   1 
ATOM   1383 C  CE1   . PHE A 1 173 ? -26.840 -24.476 -3.774  1.00 27.66 ?  221 PHE A CE1   1 
ATOM   1384 C  CE2   . PHE A 1 173 ? -28.040 -24.754 -5.808  1.00 27.07 ?  221 PHE A CE2   1 
ATOM   1385 C  CZ    . PHE A 1 173 ? -28.007 -24.787 -4.438  1.00 27.80 ?  221 PHE A CZ    1 
ATOM   1386 N  N     . TRP A 1 174 ? -21.524 -23.835 -7.870  1.00 25.03 ?  222 TRP A N     1 
ATOM   1387 C  CA    . TRP A 1 174 ? -20.712 -23.752 -9.092  1.00 26.42 ?  222 TRP A CA    1 
ATOM   1388 C  C     . TRP A 1 174 ? -19.851 -25.013 -9.243  1.00 28.25 ?  222 TRP A C     1 
ATOM   1389 O  O     . TRP A 1 174 ? -19.745 -25.604 -10.337 1.00 28.86 ?  222 TRP A O     1 
ATOM   1390 C  CB    . TRP A 1 174 ? -19.853 -22.475 -9.081  1.00 27.68 ?  222 TRP A CB    1 
ATOM   1391 C  CG    . TRP A 1 174 ? -19.048 -22.245 -10.358 1.00 29.45 ?  222 TRP A CG    1 
ATOM   1392 C  CD1   . TRP A 1 174 ? -19.424 -21.522 -11.461 1.00 30.97 ?  222 TRP A CD1   1 
ATOM   1393 C  CD2   . TRP A 1 174 ? -17.731 -22.721 -10.625 1.00 30.62 ?  222 TRP A CD2   1 
ATOM   1394 N  NE1   . TRP A 1 174 ? -18.407 -21.540 -12.413 1.00 31.62 ?  222 TRP A NE1   1 
ATOM   1395 C  CE2   . TRP A 1 174 ? -17.368 -22.278 -11.917 1.00 31.15 ?  222 TRP A CE2   1 
ATOM   1396 C  CE3   . TRP A 1 174 ? -16.820 -23.495 -9.894  1.00 32.17 ?  222 TRP A CE3   1 
ATOM   1397 C  CZ2   . TRP A 1 174 ? -16.125 -22.574 -12.493 1.00 32.74 ?  222 TRP A CZ2   1 
ATOM   1398 C  CZ3   . TRP A 1 174 ? -15.596 -23.794 -10.474 1.00 33.08 ?  222 TRP A CZ3   1 
ATOM   1399 C  CH2   . TRP A 1 174 ? -15.259 -23.330 -11.759 1.00 33.59 ?  222 TRP A CH2   1 
ATOM   1400 N  N     . ARG A 1 175 ? -19.262 -25.461 -8.149  1.00 29.99 ?  223 ARG A N     1 
ATOM   1401 C  CA    . ARG A 1 175 ? -18.416 -26.654 -8.188  1.00 32.52 ?  223 ARG A CA    1 
ATOM   1402 C  C     . ARG A 1 175 ? -19.202 -27.909 -8.518  1.00 34.43 ?  223 ARG A C     1 
ATOM   1403 O  O     . ARG A 1 175 ? -18.639 -28.866 -9.077  1.00 35.07 ?  223 ARG A O     1 
ATOM   1404 C  CB    . ARG A 1 175 ? -17.709 -26.858 -6.851  1.00 33.10 ?  223 ARG A CB    1 
ATOM   1405 C  CG    . ARG A 1 175 ? -16.538 -25.931 -6.626  1.00 34.41 ?  223 ARG A CG    1 
ATOM   1406 C  CD    . ARG A 1 175 ? -16.099 -26.039 -5.184  1.00 36.71 ?  223 ARG A CD    1 
ATOM   1407 N  NE    . ARG A 1 175 ? -14.884 -25.277 -4.928  1.00 39.76 ?  223 ARG A NE    1 
ATOM   1408 C  CZ    . ARG A 1 175 ? -14.562 -24.793 -3.739  1.00 42.81 ?  223 ARG A CZ    1 
ATOM   1409 N  NH1   . ARG A 1 175 ? -13.435 -24.098 -3.579  1.00 43.71 ?  223 ARG A NH1   1 
ATOM   1410 N  NH2   . ARG A 1 175 ? -15.397 -24.973 -2.716  1.00 44.24 ?  223 ARG A NH2   1 
ATOM   1411 N  N     . SER A 1 176 ? -20.478 -27.923 -8.130  1.00 35.31 ?  224 SER A N     1 
ATOM   1412 C  CA    . SER A 1 176 ? -21.358 -29.088 -8.319  1.00 37.13 ?  224 SER A CA    1 
ATOM   1413 C  C     . SER A 1 176 ? -21.976 -29.165 -9.699  1.00 37.58 ?  224 SER A C     1 
ATOM   1414 O  O     . SER A 1 176 ? -22.712 -30.116 -10.009 1.00 38.57 ?  224 SER A O     1 
ATOM   1415 C  CB    . SER A 1 176 ? -22.479 -29.068 -7.289  1.00 38.61 ?  224 SER A CB    1 
ATOM   1416 O  OG    . SER A 1 176 ? -21.921 -29.134 -5.977  1.00 40.11 ?  224 SER A OG    1 
ATOM   1417 N  N     . GLY A 1 177 ? -21.716 -28.154 -10.512 1.00 36.81 ?  225 GLY A N     1 
ATOM   1418 C  CA    . GLY A 1 177 ? -22.242 -28.107 -11.861 1.00 36.54 ?  225 GLY A CA    1 
ATOM   1419 C  C     . GLY A 1 177 ? -23.697 -27.674 -11.976 1.00 36.68 ?  225 GLY A C     1 
ATOM   1420 O  O     . GLY A 1 177 ? -24.352 -27.901 -13.012 1.00 37.68 ?  225 GLY A O     1 
ATOM   1421 N  N     . LYS A 1 178 ? -24.220 -27.051 -10.924 1.00 34.93 ?  226 LYS A N     1 
ATOM   1422 C  CA    . LYS A 1 178 ? -25.588 -26.575 -10.949 1.00 34.38 ?  226 LYS A CA    1 
ATOM   1423 C  C     . LYS A 1 178 ? -25.632 -25.132 -11.450 1.00 31.72 ?  226 LYS A C     1 
ATOM   1424 O  O     . LYS A 1 178 ? -24.613 -24.456 -11.492 1.00 31.65 ?  226 LYS A O     1 
ATOM   1425 C  CB    . LYS A 1 178 ? -26.200 -26.667 -9.556  1.00 36.79 ?  226 LYS A CB    1 
ATOM   1426 C  CG    . LYS A 1 178 ? -26.120 -28.071 -8.927  1.00 39.43 ?  226 LYS A CG    1 
ATOM   1427 C  CD    . LYS A 1 178 ? -26.754 -28.082 -7.525  1.00 42.25 ?  226 LYS A CD    1 
ATOM   1428 C  CE    . LYS A 1 178 ? -26.158 -29.181 -6.632  1.00 44.50 ?  226 LYS A CE    1 
ATOM   1429 N  NZ    . LYS A 1 178 ? -25.689 -28.640 -5.285  1.00 45.78 ?  226 LYS A NZ    1 
ATOM   1430 N  N     . GLN A 1 179 ? -26.810 -24.674 -11.829 1.00 30.15 ?  227 GLN A N     1 
ATOM   1431 C  CA    . GLN A 1 179 ? -26.982 -23.298 -12.252 1.00 29.85 ?  227 GLN A CA    1 
ATOM   1432 C  C     . GLN A 1 179 ? -27.015 -22.379 -11.037 1.00 27.10 ?  227 GLN A C     1 
ATOM   1433 O  O     . GLN A 1 179 ? -27.585 -22.741 -9.990  1.00 27.49 ?  227 GLN A O     1 
ATOM   1434 C  CB    . GLN A 1 179 ? -28.283 -23.133 -13.014 1.00 33.57 ?  227 GLN A CB    1 
ATOM   1435 C  CG    . GLN A 1 179 ? -28.301 -23.607 -14.435 1.00 36.73 ?  227 GLN A CG    1 
ATOM   1436 C  CD    . GLN A 1 179 ? -29.554 -23.052 -15.103 1.00 39.65 ?  227 GLN A CD    1 
ATOM   1437 O  OE1   . GLN A 1 179 ? -29.604 -21.865 -15.490 1.00 41.40 ?  227 GLN A OE1   1 
ATOM   1438 N  NE2   . GLN A 1 179 ? -30.592 -23.876 -15.183 1.00 40.00 ?  227 GLN A NE2   1 
ATOM   1439 N  N     . ARG A 1 180 ? -26.456 -21.176 -11.193 1.00 25.10 ?  228 ARG A N     1 
ATOM   1440 C  CA    . ARG A 1 180 ? -26.547 -20.137 -10.173 1.00 23.22 ?  228 ARG A CA    1 
ATOM   1441 C  C     . ARG A 1 180 ? -28.014 -19.882 -9.802  1.00 23.90 ?  228 ARG A C     1 
ATOM   1442 O  O     . ARG A 1 180 ? -28.393 -19.753 -8.629  1.00 22.99 ?  228 ARG A O     1 
ATOM   1443 C  CB    . ARG A 1 180 ? -25.890 -18.873 -10.728 1.00 22.90 ?  228 ARG A CB    1 
ATOM   1444 C  CG    . ARG A 1 180 ? -25.904 -17.683 -9.821  1.00 20.83 ?  228 ARG A CG    1 
ATOM   1445 C  CD    . ARG A 1 180 ? -25.402 -16.513 -10.619 1.00 19.88 ?  228 ARG A CD    1 
ATOM   1446 N  NE    . ARG A 1 180 ? -25.401 -15.219 -9.948  1.00 19.19 ?  228 ARG A NE    1 
ATOM   1447 C  CZ    . ARG A 1 180 ? -24.340 -14.722 -9.317  1.00 18.41 ?  228 ARG A CZ    1 
ATOM   1448 N  NH1   . ARG A 1 180 ? -23.234 -15.444 -9.174  1.00 18.07 ?  228 ARG A NH1   1 
ATOM   1449 N  NH2   . ARG A 1 180 ? -24.381 -13.498 -8.840  1.00 16.69 ?  228 ARG A NH2   1 
ATOM   1450 N  N     . GLU A 1 181 ? -28.861 -19.910 -10.824 1.00 25.48 ?  229 GLU A N     1 
ATOM   1451 C  CA    . GLU A 1 181 ? -30.266 -19.618 -10.617 1.00 28.14 ?  229 GLU A CA    1 
ATOM   1452 C  C     . GLU A 1 181 ? -30.985 -20.737 -9.888  1.00 29.14 ?  229 GLU A C     1 
ATOM   1453 O  O     . GLU A 1 181 ? -32.128 -20.551 -9.539  1.00 29.91 ?  229 GLU A O     1 
ATOM   1454 C  CB    . GLU A 1 181 ? -30.955 -19.312 -11.962 1.00 30.98 ?  229 GLU A CB    1 
ATOM   1455 C  CG    . GLU A 1 181 ? -30.468 -18.002 -12.587 1.00 34.44 ?  229 GLU A CG    1 
ATOM   1456 C  CD    . GLU A 1 181 ? -29.067 -18.066 -13.250 1.00 38.05 ?  229 GLU A CD    1 
ATOM   1457 O  OE1   . GLU A 1 181 ? -28.560 -16.957 -13.575 1.00 40.78 ?  229 GLU A OE1   1 
ATOM   1458 O  OE2   . GLU A 1 181 ? -28.476 -19.176 -13.463 1.00 38.02 ?  229 GLU A OE2   1 
ATOM   1459 N  N     . ASP A 1 182 ? -30.317 -21.862 -9.619  1.00 29.30 ?  230 ASP A N     1 
ATOM   1460 C  CA    . ASP A 1 182 ? -30.921 -22.934 -8.834  1.00 31.17 ?  230 ASP A CA    1 
ATOM   1461 C  C     . ASP A 1 182 ? -30.773 -22.670 -7.334  1.00 29.06 ?  230 ASP A C     1 
ATOM   1462 O  O     . ASP A 1 182 ? -31.403 -23.363 -6.516  1.00 29.86 ?  230 ASP A O     1 
ATOM   1463 C  CB    . ASP A 1 182 ? -30.281 -24.283 -9.145  1.00 35.01 ?  230 ASP A CB    1 
ATOM   1464 C  CG    . ASP A 1 182 ? -30.582 -24.777 -10.546 1.00 38.83 ?  230 ASP A CG    1 
ATOM   1465 O  OD1   . ASP A 1 182 ? -29.680 -25.454 -11.119 1.00 40.64 ?  230 ASP A OD1   1 
ATOM   1466 O  OD2   . ASP A 1 182 ? -31.708 -24.524 -11.061 1.00 40.11 ?  230 ASP A OD2   1 
ATOM   1467 N  N     . ILE A 1 183 ? -29.945 -21.688 -6.964  1.00 26.41 ?  231 ILE A N     1 
ATOM   1468 C  CA    . ILE A 1 183 ? -29.784 -21.374 -5.544  1.00 24.89 ?  231 ILE A CA    1 
ATOM   1469 C  C     . ILE A 1 183 ? -31.102 -20.821 -4.995  1.00 25.85 ?  231 ILE A C     1 
ATOM   1470 O  O     . ILE A 1 183 ? -31.715 -19.923 -5.578  1.00 26.15 ?  231 ILE A O     1 
ATOM   1471 C  CB    . ILE A 1 183 ? -28.646 -20.370 -5.301  1.00 23.79 ?  231 ILE A CB    1 
ATOM   1472 C  CG1   . ILE A 1 183 ? -27.296 -20.936 -5.760  1.00 23.36 ?  231 ILE A CG1   1 
ATOM   1473 C  CG2   . ILE A 1 183 ? -28.596 -19.959 -3.801  1.00 25.43 ?  231 ILE A CG2   1 
ATOM   1474 C  CD1   . ILE A 1 183 ? -26.238 -19.860 -5.954  1.00 22.93 ?  231 ILE A CD1   1 
ATOM   1475 N  N     . LYS A 1 184 ? -31.519 -21.355 -3.860  1.00 27.41 ?  232 LYS A N     1 
ATOM   1476 C  CA    . LYS A 1 184 ? -32.766 -20.924 -3.240  1.00 27.93 ?  232 LYS A CA    1 
ATOM   1477 C  C     . LYS A 1 184 ? -32.517 -20.163 -1.948  1.00 26.96 ?  232 LYS A C     1 
ATOM   1478 O  O     . LYS A 1 184 ? -31.463 -20.315 -1.325  1.00 26.99 ?  232 LYS A O     1 
ATOM   1479 C  CB    . LYS A 1 184 ? -33.655 -22.137 -2.940  1.00 31.17 ?  232 LYS A CB    1 
ATOM   1480 C  CG    . LYS A 1 184 ? -34.045 -22.838 -4.205  1.00 35.31 ?  232 LYS A CG    1 
ATOM   1481 C  CD    . LYS A 1 184 ? -35.105 -22.037 -4.877  1.00 38.92 ?  232 LYS A CD    1 
ATOM   1482 C  CE    . LYS A 1 184 ? -36.393 -22.842 -5.005  1.00 41.54 ?  232 LYS A CE    1 
ATOM   1483 N  NZ    . LYS A 1 184 ? -36.323 -23.825 -6.142  1.00 43.28 ?  232 LYS A NZ    1 
ATOM   1484 N  N     . LEU A 1 185 ? -33.493 -19.368 -1.522  1.00 27.33 ?  233 LEU A N     1 
ATOM   1485 C  CA    . LEU A 1 185 ? -33.338 -18.659 -0.272  1.00 27.95 ?  233 LEU A CA    1 
ATOM   1486 C  C     . LEU A 1 185 ? -33.050 -19.622 0.895   1.00 27.49 ?  233 LEU A C     1 
ATOM   1487 O  O     . LEU A 1 185 ? -32.246 -19.283 1.772   1.00 26.93 ?  233 LEU A O     1 
ATOM   1488 C  CB    . LEU A 1 185 ? -34.581 -17.808 0.020   1.00 28.48 ?  233 LEU A CB    1 
ATOM   1489 C  CG    . LEU A 1 185 ? -34.496 -16.967 1.299   1.00 29.61 ?  233 LEU A CG    1 
ATOM   1490 C  CD1   . LEU A 1 185 ? -33.382 -15.908 1.214   1.00 29.41 ?  233 LEU A CD1   1 
ATOM   1491 C  CD2   . LEU A 1 185 ? -35.843 -16.321 1.629   1.00 31.00 ?  233 LEU A CD2   1 
ATOM   1492 N  N     . LYS A 1 186 ? -33.652 -20.823 0.905   1.00 29.13 ?  234 LYS A N     1 
ATOM   1493 C  CA    . LYS A 1 186 ? -33.432 -21.763 2.024   1.00 30.33 ?  234 LYS A CA    1 
ATOM   1494 C  C     . LYS A 1 186 ? -31.952 -22.248 2.094   1.00 29.45 ?  234 LYS A C     1 
ATOM   1495 O  O     . LYS A 1 186 ? -31.408 -22.486 3.190   1.00 30.08 ?  234 LYS A O     1 
ATOM   1496 C  CB    . LYS A 1 186 ? -34.402 -22.949 1.930   1.00 33.40 ?  234 LYS A CB    1 
ATOM   1497 C  CG    . LYS A 1 186 ? -34.218 -23.868 0.753   1.00 37.17 ?  234 LYS A CG    1 
ATOM   1498 C  CD    . LYS A 1 186 ? -35.250 -25.020 0.769   1.00 40.84 ?  234 LYS A CD    1 
ATOM   1499 C  CE    . LYS A 1 186 ? -36.691 -24.521 0.549   1.00 43.09 ?  234 LYS A CE    1 
ATOM   1500 N  NZ    . LYS A 1 186 ? -36.855 -23.705 -0.696  1.00 44.40 ?  234 LYS A NZ    1 
ATOM   1501 N  N     . ASP A 1 187 ? -31.266 -22.301 0.948   1.00 28.72 ?  235 ASP A N     1 
ATOM   1502 C  CA    . ASP A 1 187 ? -29.832 -22.598 0.913   1.00 28.53 ?  235 ASP A CA    1 
ATOM   1503 C  C     . ASP A 1 187 ? -29.006 -21.546 1.624   1.00 27.16 ?  235 ASP A C     1 
ATOM   1504 O  O     . ASP A 1 187 ? -28.066 -21.874 2.389   1.00 27.56 ?  235 ASP A O     1 
ATOM   1505 C  CB    . ASP A 1 187 ? -29.385 -22.742 -0.557  1.00 30.32 ?  235 ASP A CB    1 
ATOM   1506 C  CG    . ASP A 1 187 ? -30.141 -23.879 -1.275  1.00 32.06 ?  235 ASP A CG    1 
ATOM   1507 O  OD1   . ASP A 1 187 ? -30.185 -25.011 -0.703  1.00 34.07 ?  235 ASP A OD1   1 
ATOM   1508 O  OD2   . ASP A 1 187 ? -30.710 -23.640 -2.384  1.00 31.70 ?  235 ASP A OD2   1 
ATOM   1509 N  N     . ILE A 1 188 ? -29.370 -20.286 1.394   1.00 25.60 ?  236 ILE A N     1 
ATOM   1510 C  CA    . ILE A 1 188 ? -28.730 -19.160 2.045   1.00 25.51 ?  236 ILE A CA    1 
ATOM   1511 C  C     . ILE A 1 188 ? -29.026 -19.161 3.547   1.00 25.92 ?  236 ILE A C     1 
ATOM   1512 O  O     . ILE A 1 188 ? -28.126 -18.953 4.387   1.00 25.22 ?  236 ILE A O     1 
ATOM   1513 C  CB    . ILE A 1 188 ? -29.173 -17.835 1.406   1.00 26.07 ?  236 ILE A CB    1 
ATOM   1514 C  CG1   . ILE A 1 188 ? -28.826 -17.796 -0.089  1.00 28.36 ?  236 ILE A CG1   1 
ATOM   1515 C  CG2   . ILE A 1 188 ? -28.539 -16.677 2.123   1.00 25.38 ?  236 ILE A CG2   1 
ATOM   1516 C  CD1   . ILE A 1 188 ? -27.357 -18.043 -0.372  1.00 28.44 ?  236 ILE A CD1   1 
ATOM   1517 N  N     . GLU A 1 189 ? -30.296 -19.343 3.885   1.00 27.10 ?  237 GLU A N     1 
ATOM   1518 C  CA    . GLU A 1 189 ? -30.696 -19.364 5.292   1.00 29.46 ?  237 GLU A CA    1 
ATOM   1519 C  C     . GLU A 1 189 ? -29.952 -20.466 6.043   1.00 30.06 ?  237 GLU A C     1 
ATOM   1520 O  O     . GLU A 1 189 ? -29.523 -20.256 7.174   1.00 30.27 ?  237 GLU A O     1 
ATOM   1521 C  CB    . GLU A 1 189 ? -32.211 -19.546 5.417   1.00 31.00 ?  237 GLU A CB    1 
ATOM   1522 C  CG    . GLU A 1 189 ? -32.997 -18.358 4.858   1.00 33.49 ?  237 GLU A CG    1 
ATOM   1523 C  CD    . GLU A 1 189 ? -34.501 -18.611 4.836   1.00 37.02 ?  237 GLU A CD    1 
ATOM   1524 O  OE1   . GLU A 1 189 ? -34.922 -19.788 4.634   1.00 38.89 ?  237 GLU A OE1   1 
ATOM   1525 O  OE2   . GLU A 1 189 ? -35.261 -17.623 4.995   1.00 37.41 ?  237 GLU A OE2   1 
ATOM   1526 N  N     . HIS A 1 190 ? -29.772 -21.624 5.425   1.00 31.22 ?  238 HIS A N     1 
ATOM   1527 C  CA    . HIS A 1 190 ? -29.103 -22.717 6.124   1.00 33.78 ?  238 HIS A CA    1 
ATOM   1528 C  C     . HIS A 1 190 ? -27.615 -22.394 6.343   1.00 31.89 ?  238 HIS A C     1 
ATOM   1529 O  O     . HIS A 1 190 ? -27.076 -22.665 7.424   1.00 32.48 ?  238 HIS A O     1 
ATOM   1530 C  CB    . HIS A 1 190 ? -29.267 -24.029 5.351   1.00 38.01 ?  238 HIS A CB    1 
ATOM   1531 C  CG    . HIS A 1 190 ? -28.511 -25.179 5.953   1.00 43.27 ?  238 HIS A CG    1 
ATOM   1532 N  ND1   . HIS A 1 190 ? -27.357 -25.692 5.392   1.00 45.81 ?  238 HIS A ND1   1 
ATOM   1533 C  CD2   . HIS A 1 190 ? -28.714 -25.867 7.098   1.00 45.09 ?  238 HIS A CD2   1 
ATOM   1534 C  CE1   . HIS A 1 190 ? -26.907 -26.683 6.145   1.00 46.35 ?  238 HIS A CE1   1 
ATOM   1535 N  NE2   . HIS A 1 190 ? -27.709 -26.800 7.195   1.00 46.24 ?  238 HIS A NE2   1 
ATOM   1536 N  N     . ALA A 1 191 ? -26.955 -21.809 5.331   1.00 29.60 ?  239 ALA A N     1 
ATOM   1537 C  CA    . ALA A 1 191 ? -25.555 -21.443 5.488   1.00 29.05 ?  239 ALA A CA    1 
ATOM   1538 C  C     . ALA A 1 191 ? -25.361 -20.344 6.538   1.00 30.27 ?  239 ALA A C     1 
ATOM   1539 O  O     . ALA A 1 191 ? -24.311 -20.285 7.194   1.00 31.08 ?  239 ALA A O     1 
ATOM   1540 C  CB    . ALA A 1 191 ? -24.975 -21.003 4.136   1.00 28.54 ?  239 ALA A CB    1 
ATOM   1541 N  N     . LEU A 1 192 ? -26.363 -19.474 6.689   1.00 29.62 ?  240 LEU A N     1 
ATOM   1542 C  CA    . LEU A 1 192 ? -26.260 -18.357 7.617   1.00 30.55 ?  240 LEU A CA    1 
ATOM   1543 C  C     . LEU A 1 192 ? -26.786 -18.691 9.004   1.00 33.84 ?  240 LEU A C     1 
ATOM   1544 O  O     . LEU A 1 192 ? -26.747 -17.847 9.898   1.00 35.52 ?  240 LEU A O     1 
ATOM   1545 C  CB    . LEU A 1 192 ? -27.008 -17.134 7.083   1.00 29.27 ?  240 LEU A CB    1 
ATOM   1546 C  CG    . LEU A 1 192 ? -26.362 -16.437 5.889   1.00 29.59 ?  240 LEU A CG    1 
ATOM   1547 C  CD1   . LEU A 1 192 ? -27.281 -15.349 5.389   1.00 30.55 ?  240 LEU A CD1   1 
ATOM   1548 C  CD2   . LEU A 1 192 ? -24.978 -15.888 6.263   1.00 31.01 ?  240 LEU A CD2   1 
ATOM   1549 N  N     . SER A 1 193 ? -27.257 -19.914 9.207   1.00 35.65 ?  241 SER A N     1 
ATOM   1550 C  CA    . SER A 1 193 ? -27.924 -20.230 10.479  1.00 39.37 ?  241 SER A CA    1 
ATOM   1551 C  C     . SER A 1 193 ? -26.959 -20.077 11.661  1.00 41.98 ?  241 SER A C     1 
ATOM   1552 O  O     . SER A 1 193 ? -27.370 -19.729 12.775  1.00 41.56 ?  241 SER A O     1 
ATOM   1553 C  CB    . SER A 1 193 ? -28.516 -21.638 10.430  1.00 41.10 ?  241 SER A CB    1 
ATOM   1554 O  OG    . SER A 1 193 ? -27.510 -22.573 10.083  1.00 43.30 ?  241 SER A OG    1 
ATOM   1555 N  N     . VAL A 1 194 ? -25.668 -20.282 11.375  1.00 44.50 ?  242 VAL A N     1 
ATOM   1556 C  CA    . VAL A 1 194 ? -24.568 -20.094 12.330  1.00 46.49 ?  242 VAL A CA    1 
ATOM   1557 C  C     . VAL A 1 194 ? -24.298 -18.622 12.734  1.00 46.20 ?  242 VAL A C     1 
ATOM   1558 O  O     . VAL A 1 194 ? -23.767 -18.382 13.831  1.00 45.93 ?  242 VAL A O     1 
ATOM   1559 C  CB    . VAL A 1 194 ? -23.257 -20.734 11.755  1.00 48.11 ?  242 VAL A CB    1 
ATOM   1560 C  CG1   . VAL A 1 194 ? -23.519 -22.170 11.273  1.00 49.21 ?  242 VAL A CG1   1 
ATOM   1561 C  CG2   . VAL A 1 194 ? -22.704 -19.896 10.610  1.00 48.65 ?  242 VAL A CG2   1 
ATOM   1562 N  N     . SER A 1 195 ? -24.664 -17.658 11.865  1.00 45.67 ?  243 SER A N     1 
ATOM   1563 C  CA    . SER A 1 195 ? -24.282 -16.237 12.015  1.00 45.18 ?  243 SER A CA    1 
ATOM   1564 C  C     . SER A 1 195 ? -25.429 -15.218 11.920  1.00 44.90 ?  243 SER A C     1 
ATOM   1565 O  O     . SER A 1 195 ? -26.023 -14.861 12.935  1.00 44.63 ?  243 SER A O     1 
ATOM   1566 C  CB    . SER A 1 195 ? -23.219 -15.859 10.973  1.00 45.27 ?  243 SER A CB    1 
ATOM   1567 O  OG    . SER A 1 195 ? -23.687 -16.035 9.641   1.00 44.41 ?  243 SER A OG    1 
ATOM   1568 N  N     . VAL A 1 196 ? -25.722 -14.722 10.718  1.00 44.34 ?  244 VAL A N     1 
ATOM   1569 C  CA    . VAL A 1 196 ? -26.789 -13.724 10.536  1.00 44.58 ?  244 VAL A CA    1 
ATOM   1570 C  C     . VAL A 1 196 ? -28.122 -14.220 11.130  1.00 44.47 ?  244 VAL A C     1 
ATOM   1571 O  O     . VAL A 1 196 ? -28.924 -13.435 11.641  1.00 43.72 ?  244 VAL A O     1 
ATOM   1572 C  CB    . VAL A 1 196 ? -26.941 -13.337 9.026   1.00 45.34 ?  244 VAL A CB    1 
ATOM   1573 C  CG1   . VAL A 1 196 ? -28.139 -12.399 8.799   1.00 45.77 ?  244 VAL A CG1   1 
ATOM   1574 C  CG2   . VAL A 1 196 ? -25.634 -12.705 8.492   1.00 45.20 ?  244 VAL A CG2   1 
ATOM   1575 N  N     . PHE A 1 197 ? -28.337 -15.531 11.105  1.00 44.81 ?  245 PHE A N     1 
ATOM   1576 C  CA    . PHE A 1 197 ? -29.618 -16.074 11.537  1.00 46.43 ?  245 PHE A CA    1 
ATOM   1577 C  C     . PHE A 1 197 ? -29.521 -16.943 12.786  1.00 46.57 ?  245 PHE A C     1 
ATOM   1578 O  O     . PHE A 1 197 ? -30.373 -17.802 12.999  1.00 46.46 ?  245 PHE A O     1 
ATOM   1579 C  CB    . PHE A 1 197 ? -30.243 -16.875 10.408  1.00 47.73 ?  245 PHE A CB    1 
ATOM   1580 C  CG    . PHE A 1 197 ? -30.584 -16.044 9.204   1.00 49.15 ?  245 PHE A CG    1 
ATOM   1581 C  CD1   . PHE A 1 197 ? -31.116 -14.763 9.352   1.00 49.79 ?  245 PHE A CD1   1 
ATOM   1582 C  CD2   . PHE A 1 197 ? -30.366 -16.530 7.932   1.00 49.21 ?  245 PHE A CD2   1 
ATOM   1583 C  CE1   . PHE A 1 197 ? -31.426 -13.996 8.244   1.00 49.91 ?  245 PHE A CE1   1 
ATOM   1584 C  CE2   . PHE A 1 197 ? -30.681 -15.765 6.819   1.00 49.52 ?  245 PHE A CE2   1 
ATOM   1585 C  CZ    . PHE A 1 197 ? -31.209 -14.503 6.975   1.00 49.79 ?  245 PHE A CZ    1 
ATOM   1586 N  N     . ASN A 1 198 ? -28.500 -16.725 13.615  1.00 46.96 ?  246 ASN A N     1 
ATOM   1587 C  CA    . ASN A 1 198 ? -28.431 -17.459 14.885  1.00 46.93 ?  246 ASN A CA    1 
ATOM   1588 C  C     . ASN A 1 198 ? -29.360 -16.833 15.937  1.00 48.22 ?  246 ASN A C     1 
ATOM   1589 O  O     . ASN A 1 198 ? -30.058 -15.842 15.678  1.00 46.85 ?  246 ASN A O     1 
ATOM   1590 C  CB    . ASN A 1 198 ? -26.982 -17.561 15.412  1.00 46.13 ?  246 ASN A CB    1 
ATOM   1591 C  CG    . ASN A 1 198 ? -26.318 -16.206 15.625  1.00 44.99 ?  246 ASN A CG    1 
ATOM   1592 O  OD1   . ASN A 1 198 ? -26.986 -15.186 15.790  1.00 44.36 ?  246 ASN A OD1   1 
ATOM   1593 N  ND2   . ASN A 1 198 ? -24.985 -16.201 15.640  1.00 44.35 ?  246 ASN A ND2   1 
ATOM   1594 N  N     . ASN A 1 199 ? -29.390 -17.425 17.126  1.00 50.52 ?  247 ASN A N     1 
ATOM   1595 C  CA    . ASN A 1 199 ? -30.385 -17.017 18.109  1.00 52.66 ?  247 ASN A CA    1 
ATOM   1596 C  C     . ASN A 1 199 ? -30.129 -15.617 18.683  1.00 52.37 ?  247 ASN A C     1 
ATOM   1597 O  O     . ASN A 1 199 ? -31.075 -14.878 18.976  1.00 51.97 ?  247 ASN A O     1 
ATOM   1598 C  CB    . ASN A 1 199 ? -30.459 -18.049 19.233  1.00 54.85 ?  247 ASN A CB    1 
ATOM   1599 C  CG    . ASN A 1 199 ? -31.076 -19.358 18.774  1.00 56.64 ?  247 ASN A CG    1 
ATOM   1600 O  OD1   . ASN A 1 199 ? -31.790 -19.407 17.757  1.00 57.15 ?  247 ASN A OD1   1 
ATOM   1601 N  ND2   . ASN A 1 199 ? -30.817 -20.428 19.525  1.00 56.94 ?  247 ASN A ND2   1 
ATOM   1602 N  N     . LYS A 1 200 ? -28.858 -15.253 18.838  1.00 52.42 ?  248 LYS A N     1 
ATOM   1603 C  CA    . LYS A 1 200 ? -28.509 -13.953 19.402  1.00 52.81 ?  248 LYS A CA    1 
ATOM   1604 C  C     . LYS A 1 200 ? -28.975 -12.828 18.483  1.00 52.02 ?  248 LYS A C     1 
ATOM   1605 O  O     . LYS A 1 200 ? -29.491 -11.817 18.948  1.00 51.11 ?  248 LYS A O     1 
ATOM   1606 C  CB    . LYS A 1 200 ? -26.998 -13.845 19.652  1.00 53.79 ?  248 LYS A CB    1 
ATOM   1607 C  CG    . LYS A 1 200 ? -26.579 -12.532 20.313  1.00 54.98 ?  248 LYS A CG    1 
ATOM   1608 C  CD    . LYS A 1 200 ? -25.333 -12.722 21.178  1.00 56.01 ?  248 LYS A CD    1 
ATOM   1609 C  CE    . LYS A 1 200 ? -25.426 -11.898 22.477  1.00 57.01 ?  248 LYS A CE    1 
ATOM   1610 N  NZ    . LYS A 1 200 ? -25.878 -12.668 23.675  1.00 57.77 ?  248 LYS A NZ    1 
ATOM   1611 N  N     . ASN A 1 201 ? -28.788 -13.013 17.179  1.00 51.98 ?  249 ASN A N     1 
ATOM   1612 C  CA    . ASN A 1 201 ? -29.237 -12.017 16.208  1.00 51.98 ?  249 ASN A CA    1 
ATOM   1613 C  C     . ASN A 1 201 ? -30.757 -12.061 16.029  1.00 50.13 ?  249 ASN A C     1 
ATOM   1614 O  O     . ASN A 1 201 ? -31.392 -11.017 15.799  1.00 49.15 ?  249 ASN A O     1 
ATOM   1615 C  CB    . ASN A 1 201 ? -28.539 -12.215 14.859  1.00 53.61 ?  249 ASN A CB    1 
ATOM   1616 C  CG    . ASN A 1 201 ? -27.043 -11.916 14.917  1.00 55.06 ?  249 ASN A CG    1 
ATOM   1617 O  OD1   . ASN A 1 201 ? -26.594 -11.044 15.667  1.00 55.48 ?  249 ASN A OD1   1 
ATOM   1618 N  ND2   . ASN A 1 201 ? -26.265 -12.641 14.117  1.00 55.73 ?  249 ASN A ND2   1 
ATOM   1619 N  N     . SER A 1 202 ? -31.347 -13.256 16.124  1.00 48.63 ?  250 SER A N     1 
ATOM   1620 C  CA    . SER A 1 202 ? -32.813 -13.360 16.114  1.00 47.28 ?  250 SER A CA    1 
ATOM   1621 C  C     . SER A 1 202 ? -33.361 -12.639 17.334  1.00 44.40 ?  250 SER A C     1 
ATOM   1622 O  O     . SER A 1 202 ? -34.408 -11.973 17.264  1.00 44.17 ?  250 SER A O     1 
ATOM   1623 C  CB    . SER A 1 202 ? -33.292 -14.820 16.116  1.00 48.44 ?  250 SER A CB    1 
ATOM   1624 O  OG    . SER A 1 202 ? -33.012 -15.454 14.883  1.00 49.14 ?  250 SER A OG    1 
ATOM   1625 N  N     . GLY A 1 203 ? -32.642 -12.788 18.451  1.00 40.89 ?  251 GLY A N     1 
ATOM   1626 C  CA    . GLY A 1 203 ? -32.980 -12.097 19.677  1.00 37.43 ?  251 GLY A CA    1 
ATOM   1627 C  C     . GLY A 1 203 ? -32.935 -10.598 19.404  1.00 33.93 ?  251 GLY A C     1 
ATOM   1628 O  O     . GLY A 1 203 ? -33.885 -9.865  19.723  1.00 33.62 ?  251 GLY A O     1 
ATOM   1629 N  N     . PHE A 1 204 ? -31.828 -10.152 18.808  1.00 31.10 ?  252 PHE A N     1 
ATOM   1630 C  CA    . PHE A 1 204 ? -31.567 -8.721  18.657  1.00 28.99 ?  252 PHE A CA    1 
ATOM   1631 C  C     . PHE A 1 204 ? -32.672 -8.063  17.832  1.00 28.28 ?  252 PHE A C     1 
ATOM   1632 O  O     . PHE A 1 204 ? -33.103 -6.937  18.094  1.00 27.89 ?  252 PHE A O     1 
ATOM   1633 C  CB    . PHE A 1 204 ? -30.209 -8.478  17.986  1.00 27.81 ?  252 PHE A CB    1 
ATOM   1634 C  CG    . PHE A 1 204 ? -29.875 -7.013  17.794  1.00 27.46 ?  252 PHE A CG    1 
ATOM   1635 C  CD1   . PHE A 1 204 ? -29.230 -6.308  18.806  1.00 27.82 ?  252 PHE A CD1   1 
ATOM   1636 C  CD2   . PHE A 1 204 ? -30.210 -6.355  16.607  1.00 27.43 ?  252 PHE A CD2   1 
ATOM   1637 C  CE1   . PHE A 1 204 ? -28.915 -4.961  18.658  1.00 27.68 ?  252 PHE A CE1   1 
ATOM   1638 C  CE2   . PHE A 1 204 ? -29.915 -5.014  16.438  1.00 27.79 ?  252 PHE A CE2   1 
ATOM   1639 C  CZ    . PHE A 1 204 ? -29.235 -4.303  17.473  1.00 27.48 ?  252 PHE A CZ    1 
ATOM   1640 N  N     . TRP A 1 205 ? -33.113 -8.763  16.800  1.00 26.81 ?  253 TRP A N     1 
ATOM   1641 C  CA    . TRP A 1 205 ? -34.074 -8.164  15.879  1.00 25.85 ?  253 TRP A CA    1 
ATOM   1642 C  C     . TRP A 1 205 ? -35.503 -8.577  16.193  1.00 25.95 ?  253 TRP A C     1 
ATOM   1643 O  O     . TRP A 1 205 ? -36.388 -8.325  15.410  1.00 26.05 ?  253 TRP A O     1 
ATOM   1644 C  CB    . TRP A 1 205 ? -33.735 -8.545  14.443  1.00 25.32 ?  253 TRP A CB    1 
ATOM   1645 C  CG    . TRP A 1 205 ? -32.541 -7.820  13.908  1.00 25.23 ?  253 TRP A CG    1 
ATOM   1646 C  CD1   . TRP A 1 205 ? -31.288 -8.325  13.698  1.00 25.85 ?  253 TRP A CD1   1 
ATOM   1647 C  CD2   . TRP A 1 205 ? -32.488 -6.448  13.520  1.00 23.45 ?  253 TRP A CD2   1 
ATOM   1648 N  NE1   . TRP A 1 205 ? -30.471 -7.349  13.193  1.00 25.63 ?  253 TRP A NE1   1 
ATOM   1649 C  CE2   . TRP A 1 205 ? -31.186 -6.191  13.066  1.00 24.68 ?  253 TRP A CE2   1 
ATOM   1650 C  CE3   . TRP A 1 205 ? -33.415 -5.414  13.526  1.00 23.98 ?  253 TRP A CE3   1 
ATOM   1651 C  CZ2   . TRP A 1 205 ? -30.796 -4.948  12.617  1.00 23.25 ?  253 TRP A CZ2   1 
ATOM   1652 C  CZ3   . TRP A 1 205 ? -33.029 -4.191  13.051  1.00 23.97 ?  253 TRP A CZ3   1 
ATOM   1653 C  CH2   . TRP A 1 205 ? -31.724 -3.952  12.634  1.00 23.51 ?  253 TRP A CH2   1 
ATOM   1654 N  N     . HIS A 1 206 ? -35.749 -9.175  17.357  1.00 27.21 ?  254 HIS A N     1 
ATOM   1655 C  CA    . HIS A 1 206 ? -37.102 -9.591  17.708  1.00 28.72 ?  254 HIS A CA    1 
ATOM   1656 C  C     . HIS A 1 206 ? -38.016 -8.391  18.023  1.00 28.65 ?  254 HIS A C     1 
ATOM   1657 O  O     . HIS A 1 206 ? -37.570 -7.405  18.604  1.00 28.61 ?  254 HIS A O     1 
ATOM   1658 C  CB    . HIS A 1 206 ? -37.052 -10.531 18.911  1.00 30.69 ?  254 HIS A CB    1 
ATOM   1659 C  CG    . HIS A 1 206 ? -38.246 -11.427 19.037  1.00 34.21 ?  254 HIS A CG    1 
ATOM   1660 N  ND1   . HIS A 1 206 ? -38.559 -12.401 18.107  1.00 35.69 ?  254 HIS A ND1   1 
ATOM   1661 C  CD2   . HIS A 1 206 ? -39.190 -11.515 20.003  1.00 36.13 ?  254 HIS A CD2   1 
ATOM   1662 C  CE1   . HIS A 1 206 ? -39.649 -13.043 18.494  1.00 37.00 ?  254 HIS A CE1   1 
ATOM   1663 N  NE2   . HIS A 1 206 ? -40.050 -12.526 19.642  1.00 37.21 ?  254 HIS A NE2   1 
ATOM   1664 N  N     . SER A 1 207 ? -39.286 -8.487  17.616  1.00 28.24 ?  255 SER A N     1 
ATOM   1665 C  CA    . SER A 1 207 ? -40.316 -7.512  17.992  1.00 29.08 ?  255 SER A CA    1 
ATOM   1666 C  C     . SER A 1 207 ? -40.450 -7.438  19.521  1.00 30.39 ?  255 SER A C     1 
ATOM   1667 O  O     . SER A 1 207 ? -40.207 -8.437  20.236  1.00 31.33 ?  255 SER A O     1 
ATOM   1668 C  CB    . SER A 1 207 ? -41.652 -7.906  17.346  1.00 28.64 ?  255 SER A CB    1 
ATOM   1669 O  OG    . SER A 1 207 ? -42.757 -7.215  17.913  1.00 28.58 ?  255 SER A OG    1 
ATOM   1670 N  N     . SER A 1 208 ? -40.793 -6.255  20.024  1.00 30.96 ?  256 SER A N     1 
ATOM   1671 C  CA    . SER A 1 208 ? -41.130 -6.067  21.439  1.00 32.94 ?  256 SER A CA    1 
ATOM   1672 C  C     . SER A 1 208 ? -42.602 -6.193  21.724  1.00 35.38 ?  256 SER A C     1 
ATOM   1673 O  O     . SER A 1 208 ? -43.039 -6.007  22.887  1.00 37.11 ?  256 SER A O     1 
ATOM   1674 C  CB    . SER A 1 208 ? -40.670 -4.707  21.916  1.00 34.60 ?  256 SER A CB    1 
ATOM   1675 O  OG    . SER A 1 208 ? -39.256 -4.708  21.956  1.00 36.81 ?  256 SER A OG    1 
ATOM   1676 N  N     . LEU A 1 209 ? -43.374 -6.538  20.703  1.00 36.16 ?  257 LEU A N     1 
ATOM   1677 C  CA    . LEU A 1 209 ? -44.831 -6.587  20.846  1.00 37.38 ?  257 LEU A CA    1 
ATOM   1678 C  C     . LEU A 1 209 ? -45.382 -7.994  20.579  1.00 38.28 ?  257 LEU A C     1 
ATOM   1679 O  O     . LEU A 1 209 ? -46.236 -8.485  21.315  1.00 39.13 ?  257 LEU A O     1 
ATOM   1680 C  CB    . LEU A 1 209 ? -45.478 -5.568  19.889  1.00 38.18 ?  257 LEU A CB    1 
ATOM   1681 C  CG    . LEU A 1 209 ? -46.930 -5.146  20.136  1.00 40.00 ?  257 LEU A CG    1 
ATOM   1682 C  CD1   . LEU A 1 209 ? -46.974 -4.406  21.442  1.00 40.35 ?  257 LEU A CD1   1 
ATOM   1683 C  CD2   . LEU A 1 209 ? -47.532 -4.298  19.008  1.00 40.42 ?  257 LEU A CD2   1 
ATOM   1684 N  N     . ILE A 1 210 ? -44.906 -8.647  19.522  1.00 38.83 ?  258 ILE A N     1 
ATOM   1685 C  CA    . ILE A 1 210 ? -45.383 -9.972  19.133  1.00 39.52 ?  258 ILE A CA    1 
ATOM   1686 C  C     . ILE A 1 210 ? -44.240 -10.915 18.756  1.00 39.74 ?  258 ILE A C     1 
ATOM   1687 O  O     . ILE A 1 210 ? -43.074 -10.515 18.715  1.00 39.22 ?  258 ILE A O     1 
ATOM   1688 C  CB    . ILE A 1 210 ? -46.420 -9.872  17.971  1.00 39.44 ?  258 ILE A CB    1 
ATOM   1689 C  CG1   . ILE A 1 210 ? -45.831 -9.192  16.725  1.00 38.50 ?  258 ILE A CG1   1 
ATOM   1690 C  CG2   . ILE A 1 210 ? -47.658 -9.151  18.446  1.00 40.31 ?  258 ILE A CG2   1 
ATOM   1691 C  CD1   . ILE A 1 210 ? -46.780 -9.188  15.515  1.00 38.05 ?  258 ILE A CD1   1 
ATOM   1692 N  N     . ASP A 1 211 ? -44.579 -12.171 18.467  1.00 40.33 ?  259 ASP A N     1 
ATOM   1693 C  CA    . ASP A 1 211 ? -43.558 -13.184 18.198  1.00 40.79 ?  259 ASP A CA    1 
ATOM   1694 C  C     . ASP A 1 211 ? -43.112 -13.210 16.727  1.00 39.74 ?  259 ASP A C     1 
ATOM   1695 O  O     . ASP A 1 211 ? -43.356 -14.181 15.985  1.00 40.77 ?  259 ASP A O     1 
ATOM   1696 C  CB    . ASP A 1 211 ? -44.065 -14.554 18.621  1.00 42.63 ?  259 ASP A CB    1 
ATOM   1697 C  CG    . ASP A 1 211 ? -42.998 -15.608 18.558  1.00 44.39 ?  259 ASP A CG    1 
ATOM   1698 O  OD1   . ASP A 1 211 ? -41.804 -15.255 18.497  1.00 44.40 ?  259 ASP A OD1   1 
ATOM   1699 O  OD2   . ASP A 1 211 ? -43.366 -16.805 18.595  1.00 46.18 ?  259 ASP A OD2   1 
ATOM   1700 N  N     . ARG A 1 212 ? -42.437 -12.131 16.336  1.00 36.80 ?  260 ARG A N     1 
ATOM   1701 C  CA    . ARG A 1 212 ? -42.034 -11.868 14.965  1.00 34.95 ?  260 ARG A CA    1 
ATOM   1702 C  C     . ARG A 1 212 ? -40.654 -11.151 14.911  1.00 32.07 ?  260 ARG A C     1 
ATOM   1703 O  O     . ARG A 1 212 ? -40.231 -10.542 15.909  1.00 31.52 ?  260 ARG A O     1 
ATOM   1704 C  CB    . ARG A 1 212 ? -43.076 -10.997 14.272  1.00 37.47 ?  260 ARG A CB    1 
ATOM   1705 C  CG    . ARG A 1 212 ? -44.402 -11.679 14.013  1.00 40.39 ?  260 ARG A CG    1 
ATOM   1706 C  CD    . ARG A 1 212 ? -44.275 -12.949 13.189  1.00 43.29 ?  260 ARG A CD    1 
ATOM   1707 N  NE    . ARG A 1 212 ? -44.059 -12.715 11.773  1.00 46.55 ?  260 ARG A NE    1 
ATOM   1708 C  CZ    . ARG A 1 212 ? -45.016 -12.302 10.947  1.00 48.44 ?  260 ARG A CZ    1 
ATOM   1709 N  NH1   . ARG A 1 212 ? -46.248 -12.047 11.412  1.00 49.28 ?  260 ARG A NH1   1 
ATOM   1710 N  NH2   . ARG A 1 212 ? -44.744 -12.129 9.653   1.00 49.02 ?  260 ARG A NH2   1 
ATOM   1711 N  N     . ASN A 1 213 ? -39.967 -11.231 13.763  1.00 30.18 ?  261 ASN A N     1 
ATOM   1712 C  CA    . ASN A 1 213 ? -38.731 -10.489 13.534  1.00 27.79 ?  261 ASN A CA    1 
ATOM   1713 C  C     . ASN A 1 213 ? -39.124 -9.072  13.092  1.00 24.86 ?  261 ASN A C     1 
ATOM   1714 O  O     . ASN A 1 213 ? -40.107 -8.898  12.396  1.00 25.29 ?  261 ASN A O     1 
ATOM   1715 C  CB    . ASN A 1 213 ? -37.878 -11.189 12.440  1.00 28.51 ?  261 ASN A CB    1 
ATOM   1716 C  CG    . ASN A 1 213 ? -36.387 -10.775 12.439  1.00 29.55 ?  261 ASN A CG    1 
ATOM   1717 O  OD1   . ASN A 1 213 ? -36.046 -9.618  12.283  1.00 27.91 ?  261 ASN A OD1   1 
ATOM   1718 N  ND2   . ASN A 1 213 ? -35.497 -11.760 12.621  1.00 31.87 ?  261 ASN A ND2   1 
ATOM   1719 N  N     . LEU A 1 214 ? -38.340 -8.066  13.463  1.00 21.62 ?  262 LEU A N     1 
ATOM   1720 C  CA    . LEU A 1 214 ? -38.538 -6.695  12.964  1.00 18.67 ?  262 LEU A CA    1 
ATOM   1721 C  C     . LEU A 1 214 ? -38.169 -6.575  11.488  1.00 18.37 ?  262 LEU A C     1 
ATOM   1722 O  O     . LEU A 1 214 ? -38.633 -5.649  10.828  1.00 19.55 ?  262 LEU A O     1 
ATOM   1723 C  CB    . LEU A 1 214 ? -37.680 -5.687  13.721  1.00 20.19 ?  262 LEU A CB    1 
ATOM   1724 C  CG    . LEU A 1 214 ? -38.119 -5.593  15.186  1.00 20.28 ?  262 LEU A CG    1 
ATOM   1725 C  CD1   . LEU A 1 214 ? -37.074 -4.727  15.914  1.00 22.08 ?  262 LEU A CD1   1 
ATOM   1726 C  CD2   . LEU A 1 214 ? -39.512 -4.947  15.297  1.00 22.02 ?  262 LEU A CD2   1 
ATOM   1727 N  N     A ILE A 1 215 ? -37.319 -7.476  10.978  0.66 18.06 ?  263 ILE A N     1 
ATOM   1728 N  N     B ILE A 1 215 ? -37.334 -7.495  11.006  0.34 18.03 ?  263 ILE A N     1 
ATOM   1729 C  CA    A ILE A 1 215 ? -36.926 -7.452  9.548   0.66 18.42 ?  263 ILE A CA    1 
ATOM   1730 C  CA    B ILE A 1 215 ? -36.967 -7.556  9.591   0.34 18.10 ?  263 ILE A CA    1 
ATOM   1731 C  C     A ILE A 1 215 ? -37.840 -8.384  8.782   0.66 18.75 ?  263 ILE A C     1 
ATOM   1732 C  C     B ILE A 1 215 ? -38.003 -8.386  8.884   0.34 18.34 ?  263 ILE A C     1 
ATOM   1733 O  O     A ILE A 1 215 ? -37.888 -9.596  9.059   0.66 20.37 ?  263 ILE A O     1 
ATOM   1734 O  O     B ILE A 1 215 ? -38.284 -9.527  9.279   0.34 18.74 ?  263 ILE A O     1 
ATOM   1735 C  CB    A ILE A 1 215 ? -35.441 -7.835  9.354   0.66 18.81 ?  263 ILE A CB    1 
ATOM   1736 C  CB    B ILE A 1 215 ? -35.567 -8.139  9.403   0.34 17.88 ?  263 ILE A CB    1 
ATOM   1737 C  CG1   A ILE A 1 215 ? -34.541 -6.721  9.916   0.66 19.65 ?  263 ILE A CG1   1 
ATOM   1738 C  CG1   B ILE A 1 215 ? -34.592 -7.401  10.314  0.34 17.73 ?  263 ILE A CG1   1 
ATOM   1739 C  CG2   A ILE A 1 215 ? -35.160 -8.065  7.877   0.66 19.35 ?  263 ILE A CG2   1 
ATOM   1740 C  CG2   B ILE A 1 215 ? -35.138 -8.042  7.943   0.34 18.23 ?  263 ILE A CG2   1 
ATOM   1741 C  CD1   A ILE A 1 215 ? -33.043 -7.089  10.094  0.66 19.82 ?  263 ILE A CD1   1 
ATOM   1742 C  CD1   B ILE A 1 215 ? -34.469 -5.920  9.988   0.34 17.59 ?  263 ILE A CD1   1 
ATOM   1743 N  N     . ASP A 1 216 ? -38.617 -7.814  7.861   1.00 18.05 ?  264 ASP A N     1 
ATOM   1744 C  CA    . ASP A 1 216 ? -39.640 -8.559  7.139   1.00 19.09 ?  264 ASP A CA    1 
ATOM   1745 C  C     . ASP A 1 216 ? -39.032 -9.457  6.073   1.00 18.90 ?  264 ASP A C     1 
ATOM   1746 O  O     . ASP A 1 216 ? -39.528 -10.590 5.794   1.00 20.13 ?  264 ASP A O     1 
ATOM   1747 C  CB    . ASP A 1 216 ? -40.595 -7.576  6.513   1.00 19.04 ?  264 ASP A CB    1 
ATOM   1748 C  CG    . ASP A 1 216 ? -41.342 -6.781  7.556   1.00 20.51 ?  264 ASP A CG    1 
ATOM   1749 O  OD1   . ASP A 1 216 ? -41.940 -7.427  8.440   1.00 23.27 ?  264 ASP A OD1   1 
ATOM   1750 O  OD2   . ASP A 1 216 ? -41.325 -5.561  7.540   1.00 21.09 ?  264 ASP A OD2   1 
ATOM   1751 N  N     . TYR A 1 217 ? -37.995 -8.942  5.400   1.00 17.90 ?  265 TYR A N     1 
ATOM   1752 C  CA    . TYR A 1 217 ? -37.314 -9.719  4.348   1.00 18.66 ?  265 TYR A CA    1 
ATOM   1753 C  C     . TYR A 1 217 ? -35.825 -9.537  4.387   1.00 17.86 ?  265 TYR A C     1 
ATOM   1754 O  O     . TYR A 1 217 ? -35.334 -8.417  4.392   1.00 17.79 ?  265 TYR A O     1 
ATOM   1755 C  CB    . TYR A 1 217 ? -37.776 -9.349  2.935   1.00 20.08 ?  265 TYR A CB    1 
ATOM   1756 C  CG    . TYR A 1 217 ? -39.269 -9.543  2.747   1.00 21.59 ?  265 TYR A CG    1 
ATOM   1757 C  CD1   . TYR A 1 217 ? -39.762 -10.766 2.332   1.00 23.98 ?  265 TYR A CD1   1 
ATOM   1758 C  CD2   . TYR A 1 217 ? -40.164 -8.504  3.008   1.00 22.10 ?  265 TYR A CD2   1 
ATOM   1759 C  CE1   . TYR A 1 217 ? -41.132 -10.957 2.178   1.00 26.44 ?  265 TYR A CE1   1 
ATOM   1760 C  CE2   . TYR A 1 217 ? -41.538 -8.680  2.849   1.00 23.95 ?  265 TYR A CE2   1 
ATOM   1761 C  CZ    . TYR A 1 217 ? -42.012 -9.915  2.433   1.00 26.55 ?  265 TYR A CZ    1 
ATOM   1762 O  OH    . TYR A 1 217 ? -43.358 -10.183 2.252   1.00 29.33 ?  265 TYR A OH    1 
ATOM   1763 N  N     A PHE A 1 218 ? -35.079 -10.649 4.448   0.55 18.20 ?  266 PHE A N     1 
ATOM   1764 N  N     B PHE A 1 218 ? -35.155 -10.669 4.415   0.45 18.34 ?  266 PHE A N     1 
ATOM   1765 C  CA    A PHE A 1 218 ? -33.614 -10.662 4.253   0.55 18.13 ?  266 PHE A CA    1 
ATOM   1766 C  CA    B PHE A 1 218 ? -33.753 -10.752 4.181   0.45 18.32 ?  266 PHE A CA    1 
ATOM   1767 C  C     A PHE A 1 218 ? -33.317 -11.011 2.802   0.55 17.94 ?  266 PHE A C     1 
ATOM   1768 C  C     B PHE A 1 218 ? -33.569 -10.880 2.657   0.45 17.47 ?  266 PHE A C     1 
ATOM   1769 O  O     A PHE A 1 218 ? -33.618 -12.119 2.359   0.55 19.33 ?  266 PHE A O     1 
ATOM   1770 O  O     B PHE A 1 218 ? -34.267 -11.658 1.958   0.45 18.21 ?  266 PHE A O     1 
ATOM   1771 C  CB    A PHE A 1 218 ? -32.917 -11.690 5.163   0.55 18.88 ?  266 PHE A CB    1 
ATOM   1772 C  CB    B PHE A 1 218 ? -33.205 -11.934 4.976   0.45 19.08 ?  266 PHE A CB    1 
ATOM   1773 C  CG    A PHE A 1 218 ? -32.965 -11.351 6.615   0.55 19.46 ?  266 PHE A CG    1 
ATOM   1774 C  CG    B PHE A 1 218 ? -31.880 -12.376 4.541   0.45 19.52 ?  266 PHE A CG    1 
ATOM   1775 C  CD1   A PHE A 1 218 ? -31.977 -10.548 7.212   0.55 19.78 ?  266 PHE A CD1   1 
ATOM   1776 C  CD1   B PHE A 1 218 ? -30.745 -11.810 5.063   0.45 19.91 ?  266 PHE A CD1   1 
ATOM   1777 C  CD2   A PHE A 1 218 ? -34.009 -11.820 7.410   0.55 20.79 ?  266 PHE A CD2   1 
ATOM   1778 C  CD2   B PHE A 1 218 ? -31.775 -13.372 3.589   0.45 19.85 ?  266 PHE A CD2   1 
ATOM   1779 C  CE1   A PHE A 1 218 ? -32.042 -10.222 8.582   0.55 19.36 ?  266 PHE A CE1   1 
ATOM   1780 C  CE1   B PHE A 1 218 ? -29.465 -12.243 4.605   0.45 18.62 ?  266 PHE A CE1   1 
ATOM   1781 C  CE2   A PHE A 1 218 ? -34.063 -11.524 8.760   0.55 20.55 ?  266 PHE A CE2   1 
ATOM   1782 C  CE2   B PHE A 1 218 ? -30.630 -13.809 3.174   0.45 17.11 ?  266 PHE A CE2   1 
ATOM   1783 C  CZ    A PHE A 1 218 ? -33.097 -10.712 9.341   0.55 19.96 ?  266 PHE A CZ    1 
ATOM   1784 C  CZ    B PHE A 1 218 ? -29.423 -13.249 3.657   0.45 18.67 ?  266 PHE A CZ    1 
ATOM   1785 N  N     . VAL A 1 219 ? -32.657 -10.080 2.121   1.00 16.24 ?  267 VAL A N     1 
ATOM   1786 C  CA    . VAL A 1 219 ? -32.482 -10.086 0.684   1.00 14.79 ?  267 VAL A CA    1 
ATOM   1787 C  C     . VAL A 1 219 ? -30.983 -10.331 0.361   1.00 15.39 ?  267 VAL A C     1 
ATOM   1788 O  O     . VAL A 1 219 ? -30.164 -9.426  0.549   1.00 15.65 ?  267 VAL A O     1 
ATOM   1789 C  CB    . VAL A 1 219 ? -32.941 -8.753  0.077   1.00 14.82 ?  267 VAL A CB    1 
ATOM   1790 C  CG1   . VAL A 1 219 ? -32.896 -8.878  -1.457  1.00 16.45 ?  267 VAL A CG1   1 
ATOM   1791 C  CG2   . VAL A 1 219 ? -34.389 -8.375  0.550   1.00 16.11 ?  267 VAL A CG2   1 
ATOM   1792 N  N     . PRO A 1 220 ? -30.616 -11.557 -0.017  1.00 15.78 ?  268 PRO A N     1 
ATOM   1793 C  CA    . PRO A 1 220 ? -29.159 -11.807 -0.181  1.00 15.53 ?  268 PRO A CA    1 
ATOM   1794 C  C     . PRO A 1 220 ? -28.628 -11.411 -1.561  1.00 16.53 ?  268 PRO A C     1 
ATOM   1795 O  O     . PRO A 1 220 ? -29.332 -11.579 -2.573  1.00 17.93 ?  268 PRO A O     1 
ATOM   1796 C  CB    . PRO A 1 220 ? -29.050 -13.330 -0.014  1.00 17.68 ?  268 PRO A CB    1 
ATOM   1797 C  CG    . PRO A 1 220 ? -30.389 -13.802 -0.634  1.00 18.41 ?  268 PRO A CG    1 
ATOM   1798 C  CD    . PRO A 1 220 ? -31.418 -12.780 -0.211  1.00 17.57 ?  268 PRO A CD    1 
ATOM   1799 N  N     . PHE A 1 221 ? -27.378 -10.955 -1.559  1.00 15.69 ?  269 PHE A N     1 
ATOM   1800 C  CA    . PHE A 1 221 ? -26.666 -10.549 -2.760  1.00 15.01 ?  269 PHE A CA    1 
ATOM   1801 C  C     . PHE A 1 221 ? -25.479 -11.473 -2.974  1.00 15.99 ?  269 PHE A C     1 
ATOM   1802 O  O     . PHE A 1 221 ? -24.643 -11.605 -2.077  1.00 18.37 ?  269 PHE A O     1 
ATOM   1803 C  CB    . PHE A 1 221 ? -26.231 -9.061  -2.657  1.00 14.42 ?  269 PHE A CB    1 
ATOM   1804 C  CG    . PHE A 1 221 ? -27.353 -8.129  -2.947  1.00 15.48 ?  269 PHE A CG    1 
ATOM   1805 C  CD1   . PHE A 1 221 ? -28.399 -8.017  -2.028  1.00 16.01 ?  269 PHE A CD1   1 
ATOM   1806 C  CD2   . PHE A 1 221 ? -27.409 -7.432  -4.167  1.00 15.84 ?  269 PHE A CD2   1 
ATOM   1807 C  CE1   . PHE A 1 221 ? -29.492 -7.206  -2.317  1.00 16.90 ?  269 PHE A CE1   1 
ATOM   1808 C  CE2   . PHE A 1 221 ? -28.515 -6.627  -4.451  1.00 16.93 ?  269 PHE A CE2   1 
ATOM   1809 C  CZ    . PHE A 1 221 ? -29.540 -6.502  -3.484  1.00 17.22 ?  269 PHE A CZ    1 
ATOM   1810 N  N     . LEU A 1 222 ? -25.413 -12.066 -4.162  1.00 16.01 ?  270 LEU A N     1 
ATOM   1811 C  CA    . LEU A 1 222 ? -24.411 -13.069 -4.534  1.00 15.69 ?  270 LEU A CA    1 
ATOM   1812 C  C     . LEU A 1 222 ? -23.202 -12.390 -5.136  1.00 15.16 ?  270 LEU A C     1 
ATOM   1813 O  O     . LEU A 1 222 ? -23.343 -11.321 -5.709  1.00 15.55 ?  270 LEU A O     1 
ATOM   1814 C  CB    . LEU A 1 222 ? -25.009 -14.005 -5.583  1.00 17.99 ?  270 LEU A CB    1 
ATOM   1815 C  CG    . LEU A 1 222 ? -26.265 -14.747 -5.211  1.00 20.99 ?  270 LEU A CG    1 
ATOM   1816 C  CD1   . LEU A 1 222 ? -27.057 -15.211 -6.461  1.00 22.69 ?  270 LEU A CD1   1 
ATOM   1817 C  CD2   . LEU A 1 222 ? -25.871 -15.878 -4.283  1.00 23.01 ?  270 LEU A CD2   1 
ATOM   1818 N  N     . PRO A 1 223 ? -22.013 -12.993 -4.997  1.00 15.36 ?  271 PRO A N     1 
ATOM   1819 C  CA    . PRO A 1 223 ? -20.845 -12.453 -5.682  1.00 15.65 ?  271 PRO A CA    1 
ATOM   1820 C  C     . PRO A 1 223 ? -21.015 -12.537 -7.213  1.00 16.43 ?  271 PRO A C     1 
ATOM   1821 O  O     . PRO A 1 223 ? -21.761 -13.391 -7.717  1.00 16.07 ?  271 PRO A O     1 
ATOM   1822 C  CB    . PRO A 1 223 ? -19.703 -13.350 -5.170  1.00 15.03 ?  271 PRO A CB    1 
ATOM   1823 C  CG    . PRO A 1 223 ? -20.366 -14.732 -4.964  1.00 16.29 ?  271 PRO A CG    1 
ATOM   1824 C  CD    . PRO A 1 223 ? -21.757 -14.307 -4.384  1.00 16.15 ?  271 PRO A CD    1 
ATOM   1825 N  N     . LEU A 1 224 ? -20.318 -11.676 -7.945  1.00 15.41 ?  272 LEU A N     1 
ATOM   1826 C  CA    . LEU A 1 224 ? -20.526 -11.630 -9.419  1.00 14.98 ?  272 LEU A CA    1 
ATOM   1827 C  C     . LEU A 1 224 ? -19.454 -12.405 -10.174 1.00 16.20 ?  272 LEU A C     1 
ATOM   1828 O  O     . LEU A 1 224 ? -18.278 -12.476 -9.755  1.00 16.76 ?  272 LEU A O     1 
ATOM   1829 C  CB    . LEU A 1 224 ? -20.544 -10.154 -9.891  1.00 15.34 ?  272 LEU A CB    1 
ATOM   1830 C  CG    . LEU A 1 224 ? -21.749 -9.332  -9.346  1.00 16.96 ?  272 LEU A CG    1 
ATOM   1831 C  CD1   . LEU A 1 224 ? -21.589 -7.881  -9.811  1.00 17.32 ?  272 LEU A CD1   1 
ATOM   1832 C  CD2   . LEU A 1 224 ? -23.071 -9.899  -9.846  1.00 17.65 ?  272 LEU A CD2   1 
ATOM   1833 N  N     . GLU A 1 225 ? -19.861 -12.958 -11.320 1.00 16.44 ?  273 GLU A N     1 
ATOM   1834 C  CA    . GLU A 1 225 ? -18.948 -13.678 -12.222 1.00 16.57 ?  273 GLU A CA    1 
ATOM   1835 C  C     . GLU A 1 225 ? -18.486 -12.747 -13.330 1.00 16.17 ?  273 GLU A C     1 
ATOM   1836 O  O     . GLU A 1 225 ? -19.048 -11.653 -13.544 1.00 15.38 ?  273 GLU A O     1 
ATOM   1837 C  CB    . GLU A 1 225 ? -19.630 -14.888 -12.888 1.00 17.26 ?  273 GLU A CB    1 
ATOM   1838 C  CG    . GLU A 1 225 ? -20.065 -15.970 -11.905 1.00 20.29 ?  273 GLU A CG    1 
ATOM   1839 C  CD    . GLU A 1 225 ? -20.764 -17.130 -12.608 1.00 24.53 ?  273 GLU A CD    1 
ATOM   1840 O  OE1   . GLU A 1 225 ? -21.768 -17.615 -12.063 1.00 27.10 ?  273 GLU A OE1   1 
ATOM   1841 O  OE2   . GLU A 1 225 ? -20.293 -17.553 -13.697 1.00 26.85 ?  273 GLU A OE2   1 
ATOM   1842 N  N     . TYR A 1 226 ? -17.469 -13.201 -14.062 1.00 15.31 ?  274 TYR A N     1 
ATOM   1843 C  CA    . TYR A 1 226 ? -16.951 -12.472 -15.213 1.00 16.18 ?  274 TYR A CA    1 
ATOM   1844 C  C     . TYR A 1 226 ? -18.053 -12.042 -16.204 1.00 15.79 ?  274 TYR A C     1 
ATOM   1845 O  O     . TYR A 1 226 ? -18.092 -10.866 -16.659 1.00 15.39 ?  274 TYR A O     1 
ATOM   1846 C  CB    . TYR A 1 226 ? -15.903 -13.361 -15.870 1.00 17.06 ?  274 TYR A CB    1 
ATOM   1847 C  CG    . TYR A 1 226 ? -15.209 -12.827 -17.091 1.00 17.41 ?  274 TYR A CG    1 
ATOM   1848 C  CD1   . TYR A 1 226 ? -14.248 -11.823 -17.011 1.00 18.46 ?  274 TYR A CD1   1 
ATOM   1849 C  CD2   . TYR A 1 226 ? -15.450 -13.407 -18.308 1.00 20.84 ?  274 TYR A CD2   1 
ATOM   1850 C  CE1   . TYR A 1 226 ? -13.558 -11.371 -18.129 1.00 19.40 ?  274 TYR A CE1   1 
ATOM   1851 C  CE2   . TYR A 1 226 ? -14.771 -12.981 -19.422 1.00 22.60 ?  274 TYR A CE2   1 
ATOM   1852 C  CZ    . TYR A 1 226 ? -13.841 -11.950 -19.325 1.00 22.11 ?  274 TYR A CZ    1 
ATOM   1853 O  OH    . TYR A 1 226 ? -13.162 -11.534 -20.466 1.00 25.58 ?  274 TYR A OH    1 
ATOM   1854 N  N     . LYS A 1 227 ? -18.979 -12.939 -16.513 1.00 16.05 ?  275 LYS A N     1 
ATOM   1855 C  CA    . LYS A 1 227 ? -20.032 -12.546 -17.460 1.00 15.31 ?  275 LYS A CA    1 
ATOM   1856 C  C     . LYS A 1 227 ? -20.867 -11.357 -16.952 1.00 15.53 ?  275 LYS A C     1 
ATOM   1857 O  O     . LYS A 1 227 ? -21.354 -10.546 -17.749 1.00 16.33 ?  275 LYS A O     1 
ATOM   1858 C  CB    . LYS A 1 227 ? -20.934 -13.755 -17.797 1.00 18.44 ?  275 LYS A CB    1 
ATOM   1859 C  CG    . LYS A 1 227 ? -21.702 -14.320 -16.601 1.00 21.41 ?  275 LYS A CG    1 
ATOM   1860 C  CD    . LYS A 1 227 ? -22.567 -15.519 -17.042 1.00 25.07 ?  275 LYS A CD    1 
ATOM   1861 C  CE    . LYS A 1 227 ? -23.252 -16.133 -15.877 1.00 29.55 ?  275 LYS A CE    1 
ATOM   1862 N  NZ    . LYS A 1 227 ? -23.644 -17.553 -16.177 1.00 32.45 ?  275 LYS A NZ    1 
ATOM   1863 N  N     . HIS A 1 228 ? -21.050 -11.244 -15.631 1.00 15.40 ?  276 HIS A N     1 
ATOM   1864 C  CA    . HIS A 1 228 ? -21.853 -10.144 -15.068 1.00 14.80 ?  276 HIS A CA    1 
ATOM   1865 C  C     . HIS A 1 228 ? -21.098 -8.844  -15.198 1.00 14.73 ?  276 HIS A C     1 
ATOM   1866 O  O     . HIS A 1 228 ? -21.679 -7.813  -15.505 1.00 15.31 ?  276 HIS A O     1 
ATOM   1867 C  CB    . HIS A 1 228 ? -22.229 -10.427 -13.611 1.00 14.90 ?  276 HIS A CB    1 
ATOM   1868 C  CG    . HIS A 1 228 ? -22.989 -11.699 -13.450 1.00 16.40 ?  276 HIS A CG    1 
ATOM   1869 N  ND1   . HIS A 1 228 ? -22.572 -12.708 -12.612 1.00 17.60 ?  276 HIS A ND1   1 
ATOM   1870 C  CD2   . HIS A 1 228 ? -24.135 -12.136 -14.040 1.00 17.52 ?  276 HIS A CD2   1 
ATOM   1871 C  CE1   . HIS A 1 228 ? -23.429 -13.715 -12.680 1.00 18.55 ?  276 HIS A CE1   1 
ATOM   1872 N  NE2   . HIS A 1 228 ? -24.392 -13.394 -13.534 1.00 19.04 ?  276 HIS A NE2   1 
ATOM   1873 N  N     . LEU A 1 229 ? -19.790 -8.884  -14.951 1.00 13.90 ?  277 LEU A N     1 
ATOM   1874 C  CA    . LEU A 1 229 ? -18.989 -7.670  -15.120 1.00 14.17 ?  277 LEU A CA    1 
ATOM   1875 C  C     . LEU A 1 229 ? -19.095 -7.167  -16.561 1.00 13.40 ?  277 LEU A C     1 
ATOM   1876 O  O     . LEU A 1 229 ? -19.214 -5.946  -16.769 1.00 14.86 ?  277 LEU A O     1 
ATOM   1877 C  CB    . LEU A 1 229 ? -17.511 -7.902  -14.777 1.00 15.88 ?  277 LEU A CB    1 
ATOM   1878 C  CG    . LEU A 1 229 ? -17.240 -8.271  -13.306 1.00 19.98 ?  277 LEU A CG    1 
ATOM   1879 C  CD1   . LEU A 1 229 ? -15.762 -8.107  -13.038 1.00 20.16 ?  277 LEU A CD1   1 
ATOM   1880 C  CD2   . LEU A 1 229 ? -18.132 -7.645  -12.326 1.00 23.15 ?  277 LEU A CD2   1 
ATOM   1881 N  N     . LYS A 1 230 ? -19.034 -8.066  -17.542 1.00 13.93 ?  278 LYS A N     1 
ATOM   1882 C  CA    . LYS A 1 230 ? -19.135 -7.611  -18.932 1.00 14.48 ?  278 LYS A CA    1 
ATOM   1883 C  C     . LYS A 1 230 ? -20.480 -6.921  -19.178 1.00 14.30 ?  278 LYS A C     1 
ATOM   1884 O  O     . LYS A 1 230 ? -20.541 -5.933  -19.902 1.00 15.89 ?  278 LYS A O     1 
ATOM   1885 C  CB    . LYS A 1 230 ? -18.963 -8.804  -19.884 1.00 15.95 ?  278 LYS A CB    1 
ATOM   1886 C  CG    . LYS A 1 230 ? -17.519 -9.395  -19.842 1.00 17.85 ?  278 LYS A CG    1 
ATOM   1887 C  CD    . LYS A 1 230 ? -17.256 -10.245 -21.091 1.00 23.66 ?  278 LYS A CD    1 
ATOM   1888 C  CE    . LYS A 1 230 ? -17.878 -11.577 -20.866 1.00 28.64 ?  278 LYS A CE    1 
ATOM   1889 N  NZ    . LYS A 1 230 ? -17.492 -12.551 -21.962 1.00 32.32 ?  278 LYS A NZ    1 
ATOM   1890 N  N     . MET A 1 231 ? -21.559 -7.457  -18.602 1.00 14.66 ?  279 MET A N     1 
ATOM   1891 C  CA    . MET A 1 231 ? -22.849 -6.788  -18.791 1.00 14.80 ?  279 MET A CA    1 
ATOM   1892 C  C     . MET A 1 231 ? -22.830 -5.357  -18.251 1.00 15.15 ?  279 MET A C     1 
ATOM   1893 O  O     . MET A 1 231 ? -23.320 -4.400  -18.890 1.00 15.81 ?  279 MET A O     1 
ATOM   1894 C  CB    . MET A 1 231 ? -23.960 -7.566  -18.081 1.00 15.57 ?  279 MET A CB    1 
ATOM   1895 C  CG    . MET A 1 231 ? -24.113 -9.000  -18.647 1.00 18.18 ?  279 MET A CG    1 
ATOM   1896 S  SD    . MET A 1 231 ? -25.215 -9.970  -17.545 1.00 22.49 ?  279 MET A SD    1 
ATOM   1897 C  CE    . MET A 1 231 ? -26.775 -9.554  -18.316 1.00 26.81 ?  279 MET A CE    1 
ATOM   1898 N  N     . CYS A 1 232 ? -22.227 -5.199  -17.069 1.00 14.68 ?  280 CYS A N     1 
ATOM   1899 C  CA    . CYS A 1 232 ? -22.137 -3.857  -16.516 1.00 16.28 ?  280 CYS A CA    1 
ATOM   1900 C  C     . CYS A 1 232 ? -21.235 -2.871  -17.293 1.00 15.38 ?  280 CYS A C     1 
ATOM   1901 O  O     . CYS A 1 232 ? -21.551 -1.689  -17.440 1.00 15.85 ?  280 CYS A O     1 
ATOM   1902 C  CB    . CYS A 1 232 ? -21.591 -3.953  -15.078 1.00 16.57 ?  280 CYS A CB    1 
ATOM   1903 S  SG    . CYS A 1 232 ? -22.577 -4.874  -13.879 1.00 20.94 ?  280 CYS A SG    1 
ATOM   1904 N  N     . ILE A 1 233 ? -20.112 -3.362  -17.771 1.00 14.08 ?  281 ILE A N     1 
ATOM   1905 C  CA    . ILE A 1 233 ? -19.190 -2.522  -18.526 1.00 14.36 ?  281 ILE A CA    1 
ATOM   1906 C  C     . ILE A 1 233 ? -19.892 -1.998  -19.794 1.00 14.88 ?  281 ILE A C     1 
ATOM   1907 O  O     . ILE A 1 233 ? -19.706 -0.851  -20.179 1.00 15.62 ?  281 ILE A O     1 
ATOM   1908 C  CB    . ILE A 1 233 ? -17.953 -3.309  -18.866 1.00 13.78 ?  281 ILE A CB    1 
ATOM   1909 C  CG1   . ILE A 1 233 ? -17.127 -3.599  -17.596 1.00 14.20 ?  281 ILE A CG1   1 
ATOM   1910 C  CG2   . ILE A 1 233 ? -17.036 -2.541  -19.852 1.00 15.62 ?  281 ILE A CG2   1 
ATOM   1911 C  CD1   . ILE A 1 233 ? -16.177 -4.807  -17.759 1.00 15.37 ?  281 ILE A CD1   1 
ATOM   1912 N  N     . ARG A 1 234 ? -20.672 -2.855  -20.467 1.00 14.63 ?  282 ARG A N     1 
ATOM   1913 C  CA    . ARG A 1 234 ? -21.366 -2.391  -21.669 1.00 15.23 ?  282 ARG A CA    1 
ATOM   1914 C  C     . ARG A 1 234 ? -22.313 -1.224  -21.352 1.00 15.28 ?  282 ARG A C     1 
ATOM   1915 O  O     . ARG A 1 234 ? -22.420 -0.244  -22.101 1.00 16.53 ?  282 ARG A O     1 
ATOM   1916 C  CB    . ARG A 1 234 ? -22.135 -3.558  -22.285 1.00 14.21 ?  282 ARG A CB    1 
ATOM   1917 C  CG    . ARG A 1 234 ? -21.248 -4.647  -22.908 1.00 15.54 ?  282 ARG A CG    1 
ATOM   1918 C  CD    . ARG A 1 234 ? -22.053 -5.944  -23.127 1.00 16.18 ?  282 ARG A CD    1 
ATOM   1919 N  NE    . ARG A 1 234 ? -21.154 -7.003  -23.594 1.00 16.15 ?  282 ARG A NE    1 
ATOM   1920 C  CZ    . ARG A 1 234 ? -21.151 -8.258  -23.169 1.00 16.84 ?  282 ARG A CZ    1 
ATOM   1921 N  NH1   . ARG A 1 234 ? -22.095 -8.695  -22.308 1.00 16.09 ?  282 ARG A NH1   1 
ATOM   1922 N  NH2   . ARG A 1 234 ? -20.206 -9.091  -23.600 1.00 17.75 ?  282 ARG A NH2   1 
ATOM   1923 N  N     . VAL A 1 235 ? -23.036 -1.334  -20.239 1.00 15.04 ?  283 VAL A N     1 
ATOM   1924 C  CA    . VAL A 1 235 ? -23.919 -0.260  -19.824 1.00 16.30 ?  283 VAL A CA    1 
ATOM   1925 C  C     . VAL A 1 235 ? -23.141 1.007   -19.533 1.00 16.28 ?  283 VAL A C     1 
ATOM   1926 O  O     . VAL A 1 235 ? -23.553 2.097   -19.974 1.00 17.35 ?  283 VAL A O     1 
ATOM   1927 C  CB    . VAL A 1 235 ? -24.710 -0.699  -18.586 1.00 17.29 ?  283 VAL A CB    1 
ATOM   1928 C  CG1   . VAL A 1 235 ? -25.478 0.470   -17.905 1.00 18.32 ?  283 VAL A CG1   1 
ATOM   1929 C  CG2   . VAL A 1 235 ? -25.640 -1.827  -18.963 1.00 17.45 ?  283 VAL A CG2   1 
ATOM   1930 N  N     . GLU A 1 236 ? -21.992 0.889   -18.823 1.00 15.56 ?  284 GLU A N     1 
ATOM   1931 C  CA    . GLU A 1 236 ? -21.244 2.090   -18.538 1.00 16.06 ?  284 GLU A CA    1 
ATOM   1932 C  C     . GLU A 1 236 ? -20.680 2.721   -19.851 1.00 15.39 ?  284 GLU A C     1 
ATOM   1933 O  O     . GLU A 1 236 ? -20.659 3.953   -19.988 1.00 16.35 ?  284 GLU A O     1 
ATOM   1934 C  CB    . GLU A 1 236 ? -20.092 1.793   -17.572 1.00 16.82 ?  284 GLU A CB    1 
ATOM   1935 C  CG    . GLU A 1 236 ? -19.175 2.980   -17.267 1.00 18.68 ?  284 GLU A CG    1 
ATOM   1936 C  CD    . GLU A 1 236 ? -19.856 4.050   -16.440 1.00 22.31 ?  284 GLU A CD    1 
ATOM   1937 O  OE1   . GLU A 1 236 ? -20.947 3.834   -15.887 1.00 22.65 ?  284 GLU A OE1   1 
ATOM   1938 O  OE2   . GLU A 1 236 ? -19.278 5.132   -16.314 1.00 25.39 ?  284 GLU A OE2   1 
ATOM   1939 N  N     . MET A 1 237 ? -20.191 1.893   -20.783 1.00 15.96 ?  285 MET A N     1 
ATOM   1940 C  CA    . MET A 1 237 ? -19.709 2.440   -22.052 1.00 15.56 ?  285 MET A CA    1 
ATOM   1941 C  C     . MET A 1 237 ? -20.823 3.285   -22.732 1.00 17.29 ?  285 MET A C     1 
ATOM   1942 O  O     . MET A 1 237 ? -20.567 4.395   -23.212 1.00 18.03 ?  285 MET A O     1 
ATOM   1943 C  CB    . MET A 1 237 ? -19.292 1.301   -23.006 1.00 16.08 ?  285 MET A CB    1 
ATOM   1944 C  CG    . MET A 1 237 ? -17.931 0.657   -22.539 1.00 16.66 ?  285 MET A CG    1 
ATOM   1945 S  SD    . MET A 1 237 ? -17.661 -0.785  -23.589 1.00 17.21 ?  285 MET A SD    1 
ATOM   1946 C  CE    . MET A 1 237 ? -15.894 -1.129  -23.252 1.00 17.08 ?  285 MET A CE    1 
ATOM   1947 N  N     . GLN A 1 238 ? -22.037 2.735   -22.811 1.00 17.88 ?  286 GLN A N     1 
ATOM   1948 C  CA    . GLN A 1 238 ? -23.121 3.458   -23.461 1.00 20.09 ?  286 GLN A CA    1 
ATOM   1949 C  C     . GLN A 1 238 ? -23.433 4.760   -22.721 1.00 20.25 ?  286 GLN A C     1 
ATOM   1950 O  O     . GLN A 1 238 ? -23.689 5.813   -23.345 1.00 22.66 ?  286 GLN A O     1 
ATOM   1951 C  CB    . GLN A 1 238 ? -24.341 2.559   -23.547 1.00 22.92 ?  286 GLN A CB    1 
ATOM   1952 C  CG    . GLN A 1 238 ? -24.077 1.318   -24.326 1.00 28.39 ?  286 GLN A CG    1 
ATOM   1953 C  CD    . GLN A 1 238 ? -25.231 0.309   -24.312 1.00 33.15 ?  286 GLN A CD    1 
ATOM   1954 O  OE1   . GLN A 1 238 ? -25.484 -0.404  -23.293 1.00 35.25 ?  286 GLN A OE1   1 
ATOM   1955 N  NE2   . GLN A 1 238 ? -25.894 0.191   -25.460 1.00 33.88 ?  286 GLN A NE2   1 
ATOM   1956 N  N     . SER A 1 239 ? -23.400 4.707   -21.392 1.00 19.65 ?  287 SER A N     1 
ATOM   1957 C  CA    . SER A 1 239 ? -23.756 5.893   -20.654 1.00 22.28 ?  287 SER A CA    1 
ATOM   1958 C  C     . SER A 1 239 ? -22.722 7.012   -20.876 1.00 22.60 ?  287 SER A C     1 
ATOM   1959 O  O     . SER A 1 239 ? -23.046 8.198   -20.762 1.00 24.73 ?  287 SER A O     1 
ATOM   1960 C  CB    . SER A 1 239 ? -23.902 5.559   -19.180 1.00 26.44 ?  287 SER A CB    1 
ATOM   1961 O  OG    . SER A 1 239 ? -22.634 5.331   -18.606 1.00 31.41 ?  287 SER A OG    1 
ATOM   1962 N  N     . ARG A 1 240 ? -21.480 6.637   -21.173 1.00 22.14 ?  288 ARG A N     1 
ATOM   1963 C  CA    . ARG A 1 240 ? -20.434 7.624   -21.442 1.00 23.22 ?  288 ARG A CA    1 
ATOM   1964 C  C     . ARG A 1 240 ? -20.417 8.089   -22.886 1.00 24.95 ?  288 ARG A C     1 
ATOM   1965 O  O     . ARG A 1 240 ? -19.641 8.993   -23.229 1.00 27.49 ?  288 ARG A O     1 
ATOM   1966 C  CB    . ARG A 1 240 ? -19.057 7.051   -21.104 1.00 23.36 ?  288 ARG A CB    1 
ATOM   1967 C  CG    . ARG A 1 240 ? -18.890 6.771   -19.610 1.00 23.42 ?  288 ARG A CG    1 
ATOM   1968 C  CD    . ARG A 1 240 ? -17.468 6.301   -19.393 1.00 23.92 ?  288 ARG A CD    1 
ATOM   1969 N  NE    . ARG A 1 240 ? -17.204 5.980   -17.999 1.00 24.59 ?  288 ARG A NE    1 
ATOM   1970 C  CZ    . ARG A 1 240 ? -15.985 5.963   -17.446 1.00 23.74 ?  288 ARG A CZ    1 
ATOM   1971 N  NH1   . ARG A 1 240 ? -14.910 6.236   -18.177 1.00 23.76 ?  288 ARG A NH1   1 
ATOM   1972 N  NH2   . ARG A 1 240 ? -15.844 5.654   -16.171 1.00 25.61 ?  288 ARG A NH2   1 
ATOM   1973 N  N     . GLY A 1 241 ? -21.234 7.475   -23.739 1.00 24.78 ?  289 GLY A N     1 
ATOM   1974 C  CA    . GLY A 1 241 ? -21.282 7.834   -25.151 1.00 24.59 ?  289 GLY A CA    1 
ATOM   1975 C  C     . GLY A 1 241 ? -20.188 7.157   -25.970 1.00 24.55 ?  289 GLY A C     1 
ATOM   1976 O  O     . GLY A 1 241 ? -19.960 7.513   -27.129 1.00 26.78 ?  289 GLY A O     1 
ATOM   1977 N  N     . TYR A 1 242 ? -19.525 6.152   -25.395 1.00 22.25 ?  290 TYR A N     1 
ATOM   1978 C  CA    . TYR A 1 242 ? -18.527 5.419   -26.158 1.00 21.20 ?  290 TYR A CA    1 
ATOM   1979 C  C     . TYR A 1 242 ? -19.156 4.454   -27.156 1.00 21.99 ?  290 TYR A C     1 
ATOM   1980 O  O     . TYR A 1 242 ? -20.230 3.937   -26.907 1.00 23.83 ?  290 TYR A O     1 
ATOM   1981 C  CB    . TYR A 1 242 ? -17.639 4.592   -25.261 1.00 20.59 ?  290 TYR A CB    1 
ATOM   1982 C  CG    . TYR A 1 242 ? -16.854 5.284   -24.182 1.00 22.00 ?  290 TYR A CG    1 
ATOM   1983 C  CD1   . TYR A 1 242 ? -16.376 4.540   -23.122 1.00 22.02 ?  290 TYR A CD1   1 
ATOM   1984 C  CD2   . TYR A 1 242 ? -16.531 6.628   -24.241 1.00 23.99 ?  290 TYR A CD2   1 
ATOM   1985 C  CE1   . TYR A 1 242 ? -15.595 5.119   -22.107 1.00 23.90 ?  290 TYR A CE1   1 
ATOM   1986 C  CE2   . TYR A 1 242 ? -15.771 7.224   -23.204 1.00 25.32 ?  290 TYR A CE2   1 
ATOM   1987 C  CZ    . TYR A 1 242 ? -15.321 6.453   -22.155 1.00 25.41 ?  290 TYR A CZ    1 
ATOM   1988 O  OH    . TYR A 1 242 ? -14.553 6.997   -21.140 1.00 27.37 ?  290 TYR A OH    1 
ATOM   1989 N  N     . GLU A 1 243 ? -18.474 4.180   -28.260 1.00 22.52 ?  291 GLU A N     1 
ATOM   1990 C  CA    . GLU A 1 243 ? -18.790 3.004   -29.088 1.00 23.59 ?  291 GLU A CA    1 
ATOM   1991 C  C     . GLU A 1 243 ? -18.270 1.754   -28.404 1.00 20.89 ?  291 GLU A C     1 
ATOM   1992 O  O     . GLU A 1 243 ? -17.054 1.679   -28.079 1.00 21.97 ?  291 GLU A O     1 
ATOM   1993 C  CB    . GLU A 1 243 ? -18.169 3.136   -30.499 1.00 29.13 ?  291 GLU A CB    1 
ATOM   1994 C  CG    . GLU A 1 243 ? -18.866 4.155   -31.269 1.00 35.40 ?  291 GLU A CG    1 
ATOM   1995 C  CD    . GLU A 1 243 ? -20.325 3.741   -31.513 1.00 41.10 ?  291 GLU A CD    1 
ATOM   1996 O  OE1   . GLU A 1 243 ? -20.580 2.607   -32.040 1.00 43.83 ?  291 GLU A OE1   1 
ATOM   1997 O  OE2   . GLU A 1 243 ? -21.216 4.534   -31.142 1.00 43.16 ?  291 GLU A OE2   1 
ATOM   1998 N  N     . ILE A 1 244 ? -19.155 0.797   -28.109 1.00 18.83 ?  292 ILE A N     1 
ATOM   1999 C  CA    . ILE A 1 244 ? -18.723 -0.429  -27.422 1.00 18.04 ?  292 ILE A CA    1 
ATOM   2000 C  C     . ILE A 1 244 ? -17.690 -1.191  -28.243 1.00 17.20 ?  292 ILE A C     1 
ATOM   2001 O  O     . ILE A 1 244 ? -17.803 -1.330  -29.464 1.00 18.57 ?  292 ILE A O     1 
ATOM   2002 C  CB    . ILE A 1 244 ? -19.938 -1.343  -27.108 1.00 18.76 ?  292 ILE A CB    1 
ATOM   2003 C  CG1   . ILE A 1 244 ? -20.775 -0.678  -26.000 1.00 20.36 ?  292 ILE A CG1   1 
ATOM   2004 C  CG2   . ILE A 1 244 ? -19.488 -2.760  -26.715 1.00 19.08 ?  292 ILE A CG2   1 
ATOM   2005 C  CD1   . ILE A 1 244 ? -22.033 -1.430  -25.706 1.00 20.82 ?  292 ILE A CD1   1 
ATOM   2006 N  N     . ASP A 1 245 ? -16.663 -1.640  -27.554 1.00 17.14 ?  293 ASP A N     1 
ATOM   2007 C  CA    . ASP A 1 245 ? -15.581 -2.402  -28.127 1.00 15.51 ?  293 ASP A CA    1 
ATOM   2008 C  C     . ASP A 1 245 ? -15.506 -3.664  -27.246 1.00 15.84 ?  293 ASP A C     1 
ATOM   2009 O  O     . ASP A 1 245 ? -15.096 -3.551  -26.085 1.00 15.74 ?  293 ASP A O     1 
ATOM   2010 C  CB    . ASP A 1 245 ? -14.304 -1.560  -28.144 1.00 16.91 ?  293 ASP A CB    1 
ATOM   2011 C  CG    . ASP A 1 245 ? -13.089 -2.316  -28.634 1.00 18.26 ?  293 ASP A CG    1 
ATOM   2012 O  OD1   . ASP A 1 245 ? -13.030 -3.543  -28.421 1.00 19.04 ?  293 ASP A OD1   1 
ATOM   2013 O  OD2   . ASP A 1 245 ? -12.168 -1.682  -29.225 1.00 19.52 ?  293 ASP A OD2   1 
ATOM   2014 N  N     . GLU A 1 246 ? -15.939 -4.816  -27.763 1.00 14.45 ?  294 GLU A N     1 
ATOM   2015 C  CA    . GLU A 1 246 ? -15.997 -6.051  -26.975 1.00 14.96 ?  294 GLU A CA    1 
ATOM   2016 C  C     . GLU A 1 246 ? -14.626 -6.535  -26.600 1.00 14.18 ?  294 GLU A C     1 
ATOM   2017 O  O     . GLU A 1 246 ? -14.488 -7.244  -25.606 1.00 15.65 ?  294 GLU A O     1 
ATOM   2018 C  CB    . GLU A 1 246 ? -16.790 -7.172  -27.688 1.00 15.92 ?  294 GLU A CB    1 
ATOM   2019 C  CG    . GLU A 1 246 ? -18.308 -6.913  -27.638 1.00 17.74 ?  294 GLU A CG    1 
ATOM   2020 C  CD    . GLU A 1 246 ? -18.834 -6.965  -26.195 1.00 19.17 ?  294 GLU A CD    1 
ATOM   2021 O  OE1   . GLU A 1 246 ? -18.293 -7.722  -25.352 1.00 18.86 ?  294 GLU A OE1   1 
ATOM   2022 O  OE2   . GLU A 1 246 ? -19.789 -6.229  -25.910 1.00 20.73 ?  294 GLU A OE2   1 
ATOM   2023 N  N     . ASP A 1 247 ? -13.575 -6.155  -27.344 1.00 13.96 ?  295 ASP A N     1 
ATOM   2024 C  CA    . ASP A 1 247 ? -12.233 -6.514  -26.878 1.00 15.56 ?  295 ASP A CA    1 
ATOM   2025 C  C     . ASP A 1 247 ? -11.887 -5.742  -25.612 1.00 15.68 ?  295 ASP A C     1 
ATOM   2026 O  O     . ASP A 1 247 ? -11.287 -6.322  -24.660 1.00 17.33 ?  295 ASP A O     1 
ATOM   2027 C  CB    . ASP A 1 247 ? -11.205 -6.257  -27.984 1.00 17.77 ?  295 ASP A CB    1 
ATOM   2028 C  CG    . ASP A 1 247 ? -9.912  -6.982  -27.720 1.00 20.35 ?  295 ASP A CG    1 
ATOM   2029 O  OD1   . ASP A 1 247 ? -9.939  -8.232  -27.757 1.00 22.67 ?  295 ASP A OD1   1 
ATOM   2030 O  OD2   . ASP A 1 247 ? -8.890  -6.312  -27.483 1.00 21.51 ?  295 ASP A OD2   1 
ATOM   2031 N  N     . ILE A 1 248 ? -12.258 -4.458  -25.568 1.00 15.23 ?  296 ILE A N     1 
ATOM   2032 C  CA    . ILE A 1 248 ? -12.054 -3.679  -24.331 1.00 15.43 ?  296 ILE A CA    1 
ATOM   2033 C  C     . ILE A 1 248 ? -12.979 -4.202  -23.217 1.00 15.02 ?  296 ILE A C     1 
ATOM   2034 O  O     . ILE A 1 248 ? -12.542 -4.270  -22.053 1.00 15.43 ?  296 ILE A O     1 
ATOM   2035 C  CB    . ILE A 1 248 ? -12.243 -2.151  -24.588 1.00 16.36 ?  296 ILE A CB    1 
ATOM   2036 C  CG1   . ILE A 1 248 ? -11.163 -1.656  -25.547 1.00 17.36 ?  296 ILE A CG1   1 
ATOM   2037 C  CG2   . ILE A 1 248 ? -12.184 -1.360  -23.246 1.00 17.01 ?  296 ILE A CG2   1 
ATOM   2038 C  CD1   . ILE A 1 248 ? -11.405 -0.245  -26.050 1.00 19.01 ?  296 ILE A CD1   1 
ATOM   2039 N  N     . VAL A 1 249 ? -14.228 -4.575  -23.533 1.00 14.65 ?  297 VAL A N     1 
ATOM   2040 C  CA    . VAL A 1 249 ? -15.089 -5.151  -22.488 1.00 14.06 ?  297 VAL A CA    1 
ATOM   2041 C  C     . VAL A 1 249 ? -14.378 -6.340  -21.834 1.00 14.68 ?  297 VAL A C     1 
ATOM   2042 O  O     . VAL A 1 249 ? -14.302 -6.443  -20.588 1.00 15.39 ?  297 VAL A O     1 
ATOM   2043 C  CB    . VAL A 1 249 ? -16.453 -5.597  -23.091 1.00 14.79 ?  297 VAL A CB    1 
ATOM   2044 C  CG1   . VAL A 1 249 ? -17.257 -6.377  -22.063 1.00 14.93 ?  297 VAL A CG1   1 
ATOM   2045 C  CG2   . VAL A 1 249 ? -17.252 -4.376  -23.605 1.00 15.19 ?  297 VAL A CG2   1 
ATOM   2046 N  N     . SER A 1 250 ? -13.902 -7.280  -22.640 1.00 15.20 ?  298 SER A N     1 
ATOM   2047 C  CA    . SER A 1 250 ? -13.249 -8.491  -22.088 1.00 17.60 ?  298 SER A CA    1 
ATOM   2048 C  C     . SER A 1 250 ? -12.020 -8.153  -21.266 1.00 17.41 ?  298 SER A C     1 
ATOM   2049 O  O     . SER A 1 250 ? -11.805 -8.737  -20.198 1.00 19.86 ?  298 SER A O     1 
ATOM   2050 C  CB    . SER A 1 250 ? -12.868 -9.472  -23.209 1.00 20.69 ?  298 SER A CB    1 
ATOM   2051 O  OG    . SER A 1 250 ? -14.059 -10.021 -23.751 1.00 23.79 ?  298 SER A OG    1 
ATOM   2052 N  N     . ARG A 1 251 ? -11.218 -7.193  -21.735 1.00 17.59 ?  299 ARG A N     1 
ATOM   2053 C  CA    . ARG A 1 251 ? -9.979  -6.857  -21.004 1.00 17.62 ?  299 ARG A CA    1 
ATOM   2054 C  C     . ARG A 1 251 ? -10.289 -6.122  -19.712 1.00 17.52 ?  299 ARG A C     1 
ATOM   2055 O  O     . ARG A 1 251 ? -9.688  -6.412  -18.671 1.00 19.18 ?  299 ARG A O     1 
ATOM   2056 C  CB    . ARG A 1 251 ? -9.078  -6.006  -21.893 1.00 18.96 ?  299 ARG A CB    1 
ATOM   2057 C  CG    . ARG A 1 251 ? -8.506  -6.822  -23.036 1.00 22.75 ?  299 ARG A CG    1 
ATOM   2058 C  CD    . ARG A 1 251 ? -7.790  -5.935  -24.020 1.00 25.02 ?  299 ARG A CD    1 
ATOM   2059 N  NE    . ARG A 1 251 ? -7.251  -6.734  -25.105 1.00 27.37 ?  299 ARG A NE    1 
ATOM   2060 C  CZ    . ARG A 1 251 ? -6.023  -7.218  -25.138 1.00 30.48 ?  299 ARG A CZ    1 
ATOM   2061 N  NH1   . ARG A 1 251 ? -5.187  -6.971  -24.127 1.00 31.83 ?  299 ARG A NH1   1 
ATOM   2062 N  NH2   . ARG A 1 251 ? -5.637  -7.940  -26.186 1.00 32.08 ?  299 ARG A NH2   1 
ATOM   2063 N  N     . VAL A 1 252 ? -11.243 -5.198  -19.751 1.00 16.54 ?  300 VAL A N     1 
ATOM   2064 C  CA    . VAL A 1 252 ? -11.595 -4.440  -18.520 1.00 15.29 ?  300 VAL A CA    1 
ATOM   2065 C  C     . VAL A 1 252 ? -12.167 -5.400  -17.495 1.00 14.91 ?  300 VAL A C     1 
ATOM   2066 O  O     . VAL A 1 252 ? -11.878 -5.256  -16.279 1.00 17.13 ?  300 VAL A O     1 
ATOM   2067 C  CB    . VAL A 1 252 ? -12.558 -3.246  -18.862 1.00 15.13 ?  300 VAL A CB    1 
ATOM   2068 C  CG1   . VAL A 1 252 ? -13.207 -2.671  -17.630 1.00 15.81 ?  300 VAL A CG1   1 
ATOM   2069 C  CG2   . VAL A 1 252 ? -11.767 -2.180  -19.550 1.00 16.71 ?  300 VAL A CG2   1 
ATOM   2070 N  N     . ALA A 1 253 ? -12.927 -6.406  -17.940 1.00 14.50 ?  301 ALA A N     1 
ATOM   2071 C  CA    . ALA A 1 253 ? -13.524 -7.374  -16.993 1.00 15.26 ?  301 ALA A CA    1 
ATOM   2072 C  C     . ALA A 1 253 ? -12.523 -8.346  -16.376 1.00 15.19 ?  301 ALA A C     1 
ATOM   2073 O  O     . ALA A 1 253 ? -12.896 -9.060  -15.438 1.00 16.58 ?  301 ALA A O     1 
ATOM   2074 C  CB    . ALA A 1 253 ? -14.651 -8.151  -17.701 1.00 15.93 ?  301 ALA A CB    1 
ATOM   2075 N  N     . GLU A 1 254 ? -11.279 -8.377  -16.866 1.00 16.26 ?  302 GLU A N     1 
ATOM   2076 C  CA    . GLU A 1 254 ? -10.226 -9.173  -16.211 1.00 17.38 ?  302 GLU A CA    1 
ATOM   2077 C  C     . GLU A 1 254 ? -9.709  -8.500  -14.954 1.00 17.08 ?  302 GLU A C     1 
ATOM   2078 O  O     . GLU A 1 254 ? -8.573  -7.975  -14.864 1.00 18.96 ?  302 GLU A O     1 
ATOM   2079 C  CB    . GLU A 1 254 ? -9.066  -9.453  -17.181 1.00 20.39 ?  302 GLU A CB    1 
ATOM   2080 C  CG    . GLU A 1 254 ? -9.482  -10.297 -18.373 1.00 24.75 ?  302 GLU A CG    1 
ATOM   2081 C  CD    . GLU A 1 254 ? -9.671  -11.757 -18.036 1.00 30.94 ?  302 GLU A CD    1 
ATOM   2082 O  OE1   . GLU A 1 254 ? -9.367  -12.172 -16.871 1.00 33.38 ?  302 GLU A OE1   1 
ATOM   2083 O  OE2   . GLU A 1 254 ? -10.119 -12.495 -18.967 1.00 33.86 ?  302 GLU A OE2   1 
ATOM   2084 N  N     . MET A 1 255 ? -10.546 -8.585  -13.926 1.00 16.04 ?  303 MET A N     1 
ATOM   2085 C  CA    . MET A 1 255 ? -10.240 -8.143  -12.572 1.00 15.07 ?  303 MET A CA    1 
ATOM   2086 C  C     . MET A 1 255 ? -9.479  -9.234  -11.833 1.00 15.13 ?  303 MET A C     1 
ATOM   2087 O  O     . MET A 1 255 ? -9.070  -10.245 -12.423 1.00 16.93 ?  303 MET A O     1 
ATOM   2088 C  CB    . MET A 1 255 ? -11.561 -7.823  -11.830 1.00 16.41 ?  303 MET A CB    1 
ATOM   2089 C  CG    . MET A 1 255 ? -12.429 -6.792  -12.576 1.00 16.79 ?  303 MET A CG    1 
ATOM   2090 S  SD    . MET A 1 255 ? -11.670 -5.188  -12.878 1.00 17.10 ?  303 MET A SD    1 
ATOM   2091 C  CE    . MET A 1 255 ? -11.598 -4.497  -11.256 1.00 17.06 ?  303 MET A CE    1 
ATOM   2092 N  N     . THR A 1 256 ? -9.310  -9.052  -10.524 1.00 14.54 ?  304 THR A N     1 
ATOM   2093 C  CA    . THR A 1 256 ? -8.793  -10.147 -9.726  1.00 14.97 ?  304 THR A CA    1 
ATOM   2094 C  C     . THR A 1 256 ? -9.977  -11.006 -9.192  1.00 15.06 ?  304 THR A C     1 
ATOM   2095 O  O     . THR A 1 256 ? -10.977 -10.471 -8.675  1.00 16.04 ?  304 THR A O     1 
ATOM   2096 C  CB    . THR A 1 256 ? -7.914  -9.641  -8.552  1.00 16.40 ?  304 THR A CB    1 
ATOM   2097 O  OG1   . THR A 1 256 ? -8.681  -8.749  -7.727  1.00 17.70 ?  304 THR A OG1   1 
ATOM   2098 C  CG2   . THR A 1 256 ? -6.703  -8.901  -9.091  1.00 18.11 ?  304 THR A CG2   1 
ATOM   2099 N  N     . PHE A 1 257 ? -9.890  -12.322 -9.408  1.00 15.81 ?  305 PHE A N     1 
ATOM   2100 C  CA    . PHE A 1 257 ? -10.941 -13.275 -9.081  1.00 15.95 ?  305 PHE A CA    1 
ATOM   2101 C  C     . PHE A 1 257 ? -10.502 -14.262 -7.987  1.00 17.11 ?  305 PHE A C     1 
ATOM   2102 O  O     . PHE A 1 257 ? -9.300  -14.520 -7.778  1.00 18.03 ?  305 PHE A O     1 
ATOM   2103 C  CB    . PHE A 1 257 ? -11.364 -14.074 -10.321 1.00 15.89 ?  305 PHE A CB    1 
ATOM   2104 C  CG    . PHE A 1 257 ? -12.148 -13.264 -11.326 1.00 16.47 ?  305 PHE A CG    1 
ATOM   2105 C  CD1   . PHE A 1 257 ? -13.537 -13.324 -11.365 1.00 17.11 ?  305 PHE A CD1   1 
ATOM   2106 C  CD2   . PHE A 1 257 ? -11.489 -12.396 -12.176 1.00 17.83 ?  305 PHE A CD2   1 
ATOM   2107 C  CE1   . PHE A 1 257 ? -14.280 -12.539 -12.255 1.00 17.78 ?  305 PHE A CE1   1 
ATOM   2108 C  CE2   . PHE A 1 257 ? -12.179 -11.629 -13.094 1.00 19.44 ?  305 PHE A CE2   1 
ATOM   2109 C  CZ    . PHE A 1 257 ? -13.581 -11.679 -13.129 1.00 17.52 ?  305 PHE A CZ    1 
ATOM   2110 N  N     . PHE A 1 258 ? -11.478 -14.898 -7.364  1.00 17.19 ?  306 PHE A N     1 
ATOM   2111 C  CA    . PHE A 1 258 ? -11.210 -15.893 -6.311  1.00 18.24 ?  306 PHE A CA    1 
ATOM   2112 C  C     . PHE A 1 258 ? -12.189 -17.039 -6.453  1.00 19.27 ?  306 PHE A C     1 
ATOM   2113 O  O     . PHE A 1 258 ? -13.205 -16.881 -7.171  1.00 18.94 ?  306 PHE A O     1 
ATOM   2114 C  CB    . PHE A 1 258 ? -11.317 -15.239 -4.911  1.00 19.42 ?  306 PHE A CB    1 
ATOM   2115 C  CG    . PHE A 1 258 ? -12.723 -14.894 -4.507  1.00 19.92 ?  306 PHE A CG    1 
ATOM   2116 C  CD1   . PHE A 1 258 ? -13.250 -13.641 -4.780  1.00 19.58 ?  306 PHE A CD1   1 
ATOM   2117 C  CD2   . PHE A 1 258 ? -13.517 -15.846 -3.871  1.00 21.45 ?  306 PHE A CD2   1 
ATOM   2118 C  CE1   . PHE A 1 258 ? -14.556 -13.309 -4.413  1.00 20.10 ?  306 PHE A CE1   1 
ATOM   2119 C  CE2   . PHE A 1 258 ? -14.817 -15.537 -3.499  1.00 21.18 ?  306 PHE A CE2   1 
ATOM   2120 C  CZ    . PHE A 1 258 ? -15.337 -14.244 -3.778  1.00 20.05 ?  306 PHE A CZ    1 
ATOM   2121 N  N     . PRO A 1 259 ? -11.934 -18.188 -5.788  1.00 21.74 ?  307 PRO A N     1 
ATOM   2122 C  CA    . PRO A 1 259 ? -10.701 -18.630 -5.126  1.00 23.25 ?  307 PRO A CA    1 
ATOM   2123 C  C     . PRO A 1 259 ? -9.532  -18.792 -6.082  1.00 24.57 ?  307 PRO A C     1 
ATOM   2124 O  O     . PRO A 1 259 ? -9.731  -18.644 -7.311  1.00 24.65 ?  307 PRO A O     1 
ATOM   2125 C  CB    . PRO A 1 259 ? -11.070 -20.005 -4.538  1.00 24.51 ?  307 PRO A CB    1 
ATOM   2126 C  CG    . PRO A 1 259 ? -12.564 -20.031 -4.498  1.00 24.66 ?  307 PRO A CG    1 
ATOM   2127 C  CD    . PRO A 1 259 ? -12.988 -19.222 -5.699  1.00 23.14 ?  307 PRO A CD    1 
ATOM   2128 N  N     . LYS A 1 260 ? -8.347  -19.124 -5.542  1.00 27.99 ?  308 LYS A N     1 
ATOM   2129 C  CA    . LYS A 1 260 ? -7.179  -19.235 -6.409  1.00 31.61 ?  308 LYS A CA    1 
ATOM   2130 C  C     . LYS A 1 260 ? -7.378  -20.327 -7.455  1.00 33.65 ?  308 LYS A C     1 
ATOM   2131 O  O     . LYS A 1 260 ? -6.956  -20.172 -8.593  1.00 33.62 ?  308 LYS A O     1 
ATOM   2132 C  CB    . LYS A 1 260 ? -5.909  -19.508 -5.598  1.00 34.59 ?  308 LYS A CB    1 
ATOM   2133 C  CG    . LYS A 1 260 ? -5.574  -18.354 -4.659  1.00 37.57 ?  308 LYS A CG    1 
ATOM   2134 C  CD    . LYS A 1 260 ? -4.338  -18.634 -3.802  1.00 40.41 ?  308 LYS A CD    1 
ATOM   2135 C  CE    . LYS A 1 260 ? -4.675  -19.541 -2.600  1.00 42.39 ?  308 LYS A CE    1 
ATOM   2136 N  NZ    . LYS A 1 260 ? -5.678  -18.883 -1.715  1.00 43.94 ?  308 LYS A NZ    1 
ATOM   2137 N  N     . GLU A 1 261 ? -8.037  -21.421 -7.087  1.00 35.38 ?  309 GLU A N     1 
ATOM   2138 C  CA    . GLU A 1 261 ? -8.245  -22.483 -8.059  1.00 37.79 ?  309 GLU A CA    1 
ATOM   2139 C  C     . GLU A 1 261 ? -9.277  -22.088 -9.128  1.00 35.00 ?  309 GLU A C     1 
ATOM   2140 O  O     . GLU A 1 261 ? -8.957  -22.007 -10.304 1.00 35.50 ?  309 GLU A O     1 
ATOM   2141 C  CB    . GLU A 1 261 ? -8.686  -23.773 -7.355  1.00 42.25 ?  309 GLU A CB    1 
ATOM   2142 C  CG    . GLU A 1 261 ? -8.385  -25.002 -8.167  1.00 46.77 ?  309 GLU A CG    1 
ATOM   2143 C  CD    . GLU A 1 261 ? -6.910  -25.320 -8.114  1.00 50.36 ?  309 GLU A CD    1 
ATOM   2144 O  OE1   . GLU A 1 261 ? -6.397  -25.555 -6.992  1.00 51.88 ?  309 GLU A OE1   1 
ATOM   2145 O  OE2   . GLU A 1 261 ? -6.253  -25.283 -9.184  1.00 51.62 ?  309 GLU A OE2   1 
ATOM   2146 N  N     . GLU A 1 262 ? -10.508 -21.834 -8.703  1.00 32.27 ?  310 GLU A N     1 
ATOM   2147 C  CA    . GLU A 1 262 ? -11.610 -21.661 -9.633  1.00 30.56 ?  310 GLU A CA    1 
ATOM   2148 C  C     . GLU A 1 262 ? -11.629 -20.278 -10.326 1.00 27.65 ?  310 GLU A C     1 
ATOM   2149 O  O     . GLU A 1 262 ? -12.059 -20.160 -11.485 1.00 28.01 ?  310 GLU A O     1 
ATOM   2150 C  CB    . GLU A 1 262 ? -12.937 -21.868 -8.910  1.00 33.06 ?  310 GLU A CB    1 
ATOM   2151 C  CG    . GLU A 1 262 ? -13.164 -23.312 -8.439  1.00 35.59 ?  310 GLU A CG    1 
ATOM   2152 C  CD    . GLU A 1 262 ? -12.638 -23.590 -7.063  1.00 37.56 ?  310 GLU A CD    1 
ATOM   2153 O  OE1   . GLU A 1 262 ? -12.021 -22.691 -6.463  1.00 37.44 ?  310 GLU A OE1   1 
ATOM   2154 O  OE2   . GLU A 1 262 ? -12.883 -24.711 -6.557  1.00 39.99 ?  310 GLU A OE2   1 
ATOM   2155 N  N     . ARG A 1 263 ? -11.176 -19.243 -9.622  1.00 24.51 ?  311 ARG A N     1 
ATOM   2156 C  CA    . ARG A 1 263 ? -11.161 -17.904 -10.187 1.00 23.89 ?  311 ARG A CA    1 
ATOM   2157 C  C     . ARG A 1 263 ? -12.503 -17.527 -10.742 1.00 22.38 ?  311 ARG A C     1 
ATOM   2158 O  O     . ARG A 1 263 ? -12.596 -16.981 -11.839 1.00 23.19 ?  311 ARG A O     1 
ATOM   2159 C  CB    . ARG A 1 263 ? -10.089 -17.774 -11.301 1.00 24.14 ?  311 ARG A CB    1 
ATOM   2160 C  CG    . ARG A 1 263 ? -8.686  -18.148 -10.870 1.00 24.88 ?  311 ARG A CG    1 
ATOM   2161 C  CD    . ARG A 1 263 ? -8.022  -17.031 -10.051 1.00 25.99 ?  311 ARG A CD    1 
ATOM   2162 N  NE    . ARG A 1 263 ? -6.755  -17.471 -9.472  1.00 27.12 ?  311 ARG A NE    1 
ATOM   2163 C  CZ    . ARG A 1 263 ? -5.741  -16.665 -9.165  1.00 28.64 ?  311 ARG A CZ    1 
ATOM   2164 N  NH1   . ARG A 1 263 ? -4.625  -17.167 -8.633  1.00 29.18 ?  311 ARG A NH1   1 
ATOM   2165 N  NH2   . ARG A 1 263 ? -5.837  -15.360 -9.397  1.00 29.47 ?  311 ARG A NH2   1 
ATOM   2166 N  N     . VAL A 1 264 ? -13.560 -17.745 -9.972  1.00 20.19 ?  312 VAL A N     1 
ATOM   2167 C  CA    . VAL A 1 264 ? -14.901 -17.590 -10.530 1.00 19.53 ?  312 VAL A CA    1 
ATOM   2168 C  C     . VAL A 1 264 ? -15.592 -16.257 -10.142 1.00 18.73 ?  312 VAL A C     1 
ATOM   2169 O  O     . VAL A 1 264 ? -16.413 -15.756 -10.904 1.00 18.94 ?  312 VAL A O     1 
ATOM   2170 C  CB    . VAL A 1 264 ? -15.781 -18.805 -10.177 1.00 22.46 ?  312 VAL A CB    1 
ATOM   2171 C  CG1   . VAL A 1 264 ? -15.798 -19.015 -8.750  1.00 23.24 ?  312 VAL A CG1   1 
ATOM   2172 C  CG2   . VAL A 1 264 ? -17.216 -18.639 -10.688 1.00 23.93 ?  312 VAL A CG2   1 
ATOM   2173 N  N     . PHE A 1 265 ? -15.286 -15.708 -8.979  1.00 16.40 ?  313 PHE A N     1 
ATOM   2174 C  CA    . PHE A 1 265 ? -15.961 -14.456 -8.540  1.00 14.85 ?  313 PHE A CA    1 
ATOM   2175 C  C     . PHE A 1 265 ? -14.999 -13.295 -8.411  1.00 15.14 ?  313 PHE A C     1 
ATOM   2176 O  O     . PHE A 1 265 ? -13.863 -13.452 -7.975  1.00 15.41 ?  313 PHE A O     1 
ATOM   2177 C  CB    . PHE A 1 265 ? -16.681 -14.653 -7.183  1.00 15.82 ?  313 PHE A CB    1 
ATOM   2178 C  CG    . PHE A 1 265 ? -17.656 -15.794 -7.204  1.00 17.03 ?  313 PHE A CG    1 
ATOM   2179 C  CD1   . PHE A 1 265 ? -18.672 -15.809 -8.144  1.00 17.98 ?  313 PHE A CD1   1 
ATOM   2180 C  CD2   . PHE A 1 265 ? -17.580 -16.824 -6.265  1.00 19.49 ?  313 PHE A CD2   1 
ATOM   2181 C  CE1   . PHE A 1 265 ? -19.596 -16.864 -8.183  1.00 19.03 ?  313 PHE A CE1   1 
ATOM   2182 C  CE2   . PHE A 1 265 ? -18.503 -17.885 -6.281  1.00 19.87 ?  313 PHE A CE2   1 
ATOM   2183 C  CZ    . PHE A 1 265 ? -19.506 -17.897 -7.267  1.00 19.46 ?  313 PHE A CZ    1 
ATOM   2184 N  N     A SER A 1 266 ? -15.446 -12.092 -8.752  0.58 16.00 ?  314 SER A N     1 
ATOM   2185 N  N     B SER A 1 266 ? -15.502 -12.114 -8.725  0.42 15.29 ?  314 SER A N     1 
ATOM   2186 C  CA    A SER A 1 266 ? -14.549 -10.923 -8.680  0.58 15.31 ?  314 SER A CA    1 
ATOM   2187 C  CA    B SER A 1 266 ? -14.733 -10.880 -8.626  0.42 14.48 ?  314 SER A CA    1 
ATOM   2188 C  C     A SER A 1 266 ? -14.455 -10.422 -7.242  0.58 14.42 ?  314 SER A C     1 
ATOM   2189 C  C     B SER A 1 266 ? -14.467 -10.537 -7.151  0.42 13.86 ?  314 SER A C     1 
ATOM   2190 O  O     A SER A 1 266 ? -15.464 -10.284 -6.534  0.58 14.92 ?  314 SER A O     1 
ATOM   2191 O  O     B SER A 1 266 ? -15.375 -10.657 -6.315  0.42 13.68 ?  314 SER A O     1 
ATOM   2192 C  CB    A SER A 1 266 ? -15.028 -9.800  -9.584  0.58 15.56 ?  314 SER A CB    1 
ATOM   2193 C  CB    B SER A 1 266 ? -15.506 -9.770  -9.338  0.42 14.25 ?  314 SER A CB    1 
ATOM   2194 O  OG    A SER A 1 266 ? -16.251 -9.310  -9.070  0.58 15.80 ?  314 SER A OG    1 
ATOM   2195 O  OG    B SER A 1 266 ? -14.794 -8.565  -9.356  0.42 13.72 ?  314 SER A OG    1 
ATOM   2196 N  N     . ASP A 1 267 ? -13.237 -10.144 -6.803  1.00 13.61 ?  315 ASP A N     1 
ATOM   2197 C  CA    . ASP A 1 267 ? -12.996 -9.664  -5.427  1.00 14.50 ?  315 ASP A CA    1 
ATOM   2198 C  C     . ASP A 1 267 ? -13.924 -8.515  -5.017  1.00 13.68 ?  315 ASP A C     1 
ATOM   2199 O  O     . ASP A 1 267 ? -14.404 -8.475  -3.878  1.00 14.91 ?  315 ASP A O     1 
ATOM   2200 C  CB    . ASP A 1 267 ? -11.549 -9.160  -5.286  1.00 15.86 ?  315 ASP A CB    1 
ATOM   2201 C  CG    . ASP A 1 267 ? -10.552 -10.269 -5.016  1.00 18.06 ?  315 ASP A CG    1 
ATOM   2202 O  OD1   . ASP A 1 267 ? -9.396  -10.100 -5.448  1.00 17.87 ?  315 ASP A OD1   1 
ATOM   2203 O  OD2   . ASP A 1 267 ? -10.894 -11.224 -4.273  1.00 19.87 ?  315 ASP A OD2   1 
ATOM   2204 N  N     . LYS A 1 268 ? -14.191 -7.592  -5.950  1.00 13.47 ?  316 LYS A N     1 
ATOM   2205 C  CA    . LYS A 1 268 ? -14.837 -6.361  -5.582  1.00 12.53 ?  316 LYS A CA    1 
ATOM   2206 C  C     . LYS A 1 268 ? -16.174 -6.160  -6.310  1.00 12.60 ?  316 LYS A C     1 
ATOM   2207 O  O     . LYS A 1 268 ? -16.664 -5.023  -6.413  1.00 12.87 ?  316 LYS A O     1 
ATOM   2208 C  CB    . LYS A 1 268 ? -13.931 -5.157  -5.813  1.00 13.23 ?  316 LYS A CB    1 
ATOM   2209 C  CG    . LYS A 1 268 ? -12.696 -5.157  -4.868  1.00 14.65 ?  316 LYS A CG    1 
ATOM   2210 C  CD    . LYS A 1 268 ? -11.658 -4.122  -5.286  1.00 14.72 ?  316 LYS A CD    1 
ATOM   2211 C  CE    . LYS A 1 268 ? -10.704 -4.726  -6.340  1.00 14.46 ?  316 LYS A CE    1 
ATOM   2212 N  NZ    . LYS A 1 268 ? -9.800  -3.713  -6.872  1.00 15.49 ?  316 LYS A NZ    1 
ATOM   2213 N  N     . GLY A 1 269 ? -16.767 -7.263  -6.791  1.00 13.79 ?  317 GLY A N     1 
ATOM   2214 C  CA    . GLY A 1 269 ? -18.028 -7.119  -7.530  1.00 13.42 ?  317 GLY A CA    1 
ATOM   2215 C  C     . GLY A 1 269 ? -17.755 -6.272  -8.779  1.00 13.47 ?  317 GLY A C     1 
ATOM   2216 O  O     . GLY A 1 269 ? -16.797 -6.518  -9.510  1.00 14.95 ?  317 GLY A O     1 
ATOM   2217 N  N     A CYS A 1 270 ? -18.593 -5.272  -9.024  0.70 12.01 ?  318 CYS A N     1 
ATOM   2218 N  N     B CYS A 1 270 ? -18.586 -5.256  -8.991  0.30 13.81 ?  318 CYS A N     1 
ATOM   2219 C  CA    A CYS A 1 270 ? -18.363 -4.340  -10.107 0.70 13.36 ?  318 CYS A CA    1 
ATOM   2220 C  CA    B CYS A 1 270 ? -18.404 -4.316  -10.085 0.30 15.04 ?  318 CYS A CA    1 
ATOM   2221 C  C     A CYS A 1 270 ? -17.613 -3.064  -9.714  0.70 13.45 ?  318 CYS A C     1 
ATOM   2222 C  C     B CYS A 1 270 ? -17.511 -3.125  -9.745  0.30 13.71 ?  318 CYS A C     1 
ATOM   2223 O  O     A CYS A 1 270 ? -17.483 -2.120  -10.512 0.70 16.58 ?  318 CYS A O     1 
ATOM   2224 O  O     B CYS A 1 270 ? -17.179 -2.324  -10.619 0.30 14.35 ?  318 CYS A O     1 
ATOM   2225 C  CB    A CYS A 1 270 ? -19.708 -3.972  -10.697 0.70 15.31 ?  318 CYS A CB    1 
ATOM   2226 C  CB    B CYS A 1 270 ? -19.766 -3.801  -10.538 0.30 17.73 ?  318 CYS A CB    1 
ATOM   2227 S  SG    A CYS A 1 270 ? -19.607 -3.316  -12.385 0.70 18.07 ?  318 CYS A SG    1 
ATOM   2228 S  SG    B CYS A 1 270 ? -20.749 -5.020  -11.393 0.30 20.52 ?  318 CYS A SG    1 
ATOM   2229 N  N     . LYS A 1 271 ? -17.096 -2.996  -8.491  1.00 12.33 ?  319 LYS A N     1 
ATOM   2230 C  CA    . LYS A 1 271 ? -16.365 -1.805  -8.095  1.00 12.19 ?  319 LYS A CA    1 
ATOM   2231 C  C     . LYS A 1 271 ? -14.908 -1.851  -8.533  1.00 12.07 ?  319 LYS A C     1 
ATOM   2232 O  O     . LYS A 1 271 ? -14.281 -2.919  -8.603  1.00 13.87 ?  319 LYS A O     1 
ATOM   2233 C  CB    . LYS A 1 271 ? -16.445 -1.612  -6.563  1.00 11.81 ?  319 LYS A CB    1 
ATOM   2234 C  CG    . LYS A 1 271 ? -17.828 -1.102  -6.179  1.00 13.42 ?  319 LYS A CG    1 
ATOM   2235 C  CD    . LYS A 1 271 ? -17.995 -0.888  -4.677  1.00 14.00 ?  319 LYS A CD    1 
ATOM   2236 C  CE    . LYS A 1 271 ? -19.405 -0.212  -4.468  1.00 13.96 ?  319 LYS A CE    1 
ATOM   2237 N  NZ    . LYS A 1 271 ? -19.535 0.290   -3.066  1.00 13.61 ?  319 LYS A NZ    1 
ATOM   2238 N  N     . THR A 1 272 ? -14.393 -0.649  -8.791  1.00 12.29 ?  320 THR A N     1 
ATOM   2239 C  CA    . THR A 1 272 ? -13.020 -0.371  -9.348  1.00 13.68 ?  320 THR A CA    1 
ATOM   2240 C  C     . THR A 1 272 ? -12.888 -0.870  -10.798 1.00 14.97 ?  320 THR A C     1 
ATOM   2241 O  O     . THR A 1 272 ? -11.790 -0.839  -11.334 1.00 17.43 ?  320 THR A O     1 
ATOM   2242 C  CB    . THR A 1 272 ? -11.836 -0.925  -8.489  1.00 14.07 ?  320 THR A CB    1 
ATOM   2243 O  OG1   . THR A 1 272 ? -11.709 -2.357  -8.568  1.00 14.82 ?  320 THR A OG1   1 
ATOM   2244 C  CG2   . THR A 1 272 ? -12.020 -0.471  -6.991  1.00 14.51 ?  320 THR A CG2   1 
ATOM   2245 N  N     . VAL A 1 273 ? -13.992 -1.300  -11.422 1.00 14.03 ?  321 VAL A N     1 
ATOM   2246 C  CA    . VAL A 1 273 ? -13.940 -1.767  -12.794 1.00 15.11 ?  321 VAL A CA    1 
ATOM   2247 C  C     . VAL A 1 273 ? -13.901 -0.593  -13.736 1.00 14.47 ?  321 VAL A C     1 
ATOM   2248 O  O     . VAL A 1 273 ? -13.060 -0.546  -14.665 1.00 15.77 ?  321 VAL A O     1 
ATOM   2249 C  CB    . VAL A 1 273 ? -15.158 -2.659  -13.099 1.00 14.31 ?  321 VAL A CB    1 
ATOM   2250 C  CG1   . VAL A 1 273 ? -15.156 -3.060  -14.591 1.00 16.70 ?  321 VAL A CG1   1 
ATOM   2251 C  CG2   . VAL A 1 273 ? -15.200 -3.923  -12.235 1.00 14.50 ?  321 VAL A CG2   1 
ATOM   2252 N  N     . PHE A 1 274 ? -14.801 0.374   -13.549 1.00 15.70 ?  322 PHE A N     1 
ATOM   2253 C  CA    . PHE A 1 274 ? -14.987 1.390   -14.595 1.00 16.47 ?  322 PHE A CA    1 
ATOM   2254 C  C     . PHE A 1 274 ? -13.806 2.351   -14.651 1.00 16.66 ?  322 PHE A C     1 
ATOM   2255 O  O     . PHE A 1 274 ? -13.588 2.989   -15.699 1.00 17.88 ?  322 PHE A O     1 
ATOM   2256 C  CB    . PHE A 1 274 ? -16.286 2.173   -14.353 1.00 17.28 ?  322 PHE A CB    1 
ATOM   2257 C  CG    . PHE A 1 274 ? -17.539 1.349   -14.356 1.00 16.37 ?  322 PHE A CG    1 
ATOM   2258 C  CD1   . PHE A 1 274 ? -17.630 0.131   -15.035 1.00 17.75 ?  322 PHE A CD1   1 
ATOM   2259 C  CD2   . PHE A 1 274 ? -18.681 1.829   -13.712 1.00 18.46 ?  322 PHE A CD2   1 
ATOM   2260 C  CE1   . PHE A 1 274 ? -18.805 -0.635  -15.005 1.00 18.90 ?  322 PHE A CE1   1 
ATOM   2261 C  CE2   . PHE A 1 274 ? -19.881 1.083   -13.736 1.00 18.22 ?  322 PHE A CE2   1 
ATOM   2262 C  CZ    . PHE A 1 274 ? -19.927 -0.143  -14.372 1.00 19.24 ?  322 PHE A CZ    1 
ATOM   2263 N  N     . THR A 1 275 ? -13.043 2.453   -13.554 1.00 16.42 ?  323 THR A N     1 
ATOM   2264 C  CA    . THR A 1 275 ? -11.784 3.179   -13.584 1.00 18.39 ?  323 THR A CA    1 
ATOM   2265 C  C     . THR A 1 275 ? -10.890 2.782   -14.753 1.00 17.54 ?  323 THR A C     1 
ATOM   2266 O  O     . THR A 1 275 ? -10.196 3.631   -15.347 1.00 18.72 ?  323 THR A O     1 
ATOM   2267 C  CB    . THR A 1 275 ? -11.008 2.914   -12.263 1.00 21.21 ?  323 THR A CB    1 
ATOM   2268 O  OG1   . THR A 1 275 ? -11.729 3.505   -11.161 1.00 26.33 ?  323 THR A OG1   1 
ATOM   2269 C  CG2   . THR A 1 275 ? -9.603  3.477   -12.356 1.00 22.87 ?  323 THR A CG2   1 
ATOM   2270 N  N     . LYS A 1 276 ? -10.943 1.496   -15.103 1.00 16.63 ?  324 LYS A N     1 
ATOM   2271 C  CA    . LYS A 1 276 ? -10.032 0.960   -16.103 1.00 15.87 ?  324 LYS A CA    1 
ATOM   2272 C  C     . LYS A 1 276 ? -10.404 1.426   -17.521 1.00 15.91 ?  324 LYS A C     1 
ATOM   2273 O  O     . LYS A 1 276 ? -9.567  1.361   -18.416 1.00 16.51 ?  324 LYS A O     1 
ATOM   2274 C  CB    . LYS A 1 276 ? -10.018 -0.571  -16.044 1.00 16.73 ?  324 LYS A CB    1 
ATOM   2275 C  CG    . LYS A 1 276 ? -9.585  -1.096  -14.660 1.00 17.59 ?  324 LYS A CG    1 
ATOM   2276 C  CD    . LYS A 1 276 ? -9.836  -2.592  -14.477 1.00 18.41 ?  324 LYS A CD    1 
ATOM   2277 C  CE    . LYS A 1 276 ? -8.957  -3.433  -15.409 1.00 19.09 ?  324 LYS A CE    1 
ATOM   2278 N  NZ    . LYS A 1 276 ? -9.175  -4.919  -15.261 1.00 19.18 ?  324 LYS A NZ    1 
ATOM   2279 N  N     . LEU A 1 277 ? -11.642 1.890   -17.735 1.00 16.31 ?  325 LEU A N     1 
ATOM   2280 C  CA    . LEU A 1 277 ? -12.018 2.393   -19.080 1.00 16.25 ?  325 LEU A CA    1 
ATOM   2281 C  C     . LEU A 1 277 ? -11.117 3.519   -19.528 1.00 19.11 ?  325 LEU A C     1 
ATOM   2282 O  O     . LEU A 1 277 ? -10.852 3.657   -20.735 1.00 19.37 ?  325 LEU A O     1 
ATOM   2283 C  CB    . LEU A 1 277 ? -13.475 2.846   -19.102 1.00 17.40 ?  325 LEU A CB    1 
ATOM   2284 C  CG    . LEU A 1 277 ? -14.472 1.683   -19.050 1.00 17.16 ?  325 LEU A CG    1 
ATOM   2285 C  CD1   . LEU A 1 277 ? -15.896 2.205   -18.721 1.00 18.21 ?  325 LEU A CD1   1 
ATOM   2286 C  CD2   . LEU A 1 277 ? -14.503 0.798   -20.343 1.00 18.22 ?  325 LEU A CD2   1 
ATOM   2287 N  N     . ASP A 1 278 ? -10.621 4.337   -18.598 1.00 19.12 ?  326 ASP A N     1 
ATOM   2288 C  CA    . ASP A 1 278 ? -9.759  5.454   -18.999 1.00 19.46 ?  326 ASP A CA    1 
ATOM   2289 C  C     . ASP A 1 278 ? -8.396  5.011   -19.498 1.00 18.89 ?  326 ASP A C     1 
ATOM   2290 O  O     . ASP A 1 278 ? -7.659  5.814   -20.102 1.00 20.62 ?  326 ASP A O     1 
ATOM   2291 C  CB    . ASP A 1 278 ? -9.599  6.412   -17.825 1.00 22.02 ?  326 ASP A CB    1 
ATOM   2292 C  CG    . ASP A 1 278 ? -10.904 7.055   -17.452 1.00 25.72 ?  326 ASP A CG    1 
ATOM   2293 O  OD1   . ASP A 1 278 ? -11.741 7.382   -18.341 1.00 26.87 ?  326 ASP A OD1   1 
ATOM   2294 O  OD2   . ASP A 1 278 ? -11.111 7.209   -16.262 1.00 27.83 ?  326 ASP A OD2   1 
ATOM   2295 N  N     . TYR A 1 279 ? -8.053  3.751   -19.287 1.00 17.72 ?  327 TYR A N     1 
ATOM   2296 C  CA    . TYR A 1 279 ? -6.817  3.230   -19.903 1.00 19.21 ?  327 TYR A CA    1 
ATOM   2297 C  C     . TYR A 1 279 ? -6.992  2.953   -21.392 1.00 20.56 ?  327 TYR A C     1 
ATOM   2298 O  O     . TYR A 1 279 ? -5.984  2.779   -22.116 1.00 22.27 ?  327 TYR A O     1 
ATOM   2299 C  CB    . TYR A 1 279 ? -6.355  1.977   -19.203 1.00 19.93 ?  327 TYR A CB    1 
ATOM   2300 C  CG    . TYR A 1 279 ? -6.203  2.188   -17.702 1.00 21.15 ?  327 TYR A CG    1 
ATOM   2301 C  CD1   . TYR A 1 279 ? -6.364  1.136   -16.818 1.00 21.78 ?  327 TYR A CD1   1 
ATOM   2302 C  CD2   . TYR A 1 279 ? -5.847  3.464   -17.184 1.00 22.45 ?  327 TYR A CD2   1 
ATOM   2303 C  CE1   . TYR A 1 279 ? -6.206  1.328   -15.431 1.00 20.93 ?  327 TYR A CE1   1 
ATOM   2304 C  CE2   . TYR A 1 279 ? -5.733  3.680   -15.808 1.00 23.33 ?  327 TYR A CE2   1 
ATOM   2305 C  CZ    . TYR A 1 279 ? -5.941  2.601   -14.951 1.00 22.05 ?  327 TYR A CZ    1 
ATOM   2306 O  OH    . TYR A 1 279 ? -5.807  2.801   -13.597 1.00 22.42 ?  327 TYR A OH    1 
ATOM   2307 N  N     . TYR A 1 280 ? -8.239  2.861   -21.851 1.00 19.98 ?  328 TYR A N     1 
ATOM   2308 C  CA    . TYR A 1 280 ? -8.526  2.442   -23.224 1.00 20.31 ?  328 TYR A CA    1 
ATOM   2309 C  C     . TYR A 1 280 ? -9.232  3.477   -24.078 1.00 21.42 ?  328 TYR A C     1 
ATOM   2310 O  O     . TYR A 1 280 ? -9.231  3.336   -25.302 1.00 23.92 ?  328 TYR A O     1 
ATOM   2311 C  CB    . TYR A 1 280 ? -9.411  1.189   -23.186 1.00 20.80 ?  328 TYR A CB    1 
ATOM   2312 C  CG    . TYR A 1 280 ? -8.738  0.009   -22.547 1.00 21.32 ?  328 TYR A CG    1 
ATOM   2313 C  CD1   . TYR A 1 280 ? -8.890  -0.251  -21.185 1.00 21.83 ?  328 TYR A CD1   1 
ATOM   2314 C  CD2   . TYR A 1 280 ? -7.987  -0.874  -23.318 1.00 24.07 ?  328 TYR A CD2   1 
ATOM   2315 C  CE1   . TYR A 1 280 ? -8.227  -1.314  -20.596 1.00 24.91 ?  328 TYR A CE1   1 
ATOM   2316 C  CE2   . TYR A 1 280 ? -7.360  -1.946  -22.769 1.00 27.05 ?  328 TYR A CE2   1 
ATOM   2317 C  CZ    . TYR A 1 280 ? -7.478  -2.177  -21.415 1.00 27.28 ?  328 TYR A CZ    1 
ATOM   2318 O  OH    . TYR A 1 280 ? -6.834  -3.271  -20.868 1.00 30.64 ?  328 TYR A OH    1 
ATOM   2319 N  N     . TYR A 1 281 ? -9.949  4.385   -23.440 1.00 21.21 ?  329 TYR A N     1 
ATOM   2320 C  CA    . TYR A 1 281 ? -10.693 5.445   -24.121 1.00 22.56 ?  329 TYR A CA    1 
ATOM   2321 C  C     . TYR A 1 281 ? -10.149 6.785   -23.720 1.00 25.60 ?  329 TYR A C     1 
ATOM   2322 O  O     . TYR A 1 281 ? -9.834  7.003   -22.546 1.00 26.44 ?  329 TYR A O     1 
ATOM   2323 C  CB    . TYR A 1 281 ? -12.190 5.400   -23.772 1.00 21.04 ?  329 TYR A CB    1 
ATOM   2324 C  CG    . TYR A 1 281 ? -12.968 4.259   -24.404 1.00 20.86 ?  329 TYR A CG    1 
ATOM   2325 C  CD1   . TYR A 1 281 ? -13.635 4.422   -25.630 1.00 19.64 ?  329 TYR A CD1   1 
ATOM   2326 C  CD2   . TYR A 1 281 ? -13.091 3.049   -23.727 1.00 20.34 ?  329 TYR A CD2   1 
ATOM   2327 C  CE1   . TYR A 1 281 ? -14.364 3.386   -26.191 1.00 19.72 ?  329 TYR A CE1   1 
ATOM   2328 C  CE2   . TYR A 1 281 ? -13.822 2.016   -24.256 1.00 20.95 ?  329 TYR A CE2   1 
ATOM   2329 C  CZ    . TYR A 1 281 ? -14.475 2.179   -25.498 1.00 20.59 ?  329 TYR A CZ    1 
ATOM   2330 O  OH    . TYR A 1 281 ? -15.218 1.124   -26.020 1.00 21.75 ?  329 TYR A OH    1 
ATOM   2331 N  N     . ASP A 1 282 ? -10.069 7.710   -24.658 1.00 29.98 ?  330 ASP A N     1 
ATOM   2332 C  CA    . ASP A 1 282 ? -9.745  9.077   -24.282 1.00 34.89 ?  330 ASP A CA    1 
ATOM   2333 C  C     . ASP A 1 282 ? -11.070 9.818   -24.095 1.00 37.51 ?  330 ASP A C     1 
ATOM   2334 O  O     . ASP A 1 282 ? -11.128 10.816  -23.388 1.00 41.39 ?  330 ASP A O     1 
ATOM   2335 C  CB    . ASP A 1 282 ? -8.854  9.746   -25.336 1.00 38.06 ?  330 ASP A CB    1 
ATOM   2336 C  CG    . ASP A 1 282 ? -7.596  8.928   -25.649 1.00 41.18 ?  330 ASP A CG    1 
ATOM   2337 O  OD1   . ASP A 1 282 ? -6.978  8.368   -24.716 1.00 41.69 ?  330 ASP A OD1   1 
ATOM   2338 O  OD2   . ASP A 1 282 ? -7.216  8.850   -26.842 1.00 43.58 ?  330 ASP A OD2   1 
ATOM   2339 N  N     . ASN B 2 5   ? -13.314 45.411  -22.077 1.00 45.57 ?  236 ASN B N     1 
ATOM   2340 C  CA    . ASN B 2 5   ? -12.609 45.431  -20.802 1.00 44.60 ?  236 ASN B CA    1 
ATOM   2341 C  C     . ASN B 2 5   ? -12.113 44.033  -20.422 1.00 40.78 ?  236 ASN B C     1 
ATOM   2342 O  O     . ASN B 2 5   ? -11.981 43.678  -19.246 1.00 40.44 ?  236 ASN B O     1 
ATOM   2343 C  CB    . ASN B 2 5   ? -13.505 46.015  -19.728 1.00 46.61 ?  236 ASN B CB    1 
ATOM   2344 C  CG    . ASN B 2 5   ? -13.885 47.463  -20.037 1.00 49.08 ?  236 ASN B CG    1 
ATOM   2345 O  OD1   . ASN B 2 5   ? -13.252 48.098  -20.880 1.00 50.22 ?  236 ASN B OD1   1 
ATOM   2346 N  ND2   . ASN B 2 5   ? -14.929 47.978  -19.378 1.00 49.95 ?  236 ASN B ND2   1 
ATOM   2347 N  N     . SER B 2 6   ? -11.843 43.254  -21.457 1.00 37.87 ?  237 SER B N     1 
ATOM   2348 C  CA    . SER B 2 6   ? -11.210 41.957  -21.339 1.00 36.25 ?  237 SER B CA    1 
ATOM   2349 C  C     . SER B 2 6   ? -9.910  42.031  -22.118 1.00 33.30 ?  237 SER B C     1 
ATOM   2350 O  O     . SER B 2 6   ? -9.840  42.656  -23.187 1.00 33.82 ?  237 SER B O     1 
ATOM   2351 C  CB    . SER B 2 6   ? -12.089 40.836  -21.904 1.00 38.88 ?  237 SER B CB    1 
ATOM   2352 O  OG    . SER B 2 6   ? -13.123 40.470  -21.010 1.00 40.53 ?  237 SER B OG    1 
ATOM   2353 N  N     . TYR B 2 7   ? -8.889  41.384  -21.590 1.00 30.32 ?  238 TYR B N     1 
ATOM   2354 C  CA    . TYR B 2 7   ? -7.598  41.259  -22.240 1.00 29.20 ?  238 TYR B CA    1 
ATOM   2355 C  C     . TYR B 2 7   ? -7.472  39.835  -22.744 1.00 29.65 ?  238 TYR B C     1 
ATOM   2356 O  O     . TYR B 2 7   ? -7.810  38.893  -22.025 1.00 28.13 ?  238 TYR B O     1 
ATOM   2357 C  CB    . TYR B 2 7   ? -6.446  41.588  -21.248 1.00 28.96 ?  238 TYR B CB    1 
ATOM   2358 C  CG    . TYR B 2 7   ? -5.036  41.380  -21.802 1.00 29.71 ?  238 TYR B CG    1 
ATOM   2359 C  CD1   . TYR B 2 7   ? -4.451  40.105  -21.825 1.00 30.17 ?  238 TYR B CD1   1 
ATOM   2360 C  CD2   . TYR B 2 7   ? -4.273  42.448  -22.275 1.00 30.74 ?  238 TYR B CD2   1 
ATOM   2361 C  CE1   . TYR B 2 7   ? -3.167  39.905  -22.320 1.00 31.66 ?  238 TYR B CE1   1 
ATOM   2362 C  CE2   . TYR B 2 7   ? -2.955  42.256  -22.743 1.00 31.52 ?  238 TYR B CE2   1 
ATOM   2363 C  CZ    . TYR B 2 7   ? -2.421  40.987  -22.771 1.00 32.08 ?  238 TYR B CZ    1 
ATOM   2364 O  OH    . TYR B 2 7   ? -1.126  40.792  -23.228 1.00 34.26 ?  238 TYR B OH    1 
ATOM   2365 N  N     . TYR B 2 8   ? -6.975  39.668  -23.971 1.00 31.52 ?  239 TYR B N     1 
ATOM   2366 C  CA    . TYR B 2 8   ? -6.699  38.346  -24.537 1.00 33.79 ?  239 TYR B CA    1 
ATOM   2367 C  C     . TYR B 2 8   ? -5.267  38.216  -25.022 1.00 35.72 ?  239 TYR B C     1 
ATOM   2368 O  O     . TYR B 2 8   ? -4.821  39.035  -25.840 1.00 36.43 ?  239 TYR B O     1 
ATOM   2369 C  CB    . TYR B 2 8   ? -7.615  38.069  -25.731 1.00 34.30 ?  239 TYR B CB    1 
ATOM   2370 C  CG    . TYR B 2 8   ? -9.060  38.153  -25.390 1.00 36.62 ?  239 TYR B CG    1 
ATOM   2371 C  CD1   . TYR B 2 8   ? -9.710  37.072  -24.807 1.00 38.20 ?  239 TYR B CD1   1 
ATOM   2372 C  CD2   . TYR B 2 8   ? -9.782  39.326  -25.609 1.00 38.15 ?  239 TYR B CD2   1 
ATOM   2373 C  CE1   . TYR B 2 8   ? -11.046 37.141  -24.468 1.00 39.24 ?  239 TYR B CE1   1 
ATOM   2374 C  CE2   . TYR B 2 8   ? -11.125 39.411  -25.269 1.00 38.95 ?  239 TYR B CE2   1 
ATOM   2375 C  CZ    . TYR B 2 8   ? -11.754 38.305  -24.706 1.00 39.97 ?  239 TYR B CZ    1 
ATOM   2376 O  OH    . TYR B 2 8   ? -13.090 38.340  -24.354 1.00 41.62 ?  239 TYR B OH    1 
ATOM   2377 N  N     . SER B 2 9   ? -4.567  37.182  -24.555 1.00 36.77 ?  240 SER B N     1 
ATOM   2378 C  CA    . SER B 2 9   ? -3.251  36.826  -25.088 1.00 38.80 ?  240 SER B CA    1 
ATOM   2379 C  C     . SER B 2 9   ? -3.391  36.323  -26.521 1.00 41.74 ?  240 SER B C     1 
ATOM   2380 O  O     . SER B 2 9   ? -4.476  35.929  -26.943 1.00 40.34 ?  240 SER B O     1 
ATOM   2381 C  CB    . SER B 2 9   ? -2.594  35.745  -24.231 1.00 38.37 ?  240 SER B CB    1 
ATOM   2382 O  OG    . SER B 2 9   ? -2.310  36.257  -22.961 1.00 37.85 ?  240 SER B OG    1 
ATOM   2383 N  N     . SER B 2 10  ? -2.291  36.304  -27.269 1.00 46.01 ?  241 SER B N     1 
ATOM   2384 C  CA    . SER B 2 10  ? -2.357  35.703  -28.592 1.00 50.12 ?  241 SER B CA    1 
ATOM   2385 C  C     . SER B 2 10  ? -2.589  34.185  -28.444 1.00 53.28 ?  241 SER B C     1 
ATOM   2386 O  O     . SER B 2 10  ? -2.143  33.581  -27.459 1.00 53.55 ?  241 SER B O     1 
ATOM   2387 C  CB    . SER B 2 10  ? -1.082  35.988  -29.376 1.00 50.83 ?  241 SER B CB    1 
ATOM   2388 O  OG    . SER B 2 10  ? -0.030  35.191  -28.889 1.00 51.64 ?  241 SER B OG    1 
ATOM   2389 N  N     . PRO B 2 11  ? -3.304  33.566  -29.411 1.00 55.53 ?  242 PRO B N     1 
ATOM   2390 C  CA    . PRO B 2 11  ? -3.445  32.098  -29.452 1.00 56.74 ?  242 PRO B CA    1 
ATOM   2391 C  C     . PRO B 2 11  ? -2.090  31.360  -29.371 1.00 58.05 ?  242 PRO B C     1 
ATOM   2392 O  O     . PRO B 2 11  ? -2.020  30.221  -28.885 1.00 58.39 ?  242 PRO B O     1 
ATOM   2393 C  CB    . PRO B 2 11  ? -4.123  31.843  -30.811 1.00 56.61 ?  242 PRO B CB    1 
ATOM   2394 C  CG    . PRO B 2 11  ? -4.830  33.112  -31.128 1.00 56.38 ?  242 PRO B CG    1 
ATOM   2395 C  CD    . PRO B 2 11  ? -4.013  34.226  -30.528 1.00 56.14 ?  242 PRO B CD    1 
ATOM   2396 N  N     . ALA B 2 12  ? -1.032  32.029  -29.829 1.00 58.63 ?  243 ALA B N     1 
ATOM   2397 C  CA    . ALA B 2 12  ? 0.322   31.483  -29.817 1.00 59.64 ?  243 ALA B CA    1 
ATOM   2398 C  C     . ALA B 2 12  ? 0.867   31.188  -28.409 1.00 60.24 ?  243 ALA B C     1 
ATOM   2399 O  O     . ALA B 2 12  ? 1.786   30.376  -28.257 1.00 60.48 ?  243 ALA B O     1 
ATOM   2400 C  CB    . ALA B 2 12  ? 1.266   32.443  -30.549 1.00 60.06 ?  243 ALA B CB    1 
ATOM   2401 N  N     . GLN B 2 13  ? 0.313   31.841  -27.385 1.00 60.05 ?  244 GLN B N     1 
ATOM   2402 C  CA    . GLN B 2 13  ? 0.803   31.639  -26.013 1.00 59.45 ?  244 GLN B CA    1 
ATOM   2403 C  C     . GLN B 2 13  ? 0.275   30.328  -25.409 1.00 56.95 ?  244 GLN B C     1 
ATOM   2404 O  O     . GLN B 2 13  ? 0.853   29.807  -24.449 1.00 56.74 ?  244 GLN B O     1 
ATOM   2405 C  CB    . GLN B 2 13  ? 0.428   32.824  -25.113 1.00 60.93 ?  244 GLN B CB    1 
ATOM   2406 C  CG    . GLN B 2 13  ? 0.644   34.216  -25.735 1.00 62.62 ?  244 GLN B CG    1 
ATOM   2407 C  CD    . GLN B 2 13  ? 2.089   34.506  -26.179 1.00 64.20 ?  244 GLN B CD    1 
ATOM   2408 O  OE1   . GLN B 2 13  ? 2.325   34.914  -27.323 1.00 64.79 ?  244 GLN B OE1   1 
ATOM   2409 N  NE2   . GLN B 2 13  ? 3.052   34.319  -25.269 1.00 64.64 ?  244 GLN B NE2   1 
ATOM   2410 N  N     . GLN B 2 14  ? -0.808  29.800  -25.987 1.00 54.56 ?  245 GLN B N     1 
ATOM   2411 C  CA    . GLN B 2 14  ? -1.429  28.545  -25.533 1.00 51.83 ?  245 GLN B CA    1 
ATOM   2412 C  C     . GLN B 2 14  ? -1.653  28.543  -24.019 1.00 46.20 ?  245 GLN B C     1 
ATOM   2413 O  O     . GLN B 2 14  ? -1.291  27.586  -23.312 1.00 46.98 ?  245 GLN B O     1 
ATOM   2414 C  CB    . GLN B 2 14  ? -0.584  27.328  -25.940 1.00 54.50 ?  245 GLN B CB    1 
ATOM   2415 C  CG    . GLN B 2 14  ? -0.997  26.705  -27.282 1.00 56.99 ?  245 GLN B CG    1 
ATOM   2416 C  CD    . GLN B 2 14  ? -2.333  25.964  -27.210 1.00 59.16 ?  245 GLN B CD    1 
ATOM   2417 O  OE1   . GLN B 2 14  ? -2.672  25.342  -26.189 1.00 59.90 ?  245 GLN B OE1   1 
ATOM   2418 N  NE2   . GLN B 2 14  ? -3.107  26.040  -28.295 1.00 59.95 ?  245 GLN B NE2   1 
ATOM   2419 N  N     . VAL B 2 15  ? -2.225  29.635  -23.532 1.00 39.03 ?  246 VAL B N     1 
ATOM   2420 C  CA    . VAL B 2 15  ? -2.673  29.750  -22.141 1.00 32.37 ?  246 VAL B CA    1 
ATOM   2421 C  C     . VAL B 2 15  ? -3.571  28.567  -21.780 1.00 29.41 ?  246 VAL B C     1 
ATOM   2422 O  O     . VAL B 2 15  ? -4.540  28.297  -22.477 1.00 28.91 ?  246 VAL B O     1 
ATOM   2423 C  CB    . VAL B 2 15  ? -3.381  31.097  -21.971 1.00 31.26 ?  246 VAL B CB    1 
ATOM   2424 C  CG1   . VAL B 2 15  ? -4.057  31.205  -20.660 1.00 29.86 ?  246 VAL B CG1   1 
ATOM   2425 C  CG2   . VAL B 2 15  ? -2.394  32.246  -22.211 1.00 31.55 ?  246 VAL B CG2   1 
ATOM   2426 N  N     . PRO B 2 16  ? -3.246  27.850  -20.685 1.00 27.57 ?  247 PRO B N     1 
ATOM   2427 C  CA    . PRO B 2 16  ? -4.013  26.648  -20.362 1.00 27.30 ?  247 PRO B CA    1 
ATOM   2428 C  C     . PRO B 2 16  ? -5.485  26.902  -20.014 1.00 27.41 ?  247 PRO B C     1 
ATOM   2429 O  O     . PRO B 2 16  ? -5.785  27.749  -19.167 1.00 28.16 ?  247 PRO B O     1 
ATOM   2430 C  CB    . PRO B 2 16  ? -3.305  26.086  -19.115 1.00 26.57 ?  247 PRO B CB    1 
ATOM   2431 C  CG    . PRO B 2 16  ? -2.068  26.777  -18.959 1.00 27.99 ?  247 PRO B CG    1 
ATOM   2432 C  CD    . PRO B 2 16  ? -2.076  28.030  -19.802 1.00 27.76 ?  247 PRO B CD    1 
ATOM   2433 N  N     . LYS B 2 17  ? -6.376  26.104  -20.591 1.00 27.14 ?  248 LYS B N     1 
ATOM   2434 C  CA    . LYS B 2 17  ? -7.751  26.087  -20.168 1.00 27.81 ?  248 LYS B CA    1 
ATOM   2435 C  C     . LYS B 2 17  ? -7.896  25.632  -18.702 1.00 26.10 ?  248 LYS B C     1 
ATOM   2436 O  O     . LYS B 2 17  ? -8.696  26.172  -17.932 1.00 27.08 ?  248 LYS B O     1 
ATOM   2437 C  CB    . LYS B 2 17  ? -8.532  25.157  -21.093 1.00 33.07 ?  248 LYS B CB    1 
ATOM   2438 C  CG    . LYS B 2 17  ? -10.004 25.229  -20.947 1.00 37.29 ?  248 LYS B CG    1 
ATOM   2439 C  CD    . LYS B 2 17  ? -10.635 25.016  -22.334 1.00 40.77 ?  248 LYS B CD    1 
ATOM   2440 C  CE    . LYS B 2 17  ? -10.418 26.226  -23.278 1.00 43.33 ?  248 LYS B CE    1 
ATOM   2441 N  NZ    . LYS B 2 17  ? -11.270 27.450  -22.974 1.00 44.66 ?  248 LYS B NZ    1 
ATOM   2442 N  N     . ASN B 2 18  ? -7.117  24.629  -18.332 1.00 22.63 ?  249 ASN B N     1 
ATOM   2443 C  CA    . ASN B 2 18  ? -7.137  24.067  -16.966 1.00 20.92 ?  249 ASN B CA    1 
ATOM   2444 C  C     . ASN B 2 18  ? -5.721  24.159  -16.368 1.00 19.37 ?  249 ASN B C     1 
ATOM   2445 O  O     . ASN B 2 18  ? -4.915  23.252  -16.571 1.00 19.69 ?  249 ASN B O     1 
ATOM   2446 C  CB    . ASN B 2 18  ? -7.639  22.611  -17.039 1.00 20.99 ?  249 ASN B CB    1 
ATOM   2447 C  CG    . ASN B 2 18  ? -7.830  21.967  -15.646 1.00 20.53 ?  249 ASN B CG    1 
ATOM   2448 O  OD1   . ASN B 2 18  ? -7.203  22.361  -14.682 1.00 20.43 ?  249 ASN B OD1   1 
ATOM   2449 N  ND2   . ASN B 2 18  ? -8.705  20.971  -15.569 1.00 22.13 ?  249 ASN B ND2   1 
ATOM   2450 N  N     . PRO B 2 19  ? -5.419  25.273  -15.657 1.00 18.33 ?  250 PRO B N     1 
ATOM   2451 C  CA    . PRO B 2 19  ? -4.054  25.472  -15.152 1.00 17.71 ?  250 PRO B CA    1 
ATOM   2452 C  C     . PRO B 2 19  ? -3.610  24.315  -14.228 1.00 17.37 ?  250 PRO B C     1 
ATOM   2453 O  O     . PRO B 2 19  ? -2.467  23.891  -14.331 1.00 17.01 ?  250 PRO B O     1 
ATOM   2454 C  CB    . PRO B 2 19  ? -4.139  26.792  -14.371 1.00 19.06 ?  250 PRO B CB    1 
ATOM   2455 C  CG    . PRO B 2 19  ? -5.338  27.532  -14.945 1.00 20.70 ?  250 PRO B CG    1 
ATOM   2456 C  CD    . PRO B 2 19  ? -6.259  26.482  -15.517 1.00 19.72 ?  250 PRO B CD    1 
ATOM   2457 N  N     . ALA B 2 20  ? -4.492  23.805  -13.352 1.00 17.54 ?  251 ALA B N     1 
ATOM   2458 C  CA    . ALA B 2 20  ? -4.040  22.781  -12.419 1.00 16.98 ?  251 ALA B CA    1 
ATOM   2459 C  C     . ALA B 2 20  ? -3.699  21.505  -13.189 1.00 16.51 ?  251 ALA B C     1 
ATOM   2460 O  O     . ALA B 2 20  ? -2.752  20.784  -12.847 1.00 17.59 ?  251 ALA B O     1 
ATOM   2461 C  CB    . ALA B 2 20  ? -5.106  22.510  -11.395 1.00 17.14 ?  251 ALA B CB    1 
ATOM   2462 N  N     . LEU B 2 21  ? -4.474  21.181  -14.237 1.00 16.35 ?  252 LEU B N     1 
ATOM   2463 C  CA    . LEU B 2 21  ? -4.200  19.959  -15.007 1.00 16.30 ?  252 LEU B CA    1 
ATOM   2464 C  C     . LEU B 2 21  ? -2.856  20.087  -15.743 1.00 17.31 ?  252 LEU B C     1 
ATOM   2465 O  O     . LEU B 2 21  ? -2.029  19.183  -15.711 1.00 18.17 ?  252 LEU B O     1 
ATOM   2466 C  CB    . LEU B 2 21  ? -5.313  19.707  -16.033 1.00 19.11 ?  252 LEU B CB    1 
ATOM   2467 C  CG    . LEU B 2 21  ? -5.013  18.579  -17.020 1.00 20.82 ?  252 LEU B CG    1 
ATOM   2468 C  CD1   . LEU B 2 21  ? -4.782  17.169  -16.320 1.00 22.51 ?  252 LEU B CD1   1 
ATOM   2469 C  CD2   . LEU B 2 21  ? -6.109  18.551  -18.081 1.00 22.85 ?  252 LEU B CD2   1 
ATOM   2470 N  N     . GLU B 2 22  ? -2.632  21.241  -16.386 1.00 19.08 ?  253 GLU B N     1 
ATOM   2471 C  CA    . GLU B 2 22  ? -1.395  21.422  -17.160 1.00 19.12 ?  253 GLU B CA    1 
ATOM   2472 C  C     . GLU B 2 22  ? -0.163  21.408  -16.250 1.00 18.51 ?  253 GLU B C     1 
ATOM   2473 O  O     . GLU B 2 22  ? 0.877   20.839  -16.608 1.00 18.81 ?  253 GLU B O     1 
ATOM   2474 C  CB    . GLU B 2 22  ? -1.483  22.714  -17.963 1.00 21.31 ?  253 GLU B CB    1 
ATOM   2475 C  CG    . GLU B 2 22  ? -2.609  22.635  -18.993 1.00 25.46 ?  253 GLU B CG    1 
ATOM   2476 C  CD    . GLU B 2 22  ? -2.587  21.387  -19.865 1.00 31.35 ?  253 GLU B CD    1 
ATOM   2477 O  OE1   . GLU B 2 22  ? -1.514  20.959  -20.376 1.00 33.62 ?  253 GLU B OE1   1 
ATOM   2478 O  OE2   . GLU B 2 22  ? -3.686  20.859  -20.088 1.00 34.49 ?  253 GLU B OE2   1 
ATOM   2479 N  N     . ALA B 2 23  ? -0.263  21.999  -15.058 1.00 17.45 ?  254 ALA B N     1 
ATOM   2480 C  CA    . ALA B 2 23  ? 0.876   21.996  -14.138 1.00 17.34 ?  254 ALA B CA    1 
ATOM   2481 C  C     . ALA B 2 23  ? 1.134   20.567  -13.667 1.00 17.53 ?  254 ALA B C     1 
ATOM   2482 O  O     . ALA B 2 23  ? 2.297   20.156  -13.545 1.00 17.88 ?  254 ALA B O     1 
ATOM   2483 C  CB    . ALA B 2 23  ? 0.624   22.944  -12.946 1.00 16.98 ?  254 ALA B CB    1 
ATOM   2484 N  N     . PHE B 2 24  ? 0.074   19.813  -13.342 1.00 16.38 ?  255 PHE B N     1 
ATOM   2485 C  CA    . PHE B 2 24  ? 0.251   18.421  -12.911 1.00 16.56 ?  255 PHE B CA    1 
ATOM   2486 C  C     . PHE B 2 24  ? 0.972   17.615  -14.003 1.00 17.27 ?  255 PHE B C     1 
ATOM   2487 O  O     . PHE B 2 24  ? 1.905   16.854  -13.724 1.00 17.00 ?  255 PHE B O     1 
ATOM   2488 C  CB    . PHE B 2 24  ? -1.105  17.755  -12.602 1.00 15.82 ?  255 PHE B CB    1 
ATOM   2489 C  CG    . PHE B 2 24  ? -1.012  16.251  -12.563 1.00 15.26 ?  255 PHE B CG    1 
ATOM   2490 C  CD1   . PHE B 2 24  ? -0.429  15.589  -11.447 1.00 15.76 ?  255 PHE B CD1   1 
ATOM   2491 C  CD2   . PHE B 2 24  ? -1.430  15.476  -13.667 1.00 15.35 ?  255 PHE B CD2   1 
ATOM   2492 C  CE1   . PHE B 2 24  ? -0.254  14.169  -11.450 1.00 15.88 ?  255 PHE B CE1   1 
ATOM   2493 C  CE2   . PHE B 2 24  ? -1.274  14.081  -13.649 1.00 15.32 ?  255 PHE B CE2   1 
ATOM   2494 C  CZ    . PHE B 2 24  ? -0.715  13.403  -12.538 1.00 15.56 ?  255 PHE B CZ    1 
ATOM   2495 N  N     . LEU B 2 25  ? 0.532   17.767  -15.248 1.00 17.65 ?  256 LEU B N     1 
ATOM   2496 C  CA    . LEU B 2 25  ? 1.127   16.921  -16.311 1.00 17.56 ?  256 LEU B CA    1 
ATOM   2497 C  C     . LEU B 2 25  ? 2.625   17.184  -16.441 1.00 18.38 ?  256 LEU B C     1 
ATOM   2498 O  O     . LEU B 2 25  ? 3.445   16.247  -16.622 1.00 19.73 ?  256 LEU B O     1 
ATOM   2499 C  CB    . LEU B 2 25  ? 0.419   17.171  -17.636 1.00 18.19 ?  256 LEU B CB    1 
ATOM   2500 C  CG    . LEU B 2 25  ? -1.014  16.627  -17.712 1.00 19.04 ?  256 LEU B CG    1 
ATOM   2501 C  CD1   . LEU B 2 25  ? -1.688  17.050  -19.013 1.00 19.47 ?  256 LEU B CD1   1 
ATOM   2502 C  CD2   . LEU B 2 25  ? -1.035  15.087  -17.588 1.00 19.58 ?  256 LEU B CD2   1 
ATOM   2503 N  N     . ALA B 2 26  ? 2.972   18.464  -16.339 1.00 18.83 ?  257 ALA B N     1 
ATOM   2504 C  CA    . ALA B 2 26  ? 4.391   18.878  -16.479 1.00 18.38 ?  257 ALA B CA    1 
ATOM   2505 C  C     . ALA B 2 26  ? 5.209   18.330  -15.306 1.00 19.14 ?  257 ALA B C     1 
ATOM   2506 O  O     . ALA B 2 26  ? 6.289   17.755  -15.500 1.00 20.51 ?  257 ALA B O     1 
ATOM   2507 C  CB    . ALA B 2 26  ? 4.510   20.446  -16.590 1.00 18.71 ?  257 ALA B CB    1 
ATOM   2508 N  N     . GLN B 2 27  ? 4.694   18.460  -14.091 1.00 19.36 ?  258 GLN B N     1 
ATOM   2509 C  CA    . GLN B 2 27  ? 5.438   18.019  -12.924 1.00 19.64 ?  258 GLN B CA    1 
ATOM   2510 C  C     . GLN B 2 27  ? 5.495   16.493  -12.832 1.00 19.23 ?  258 GLN B C     1 
ATOM   2511 O  O     . GLN B 2 27  ? 6.520   15.925  -12.467 1.00 19.27 ?  258 GLN B O     1 
ATOM   2512 C  CB    . GLN B 2 27  ? 4.794   18.633  -11.683 1.00 21.70 ?  258 GLN B CB    1 
ATOM   2513 C  CG    . GLN B 2 27  ? 5.513   18.404  -10.360 1.00 24.27 ?  258 GLN B CG    1 
ATOM   2514 C  CD    . GLN B 2 27  ? 5.131   19.483  -9.297  1.00 29.27 ?  258 GLN B CD    1 
ATOM   2515 O  OE1   . GLN B 2 27  ? 5.022   20.708  -9.613  1.00 31.72 ?  258 GLN B OE1   1 
ATOM   2516 N  NE2   . GLN B 2 27  ? 4.993   19.054  -8.041  1.00 30.76 ?  258 GLN B NE2   1 
ATOM   2517 N  N     . PHE B 2 28  ? 4.389   15.816  -13.197 1.00 18.12 ?  259 PHE B N     1 
ATOM   2518 C  CA    . PHE B 2 28  ? 4.361   14.362  -13.142 1.00 16.85 ?  259 PHE B CA    1 
ATOM   2519 C  C     . PHE B 2 28  ? 5.358   13.787  -14.155 1.00 18.65 ?  259 PHE B C     1 
ATOM   2520 O  O     . PHE B 2 28  ? 6.005   12.767  -13.882 1.00 19.39 ?  259 PHE B O     1 
ATOM   2521 C  CB    . PHE B 2 28  ? 2.933   13.865  -13.408 1.00 17.88 ?  259 PHE B CB    1 
ATOM   2522 C  CG    . PHE B 2 28  ? 2.720   12.399  -13.065 1.00 17.34 ?  259 PHE B CG    1 
ATOM   2523 C  CD1   . PHE B 2 28  ? 2.606   11.962  -11.727 1.00 18.13 ?  259 PHE B CD1   1 
ATOM   2524 C  CD2   . PHE B 2 28  ? 2.635   11.467  -14.085 1.00 18.62 ?  259 PHE B CD2   1 
ATOM   2525 C  CE1   . PHE B 2 28  ? 2.390   10.606  -11.463 1.00 17.88 ?  259 PHE B CE1   1 
ATOM   2526 C  CE2   . PHE B 2 28  ? 2.439   10.128  -13.826 1.00 18.08 ?  259 PHE B CE2   1 
ATOM   2527 C  CZ    . PHE B 2 28  ? 2.329   9.680   -12.528 1.00 18.05 ?  259 PHE B CZ    1 
ATOM   2528 N  N     . SER B 2 29  ? 5.501   14.442  -15.326 1.00 20.13 ?  260 SER B N     1 
ATOM   2529 C  CA    . SER B 2 29  ? 6.489   14.000  -16.290 1.00 22.78 ?  260 SER B CA    1 
ATOM   2530 C  C     . SER B 2 29  ? 7.925   14.123  -15.700 1.00 22.72 ?  260 SER B C     1 
ATOM   2531 O  O     . SER B 2 29  ? 8.794   13.243  -15.881 1.00 24.55 ?  260 SER B O     1 
ATOM   2532 C  CB    . SER B 2 29  ? 6.360   14.821  -17.578 1.00 25.20 ?  260 SER B CB    1 
ATOM   2533 O  OG    . SER B 2 29  ? 7.317   14.350  -18.487 1.00 28.48 ?  260 SER B OG    1 
ATOM   2534 N  N     . GLN B 2 30  ? 8.179   15.219  -15.001 1.00 22.37 ?  261 GLN B N     1 
ATOM   2535 C  CA    . GLN B 2 30  ? 9.508   15.477  -14.419 1.00 23.87 ?  261 GLN B CA    1 
ATOM   2536 C  C     . GLN B 2 30  ? 9.796   14.471  -13.313 1.00 23.54 ?  261 GLN B C     1 
ATOM   2537 O  O     . GLN B 2 30  ? 10.953  14.107  -13.086 1.00 24.52 ?  261 GLN B O     1 
ATOM   2538 C  CB    . GLN B 2 30  ? 9.613   16.921  -13.937 1.00 27.30 ?  261 GLN B CB    1 
ATOM   2539 C  CG    . GLN B 2 30  ? 9.656   17.915  -15.124 1.00 32.38 ?  261 GLN B CG    1 
ATOM   2540 C  CD    . GLN B 2 30  ? 9.695   19.401  -14.705 1.00 38.28 ?  261 GLN B CD    1 
ATOM   2541 O  OE1   . GLN B 2 30  ? 9.685   19.742  -13.512 1.00 40.66 ?  261 GLN B OE1   1 
ATOM   2542 N  NE2   . GLN B 2 30  ? 9.759   20.286  -15.705 1.00 40.79 ?  261 GLN B NE2   1 
ATOM   2543 N  N     . LEU B 2 31  ? 8.747   13.941  -12.674 1.00 23.28 ?  262 LEU B N     1 
ATOM   2544 C  CA    . LEU B 2 31  ? 8.991   12.893  -11.661 1.00 25.60 ?  262 LEU B CA    1 
ATOM   2545 C  C     . LEU B 2 31  ? 9.630   11.622  -12.182 1.00 25.52 ?  262 LEU B C     1 
ATOM   2546 O  O     . LEU B 2 31  ? 10.337  10.924  -11.459 1.00 25.09 ?  262 LEU B O     1 
ATOM   2547 C  CB    . LEU B 2 31  ? 7.682   12.461  -10.963 1.00 27.44 ?  262 LEU B CB    1 
ATOM   2548 C  CG    . LEU B 2 31  ? 7.112   13.394  -9.925  1.00 27.85 ?  262 LEU B CG    1 
ATOM   2549 C  CD1   . LEU B 2 31  ? 5.817   12.792  -9.296  1.00 26.24 ?  262 LEU B CD1   1 
ATOM   2550 C  CD2   . LEU B 2 31  ? 8.143   13.712  -8.866  1.00 28.79 ?  262 LEU B CD2   1 
ATOM   2551 N  N     . GLU B 2 32  ? 9.339   11.281  -13.423 1.00 27.64 ?  263 GLU B N     1 
ATOM   2552 C  CA    . GLU B 2 32  ? 9.879   10.096  -13.994 1.00 29.31 ?  263 GLU B CA    1 
ATOM   2553 C  C     . GLU B 2 32  ? 11.415  10.143  -13.983 1.00 29.44 ?  263 GLU B C     1 
ATOM   2554 O  O     . GLU B 2 32  ? 12.083  9.124   -13.775 1.00 30.76 ?  263 GLU B O     1 
ATOM   2555 C  CB    . GLU B 2 32  ? 9.303   9.942   -15.405 1.00 32.12 ?  263 GLU B CB    1 
ATOM   2556 C  CG    . GLU B 2 32  ? 9.046   8.584   -15.757 1.00 33.26 ?  263 GLU B CG    1 
ATOM   2557 C  CD    . GLU B 2 32  ? 8.412   8.450   -17.117 1.00 32.92 ?  263 GLU B CD    1 
ATOM   2558 O  OE1   . GLU B 2 32  ? 7.326   9.045   -17.359 1.00 31.77 ?  263 GLU B OE1   1 
ATOM   2559 O  OE2   . GLU B 2 32  ? 9.017   7.743   -17.945 1.00 33.65 ?  263 GLU B OE2   1 
ATOM   2560 N  N     . ASP B 2 33  ? 11.990  11.327  -14.153 1.00 27.47 ?  264 ASP B N     1 
ATOM   2561 C  CA    . ASP B 2 33  ? 13.432  11.422  -14.155 1.00 28.70 ?  264 ASP B CA    1 
ATOM   2562 C  C     . ASP B 2 33  ? 14.020  11.308  -12.745 1.00 26.97 ?  264 ASP B C     1 
ATOM   2563 O  O     . ASP B 2 33  ? 15.155  10.854  -12.593 1.00 28.70 ?  264 ASP B O     1 
ATOM   2564 C  CB    . ASP B 2 33  ? 13.897  12.732  -14.796 1.00 31.93 ?  264 ASP B CB    1 
ATOM   2565 C  CG    . ASP B 2 33  ? 13.522  12.822  -16.266 1.00 36.52 ?  264 ASP B CG    1 
ATOM   2566 O  OD1   . ASP B 2 33  ? 13.358  11.763  -16.932 1.00 38.91 ?  264 ASP B OD1   1 
ATOM   2567 O  OD2   . ASP B 2 33  ? 13.369  13.957  -16.755 1.00 37.94 ?  264 ASP B OD2   1 
ATOM   2568 N  N     . LYS B 2 34  ? 13.245  11.689  -11.720 1.00 23.49 ?  265 LYS B N     1 
ATOM   2569 C  CA    . LYS B 2 34  ? 13.697  11.585  -10.338 1.00 23.53 ?  265 LYS B CA    1 
ATOM   2570 C  C     . LYS B 2 34  ? 13.579  10.152  -9.811  1.00 21.94 ?  265 LYS B C     1 
ATOM   2571 O  O     . LYS B 2 34  ? 14.234  9.807   -8.830  1.00 22.98 ?  265 LYS B O     1 
ATOM   2572 C  CB    . LYS B 2 34  ? 12.917  12.545  -9.466  1.00 26.82 ?  265 LYS B CB    1 
ATOM   2573 C  CG    . LYS B 2 34  ? 12.945  14.017  -9.943  1.00 31.37 ?  265 LYS B CG    1 
ATOM   2574 C  CD    . LYS B 2 34  ? 12.394  14.959  -8.828  1.00 35.69 ?  265 LYS B CD    1 
ATOM   2575 C  CE    . LYS B 2 34  ? 11.709  16.224  -9.372  1.00 39.20 ?  265 LYS B CE    1 
ATOM   2576 N  NZ    . LYS B 2 34  ? 12.612  17.270  -9.928  1.00 40.83 ?  265 LYS B NZ    1 
ATOM   2577 N  N     . PHE B 2 35  ? 12.725  9.331   -10.459 1.00 19.58 ?  266 PHE B N     1 
ATOM   2578 C  CA    . PHE B 2 35  ? 12.434  7.961   -10.019 1.00 18.23 ?  266 PHE B CA    1 
ATOM   2579 C  C     . PHE B 2 35  ? 12.619  6.983   -11.160 1.00 18.94 ?  266 PHE B C     1 
ATOM   2580 O  O     . PHE B 2 35  ? 11.644  6.461   -11.693 1.00 19.68 ?  266 PHE B O     1 
ATOM   2581 C  CB    . PHE B 2 35  ? 10.972  7.860   -9.482  1.00 17.86 ?  266 PHE B CB    1 
ATOM   2582 C  CG    . PHE B 2 35  ? 10.757  8.654   -8.240  1.00 18.21 ?  266 PHE B CG    1 
ATOM   2583 C  CD1   . PHE B 2 35  ? 10.990  8.067   -6.991  1.00 19.25 ?  266 PHE B CD1   1 
ATOM   2584 C  CD2   . PHE B 2 35  ? 10.402  10.000  -8.296  1.00 19.47 ?  266 PHE B CD2   1 
ATOM   2585 C  CE1   . PHE B 2 35  ? 10.799  8.795   -5.822  1.00 19.54 ?  266 PHE B CE1   1 
ATOM   2586 C  CE2   . PHE B 2 35  ? 10.210  10.754  -7.088  1.00 20.09 ?  266 PHE B CE2   1 
ATOM   2587 C  CZ    . PHE B 2 35  ? 10.446  10.124  -5.858  1.00 20.18 ?  266 PHE B CZ    1 
ATOM   2588 N  N     . PRO B 2 36  ? 13.870  6.747   -11.554 1.00 20.13 ?  267 PRO B N     1 
ATOM   2589 C  CA    . PRO B 2 36  ? 14.148  5.763   -12.591 1.00 21.64 ?  267 PRO B CA    1 
ATOM   2590 C  C     . PRO B 2 36  ? 13.793  4.349   -12.142 1.00 21.35 ?  267 PRO B C     1 
ATOM   2591 O  O     . PRO B 2 36  ? 13.643  4.061   -10.932 1.00 22.12 ?  267 PRO B O     1 
ATOM   2592 C  CB    . PRO B 2 36  ? 15.666  5.930   -12.817 1.00 22.61 ?  267 PRO B CB    1 
ATOM   2593 C  CG    . PRO B 2 36  ? 16.154  6.358   -11.442 1.00 22.91 ?  267 PRO B CG    1 
ATOM   2594 C  CD    . PRO B 2 36  ? 15.089  7.323   -10.972 1.00 21.12 ?  267 PRO B CD    1 
ATOM   2595 N  N     . GLY B 2 37  ? 13.656  3.464   -13.123 1.00 20.45 ?  268 GLY B N     1 
ATOM   2596 C  CA    . GLY B 2 37  ? 13.524  2.041   -12.837 1.00 21.27 ?  268 GLY B CA    1 
ATOM   2597 C  C     . GLY B 2 37  ? 12.146  1.567   -12.402 1.00 21.09 ?  268 GLY B C     1 
ATOM   2598 O  O     . GLY B 2 37  ? 12.019  0.454   -11.899 1.00 22.64 ?  268 GLY B O     1 
ATOM   2599 N  N     . GLN B 2 38  ? 11.119  2.365   -12.655 1.00 19.49 ?  269 GLN B N     1 
ATOM   2600 C  CA    . GLN B 2 38  ? 9.753   1.946   -12.299 1.00 18.23 ?  269 GLN B CA    1 
ATOM   2601 C  C     . GLN B 2 38  ? 9.028   1.302   -13.489 1.00 20.33 ?  269 GLN B C     1 
ATOM   2602 O  O     . GLN B 2 38  ? 9.366   1.549   -14.640 1.00 22.18 ?  269 GLN B O     1 
ATOM   2603 C  CB    . GLN B 2 38  ? 8.921   3.139   -11.811 1.00 17.92 ?  269 GLN B CB    1 
ATOM   2604 C  CG    . GLN B 2 38  ? 9.617   3.935   -10.683 1.00 17.02 ?  269 GLN B CG    1 
ATOM   2605 C  CD    . GLN B 2 38  ? 10.038  3.088   -9.515  1.00 17.83 ?  269 GLN B CD    1 
ATOM   2606 O  OE1   . GLN B 2 38  ? 9.269   2.242   -9.046  1.00 18.88 ?  269 GLN B OE1   1 
ATOM   2607 N  NE2   . GLN B 2 38  ? 11.281  3.315   -9.008  1.00 18.99 ?  269 GLN B NE2   1 
ATOM   2608 N  N     . SER B 2 39  ? 7.982   0.526   -13.176 1.00 20.17 ?  270 SER B N     1 
ATOM   2609 C  CA    . SER B 2 39  ? 7.107   -0.079  -14.183 1.00 21.54 ?  270 SER B CA    1 
ATOM   2610 C  C     . SER B 2 39  ? 6.551   0.998   -15.093 1.00 21.49 ?  270 SER B C     1 
ATOM   2611 O  O     . SER B 2 39  ? 6.013   2.014   -14.600 1.00 21.00 ?  270 SER B O     1 
ATOM   2612 C  CB    . SER B 2 39  ? 5.933   -0.812  -13.506 1.00 25.27 ?  270 SER B CB    1 
ATOM   2613 O  OG    . SER B 2 39  ? 6.369   -1.803  -12.562 1.00 27.44 ?  270 SER B OG    1 
ATOM   2614 N  N     . SER B 2 40  ? 6.596   0.797   -16.412 1.00 21.58 ?  271 SER B N     1 
ATOM   2615 C  CA    . SER B 2 40  ? 5.945   1.766   -17.280 1.00 21.71 ?  271 SER B CA    1 
ATOM   2616 C  C     . SER B 2 40  ? 4.440   1.961   -16.943 1.00 20.72 ?  271 SER B C     1 
ATOM   2617 O  O     . SER B 2 40  ? 3.938   3.063   -17.106 1.00 20.98 ?  271 SER B O     1 
ATOM   2618 C  CB    . SER B 2 40  ? 6.130   1.370   -18.756 1.00 26.52 ?  271 SER B CB    1 
ATOM   2619 O  OG    . SER B 2 40  ? 5.391   0.220   -19.034 1.00 30.46 ?  271 SER B OG    1 
ATOM   2620 N  N     . PHE B 2 41  ? 3.728   0.930   -16.478 1.00 19.96 ?  272 PHE B N     1 
ATOM   2621 C  CA    . PHE B 2 41  ? 2.310   1.136   -16.198 1.00 18.51 ?  272 PHE B CA    1 
ATOM   2622 C  C     . PHE B 2 41  ? 2.104   2.040   -14.968 1.00 18.10 ?  272 PHE B C     1 
ATOM   2623 O  O     . PHE B 2 41  ? 1.007   2.604   -14.803 1.00 18.62 ?  272 PHE B O     1 
ATOM   2624 C  CB    . PHE B 2 41  ? 1.496   -0.196  -16.071 1.00 19.37 ?  272 PHE B CB    1 
ATOM   2625 C  CG    . PHE B 2 41  ? 1.756   -1.046  -14.825 1.00 20.15 ?  272 PHE B CG    1 
ATOM   2626 C  CD1   . PHE B 2 41  ? 1.028   -0.826  -13.656 1.00 20.57 ?  272 PHE B CD1   1 
ATOM   2627 C  CD2   . PHE B 2 41  ? 2.678   -2.119  -14.851 1.00 21.26 ?  272 PHE B CD2   1 
ATOM   2628 C  CE1   . PHE B 2 41  ? 1.234   -1.621  -12.507 1.00 21.83 ?  272 PHE B CE1   1 
ATOM   2629 C  CE2   . PHE B 2 41  ? 2.891   -2.911  -13.737 1.00 21.61 ?  272 PHE B CE2   1 
ATOM   2630 C  CZ    . PHE B 2 41  ? 2.158   -2.676  -12.544 1.00 22.07 ?  272 PHE B CZ    1 
ATOM   2631 N  N     . LEU B 2 42  ? 3.094   2.152   -14.087 1.00 17.97 ?  273 LEU B N     1 
ATOM   2632 C  CA    . LEU B 2 42  ? 2.949   3.124   -13.003 1.00 17.04 ?  273 LEU B CA    1 
ATOM   2633 C  C     . LEU B 2 42  ? 2.787   4.553   -13.546 1.00 17.47 ?  273 LEU B C     1 
ATOM   2634 O  O     . LEU B 2 42  ? 1.848   5.276   -13.187 1.00 17.51 ?  273 LEU B O     1 
ATOM   2635 C  CB    . LEU B 2 42  ? 4.189   3.026   -12.077 1.00 16.90 ?  273 LEU B CB    1 
ATOM   2636 C  CG    . LEU B 2 42  ? 4.180   3.921   -10.827 1.00 17.24 ?  273 LEU B CG    1 
ATOM   2637 C  CD1   . LEU B 2 42  ? 5.073   3.356   -9.774  1.00 18.79 ?  273 LEU B CD1   1 
ATOM   2638 C  CD2   . LEU B 2 42  ? 4.576   5.370   -11.125 1.00 18.62 ?  273 LEU B CD2   1 
ATOM   2639 N  N     . TRP B 2 43  ? 3.651   4.970   -14.469 1.00 16.63 ?  274 TRP B N     1 
ATOM   2640 C  CA    . TRP B 2 43  ? 3.529   6.320   -14.995 1.00 16.86 ?  274 TRP B CA    1 
ATOM   2641 C  C     . TRP B 2 43  ? 2.310   6.459   -15.915 1.00 17.08 ?  274 TRP B C     1 
ATOM   2642 O  O     . TRP B 2 43  ? 1.624   7.464   -15.864 1.00 17.72 ?  274 TRP B O     1 
ATOM   2643 C  CB    . TRP B 2 43  ? 4.783   6.736   -15.792 1.00 17.64 ?  274 TRP B CB    1 
ATOM   2644 C  CG    . TRP B 2 43  ? 6.034   6.579   -14.941 1.00 17.65 ?  274 TRP B CG    1 
ATOM   2645 C  CD1   . TRP B 2 43  ? 7.084   5.712   -15.154 1.00 18.08 ?  274 TRP B CD1   1 
ATOM   2646 C  CD2   . TRP B 2 43  ? 6.342   7.307   -13.759 1.00 17.27 ?  274 TRP B CD2   1 
ATOM   2647 N  NE1   . TRP B 2 43  ? 8.043   5.878   -14.181 1.00 17.89 ?  274 TRP B NE1   1 
ATOM   2648 C  CE2   . TRP B 2 43  ? 7.603   6.851   -13.301 1.00 17.40 ?  274 TRP B CE2   1 
ATOM   2649 C  CE3   . TRP B 2 43  ? 5.673   8.318   -13.036 1.00 17.72 ?  274 TRP B CE3   1 
ATOM   2650 C  CZ2   . TRP B 2 43  ? 8.210   7.358   -12.158 1.00 18.51 ?  274 TRP B CZ2   1 
ATOM   2651 C  CZ3   . TRP B 2 43  ? 6.275   8.812   -11.894 1.00 17.97 ?  274 TRP B CZ3   1 
ATOM   2652 C  CH2   . TRP B 2 43  ? 7.526   8.303   -11.442 1.00 19.05 ?  274 TRP B CH2   1 
ATOM   2653 N  N     . GLN B 2 44  ? 2.046   5.451   -16.734 1.00 17.24 ?  275 GLN B N     1 
ATOM   2654 C  CA    . GLN B 2 44  ? 0.932   5.550   -17.682 1.00 17.69 ?  275 GLN B CA    1 
ATOM   2655 C  C     . GLN B 2 44  ? -0.413  5.572   -16.932 1.00 17.15 ?  275 GLN B C     1 
ATOM   2656 O  O     . GLN B 2 44  ? -1.287  6.440   -17.192 1.00 17.62 ?  275 GLN B O     1 
ATOM   2657 C  CB    . GLN B 2 44  ? 0.954   4.383   -18.662 1.00 21.32 ?  275 GLN B CB    1 
ATOM   2658 C  CG    . GLN B 2 44  ? -0.032  4.623   -19.770 1.00 29.30 ?  275 GLN B CG    1 
ATOM   2659 C  CD    . GLN B 2 44  ? -0.074  3.484   -20.777 1.00 36.46 ?  275 GLN B CD    1 
ATOM   2660 O  OE1   . GLN B 2 44  ? -0.152  2.314   -20.382 1.00 40.35 ?  275 GLN B OE1   1 
ATOM   2661 N  NE2   . GLN B 2 44  ? -0.078  3.810   -22.077 1.00 38.13 ?  275 GLN B NE2   1 
ATOM   2662 N  N     . ARG B 2 45  ? -0.646  4.579   -16.068 1.00 16.19 ?  276 ARG B N     1 
ATOM   2663 C  CA    . ARG B 2 45  ? -1.922  4.549   -15.370 1.00 16.19 ?  276 ARG B CA    1 
ATOM   2664 C  C     . ARG B 2 45  ? -2.051  5.673   -14.366 1.00 15.67 ?  276 ARG B C     1 
ATOM   2665 O  O     . ARG B 2 45  ? -3.156  6.235   -14.220 1.00 15.65 ?  276 ARG B O     1 
ATOM   2666 C  CB    . ARG B 2 45  ? -2.129  3.196   -14.698 1.00 15.39 ?  276 ARG B CB    1 
ATOM   2667 C  CG    . ARG B 2 45  ? -2.257  2.052   -15.739 1.00 19.42 ?  276 ARG B CG    1 
ATOM   2668 C  CD    . ARG B 2 45  ? -2.595  0.721   -15.058 1.00 23.09 ?  276 ARG B CD    1 
ATOM   2669 N  NE    . ARG B 2 45  ? -2.796  -0.376  -16.005 1.00 26.93 ?  276 ARG B NE    1 
ATOM   2670 C  CZ    . ARG B 2 45  ? -3.291  -1.569  -15.651 1.00 28.97 ?  276 ARG B CZ    1 
ATOM   2671 N  NH1   . ARG B 2 45  ? -3.646  -1.806  -14.391 1.00 28.90 ?  276 ARG B NH1   1 
ATOM   2672 N  NH2   . ARG B 2 45  ? -3.466  -2.500  -16.553 1.00 31.89 ?  276 ARG B NH2   1 
ATOM   2673 N  N     . GLY B 2 46  ? -0.970  6.000   -13.667 1.00 14.78 ?  277 GLY B N     1 
ATOM   2674 C  CA    . GLY B 2 46  ? -1.072  7.105   -12.707 1.00 15.67 ?  277 GLY B CA    1 
ATOM   2675 C  C     . GLY B 2 46  ? -1.418  8.431   -13.394 1.00 16.01 ?  277 GLY B C     1 
ATOM   2676 O  O     . GLY B 2 46  ? -2.251  9.217   -12.915 1.00 16.05 ?  277 GLY B O     1 
ATOM   2677 N  N     . ARG B 2 47  ? -0.785  8.711   -14.532 1.00 15.78 ?  278 ARG B N     1 
ATOM   2678 C  CA    . ARG B 2 47  ? -1.093  9.935   -15.243 1.00 15.93 ?  278 ARG B CA    1 
ATOM   2679 C  C     . ARG B 2 47  ? -2.552  9.929   -15.680 1.00 15.85 ?  278 ARG B C     1 
ATOM   2680 O  O     . ARG B 2 47  ? -3.262  10.904  -15.481 1.00 16.40 ?  278 ARG B O     1 
ATOM   2681 C  CB    . ARG B 2 47  ? -0.232  10.073  -16.519 1.00 17.42 ?  278 ARG B CB    1 
ATOM   2682 C  CG    . ARG B 2 47  ? -0.470  11.362  -17.268 1.00 21.36 ?  278 ARG B CG    1 
ATOM   2683 C  CD    . ARG B 2 47  ? 0.354   11.502  -18.567 1.00 25.58 ?  278 ARG B CD    1 
ATOM   2684 N  NE    . ARG B 2 47  ? 0.557   10.219  -19.229 1.00 33.63 ?  278 ARG B NE    1 
ATOM   2685 C  CZ    . ARG B 2 47  ? -0.185  9.707   -20.203 1.00 37.90 ?  278 ARG B CZ    1 
ATOM   2686 N  NH1   . ARG B 2 47  ? -1.246  10.378  -20.674 1.00 40.23 ?  278 ARG B NH1   1 
ATOM   2687 N  NH2   . ARG B 2 47  ? 0.166   8.518   -20.721 1.00 38.35 ?  278 ARG B NH2   1 
ATOM   2688 N  N     . LYS B 2 48  ? -3.010  8.842   -16.312 1.00 15.61 ?  279 LYS B N     1 
ATOM   2689 C  CA    . LYS B 2 48  ? -4.392  8.853   -16.854 1.00 15.89 ?  279 LYS B CA    1 
ATOM   2690 C  C     . LYS B 2 48  ? -5.422  8.945   -15.737 1.00 16.06 ?  279 LYS B C     1 
ATOM   2691 O  O     . LYS B 2 48  ? -6.434  9.647   -15.887 1.00 16.12 ?  279 LYS B O     1 
ATOM   2692 C  CB    . LYS B 2 48  ? -4.614  7.602   -17.711 1.00 17.34 ?  279 LYS B CB    1 
ATOM   2693 C  CG    . LYS B 2 48  ? -3.836  7.694   -19.007 1.00 21.10 ?  279 LYS B CG    1 
ATOM   2694 C  CD    . LYS B 2 48  ? -4.106  6.469   -19.882 1.00 25.60 ?  279 LYS B CD    1 
ATOM   2695 C  CE    . LYS B 2 48  ? -3.368  6.617   -21.231 1.00 27.82 ?  279 LYS B CE    1 
ATOM   2696 N  NZ    . LYS B 2 48  ? -3.811  5.701   -22.328 1.00 30.33 ?  279 LYS B NZ    1 
ATOM   2697 N  N     . PHE B 2 49  ? -5.170  8.272   -14.629 1.00 15.66 ?  280 PHE B N     1 
ATOM   2698 C  CA    . PHE B 2 49  ? -6.126  8.292   -13.511 1.00 15.16 ?  280 PHE B CA    1 
ATOM   2699 C  C     . PHE B 2 49  ? -6.216  9.693   -12.867 1.00 14.97 ?  280 PHE B C     1 
ATOM   2700 O  O     . PHE B 2 49  ? -7.315  10.229  -12.670 1.00 14.68 ?  280 PHE B O     1 
ATOM   2701 C  CB    . PHE B 2 49  ? -5.647  7.271   -12.490 1.00 14.15 ?  280 PHE B CB    1 
ATOM   2702 C  CG    . PHE B 2 49  ? -6.531  7.108   -11.276 1.00 15.53 ?  280 PHE B CG    1 
ATOM   2703 C  CD1   . PHE B 2 49  ? -7.768  6.512   -11.370 1.00 19.12 ?  280 PHE B CD1   1 
ATOM   2704 C  CD2   . PHE B 2 49  ? -6.119  7.546   -10.037 1.00 15.46 ?  280 PHE B CD2   1 
ATOM   2705 C  CE1   . PHE B 2 49  ? -8.571  6.289   -10.236 1.00 19.70 ?  280 PHE B CE1   1 
ATOM   2706 C  CE2   . PHE B 2 49  ? -6.908  7.336   -8.863  1.00 15.59 ?  280 PHE B CE2   1 
ATOM   2707 C  CZ    . PHE B 2 49  ? -8.149  6.706   -9.014  1.00 17.30 ?  280 PHE B CZ    1 
ATOM   2708 N  N     . LEU B 2 50  ? -5.054  10.290  -12.539 1.00 14.38 ?  281 LEU B N     1 
ATOM   2709 C  CA    . LEU B 2 50  ? -5.122  11.625  -11.946 1.00 14.74 ?  281 LEU B CA    1 
ATOM   2710 C  C     . LEU B 2 50  ? -5.574  12.713  -12.913 1.00 14.26 ?  281 LEU B C     1 
ATOM   2711 O  O     . LEU B 2 50  ? -6.295  13.636  -12.507 1.00 14.64 ?  281 LEU B O     1 
ATOM   2712 C  CB    . LEU B 2 50  ? -3.774  11.990  -11.285 1.00 15.98 ?  281 LEU B CB    1 
ATOM   2713 C  CG    . LEU B 2 50  ? -3.415  11.019  -10.144 1.00 15.62 ?  281 LEU B CG    1 
ATOM   2714 C  CD1   . LEU B 2 50  ? -1.983  11.237  -9.630  1.00 17.23 ?  281 LEU B CD1   1 
ATOM   2715 C  CD2   . LEU B 2 50  ? -4.413  11.150  -8.934  1.00 16.94 ?  281 LEU B CD2   1 
ATOM   2716 N  N     . GLN B 2 51  ? -5.189  12.596  -14.197 1.00 14.50 ?  282 GLN B N     1 
ATOM   2717 C  CA    . GLN B 2 51  ? -5.621  13.559  -15.209 1.00 16.03 ?  282 GLN B CA    1 
ATOM   2718 C  C     . GLN B 2 51  ? -7.161  13.580  -15.318 1.00 16.32 ?  282 GLN B C     1 
ATOM   2719 O  O     . GLN B 2 51  ? -7.772  14.664  -15.411 1.00 16.55 ?  282 GLN B O     1 
ATOM   2720 C  CB    . GLN B 2 51  ? -4.984  13.220  -16.543 1.00 20.18 ?  282 GLN B CB    1 
ATOM   2721 C  CG    . GLN B 2 51  ? -5.686  13.660  -17.767 1.00 24.90 ?  282 GLN B CG    1 
ATOM   2722 C  CD    . GLN B 2 51  ? -4.852  13.231  -18.937 1.00 28.99 ?  282 GLN B CD    1 
ATOM   2723 O  OE1   . GLN B 2 51  ? -3.897  13.892  -19.268 1.00 31.86 ?  282 GLN B OE1   1 
ATOM   2724 N  NE2   . GLN B 2 51  ? -5.197  12.102  -19.552 1.00 28.42 ?  282 GLN B NE2   1 
ATOM   2725 N  N     . LYS B 2 52  ? -7.776  12.394  -15.250 1.00 15.56 ?  283 LYS B N     1 
ATOM   2726 C  CA    . LYS B 2 52  ? -9.233  12.315  -15.404 1.00 16.83 ?  283 LYS B CA    1 
ATOM   2727 C  C     . LYS B 2 52  ? -9.904  13.084  -14.286 1.00 14.86 ?  283 LYS B C     1 
ATOM   2728 O  O     . LYS B 2 52  ? -10.868 13.809  -14.489 1.00 16.97 ?  283 LYS B O     1 
ATOM   2729 C  CB    . LYS B 2 52  ? -9.677  10.854  -15.415 1.00 18.84 ?  283 LYS B CB    1 
ATOM   2730 C  CG    . LYS B 2 52  ? -11.193 10.581  -15.646 1.00 21.07 ?  283 LYS B CG    1 
ATOM   2731 C  CD    . LYS B 2 52  ? -11.486 10.674  -17.132 1.00 22.57 ?  283 LYS B CD    1 
ATOM   2732 C  CE    . LYS B 2 52  ? -13.009 10.596  -17.472 1.00 26.40 ?  283 LYS B CE    1 
ATOM   2733 N  NZ    . LYS B 2 52  ? -13.566 9.262   -17.298 1.00 29.56 ?  283 LYS B NZ    1 
ATOM   2734 N  N     . HIS B 2 53  ? -9.355  12.956  -13.072 1.00 14.39 ?  284 HIS B N     1 
ATOM   2735 C  CA    A HIS B 2 53  ? -9.904  13.636  -11.933 0.55 15.33 ?  284 HIS B CA    1 
ATOM   2736 C  CA    B HIS B 2 53  ? -9.916  13.625  -11.907 0.45 15.37 ?  284 HIS B CA    1 
ATOM   2737 C  C     . HIS B 2 53  ? -9.669  15.154  -11.994 1.00 16.08 ?  284 HIS B C     1 
ATOM   2738 O  O     . HIS B 2 53  ? -10.574 15.956  -11.738 1.00 16.83 ?  284 HIS B O     1 
ATOM   2739 C  CB    A HIS B 2 53  ? -9.302  13.039  -10.669 0.55 15.94 ?  284 HIS B CB    1 
ATOM   2740 C  CB    B HIS B 2 53  ? -9.327  12.979  -10.622 0.45 16.05 ?  284 HIS B CB    1 
ATOM   2741 C  CG    A HIS B 2 53  ? -10.063 13.428  -9.467  0.55 15.65 ?  284 HIS B CG    1 
ATOM   2742 C  CG    B HIS B 2 53  ? -10.093 11.775  -10.153 0.45 16.15 ?  284 HIS B CG    1 
ATOM   2743 N  ND1   A HIS B 2 53  ? -9.637  14.411  -8.606  0.55 16.87 ?  284 HIS B ND1   1 
ATOM   2744 N  ND1   B HIS B 2 53  ? -9.771  10.478  -10.501 0.45 17.26 ?  284 HIS B ND1   1 
ATOM   2745 C  CD2   A HIS B 2 53  ? -11.263 13.007  -9.001  0.55 15.38 ?  284 HIS B CD2   1 
ATOM   2746 C  CD2   B HIS B 2 53  ? -11.177 11.678  -9.345  0.45 15.38 ?  284 HIS B CD2   1 
ATOM   2747 C  CE1   A HIS B 2 53  ? -10.520 14.542  -7.632  0.55 15.18 ?  284 HIS B CE1   1 
ATOM   2748 C  CE1   B HIS B 2 53  ? -10.624 9.635   -9.927  0.45 15.34 ?  284 HIS B CE1   1 
ATOM   2749 N  NE2   A HIS B 2 53  ? -11.552 13.768  -7.898  0.55 14.36 ?  284 HIS B NE2   1 
ATOM   2750 N  NE2   B HIS B 2 53  ? -11.490 10.340  -9.236  0.45 16.82 ?  284 HIS B NE2   1 
ATOM   2751 N  N     . LEU B 2 54  ? -8.464  15.570  -12.376 1.00 16.54 ?  285 LEU B N     1 
ATOM   2752 C  CA    . LEU B 2 54  ? -8.180  16.990  -12.487 1.00 16.89 ?  285 LEU B CA    1 
ATOM   2753 C  C     . LEU B 2 54  ? -8.999  17.667  -13.580 1.00 18.49 ?  285 LEU B C     1 
ATOM   2754 O  O     . LEU B 2 54  ? -9.259  18.881  -13.528 1.00 19.55 ?  285 LEU B O     1 
ATOM   2755 C  CB    . LEU B 2 54  ? -6.686  17.217  -12.761 1.00 17.24 ?  285 LEU B CB    1 
ATOM   2756 C  CG    . LEU B 2 54  ? -5.861  16.970  -11.504 1.00 17.73 ?  285 LEU B CG    1 
ATOM   2757 C  CD1   . LEU B 2 54  ? -4.396  16.690  -11.955 1.00 19.56 ?  285 LEU B CD1   1 
ATOM   2758 C  CD2   . LEU B 2 54  ? -5.920  18.153  -10.506 1.00 20.29 ?  285 LEU B CD2   1 
ATOM   2759 N  N     . ASN B 2 55  ? -9.371  16.901  -14.597 1.00 18.53 ?  286 ASN B N     1 
ATOM   2760 C  CA    . ASN B 2 55  ? -10.120 17.484  -15.716 1.00 20.72 ?  286 ASN B CA    1 
ATOM   2761 C  C     . ASN B 2 55  ? -11.632 17.492  -15.472 1.00 20.87 ?  286 ASN B C     1 
ATOM   2762 O  O     . ASN B 2 55  ? -12.383 18.049  -16.266 1.00 23.22 ?  286 ASN B O     1 
ATOM   2763 C  CB    . ASN B 2 55  ? -9.813  16.722  -16.996 1.00 25.36 ?  286 ASN B CB    1 
ATOM   2764 C  CG    . ASN B 2 55  ? -10.032 17.577  -18.224 1.00 31.19 ?  286 ASN B CG    1 
ATOM   2765 O  OD1   . ASN B 2 55  ? -9.707  18.771  -18.244 1.00 33.46 ?  286 ASN B OD1   1 
ATOM   2766 N  ND2   . ASN B 2 55  ? -10.656 17.008  -19.197 1.00 33.21 ?  286 ASN B ND2   1 
ATOM   2767 N  N     . ALA B 2 56  ? -12.080 16.846  -14.398 1.00 19.76 ?  287 ALA B N     1 
ATOM   2768 C  CA    . ALA B 2 56  ? -13.504 16.736  -14.113 1.00 20.77 ?  287 ALA B CA    1 
ATOM   2769 C  C     . ALA B 2 56  ? -14.043 18.021  -13.534 1.00 24.23 ?  287 ALA B C     1 
ATOM   2770 O  O     . ALA B 2 56  ? -13.571 18.493  -12.511 1.00 25.80 ?  287 ALA B O     1 
ATOM   2771 C  CB    . ALA B 2 56  ? -13.781 15.587  -13.172 1.00 20.58 ?  287 ALA B CB    1 
ATOM   2772 N  N     . SER B 2 57  ? -15.065 18.558  -14.179 1.00 28.39 ?  288 SER B N     1 
ATOM   2773 C  CA    . SER B 2 57  ? -15.697 19.767  -13.675 1.00 33.47 ?  288 SER B CA    1 
ATOM   2774 C  C     . SER B 2 57  ? -16.465 19.496  -12.401 1.00 34.46 ?  288 SER B C     1 
ATOM   2775 O  O     . SER B 2 57  ? -16.496 20.327  -11.490 1.00 36.65 ?  288 SER B O     1 
ATOM   2776 C  CB    . SER B 2 57  ? -16.636 20.377  -14.708 1.00 36.95 ?  288 SER B CB    1 
ATOM   2777 O  OG    . SER B 2 57  ? -16.823 19.490  -15.802 1.00 40.72 ?  288 SER B OG    1 
ATOM   2778 N  N     . ASN B 2 58  ? -17.084 18.336  -12.320 1.00 32.51 ?  289 ASN B N     1 
ATOM   2779 C  CA    . ASN B 2 58  ? -17.849 18.037  -11.100 1.00 32.75 ?  289 ASN B CA    1 
ATOM   2780 C  C     . ASN B 2 58  ? -17.591 16.585  -10.722 1.00 29.02 ?  289 ASN B C     1 
ATOM   2781 O  O     . ASN B 2 58  ? -18.427 15.722  -10.967 1.00 28.34 ?  289 ASN B O     1 
ATOM   2782 C  CB    . ASN B 2 58  ? -19.338 18.317  -11.309 1.00 37.51 ?  289 ASN B CB    1 
ATOM   2783 C  CG    . ASN B 2 58  ? -19.654 19.801  -11.336 1.00 41.55 ?  289 ASN B CG    1 
ATOM   2784 O  OD1   . ASN B 2 58  ? -20.073 20.342  -12.359 1.00 43.65 ?  289 ASN B OD1   1 
ATOM   2785 N  ND2   . ASN B 2 58  ? -19.445 20.470  -10.211 1.00 43.08 ?  289 ASN B ND2   1 
ATOM   2786 N  N     . PRO B 2 59  ? -16.409 16.299  -10.150 1.00 27.83 ?  290 PRO B N     1 
ATOM   2787 C  CA    . PRO B 2 59  ? -16.069 14.897  -9.896  1.00 25.57 ?  290 PRO B CA    1 
ATOM   2788 C  C     . PRO B 2 59  ? -17.063 14.217  -8.967  1.00 23.03 ?  290 PRO B C     1 
ATOM   2789 O  O     . PRO B 2 59  ? -17.631 14.836  -8.064  1.00 25.09 ?  290 PRO B O     1 
ATOM   2790 C  CB    . PRO B 2 59  ? -14.687 14.979  -9.231  1.00 26.90 ?  290 PRO B CB    1 
ATOM   2791 C  CG    . PRO B 2 59  ? -14.692 16.385  -8.630  1.00 28.77 ?  290 PRO B CG    1 
ATOM   2792 C  CD    . PRO B 2 59  ? -15.387 17.218  -9.624  1.00 28.47 ?  290 PRO B CD    1 
ATOM   2793 N  N     . THR B 2 60  ? -17.322 12.951  -9.230  1.00 21.56 ?  291 THR B N     1 
ATOM   2794 C  CA    . THR B 2 60  ? -18.276 12.194  -8.434  1.00 20.87 ?  291 THR B CA    1 
ATOM   2795 C  C     . THR B 2 60  ? -17.601 11.527  -7.217  1.00 18.05 ?  291 THR B C     1 
ATOM   2796 O  O     . THR B 2 60  ? -18.275 11.071  -6.327  1.00 15.99 ?  291 THR B O     1 
ATOM   2797 C  CB    . THR B 2 60  ? -18.983 11.098  -9.286  1.00 24.09 ?  291 THR B CB    1 
ATOM   2798 O  OG1   . THR B 2 60  ? -18.024 10.203  -9.879  1.00 25.99 ?  291 THR B OG1   1 
ATOM   2799 C  CG2   . THR B 2 60  ? -19.859 11.700  -10.390 1.00 26.39 ?  291 THR B CG2   1 
ATOM   2800 N  N     . GLU B 2 61  ? -16.275 11.431  -7.235  1.00 16.10 ?  292 GLU B N     1 
ATOM   2801 C  CA    . GLU B 2 61  ? -15.539 10.761  -6.156  1.00 16.26 ?  292 GLU B CA    1 
ATOM   2802 C  C     . GLU B 2 61  ? -14.085 11.188  -6.227  1.00 14.53 ?  292 GLU B C     1 
ATOM   2803 O  O     . GLU B 2 61  ? -13.612 11.654  -7.271  1.00 14.80 ?  292 GLU B O     1 
ATOM   2804 C  CB    . GLU B 2 61  ? -15.654 9.235   -6.253  1.00 18.34 ?  292 GLU B CB    1 
ATOM   2805 C  CG    . GLU B 2 61  ? -14.883 8.665   -7.400  1.00 20.97 ?  292 GLU B CG    1 
ATOM   2806 C  CD    . GLU B 2 61  ? -14.929 7.120   -7.456  1.00 24.72 ?  292 GLU B CD    1 
ATOM   2807 O  OE1   . GLU B 2 61  ? -14.708 6.391   -6.475  1.00 26.81 ?  292 GLU B OE1   1 
ATOM   2808 O  OE2   . GLU B 2 61  ? -15.175 6.615   -8.529  1.00 29.52 ?  292 GLU B OE2   1 
ATOM   2809 N  N     . PRO B 2 62  ? -13.389 11.112  -5.089  1.00 14.70 ?  293 PRO B N     1 
ATOM   2810 C  CA    . PRO B 2 62  ? -11.974 11.469  -5.035  1.00 13.59 ?  293 PRO B CA    1 
ATOM   2811 C  C     . PRO B 2 62  ? -11.112 10.445  -5.764  1.00 14.50 ?  293 PRO B C     1 
ATOM   2812 O  O     . PRO B 2 62  ? -11.581 9.338   -6.104  1.00 16.89 ?  293 PRO B O     1 
ATOM   2813 C  CB    . PRO B 2 62  ? -11.662 11.459  -3.526  1.00 17.02 ?  293 PRO B CB    1 
ATOM   2814 C  CG    . PRO B 2 62  ? -12.630 10.459  -2.980  1.00 17.31 ?  293 PRO B CG    1 
ATOM   2815 C  CD    . PRO B 2 62  ? -13.896 10.623  -3.780  1.00 16.97 ?  293 PRO B CD    1 
ATOM   2816 N  N     . ALA B 2 63  ? -9.886  10.849  -6.052  1.00 14.31 ?  294 ALA B N     1 
ATOM   2817 C  CA    . ALA B 2 63  ? -8.912  9.959   -6.684  1.00 15.01 ?  294 ALA B CA    1 
ATOM   2818 C  C     . ALA B 2 63  ? -8.065  9.271   -5.624  1.00 15.86 ?  294 ALA B C     1 
ATOM   2819 O  O     . ALA B 2 63  ? -7.235  9.922   -5.034  1.00 19.13 ?  294 ALA B O     1 
ATOM   2820 C  CB    . ALA B 2 63  ? -7.990  10.742  -7.611  1.00 15.48 ?  294 ALA B CB    1 
ATOM   2821 N  N     . THR B 2 64  ? -8.215  7.975   -5.450  1.00 13.70 ?  295 THR B N     1 
ATOM   2822 C  CA    . THR B 2 64  ? -7.429  7.223   -4.438  1.00 13.55 ?  295 THR B CA    1 
ATOM   2823 C  C     . THR B 2 64  ? -6.488  6.258   -5.142  1.00 13.19 ?  295 THR B C     1 
ATOM   2824 O  O     . THR B 2 64  ? -6.940  5.471   -5.992  1.00 14.80 ?  295 THR B O     1 
ATOM   2825 C  CB    . THR B 2 64  ? -8.338  6.382   -3.495  1.00 15.16 ?  295 THR B CB    1 
ATOM   2826 O  OG1   . THR B 2 64  ? -9.277  7.283   -2.890  1.00 16.91 ?  295 THR B OG1   1 
ATOM   2827 C  CG2   . THR B 2 64  ? -7.503  5.665   -2.370  1.00 15.21 ?  295 THR B CG2   1 
ATOM   2828 N  N     A ILE B 2 65  ? -5.194  6.347   -4.801  0.60 12.84 ?  296 ILE B N     1 
ATOM   2829 N  N     B ILE B 2 65  ? -5.227  6.249   -4.735  0.40 13.28 ?  296 ILE B N     1 
ATOM   2830 C  CA    A ILE B 2 65  ? -4.128  5.500   -5.375  0.60 12.47 ?  296 ILE B CA    1 
ATOM   2831 C  CA    B ILE B 2 65  ? -4.224  5.479   -5.450  0.40 13.29 ?  296 ILE B CA    1 
ATOM   2832 C  C     A ILE B 2 65  ? -3.448  4.774   -4.242  0.60 12.28 ?  296 ILE B C     1 
ATOM   2833 C  C     B ILE B 2 65  ? -3.322  4.840   -4.378  0.40 12.76 ?  296 ILE B C     1 
ATOM   2834 O  O     A ILE B 2 65  ? -3.229  5.373   -3.188  0.60 13.56 ?  296 ILE B O     1 
ATOM   2835 O  O     B ILE B 2 65  ? -2.915  5.544   -3.446  0.40 13.25 ?  296 ILE B O     1 
ATOM   2836 C  CB    A ILE B 2 65  ? -3.052  6.306   -6.115  0.60 13.80 ?  296 ILE B CB    1 
ATOM   2837 C  CB    B ILE B 2 65  ? -3.486  6.416   -6.461  0.40 14.99 ?  296 ILE B CB    1 
ATOM   2838 C  CG1   A ILE B 2 65  ? -3.624  6.960   -7.365  0.60 15.45 ?  296 ILE B CG1   1 
ATOM   2839 C  CG1   B ILE B 2 65  ? -2.431  5.675   -7.282  0.40 16.07 ?  296 ILE B CG1   1 
ATOM   2840 C  CG2   A ILE B 2 65  ? -1.833  5.395   -6.538  0.60 13.61 ?  296 ILE B CG2   1 
ATOM   2841 C  CG2   B ILE B 2 65  ? -2.934  7.653   -5.766  0.40 15.12 ?  296 ILE B CG2   1 
ATOM   2842 C  CD1   A ILE B 2 65  ? -2.632  7.879   -8.077  0.60 17.04 ?  296 ILE B CD1   1 
ATOM   2843 C  CD1   B ILE B 2 65  ? -1.967  6.469   -8.530  0.40 16.42 ?  296 ILE B CD1   1 
ATOM   2844 N  N     . ILE B 2 66  ? -3.084  3.523   -4.456  1.00 13.06 ?  297 ILE B N     1 
ATOM   2845 C  CA    . ILE B 2 66  ? -2.150  2.815   -3.530  1.00 13.07 ?  297 ILE B CA    1 
ATOM   2846 C  C     . ILE B 2 66  ? -0.824  2.577   -4.220  1.00 13.53 ?  297 ILE B C     1 
ATOM   2847 O  O     . ILE B 2 66  ? -0.777  1.969   -5.276  1.00 15.71 ?  297 ILE B O     1 
ATOM   2848 C  CB    . ILE B 2 66  ? -2.697  1.450   -3.064  1.00 13.94 ?  297 ILE B CB    1 
ATOM   2849 C  CG1   . ILE B 2 66  ? -4.001  1.661   -2.278  1.00 15.00 ?  297 ILE B CG1   1 
ATOM   2850 C  CG2   . ILE B 2 66  ? -1.637  0.745   -2.124  1.00 16.12 ?  297 ILE B CG2   1 
ATOM   2851 C  CD1   . ILE B 2 66  ? -4.664  0.314   -1.916  1.00 15.27 ?  297 ILE B CD1   1 
ATOM   2852 N  N     . PHE B 2 67  ? 0.264   3.042   -3.604  1.00 13.80 ?  298 PHE B N     1 
ATOM   2853 C  CA    . PHE B 2 67  ? 1.629   2.632   -3.978  1.00 12.69 ?  298 PHE B CA    1 
ATOM   2854 C  C     . PHE B 2 67  ? 2.117   1.576   -2.990  1.00 12.22 ?  298 PHE B C     1 
ATOM   2855 O  O     . PHE B 2 67  ? 1.825   1.678   -1.783  1.00 13.69 ?  298 PHE B O     1 
ATOM   2856 C  CB    . PHE B 2 67  ? 2.590   3.814   -3.962  1.00 12.95 ?  298 PHE B CB    1 
ATOM   2857 C  CG    . PHE B 2 67  ? 2.329   4.786   -5.068  1.00 12.95 ?  298 PHE B CG    1 
ATOM   2858 C  CD1   . PHE B 2 67  ? 2.770   4.498   -6.359  1.00 13.75 ?  298 PHE B CD1   1 
ATOM   2859 C  CD2   . PHE B 2 67  ? 1.667   5.966   -4.855  1.00 15.78 ?  298 PHE B CD2   1 
ATOM   2860 C  CE1   . PHE B 2 67  ? 2.536   5.399   -7.418  1.00 15.72 ?  298 PHE B CE1   1 
ATOM   2861 C  CE2   . PHE B 2 67  ? 1.420   6.873   -5.879  1.00 17.51 ?  298 PHE B CE2   1 
ATOM   2862 C  CZ    . PHE B 2 67  ? 1.846   6.582   -7.185  1.00 15.97 ?  298 PHE B CZ    1 
ATOM   2863 N  N     . THR B 2 68  ? 2.816   0.540   -3.479  1.00 13.00 ?  299 THR B N     1 
ATOM   2864 C  CA    . THR B 2 68  ? 3.364   -0.483  -2.589  1.00 13.22 ?  299 THR B CA    1 
ATOM   2865 C  C     . THR B 2 68  ? 4.800   -0.791  -2.964  1.00 13.66 ?  299 THR B C     1 
ATOM   2866 O  O     . THR B 2 68  ? 5.152   -0.726  -4.131  1.00 15.79 ?  299 THR B O     1 
ATOM   2867 C  CB    . THR B 2 68  ? 2.489   -1.746  -2.617  1.00 15.20 ?  299 THR B CB    1 
ATOM   2868 O  OG1   . THR B 2 68  ? 2.892   -2.688  -1.613  1.00 16.15 ?  299 THR B OG1   1 
ATOM   2869 C  CG2   . THR B 2 68  ? 2.440   -2.411  -4.006  1.00 16.49 ?  299 THR B CG2   1 
ATOM   2870 N  N     . ALA B 2 69  ? 5.599   -1.167  -1.986  1.00 14.56 ?  300 ALA B N     1 
ATOM   2871 C  CA    . ALA B 2 69  ? 6.993   -1.580  -2.224  1.00 14.45 ?  300 ALA B CA    1 
ATOM   2872 C  C     . ALA B 2 69  ? 7.299   -2.688  -1.258  1.00 14.77 ?  300 ALA B C     1 
ATOM   2873 O  O     . ALA B 2 69  ? 6.618   -2.851  -0.206  1.00 16.35 ?  300 ALA B O     1 
ATOM   2874 C  CB    . ALA B 2 69  ? 7.979   -0.398  -2.029  1.00 15.47 ?  300 ALA B CB    1 
ATOM   2875 N  N     . ALA B 2 70  ? 8.310   -3.468  -1.620  1.00 16.08 ?  301 ALA B N     1 
ATOM   2876 C  CA    . ALA B 2 70  ? 8.912   -4.386  -0.654  1.00 17.31 ?  301 ALA B CA    1 
ATOM   2877 C  C     . ALA B 2 70  ? 9.859   -3.640  0.287   1.00 16.77 ?  301 ALA B C     1 
ATOM   2878 O  O     . ALA B 2 70  ? 10.112  -2.468  0.093   1.00 17.55 ?  301 ALA B O     1 
ATOM   2879 C  CB    . ALA B 2 70  ? 9.644   -5.529  -1.383  1.00 18.68 ?  301 ALA B CB    1 
ATOM   2880 N  N     . ARG B 2 71  ? 10.418  -4.332  1.286   1.00 18.27 ?  302 ARG B N     1 
ATOM   2881 C  CA    . ARG B 2 71  ? 11.210  -3.637  2.294   1.00 19.62 ?  302 ARG B CA    1 
ATOM   2882 C  C     . ARG B 2 71  ? 12.411  -2.906  1.673   1.00 19.76 ?  302 ARG B C     1 
ATOM   2883 O  O     . ARG B 2 71  ? 12.816  -1.819  2.183   1.00 20.75 ?  302 ARG B O     1 
ATOM   2884 C  CB    . ARG B 2 71  ? 11.664  -4.618  3.384   1.00 21.64 ?  302 ARG B CB    1 
ATOM   2885 C  CG    . ARG B 2 71  ? 10.454  -5.089  4.220   1.00 24.11 ?  302 ARG B CG    1 
ATOM   2886 C  CD    . ARG B 2 71  ? 10.878  -6.027  5.321   1.00 29.45 ?  302 ARG B CD    1 
ATOM   2887 N  NE    . ARG B 2 71  ? 11.723  -5.382  6.335   1.00 33.83 ?  302 ARG B NE    1 
ATOM   2888 C  CZ    . ARG B 2 71  ? 11.267  -4.623  7.335   1.00 35.58 ?  302 ARG B CZ    1 
ATOM   2889 N  NH1   . ARG B 2 71  ? 12.137  -4.109  8.204   1.00 37.02 ?  302 ARG B NH1   1 
ATOM   2890 N  NH2   . ARG B 2 71  ? 9.953   -4.389  7.479   1.00 35.24 ?  302 ARG B NH2   1 
ATOM   2891 N  N     . GLU B 2 72  ? 12.995  -3.470  0.606   1.00 18.78 ?  303 GLU B N     1 
ATOM   2892 C  CA    . GLU B 2 72  ? 14.167  -2.813  0.015   1.00 19.92 ?  303 GLU B CA    1 
ATOM   2893 C  C     . GLU B 2 72  ? 13.820  -1.466  -0.650  1.00 20.02 ?  303 GLU B C     1 
ATOM   2894 O  O     . GLU B 2 72  ? 14.721  -0.652  -0.921  1.00 21.18 ?  303 GLU B O     1 
ATOM   2895 C  CB    . GLU B 2 72  ? 14.911  -3.725  -0.994  1.00 21.74 ?  303 GLU B CB    1 
ATOM   2896 C  CG    . GLU B 2 72  ? 14.138  -3.944  -2.261  1.00 23.92 ?  303 GLU B CG    1 
ATOM   2897 C  CD    . GLU B 2 72  ? 14.965  -4.666  -3.338  1.00 27.10 ?  303 GLU B CD    1 
ATOM   2898 O  OE1   . GLU B 2 72  ? 14.441  -4.871  -4.436  1.00 28.57 ?  303 GLU B OE1   1 
ATOM   2899 O  OE2   . GLU B 2 72  ? 16.156  -5.031  -3.101  1.00 30.57 ?  303 GLU B OE2   1 
ATOM   2900 N  N     . GLY B 2 73  ? 12.528  -1.226  -0.901  1.00 18.18 ?  304 GLY B N     1 
ATOM   2901 C  CA    . GLY B 2 73  ? 12.120  0.026   -1.517  1.00 18.82 ?  304 GLY B CA    1 
ATOM   2902 C  C     . GLY B 2 73  ? 11.419  0.997   -0.573  1.00 17.96 ?  304 GLY B C     1 
ATOM   2903 O  O     . GLY B 2 73  ? 10.744  1.932   -0.993  1.00 17.18 ?  304 GLY B O     1 
ATOM   2904 N  N     . ARG B 2 74  ? 11.637  0.828   0.725   1.00 18.37 ?  305 ARG B N     1 
ATOM   2905 C  CA    . ARG B 2 74  ? 10.841  1.614   1.679   1.00 19.28 ?  305 ARG B CA    1 
ATOM   2906 C  C     . ARG B 2 74  ? 11.069  3.146   1.618   1.00 18.13 ?  305 ARG B C     1 
ATOM   2907 O  O     . ARG B 2 74  ? 10.090  3.912   1.752   1.00 18.50 ?  305 ARG B O     1 
ATOM   2908 C  CB    . ARG B 2 74  ? 11.067  1.067   3.080   1.00 22.47 ?  305 ARG B CB    1 
ATOM   2909 C  CG    . ARG B 2 74  ? 12.438  1.282   3.616   1.00 24.52 ?  305 ARG B CG    1 
ATOM   2910 C  CD    . ARG B 2 74  ? 12.644  0.484   4.920   1.00 27.68 ?  305 ARG B CD    1 
ATOM   2911 N  NE    . ARG B 2 74  ? 11.570  0.760   5.860   1.00 29.18 ?  305 ARG B NE    1 
ATOM   2912 C  CZ    . ARG B 2 74  ? 11.218  -0.095  6.813   1.00 32.70 ?  305 ARG B CZ    1 
ATOM   2913 N  NH1   . ARG B 2 74  ? 10.246  0.195   7.645   1.00 34.06 ?  305 ARG B NH1   1 
ATOM   2914 N  NH2   . ARG B 2 74  ? 11.873  -1.243  6.935   1.00 33.74 ?  305 ARG B NH2   1 
ATOM   2915 N  N     A GLU B 2 75  ? 12.303  3.625   1.403   0.64 17.00 ?  306 GLU B N     1 
ATOM   2916 N  N     B GLU B 2 75  ? 12.298  3.604   1.391   0.36 18.03 ?  306 GLU B N     1 
ATOM   2917 C  CA    A GLU B 2 75  ? 12.476  5.079   1.308   0.64 16.82 ?  306 GLU B CA    1 
ATOM   2918 C  CA    B GLU B 2 75  ? 12.508  5.044   1.319   0.36 18.51 ?  306 GLU B CA    1 
ATOM   2919 C  C     A GLU B 2 75  ? 11.905  5.647   0.025   0.64 16.92 ?  306 GLU B C     1 
ATOM   2920 C  C     B GLU B 2 75  ? 11.938  5.641   0.037   0.36 17.65 ?  306 GLU B C     1 
ATOM   2921 O  O     A GLU B 2 75  ? 11.354  6.763   0.002   0.64 16.66 ?  306 GLU B O     1 
ATOM   2922 O  O     B GLU B 2 75  ? 11.398  6.757   0.031   0.36 17.74 ?  306 GLU B O     1 
ATOM   2923 C  CB    A GLU B 2 75  ? 13.955  5.495   1.412   0.64 18.42 ?  306 GLU B CB    1 
ATOM   2924 C  CB    B GLU B 2 75  ? 13.993  5.387   1.428   0.36 20.72 ?  306 GLU B CB    1 
ATOM   2925 C  CG    A GLU B 2 75  ? 14.630  5.048   2.755   0.64 21.12 ?  306 GLU B CG    1 
ATOM   2926 C  CG    B GLU B 2 75  ? 14.265  6.866   1.578   0.36 22.91 ?  306 GLU B CG    1 
ATOM   2927 C  CD    A GLU B 2 75  ? 13.911  5.599   3.994   0.64 26.03 ?  306 GLU B CD    1 
ATOM   2928 C  CD    B GLU B 2 75  ? 13.852  7.453   2.934   0.36 25.31 ?  306 GLU B CD    1 
ATOM   2929 O  OE1   A GLU B 2 75  ? 13.533  6.792   4.002   0.64 29.17 ?  306 GLU B OE1   1 
ATOM   2930 O  OE1   B GLU B 2 75  ? 13.296  6.733   3.799   0.36 27.10 ?  306 GLU B OE1   1 
ATOM   2931 O  OE2   A GLU B 2 75  ? 13.729  4.846   4.980   0.64 27.09 ?  306 GLU B OE2   1 
ATOM   2932 O  OE2   B GLU B 2 75  ? 14.041  8.679   3.100   0.36 25.85 ?  306 GLU B OE2   1 
ATOM   2933 N  N     . THR B 2 76  ? 12.074  4.889   -1.047  1.00 16.29 ?  307 THR B N     1 
ATOM   2934 C  CA    . THR B 2 76  ? 11.542  5.307   -2.371  1.00 15.77 ?  307 THR B CA    1 
ATOM   2935 C  C     . THR B 2 76  ? 10.004  5.373   -2.287  1.00 15.23 ?  307 THR B C     1 
ATOM   2936 O  O     . THR B 2 76  ? 9.403   6.290   -2.852  1.00 15.83 ?  307 THR B O     1 
ATOM   2937 C  CB    . THR B 2 76  ? 12.007  4.337   -3.470  1.00 16.80 ?  307 THR B CB    1 
ATOM   2938 O  OG1   . THR B 2 76  ? 13.443  4.275   -3.409  1.00 18.21 ?  307 THR B OG1   1 
ATOM   2939 C  CG2   . THR B 2 76  ? 11.590  4.853   -4.868  1.00 17.39 ?  307 THR B CG2   1 
ATOM   2940 N  N     . LEU B 2 77  ? 9.391   4.418   -1.588  1.00 16.00 ?  308 LEU B N     1 
ATOM   2941 C  CA    . LEU B 2 77  ? 7.926   4.415   -1.437  1.00 15.71 ?  308 LEU B CA    1 
ATOM   2942 C  C     . LEU B 2 77  ? 7.473   5.702   -0.771  1.00 15.22 ?  308 LEU B C     1 
ATOM   2943 O  O     . LEU B 2 77  ? 6.500   6.335   -1.241  1.00 14.51 ?  308 LEU B O     1 
ATOM   2944 C  CB    . LEU B 2 77  ? 7.502   3.169   -0.644  1.00 15.50 ?  308 LEU B CB    1 
ATOM   2945 C  CG    . LEU B 2 77  ? 5.991   3.043   -0.335  1.00 14.37 ?  308 LEU B CG    1 
ATOM   2946 C  CD1   . LEU B 2 77  ? 5.209   2.888   -1.682  1.00 14.56 ?  308 LEU B CD1   1 
ATOM   2947 C  CD2   . LEU B 2 77  ? 5.779   1.846   0.573   1.00 15.99 ?  308 LEU B CD2   1 
ATOM   2948 N  N     A LYS B 2 78  ? 8.132   6.097   0.328   0.48 15.56 ?  309 LYS B N     1 
ATOM   2949 N  N     B LYS B 2 78  ? 8.147   6.099   0.313   0.52 15.40 ?  309 LYS B N     1 
ATOM   2950 C  CA    A LYS B 2 78  ? 7.737   7.313   1.032   0.48 16.51 ?  309 LYS B CA    1 
ATOM   2951 C  CA    B LYS B 2 78  ? 7.767   7.301   1.036   0.52 16.30 ?  309 LYS B CA    1 
ATOM   2952 C  C     A LYS B 2 78  ? 7.884   8.535   0.131   0.48 16.07 ?  309 LYS B C     1 
ATOM   2953 C  C     B LYS B 2 78  ? 7.928   8.561   0.198   0.52 16.08 ?  309 LYS B C     1 
ATOM   2954 O  O     A LYS B 2 78  ? 6.984   9.392   0.050   0.48 16.62 ?  309 LYS B O     1 
ATOM   2955 O  O     B LYS B 2 78  ? 7.088   9.482   0.242   0.52 17.05 ?  309 LYS B O     1 
ATOM   2956 C  CB    A LYS B 2 78  ? 8.598   7.506   2.296   0.48 17.98 ?  309 LYS B CB    1 
ATOM   2957 C  CB    B LYS B 2 78  ? 8.638   7.417   2.293   0.52 17.26 ?  309 LYS B CB    1 
ATOM   2958 C  CG    A LYS B 2 78  ? 8.432   6.426   3.375   0.48 20.97 ?  309 LYS B CG    1 
ATOM   2959 C  CG    B LYS B 2 78  ? 8.352   8.629   3.165   0.52 19.75 ?  309 LYS B CG    1 
ATOM   2960 C  CD    A LYS B 2 78  ? 9.114   6.807   4.685   0.48 23.03 ?  309 LYS B CD    1 
ATOM   2961 C  CD    B LYS B 2 78  ? 9.072   8.535   4.539   0.52 24.10 ?  309 LYS B CD    1 
ATOM   2962 C  CE    A LYS B 2 78  ? 10.571  7.118   4.561   0.48 24.78 ?  309 LYS B CE    1 
ATOM   2963 C  CE    B LYS B 2 78  ? 8.634   9.669   5.481   0.52 27.61 ?  309 LYS B CE    1 
ATOM   2964 N  NZ    A LYS B 2 78  ? 11.151  7.195   5.952   0.48 25.72 ?  309 LYS B NZ    1 
ATOM   2965 N  NZ    B LYS B 2 78  ? 7.126   9.678   5.731   0.52 30.11 ?  309 LYS B NZ    1 
ATOM   2966 N  N     . CYS B 2 79  ? 9.019   8.602   -0.564  1.00 15.13 ?  310 CYS B N     1 
ATOM   2967 C  CA    . CYS B 2 79  ? 9.362   9.759   -1.365  1.00 16.74 ?  310 CYS B CA    1 
ATOM   2968 C  C     . CYS B 2 79  ? 8.433   9.923   -2.595  1.00 15.95 ?  310 CYS B C     1 
ATOM   2969 O  O     . CYS B 2 79  ? 7.925   11.005  -2.871  1.00 15.53 ?  310 CYS B O     1 
ATOM   2970 C  CB    . CYS B 2 79  ? 10.844  9.585   -1.800  1.00 19.95 ?  310 CYS B CB    1 
ATOM   2971 S  SG    . CYS B 2 79  ? 11.586  11.053  -2.515  1.00 24.95 ?  310 CYS B SG    1 
ATOM   2972 N  N     . LEU B 2 80  ? 8.250   8.823   -3.304  1.00 14.22 ?  311 LEU B N     1 
ATOM   2973 C  CA    . LEU B 2 80  ? 7.414   8.845   -4.529  1.00 13.66 ?  311 LEU B CA    1 
ATOM   2974 C  C     . LEU B 2 80  ? 5.979   9.203   -4.171  1.00 13.60 ?  311 LEU B C     1 
ATOM   2975 O  O     . LEU B 2 80  ? 5.353   10.072  -4.831  1.00 14.53 ?  311 LEU B O     1 
ATOM   2976 C  CB    . LEU B 2 80  ? 7.441   7.496   -5.218  1.00 15.53 ?  311 LEU B CB    1 
ATOM   2977 C  CG    . LEU B 2 80  ? 6.642   7.451   -6.540  1.00 17.35 ?  311 LEU B CG    1 
ATOM   2978 C  CD1   . LEU B 2 80  ? 6.936   8.599   -7.486  1.00 17.62 ?  311 LEU B CD1   1 
ATOM   2979 C  CD2   . LEU B 2 80  ? 6.772   6.112   -7.264  1.00 21.91 ?  311 LEU B CD2   1 
ATOM   2980 N  N     A SER B 2 81  ? 5.449   8.547   -3.139  0.72 14.17 ?  312 SER B N     1 
ATOM   2981 N  N     B SER B 2 81  ? 5.446   8.583   -3.128  0.28 13.52 ?  312 SER B N     1 
ATOM   2982 C  CA    A SER B 2 81  ? 4.030   8.805   -2.744  0.72 12.87 ?  312 SER B CA    1 
ATOM   2983 C  CA    B SER B 2 81  ? 4.048   8.847   -2.758  0.28 12.62 ?  312 SER B CA    1 
ATOM   2984 C  C     A SER B 2 81  ? 3.820   10.293  -2.345  0.72 13.52 ?  312 SER B C     1 
ATOM   2985 C  C     B SER B 2 81  ? 3.821   10.304  -2.350  0.28 13.03 ?  312 SER B C     1 
ATOM   2986 O  O     A SER B 2 81  ? 2.859   10.939  -2.804  0.72 14.11 ?  312 SER B O     1 
ATOM   2987 O  O     B SER B 2 81  ? 2.828   10.920  -2.751  0.28 13.35 ?  312 SER B O     1 
ATOM   2988 C  CB    A SER B 2 81  ? 3.589   7.872   -1.614  0.72 13.69 ?  312 SER B CB    1 
ATOM   2989 C  CB    B SER B 2 81  ? 3.617   7.910   -1.647  0.28 12.22 ?  312 SER B CB    1 
ATOM   2990 O  OG    A SER B 2 81  ? 4.407   8.050   -0.485  0.72 13.41 ?  312 SER B OG    1 
ATOM   2991 O  OG    B SER B 2 81  ? 3.784   6.585   -2.091  0.28 11.06 ?  312 SER B OG    1 
ATOM   2992 N  N     . HIS B 2 82  ? 4.754   10.867  -1.593  1.00 12.79 ?  313 HIS B N     1 
ATOM   2993 C  CA    . HIS B 2 82  ? 4.657   12.266  -1.244  1.00 13.36 ?  313 HIS B CA    1 
ATOM   2994 C  C     . HIS B 2 82  ? 4.694   13.163  -2.496  1.00 14.00 ?  313 HIS B C     1 
ATOM   2995 O  O     . HIS B 2 82  ? 3.893   14.094  -2.620  1.00 14.92 ?  313 HIS B O     1 
ATOM   2996 C  CB    . HIS B 2 82  ? 5.805   12.676  -0.310  1.00 16.04 ?  313 HIS B CB    1 
ATOM   2997 C  CG    . HIS B 2 82  ? 5.743   14.113  0.060   1.00 19.26 ?  313 HIS B CG    1 
ATOM   2998 N  ND1   . HIS B 2 82  ? 5.050   14.570  1.162   1.00 22.63 ?  313 HIS B ND1   1 
ATOM   2999 C  CD2   . HIS B 2 82  ? 6.232   15.211  -0.564  1.00 20.75 ?  313 HIS B CD2   1 
ATOM   3000 C  CE1   . HIS B 2 82  ? 5.124   15.888  1.214   1.00 22.25 ?  313 HIS B CE1   1 
ATOM   3001 N  NE2   . HIS B 2 82  ? 5.858   16.305  0.195   1.00 22.59 ?  313 HIS B NE2   1 
ATOM   3002 N  N     . HIS B 2 83  ? 5.646   12.896  -3.405  1.00 14.55 ?  314 HIS B N     1 
ATOM   3003 C  CA    . HIS B 2 83  ? 5.760   13.731  -4.569  1.00 15.54 ?  314 HIS B CA    1 
ATOM   3004 C  C     . HIS B 2 83  ? 4.563   13.612  -5.501  1.00 14.98 ?  314 HIS B C     1 
ATOM   3005 O  O     . HIS B 2 83  ? 4.223   14.594  -6.185  1.00 15.12 ?  314 HIS B O     1 
ATOM   3006 C  CB    . HIS B 2 83  ? 7.017   13.335  -5.329  1.00 18.35 ?  314 HIS B CB    1 
ATOM   3007 C  CG    . HIS B 2 83  ? 8.247   14.045  -4.883  1.00 23.26 ?  314 HIS B CG    1 
ATOM   3008 N  ND1   . HIS B 2 83  ? 9.048   13.594  -3.859  1.00 27.17 ?  314 HIS B ND1   1 
ATOM   3009 C  CD2   . HIS B 2 83  ? 8.901   15.092  -5.443  1.00 26.54 ?  314 HIS B CD2   1 
ATOM   3010 C  CE1   . HIS B 2 83  ? 10.091  14.397  -3.732  1.00 28.03 ?  314 HIS B CE1   1 
ATOM   3011 N  NE2   . HIS B 2 83  ? 10.042  15.301  -4.698  1.00 28.58 ?  314 HIS B NE2   1 
ATOM   3012 N  N     . VAL B 2 84  ? 3.927   12.441  -5.562  1.00 13.13 ?  315 VAL B N     1 
ATOM   3013 C  CA    . VAL B 2 84  ? 2.737   12.306  -6.396  1.00 13.77 ?  315 VAL B CA    1 
ATOM   3014 C  C     . VAL B 2 84  ? 1.604   13.135  -5.778  1.00 14.03 ?  315 VAL B C     1 
ATOM   3015 O  O     . VAL B 2 84  ? 0.905   13.865  -6.478  1.00 14.54 ?  315 VAL B O     1 
ATOM   3016 C  CB    . VAL B 2 84  ? 2.357   10.834  -6.613  1.00 13.41 ?  315 VAL B CB    1 
ATOM   3017 C  CG1   . VAL B 2 84  ? 0.964   10.687  -7.289  1.00 14.10 ?  315 VAL B CG1   1 
ATOM   3018 C  CG2   . VAL B 2 84  ? 3.411   10.141  -7.500  1.00 15.13 ?  315 VAL B CG2   1 
ATOM   3019 N  N     . ALA B 2 85  ? 1.419   13.031  -4.472  1.00 13.63 ?  316 ALA B N     1 
ATOM   3020 C  CA    . ALA B 2 85  ? 0.382   13.838  -3.818  1.00 13.46 ?  316 ALA B CA    1 
ATOM   3021 C  C     . ALA B 2 85  ? 0.682   15.333  -4.002  1.00 13.72 ?  316 ALA B C     1 
ATOM   3022 O  O     . ALA B 2 85  ? -0.228  16.145  -4.239  1.00 14.51 ?  316 ALA B O     1 
ATOM   3023 C  CB    . ALA B 2 85  ? 0.304   13.476  -2.323  1.00 14.25 ?  316 ALA B CB    1 
ATOM   3024 N  N     . ASP B 2 86  ? 1.964   15.712  -3.902  1.00 13.90 ?  317 ASP B N     1 
ATOM   3025 C  CA    . ASP B 2 86  ? 2.295   17.133  -4.071  1.00 15.10 ?  317 ASP B CA    1 
ATOM   3026 C  C     . ASP B 2 86  ? 2.026   17.608  -5.529  1.00 15.31 ?  317 ASP B C     1 
ATOM   3027 O  O     . ASP B 2 86  ? 1.612   18.753  -5.750  1.00 16.12 ?  317 ASP B O     1 
ATOM   3028 C  CB    . ASP B 2 86  ? 3.753   17.352  -3.670  1.00 16.54 ?  317 ASP B CB    1 
ATOM   3029 C  CG    . ASP B 2 86  ? 4.100   18.795  -3.435  1.00 21.52 ?  317 ASP B CG    1 
ATOM   3030 O  OD1   . ASP B 2 86  ? 3.340   19.563  -2.843  1.00 22.46 ?  317 ASP B OD1   1 
ATOM   3031 O  OD2   . ASP B 2 86  ? 5.227   19.181  -3.794  1.00 27.96 ?  317 ASP B OD2   1 
ATOM   3032 N  N     . ALA B 2 87  ? 2.296   16.734  -6.506  1.00 14.99 ?  318 ALA B N     1 
ATOM   3033 C  CA    . ALA B 2 87  ? 2.075   17.085  -7.914  1.00 15.68 ?  318 ALA B CA    1 
ATOM   3034 C  C     . ALA B 2 87  ? 0.614   17.333  -8.243  1.00 15.62 ?  318 ALA B C     1 
ATOM   3035 O  O     . ALA B 2 87  ? 0.297   18.058  -9.168  1.00 15.96 ?  318 ALA B O     1 
ATOM   3036 C  CB    . ALA B 2 87  ? 2.629   16.022  -8.796  1.00 16.75 ?  318 ALA B CB    1 
ATOM   3037 N  N     . TYR B 2 88  ? -0.293  16.787  -7.452  1.00 15.15 ?  319 TYR B N     1 
ATOM   3038 C  CA    . TYR B 2 88  ? -1.708  17.045  -7.671  1.00 15.36 ?  319 TYR B CA    1 
ATOM   3039 C  C     . TYR B 2 88  ? -1.997  18.553  -7.554  1.00 15.51 ?  319 TYR B C     1 
ATOM   3040 O  O     . TYR B 2 88  ? -2.927  19.061  -8.214  1.00 16.85 ?  319 TYR B O     1 
ATOM   3041 C  CB    . TYR B 2 88  ? -2.534  16.217  -6.655  1.00 15.80 ?  319 TYR B CB    1 
ATOM   3042 C  CG    . TYR B 2 88  ? -3.982  16.123  -7.058  1.00 16.14 ?  319 TYR B CG    1 
ATOM   3043 C  CD1   . TYR B 2 88  ? -4.373  15.247  -8.087  1.00 16.52 ?  319 TYR B CD1   1 
ATOM   3044 C  CD2   . TYR B 2 88  ? -4.933  16.897  -6.462  1.00 17.81 ?  319 TYR B CD2   1 
ATOM   3045 C  CE1   . TYR B 2 88  ? -5.708  15.143  -8.461  1.00 17.21 ?  319 TYR B CE1   1 
ATOM   3046 C  CE2   . TYR B 2 88  ? -6.239  16.828  -6.835  1.00 19.47 ?  319 TYR B CE2   1 
ATOM   3047 C  CZ    . TYR B 2 88  ? -6.635  15.955  -7.857  1.00 19.28 ?  319 TYR B CZ    1 
ATOM   3048 O  OH    . TYR B 2 88  ? -7.961  15.904  -8.301  1.00 24.04 ?  319 TYR B OH    1 
ATOM   3049 N  N     . THR B 2 89  ? -1.246  19.274  -6.703  1.00 15.00 ?  320 THR B N     1 
ATOM   3050 C  CA    . THR B 2 89  ? -1.357  20.734  -6.635  1.00 14.01 ?  320 THR B CA    1 
ATOM   3051 C  C     . THR B 2 89  ? -0.094  21.444  -7.161  1.00 14.68 ?  320 THR B C     1 
ATOM   3052 O  O     . THR B 2 89  ? 0.373   22.422  -6.600  1.00 16.01 ?  320 THR B O     1 
ATOM   3053 C  CB    . THR B 2 89  ? -1.640  21.264  -5.211  1.00 16.01 ?  320 THR B CB    1 
ATOM   3054 O  OG1   . THR B 2 89  ? -0.628  20.740  -4.326  1.00 16.06 ?  320 THR B OG1   1 
ATOM   3055 C  CG2   . THR B 2 89  ? -3.003  20.777  -4.742  1.00 18.14 ?  320 THR B CG2   1 
ATOM   3056 N  N     A SER B 2 90  ? 0.401   20.939  -8.286  0.46 15.08 ?  321 SER B N     1 
ATOM   3057 N  N     B SER B 2 90  ? 0.430   21.002  -8.294  0.54 14.58 ?  321 SER B N     1 
ATOM   3058 C  CA    A SER B 2 90  ? 1.542   21.483  -8.999  0.46 16.10 ?  321 SER B CA    1 
ATOM   3059 C  CA    B SER B 2 90  ? 1.641   21.604  -8.824  0.54 15.47 ?  321 SER B CA    1 
ATOM   3060 C  C     A SER B 2 90  ? 1.483   22.987  -9.221  0.46 16.54 ?  321 SER B C     1 
ATOM   3061 C  C     B SER B 2 90  ? 1.501   23.077  -9.193  0.54 16.64 ?  321 SER B C     1 
ATOM   3062 O  O     A SER B 2 90  ? 2.506   23.674  -9.108  0.46 18.05 ?  321 SER B O     1 
ATOM   3063 O  O     B SER B 2 90  ? 2.491   23.844  -9.159  0.54 19.05 ?  321 SER B O     1 
ATOM   3064 C  CB    A SER B 2 90  ? 1.640   20.783  -10.361 0.46 16.88 ?  321 SER B CB    1 
ATOM   3065 C  CB    B SER B 2 90  ? 2.075   20.834  -10.061 0.54 17.13 ?  321 SER B CB    1 
ATOM   3066 O  OG    A SER B 2 90  ? 2.009   19.410  -10.242 0.46 17.71 ?  321 SER B OG    1 
ATOM   3067 O  OG    B SER B 2 90  ? 3.213   21.454  -10.632 0.54 18.01 ?  321 SER B OG    1 
ATOM   3068 N  N     . SER B 2 91  ? 0.279   23.467  -9.513  1.00 17.11 ?  322 SER B N     1 
ATOM   3069 C  CA    . SER B 2 91  ? -0.058  24.878  -9.760  1.00 21.23 ?  322 SER B CA    1 
ATOM   3070 C  C     . SER B 2 91  ? -0.210  25.788  -8.529  1.00 21.38 ?  322 SER B C     1 
ATOM   3071 O  O     . SER B 2 91  ? -0.280  27.040  -8.726  1.00 21.98 ?  322 SER B O     1 
ATOM   3072 C  CB    . SER B 2 91  ? -1.384  25.010  -10.571 1.00 23.26 ?  322 SER B CB    1 
ATOM   3073 O  OG    . SER B 2 91  ? -2.466  24.627  -9.708  1.00 25.83 ?  322 SER B OG    1 
ATOM   3074 N  N     . GLN B 2 92  ? -0.078  25.271  -7.299  1.00 23.03 ?  323 GLN B N     1 
ATOM   3075 C  CA    . GLN B 2 92  ? -0.018  26.073  -6.047  1.00 23.39 ?  323 GLN B CA    1 
ATOM   3076 C  C     . GLN B 2 92  ? 1.205   25.845  -5.037  1.00 24.45 ?  323 GLN B C     1 
ATOM   3077 O  O     . GLN B 2 92  ? 1.988   24.900  -5.174  1.00 25.64 ?  323 GLN B O     1 
ATOM   3078 C  CB    . GLN B 2 92  ? -1.333  25.855  -5.298  1.00 24.49 ?  323 GLN B CB    1 
ATOM   3079 C  CG    . GLN B 2 92  ? -2.582  25.913  -6.237  1.00 23.79 ?  323 GLN B CG    1 
ATOM   3080 C  CD    . GLN B 2 92  ? -3.832  25.850  -5.495  1.00 26.77 ?  323 GLN B CD    1 
ATOM   3081 O  OE1   . GLN B 2 92  ? -4.561  24.854  -5.606  1.00 30.83 ?  323 GLN B OE1   1 
ATOM   3082 N  NE2   . GLN B 2 92  ? -4.146  26.914  -4.707  1.00 27.50 ?  323 GLN B NE2   1 
ATOM   3083 N  N     . LYS B 2 93  ? 1.364   26.700  -4.019  1.00 20.68 ?  324 LYS B N     1 
ATOM   3084 C  CA    . LYS B 2 93  ? 2.240   26.388  -2.837  1.00 18.51 ?  324 LYS B CA    1 
ATOM   3085 C  C     . LYS B 2 93  ? 1.605   25.305  -1.970  1.00 16.85 ?  324 LYS B C     1 
ATOM   3086 O  O     . LYS B 2 93  ? 2.265   24.646  -1.148  1.00 17.88 ?  324 LYS B O     1 
ATOM   3087 C  CB    . LYS B 2 93  ? 2.475   27.626  -1.931  1.00 19.09 ?  324 LYS B CB    1 
ATOM   3088 C  CG    . LYS B 2 93  ? 3.207   28.779  -2.556  1.00 19.07 ?  324 LYS B CG    1 
ATOM   3089 C  CD    . LYS B 2 93  ? 3.387   29.963  -1.605  1.00 16.86 ?  324 LYS B CD    1 
ATOM   3090 C  CE    . LYS B 2 93  ? 4.366   29.791  -0.424  1.00 15.91 ?  324 LYS B CE    1 
ATOM   3091 N  NZ    . LYS B 2 93  ? 4.378   31.068  0.304   1.00 14.59 ?  324 LYS B NZ    1 
ATOM   3092 N  N     . VAL B 2 94  ? 0.299   25.131  -2.129  1.00 15.23 ?  325 VAL B N     1 
ATOM   3093 C  CA    . VAL B 2 94  ? -0.454  24.146  -1.341  1.00 15.83 ?  325 VAL B CA    1 
ATOM   3094 C  C     . VAL B 2 94  ? 0.199   22.795  -1.393  1.00 16.20 ?  325 VAL B C     1 
ATOM   3095 O  O     . VAL B 2 94  ? 0.571   22.334  -2.459  1.00 17.06 ?  325 VAL B O     1 
ATOM   3096 C  CB    . VAL B 2 94  ? -1.894  24.081  -1.879  1.00 16.22 ?  325 VAL B CB    1 
ATOM   3097 C  CG1   . VAL B 2 94  ? -2.731  23.003  -1.159  1.00 17.72 ?  325 VAL B CG1   1 
ATOM   3098 C  CG2   . VAL B 2 94  ? -2.525  25.483  -1.811  1.00 17.89 ?  325 VAL B CG2   1 
ATOM   3099 N  N     . SER B 2 95  ? 0.334   22.148  -0.236  1.00 15.46 ?  326 SER B N     1 
ATOM   3100 C  CA    . SER B 2 95  ? 1.093   20.901  -0.049  1.00 16.24 ?  326 SER B CA    1 
ATOM   3101 C  C     . SER B 2 95  ? 0.178   19.800  0.465   1.00 14.39 ?  326 SER B C     1 
ATOM   3102 O  O     . SER B 2 95  ? -0.911  20.106  0.964   1.00 14.88 ?  326 SER B O     1 
ATOM   3103 C  CB    . SER B 2 95  ? 2.186   21.149  1.032   1.00 19.66 ?  326 SER B CB    1 
ATOM   3104 O  OG    . SER B 2 95  ? 3.080   22.174  0.686   1.00 26.23 ?  326 SER B OG    1 
ATOM   3105 N  N     . PRO B 2 96  ? 0.611   18.536  0.414   1.00 14.19 ?  327 PRO B N     1 
ATOM   3106 C  CA    . PRO B 2 96  ? -0.294  17.469  0.883   1.00 14.64 ?  327 PRO B CA    1 
ATOM   3107 C  C     . PRO B 2 96  ? -0.480  17.448  2.393   1.00 13.99 ?  327 PRO B C     1 
ATOM   3108 O  O     . PRO B 2 96  ? 0.468   17.800  3.156   1.00 15.84 ?  327 PRO B O     1 
ATOM   3109 C  CB    . PRO B 2 96  ? 0.398   16.173  0.445   1.00 17.54 ?  327 PRO B CB    1 
ATOM   3110 C  CG    . PRO B 2 96  ? 1.402   16.585  -0.535  1.00 17.45 ?  327 PRO B CG    1 
ATOM   3111 C  CD    . PRO B 2 96  ? 1.790   17.995  -0.296  1.00 15.59 ?  327 PRO B CD    1 
ATOM   3112 N  N     . ILE B 2 97  ? -1.646  16.972  2.810   1.00 13.48 ?  328 ILE B N     1 
ATOM   3113 C  CA    . ILE B 2 97  ? -1.850  16.523  4.209   1.00 13.98 ?  328 ILE B CA    1 
ATOM   3114 C  C     . ILE B 2 97  ? -1.010  15.293  4.402   1.00 14.72 ?  328 ILE B C     1 
ATOM   3115 O  O     . ILE B 2 97  ? -1.037  14.427  3.552   1.00 17.61 ?  328 ILE B O     1 
ATOM   3116 C  CB    . ILE B 2 97  ? -3.324  16.194  4.476   1.00 14.28 ?  328 ILE B CB    1 
ATOM   3117 C  CG1   . ILE B 2 97  ? -4.180  17.439  4.126   1.00 14.40 ?  328 ILE B CG1   1 
ATOM   3118 C  CG2   . ILE B 2 97  ? -3.497  15.771  5.962   1.00 15.59 ?  328 ILE B CG2   1 
ATOM   3119 C  CD1   . ILE B 2 97  ? -5.726  17.090  4.017   1.00 16.23 ?  328 ILE B CD1   1 
ATOM   3120 N  N     . GLN B 2 98  ? -0.230  15.197  5.467   1.00 15.66 ?  329 GLN B N     1 
ATOM   3121 C  CA    . GLN B 2 98  ? 0.625   14.020  5.657   1.00 16.33 ?  329 GLN B CA    1 
ATOM   3122 C  C     . GLN B 2 98  ? 0.174   13.257  6.888   1.00 15.76 ?  329 GLN B C     1 
ATOM   3123 O  O     . GLN B 2 98  ? 0.118   13.850  7.981   1.00 18.57 ?  329 GLN B O     1 
ATOM   3124 C  CB    . GLN B 2 98  ? 2.099   14.440  5.806   1.00 19.22 ?  329 GLN B CB    1 
ATOM   3125 C  CG    . GLN B 2 98  ? 2.692   15.213  4.628   1.00 22.82 ?  329 GLN B CG    1 
ATOM   3126 C  CD    . GLN B 2 98  ? 4.162   15.637  4.967   1.00 28.93 ?  329 GLN B CD    1 
ATOM   3127 O  OE1   . GLN B 2 98  ? 5.043   14.798  5.139   1.00 33.09 ?  329 GLN B OE1   1 
ATOM   3128 N  NE2   . GLN B 2 98  ? 4.384   16.909  5.100   1.00 32.25 ?  329 GLN B NE2   1 
ATOM   3129 N  N     . ILE B 2 99  ? -0.096  11.958  6.744   1.00 14.41 ?  330 ILE B N     1 
ATOM   3130 C  CA    . ILE B 2 99  ? -0.445  11.094  7.865   1.00 15.50 ?  330 ILE B CA    1 
ATOM   3131 C  C     . ILE B 2 99  ? 0.408   9.850   7.770   1.00 15.73 ?  330 ILE B C     1 
ATOM   3132 O  O     . ILE B 2 99  ? 0.700   9.414   6.649   1.00 16.42 ?  330 ILE B O     1 
ATOM   3133 C  CB    . ILE B 2 99  ? -1.941  10.726  7.840   1.00 18.56 ?  330 ILE B CB    1 
ATOM   3134 C  CG1   . ILE B 2 99  ? -2.783  12.004  7.882   1.00 21.38 ?  330 ILE B CG1   1 
ATOM   3135 C  CG2   . ILE B 2 99  ? -2.289  9.827   9.025   1.00 21.77 ?  330 ILE B CG2   1 
ATOM   3136 C  CD1   . ILE B 2 99  ? -4.245  11.767  7.663   1.00 22.70 ?  330 ILE B CD1   1 
ATOM   3137 N  N     . ASP B 2 100 ? 0.821   9.279   8.906   1.00 17.09 ?  331 ASP B N     1 
ATOM   3138 C  CA    . ASP B 2 100 ? 1.676   8.093   8.876   1.00 18.45 ?  331 ASP B CA    1 
ATOM   3139 C  C     . ASP B 2 100 ? 1.163   7.061   9.847   1.00 18.48 ?  331 ASP B C     1 
ATOM   3140 O  O     . ASP B 2 100 ? 1.036   7.363   11.053  1.00 20.41 ?  331 ASP B O     1 
ATOM   3141 C  CB    . ASP B 2 100 ? 3.141   8.468   9.204   1.00 20.45 ?  331 ASP B CB    1 
ATOM   3142 C  CG    . ASP B 2 100 ? 4.123   7.382   8.847   1.00 22.55 ?  331 ASP B CG    1 
ATOM   3143 O  OD1   . ASP B 2 100 ? 3.767   6.223   8.645   1.00 22.47 ?  331 ASP B OD1   1 
ATOM   3144 O  OD2   . ASP B 2 100 ? 5.343   7.700   8.863   1.00 27.12 ?  331 ASP B OD2   1 
ATOM   3145 N  N     . GLY B 2 101 ? 0.847   5.878   9.350   1.00 17.52 ?  332 GLY B N     1 
ATOM   3146 C  CA    . GLY B 2 101 ? 0.435   4.779   10.197  1.00 17.97 ?  332 GLY B CA    1 
ATOM   3147 C  C     . GLY B 2 101 ? 1.547   4.022   10.906  1.00 19.35 ?  332 GLY B C     1 
ATOM   3148 O  O     . GLY B 2 101 ? 1.263   3.172   11.759  1.00 20.87 ?  332 GLY B O     1 
ATOM   3149 N  N     . ALA B 2 102 ? 2.804   4.281   10.553  1.00 19.97 ?  333 ALA B N     1 
ATOM   3150 C  CA    . ALA B 2 102 ? 3.897   3.532   11.146  1.00 22.87 ?  333 ALA B CA    1 
ATOM   3151 C  C     . ALA B 2 102 ? 3.881   3.592   12.669  1.00 25.29 ?  333 ALA B C     1 
ATOM   3152 O  O     . ALA B 2 102 ? 3.759   4.673   13.283  1.00 26.04 ?  333 ALA B O     1 
ATOM   3153 C  CB    . ALA B 2 102 ? 5.230   4.039   10.648  1.00 24.13 ?  333 ALA B CB    1 
ATOM   3154 N  N     . GLY B 2 103 ? 4.039   2.426   13.279  1.00 26.78 ?  334 GLY B N     1 
ATOM   3155 C  CA    . GLY B 2 103 ? 4.094   2.377   14.716  1.00 28.54 ?  334 GLY B CA    1 
ATOM   3156 C  C     . GLY B 2 103 ? 2.767   2.516   15.439  1.00 29.09 ?  334 GLY B C     1 
ATOM   3157 O  O     . GLY B 2 103 ? 2.742   2.480   16.673  1.00 31.30 ?  334 GLY B O     1 
ATOM   3158 N  N     . ARG B 2 104 ? 1.666   2.641   14.700  1.00 26.92 ?  335 ARG B N     1 
ATOM   3159 C  CA    . ARG B 2 104 ? 0.359   2.817   15.322  1.00 26.67 ?  335 ARG B CA    1 
ATOM   3160 C  C     . ARG B 2 104 ? -0.429  1.567   15.589  1.00 26.34 ?  335 ARG B C     1 
ATOM   3161 O  O     . ARG B 2 104 ? -1.542  1.657   16.115  1.00 25.78 ?  335 ARG B O     1 
ATOM   3162 C  CB    . ARG B 2 104 ? -0.498  3.743   14.457  1.00 26.00 ?  335 ARG B CB    1 
ATOM   3163 C  CG    . ARG B 2 104 ? 0.068   5.143   14.303  1.00 24.98 ?  335 ARG B CG    1 
ATOM   3164 C  CD    . ARG B 2 104 ? -1.019  6.099   13.850  1.00 24.21 ?  335 ARG B CD    1 
ATOM   3165 N  NE    . ARG B 2 104 ? -0.474  7.417   13.522  1.00 23.50 ?  335 ARG B NE    1 
ATOM   3166 C  CZ    . ARG B 2 104 ? -0.290  8.392   14.408  1.00 25.55 ?  335 ARG B CZ    1 
ATOM   3167 N  NH1   . ARG B 2 104 ? -0.639  8.218   15.695  1.00 25.92 ?  335 ARG B NH1   1 
ATOM   3168 N  NH2   . ARG B 2 104 ? 0.230   9.541   13.996  1.00 26.81 ?  335 ARG B NH2   1 
ATOM   3169 N  N     . THR B 2 105 ? 0.128   0.403   15.289  1.00 27.28 ?  336 THR B N     1 
ATOM   3170 C  CA    . THR B 2 105 ? -0.647  -0.839  15.275  1.00 28.72 ?  336 THR B CA    1 
ATOM   3171 C  C     . THR B 2 105 ? -1.338  -1.140  16.608  1.00 29.13 ?  336 THR B C     1 
ATOM   3172 O  O     . THR B 2 105 ? -2.479  -1.590  16.617  1.00 30.10 ?  336 THR B O     1 
ATOM   3173 C  CB    . THR B 2 105 ? 0.233   -2.029  14.896  1.00 31.64 ?  336 THR B CB    1 
ATOM   3174 O  OG1   . THR B 2 105 ? 0.852   -1.774  13.641  1.00 32.65 ?  336 THR B OG1   1 
ATOM   3175 C  CG2   . THR B 2 105 ? -0.581  -3.333  14.841  1.00 32.85 ?  336 THR B CG2   1 
ATOM   3176 N  N     . TRP B 2 106 ? -0.674  -0.822  17.714  1.00 27.96 ?  337 TRP B N     1 
ATOM   3177 C  CA    . TRP B 2 106 ? -1.262  -1.110  19.029  1.00 28.33 ?  337 TRP B CA    1 
ATOM   3178 C  C     . TRP B 2 106 ? -1.821  0.107   19.723  1.00 26.99 ?  337 TRP B C     1 
ATOM   3179 O  O     . TRP B 2 106 ? -2.199  0.021   20.897  1.00 27.89 ?  337 TRP B O     1 
ATOM   3180 C  CB    . TRP B 2 106 ? -0.221  -1.776  19.947  1.00 31.19 ?  337 TRP B CB    1 
ATOM   3181 C  CG    . TRP B 2 106 ? 0.514   -2.770  19.217  1.00 36.80 ?  337 TRP B CG    1 
ATOM   3182 C  CD1   . TRP B 2 106 ? 1.782   -2.648  18.716  1.00 39.44 ?  337 TRP B CD1   1 
ATOM   3183 C  CD2   . TRP B 2 106 ? 0.031   -4.038  18.786  1.00 39.81 ?  337 TRP B CD2   1 
ATOM   3184 N  NE1   . TRP B 2 106 ? 2.107   -3.757  18.012  1.00 40.87 ?  337 TRP B NE1   1 
ATOM   3185 C  CE2   . TRP B 2 106 ? 1.060   -4.638  18.050  1.00 40.63 ?  337 TRP B CE2   1 
ATOM   3186 C  CE3   . TRP B 2 106 ? -1.173  -4.723  18.942  1.00 41.73 ?  337 TRP B CE3   1 
ATOM   3187 C  CZ2   . TRP B 2 106 ? 0.935   -5.898  17.486  1.00 41.91 ?  337 TRP B CZ2   1 
ATOM   3188 C  CZ3   . TRP B 2 106 ? -1.290  -5.983  18.378  1.00 42.72 ?  337 TRP B CZ3   1 
ATOM   3189 C  CH2   . TRP B 2 106 ? -0.248  -6.554  17.664  1.00 42.48 ?  337 TRP B CH2   1 
ATOM   3190 N  N     . GLN B 2 107 ? -1.924  1.231   19.020  1.00 24.73 ?  338 GLN B N     1 
ATOM   3191 C  CA    . GLN B 2 107 ? -2.624  2.368   19.566  1.00 23.30 ?  338 GLN B CA    1 
ATOM   3192 C  C     . GLN B 2 107 ? -4.132  2.110   19.596  1.00 22.47 ?  338 GLN B C     1 
ATOM   3193 O  O     . GLN B 2 107 ? -4.672  1.281   18.828  1.00 23.17 ?  338 GLN B O     1 
ATOM   3194 C  CB    . GLN B 2 107 ? -2.291  3.611   18.751  1.00 23.84 ?  338 GLN B CB    1 
ATOM   3195 C  CG    . GLN B 2 107 ? -0.842  4.032   18.985  1.00 25.57 ?  338 GLN B CG    1 
ATOM   3196 C  CD    . GLN B 2 107 ? -0.366  5.093   18.034  1.00 26.88 ?  338 GLN B CD    1 
ATOM   3197 O  OE1   . GLN B 2 107 ? -1.172  5.765   17.324  1.00 26.00 ?  338 GLN B OE1   1 
ATOM   3198 N  NE2   . GLN B 2 107 ? 0.990   5.250   17.979  1.00 29.00 ?  338 GLN B NE2   1 
ATOM   3199 N  N     . ASP B 2 108 ? -4.807  2.827   20.484  1.00 20.76 ?  339 ASP B N     1 
ATOM   3200 C  CA    . ASP B 2 108 ? -6.252  2.709   20.611  1.00 18.85 ?  339 ASP B CA    1 
ATOM   3201 C  C     . ASP B 2 108 ? -6.942  3.056   19.276  1.00 17.09 ?  339 ASP B C     1 
ATOM   3202 O  O     . ASP B 2 108 ? -6.727  4.132   18.723  1.00 17.46 ?  339 ASP B O     1 
ATOM   3203 C  CB    . ASP B 2 108 ? -6.752  3.630   21.717  1.00 20.15 ?  339 ASP B CB    1 
ATOM   3204 C  CG    . ASP B 2 108 ? -8.236  3.538   21.863  1.00 21.43 ?  339 ASP B CG    1 
ATOM   3205 O  OD1   . ASP B 2 108 ? -8.719  2.471   22.319  1.00 24.41 ?  339 ASP B OD1   1 
ATOM   3206 O  OD2   . ASP B 2 108 ? -8.917  4.485   21.465  1.00 21.70 ?  339 ASP B OD2   1 
ATOM   3207 N  N     . SER B 2 109 ? -7.769  2.134   18.786  1.00 16.45 ?  340 SER B N     1 
ATOM   3208 C  CA    . SER B 2 109 ? -8.359  2.274   17.467  1.00 16.34 ?  340 SER B CA    1 
ATOM   3209 C  C     . SER B 2 109 ? -9.213  3.534   17.363  1.00 15.39 ?  340 SER B C     1 
ATOM   3210 O  O     . SER B 2 109 ? -9.079  4.293   16.389  1.00 15.64 ?  340 SER B O     1 
ATOM   3211 C  CB    . SER B 2 109 ? -9.192  1.033   17.145  1.00 18.49 ?  340 SER B CB    1 
ATOM   3212 O  OG    . SER B 2 109 ? -9.585  1.100   15.788  1.00 20.52 ?  340 SER B OG    1 
ATOM   3213 N  N     . ASP B 2 110 ? -10.104 3.760   18.320  1.00 14.43 ?  341 ASP B N     1 
ATOM   3214 C  CA    . ASP B 2 110 ? -10.983 4.938   18.222  1.00 15.09 ?  341 ASP B CA    1 
ATOM   3215 C  C     . ASP B 2 110 ? -10.190 6.227   18.250  1.00 14.92 ?  341 ASP B C     1 
ATOM   3216 O  O     . ASP B 2 110 ? -10.610 7.224   17.637  1.00 15.67 ?  341 ASP B O     1 
ATOM   3217 C  CB    . ASP B 2 110 ? -11.996 4.977   19.363  1.00 15.99 ?  341 ASP B CB    1 
ATOM   3218 C  CG    . ASP B 2 110 ? -13.181 4.073   19.156  1.00 19.79 ?  341 ASP B CG    1 
ATOM   3219 O  OD1   . ASP B 2 110 ? -13.278 3.286   18.158  1.00 20.34 ?  341 ASP B OD1   1 
ATOM   3220 O  OD2   . ASP B 2 110 ? -14.094 4.140   20.047  1.00 23.28 ?  341 ASP B OD2   1 
ATOM   3221 N  N     . THR B 2 111 ? -9.107  6.271   19.049  1.00 14.31 ?  342 THR B N     1 
ATOM   3222 C  CA    . THR B 2 111 ? -8.221  7.433   19.117  1.00 14.90 ?  342 THR B CA    1 
ATOM   3223 C  C     . THR B 2 111 ? -7.601  7.740   17.746  1.00 14.84 ?  342 THR B C     1 
ATOM   3224 O  O     . THR B 2 111 ? -7.587  8.909   17.306  1.00 15.51 ?  342 THR B O     1 
ATOM   3225 C  CB    . THR B 2 111 ? -7.112  7.161   20.171  1.00 17.74 ?  342 THR B CB    1 
ATOM   3226 O  OG1   . THR B 2 111 ? -7.730  7.061   21.485  1.00 19.80 ?  342 THR B OG1   1 
ATOM   3227 C  CG2   . THR B 2 111 ? -6.100  8.270   20.185  1.00 20.99 ?  342 THR B CG2   1 
ATOM   3228 N  N     . VAL B 2 112 ? -7.090  6.693   17.095  1.00 14.33 ?  343 VAL B N     1 
ATOM   3229 C  CA    . VAL B 2 112 ? -6.456  6.898   15.785  1.00 14.77 ?  343 VAL B CA    1 
ATOM   3230 C  C     . VAL B 2 112 ? -7.532  7.248   14.753  1.00 14.50 ?  343 VAL B C     1 
ATOM   3231 O  O     . VAL B 2 112 ? -7.276  8.067   13.864  1.00 15.35 ?  343 VAL B O     1 
ATOM   3232 C  CB    . VAL B 2 112 ? -5.630  5.662   15.374  1.00 15.43 ?  343 VAL B CB    1 
ATOM   3233 C  CG1   . VAL B 2 112 ? -5.081  5.840   13.932  1.00 16.78 ?  343 VAL B CG1   1 
ATOM   3234 C  CG2   . VAL B 2 112 ? -4.467  5.486   16.345  1.00 17.27 ?  343 VAL B CG2   1 
ATOM   3235 N  N     . LYS B 2 113 ? -8.718  6.659   14.843  1.00 13.23 ?  344 LYS B N     1 
ATOM   3236 C  CA    . LYS B 2 113 ? -9.810  6.953   13.907  1.00 13.72 ?  344 LYS B CA    1 
ATOM   3237 C  C     . LYS B 2 113 ? -10.158 8.452   13.947  1.00 13.79 ?  344 LYS B C     1 
ATOM   3238 O  O     . LYS B 2 113 ? -10.356 9.123   12.904  1.00 13.76 ?  344 LYS B O     1 
ATOM   3239 C  CB    . LYS B 2 113 ? -11.031 6.099   14.265  1.00 14.45 ?  344 LYS B CB    1 
ATOM   3240 C  CG    . LYS B 2 113 ? -12.051 6.014   13.116  1.00 14.91 ?  344 LYS B CG    1 
ATOM   3241 C  CD    . LYS B 2 113 ? -13.299 5.235   13.633  1.00 15.52 ?  344 LYS B CD    1 
ATOM   3242 C  CE    . LYS B 2 113 ? -14.260 4.837   12.537  1.00 16.12 ?  344 LYS B CE    1 
ATOM   3243 N  NZ    . LYS B 2 113 ? -15.398 4.010   13.145  1.00 16.21 ?  344 LYS B NZ    1 
ATOM   3244 N  N     . LEU B 2 114 ? -10.227 9.012   15.177  1.00 13.45 ?  345 LEU B N     1 
ATOM   3245 C  CA    . LEU B 2 114 ? -10.518 10.420  15.340  1.00 13.01 ?  345 LEU B CA    1 
ATOM   3246 C  C     . LEU B 2 114 ? -9.385  11.304  14.794  1.00 13.55 ?  345 LEU B C     1 
ATOM   3247 O  O     . LEU B 2 114 ? -9.636  12.322  14.150  1.00 14.40 ?  345 LEU B O     1 
ATOM   3248 C  CB    . LEU B 2 114 ? -10.801 10.734  16.826  1.00 14.57 ?  345 LEU B CB    1 
ATOM   3249 C  CG    . LEU B 2 114 ? -11.208 12.179  17.120  1.00 14.76 ?  345 LEU B CG    1 
ATOM   3250 C  CD1   . LEU B 2 114 ? -12.573 12.542  16.482  1.00 16.11 ?  345 LEU B CD1   1 
ATOM   3251 C  CD2   . LEU B 2 114 ? -11.246 12.350  18.689  1.00 15.81 ?  345 LEU B CD2   1 
ATOM   3252 N  N     . LEU B 2 115 ? -8.134  10.931  15.076  1.00 14.22 ?  346 LEU B N     1 
ATOM   3253 C  CA    . LEU B 2 115 ? -6.985  11.693  14.570  1.00 14.58 ?  346 LEU B CA    1 
ATOM   3254 C  C     . LEU B 2 115 ? -7.024  11.757  13.033  1.00 15.19 ?  346 LEU B C     1 
ATOM   3255 O  O     . LEU B 2 115 ? -6.885  12.850  12.460  1.00 15.47 ?  346 LEU B O     1 
ATOM   3256 C  CB    . LEU B 2 115 ? -5.678  11.034  15.016  1.00 17.68 ?  346 LEU B CB    1 
ATOM   3257 C  CG    . LEU B 2 115 ? -4.433  11.767  14.525  1.00 21.45 ?  346 LEU B CG    1 
ATOM   3258 C  CD1   . LEU B 2 115 ? -4.385  13.177  15.108  1.00 23.75 ?  346 LEU B CD1   1 
ATOM   3259 C  CD2   . LEU B 2 115 ? -3.194  10.988  14.954  1.00 22.57 ?  346 LEU B CD2   1 
ATOM   3260 N  N     . VAL B 2 116 ? -7.170  10.587  12.396  1.00 14.60 ?  347 VAL B N     1 
ATOM   3261 C  CA    . VAL B 2 116 ? -7.184  10.558  10.924  1.00 14.65 ?  347 VAL B CA    1 
ATOM   3262 C  C     . VAL B 2 116 ? -8.336  11.402  10.377  1.00 13.16 ?  347 VAL B C     1 
ATOM   3263 O  O     . VAL B 2 116 ? -8.191  12.240  9.475   1.00 14.18 ?  347 VAL B O     1 
ATOM   3264 C  CB    . VAL B 2 116 ? -7.255  9.129   10.425  1.00 14.56 ?  347 VAL B CB    1 
ATOM   3265 C  CG1   . VAL B 2 116 ? -7.411  9.118   8.909   1.00 15.67 ?  347 VAL B CG1   1 
ATOM   3266 C  CG2   . VAL B 2 116 ? -5.950  8.363   10.813  1.00 17.12 ?  347 VAL B CG2   1 
ATOM   3267 N  N     . ASP B 2 117 ? -9.510  11.243  10.954  1.00 12.98 ?  348 ASP B N     1 
ATOM   3268 C  CA    . ASP B 2 117 ? -10.679 11.969  10.492  1.00 13.28 ?  348 ASP B CA    1 
ATOM   3269 C  C     . ASP B 2 117 ? -10.446 13.499  10.577  1.00 13.67 ?  348 ASP B C     1 
ATOM   3270 O  O     . ASP B 2 117 ? -10.733 14.257  9.625   1.00 14.54 ?  348 ASP B O     1 
ATOM   3271 C  CB    . ASP B 2 117 ? -11.879 11.549  11.337  1.00 13.65 ?  348 ASP B CB    1 
ATOM   3272 C  CG    . ASP B 2 117 ? -13.190 12.123  10.830  1.00 15.06 ?  348 ASP B CG    1 
ATOM   3273 O  OD1   . ASP B 2 117 ? -13.335 12.347  9.599   1.00 16.16 ?  348 ASP B OD1   1 
ATOM   3274 O  OD2   . ASP B 2 117 ? -14.132 12.269  11.641  1.00 17.14 ?  348 ASP B OD2   1 
ATOM   3275 N  N     . LEU B 2 118 ? -9.952  13.975  11.717  1.00 13.34 ?  349 LEU B N     1 
ATOM   3276 C  CA    . LEU B 2 118 ? -9.788  15.391  11.870  1.00 13.86 ?  349 LEU B CA    1 
ATOM   3277 C  C     . LEU B 2 118 ? -8.646  15.939  11.014  1.00 14.27 ?  349 LEU B C     1 
ATOM   3278 O  O     . LEU B 2 118 ? -8.711  17.088  10.548  1.00 15.51 ?  349 LEU B O     1 
ATOM   3279 C  CB    . LEU B 2 118 ? -9.489  15.760  13.341  1.00 15.02 ?  349 LEU B CB    1 
ATOM   3280 C  CG    . LEU B 2 118 ? -10.695 15.501  14.269  1.00 17.33 ?  349 LEU B CG    1 
ATOM   3281 C  CD1   . LEU B 2 118 ? -10.226 15.704  15.688  1.00 18.90 ?  349 LEU B CD1   1 
ATOM   3282 C  CD2   . LEU B 2 118 ? -11.848 16.436  13.909  1.00 19.71 ?  349 LEU B CD2   1 
ATOM   3283 N  N     . GLU B 2 119 ? -7.562  15.178  10.848  1.00 13.68 ?  350 GLU B N     1 
ATOM   3284 C  CA    . GLU B 2 119 ? -6.480  15.704  9.989   1.00 15.10 ?  350 GLU B CA    1 
ATOM   3285 C  C     . GLU B 2 119 ? -6.924  15.798  8.547   1.00 15.15 ?  350 GLU B C     1 
ATOM   3286 O  O     . GLU B 2 119 ? -6.605  16.802  7.886   1.00 15.19 ?  350 GLU B O     1 
ATOM   3287 C  CB    . GLU B 2 119 ? -5.235  14.817  10.119  1.00 18.59 ?  350 GLU B CB    1 
ATOM   3288 C  CG    . GLU B 2 119 ? -4.603  14.873  11.563  1.00 24.65 ?  350 GLU B CG    1 
ATOM   3289 C  CD    . GLU B 2 119 ? -3.736  16.063  11.798  1.00 32.63 ?  350 GLU B CD    1 
ATOM   3290 O  OE1   . GLU B 2 119 ? -4.179  17.165  11.447  1.00 36.76 ?  350 GLU B OE1   1 
ATOM   3291 O  OE2   . GLU B 2 119 ? -2.663  15.926  12.459  1.00 37.58 ?  350 GLU B OE2   1 
ATOM   3292 N  N     . LEU B 2 120 ? -7.647  14.795  8.070   1.00 14.07 ?  351 LEU B N     1 
ATOM   3293 C  CA    . LEU B 2 120 ? -8.134  14.880  6.681   1.00 13.97 ?  351 LEU B CA    1 
ATOM   3294 C  C     . LEU B 2 120 ? -9.161  15.968  6.541   1.00 13.90 ?  351 LEU B C     1 
ATOM   3295 O  O     . LEU B 2 120 ? -9.076  16.814  5.629   1.00 14.84 ?  351 LEU B O     1 
ATOM   3296 C  CB    . LEU B 2 120 ? -8.708  13.534  6.210   1.00 13.30 ?  351 LEU B CB    1 
ATOM   3297 C  CG    . LEU B 2 120 ? -7.685  12.410  6.080   1.00 13.06 ?  351 LEU B CG    1 
ATOM   3298 C  CD1   . LEU B 2 120 ? -8.395  11.104  5.780   1.00 14.54 ?  351 LEU B CD1   1 
ATOM   3299 C  CD2   . LEU B 2 120 ? -6.656  12.724  4.973   1.00 14.38 ?  351 LEU B CD2   1 
ATOM   3300 N  N     . SER B 2 121 ? -10.191 15.975  7.410   1.00 13.87 ?  352 SER B N     1 
ATOM   3301 C  CA    . SER B 2 121 ? -11.271 16.942  7.224   1.00 14.77 ?  352 SER B CA    1 
ATOM   3302 C  C     . SER B 2 121 ? -10.768 18.388  7.345   1.00 14.59 ?  352 SER B C     1 
ATOM   3303 O  O     . SER B 2 121 ? -11.091 19.258  6.517   1.00 15.10 ?  352 SER B O     1 
ATOM   3304 C  CB    . SER B 2 121 ? -12.386 16.672  8.241   1.00 17.25 ?  352 SER B CB    1 
ATOM   3305 O  OG    . SER B 2 121 ? -13.590 17.183  7.765   1.00 23.65 ?  352 SER B OG    1 
ATOM   3306 N  N     . TYR B 2 122 ? -9.976  18.678  8.371   1.00 14.55 ?  353 TYR B N     1 
ATOM   3307 C  CA    . TYR B 2 122 ? -9.522  20.063  8.516   1.00 15.29 ?  353 TYR B CA    1 
ATOM   3308 C  C     . TYR B 2 122 ? -8.678  20.523  7.297   1.00 15.47 ?  353 TYR B C     1 
ATOM   3309 O  O     . TYR B 2 122 ? -8.857  21.654  6.805   1.00 16.37 ?  353 TYR B O     1 
ATOM   3310 C  CB    . TYR B 2 122 ? -8.716  20.217  9.845   1.00 16.93 ?  353 TYR B CB    1 
ATOM   3311 C  CG    . TYR B 2 122 ? -8.128  21.606  10.014  1.00 19.48 ?  353 TYR B CG    1 
ATOM   3312 C  CD1   . TYR B 2 122 ? -8.882  22.660  10.538  1.00 20.22 ?  353 TYR B CD1   1 
ATOM   3313 C  CD2   . TYR B 2 122 ? -6.847  21.882  9.594   1.00 22.47 ?  353 TYR B CD2   1 
ATOM   3314 C  CE1   . TYR B 2 122 ? -8.341  23.936  10.669  1.00 22.91 ?  353 TYR B CE1   1 
ATOM   3315 C  CE2   . TYR B 2 122 ? -6.314  23.143  9.716   1.00 26.06 ?  353 TYR B CE2   1 
ATOM   3316 C  CZ    . TYR B 2 122 ? -7.066  24.169  10.243  1.00 25.62 ?  353 TYR B CZ    1 
ATOM   3317 O  OH    . TYR B 2 122 ? -6.520  25.437  10.324  1.00 30.15 ?  353 TYR B OH    1 
ATOM   3318 N  N     . GLY B 2 123 ? -7.778  19.665  6.828   1.00 15.06 ?  354 GLY B N     1 
ATOM   3319 C  CA    . GLY B 2 123 ? -6.954  20.031  5.690   1.00 15.29 ?  354 GLY B CA    1 
ATOM   3320 C  C     . GLY B 2 123 ? -7.804  20.275  4.459   1.00 14.55 ?  354 GLY B C     1 
ATOM   3321 O  O     . GLY B 2 123 ? -7.605  21.271  3.730   1.00 15.59 ?  354 GLY B O     1 
ATOM   3322 N  N     . PHE B 2 124 ? -8.729  19.359  4.182   1.00 13.61 ?  355 PHE B N     1 
ATOM   3323 C  CA    . PHE B 2 124 ? -9.553  19.529  2.966   1.00 14.77 ?  355 PHE B CA    1 
ATOM   3324 C  C     . PHE B 2 124 ? -10.517 20.713  3.093   1.00 15.55 ?  355 PHE B C     1 
ATOM   3325 O  O     . PHE B 2 124 ? -10.852 21.351  2.060   1.00 18.48 ?  355 PHE B O     1 
ATOM   3326 C  CB    . PHE B 2 124 ? -10.346 18.254  2.636   1.00 13.52 ?  355 PHE B CB    1 
ATOM   3327 C  CG    . PHE B 2 124 ? -9.485  17.055  2.262   1.00 12.84 ?  355 PHE B CG    1 
ATOM   3328 C  CD1   . PHE B 2 124 ? -8.353  17.219  1.444   1.00 14.04 ?  355 PHE B CD1   1 
ATOM   3329 C  CD2   . PHE B 2 124 ? -9.844  15.760  2.647   1.00 13.26 ?  355 PHE B CD2   1 
ATOM   3330 C  CE1   . PHE B 2 124 ? -7.596  16.107  1.044   1.00 15.41 ?  355 PHE B CE1   1 
ATOM   3331 C  CE2   . PHE B 2 124 ? -9.078  14.648  2.287   1.00 13.97 ?  355 PHE B CE2   1 
ATOM   3332 C  CZ    . PHE B 2 124 ? -7.963  14.808  1.453   1.00 13.67 ?  355 PHE B CZ    1 
ATOM   3333 N  N     . GLU B 2 125 ? -10.967 21.027  4.311   1.00 16.40 ?  356 GLU B N     1 
ATOM   3334 C  CA    . GLU B 2 125 ? -11.790 22.218  4.524   1.00 17.90 ?  356 GLU B CA    1 
ATOM   3335 C  C     . GLU B 2 125 ? -11.071 23.521  4.328   1.00 19.29 ?  356 GLU B C     1 
ATOM   3336 O  O     . GLU B 2 125 ? -11.711 24.556  4.099   1.00 22.79 ?  356 GLU B O     1 
ATOM   3337 C  CB    . GLU B 2 125 ? -12.396 22.211  5.941   1.00 18.55 ?  356 GLU B CB    1 
ATOM   3338 C  CG    . GLU B 2 125 ? -13.415 21.128  6.155   1.00 20.31 ?  356 GLU B CG    1 
ATOM   3339 C  CD    . GLU B 2 125 ? -13.601 20.718  7.620   1.00 24.22 ?  356 GLU B CD    1 
ATOM   3340 O  OE1   . GLU B 2 125 ? -13.018 21.330  8.541   1.00 25.65 ?  356 GLU B OE1   1 
ATOM   3341 O  OE2   . GLU B 2 125 ? -14.333 19.725  7.842   1.00 27.39 ?  356 GLU B OE2   1 
ATOM   3342 N  N     . ASN B 2 126 ? -9.749  23.493  4.436   1.00 18.86 ?  357 ASN B N     1 
ATOM   3343 C  CA    . ASN B 2 126 ? -8.965  24.706  4.407   1.00 20.64 ?  357 ASN B CA    1 
ATOM   3344 C  C     . ASN B 2 126 ? -8.025  24.790  3.209   1.00 22.59 ?  357 ASN B C     1 
ATOM   3345 O  O     . ASN B 2 126 ? -7.047  25.487  3.241   1.00 26.78 ?  357 ASN B O     1 
ATOM   3346 C  CB    . ASN B 2 126 ? -8.225  24.828  5.729   1.00 22.90 ?  357 ASN B CB    1 
ATOM   3347 C  CG    . ASN B 2 126 ? -9.179  25.244  6.852   1.00 25.91 ?  357 ASN B CG    1 
ATOM   3348 O  OD1   . ASN B 2 126 ? -9.594  26.408  6.927   1.00 29.62 ?  357 ASN B OD1   1 
ATOM   3349 N  ND2   . ASN B 2 126 ? -9.586  24.297  7.669   1.00 25.68 ?  357 ASN B ND2   1 
ATOM   3350 N  N     . GLY B 2 127 ? -8.358  24.128  2.127   1.00 21.25 ?  358 GLY B N     1 
ATOM   3351 C  CA    . GLY B 2 127 ? -7.681  24.424  0.884   1.00 20.53 ?  358 GLY B CA    1 
ATOM   3352 C  C     . GLY B 2 127 ? -6.752  23.366  0.363   1.00 19.80 ?  358 GLY B C     1 
ATOM   3353 O  O     . GLY B 2 127 ? -6.344  23.429  -0.821  1.00 21.46 ?  358 GLY B O     1 
ATOM   3354 N  N     . GLN B 2 128 ? -6.393  22.399  1.189   1.00 16.79 ?  359 GLN B N     1 
ATOM   3355 C  CA    . GLN B 2 128 ? -5.487  21.335  0.673   1.00 14.63 ?  359 GLN B CA    1 
ATOM   3356 C  C     . GLN B 2 128 ? -6.325  20.395  -0.201  1.00 14.57 ?  359 GLN B C     1 
ATOM   3357 O  O     . GLN B 2 128 ? -7.504  20.200  0.057   1.00 15.35 ?  359 GLN B O     1 
ATOM   3358 C  CB    . GLN B 2 128 ? -4.784  20.597  1.803   1.00 14.85 ?  359 GLN B CB    1 
ATOM   3359 C  CG    . GLN B 2 128 ? -3.706  21.545  2.421   1.00 15.66 ?  359 GLN B CG    1 
ATOM   3360 C  CD    . GLN B 2 128 ? -3.168  20.960  3.689   1.00 16.06 ?  359 GLN B CD    1 
ATOM   3361 O  OE1   . GLN B 2 128 ? -3.805  21.072  4.758   1.00 18.18 ?  359 GLN B OE1   1 
ATOM   3362 N  NE2   . GLN B 2 128 ? -1.992  20.351  3.623   1.00 16.08 ?  359 GLN B NE2   1 
ATOM   3363 N  N     . LYS B 2 129 ? -5.705  19.836  -1.241  1.00 13.25 ?  360 LYS B N     1 
ATOM   3364 C  CA    . LYS B 2 129 ? -6.422  18.995  -2.218  1.00 13.99 ?  360 LYS B CA    1 
ATOM   3365 C  C     . LYS B 2 129 ? -5.892  17.574  -2.282  1.00 13.59 ?  360 LYS B C     1 
ATOM   3366 O  O     . LYS B 2 129 ? -6.426  16.770  -3.039  1.00 14.79 ?  360 LYS B O     1 
ATOM   3367 C  CB    . LYS B 2 129 ? -6.351  19.624  -3.628  1.00 16.22 ?  360 LYS B CB    1 
ATOM   3368 C  CG    . LYS B 2 129 ? -6.858  21.084  -3.686  1.00 22.11 ?  360 LYS B CG    1 
ATOM   3369 C  CD    . LYS B 2 129 ? -8.340  21.111  -3.522  1.00 26.86 ?  360 LYS B CD    1 
ATOM   3370 C  CE    . LYS B 2 129 ? -8.957  20.929  -4.930  1.00 31.69 ?  360 LYS B CE    1 
ATOM   3371 N  NZ    . LYS B 2 129 ? -10.427 21.203  -4.894  1.00 34.58 ?  360 LYS B NZ    1 
ATOM   3372 N  N     . ALA B 2 130 ? -4.854  17.238  -1.508  1.00 12.75 ?  361 ALA B N     1 
ATOM   3373 C  CA    . ALA B 2 130 ? -4.354  15.862  -1.508  1.00 12.77 ?  361 ALA B CA    1 
ATOM   3374 C  C     . ALA B 2 130 ? -3.846  15.490  -0.145  1.00 12.88 ?  361 ALA B C     1 
ATOM   3375 O  O     . ALA B 2 130 ? -3.405  16.363  0.620   1.00 14.36 ?  361 ALA B O     1 
ATOM   3376 C  CB    . ALA B 2 130 ? -3.234  15.679  -2.558  1.00 13.80 ?  361 ALA B CB    1 
ATOM   3377 N  N     . ALA B 2 131 ? -3.931  14.192  0.147   1.00 12.71 ?  362 ALA B N     1 
ATOM   3378 C  CA    . ALA B 2 131 ? -3.332  13.624  1.348   1.00 13.05 ?  362 ALA B CA    1 
ATOM   3379 C  C     . ALA B 2 131 ? -2.426  12.497  0.948   1.00 12.54 ?  362 ALA B C     1 
ATOM   3380 O  O     . ALA B 2 131 ? -2.731  11.774  -0.014  1.00 13.96 ?  362 ALA B O     1 
ATOM   3381 C  CB    . ALA B 2 131 ? -4.406  13.095  2.300   1.00 13.09 ?  362 ALA B CB    1 
ATOM   3382 N  N     . VAL B 2 132 ? -1.333  12.318  1.686   1.00 12.72 ?  363 VAL B N     1 
ATOM   3383 C  CA    . VAL B 2 132 ? -0.516  11.100  1.583   1.00 13.24 ?  363 VAL B CA    1 
ATOM   3384 C  C     . VAL B 2 132 ? -0.616  10.401  2.923   1.00 12.90 ?  363 VAL B C     1 
ATOM   3385 O  O     . VAL B 2 132 ? -0.384  10.999  3.985   1.00 13.75 ?  363 VAL B O     1 
ATOM   3386 C  CB    . VAL B 2 132 ? 0.932   11.368  1.140   1.00 15.26 ?  363 VAL B CB    1 
ATOM   3387 C  CG1   . VAL B 2 132 ? 1.673   12.323  2.103   1.00 16.93 ?  363 VAL B CG1   1 
ATOM   3388 C  CG2   . VAL B 2 132 ? 1.666   10.010  0.960   1.00 15.76 ?  363 VAL B CG2   1 
ATOM   3389 N  N     . VAL B 2 133 ? -1.024  9.143   2.852   1.00 12.85 ?  364 VAL B N     1 
ATOM   3390 C  CA    . VAL B 2 133 ? -1.228  8.302   4.054   1.00 13.24 ?  364 VAL B CA    1 
ATOM   3391 C  C     . VAL B 2 133 ? -0.258  7.125   3.988   1.00 13.84 ?  364 VAL B C     1 
ATOM   3392 O  O     . VAL B 2 133 ? -0.492  6.109   3.287   1.00 14.22 ?  364 VAL B O     1 
ATOM   3393 C  CB    . VAL B 2 133 ? -2.678  7.794   4.132   1.00 15.20 ?  364 VAL B CB    1 
ATOM   3394 C  CG1   . VAL B 2 133 ? -2.872  6.973   5.457   1.00 16.63 ?  364 VAL B CG1   1 
ATOM   3395 C  CG2   . VAL B 2 133 ? -3.649  8.987   4.034   1.00 15.85 ?  364 VAL B CG2   1 
ATOM   3396 N  N     . HIS B 2 134 ? 0.846   7.295   4.691   1.00 14.15 ?  365 HIS B N     1 
ATOM   3397 C  CA    . HIS B 2 134 ? 1.920   6.304   4.670   1.00 14.10 ?  365 HIS B CA    1 
ATOM   3398 C  C     . HIS B 2 134 ? 1.623   5.104   5.543   1.00 14.59 ?  365 HIS B C     1 
ATOM   3399 O  O     . HIS B 2 134 ? 1.052   5.261   6.624   1.00 14.93 ?  365 HIS B O     1 
ATOM   3400 C  CB    . HIS B 2 134 ? 3.241   6.917   5.167   1.00 14.81 ?  365 HIS B CB    1 
ATOM   3401 C  CG    . HIS B 2 134 ? 3.725   8.076   4.357   1.00 15.20 ?  365 HIS B CG    1 
ATOM   3402 N  ND1   . HIS B 2 134 ? 4.406   7.906   3.176   1.00 16.94 ?  365 HIS B ND1   1 
ATOM   3403 C  CD2   . HIS B 2 134 ? 3.610   9.411   4.539   1.00 17.59 ?  365 HIS B CD2   1 
ATOM   3404 C  CE1   . HIS B 2 134 ? 4.721   9.094   2.675   1.00 17.62 ?  365 HIS B CE1   1 
ATOM   3405 N  NE2   . HIS B 2 134 ? 4.252   10.026  3.486   1.00 17.57 ?  365 HIS B NE2   1 
ATOM   3406 N  N     . HIS B 2 135 ? 2.037   3.920   5.105   1.00 15.00 ?  366 HIS B N     1 
ATOM   3407 C  CA    . HIS B 2 135 ? 2.007   2.713   5.959   1.00 15.69 ?  366 HIS B CA    1 
ATOM   3408 C  C     . HIS B 2 135 ? 0.616   2.381   6.450   1.00 15.35 ?  366 HIS B C     1 
ATOM   3409 O  O     . HIS B 2 135 ? 0.362   2.169   7.662   1.00 16.40 ?  366 HIS B O     1 
ATOM   3410 C  CB    . HIS B 2 135 ? 2.921   2.902   7.179   1.00 18.51 ?  366 HIS B CB    1 
ATOM   3411 C  CG    . HIS B 2 135 ? 4.362   2.960   6.833   1.00 22.78 ?  366 HIS B CG    1 
ATOM   3412 N  ND1   . HIS B 2 135 ? 5.123   4.096   6.985   1.00 24.34 ?  366 HIS B ND1   1 
ATOM   3413 C  CD2   . HIS B 2 135 ? 5.184   2.004   6.347   1.00 27.44 ?  366 HIS B CD2   1 
ATOM   3414 C  CE1   . HIS B 2 135 ? 6.357   3.843   6.584   1.00 27.79 ?  366 HIS B CE1   1 
ATOM   3415 N  NE2   . HIS B 2 135 ? 6.432   2.565   6.245   1.00 28.94 ?  366 HIS B NE2   1 
ATOM   3416 N  N     . PHE B 2 136 ? -0.280  2.332   5.498   1.00 15.22 ?  367 PHE B N     1 
ATOM   3417 C  CA    . PHE B 2 136 ? -1.680  1.997   5.751   1.00 15.28 ?  367 PHE B CA    1 
ATOM   3418 C  C     . PHE B 2 136 ? -1.817  0.676   6.475   1.00 15.04 ?  367 PHE B C     1 
ATOM   3419 O  O     . PHE B 2 136 ? -2.709  0.522   7.334   1.00 15.81 ?  367 PHE B O     1 
ATOM   3420 C  CB    . PHE B 2 136 ? -2.404  1.931   4.363   1.00 14.99 ?  367 PHE B CB    1 
ATOM   3421 C  CG    . PHE B 2 136 ? -3.899  1.916   4.461   1.00 16.20 ?  367 PHE B CG    1 
ATOM   3422 C  CD1   . PHE B 2 136 ? -4.588  3.106   4.509   1.00 17.46 ?  367 PHE B CD1   1 
ATOM   3423 C  CD2   . PHE B 2 136 ? -4.607  0.725   4.492   1.00 16.64 ?  367 PHE B CD2   1 
ATOM   3424 C  CE1   . PHE B 2 136 ? -6.020  3.134   4.588   1.00 17.83 ?  367 PHE B CE1   1 
ATOM   3425 C  CE2   . PHE B 2 136 ? -6.043  0.726   4.545   1.00 16.63 ?  367 PHE B CE2   1 
ATOM   3426 C  CZ    . PHE B 2 136 ? -6.712  1.922   4.636   1.00 16.17 ?  367 PHE B CZ    1 
ATOM   3427 N  N     . GLU B 2 137 ? -0.930  -0.292  6.184   1.00 14.91 ?  368 GLU B N     1 
ATOM   3428 C  CA    . GLU B 2 137 ? -1.010  -1.622  6.796   1.00 16.60 ?  368 GLU B CA    1 
ATOM   3429 C  C     . GLU B 2 137 ? -0.759  -1.621  8.317   1.00 16.53 ?  368 GLU B C     1 
ATOM   3430 O  O     . GLU B 2 137 ? -1.027  -2.602  8.972   1.00 18.16 ?  368 GLU B O     1 
ATOM   3431 C  CB    . GLU B 2 137 ? -0.004  -2.595  6.130   1.00 17.45 ?  368 GLU B CB    1 
ATOM   3432 C  CG    . GLU B 2 137 ? 1.489   -2.447  6.580   1.00 18.83 ?  368 GLU B CG    1 
ATOM   3433 C  CD    . GLU B 2 137 ? 2.135   -1.115  6.190   1.00 19.99 ?  368 GLU B CD    1 
ATOM   3434 O  OE1   . GLU B 2 137 ? 1.775   -0.529  5.167   1.00 19.18 ?  368 GLU B OE1   1 
ATOM   3435 O  OE2   . GLU B 2 137 ? 3.010   -0.622  6.980   1.00 22.88 ?  368 GLU B OE2   1 
ATOM   3436 N  N     . SER B 2 138 ? -0.253  -0.502  8.822   1.00 15.28 ?  369 SER B N     1 
ATOM   3437 C  CA    . SER B 2 138 ? 0.149   -0.421  10.215  1.00 16.06 ?  369 SER B CA    1 
ATOM   3438 C  C     . SER B 2 138 ? -0.842  0.290   11.096  1.00 16.82 ?  369 SER B C     1 
ATOM   3439 O  O     . SER B 2 138 ? -0.662  0.337   12.309  1.00 17.48 ?  369 SER B O     1 
ATOM   3440 C  CB    . SER B 2 138 ? 1.513   0.272   10.301  1.00 17.88 ?  369 SER B CB    1 
ATOM   3441 O  OG    . SER B 2 138 ? 2.527   -0.515  9.716   1.00 20.96 ?  369 SER B OG    1 
ATOM   3442 N  N     . PHE B 2 139 ? -1.950  0.797   10.548  1.00 16.34 ?  370 PHE B N     1 
ATOM   3443 C  CA    . PHE B 2 139 ? -2.998  1.372   11.421  1.00 15.40 ?  370 PHE B CA    1 
ATOM   3444 C  C     . PHE B 2 139 ? -3.682  0.281   12.235  1.00 17.04 ?  370 PHE B C     1 
ATOM   3445 O  O     . PHE B 2 139 ? -3.758  -0.874  11.774  1.00 17.57 ?  370 PHE B O     1 
ATOM   3446 C  CB    . PHE B 2 139 ? -4.074  2.077   10.532  1.00 15.96 ?  370 PHE B CB    1 
ATOM   3447 C  CG    . PHE B 2 139 ? -3.651  3.403   9.994   1.00 17.58 ?  370 PHE B CG    1 
ATOM   3448 C  CD1   . PHE B 2 139 ? -3.520  4.497   10.809  1.00 18.33 ?  370 PHE B CD1   1 
ATOM   3449 C  CD2   . PHE B 2 139 ? -3.449  3.555   8.661   1.00 24.32 ?  370 PHE B CD2   1 
ATOM   3450 C  CE1   . PHE B 2 139 ? -3.178  5.737   10.330  1.00 18.53 ?  370 PHE B CE1   1 
ATOM   3451 C  CE2   . PHE B 2 139 ? -3.110  4.796   8.169   1.00 26.42 ?  370 PHE B CE2   1 
ATOM   3452 C  CZ    . PHE B 2 139 ? -2.971  5.893   9.010   1.00 23.35 ?  370 PHE B CZ    1 
ATOM   3453 N  N     . PRO B 2 140 ? -4.258  0.651   13.405  1.00 16.56 ?  371 PRO B N     1 
ATOM   3454 C  CA    . PRO B 2 140 ? -5.203  -0.292  14.037  1.00 16.34 ?  371 PRO B CA    1 
ATOM   3455 C  C     . PRO B 2 140 ? -6.297  -0.654  13.048  1.00 17.60 ?  371 PRO B C     1 
ATOM   3456 O  O     . PRO B 2 140 ? -6.818  0.261   12.367  1.00 17.60 ?  371 PRO B O     1 
ATOM   3457 C  CB    . PRO B 2 140 ? -5.794  0.482   15.261  1.00 17.45 ?  371 PRO B CB    1 
ATOM   3458 C  CG    . PRO B 2 140 ? -4.836  1.608   15.515  1.00 18.18 ?  371 PRO B CG    1 
ATOM   3459 C  CD    . PRO B 2 140 ? -4.216  1.945   14.102  1.00 17.54 ?  371 PRO B CD    1 
ATOM   3460 N  N     . ALA B 2 141 ? -6.658  -1.932  12.984  1.00 16.90 ?  372 ALA B N     1 
ATOM   3461 C  CA    . ALA B 2 141 ? -7.573  -2.322  11.915  1.00 17.41 ?  372 ALA B CA    1 
ATOM   3462 C  C     . ALA B 2 141 ? -8.910  -1.561  11.939  1.00 16.60 ?  372 ALA B C     1 
ATOM   3463 O  O     . ALA B 2 141 ? -9.408  -1.148  10.887  1.00 17.62 ?  372 ALA B O     1 
ATOM   3464 C  CB    . ALA B 2 141 ? -7.851  -3.815  11.951  1.00 18.56 ?  372 ALA B CB    1 
ATOM   3465 N  N     . GLY B 2 142 ? -9.510  -1.371  13.097  1.00 16.54 ?  373 GLY B N     1 
ATOM   3466 C  CA    . GLY B 2 142 ? -10.822 -0.739  13.151  1.00 17.70 ?  373 GLY B CA    1 
ATOM   3467 C  C     . GLY B 2 142 ? -10.792 0.693   12.687  1.00 17.86 ?  373 GLY B C     1 
ATOM   3468 O  O     . GLY B 2 142 ? -11.800 1.207   12.141  1.00 18.70 ?  373 GLY B O     1 
ATOM   3469 N  N     . SER B 2 143 ? -9.659  1.364   12.928  1.00 17.49 ?  374 SER B N     1 
ATOM   3470 C  CA    . SER B 2 143 ? -9.593  2.784   12.586  1.00 16.46 ?  374 SER B CA    1 
ATOM   3471 C  C     . SER B 2 143 ? -9.727  3.007   11.076  1.00 16.06 ?  374 SER B C     1 
ATOM   3472 O  O     . SER B 2 143 ? -10.187 4.071   10.645  1.00 16.58 ?  374 SER B O     1 
ATOM   3473 C  CB    . SER B 2 143 ? -8.292  3.448   13.081  1.00 17.00 ?  374 SER B CB    1 
ATOM   3474 O  OG    . SER B 2 143 ? -7.146  2.983   12.372  1.00 18.61 ?  374 SER B OG    1 
ATOM   3475 N  N     . THR B 2 144 ? -9.329  1.999   10.287  1.00 14.98 ?  375 THR B N     1 
ATOM   3476 C  CA    . THR B 2 144 ? -9.306  2.185   8.816   1.00 15.42 ?  375 THR B CA    1 
ATOM   3477 C  C     . THR B 2 144 ? -10.713 2.232   8.258   1.00 14.74 ?  375 THR B C     1 
ATOM   3478 O  O     . THR B 2 144 ? -10.872 2.597   7.097   1.00 15.64 ?  375 THR B O     1 
ATOM   3479 C  CB    . THR B 2 144 ? -8.493  1.090   8.084   1.00 15.42 ?  375 THR B CB    1 
ATOM   3480 O  OG1   . THR B 2 144 ? -9.114  -0.196  8.233   1.00 16.32 ?  375 THR B OG1   1 
ATOM   3481 C  CG2   . THR B 2 144 ? -7.021  1.081   8.600   1.00 17.29 ?  375 THR B CG2   1 
ATOM   3482 N  N     . LEU B 2 145 ? -11.739 1.902   9.064   1.00 14.27 ?  376 LEU B N     1 
ATOM   3483 C  CA    . LEU B 2 145 ? -13.137 2.075   8.617   1.00 14.73 ?  376 LEU B CA    1 
ATOM   3484 C  C     . LEU B 2 145 ? -13.403 3.544   8.286   1.00 13.35 ?  376 LEU B C     1 
ATOM   3485 O  O     . LEU B 2 145 ? -14.345 3.848   7.523   1.00 13.50 ?  376 LEU B O     1 
ATOM   3486 C  CB    . LEU B 2 145 ? -14.138 1.540   9.674   1.00 15.75 ?  376 LEU B CB    1 
ATOM   3487 C  CG    . LEU B 2 145 ? -14.127 -0.002  9.869   1.00 18.15 ?  376 LEU B CG    1 
ATOM   3488 C  CD1   . LEU B 2 145 ? -15.043 -0.404  11.001  1.00 20.33 ?  376 LEU B CD1   1 
ATOM   3489 C  CD2   . LEU B 2 145 ? -14.594 -0.717  8.579   1.00 20.93 ?  376 LEU B CD2   1 
ATOM   3490 N  N     . ILE B 2 146 ? -12.614 4.489   8.825   1.00 13.88 ?  377 ILE B N     1 
ATOM   3491 C  CA    . ILE B 2 146 ? -12.809 5.911   8.464   1.00 13.03 ?  377 ILE B CA    1 
ATOM   3492 C  C     . ILE B 2 146 ? -12.580 6.150   6.988   1.00 12.45 ?  377 ILE B C     1 
ATOM   3493 O  O     . ILE B 2 146 ? -13.100 7.165   6.426   1.00 13.60 ?  377 ILE B O     1 
ATOM   3494 C  CB    . ILE B 2 146 ? -11.911 6.859   9.313   1.00 14.56 ?  377 ILE B CB    1 
ATOM   3495 C  CG1   . ILE B 2 146 ? -12.457 8.316   9.312   1.00 14.65 ?  377 ILE B CG1   1 
ATOM   3496 C  CG2   . ILE B 2 146 ? -10.449 6.803   8.872   1.00 16.10 ?  377 ILE B CG2   1 
ATOM   3497 C  CD1   . ILE B 2 146 ? -13.832 8.472   9.992   1.00 15.64 ?  377 ILE B CD1   1 
ATOM   3498 N  N     . PHE B 2 147 ? -11.834 5.257   6.334   1.00 13.04 ?  378 PHE B N     1 
ATOM   3499 C  CA    . PHE B 2 147 ? -11.622 5.497   4.902   1.00 13.62 ?  378 PHE B CA    1 
ATOM   3500 C  C     . PHE B 2 147 ? -12.886 5.212   4.082   1.00 13.67 ?  378 PHE B C     1 
ATOM   3501 O  O     . PHE B 2 147 ? -12.965 5.718   2.945   1.00 15.79 ?  378 PHE B O     1 
ATOM   3502 C  CB    . PHE B 2 147 ? -10.387 4.740   4.392   1.00 14.33 ?  378 PHE B CB    1 
ATOM   3503 C  CG    . PHE B 2 147 ? -9.144  5.406   4.883   1.00 15.22 ?  378 PHE B CG    1 
ATOM   3504 C  CD1   . PHE B 2 147 ? -8.631  6.470   4.153   1.00 15.98 ?  378 PHE B CD1   1 
ATOM   3505 C  CD2   . PHE B 2 147 ? -8.545  5.045   6.088   1.00 16.41 ?  378 PHE B CD2   1 
ATOM   3506 C  CE1   . PHE B 2 147 ? -7.531  7.159   4.577   1.00 17.60 ?  378 PHE B CE1   1 
ATOM   3507 C  CE2   . PHE B 2 147 ? -7.456  5.745   6.560   1.00 16.82 ?  378 PHE B CE2   1 
ATOM   3508 C  CZ    . PHE B 2 147 ? -6.915  6.794   5.805   1.00 16.80 ?  378 PHE B CZ    1 
ATOM   3509 N  N     . TYR B 2 148 ? -13.895 4.504   4.635   1.00 13.43 ?  379 TYR B N     1 
ATOM   3510 C  CA    . TYR B 2 148 ? -15.198 4.524   3.916   1.00 13.20 ?  379 TYR B CA    1 
ATOM   3511 C  C     . TYR B 2 148 ? -15.689 5.975   3.728   1.00 13.57 ?  379 TYR B C     1 
ATOM   3512 O  O     . TYR B 2 148 ? -16.319 6.302   2.707   1.00 15.99 ?  379 TYR B O     1 
ATOM   3513 C  CB    . TYR B 2 148 ? -16.260 3.707   4.695   1.00 14.23 ?  379 TYR B CB    1 
ATOM   3514 C  CG    . TYR B 2 148 ? -16.324 2.217   4.513   1.00 14.49 ?  379 TYR B CG    1 
ATOM   3515 C  CD1   . TYR B 2 148 ? -15.478 1.356   5.210   1.00 16.69 ?  379 TYR B CD1   1 
ATOM   3516 C  CD2   . TYR B 2 148 ? -17.352 1.633   3.747   1.00 15.74 ?  379 TYR B CD2   1 
ATOM   3517 C  CE1   . TYR B 2 148 ? -15.598 -0.083  5.094   1.00 16.83 ?  379 TYR B CE1   1 
ATOM   3518 C  CE2   . TYR B 2 148 ? -17.502 0.228   3.673   1.00 16.69 ?  379 TYR B CE2   1 
ATOM   3519 C  CZ    . TYR B 2 148 ? -16.638 -0.622  4.353   1.00 16.58 ?  379 TYR B CZ    1 
ATOM   3520 O  OH    . TYR B 2 148 ? -16.821 -2.001  4.271   1.00 16.68 ?  379 TYR B OH    1 
ATOM   3521 N  N     . LYS B 2 149 ? -15.513 6.826   4.754   1.00 13.88 ?  380 LYS B N     1 
ATOM   3522 C  CA    . LYS B 2 149 ? -16.039 8.197   4.726   1.00 13.18 ?  380 LYS B CA    1 
ATOM   3523 C  C     . LYS B 2 149 ? -15.406 8.971   3.562   1.00 13.50 ?  380 LYS B C     1 
ATOM   3524 O  O     . LYS B 2 149 ? -16.084 9.758   2.853   1.00 14.93 ?  380 LYS B O     1 
ATOM   3525 C  CB    . LYS B 2 149 ? -15.761 8.914   6.043   1.00 13.28 ?  380 LYS B CB    1 
ATOM   3526 C  CG    . LYS B 2 149 ? -15.939 10.433  5.971   1.00 14.40 ?  380 LYS B CG    1 
ATOM   3527 C  CD    . LYS B 2 149 ? -15.879 11.038  7.379   1.00 14.22 ?  380 LYS B CD    1 
ATOM   3528 C  CE    . LYS B 2 149 ? -15.913 12.560  7.295   1.00 14.83 ?  380 LYS B CE    1 
ATOM   3529 N  NZ    . LYS B 2 149 ? -15.823 13.214  8.712   1.00 16.82 ?  380 LYS B NZ    1 
ATOM   3530 N  N     . TYR B 2 150 ? -14.103 8.727   3.360   1.00 12.93 ?  381 TYR B N     1 
ATOM   3531 C  CA    . TYR B 2 150 ? -13.352 9.512   2.403   1.00 12.54 ?  381 TYR B CA    1 
ATOM   3532 C  C     . TYR B 2 150 ? -13.293 8.940   0.991   1.00 13.45 ?  381 TYR B C     1 
ATOM   3533 O  O     . TYR B 2 150 ? -12.980 9.669   0.087   1.00 15.42 ?  381 TYR B O     1 
ATOM   3534 C  CB    . TYR B 2 150 ? -11.914 9.759   2.922   1.00 13.23 ?  381 TYR B CB    1 
ATOM   3535 C  CG    . TYR B 2 150 ? -12.009 10.725  4.100   1.00 12.82 ?  381 TYR B CG    1 
ATOM   3536 C  CD1   . TYR B 2 150 ? -12.091 12.089  3.883   1.00 13.26 ?  381 TYR B CD1   1 
ATOM   3537 C  CD2   . TYR B 2 150 ? -12.084 10.259  5.412   1.00 12.44 ?  381 TYR B CD2   1 
ATOM   3538 C  CE1   . TYR B 2 150 ? -12.229 13.016  4.944   1.00 13.27 ?  381 TYR B CE1   1 
ATOM   3539 C  CE2   . TYR B 2 150 ? -12.251 11.153  6.500   1.00 13.45 ?  381 TYR B CE2   1 
ATOM   3540 C  CZ    . TYR B 2 150 ? -12.311 12.534  6.241   1.00 13.75 ?  381 TYR B CZ    1 
ATOM   3541 O  OH    . TYR B 2 150 ? -12.452 13.425  7.285   1.00 16.02 ?  381 TYR B OH    1 
ATOM   3542 N  N     . CYS B 2 151 ? -13.566 7.660   0.842   1.00 13.42 ?  382 CYS B N     1 
ATOM   3543 C  CA    . CYS B 2 151 ? -13.254 6.976   -0.442  1.00 13.13 ?  382 CYS B CA    1 
ATOM   3544 C  C     . CYS B 2 151 ? -14.464 6.327   -1.098  1.00 13.67 ?  382 CYS B C     1 
ATOM   3545 O  O     . CYS B 2 151 ? -14.316 5.631   -2.092  1.00 14.95 ?  382 CYS B O     1 
ATOM   3546 C  CB    . CYS B 2 151 ? -12.176 5.897   -0.204  1.00 14.15 ?  382 CYS B CB    1 
ATOM   3547 S  SG    . CYS B 2 151 ? -10.611 6.598   0.474   1.00 15.43 ?  382 CYS B SG    1 
ATOM   3548 N  N     . ASP B 2 152 ? -15.658 6.519   -0.537  1.00 12.97 ?  383 ASP B N     1 
ATOM   3549 C  CA    . ASP B 2 152 ? -16.858 5.972   -1.204  1.00 13.51 ?  383 ASP B CA    1 
ATOM   3550 C  C     . ASP B 2 152 ? -17.006 6.519   -2.640  1.00 13.07 ?  383 ASP B C     1 
ATOM   3551 O  O     . ASP B 2 152 ? -16.708 7.684   -2.899  1.00 14.02 ?  383 ASP B O     1 
ATOM   3552 C  CB    . ASP B 2 152 ? -18.112 6.358   -0.388  1.00 13.93 ?  383 ASP B CB    1 
ATOM   3553 C  CG    . ASP B 2 152 ? -19.320 5.563   -0.826  1.00 14.54 ?  383 ASP B CG    1 
ATOM   3554 O  OD1   . ASP B 2 152 ? -19.391 4.381   -0.463  1.00 15.22 ?  383 ASP B OD1   1 
ATOM   3555 O  OD2   . ASP B 2 152 ? -20.163 6.091   -1.593  1.00 14.87 ?  383 ASP B OD2   1 
ATOM   3556 N  N     . HIS B 2 153 ? -17.516 5.693   -3.552  1.00 12.47 ?  384 HIS B N     1 
ATOM   3557 C  CA    . HIS B 2 153 ? -17.627 6.159   -4.960  1.00 12.49 ?  384 HIS B CA    1 
ATOM   3558 C  C     . HIS B 2 153 ? -18.765 7.125   -5.201  1.00 14.35 ?  384 HIS B C     1 
ATOM   3559 O  O     . HIS B 2 153 ? -18.781 7.764   -6.248  1.00 15.68 ?  384 HIS B O     1 
ATOM   3560 C  CB    . HIS B 2 153 ? -17.754 4.961   -5.937  1.00 14.46 ?  384 HIS B CB    1 
ATOM   3561 C  CG    . HIS B 2 153 ? -19.141 4.436   -6.102  1.00 13.57 ?  384 HIS B CG    1 
ATOM   3562 N  ND1   . HIS B 2 153 ? -19.746 3.589   -5.195  1.00 14.37 ?  384 HIS B ND1   1 
ATOM   3563 C  CD2   . HIS B 2 153 ? -20.043 4.601   -7.109  1.00 16.57 ?  384 HIS B CD2   1 
ATOM   3564 C  CE1   . HIS B 2 153 ? -20.964 3.274   -5.623  1.00 15.59 ?  384 HIS B CE1   1 
ATOM   3565 N  NE2   . HIS B 2 153 ? -21.157 3.863   -6.789  1.00 18.79 ?  384 HIS B NE2   1 
ATOM   3566 N  N     . GLU B 2 154 ? -19.720 7.228   -4.267  1.00 14.75 ?  385 GLU B N     1 
ATOM   3567 C  CA    . GLU B 2 154 ? -20.871 8.132   -4.427  1.00 16.19 ?  385 GLU B CA    1 
ATOM   3568 C  C     . GLU B 2 154 ? -20.985 9.214   -3.382  1.00 15.20 ?  385 GLU B C     1 
ATOM   3569 O  O     . GLU B 2 154 ? -21.419 10.353  -3.660  1.00 16.09 ?  385 GLU B O     1 
ATOM   3570 C  CB    . GLU B 2 154 ? -22.220 7.353   -4.311  1.00 20.37 ?  385 GLU B CB    1 
ATOM   3571 C  CG    . GLU B 2 154 ? -22.296 6.183   -5.101  1.00 24.94 ?  385 GLU B CG    1 
ATOM   3572 C  CD    . GLU B 2 154 ? -23.624 5.526   -5.053  1.00 25.81 ?  385 GLU B CD    1 
ATOM   3573 O  OE1   . GLU B 2 154 ? -23.988 4.834   -4.060  1.00 23.18 ?  385 GLU B OE1   1 
ATOM   3574 O  OE2   . GLU B 2 154 ? -24.312 5.693   -6.069  1.00 29.80 ?  385 GLU B OE2   1 
ATOM   3575 N  N     . ASN B 2 155 ? -20.649 8.854   -2.140  1.00 14.00 ?  386 ASN B N     1 
ATOM   3576 C  CA    . ASN B 2 155 ? -20.999 9.728   -1.026  1.00 14.91 ?  386 ASN B CA    1 
ATOM   3577 C  C     . ASN B 2 155 ? -19.777 10.156  -0.225  1.00 13.99 ?  386 ASN B C     1 
ATOM   3578 O  O     . ASN B 2 155 ? -19.854 10.386  0.980   1.00 15.92 ?  386 ASN B O     1 
ATOM   3579 C  CB    . ASN B 2 155 ? -22.011 9.014   -0.137  1.00 17.91 ?  386 ASN B CB    1 
ATOM   3580 C  CG    . ASN B 2 155 ? -23.357 8.902   -0.812  1.00 22.51 ?  386 ASN B CG    1 
ATOM   3581 O  OD1   . ASN B 2 155 ? -23.817 9.870   -1.404  1.00 26.10 ?  386 ASN B OD1   1 
ATOM   3582 N  ND2   . ASN B 2 155 ? -23.923 7.737   -0.816  1.00 23.78 ?  386 ASN B ND2   1 
ATOM   3583 N  N     . ALA B 2 156 ? -18.637 10.238  -0.899  1.00 12.83 ?  387 ALA B N     1 
ATOM   3584 C  CA    . ALA B 2 156 ? -17.427 10.659  -0.215  1.00 13.45 ?  387 ALA B CA    1 
ATOM   3585 C  C     . ALA B 2 156 ? -17.552 12.058  0.407   1.00 13.83 ?  387 ALA B C     1 
ATOM   3586 O  O     . ALA B 2 156 ? -18.210 12.953  -0.155  1.00 15.36 ?  387 ALA B O     1 
ATOM   3587 C  CB    . ALA B 2 156 ? -16.219 10.623  -1.196  1.00 13.42 ?  387 ALA B CB    1 
ATOM   3588 N  N     . ALA B 2 157 ? -16.887 12.250  1.548   1.00 13.40 ?  388 ALA B N     1 
ATOM   3589 C  CA    . ALA B 2 157 ? -16.946 13.566  2.183   1.00 13.26 ?  388 ALA B CA    1 
ATOM   3590 C  C     . ALA B 2 157 ? -16.417 14.716  1.297   1.00 14.10 ?  388 ALA B C     1 
ATOM   3591 O  O     . ALA B 2 157 ? -16.984 15.855  1.298   1.00 16.87 ?  388 ALA B O     1 
ATOM   3592 C  CB    . ALA B 2 157 ? -16.177 13.534  3.544   1.00 15.14 ?  388 ALA B CB    1 
ATOM   3593 N  N     . PHE B 2 158 ? -15.343 14.440  0.560   1.00 13.62 ?  389 PHE B N     1 
ATOM   3594 C  CA    . PHE B 2 158 ? -14.735 15.442  -0.330  1.00 14.10 ?  389 PHE B CA    1 
ATOM   3595 C  C     . PHE B 2 158 ? -14.464 14.811  -1.661  1.00 14.84 ?  389 PHE B C     1 
ATOM   3596 O  O     . PHE B 2 158 ? -13.650 13.872  -1.762  1.00 16.08 ?  389 PHE B O     1 
ATOM   3597 C  CB    . PHE B 2 158 ? -13.388 15.996  0.247   1.00 14.16 ?  389 PHE B CB    1 
ATOM   3598 C  CG    . PHE B 2 158 ? -13.566 16.664  1.601   1.00 14.30 ?  389 PHE B CG    1 
ATOM   3599 C  CD1   . PHE B 2 158 ? -13.486 15.929  2.771   1.00 14.39 ?  389 PHE B CD1   1 
ATOM   3600 C  CD2   . PHE B 2 158 ? -13.816 18.047  1.682   1.00 16.03 ?  389 PHE B CD2   1 
ATOM   3601 C  CE1   . PHE B 2 158 ? -13.704 16.561  4.033   1.00 14.28 ?  389 PHE B CE1   1 
ATOM   3602 C  CE2   . PHE B 2 158 ? -14.011 18.682  2.901   1.00 16.53 ?  389 PHE B CE2   1 
ATOM   3603 C  CZ    . PHE B 2 158 ? -13.923 17.923  4.097   1.00 15.33 ?  389 PHE B CZ    1 
ATOM   3604 N  N     . LYS B 2 159 ? -15.145 15.300  -2.690  1.00 15.95 ?  390 LYS B N     1 
ATOM   3605 C  CA    . LYS B 2 159 ? -15.031 14.610  -3.992  1.00 15.86 ?  390 LYS B CA    1 
ATOM   3606 C  C     . LYS B 2 159 ? -13.915 15.110  -4.900  1.00 16.40 ?  390 LYS B C     1 
ATOM   3607 O  O     . LYS B 2 159 ? -13.541 14.420  -5.834  1.00 17.96 ?  390 LYS B O     1 
ATOM   3608 C  CB    . LYS B 2 159 ? -16.381 14.698  -4.690  1.00 18.05 ?  390 LYS B CB    1 
ATOM   3609 C  CG    . LYS B 2 159 ? -17.420 13.833  -3.906  1.00 18.80 ?  390 LYS B CG    1 
ATOM   3610 C  CD    . LYS B 2 159 ? -18.797 14.051  -4.405  1.00 20.77 ?  390 LYS B CD    1 
ATOM   3611 C  CE    . LYS B 2 159 ? -19.747 13.166  -3.623  1.00 20.54 ?  390 LYS B CE    1 
ATOM   3612 N  NZ    . LYS B 2 159 ? -20.011 13.798  -2.287  1.00 22.34 ?  390 LYS B NZ    1 
ATOM   3613 N  N     A ASP B 2 160 ? -13.424 16.307  -4.610  0.46 15.53 ?  391 ASP B N     1 
ATOM   3614 N  N     B ASP B 2 160 ? -13.370 16.288  -4.636  0.54 15.80 ?  391 ASP B N     1 
ATOM   3615 C  CA    A ASP B 2 160 ? -12.470 16.977  -5.478  0.46 16.02 ?  391 ASP B CA    1 
ATOM   3616 C  CA    B ASP B 2 160 ? -12.437 16.888  -5.593  0.54 17.02 ?  391 ASP B CA    1 
ATOM   3617 C  C     A ASP B 2 160 ? -11.095 16.965  -4.807  0.46 15.59 ?  391 ASP B C     1 
ATOM   3618 C  C     B ASP B 2 160 ? -10.983 16.803  -5.113  0.54 16.54 ?  391 ASP B C     1 
ATOM   3619 O  O     A ASP B 2 160 ? -10.414 18.007  -4.740  0.46 16.31 ?  391 ASP B O     1 
ATOM   3620 O  O     B ASP B 2 160 ? -10.135 17.628  -5.488  0.54 18.37 ?  391 ASP B O     1 
ATOM   3621 C  CB    A ASP B 2 160 ? -12.933 18.418  -5.770  0.46 17.69 ?  391 ASP B CB    1 
ATOM   3622 C  CB    B ASP B 2 160 ? -12.813 18.347  -5.845  0.54 19.94 ?  391 ASP B CB    1 
ATOM   3623 C  CG    A ASP B 2 160 ? -12.230 19.026  -6.960  0.46 20.38 ?  391 ASP B CG    1 
ATOM   3624 C  CG    B ASP B 2 160 ? -12.691 19.193  -4.602  0.54 23.62 ?  391 ASP B CG    1 
ATOM   3625 O  OD1   A ASP B 2 160 ? -11.736 18.256  -7.796  0.46 21.86 ?  391 ASP B OD1   1 
ATOM   3626 O  OD1   B ASP B 2 160 ? -12.439 20.407  -4.760  0.54 25.89 ?  391 ASP B OD1   1 
ATOM   3627 O  OD2   A ASP B 2 160 ? -12.180 20.279  -7.059  0.46 21.84 ?  391 ASP B OD2   1 
ATOM   3628 O  OD2   B ASP B 2 160 ? -12.836 18.664  -3.466  0.54 24.55 ?  391 ASP B OD2   1 
ATOM   3629 N  N     . VAL B 2 161 ? -10.695 15.795  -4.299  1.00 14.88 ?  392 VAL B N     1 
ATOM   3630 C  CA    . VAL B 2 161 ? -9.344  15.615  -3.703  1.00 13.54 ?  392 VAL B CA    1 
ATOM   3631 C  C     . VAL B 2 161 ? -8.712  14.294  -4.122  1.00 13.60 ?  392 VAL B C     1 
ATOM   3632 O  O     . VAL B 2 161 ? -9.372  13.440  -4.723  1.00 14.74 ?  392 VAL B O     1 
ATOM   3633 C  CB    . VAL B 2 161 ? -9.422  15.670  -2.138  1.00 14.81 ?  392 VAL B CB    1 
ATOM   3634 C  CG1   . VAL B 2 161 ? -10.011 17.026  -1.700  1.00 16.41 ?  392 VAL B CG1   1 
ATOM   3635 C  CG2   . VAL B 2 161 ? -10.206 14.470  -1.591  1.00 15.56 ?  392 VAL B CG2   1 
ATOM   3636 N  N     . ALA B 2 162 ? -7.420  14.136  -3.809  1.00 13.16 ?  393 ALA B N     1 
ATOM   3637 C  CA    . ALA B 2 162 ? -6.704  12.899  -4.052  1.00 14.40 ?  393 ALA B CA    1 
ATOM   3638 C  C     . ALA B 2 162 ? -6.223  12.329  -2.739  1.00 14.14 ?  393 ALA B C     1 
ATOM   3639 O  O     . ALA B 2 162 ? -5.792  13.086  -1.845  1.00 16.04 ?  393 ALA B O     1 
ATOM   3640 C  CB    . ALA B 2 162 ? -5.500  13.123  -5.001  1.00 15.48 ?  393 ALA B CB    1 
ATOM   3641 N  N     . LEU B 2 163 ? -6.232  11.008  -2.642  1.00 13.68 ?  394 LEU B N     1 
ATOM   3642 C  CA    . LEU B 2 163 ? -5.706  10.331  -1.450  1.00 13.42 ?  394 LEU B CA    1 
ATOM   3643 C  C     . LEU B 2 163 ? -4.701  9.313   -1.949  1.00 12.66 ?  394 LEU B C     1 
ATOM   3644 O  O     . LEU B 2 163 ? -5.075  8.355   -2.659  1.00 14.30 ?  394 LEU B O     1 
ATOM   3645 C  CB    . LEU B 2 163 ? -6.813  9.627   -0.600  1.00 15.74 ?  394 LEU B CB    1 
ATOM   3646 C  CG    . LEU B 2 163 ? -7.739  10.584  0.157   1.00 18.80 ?  394 LEU B CG    1 
ATOM   3647 C  CD1   . LEU B 2 163 ? -9.075  10.672  -0.589  1.00 21.93 ?  394 LEU B CD1   1 
ATOM   3648 C  CD2   . LEU B 2 163 ? -8.058  10.082  1.575   1.00 21.66 ?  394 LEU B CD2   1 
ATOM   3649 N  N     . VAL B 2 164 ? -3.456  9.491   -1.518  1.00 12.42 ?  395 VAL B N     1 
ATOM   3650 C  CA    . VAL B 2 164 ? -2.383  8.598   -1.920  1.00 13.42 ?  395 VAL B CA    1 
ATOM   3651 C  C     . VAL B 2 164 ? -2.020  7.756   -0.722  1.00 13.22 ?  395 VAL B C     1 
ATOM   3652 O  O     . VAL B 2 164 ? -1.510  8.296   0.255   1.00 15.93 ?  395 VAL B O     1 
ATOM   3653 C  CB    . VAL B 2 164 ? -1.138  9.383   -2.438  1.00 13.95 ?  395 VAL B CB    1 
ATOM   3654 C  CG1   . VAL B 2 164 ? 0.007   8.429   -2.825  1.00 15.61 ?  395 VAL B CG1   1 
ATOM   3655 C  CG2   . VAL B 2 164 ? -1.595  10.279  -3.594  1.00 14.19 ?  395 VAL B CG2   1 
ATOM   3656 N  N     . LEU B 2 165 ? -2.272  6.449   -0.798  1.00 12.41 ?  396 LEU B N     1 
ATOM   3657 C  CA    . LEU B 2 165 ? -2.058  5.515   0.331   1.00 13.28 ?  396 LEU B CA    1 
ATOM   3658 C  C     . LEU B 2 165 ? -0.804  4.703   0.042   1.00 13.89 ?  396 LEU B C     1 
ATOM   3659 O  O     . LEU B 2 165 ? -0.546  4.423   -1.141  1.00 15.04 ?  396 LEU B O     1 
ATOM   3660 C  CB    . LEU B 2 165 ? -3.218  4.537   0.519   1.00 14.62 ?  396 LEU B CB    1 
ATOM   3661 C  CG    . LEU B 2 165 ? -4.609  5.150   0.502   1.00 17.20 ?  396 LEU B CG    1 
ATOM   3662 C  CD1   . LEU B 2 165 ? -5.629  4.019   0.732   1.00 18.14 ?  396 LEU B CD1   1 
ATOM   3663 C  CD2   . LEU B 2 165 ? -4.780  6.296   1.479   1.00 18.26 ?  396 LEU B CD2   1 
ATOM   3664 N  N     . THR B 2 166 ? -0.011  4.340   1.053   1.00 13.61 ?  397 THR B N     1 
ATOM   3665 C  CA    . THR B 2 166 ? 1.108   3.398   0.769   1.00 13.24 ?  397 THR B CA    1 
ATOM   3666 C  C     . THR B 2 166 ? 1.004   2.151   1.645   1.00 13.81 ?  397 THR B C     1 
ATOM   3667 O  O     . THR B 2 166 ? 0.499   2.221   2.763   1.00 15.16 ?  397 THR B O     1 
ATOM   3668 C  CB    . THR B 2 166 ? 2.523   4.000   0.947   1.00 15.52 ?  397 THR B CB    1 
ATOM   3669 O  OG1   . THR B 2 166 ? 2.845   4.113   2.349   1.00 14.76 ?  397 THR B OG1   1 
ATOM   3670 C  CG2   . THR B 2 166 ? 2.570   5.351   0.347   1.00 17.07 ?  397 THR B CG2   1 
ATOM   3671 N  N     . VAL B 2 167 ? 1.452   1.034   1.115   1.00 14.46 ?  398 VAL B N     1 
ATOM   3672 C  CA    . VAL B 2 167 ? 1.499   -0.235  1.835   1.00 14.30 ?  398 VAL B CA    1 
ATOM   3673 C  C     . VAL B 2 167 ? 2.909   -0.765  1.670   1.00 14.48 ?  398 VAL B C     1 
ATOM   3674 O  O     . VAL B 2 167 ? 3.397   -0.944  0.535   1.00 14.85 ?  398 VAL B O     1 
ATOM   3675 C  CB    . VAL B 2 167 ? 0.481   -1.235  1.300   1.00 14.21 ?  398 VAL B CB    1 
ATOM   3676 C  CG1   . VAL B 2 167 ? 0.700   -2.649  1.885   1.00 15.64 ?  398 VAL B CG1   1 
ATOM   3677 C  CG2   . VAL B 2 167 ? -0.936  -0.720  1.614   1.00 15.35 ?  398 VAL B CG2   1 
ATOM   3678 N  N     . LEU B 2 168 ? 3.577   -1.011  2.800   1.00 14.84 ?  399 LEU B N     1 
ATOM   3679 C  CA    . LEU B 2 168 ? 4.894   -1.644  2.781   1.00 15.02 ?  399 LEU B CA    1 
ATOM   3680 C  C     . LEU B 2 168 ? 4.723   -3.160  2.965   1.00 16.58 ?  399 LEU B C     1 
ATOM   3681 O  O     . LEU B 2 168 ? 4.161   -3.617  3.977   1.00 17.83 ?  399 LEU B O     1 
ATOM   3682 C  CB    . LEU B 2 168 ? 5.820   -1.036  3.856   1.00 16.04 ?  399 LEU B CB    1 
ATOM   3683 C  CG    . LEU B 2 168 ? 7.267   -1.529  3.778   1.00 18.09 ?  399 LEU B CG    1 
ATOM   3684 C  CD1   . LEU B 2 168 ? 7.905   -0.953  2.521   1.00 20.14 ?  399 LEU B CD1   1 
ATOM   3685 C  CD2   . LEU B 2 168 ? 8.005   -1.046  5.025   1.00 20.06 ?  399 LEU B CD2   1 
ATOM   3686 N  N     . LEU B 2 169 ? 5.121   -3.921  1.955   1.00 16.19 ?  400 LEU B N     1 
ATOM   3687 C  CA    . LEU B 2 169 ? 4.986   -5.391  2.027   1.00 16.02 ?  400 LEU B CA    1 
ATOM   3688 C  C     . LEU B 2 169 ? 5.979   -5.987  3.039   1.00 18.72 ?  400 LEU B C     1 
ATOM   3689 O  O     . LEU B 2 169 ? 7.003   -5.360  3.386   1.00 19.84 ?  400 LEU B O     1 
ATOM   3690 C  CB    . LEU B 2 169 ? 5.201   -6.006  0.638   1.00 17.49 ?  400 LEU B CB    1 
ATOM   3691 C  CG    . LEU B 2 169 ? 4.234   -5.490  -0.431  1.00 16.69 ?  400 LEU B CG    1 
ATOM   3692 C  CD1   . LEU B 2 169 ? 4.662   -6.039  -1.798  1.00 18.99 ?  400 LEU B CD1   1 
ATOM   3693 C  CD2   . LEU B 2 169 ? 2.803   -5.945  -0.158  1.00 16.85 ?  400 LEU B CD2   1 
ATOM   3694 N  N     . GLU B 2 170 ? 5.742   -7.229  3.423   1.00 19.77 ?  401 GLU B N     1 
ATOM   3695 C  CA    . GLU B 2 170 ? 6.659   -7.878  4.349   1.00 23.34 ?  401 GLU B CA    1 
ATOM   3696 C  C     . GLU B 2 170 ? 7.876   -8.510  3.683   1.00 24.93 ?  401 GLU B C     1 
ATOM   3697 O  O     . GLU B 2 170 ? 8.899   -8.787  4.357   1.00 27.13 ?  401 GLU B O     1 
ATOM   3698 C  CB    . GLU B 2 170 ? 5.881   -8.920  5.169   1.00 26.91 ?  401 GLU B CB    1 
ATOM   3699 C  CG    . GLU B 2 170 ? 4.925   -8.180  6.070   1.00 30.99 ?  401 GLU B CG    1 
ATOM   3700 C  CD    . GLU B 2 170 ? 4.114   -9.066  6.964   1.00 36.24 ?  401 GLU B CD    1 
ATOM   3701 O  OE1   . GLU B 2 170 ? 4.048   -10.295 6.703   1.00 38.59 ?  401 GLU B OE1   1 
ATOM   3702 O  OE2   . GLU B 2 170 ? 3.526   -8.513  7.926   1.00 37.91 ?  401 GLU B OE2   1 
ATOM   3703 N  N     . GLU B 2 171 ? 7.799   -8.766  2.391   1.00 24.67 ?  402 GLU B N     1 
ATOM   3704 C  CA    . GLU B 2 171 ? 8.940   -9.407  1.743   1.00 27.15 ?  402 GLU B CA    1 
ATOM   3705 C  C     . GLU B 2 171 ? 10.060  -8.415  1.486   1.00 25.56 ?  402 GLU B C     1 
ATOM   3706 O  O     . GLU B 2 171 ? 9.847   -7.199  1.533   1.00 24.58 ?  402 GLU B O     1 
ATOM   3707 C  CB    . GLU B 2 171 ? 8.539   -10.094 0.439   1.00 31.93 ?  402 GLU B CB    1 
ATOM   3708 C  CG    . GLU B 2 171 ? 7.825   -9.259  -0.578  1.00 35.98 ?  402 GLU B CG    1 
ATOM   3709 C  CD    . GLU B 2 171 ? 6.384   -9.662  -0.632  1.00 40.77 ?  402 GLU B CD    1 
ATOM   3710 O  OE1   . GLU B 2 171 ? 5.816   -9.867  -1.758  1.00 43.12 ?  402 GLU B OE1   1 
ATOM   3711 O  OE2   . GLU B 2 171 ? 5.830   -9.808  0.486   1.00 41.24 ?  402 GLU B OE2   1 
ATOM   3712 N  N     . GLU B 2 172 ? 11.243  -8.938  1.189   1.00 26.39 ?  403 GLU B N     1 
ATOM   3713 C  CA    . GLU B 2 172 ? 12.387  -8.064  1.029   1.00 27.76 ?  403 GLU B CA    1 
ATOM   3714 C  C     . GLU B 2 172 ? 12.403  -7.423  -0.349  1.00 26.57 ?  403 GLU B C     1 
ATOM   3715 O  O     . GLU B 2 172 ? 12.843  -6.273  -0.497  1.00 25.21 ?  403 GLU B O     1 
ATOM   3716 C  CB    . GLU B 2 172 ? 13.674  -8.838  1.282   1.00 31.11 ?  403 GLU B CB    1 
ATOM   3717 C  CG    . GLU B 2 172 ? 14.887  -7.960  1.324   1.00 35.47 ?  403 GLU B CG    1 
ATOM   3718 C  CD    . GLU B 2 172 ? 14.852  -6.950  2.473   1.00 39.88 ?  403 GLU B CD    1 
ATOM   3719 O  OE1   . GLU B 2 172 ? 14.199  -7.207  3.523   1.00 40.05 ?  403 GLU B OE1   1 
ATOM   3720 O  OE2   . GLU B 2 172 ? 15.508  -5.889  2.318   1.00 43.06 ?  403 GLU B OE2   1 
ATOM   3721 N  N     . THR B 2 173 ? 11.969  -8.178  -1.363  1.00 26.38 ?  404 THR B N     1 
ATOM   3722 C  CA    . THR B 2 173 ? 12.044  -7.659  -2.732  1.00 26.70 ?  404 THR B CA    1 
ATOM   3723 C  C     . THR B 2 173 ? 10.753  -7.907  -3.488  1.00 26.37 ?  404 THR B C     1 
ATOM   3724 O  O     . THR B 2 173 ? 9.977   -8.809  -3.155  1.00 27.16 ?  404 THR B O     1 
ATOM   3725 C  CB    . THR B 2 173 ? 13.183  -8.295  -3.524  1.00 29.12 ?  404 THR B CB    1 
ATOM   3726 O  OG1   . THR B 2 173 ? 12.841  -9.656  -3.810  1.00 30.67 ?  404 THR B OG1   1 
ATOM   3727 C  CG2   . THR B 2 173 ? 14.465  -8.299  -2.719  1.00 29.90 ?  404 THR B CG2   1 
ATOM   3728 N  N     . LEU B 2 174 ? 10.536  -7.093  -4.498  1.00 24.78 ?  405 LEU B N     1 
ATOM   3729 C  CA    . LEU B 2 174 ? 9.379   -7.191  -5.353  1.00 25.53 ?  405 LEU B CA    1 
ATOM   3730 C  C     . LEU B 2 174 ? 9.928   -7.380  -6.780  1.00 28.13 ?  405 LEU B C     1 
ATOM   3731 O  O     . LEU B 2 174 ? 10.768  -6.592  -7.221  1.00 29.08 ?  405 LEU B O     1 
ATOM   3732 C  CB    . LEU B 2 174 ? 8.535   -5.918  -5.171  1.00 25.90 ?  405 LEU B CB    1 
ATOM   3733 C  CG    . LEU B 2 174 ? 7.183   -5.831  -5.802  1.00 25.52 ?  405 LEU B CG    1 
ATOM   3734 C  CD1   . LEU B 2 174 ? 6.308   -6.972  -5.302  1.00 26.07 ?  405 LEU B CD1   1 
ATOM   3735 C  CD2   . LEU B 2 174 ? 6.591   -4.412  -5.511  1.00 25.23 ?  405 LEU B CD2   1 
ATOM   3736 N  N     . GLU B 2 175 ? 9.538   -8.437  -7.497  1.00 30.53 ?  406 GLU B N     1 
ATOM   3737 C  CA    . GLU B 2 175 ? 10.128  -8.641  -8.839  1.00 34.13 ?  406 GLU B CA    1 
ATOM   3738 C  C     . GLU B 2 175 ? 9.851   -7.477  -9.787  1.00 32.76 ?  406 GLU B C     1 
ATOM   3739 O  O     . GLU B 2 175 ? 8.749   -6.961  -9.818  1.00 31.25 ?  406 GLU B O     1 
ATOM   3740 C  CB    . GLU B 2 175 ? 9.633   -9.945  -9.481  1.00 39.51 ?  406 GLU B CB    1 
ATOM   3741 C  CG    . GLU B 2 175 ? 10.180  -11.182 -8.807  1.00 43.65 ?  406 GLU B CG    1 
ATOM   3742 C  CD    . GLU B 2 175 ? 11.711  -11.187 -8.794  1.00 48.11 ?  406 GLU B CD    1 
ATOM   3743 O  OE1   . GLU B 2 175 ? 12.318  -11.195 -9.896  1.00 49.52 ?  406 GLU B OE1   1 
ATOM   3744 O  OE2   . GLU B 2 175 ? 12.307  -11.142 -7.687  1.00 49.60 ?  406 GLU B OE2   1 
ATOM   3745 N  N     . ALA B 2 176 ? 10.855  -7.065  -10.560 1.00 33.96 ?  407 ALA B N     1 
ATOM   3746 C  CA    . ALA B 2 176 ? 10.715  -5.881  -11.432 1.00 34.23 ?  407 ALA B CA    1 
ATOM   3747 C  C     . ALA B 2 176 ? 9.588   -6.061  -12.448 1.00 32.19 ?  407 ALA B C     1 
ATOM   3748 O  O     . ALA B 2 176 ? 8.951   -5.077  -12.855 1.00 32.36 ?  407 ALA B O     1 
ATOM   3749 C  CB    . ALA B 2 176 ? 12.015  -5.569  -12.161 1.00 34.88 ?  407 ALA B CB    1 
ATOM   3750 N  N     . SER B 2 177 ? 9.319   -7.309  -12.817 1.00 30.18 ?  408 SER B N     1 
ATOM   3751 C  CA    . SER B 2 177 ? 8.333   -7.574  -13.854 1.00 28.85 ?  408 SER B CA    1 
ATOM   3752 C  C     . SER B 2 177 ? 6.934   -7.810  -13.267 1.00 26.81 ?  408 SER B C     1 
ATOM   3753 O  O     . SER B 2 177 ? 6.037   -8.143  -14.006 1.00 26.59 ?  408 SER B O     1 
ATOM   3754 C  CB    . SER B 2 177 ? 8.739   -8.777  -14.710 1.00 32.79 ?  408 SER B CB    1 
ATOM   3755 O  OG    . SER B 2 177 ? 8.698   -9.965  -13.944 1.00 35.23 ?  408 SER B OG    1 
ATOM   3756 N  N     . VAL B 2 178 ? 6.747   -7.613  -11.963 1.00 24.44 ?  409 VAL B N     1 
ATOM   3757 C  CA    . VAL B 2 178 ? 5.422   -7.870  -11.375 1.00 23.49 ?  409 VAL B CA    1 
ATOM   3758 C  C     . VAL B 2 178 ? 4.340   -7.038  -12.080 1.00 22.57 ?  409 VAL B C     1 
ATOM   3759 O  O     . VAL B 2 178 ? 4.503   -5.844  -12.354 1.00 23.70 ?  409 VAL B O     1 
ATOM   3760 C  CB    . VAL B 2 178 ? 5.415   -7.605  -9.847  1.00 23.44 ?  409 VAL B CB    1 
ATOM   3761 C  CG1   . VAL B 2 178 ? 5.565   -6.114  -9.518  1.00 22.30 ?  409 VAL B CG1   1 
ATOM   3762 C  CG2   . VAL B 2 178 ? 4.173   -8.174  -9.199  1.00 23.19 ?  409 VAL B CG2   1 
ATOM   3763 N  N     . GLY B 2 179 ? 3.237   -7.675  -12.415 1.00 21.07 ?  410 GLY B N     1 
ATOM   3764 C  CA    . GLY B 2 179 ? 2.212   -6.967  -13.156 1.00 20.92 ?  410 GLY B CA    1 
ATOM   3765 C  C     . GLY B 2 179 ? 1.154   -6.378  -12.264 1.00 19.95 ?  410 GLY B C     1 
ATOM   3766 O  O     . GLY B 2 179 ? 1.185   -6.531  -11.028 1.00 20.15 ?  410 GLY B O     1 
ATOM   3767 N  N     . PRO B 2 180 ? 0.196   -5.709  -12.874 1.00 20.21 ?  411 PRO B N     1 
ATOM   3768 C  CA    . PRO B 2 180 ? -0.803  -4.989  -12.076 1.00 19.01 ?  411 PRO B CA    1 
ATOM   3769 C  C     . PRO B 2 180 ? -1.651  -5.917  -11.193 1.00 18.40 ?  411 PRO B C     1 
ATOM   3770 O  O     . PRO B 2 180 ? -1.882  -5.582  -10.030 1.00 19.41 ?  411 PRO B O     1 
ATOM   3771 C  CB    . PRO B 2 180 ? -1.695  -4.318  -13.143 1.00 20.65 ?  411 PRO B CB    1 
ATOM   3772 C  CG    . PRO B 2 180 ? -0.853  -4.204  -14.352 1.00 21.92 ?  411 PRO B CG    1 
ATOM   3773 C  CD    . PRO B 2 180 ? 0.140   -5.359  -14.309 1.00 21.02 ?  411 PRO B CD    1 
ATOM   3774 N  N     . ARG B 2 181 ? -2.153  -7.027  -11.726 1.00 18.97 ?  412 ARG B N     1 
ATOM   3775 C  CA    . ARG B 2 181 ? -3.016  -7.874  -10.885 1.00 19.61 ?  412 ARG B CA    1 
ATOM   3776 C  C     . ARG B 2 181 ? -2.207  -8.540  -9.793  1.00 18.24 ?  412 ARG B C     1 
ATOM   3777 O  O     . ARG B 2 181 ? -2.686  -8.648  -8.673  1.00 17.70 ?  412 ARG B O     1 
ATOM   3778 C  CB    . ARG B 2 181 ? -3.779  -8.959  -11.686 1.00 23.59 ?  412 ARG B CB    1 
ATOM   3779 C  CG    . ARG B 2 181 ? -4.764  -8.419  -12.697 1.00 29.59 ?  412 ARG B CG    1 
ATOM   3780 C  CD    . ARG B 2 181 ? -4.944  -9.468  -13.812 1.00 35.14 ?  412 ARG B CD    1 
ATOM   3781 N  NE    . ARG B 2 181 ? -6.224  -10.103 -13.815 1.00 39.01 ?  412 ARG B NE    1 
ATOM   3782 C  CZ    . ARG B 2 181 ? -6.577  -11.129 -14.592 1.00 38.85 ?  412 ARG B CZ    1 
ATOM   3783 N  NH1   . ARG B 2 181 ? -7.835  -11.616 -14.476 1.00 38.60 ?  412 ARG B NH1   1 
ATOM   3784 N  NH2   . ARG B 2 181 ? -5.686  -11.673 -15.471 1.00 39.53 ?  412 ARG B NH2   1 
ATOM   3785 N  N     . GLU B 2 182 ? -0.983  -9.007  -10.066 1.00 18.18 ?  413 GLU B N     1 
ATOM   3786 C  CA    . GLU B 2 182 ? -0.224  -9.654  -8.986  1.00 19.69 ?  413 GLU B CA    1 
ATOM   3787 C  C     . GLU B 2 182 ? 0.127   -8.656  -7.882  1.00 18.48 ?  413 GLU B C     1 
ATOM   3788 O  O     . GLU B 2 182 ? 0.111   -8.998  -6.690  1.00 18.85 ?  413 GLU B O     1 
ATOM   3789 C  CB    . GLU B 2 182 ? 1.090   -10.274 -9.502  1.00 24.06 ?  413 GLU B CB    1 
ATOM   3790 C  CG    . GLU B 2 182 ? 1.841   -11.028 -8.400  1.00 27.30 ?  413 GLU B CG    1 
ATOM   3791 C  CD    . GLU B 2 182 ? 2.969   -11.903 -8.891  1.00 31.77 ?  413 GLU B CD    1 
ATOM   3792 O  OE1   . GLU B 2 182 ? 3.326   -11.820 -10.097 1.00 33.52 ?  413 GLU B OE1   1 
ATOM   3793 O  OE2   . GLU B 2 182 ? 3.499   -12.685 -8.049  1.00 34.10 ?  413 GLU B OE2   1 
ATOM   3794 N  N     . THR B 2 183 ? 0.431   -7.416  -8.274  1.00 17.32 ?  414 THR B N     1 
ATOM   3795 C  CA    . THR B 2 183 ? 0.719   -6.377  -7.286  1.00 16.92 ?  414 THR B CA    1 
ATOM   3796 C  C     . THR B 2 183 ? -0.509  -6.164  -6.381  1.00 15.62 ?  414 THR B C     1 
ATOM   3797 O  O     . THR B 2 183 ? -0.403  -6.082  -5.129  1.00 15.97 ?  414 THR B O     1 
ATOM   3798 C  CB    . THR B 2 183 ? 1.085   -5.007  -7.957  1.00 17.42 ?  414 THR B CB    1 
ATOM   3799 O  OG1   . THR B 2 183 ? 2.234   -5.166  -8.808  1.00 19.10 ?  414 THR B OG1   1 
ATOM   3800 C  CG2   . THR B 2 183 ? 1.390   -3.919  -6.906  1.00 18.34 ?  414 THR B CG2   1 
ATOM   3801 N  N     . GLU B 2 184 ? -1.684  -6.039  -7.004  1.00 14.56 ?  415 GLU B N     1 
ATOM   3802 C  CA    . GLU B 2 184 ? -2.922  -5.855  -6.274  1.00 15.38 ?  415 GLU B CA    1 
ATOM   3803 C  C     . GLU B 2 184 ? -3.194  -7.064  -5.354  1.00 15.17 ?  415 GLU B C     1 
ATOM   3804 O  O     . GLU B 2 184 ? -3.601  -6.853  -4.202  1.00 16.22 ?  415 GLU B O     1 
ATOM   3805 C  CB    . GLU B 2 184 ? -4.067  -5.640  -7.272  1.00 15.88 ?  415 GLU B CB    1 
ATOM   3806 C  CG    . GLU B 2 184 ? -5.406  -5.541  -6.585  1.00 17.49 ?  415 GLU B CG    1 
ATOM   3807 C  CD    . GLU B 2 184 ? -6.516  -5.174  -7.522  1.00 18.76 ?  415 GLU B CD    1 
ATOM   3808 O  OE1   . GLU B 2 184 ? -6.273  -4.636  -8.623  1.00 21.69 ?  415 GLU B OE1   1 
ATOM   3809 O  OE2   . GLU B 2 184 ? -7.669  -5.378  -7.136  1.00 18.81 ?  415 GLU B OE2   1 
ATOM   3810 N  N     . GLU B 2 185 ? -2.931  -8.305  -5.817  1.00 15.66 ?  416 GLU B N     1 
ATOM   3811 C  CA    . GLU B 2 185 ? -3.148  -9.508  -4.977  1.00 15.67 ?  416 GLU B CA    1 
ATOM   3812 C  C     . GLU B 2 185 ? -2.243  -9.484  -3.747  1.00 15.66 ?  416 GLU B C     1 
ATOM   3813 O  O     . GLU B 2 185 ? -2.665  -9.858  -2.657  1.00 16.52 ?  416 GLU B O     1 
ATOM   3814 C  CB    . GLU B 2 185 ? -2.883  -10.802 -5.760  1.00 18.10 ?  416 GLU B CB    1 
ATOM   3815 C  CG    . GLU B 2 185 ? -3.926  -11.033 -6.876  1.00 20.42 ?  416 GLU B CG    1 
ATOM   3816 C  CD    . GLU B 2 185 ? -3.591  -12.234 -7.763  1.00 25.03 ?  416 GLU B CD    1 
ATOM   3817 O  OE1   . GLU B 2 185 ? -2.415  -12.681 -7.799  1.00 26.87 ?  416 GLU B OE1   1 
ATOM   3818 O  OE2   . GLU B 2 185 ? -4.491  -12.762 -8.465  1.00 26.24 ?  416 GLU B OE2   1 
ATOM   3819 N  N     . LYS B 2 186 ? -0.980  -9.053  -3.939  1.00 15.69 ?  417 LYS B N     1 
ATOM   3820 C  CA    . LYS B 2 186 ? -0.062  -8.981  -2.791  1.00 16.20 ?  417 LYS B CA    1 
ATOM   3821 C  C     . LYS B 2 186 ? -0.569  -8.044  -1.714  1.00 15.63 ?  417 LYS B C     1 
ATOM   3822 O  O     . LYS B 2 186 ? -0.509  -8.393  -0.513  1.00 16.30 ?  417 LYS B O     1 
ATOM   3823 C  CB    . LYS B 2 186 ? 1.350   -8.570  -3.274  1.00 17.54 ?  417 LYS B CB    1 
ATOM   3824 C  CG    . LYS B 2 186 ? 2.060   -9.668  -4.020  1.00 19.71 ?  417 LYS B CG    1 
ATOM   3825 C  CD    . LYS B 2 186 ? 3.463   -9.147  -4.495  1.00 21.41 ?  417 LYS B CD    1 
ATOM   3826 C  CE    . LYS B 2 186 ? 4.242   -10.131 -5.326  1.00 25.60 ?  417 LYS B CE    1 
ATOM   3827 N  NZ    . LYS B 2 186 ? 4.550   -11.354 -4.542  1.00 29.19 ?  417 LYS B NZ    1 
ATOM   3828 N  N     . VAL B 2 187 ? -1.020  -6.868  -2.111  1.00 14.46 ?  418 VAL B N     1 
ATOM   3829 C  CA    . VAL B 2 187 ? -1.519  -5.879  -1.146  1.00 14.90 ?  418 VAL B CA    1 
ATOM   3830 C  C     . VAL B 2 187 ? -2.791  -6.411  -0.482  1.00 14.02 ?  418 VAL B C     1 
ATOM   3831 O  O     . VAL B 2 187 ? -2.918  -6.357  0.740   1.00 15.52 ?  418 VAL B O     1 
ATOM   3832 C  CB    . VAL B 2 187 ? -1.744  -4.498  -1.800  1.00 14.30 ?  418 VAL B CB    1 
ATOM   3833 C  CG1   . VAL B 2 187 ? -2.421  -3.533  -0.837  1.00 15.12 ?  418 VAL B CG1   1 
ATOM   3834 C  CG2   . VAL B 2 187 ? -0.405  -3.927  -2.296  1.00 16.22 ?  418 VAL B CG2   1 
ATOM   3835 N  N     . ARG B 2 188 ? -3.720  -6.933  -1.281  1.00 14.59 ?  419 ARG B N     1 
ATOM   3836 C  CA    . ARG B 2 188 ? -4.956  -7.522  -0.786  1.00 13.69 ?  419 ARG B CA    1 
ATOM   3837 C  C     . ARG B 2 188 ? -4.638  -8.578  0.286   1.00 15.07 ?  419 ARG B C     1 
ATOM   3838 O  O     . ARG B 2 188 ? -5.193  -8.551  1.405   1.00 15.38 ?  419 ARG B O     1 
ATOM   3839 C  CB    . ARG B 2 188 ? -5.693  -8.177  -1.955  1.00 14.51 ?  419 ARG B CB    1 
ATOM   3840 C  CG    . ARG B 2 188 ? -6.943  -8.949  -1.574  1.00 14.96 ?  419 ARG B CG    1 
ATOM   3841 C  CD    . ARG B 2 188 ? -7.400  -9.913  -2.683  1.00 15.70 ?  419 ARG B CD    1 
ATOM   3842 N  NE    . ARG B 2 188 ? -6.431  -10.999 -2.814  1.00 17.39 ?  419 ARG B NE    1 
ATOM   3843 C  CZ    . ARG B 2 188 ? -6.330  -11.795 -3.872  1.00 17.74 ?  419 ARG B CZ    1 
ATOM   3844 N  NH1   . ARG B 2 188 ? -7.189  -11.707 -4.876  1.00 17.77 ?  419 ARG B NH1   1 
ATOM   3845 N  NH2   . ARG B 2 188 ? -5.378  -12.727 -3.937  1.00 18.60 ?  419 ARG B NH2   1 
ATOM   3846 N  N     . ASP B 2 189 ? -3.718  -9.481  -0.032  1.00 15.46 ?  420 ASP B N     1 
ATOM   3847 C  CA    . ASP B 2 189 ? -3.486  -10.589 0.915   1.00 16.86 ?  420 ASP B CA    1 
ATOM   3848 C  C     . ASP B 2 189 ? -2.823  -10.088 2.203   1.00 16.57 ?  420 ASP B C     1 
ATOM   3849 O  O     . ASP B 2 189 ? -3.137  -10.591 3.290   1.00 17.55 ?  420 ASP B O     1 
ATOM   3850 C  CB    . ASP B 2 189 ? -2.633  -11.680 0.251   1.00 19.96 ?  420 ASP B CB    1 
ATOM   3851 C  CG    . ASP B 2 189 ? -3.395  -12.435 -0.864  1.00 24.39 ?  420 ASP B CG    1 
ATOM   3852 O  OD1   . ASP B 2 189 ? -4.644  -12.374 -0.892  1.00 24.74 ?  420 ASP B OD1   1 
ATOM   3853 O  OD2   . ASP B 2 189 ? -2.737  -13.095 -1.703  1.00 28.21 ?  420 ASP B OD2   1 
ATOM   3854 N  N     . LEU B 2 190 ? -1.961  -9.075  2.086   1.00 16.07 ?  421 LEU B N     1 
ATOM   3855 C  CA    . LEU B 2 190 ? -1.303  -8.537  3.287   1.00 16.46 ?  421 LEU B CA    1 
ATOM   3856 C  C     . LEU B 2 190 ? -2.364  -7.859  4.144   1.00 16.32 ?  421 LEU B C     1 
ATOM   3857 O  O     . LEU B 2 190 ? -2.381  -8.044  5.375   1.00 17.74 ?  421 LEU B O     1 
ATOM   3858 C  CB    . LEU B 2 190 ? -0.187  -7.553  2.942   1.00 17.41 ?  421 LEU B CB    1 
ATOM   3859 C  CG    . LEU B 2 190 ? 0.412   -6.913  4.196   1.00 18.36 ?  421 LEU B CG    1 
ATOM   3860 C  CD1   . LEU B 2 190 ? 1.022   -7.997  5.145   1.00 19.90 ?  421 LEU B CD1   1 
ATOM   3861 C  CD2   . LEU B 2 190 ? 1.548   -5.910  3.818   1.00 20.97 ?  421 LEU B CD2   1 
ATOM   3862 N  N     . LEU B 2 191 ? -3.247  -7.043  3.558   1.00 15.36 ?  422 LEU B N     1 
ATOM   3863 C  CA    . LEU B 2 191 ? -4.258  -6.357  4.415   1.00 15.44 ?  422 LEU B CA    1 
ATOM   3864 C  C     . LEU B 2 191 ? -5.209  -7.363  5.061   1.00 15.46 ?  422 LEU B C     1 
ATOM   3865 O  O     . LEU B 2 191 ? -5.570  -7.155  6.227   1.00 16.07 ?  422 LEU B O     1 
ATOM   3866 C  CB    . LEU B 2 191 ? -5.026  -5.294  3.622   1.00 16.39 ?  422 LEU B CB    1 
ATOM   3867 C  CG    . LEU B 2 191 ? -4.140  -4.125  3.131   1.00 18.14 ?  422 LEU B CG    1 
ATOM   3868 C  CD1   . LEU B 2 191 ? -4.999  -3.054  2.438   1.00 18.65 ?  422 LEU B CD1   1 
ATOM   3869 C  CD2   . LEU B 2 191 ? -3.280  -3.490  4.249   1.00 19.94 ?  422 LEU B CD2   1 
ATOM   3870 N  N     . TRP B 2 192 ? -5.647  -8.419  4.360   1.00 16.17 ?  423 TRP B N     1 
ATOM   3871 C  CA    . TRP B 2 192 ? -6.532  -9.404  5.029   1.00 16.48 ?  423 TRP B CA    1 
ATOM   3872 C  C     . TRP B 2 192 ? -5.768  -10.091 6.185   1.00 19.06 ?  423 TRP B C     1 
ATOM   3873 O  O     . TRP B 2 192 ? -6.333  -10.365 7.252   1.00 19.84 ?  423 TRP B O     1 
ATOM   3874 C  CB    . TRP B 2 192 ? -7.055  -10.443 4.049   1.00 17.33 ?  423 TRP B CB    1 
ATOM   3875 C  CG    . TRP B 2 192 ? -8.506  -10.198 3.706   1.00 16.03 ?  423 TRP B CG    1 
ATOM   3876 C  CD1   . TRP B 2 192 ? -9.597  -10.800 4.282   1.00 16.60 ?  423 TRP B CD1   1 
ATOM   3877 C  CD2   . TRP B 2 192 ? -9.037  -9.281  2.716   1.00 15.61 ?  423 TRP B CD2   1 
ATOM   3878 N  NE1   . TRP B 2 192 ? -10.768 -10.304 3.726   1.00 16.96 ?  423 TRP B NE1   1 
ATOM   3879 C  CE2   . TRP B 2 192 ? -10.449 -9.364  2.789   1.00 16.40 ?  423 TRP B CE2   1 
ATOM   3880 C  CE3   . TRP B 2 192 ? -8.464  -8.347  1.829   1.00 15.81 ?  423 TRP B CE3   1 
ATOM   3881 C  CZ2   . TRP B 2 192 ? -11.298 -8.613  1.973   1.00 15.39 ?  423 TRP B CZ2   1 
ATOM   3882 C  CZ3   . TRP B 2 192 ? -9.334  -7.607  0.958   1.00 16.99 ?  423 TRP B CZ3   1 
ATOM   3883 C  CH2   . TRP B 2 192 ? -10.728 -7.745  1.065   1.00 15.66 ?  423 TRP B CH2   1 
ATOM   3884 N  N     . ALA B 2 193 ? -4.496  -10.367 5.983   1.00 18.50 ?  424 ALA B N     1 
ATOM   3885 C  CA    . ALA B 2 193 ? -3.704  -11.013 7.049   1.00 19.59 ?  424 ALA B CA    1 
ATOM   3886 C  C     . ALA B 2 193 ? -3.543  -10.094 8.261   1.00 19.47 ?  424 ALA B C     1 
ATOM   3887 O  O     . ALA B 2 193 ? -3.659  -10.566 9.414   1.00 22.68 ?  424 ALA B O     1 
ATOM   3888 C  CB    . ALA B 2 193 ? -2.345  -11.443 6.530   1.00 20.99 ?  424 ALA B CB    1 
ATOM   3889 N  N     . LYS B 2 194 ? -3.273  -8.807  8.026   1.00 19.54 ?  425 LYS B N     1 
ATOM   3890 C  CA    . LYS B 2 194 ? -3.076  -7.870  9.151   1.00 20.11 ?  425 LYS B CA    1 
ATOM   3891 C  C     . LYS B 2 194 ? -4.378  -7.456  9.852   1.00 20.09 ?  425 LYS B C     1 
ATOM   3892 O  O     . LYS B 2 194 ? -4.413  -7.259  11.090  1.00 22.48 ?  425 LYS B O     1 
ATOM   3893 C  CB    . LYS B 2 194 ? -2.396  -6.589  8.679   1.00 23.87 ?  425 LYS B CB    1 
ATOM   3894 C  CG    . LYS B 2 194 ? -0.986  -6.753  8.173   1.00 26.72 ?  425 LYS B CG    1 
ATOM   3895 C  CD    . LYS B 2 194 ? -0.089  -7.141  9.351   1.00 31.74 ?  425 LYS B CD    1 
ATOM   3896 C  CE    . LYS B 2 194 ? 1.251   -6.426  9.291   1.00 36.26 ?  425 LYS B CE    1 
ATOM   3897 N  NZ    . LYS B 2 194 ? 1.022   -5.032  9.769   1.00 37.99 ?  425 LYS B NZ    1 
ATOM   3898 N  N     . PHE B 2 195 ? -5.446  -7.284  9.092   1.00 19.17 ?  426 PHE B N     1 
ATOM   3899 C  CA    . PHE B 2 195 ? -6.643  -6.610  9.645   1.00 18.77 ?  426 PHE B CA    1 
ATOM   3900 C  C     . PHE B 2 195 ? -7.734  -7.572  10.107  1.00 19.42 ?  426 PHE B C     1 
ATOM   3901 O  O     . PHE B 2 195 ? -8.650  -7.142  10.779  1.00 20.93 ?  426 PHE B O     1 
ATOM   3902 C  CB    . PHE B 2 195 ? -7.289  -5.646  8.634   1.00 17.47 ?  426 PHE B CB    1 
ATOM   3903 C  CG    . PHE B 2 195 ? -6.467  -4.418  8.312   1.00 17.03 ?  426 PHE B CG    1 
ATOM   3904 C  CD1   . PHE B 2 195 ? -5.390  -4.012  9.077   1.00 17.85 ?  426 PHE B CD1   1 
ATOM   3905 C  CD2   . PHE B 2 195 ? -6.824  -3.617  7.264   1.00 18.96 ?  426 PHE B CD2   1 
ATOM   3906 C  CE1   . PHE B 2 195 ? -4.659  -2.819  8.715   1.00 18.22 ?  426 PHE B CE1   1 
ATOM   3907 C  CE2   . PHE B 2 195 ? -6.127  -2.496  6.915   1.00 19.52 ?  426 PHE B CE2   1 
ATOM   3908 C  CZ    . PHE B 2 195 ? -5.048  -2.068  7.641   1.00 18.75 ?  426 PHE B CZ    1 
ATOM   3909 N  N     A THR B 2 196 ? -7.538  -8.877  9.844   0.65 20.82 ?  427 THR B N     1 
ATOM   3910 N  N     B THR B 2 196 ? -7.724  -8.815  9.657   0.35 19.61 ?  427 THR B N     1 
ATOM   3911 C  CA    A THR B 2 196 ? -8.420  -9.952  10.321  0.65 21.67 ?  427 THR B CA    1 
ATOM   3912 C  CA    B THR B 2 196 ? -8.828  -9.678  10.023  0.35 19.08 ?  427 THR B CA    1 
ATOM   3913 C  C     A THR B 2 196 ? -7.688  -11.193 10.937  0.65 24.37 ?  427 THR B C     1 
ATOM   3914 C  C     B THR B 2 196 ? -8.344  -10.570 11.140  0.35 19.29 ?  427 THR B C     1 
ATOM   3915 O  O     A THR B 2 196 ? -6.511  -11.459 10.657  0.65 24.59 ?  427 THR B O     1 
ATOM   3916 O  O     B THR B 2 196 ? -9.065  -11.459 11.589  0.35 20.32 ?  427 THR B O     1 
ATOM   3917 C  CB    A THR B 2 196 ? -9.365  -10.469 9.199   0.65 21.05 ?  427 THR B CB    1 
ATOM   3918 C  CB    B THR B 2 196 ? -9.372  -10.542 8.855   0.35 18.86 ?  427 THR B CB    1 
ATOM   3919 O  OG1   A THR B 2 196 ? -8.653  -11.379 8.351   0.65 20.23 ?  427 THR B OG1   1 
ATOM   3920 O  OG1   B THR B 2 196 ? -8.331  -11.373 8.326   0.35 19.17 ?  427 THR B OG1   1 
ATOM   3921 C  CG2   A THR B 2 196 ? -9.955  -9.310  8.353   0.65 20.42 ?  427 THR B CG2   1 
ATOM   3922 C  CG2   B THR B 2 196 ? -10.000 -9.672  7.743   0.35 17.55 ?  427 THR B CG2   1 
ATOM   3923 N  N     A ASN B 2 197 ? -8.401  -11.929 11.796  0.65 26.60 ?  428 ASN B N     1 
ATOM   3924 N  N     B ASN B 2 197 ? -7.116  -10.294 11.577  0.35 18.73 ?  428 ASN B N     1 
ATOM   3925 C  CA    A ASN B 2 197 ? -7.886  -13.105 12.506  0.65 29.26 ?  428 ASN B CA    1 
ATOM   3926 C  CA    B ASN B 2 197 ? -6.451  -11.045 12.620  0.35 18.90 ?  428 ASN B CA    1 
ATOM   3927 C  C     A ASN B 2 197 ? -8.493  -14.405 12.022  0.65 29.53 ?  428 ASN B C     1 
ATOM   3928 C  C     B ASN B 2 197 ? -7.184  -10.813 13.921  0.35 19.12 ?  428 ASN B C     1 
ATOM   3929 O  O     A ASN B 2 197 ? -7.975  -15.481 12.294  0.65 31.39 ?  428 ASN B O     1 
ATOM   3930 O  O     B ASN B 2 197 ? -7.032  -9.768  14.557  0.35 18.97 ?  428 ASN B O     1 
ATOM   3931 C  CB    A ASN B 2 197 ? -8.168  -12.987 14.005  0.65 32.03 ?  428 ASN B CB    1 
ATOM   3932 C  CB    B ASN B 2 197 ? -4.976  -10.626 12.690  0.35 20.75 ?  428 ASN B CB    1 
ATOM   3933 C  CG    A ASN B 2 197 ? -7.533  -11.765 14.647  0.65 34.68 ?  428 ASN B CG    1 
ATOM   3934 C  CG    B ASN B 2 197 ? -4.208  -11.415 13.717  0.35 22.66 ?  428 ASN B CG    1 
ATOM   3935 O  OD1   A ASN B 2 197 ? -6.352  -11.478 14.449  0.65 35.78 ?  428 ASN B OD1   1 
ATOM   3936 O  OD1   B ASN B 2 197 ? -4.758  -12.314 14.351  0.35 23.51 ?  428 ASN B OD1   1 
ATOM   3937 N  ND2   A ASN B 2 197 ? -8.319  -11.058 15.474  0.65 35.88 ?  428 ASN B ND2   1 
ATOM   3938 N  ND2   B ASN B 2 197 ? -2.913  -11.116 13.862  0.35 23.95 ?  428 ASN B ND2   1 
ATOM   3939 N  N     A SER B 2 198 ? -9.627  -14.296 11.334  0.65 28.95 ?  429 SER B N     1 
ATOM   3940 N  N     B SER B 2 198 ? -7.971  -11.815 14.319  0.35 20.17 ?  429 SER B N     1 
ATOM   3941 C  CA    A SER B 2 198 ? -10.403 -15.414 10.807  0.65 28.96 ?  429 SER B CA    1 
ATOM   3942 C  CA    B SER B 2 198 ? -8.744  -11.736 15.559  0.35 22.01 ?  429 SER B CA    1 
ATOM   3943 C  C     A SER B 2 198 ? -11.443 -14.806 9.881   0.65 28.13 ?  429 SER B C     1 
ATOM   3944 C  C     B SER B 2 198 ? -7.861  -11.955 16.790  0.35 21.76 ?  429 SER B C     1 
ATOM   3945 O  O     A SER B 2 198 ? -11.397 -13.611 9.627   0.65 27.84 ?  429 SER B O     1 
ATOM   3946 O  O     B SER B 2 198 ? -8.295  -11.724 17.927  0.35 22.28 ?  429 SER B O     1 
ATOM   3947 C  CB    A SER B 2 198 ? -11.098 -16.225 11.908  0.65 30.01 ?  429 SER B CB    1 
ATOM   3948 C  CB    B SER B 2 198 ? -9.900  -12.736 15.534  0.35 23.59 ?  429 SER B CB    1 
ATOM   3949 O  OG    A SER B 2 198 ? -12.196 -15.505 12.450  0.65 31.58 ?  429 SER B OG    1 
ATOM   3950 O  OG    B SER B 2 198 ? -9.442  -14.074 15.440  0.35 25.29 ?  429 SER B OG    1 
ATOM   3951 N  N     A ASP B 2 199 ? -12.389 -15.606 9.398   0.65 28.60 ?  430 ASP B N     1 
ATOM   3952 N  N     B ASP B 2 199 ? -6.618  -12.388 16.585  0.35 21.24 ?  430 ASP B N     1 
ATOM   3953 C  CA    A ASP B 2 199 ? -13.470 -15.073 8.560   0.65 29.15 ?  430 ASP B CA    1 
ATOM   3954 C  CA    B ASP B 2 199 ? -5.712  -12.564 17.733  0.35 22.08 ?  430 ASP B CA    1 
ATOM   3955 C  C     A ASP B 2 199 ? -14.708 -14.749 9.382   0.65 28.91 ?  430 ASP B C     1 
ATOM   3956 C  C     B ASP B 2 199 ? -4.943  -11.265 18.004  0.35 22.21 ?  430 ASP B C     1 
ATOM   3957 O  O     A ASP B 2 199 ? -15.711 -14.270 8.848   0.65 29.59 ?  430 ASP B O     1 
ATOM   3958 O  O     B ASP B 2 199 ? -3.717  -11.216 17.931  0.35 22.65 ?  430 ASP B O     1 
ATOM   3959 C  CB    A ASP B 2 199 ? -13.826 -16.068 7.447   0.65 31.48 ?  430 ASP B CB    1 
ATOM   3960 C  CB    B ASP B 2 199 ? -4.748  -13.721 17.495  0.35 24.13 ?  430 ASP B CB    1 
ATOM   3961 C  CG    A ASP B 2 199 ? -12.728 -16.208 6.426   0.65 34.42 ?  430 ASP B CG    1 
ATOM   3962 C  CG    B ASP B 2 199 ? -5.450  -15.073 17.491  0.35 25.77 ?  430 ASP B CG    1 
ATOM   3963 O  OD1   A ASP B 2 199 ? -11.960 -15.234 6.244   0.65 35.63 ?  430 ASP B OD1   1 
ATOM   3964 O  OD1   B ASP B 2 199 ? -6.589  -15.156 18.011  0.35 25.90 ?  430 ASP B OD1   1 
ATOM   3965 O  OD2   A ASP B 2 199 ? -12.641 -17.287 5.795   0.65 36.19 ?  430 ASP B OD2   1 
ATOM   3966 O  OD2   B ASP B 2 199 ? -4.855  -16.052 16.971  0.35 27.01 ?  430 ASP B OD2   1 
ATOM   3967 N  N     A THR B 2 200 ? -14.641 -15.007 10.682  0.65 28.52 ?  431 THR B N     1 
ATOM   3968 N  N     B THR B 2 200 ? -5.688  -10.223 18.350  0.35 22.16 ?  431 THR B N     1 
ATOM   3969 C  CA    A THR B 2 200 ? -15.828 -14.846 11.513  0.65 28.55 ?  431 THR B CA    1 
ATOM   3970 C  CA    B THR B 2 200 ? -5.151  -8.875  18.505  0.35 21.51 ?  431 THR B CA    1 
ATOM   3971 C  C     A THR B 2 200 ? -16.136 -13.368 11.680  0.65 26.39 ?  431 THR B C     1 
ATOM   3972 C  C     B THR B 2 200 ? -5.875  -8.200  19.679  0.35 21.30 ?  431 THR B C     1 
ATOM   3973 O  O     A THR B 2 200 ? -15.229 -12.544 11.775  0.65 26.52 ?  431 THR B O     1 
ATOM   3974 O  O     B THR B 2 200 ? -6.999  -8.583  20.009  0.35 20.61 ?  431 THR B O     1 
ATOM   3975 C  CB    A THR B 2 200 ? -15.652 -15.527 12.878  0.65 31.58 ?  431 THR B CB    1 
ATOM   3976 C  CB    B THR B 2 200 ? -5.332  -8.025  17.187  0.35 21.02 ?  431 THR B CB    1 
ATOM   3977 O  OG1   A THR B 2 200 ? -14.596 -14.895 13.607  0.65 34.25 ?  431 THR B OG1   1 
ATOM   3978 O  OG1   B THR B 2 200 ? -6.697  -8.064  16.751  0.35 22.00 ?  431 THR B OG1   1 
ATOM   3979 C  CG2   A THR B 2 200 ? -15.283 -16.977 12.665  0.65 31.52 ?  431 THR B CG2   1 
ATOM   3980 C  CG2   B THR B 2 200 ? -4.444  -8.551  16.051  0.35 20.32 ?  431 THR B CG2   1 
ATOM   3981 N  N     A PRO B 2 201 ? -17.421 -13.019 11.678  0.65 25.41 ?  432 PRO B N     1 
ATOM   3982 N  N     B PRO B 2 201 ? -5.248  -7.188  20.303  0.35 21.60 ?  432 PRO B N     1 
ATOM   3983 C  CA    A PRO B 2 201 ? -17.838 -11.623 11.843  0.65 24.58 ?  432 PRO B CA    1 
ATOM   3984 C  CA    B PRO B 2 201 ? -5.927  -6.512  21.412  0.35 22.07 ?  432 PRO B CA    1 
ATOM   3985 C  C     A PRO B 2 201 ? -17.496 -11.060 13.216  0.65 22.40 ?  432 PRO B C     1 
ATOM   3986 C  C     B PRO B 2 201 ? -7.257  -5.900  21.021  0.35 21.82 ?  432 PRO B C     1 
ATOM   3987 O  O     A PRO B 2 201 ? -17.386 -11.819 14.174  0.65 23.48 ?  432 PRO B O     1 
ATOM   3988 O  O     B PRO B 2 201 ? -7.457  -5.508  19.859  0.35 21.06 ?  432 PRO B O     1 
ATOM   3989 C  CB    A PRO B 2 201 ? -19.360 -11.673 11.642  0.65 26.72 ?  432 PRO B CB    1 
ATOM   3990 C  CB    B PRO B 2 201 ? -4.951  -5.407  21.809  0.35 22.72 ?  432 PRO B CB    1 
ATOM   3991 C  CG    A PRO B 2 201 ? -19.745 -13.124 11.849  0.65 27.78 ?  432 PRO B CG    1 
ATOM   3992 C  CG    B PRO B 2 201 ? -3.627  -5.835  21.268  0.35 23.00 ?  432 PRO B CG    1 
ATOM   3993 C  CD    A PRO B 2 201 ? -18.546 -13.970 11.588  0.65 26.64 ?  432 PRO B CD    1 
ATOM   3994 C  CD    B PRO B 2 201 ? -3.920  -6.614  20.038  0.35 22.30 ?  432 PRO B CD    1 
ATOM   3995 N  N     A THR B 2 202 ? -17.326 -9.747  13.295  0.65 20.24 ?  433 THR B N     1 
ATOM   3996 N  N     B THR B 2 202 ? -8.143  -5.773  22.004  0.35 23.21 ?  433 THR B N     1 
ATOM   3997 C  CA    A THR B 2 202 ? -17.119 -9.051  14.563  0.65 19.62 ?  433 THR B CA    1 
ATOM   3998 C  CA    B THR B 2 202 ? -9.495  -5.268  21.765  0.35 23.93 ?  433 THR B CA    1 
ATOM   3999 C  C     A THR B 2 202 ? -18.132 -7.927  14.755  0.65 19.93 ?  433 THR B C     1 
ATOM   4000 C  C     B THR B 2 202 ? -9.458  -3.869  21.180  0.35 23.89 ?  433 THR B C     1 
ATOM   4001 O  O     A THR B 2 202 ? -18.936 -7.619  13.879  0.65 21.25 ?  433 THR B O     1 
ATOM   4002 O  O     B THR B 2 202 ? -10.257 -3.489  20.308  0.35 23.46 ?  433 THR B O     1 
ATOM   4003 C  CB    A THR B 2 202 ? -15.722 -8.445  14.642  0.65 20.56 ?  433 THR B CB    1 
ATOM   4004 C  CB    B THR B 2 202 ? -10.317 -5.258  23.078  0.35 25.15 ?  433 THR B CB    1 
ATOM   4005 O  OG1   A THR B 2 202 ? -15.561 -7.453  13.621  0.65 20.59 ?  433 THR B OG1   1 
ATOM   4006 O  OG1   B THR B 2 202 ? -10.491 -6.607  23.536  0.35 26.48 ?  433 THR B OG1   1 
ATOM   4007 C  CG2   A THR B 2 202 ? -14.687 -9.497  14.413  0.65 21.93 ?  433 THR B CG2   1 
ATOM   4008 C  CG2   B THR B 2 202 ? -11.689 -4.624  22.867  0.35 25.63 ?  433 THR B CG2   1 
ATOM   4009 N  N     A SER B 2 203 ? -18.090 -7.280  15.899  0.65 19.69 ?  434 SER B N     1 
ATOM   4010 N  N     B SER B 2 203 ? -8.490  -3.106  21.645  0.35 24.13 ?  434 SER B N     1 
ATOM   4011 C  CA    A SER B 2 203 ? -19.089 -6.243  16.129  0.65 18.96 ?  434 SER B CA    1 
ATOM   4012 C  CA    B SER B 2 203 ? -8.393  -1.722  21.267  0.35 23.06 ?  434 SER B CA    1 
ATOM   4013 C  C     A SER B 2 203 ? -18.757 -4.986  15.344  0.65 16.10 ?  434 SER B C     1 
ATOM   4014 C  C     B SER B 2 203 ? -7.931  -1.556  19.830  0.35 20.50 ?  434 SER B C     1 
ATOM   4015 O  O     A SER B 2 203 ? -17.704 -4.879  14.709  0.65 17.06 ?  434 SER B O     1 
ATOM   4016 O  O     B SER B 2 203 ? -7.862  -0.467  19.396  0.35 18.92 ?  434 SER B O     1 
ATOM   4017 C  CB    A SER B 2 203 ? -19.205 -5.967  17.627  0.65 22.12 ?  434 SER B CB    1 
ATOM   4018 C  CB    B SER B 2 203 ? -7.446  -0.968  22.200  0.35 23.25 ?  434 SER B CB    1 
ATOM   4019 O  OG    A SER B 2 203 ? -18.008 -5.399  18.095  0.65 25.56 ?  434 SER B OG    1 
ATOM   4020 O  OG    B SER B 2 203 ? -6.098  -1.292  21.923  0.35 23.79 ?  434 SER B OG    1 
ATOM   4021 N  N     A PHE B 2 204 ? -19.657 -4.025  15.392  0.65 13.98 ?  435 PHE B N     1 
ATOM   4022 N  N     B PHE B 2 204 ? -7.599  -2.656  19.134  0.35 19.13 ?  435 PHE B N     1 
ATOM   4023 C  CA    A PHE B 2 204 ? -19.691 -2.916  14.432  0.65 14.61 ?  435 PHE B CA    1 
ATOM   4024 C  CA    B PHE B 2 204 ? -7.184  -2.680  17.715  0.35 15.88 ?  435 PHE B CA    1 
ATOM   4025 C  C     A PHE B 2 204 ? -18.424 -2.055  14.388  0.65 14.29 ?  435 PHE B C     1 
ATOM   4026 C  C     B PHE B 2 204 ? -8.403  -2.790  16.844  0.35 17.42 ?  435 PHE B C     1 
ATOM   4027 O  O     A PHE B 2 204 ? -18.114 -1.435  13.356  0.65 14.48 ?  435 PHE B O     1 
ATOM   4028 O  O     B PHE B 2 204 ? -8.376  -2.437  15.649  0.35 16.22 ?  435 PHE B O     1 
ATOM   4029 C  CB    A PHE B 2 204 ? -20.914 -2.028  14.762  0.65 15.57 ?  435 PHE B CB    1 
ATOM   4030 C  CB    B PHE B 2 204 ? -6.224  -3.868  17.502  0.35 17.29 ?  435 PHE B CB    1 
ATOM   4031 C  CG    A PHE B 2 204 ? -20.696 -1.186  15.979  0.65 16.22 ?  435 PHE B CG    1 
ATOM   4032 C  CG    B PHE B 2 204 ? -5.705  -4.032  16.123  0.35 17.62 ?  435 PHE B CG    1 
ATOM   4033 C  CD1   A PHE B 2 204 ? -21.036 -1.666  17.235  0.65 17.74 ?  435 PHE B CD1   1 
ATOM   4034 C  CD1   B PHE B 2 204 ? -4.600  -3.314  15.689  0.35 17.67 ?  435 PHE B CD1   1 
ATOM   4035 C  CD2   A PHE B 2 204 ? -20.155 0.085   15.871  0.65 17.13 ?  435 PHE B CD2   1 
ATOM   4036 C  CD2   B PHE B 2 204 ? -6.240  -4.967  15.274  0.35 18.25 ?  435 PHE B CD2   1 
ATOM   4037 C  CE1   A PHE B 2 204 ? -20.760 -0.879  18.381  0.65 19.09 ?  435 PHE B CE1   1 
ATOM   4038 C  CE1   B PHE B 2 204 ? -4.101  -3.490  14.434  0.35 16.83 ?  435 PHE B CE1   1 
ATOM   4039 C  CE2   A PHE B 2 204 ? -19.892 0.848   16.941  0.65 17.24 ?  435 PHE B CE2   1 
ATOM   4040 C  CE2   B PHE B 2 204 ? -5.713  -5.118  14.021  0.35 17.49 ?  435 PHE B CE2   1 
ATOM   4041 C  CZ    A PHE B 2 204 ? -20.175 0.385   18.199  0.65 17.69 ?  435 PHE B CZ    1 
ATOM   4042 C  CZ    B PHE B 2 204 ? -4.669  -4.389  13.614  0.35 16.84 ?  435 PHE B CZ    1 
ATOM   4043 N  N     A ASN B 2 205 ? -17.690 -1.994  15.502  0.65 14.92 ?  436 ASN B N     1 
ATOM   4044 N  N     B ASN B 2 205 ? -9.514  -3.242  17.417  0.35 19.19 ?  436 ASN B N     1 
ATOM   4045 C  CA    A ASN B 2 205 ? -16.573 -1.068  15.638  0.65 14.14 ?  436 ASN B CA    1 
ATOM   4046 C  CA    B ASN B 2 205 ? -10.752 -3.366  16.637  0.35 20.06 ?  436 ASN B CA    1 
ATOM   4047 C  C     A ASN B 2 205 ? -15.232 -1.712  15.252  0.65 14.68 ?  436 ASN B C     1 
ATOM   4048 C  C     B ASN B 2 205 ? -10.534 -4.110  15.281  0.35 20.64 ?  436 ASN B C     1 
ATOM   4049 O  O     A ASN B 2 205 ? -14.226 -1.046  15.141  0.65 16.05 ?  436 ASN B O     1 
ATOM   4050 O  O     B ASN B 2 205 ? -10.897 -3.616  14.266  0.35 19.65 ?  436 ASN B O     1 
ATOM   4051 C  CB    A ASN B 2 205 ? -16.514 -0.500  17.061  0.65 14.42 ?  436 ASN B CB    1 
ATOM   4052 C  CB    B ASN B 2 205 ? -11.345 -1.980  16.322  0.35 21.16 ?  436 ASN B CB    1 
ATOM   4053 C  CG    A ASN B 2 205 ? -15.808 0.837   17.143  0.65 14.75 ?  436 ASN B CG    1 
ATOM   4054 C  CG    B ASN B 2 205 ? -12.023 -1.331  17.466  0.35 23.65 ?  436 ASN B CG    1 
ATOM   4055 O  OD1   A ASN B 2 205 ? -15.996 1.699   16.300  0.65 17.28 ?  436 ASN B OD1   1 
ATOM   4056 O  OD1   B ASN B 2 205 ? -12.098 -1.855  18.590  0.35 25.68 ?  436 ASN B OD1   1 
ATOM   4057 N  ND2   A ASN B 2 205 ? -15.005 1.018   18.193  0.65 15.94 ?  436 ASN B ND2   1 
ATOM   4058 N  ND2   B ASN B 2 205 ? -12.524 -0.145  17.206  0.35 24.91 ?  436 ASN B ND2   1 
ATOM   4059 N  N     A HIS B 2 206 ? -15.283 -2.996  14.936  0.65 15.10 ?  437 HIS B N     1 
ATOM   4060 N  N     B HIS B 2 206 ? -9.928  -5.276  15.278  0.35 22.49 ?  437 HIS B N     1 
ATOM   4061 C  CA    A HIS B 2 206 ? -14.081 -3.797  14.639  0.65 15.74 ?  437 HIS B CA    1 
ATOM   4062 C  CA    B HIS B 2 206 ? -9.871  -6.024  14.039  0.35 22.58 ?  437 HIS B CA    1 
ATOM   4063 C  C     A HIS B 2 206 ? -13.995 -4.224  13.192  0.65 15.06 ?  437 HIS B C     1 
ATOM   4064 C  C     B HIS B 2 206 ? -11.268 -6.078  13.460  0.35 23.05 ?  437 HIS B C     1 
ATOM   4065 O  O     A HIS B 2 206 ? -15.058 -4.345  12.552  0.65 16.37 ?  437 HIS B O     1 
ATOM   4066 O  O     B HIS B 2 206 ? -12.290 -6.343  14.127  0.35 21.12 ?  437 HIS B O     1 
ATOM   4067 C  CB    A HIS B 2 206 ? -14.081 -5.056  15.514  0.65 17.38 ?  437 HIS B CB    1 
ATOM   4068 C  CB    B HIS B 2 206 ? -9.304  -7.423  14.238  0.35 22.57 ?  437 HIS B CB    1 
ATOM   4069 C  CG    A HIS B 2 206 ? -13.922 -4.778  16.971  0.65 21.97 ?  437 HIS B CG    1 
ATOM   4070 C  CG    B HIS B 2 206 ? -10.224 -8.332  14.990  0.35 22.47 ?  437 HIS B CG    1 
ATOM   4071 N  ND1   A HIS B 2 206 ? -14.994 -4.713  17.826  0.65 24.49 ?  437 HIS B ND1   1 
ATOM   4072 N  ND1   B HIS B 2 206 ? -10.420 -8.246  16.354  0.35 23.30 ?  437 HIS B ND1   1 
ATOM   4073 C  CD2   A HIS B 2 206 ? -12.825 -4.524  17.719  0.65 25.17 ?  437 HIS B CD2   1 
ATOM   4074 C  CD2   B HIS B 2 206 ? -11.032 -9.325  14.554  0.35 22.19 ?  437 HIS B CD2   1 
ATOM   4075 C  CE1   A HIS B 2 206 ? -14.568 -4.434  19.047  0.65 25.74 ?  437 HIS B CE1   1 
ATOM   4076 C  CE1   B HIS B 2 206 ? -11.305 -9.151  16.725  0.35 22.09 ?  437 HIS B CE1   1 
ATOM   4077 N  NE2   A HIS B 2 206 ? -13.250 -4.338  19.013  0.65 26.91 ?  437 HIS B NE2   1 
ATOM   4078 N  NE2   B HIS B 2 206 ? -11.687 -9.825  15.655  0.35 22.21 ?  437 HIS B NE2   1 
ATOM   4079 N  N     A MET B 2 207 ? -12.784 -4.535  12.682  0.65 14.78 ?  438 MET B N     1 
ATOM   4080 N  N     B MET B 2 207 ? -11.311 -5.703  12.206  0.35 24.67 ?  438 MET B N     1 
ATOM   4081 C  CA    A MET B 2 207 ? -12.714 -5.083  11.319  0.65 15.62 ?  438 MET B CA    1 
ATOM   4082 C  CA    B MET B 2 207 ? -12.578 -5.573  11.576  0.35 25.14 ?  438 MET B CA    1 
ATOM   4083 C  C     A MET B 2 207 ? -13.093 -6.616  11.300  0.65 18.13 ?  438 MET B C     1 
ATOM   4084 C  C     B MET B 2 207 ? -12.769 -6.934  11.051  0.35 24.26 ?  438 MET B C     1 
ATOM   4085 O  O     A MET B 2 207 ? -12.859 -7.297  12.303  0.65 19.36 ?  438 MET B O     1 
ATOM   4086 O  O     B MET B 2 207 ? -12.017 -7.849  11.341  0.35 26.43 ?  438 MET B O     1 
ATOM   4087 C  CB    A MET B 2 207 ? -11.299 -4.831  10.772  0.65 15.18 ?  438 MET B CB    1 
ATOM   4088 C  CB    B MET B 2 207 ? -12.556 -4.550  10.480  0.35 26.10 ?  438 MET B CB    1 
ATOM   4089 C  CG    A MET B 2 207 ? -11.124 -5.192  9.306   0.65 16.03 ?  438 MET B CG    1 
ATOM   4090 C  CG    B MET B 2 207 ? -11.504 -4.829  9.461   0.35 26.41 ?  438 MET B CG    1 
ATOM   4091 S  SD    A MET B 2 207 ? -12.194 -4.100  8.341   0.65 16.42 ?  438 MET B SD    1 
ATOM   4092 S  SD    B MET B 2 207 ? -12.045 -3.978  8.000   0.35 26.25 ?  438 MET B SD    1 
ATOM   4093 C  CE    A MET B 2 207 ? -11.252 -2.584  8.499   0.65 19.14 ?  438 MET B CE    1 
ATOM   4094 C  CE    B MET B 2 207 ? -11.481 -2.304  8.269   0.35 26.28 ?  438 MET B CE    1 
ATOM   4095 N  N     . ASP B 2 208 ? -13.744 -7.134  10.231  1.00 21.62 ?  439 ASP B N     1 
ATOM   4096 C  CA    . ASP B 2 208 ? -13.836 -8.573  9.897   1.00 22.18 ?  439 ASP B CA    1 
ATOM   4097 C  C     . ASP B 2 208 ? -13.726 -8.668  8.357   1.00 20.43 ?  439 ASP B C     1 
ATOM   4098 O  O     . ASP B 2 208 ? -13.584 -7.634  7.698   1.00 20.45 ?  439 ASP B O     1 
ATOM   4099 C  CB    . ASP B 2 208 ? -15.101 -9.235  10.408  1.00 24.58 ?  439 ASP B CB    1 
ATOM   4100 C  CG    . ASP B 2 208 ? -16.365 -8.550  9.941   1.00 25.07 ?  439 ASP B CG    1 
ATOM   4101 O  OD1   . ASP B 2 208 ? -16.436 -8.157  8.795   1.00 25.11 ?  439 ASP B OD1   1 
ATOM   4102 O  OD2   . ASP B 2 208 ? -17.311 -8.364  10.762  1.00 26.61 ?  439 ASP B OD2   1 
ATOM   4103 N  N     . SER B 2 209 ? -13.688 -9.885  7.809   1.00 18.69 ?  440 SER B N     1 
ATOM   4104 C  CA    . SER B 2 209 ? -13.453 -10.040 6.363   1.00 18.04 ?  440 SER B CA    1 
ATOM   4105 C  C     . SER B 2 209 ? -14.555 -9.341  5.553   1.00 16.66 ?  440 SER B C     1 
ATOM   4106 O  O     . SER B 2 209 ? -14.272 -8.685  4.547   1.00 17.85 ?  440 SER B O     1 
ATOM   4107 C  CB    . SER B 2 209 ? -13.380 -11.524 6.019   1.00 21.75 ?  440 SER B CB    1 
ATOM   4108 O  OG    . SER B 2 209 ? -13.156 -11.716 4.653   1.00 21.77 ?  440 SER B OG    1 
ATOM   4109 N  N     . ASP B 2 210 ? -15.810 -9.472  6.000   1.00 16.64 ?  441 ASP B N     1 
ATOM   4110 C  CA    . ASP B 2 210 ? -16.925 -8.870  5.253   1.00 16.08 ?  441 ASP B CA    1 
ATOM   4111 C  C     . ASP B 2 210 ? -16.785 -7.327  5.276   1.00 17.92 ?  441 ASP B C     1 
ATOM   4112 O  O     . ASP B 2 210 ? -17.021 -6.678  4.248   1.00 18.71 ?  441 ASP B O     1 
ATOM   4113 C  CB    . ASP B 2 210 ? -18.256 -9.335  5.872   1.00 16.95 ?  441 ASP B CB    1 
ATOM   4114 C  CG    . ASP B 2 210 ? -18.561 -10.784 5.631   1.00 20.71 ?  441 ASP B CG    1 
ATOM   4115 O  OD1   . ASP B 2 210 ? -18.117 -11.372 4.619   1.00 22.01 ?  441 ASP B OD1   1 
ATOM   4116 O  OD2   . ASP B 2 210 ? -19.335 -11.366 6.451   1.00 24.17 ?  441 ASP B OD2   1 
ATOM   4117 N  N     . LYS B 2 211 ? -16.403 -6.727  6.416   1.00 17.24 ?  442 LYS B N     1 
ATOM   4118 C  CA    . LYS B 2 211 ? -16.206 -5.260  6.414   1.00 18.44 ?  442 LYS B CA    1 
ATOM   4119 C  C     . LYS B 2 211 ? -14.974 -4.835  5.619   1.00 17.92 ?  442 LYS B C     1 
ATOM   4120 O  O     . LYS B 2 211 ? -14.950 -3.775  4.952   1.00 17.96 ?  442 LYS B O     1 
ATOM   4121 C  CB    . LYS B 2 211 ? -16.035 -4.668  7.833   1.00 18.73 ?  442 LYS B CB    1 
ATOM   4122 C  CG    . LYS B 2 211 ? -17.151 -4.964  8.788   1.00 19.08 ?  442 LYS B CG    1 
ATOM   4123 C  CD    . LYS B 2 211 ? -17.001 -4.074  10.005  1.00 20.11 ?  442 LYS B CD    1 
ATOM   4124 C  CE    . LYS B 2 211 ? -18.003 -4.435  11.163  1.00 22.00 ?  442 LYS B CE    1 
ATOM   4125 N  NZ    . LYS B 2 211 ? -17.502 -5.620  11.958  1.00 24.08 ?  442 LYS B NZ    1 
ATOM   4126 N  N     . LEU B 2 212 ? -13.942 -5.664  5.676   1.00 15.49 ?  443 LEU B N     1 
ATOM   4127 C  CA    . LEU B 2 212 ? -12.720 -5.324  4.945   1.00 14.67 ?  443 LEU B CA    1 
ATOM   4128 C  C     . LEU B 2 212 ? -12.989 -5.355  3.435   1.00 14.91 ?  443 LEU B C     1 
ATOM   4129 O  O     . LEU B 2 212 ? -12.420 -4.561  2.685   1.00 15.41 ?  443 LEU B O     1 
ATOM   4130 C  CB    . LEU B 2 212 ? -11.631 -6.288  5.324   1.00 13.71 ?  443 LEU B CB    1 
ATOM   4131 C  CG    . LEU B 2 212 ? -10.279 -6.040  4.662   1.00 15.27 ?  443 LEU B CG    1 
ATOM   4132 C  CD1   . LEU B 2 212 ? -9.861  -4.513  4.842   1.00 16.87 ?  443 LEU B CD1   1 
ATOM   4133 C  CD2   . LEU B 2 212 ? -9.199  -6.969  5.227   1.00 16.33 ?  443 LEU B CD2   1 
ATOM   4134 N  N     . SER B 2 213 ? -13.902 -6.221  2.991   1.00 15.15 ?  444 SER B N     1 
ATOM   4135 C  CA    . SER B 2 213 ? -14.190 -6.243  1.571   1.00 15.10 ?  444 SER B CA    1 
ATOM   4136 C  C     . SER B 2 213 ? -14.717 -4.902  1.034   1.00 13.95 ?  444 SER B C     1 
ATOM   4137 O  O     . SER B 2 213 ? -14.301 -4.436  -0.039  1.00 13.79 ?  444 SER B O     1 
ATOM   4138 C  CB    . SER B 2 213 ? -15.204 -7.324  1.250   1.00 17.02 ?  444 SER B CB    1 
ATOM   4139 O  OG    . SER B 2 213 ? -16.528 -6.992  1.771   1.00 20.32 ?  444 SER B OG    1 
ATOM   4140 N  N     . GLY B 2 214 ? -15.600 -4.247  1.789   1.00 13.72 ?  445 GLY B N     1 
ATOM   4141 C  CA    . GLY B 2 214 ? -16.103 -2.934  1.337   1.00 12.85 ?  445 GLY B CA    1 
ATOM   4142 C  C     . GLY B 2 214 ? -15.074 -1.816  1.463   1.00 12.37 ?  445 GLY B C     1 
ATOM   4143 O  O     . GLY B 2 214 ? -15.131 -0.822  0.740   1.00 14.38 ?  445 GLY B O     1 
ATOM   4144 N  N     . LEU B 2 215 ? -14.104 -1.937  2.393   1.00 12.64 ?  446 LEU B N     1 
ATOM   4145 C  CA    . LEU B 2 215 ? -13.020 -0.953  2.413   1.00 12.26 ?  446 LEU B CA    1 
ATOM   4146 C  C     . LEU B 2 215 ? -12.162 -1.137  1.177   1.00 12.67 ?  446 LEU B C     1 
ATOM   4147 O  O     . LEU B 2 215 ? -11.819 -0.165  0.487   1.00 12.27 ?  446 LEU B O     1 
ATOM   4148 C  CB    . LEU B 2 215 ? -12.185 -1.126  3.699   1.00 13.40 ?  446 LEU B CB    1 
ATOM   4149 C  CG    . LEU B 2 215 ? -10.935 -0.271  3.745   1.00 14.04 ?  446 LEU B CG    1 
ATOM   4150 C  CD1   . LEU B 2 215 ? -11.251 1.225   3.656   1.00 16.19 ?  446 LEU B CD1   1 
ATOM   4151 C  CD2   . LEU B 2 215 ? -10.148 -0.624  5.081   1.00 16.40 ?  446 LEU B CD2   1 
ATOM   4152 N  N     . TRP B 2 216 ? -11.825 -2.394  0.924   1.00 12.50 ?  447 TRP B N     1 
ATOM   4153 C  CA    . TRP B 2 216 ? -10.939 -2.700  -0.205  1.00 13.02 ?  447 TRP B CA    1 
ATOM   4154 C  C     . TRP B 2 216 ? -11.518 -2.226  -1.538  1.00 11.95 ?  447 TRP B C     1 
ATOM   4155 O  O     . TRP B 2 216 ? -10.810 -1.688  -2.394  1.00 12.56 ?  447 TRP B O     1 
ATOM   4156 C  CB    . TRP B 2 216 ? -10.671 -4.208  -0.172  1.00 13.09 ?  447 TRP B CB    1 
ATOM   4157 C  CG    . TRP B 2 216 ? -9.703  -4.666  -1.242  1.00 12.23 ?  447 TRP B CG    1 
ATOM   4158 C  CD1   . TRP B 2 216 ? -9.954  -5.586  -2.253  1.00 13.57 ?  447 TRP B CD1   1 
ATOM   4159 C  CD2   . TRP B 2 216 ? -8.323  -4.237  -1.411  1.00 12.49 ?  447 TRP B CD2   1 
ATOM   4160 N  NE1   . TRP B 2 216 ? -8.799  -5.777  -3.008  1.00 14.52 ?  447 TRP B NE1   1 
ATOM   4161 C  CE2   . TRP B 2 216 ? -7.791  -4.981  -2.509  1.00 13.42 ?  447 TRP B CE2   1 
ATOM   4162 C  CE3   . TRP B 2 216 ? -7.473  -3.359  -0.713  1.00 13.27 ?  447 TRP B CE3   1 
ATOM   4163 C  CZ2   . TRP B 2 216 ? -6.494  -4.809  -2.976  1.00 14.13 ?  447 TRP B CZ2   1 
ATOM   4164 C  CZ3   . TRP B 2 216 ? -6.143  -3.218  -1.186  1.00 14.03 ?  447 TRP B CZ3   1 
ATOM   4165 C  CH2   . TRP B 2 216 ? -5.682  -3.944  -2.295  1.00 14.44 ?  447 TRP B CH2   1 
ATOM   4166 N  N     . SER B 2 217 ? -12.824 -2.445  -1.724  1.00 12.46 ?  448 SER B N     1 
ATOM   4167 C  CA    . SER B 2 217 ? -13.452 -2.005  -2.969  1.00 12.32 ?  448 SER B CA    1 
ATOM   4168 C  C     . SER B 2 217 ? -13.541 -0.484  -3.130  1.00 11.11 ?  448 SER B C     1 
ATOM   4169 O  O     . SER B 2 217 ? -13.852 -0.033  -4.249  1.00 13.15 ?  448 SER B O     1 
ATOM   4170 C  CB    . SER B 2 217 ? -14.841 -2.655  -3.091  1.00 14.49 ?  448 SER B CB    1 
ATOM   4171 O  OG    . SER B 2 217 ? -15.667 -2.073  -2.102  1.00 16.16 ?  448 SER B OG    1 
ATOM   4172 N  N     . ARG B 2 218 ? -13.233 0.291   -2.098  1.00 10.84 ?  449 ARG B N     1 
ATOM   4173 C  CA    . ARG B 2 218 ? -13.161 1.752   -2.178  1.00 11.70 ?  449 ARG B CA    1 
ATOM   4174 C  C     . ARG B 2 218 ? -11.742 2.287   -2.341  1.00 12.91 ?  449 ARG B C     1 
ATOM   4175 O  O     . ARG B 2 218 ? -11.576 3.429   -2.763  1.00 14.06 ?  449 ARG B O     1 
ATOM   4176 C  CB    . ARG B 2 218 ? -13.835 2.335   -0.928  1.00 12.11 ?  449 ARG B CB    1 
ATOM   4177 C  CG    . ARG B 2 218 ? -15.361 2.068   -1.028  1.00 12.72 ?  449 ARG B CG    1 
ATOM   4178 C  CD    . ARG B 2 218 ? -16.040 2.349   0.369   1.00 11.92 ?  449 ARG B CD    1 
ATOM   4179 N  NE    . ARG B 2 218 ? -17.524 2.354   0.208   1.00 11.98 ?  449 ARG B NE    1 
ATOM   4180 C  CZ    . ARG B 2 218 ? -18.274 1.273   -0.005  1.00 12.50 ?  449 ARG B CZ    1 
ATOM   4181 N  NH1   . ARG B 2 218 ? -19.590 1.449   -0.243  1.00 12.55 ?  449 ARG B NH1   1 
ATOM   4182 N  NH2   . ARG B 2 218 ? -17.774 0.054   0.018   1.00 12.79 ?  449 ARG B NH2   1 
ATOM   4183 N  N     . ILE B 2 219 ? -10.724 1.528   -1.912  1.00 11.29 ?  450 ILE B N     1 
ATOM   4184 C  CA    . ILE B 2 219 ? -9.348  2.098   -1.923  1.00 12.19 ?  450 ILE B CA    1 
ATOM   4185 C  C     . ILE B 2 219 ? -8.432  1.471   -2.965  1.00 13.32 ?  450 ILE B C     1 
ATOM   4186 O  O     . ILE B 2 219 ? -7.325  1.966   -3.114  1.00 15.47 ?  450 ILE B O     1 
ATOM   4187 C  CB    . ILE B 2 219 ? -8.675  1.986   -0.508  1.00 12.60 ?  450 ILE B CB    1 
ATOM   4188 C  CG1   . ILE B 2 219 ? -8.447  0.497   -0.119  1.00 12.62 ?  450 ILE B CG1   1 
ATOM   4189 C  CG2   . ILE B 2 219 ? -9.526  2.794   0.530   1.00 13.67 ?  450 ILE B CG2   1 
ATOM   4190 C  CD1   . ILE B 2 219 ? -7.585  0.327   1.169   1.00 14.60 ?  450 ILE B CD1   1 
ATOM   4191 N  N     . SER B 2 220 ? -8.866  0.446   -3.696  1.00 12.83 ?  451 SER B N     1 
ATOM   4192 C  CA    . SER B 2 220 ? -7.924  -0.280  -4.571  1.00 12.32 ?  451 SER B CA    1 
ATOM   4193 C  C     . SER B 2 220 ? -8.214  -0.097  -6.058  1.00 13.72 ?  451 SER B C     1 
ATOM   4194 O  O     . SER B 2 220 ? -8.149  -1.062  -6.834  1.00 15.93 ?  451 SER B O     1 
ATOM   4195 C  CB    . SER B 2 220 ? -7.863  -1.770  -4.220  1.00 13.24 ?  451 SER B CB    1 
ATOM   4196 O  OG    . SER B 2 220 ? -9.111  -2.418  -4.395  1.00 13.97 ?  451 SER B OG    1 
ATOM   4197 N  N     . HIS B 2 221 ? -8.558  1.121   -6.440  1.00 13.27 ?  452 HIS B N     1 
ATOM   4198 C  CA    . HIS B 2 221 ? -8.707  1.455   -7.858  1.00 13.54 ?  452 HIS B CA    1 
ATOM   4199 C  C     . HIS B 2 221 ? -7.449  1.252   -8.660  1.00 13.53 ?  452 HIS B C     1 
ATOM   4200 O  O     . HIS B 2 221 ? -7.529  0.805   -9.811  1.00 15.30 ?  452 HIS B O     1 
ATOM   4201 C  CB    . HIS B 2 221 ? -9.133  2.923   -7.983  1.00 14.34 ?  452 HIS B CB    1 
ATOM   4202 C  CG    . HIS B 2 221 ? -10.481 3.151   -7.434  1.00 14.16 ?  452 HIS B CG    1 
ATOM   4203 N  ND1   . HIS B 2 221 ? -11.631 3.114   -8.220  1.00 16.63 ?  452 HIS B ND1   1 
ATOM   4204 C  CD2   . HIS B 2 221 ? -10.883 3.403   -6.179  1.00 15.25 ?  452 HIS B CD2   1 
ATOM   4205 C  CE1   . HIS B 2 221 ? -12.685 3.332   -7.448  1.00 17.24 ?  452 HIS B CE1   1 
ATOM   4206 N  NE2   . HIS B 2 221 ? -12.259 3.523   -6.211  1.00 16.62 ?  452 HIS B NE2   1 
ATOM   4207 N  N     . LEU B 2 222 ? -6.312  1.617   -8.069  1.00 13.45 ?  453 LEU B N     1 
ATOM   4208 C  CA    . LEU B 2 222 ? -5.044  1.575   -8.781  1.00 15.14 ?  453 LEU B CA    1 
ATOM   4209 C  C     . LEU B 2 222 ? -3.987  1.219   -7.742  1.00 15.91 ?  453 LEU B C     1 
ATOM   4210 O  O     . LEU B 2 222 ? -3.739  2.006   -6.846  1.00 19.89 ?  453 LEU B O     1 
ATOM   4211 C  CB    . LEU B 2 222 ? -4.785  2.944   -9.417  1.00 19.16 ?  453 LEU B CB    1 
ATOM   4212 C  CG    . LEU B 2 222 ? -3.637  3.191   -10.360 1.00 20.70 ?  453 LEU B CG    1 
ATOM   4213 C  CD1   . LEU B 2 222 ? -3.422  2.005   -11.312 1.00 23.27 ?  453 LEU B CD1   1 
ATOM   4214 C  CD2   . LEU B 2 222 ? -3.686  4.606   -11.027 1.00 17.56 ?  453 LEU B CD2   1 
ATOM   4215 N  N     . VAL B 2 223 ? -3.382  0.039   -7.889  1.00 14.74 ?  454 VAL B N     1 
ATOM   4216 C  CA    . VAL B 2 223 ? -2.354  -0.421  -6.954  1.00 14.97 ?  454 VAL B CA    1 
ATOM   4217 C  C     . VAL B 2 223 ? -1.055  -0.554  -7.731  1.00 15.66 ?  454 VAL B C     1 
ATOM   4218 O  O     . VAL B 2 223 ? -0.937  -1.386  -8.612  1.00 18.89 ?  454 VAL B O     1 
ATOM   4219 C  CB    . VAL B 2 223 ? -2.761  -1.754  -6.295  1.00 15.85 ?  454 VAL B CB    1 
ATOM   4220 C  CG1   . VAL B 2 223 ? -1.718  -2.161  -5.189  1.00 17.49 ?  454 VAL B CG1   1 
ATOM   4221 C  CG2   . VAL B 2 223 ? -4.167  -1.670  -5.647  1.00 17.02 ?  454 VAL B CG2   1 
ATOM   4222 N  N     . LEU B 2 224 ? -0.073  0.251   -7.380  1.00 13.58 ?  455 LEU B N     1 
ATOM   4223 C  CA    . LEU B 2 224 ? 1.125   0.403   -8.237  1.00 14.37 ?  455 LEU B CA    1 
ATOM   4224 C  C     . LEU B 2 224 ? 2.381   -0.016  -7.475  1.00 14.46 ?  455 LEU B C     1 
ATOM   4225 O  O     . LEU B 2 224 ? 2.605   0.479   -6.367  1.00 14.75 ?  455 LEU B O     1 
ATOM   4226 C  CB    . LEU B 2 224 ? 1.273   1.861   -8.700  1.00 15.56 ?  455 LEU B CB    1 
ATOM   4227 C  CG    . LEU B 2 224 ? 0.098   2.316   -9.587  1.00 17.22 ?  455 LEU B CG    1 
ATOM   4228 C  CD1   . LEU B 2 224 ? 0.222   3.799   -9.908  1.00 17.71 ?  455 LEU B CD1   1 
ATOM   4229 C  CD2   . LEU B 2 224 ? 0.014   1.450   -10.849 1.00 18.74 ?  455 LEU B CD2   1 
ATOM   4230 N  N     . PRO B 2 225 ? 3.205   -0.911  -8.089  1.00 14.96 ?  456 PRO B N     1 
ATOM   4231 C  CA    . PRO B 2 225 ? 4.435   -1.356  -7.418  1.00 15.50 ?  456 PRO B CA    1 
ATOM   4232 C  C     . PRO B 2 225 ? 5.552   -0.327  -7.580  1.00 15.45 ?  456 PRO B C     1 
ATOM   4233 O  O     . PRO B 2 225 ? 5.585   0.352   -8.599  1.00 16.26 ?  456 PRO B O     1 
ATOM   4234 C  CB    . PRO B 2 225 ? 4.769   -2.654  -8.165  1.00 15.49 ?  456 PRO B CB    1 
ATOM   4235 C  CG    . PRO B 2 225 ? 4.299   -2.323  -9.626  1.00 17.00 ?  456 PRO B CG    1 
ATOM   4236 C  CD    . PRO B 2 225 ? 3.054   -1.464  -9.464  1.00 16.30 ?  456 PRO B CD    1 
ATOM   4237 N  N     . VAL B 2 226 ? 6.408   -0.214  -6.566  1.00 15.58 ?  457 VAL B N     1 
ATOM   4238 C  CA    . VAL B 2 226 ? 7.509   0.715   -6.544  1.00 16.11 ?  457 VAL B CA    1 
ATOM   4239 C  C     . VAL B 2 226 ? 8.797   -0.055  -6.296  1.00 17.20 ?  457 VAL B C     1 
ATOM   4240 O  O     . VAL B 2 226 ? 8.856   -0.885  -5.394  1.00 17.45 ?  457 VAL B O     1 
ATOM   4241 C  CB    . VAL B 2 226 ? 7.304   1.830   -5.447  1.00 15.71 ?  457 VAL B CB    1 
ATOM   4242 C  CG1   . VAL B 2 226 ? 8.511   2.776   -5.347  1.00 16.22 ?  457 VAL B CG1   1 
ATOM   4243 C  CG2   . VAL B 2 226 ? 5.997   2.608   -5.663  1.00 15.67 ?  457 VAL B CG2   1 
ATOM   4244 N  N     . GLN B 2 227 ? 9.804   0.220   -7.134  1.00 17.76 ?  458 GLN B N     1 
ATOM   4245 C  CA    . GLN B 2 227 ? 11.141  -0.368  -7.009  1.00 18.55 ?  458 GLN B CA    1 
ATOM   4246 C  C     . GLN B 2 227 ? 12.081  0.640   -6.344  1.00 17.73 ?  458 GLN B C     1 
ATOM   4247 O  O     . GLN B 2 227 ? 11.935  1.842   -6.539  1.00 18.04 ?  458 GLN B O     1 
ATOM   4248 C  CB    . GLN B 2 227 ? 11.688  -0.696  -8.407  1.00 19.08 ?  458 GLN B CB    1 
ATOM   4249 C  CG    . GLN B 2 227 ? 10.921  -1.837  -9.095  1.00 21.22 ?  458 GLN B CG    1 
ATOM   4250 C  CD    . GLN B 2 227 ? 10.958  -3.138  -8.328  1.00 22.49 ?  458 GLN B CD    1 
ATOM   4251 O  OE1   . GLN B 2 227 ? 11.909  -3.427  -7.593  1.00 25.26 ?  458 GLN B OE1   1 
ATOM   4252 N  NE2   . GLN B 2 227 ? 9.935   -3.964  -8.535  1.00 24.32 ?  458 GLN B NE2   1 
ATOM   4253 N  N     . PRO B 2 228 ? 13.066  0.151   -5.565  1.00 18.12 ?  459 PRO B N     1 
ATOM   4254 C  CA    . PRO B 2 228 ? 14.045  1.086   -4.972  1.00 19.03 ?  459 PRO B CA    1 
ATOM   4255 C  C     . PRO B 2 228 ? 14.757  1.927   -6.026  1.00 19.31 ?  459 PRO B C     1 
ATOM   4256 O  O     . PRO B 2 228 ? 15.158  1.414   -7.101  1.00 20.86 ?  459 PRO B O     1 
ATOM   4257 C  CB    . PRO B 2 228 ? 15.039  0.160   -4.229  1.00 19.89 ?  459 PRO B CB    1 
ATOM   4258 C  CG    . PRO B 2 228 ? 14.862  -1.162  -4.849  1.00 20.07 ?  459 PRO B CG    1 
ATOM   4259 C  CD    . PRO B 2 228 ? 13.380  -1.255  -5.256  1.00 18.72 ?  459 PRO B CD    1 
ATOM   4260 N  N     . VAL B 2 229 ? 14.941  3.201   -5.688  1.00 19.14 ?  460 VAL B N     1 
ATOM   4261 C  CA    . VAL B 2 229 ? 15.912  4.101   -6.379  1.00 19.09 ?  460 VAL B CA    1 
ATOM   4262 C  C     . VAL B 2 229 ? 17.107  4.118   -5.453  1.00 20.57 ?  460 VAL B C     1 
ATOM   4263 O  O     . VAL B 2 229 ? 16.968  4.563   -4.319  1.00 20.18 ?  460 VAL B O     1 
ATOM   4264 C  CB    . VAL B 2 229 ? 15.309  5.521   -6.616  1.00 19.47 ?  460 VAL B CB    1 
ATOM   4265 C  CG1   . VAL B 2 229 ? 16.356  6.471   -7.188  1.00 20.75 ?  460 VAL B CG1   1 
ATOM   4266 C  CG2   . VAL B 2 229 ? 14.120  5.422   -7.627  1.00 19.50 ?  460 VAL B CG2   1 
ATOM   4267 N  N     . SER B 2 230 ? 18.285  3.649   -5.913  1.00 21.30 ?  461 SER B N     1 
ATOM   4268 C  CA    . SER B 2 230 ? 19.406  3.463   -4.994  1.00 23.13 ?  461 SER B CA    1 
ATOM   4269 C  C     . SER B 2 230 ? 19.762  4.725   -4.237  1.00 22.58 ?  461 SER B C     1 
ATOM   4270 O  O     . SER B 2 230 ? 20.055  4.679   -3.019  1.00 23.08 ?  461 SER B O     1 
ATOM   4271 C  CB    . SER B 2 230 ? 20.644  3.001   -5.745  1.00 26.41 ?  461 SER B CB    1 
ATOM   4272 O  OG    . SER B 2 230 ? 20.399  1.737   -6.309  1.00 31.03 ?  461 SER B OG    1 
ATOM   4273 N  N     . SER B 2 231 ? 19.793  5.859   -4.935  1.00 23.65 ?  462 SER B N     1 
ATOM   4274 C  CA    . SER B 2 231 ? 20.230  7.089   -4.262  1.00 24.65 ?  462 SER B CA    1 
ATOM   4275 C  C     . SER B 2 231 ? 19.253  7.532   -3.180  1.00 23.12 ?  462 SER B C     1 
ATOM   4276 O  O     . SER B 2 231 ? 19.658  8.187   -2.232  1.00 24.27 ?  462 SER B O     1 
ATOM   4277 C  CB    . SER B 2 231 ? 20.431  8.222   -5.264  1.00 27.19 ?  462 SER B CB    1 
ATOM   4278 O  OG    . SER B 2 231 ? 19.236  8.461   -5.997  1.00 29.79 ?  462 SER B OG    1 
ATOM   4279 N  N     . ILE B 2 232 ? 17.957  7.223   -3.344  1.00 20.95 ?  463 ILE B N     1 
ATOM   4280 C  CA    . ILE B 2 232 ? 16.983  7.611   -2.350  1.00 19.72 ?  463 ILE B CA    1 
ATOM   4281 C  C     . ILE B 2 232 ? 17.122  6.646   -1.161  1.00 20.13 ?  463 ILE B C     1 
ATOM   4282 O  O     . ILE B 2 232 ? 17.050  7.065   0.001   1.00 22.25 ?  463 ILE B O     1 
ATOM   4283 C  CB    . ILE B 2 232 ? 15.579  7.589   -2.932  1.00 19.50 ?  463 ILE B CB    1 
ATOM   4284 C  CG1   . ILE B 2 232 ? 15.472  8.633   -4.065  1.00 20.63 ?  463 ILE B CG1   1 
ATOM   4285 C  CG2   . ILE B 2 232 ? 14.563  7.934   -1.831  1.00 19.42 ?  463 ILE B CG2   1 
ATOM   4286 C  CD1   . ILE B 2 232 ? 14.118  8.627   -4.794  1.00 20.54 ?  463 ILE B CD1   1 
ATOM   4287 N  N     . GLU B 2 233 ? 17.320  5.352   -1.415  1.00 19.16 ?  464 GLU B N     1 
ATOM   4288 C  CA    . GLU B 2 233 ? 17.512  4.452   -0.271  1.00 20.21 ?  464 GLU B CA    1 
ATOM   4289 C  C     . GLU B 2 233 ? 18.788  4.827   0.506   1.00 21.23 ?  464 GLU B C     1 
ATOM   4290 O  O     . GLU B 2 233 ? 18.849  4.676   1.728   1.00 22.17 ?  464 GLU B O     1 
ATOM   4291 C  CB    . GLU B 2 233 ? 17.577  2.976   -0.689  1.00 20.24 ?  464 GLU B CB    1 
ATOM   4292 C  CG    . GLU B 2 233 ? 16.316  2.454   -1.420  1.00 19.63 ?  464 GLU B CG    1 
ATOM   4293 C  CD    . GLU B 2 233 ? 15.000  2.598   -0.636  1.00 21.08 ?  464 GLU B CD    1 
ATOM   4294 O  OE1   . GLU B 2 233 ? 14.962  2.422   0.638   1.00 21.68 ?  464 GLU B OE1   1 
ATOM   4295 O  OE2   . GLU B 2 233 ? 13.961  2.803   -1.334  1.00 21.35 ?  464 GLU B OE2   1 
ATOM   4296 N  N     . GLU B 2 234 ? 19.774  5.327   -0.228  1.00 21.16 ?  465 GLU B N     1 
ATOM   4297 C  CA    . GLU B 2 234 ? 21.047  5.671   0.392   1.00 22.66 ?  465 GLU B CA    1 
ATOM   4298 C  C     . GLU B 2 234 ? 21.006  7.026   1.123   1.00 25.09 ?  465 GLU B C     1 
ATOM   4299 O  O     . GLU B 2 234 ? 21.535  7.144   2.230   1.00 26.56 ?  465 GLU B O     1 
ATOM   4300 C  CB    . GLU B 2 234 ? 22.150  5.672   -0.672  1.00 22.61 ?  465 GLU B CB    1 
ATOM   4301 C  CG    . GLU B 2 234 ? 23.478  6.201   -0.212  1.00 24.45 ?  465 GLU B CG    1 
ATOM   4302 C  CD    . GLU B 2 234 ? 24.133  5.291   0.802   1.00 26.15 ?  465 GLU B CD    1 
ATOM   4303 O  OE1   . GLU B 2 234 ? 23.889  4.065   0.754   1.00 26.49 ?  465 GLU B OE1   1 
ATOM   4304 O  OE2   . GLU B 2 234 ? 24.923  5.801   1.651   1.00 26.90 ?  465 GLU B OE2   1 
ATOM   4305 N  N     . GLN B 2 235 ? 20.421  8.040   0.495   1.00 27.85 ?  466 GLN B N     1 
ATOM   4306 C  CA    . GLN B 2 235 ? 20.552  9.426   0.933   1.00 31.34 ?  466 GLN B CA    1 
ATOM   4307 C  C     . GLN B 2 235 ? 19.276  10.009  1.507   1.00 32.02 ?  466 GLN B C     1 
ATOM   4308 O  O     . GLN B 2 235 ? 19.314  11.087  2.088   1.00 33.41 ?  466 GLN B O     1 
ATOM   4309 C  CB    . GLN B 2 235 ? 20.967  10.317  -0.238  1.00 35.48 ?  466 GLN B CB    1 
ATOM   4310 C  CG    . GLN B 2 235 ? 22.243  9.925   -0.948  1.00 38.67 ?  466 GLN B CG    1 
ATOM   4311 C  CD    . GLN B 2 235 ? 22.387  10.633  -2.281  1.00 43.01 ?  466 GLN B CD    1 
ATOM   4312 O  OE1   . GLN B 2 235 ? 21.679  11.612  -2.565  1.00 44.72 ?  466 GLN B OE1   1 
ATOM   4313 N  NE2   . GLN B 2 235 ? 23.283  10.124  -3.130  1.00 44.75 ?  466 GLN B NE2   1 
ATOM   4314 N  N     . GLY B 2 236 ? 18.141  9.342   1.276   1.00 30.84 ?  467 GLY B N     1 
ATOM   4315 C  CA    . GLY B 2 236 ? 16.840  9.871   1.679   1.00 32.69 ?  467 GLY B CA    1 
ATOM   4316 C  C     . GLY B 2 236 ? 16.196  10.691  0.583   1.00 34.88 ?  467 GLY B C     1 
ATOM   4317 O  O     . GLY B 2 236 ? 16.726  10.838  -0.518  1.00 35.46 ?  467 GLY B O     1 
ATOM   4318 N  N     . CYS B 2 237 ? 15.032  11.238  0.888   1.00 36.59 ?  468 CYS B N     1 
ATOM   4319 C  CA    . CYS B 2 237 ? 14.269  12.025  -0.067  1.00 39.35 ?  468 CYS B CA    1 
ATOM   4320 C  C     . CYS B 2 237 ? 14.727  13.475  -0.046  1.00 45.23 ?  468 CYS B C     1 
ATOM   4321 O  O     . CYS B 2 237 ? 14.220  14.258  0.740   1.00 46.85 ?  468 CYS B O     1 
ATOM   4322 C  CB    . CYS B 2 237 ? 12.814  11.923  0.324   1.00 37.07 ?  468 CYS B CB    1 
ATOM   4323 S  SG    . CYS B 2 237 ? 11.574  12.347  -0.908  1.00 34.64 ?  468 CYS B SG    1 
ATOM   4324 N  N     . LEU B 2 238 ? 15.691  13.848  -0.881  1.00 49.64 ?  469 LEU B N     1 
ATOM   4325 C  CA    . LEU B 2 238 ? 16.355  15.145  -0.686  1.00 53.58 ?  469 LEU B CA    1 
ATOM   4326 C  C     . LEU B 2 238 ? 15.890  16.245  -1.648  1.00 56.54 ?  469 LEU B C     1 
ATOM   4327 O  O     . LEU B 2 238 ? 16.605  17.226  -1.884  1.00 57.33 ?  469 LEU B O     1 
ATOM   4328 C  CB    . LEU B 2 238 ? 17.877  14.971  -0.794  1.00 54.34 ?  469 LEU B CB    1 
ATOM   4329 C  CG    . LEU B 2 238 ? 18.491  13.972  0.197   1.00 54.49 ?  469 LEU B CG    1 
ATOM   4330 C  CD1   . LEU B 2 238 ? 20.008  13.919  0.054   1.00 54.80 ?  469 LEU B CD1   1 
ATOM   4331 C  CD2   . LEU B 2 238 ? 18.082  14.291  1.638   1.00 54.30 ?  469 LEU B CD2   1 
ATOM   4332 N  N     . PHE B 2 239 ? 14.686  16.098  -2.179  1.00 57.93 ?  470 PHE B N     1 
ATOM   4333 C  CA    . PHE B 2 239 ? 14.178  17.046  -3.167  1.00 59.78 ?  470 PHE B CA    1 
ATOM   4334 C  C     . PHE B 2 239 ? 12.652  17.163  -3.081  1.00 60.16 ?  470 PHE B C     1 
ATOM   4335 O  O     . PHE B 2 239 ? 12.050  18.018  -3.740  1.00 60.44 ?  470 PHE B O     1 
ATOM   4336 C  CB    . PHE B 2 239 ? 14.608  16.630  -4.591  1.00 60.78 ?  470 PHE B CB    1 
ATOM   4337 C  CG    . PHE B 2 239 ? 14.291  15.186  -4.932  1.00 61.18 ?  470 PHE B CG    1 
ATOM   4338 C  CD1   . PHE B 2 239 ? 13.026  14.820  -5.345  1.00 60.97 ?  470 PHE B CD1   1 
ATOM   4339 C  CD2   . PHE B 2 239 ? 15.264  14.199  -4.835  1.00 61.32 ?  470 PHE B CD2   1 
ATOM   4340 C  CE1   . PHE B 2 239 ? 12.738  13.504  -5.648  1.00 60.89 ?  470 PHE B CE1   1 
ATOM   4341 C  CE2   . PHE B 2 239 ? 14.968  12.879  -5.142  1.00 60.97 ?  470 PHE B CE2   1 
ATOM   4342 C  CZ    . PHE B 2 239 ? 13.708  12.537  -5.540  1.00 60.66 ?  470 PHE B CZ    1 
ATOM   4343 N  N     . VAL C 3 3   ? -23.815 31.812  19.899  1.00 43.21 ?  3   VAL C N     1 
ATOM   4344 C  CA    . VAL C 3 3   ? -22.749 31.107  20.596  1.00 43.52 ?  3   VAL C CA    1 
ATOM   4345 C  C     . VAL C 3 3   ? -21.366 31.569  20.142  1.00 41.53 ?  3   VAL C C     1 
ATOM   4346 O  O     . VAL C 3 3   ? -21.077 31.659  18.960  1.00 40.97 ?  3   VAL C O     1 
ATOM   4347 C  CB    . VAL C 3 3   ? -22.901 29.556  20.480  1.00 45.54 ?  3   VAL C CB    1 
ATOM   4348 C  CG1   . VAL C 3 3   ? -23.002 29.117  19.087  1.00 46.27 ?  3   VAL C CG1   1 
ATOM   4349 C  CG2   . VAL C 3 3   ? -21.726 28.840  21.125  1.00 45.63 ?  3   VAL C CG2   1 
ATOM   4350 N  N     . GLN C 3 4   ? -20.541 31.893  21.146  1.00 40.02 ?  4   GLN C N     1 
ATOM   4351 C  CA    . GLN C 3 4   ? -19.168 32.379  20.994  1.00 40.31 ?  4   GLN C CA    1 
ATOM   4352 C  C     . GLN C 3 4   ? -18.255 31.564  21.882  1.00 36.26 ?  4   GLN C C     1 
ATOM   4353 O  O     . GLN C 3 4   ? -18.643 31.192  22.981  1.00 35.53 ?  4   GLN C O     1 
ATOM   4354 C  CB    . GLN C 3 4   ? -19.009 33.851  21.404  1.00 44.74 ?  4   GLN C CB    1 
ATOM   4355 C  CG    . GLN C 3 4   ? -20.024 34.856  20.856  1.00 49.22 ?  4   GLN C CG    1 
ATOM   4356 C  CD    . GLN C 3 4   ? -19.513 36.287  20.978  1.00 52.82 ?  4   GLN C CD    1 
ATOM   4357 O  OE1   . GLN C 3 4   ? -18.290 36.534  21.061  1.00 54.06 ?  4   GLN C OE1   1 
ATOM   4358 N  NE2   . GLN C 3 4   ? -20.438 37.241  21.026  1.00 54.02 ?  4   GLN C NE2   1 
ATOM   4359 N  N     . LEU C 3 5   ? -17.029 31.334  21.425  1.00 33.63 ?  5   LEU C N     1 
ATOM   4360 C  CA    . LEU C 3 5   ? -16.014 30.663  22.199  1.00 31.54 ?  5   LEU C CA    1 
ATOM   4361 C  C     . LEU C 3 5   ? -15.019 31.688  22.688  1.00 33.66 ?  5   LEU C C     1 
ATOM   4362 O  O     . LEU C 3 5   ? -14.518 32.485  21.903  1.00 34.19 ?  5   LEU C O     1 
ATOM   4363 C  CB    . LEU C 3 5   ? -15.277 29.616  21.338  1.00 29.03 ?  5   LEU C CB    1 
ATOM   4364 C  CG    . LEU C 3 5   ? -16.105 28.507  20.706  1.00 28.04 ?  5   LEU C CG    1 
ATOM   4365 C  CD1   . LEU C 3 5   ? -15.164 27.568  19.935  1.00 27.12 ?  5   LEU C CD1   1 
ATOM   4366 C  CD2   . LEU C 3 5   ? -16.866 27.721  21.706  1.00 28.63 ?  5   LEU C CD2   1 
ATOM   4367 N  N     . VAL C 3 6   ? -14.720 31.663  23.977  1.00 35.68 ?  6   VAL C N     1 
ATOM   4368 C  CA    . VAL C 3 6   ? -13.788 32.630  24.554  1.00 36.94 ?  6   VAL C CA    1 
ATOM   4369 C  C     . VAL C 3 6   ? -12.728 31.901  25.349  1.00 37.44 ?  6   VAL C C     1 
ATOM   4370 O  O     . VAL C 3 6   ? -13.061 31.259  26.335  1.00 37.54 ?  6   VAL C O     1 
ATOM   4371 C  CB    . VAL C 3 6   ? -14.507 33.650  25.460  1.00 38.17 ?  6   VAL C CB    1 
ATOM   4372 C  CG1   . VAL C 3 6   ? -13.492 34.590  26.073  1.00 38.18 ?  6   VAL C CG1   1 
ATOM   4373 C  CG2   . VAL C 3 6   ? -15.536 34.443  24.673  1.00 38.73 ?  6   VAL C CG2   1 
ATOM   4374 N  N     . GLU C 3 7   ? -11.470 31.983  24.917  1.00 37.65 ?  7   GLU C N     1 
ATOM   4375 C  CA    . GLU C 3 7   ? -10.372 31.294  25.624  1.00 37.81 ?  7   GLU C CA    1 
ATOM   4376 C  C     . GLU C 3 7   ? -9.719  32.168  26.676  1.00 39.99 ?  7   GLU C C     1 
ATOM   4377 O  O     . GLU C 3 7   ? -9.566  33.377  26.493  1.00 41.74 ?  7   GLU C O     1 
ATOM   4378 C  CB    . GLU C 3 7   ? -9.270  30.842  24.662  1.00 37.15 ?  7   GLU C CB    1 
ATOM   4379 C  CG    . GLU C 3 7   ? -9.738  30.049  23.458  1.00 37.07 ?  7   GLU C CG    1 
ATOM   4380 C  CD    . GLU C 3 7   ? -9.893  30.889  22.208  1.00 36.73 ?  7   GLU C CD    1 
ATOM   4381 O  OE1   . GLU C 3 7   ? -9.790  30.317  21.114  1.00 35.65 ?  7   GLU C OE1   1 
ATOM   4382 O  OE2   . GLU C 3 7   ? -10.138 32.112  22.293  1.00 37.28 ?  7   GLU C OE2   1 
ATOM   4383 N  N     . THR C 3 8   ? -9.289  31.533  27.762  1.00 38.93 ?  8   THR C N     1 
ATOM   4384 C  CA    . THR C 3 8   ? -8.469  32.197  28.778  1.00 39.60 ?  8   THR C CA    1 
ATOM   4385 C  C     . THR C 3 8   ? -7.375  31.246  29.271  1.00 37.64 ?  8   THR C C     1 
ATOM   4386 O  O     . THR C 3 8   ? -7.402  30.042  28.966  1.00 35.67 ?  8   THR C O     1 
ATOM   4387 C  CB    . THR C 3 8   ? -9.336  32.699  29.958  1.00 41.76 ?  8   THR C CB    1 
ATOM   4388 O  OG1   . THR C 3 8   ? -10.130 31.630  30.490  1.00 42.87 ?  8   THR C OG1   1 
ATOM   4389 C  CG2   . THR C 3 8   ? -10.264 33.802  29.484  1.00 42.76 ?  8   THR C CG2   1 
ATOM   4390 N  N     . GLY C 3 9   ? -6.397  31.790  30.002  1.00 37.99 ?  9   GLY C N     1 
ATOM   4391 C  CA    . GLY C 3 9   ? -5.381  30.966  30.619  1.00 37.95 ?  9   GLY C CA    1 
ATOM   4392 C  C     . GLY C 3 9   ? -3.996  31.050  30.016  1.00 39.29 ?  9   GLY C C     1 
ATOM   4393 O  O     . GLY C 3 9   ? -3.059  30.423  30.510  1.00 40.37 ?  9   GLY C O     1 
ATOM   4394 N  N     . GLY C 3 10  ? -3.836  31.815  28.947  1.00 39.54 ?  10  GLY C N     1 
ATOM   4395 C  CA    . GLY C 3 10  ? -2.518  31.921  28.341  1.00 39.76 ?  10  GLY C CA    1 
ATOM   4396 C  C     . GLY C 3 10  ? -1.514  32.752  29.120  1.00 39.99 ?  10  GLY C C     1 
ATOM   4397 O  O     . GLY C 3 10  ? -1.859  33.346  30.151  1.00 41.08 ?  10  GLY C O     1 
ATOM   4398 N  N     . GLY C 3 11  ? -0.265  32.768  28.660  1.00 39.46 ?  11  GLY C N     1 
ATOM   4399 C  CA    . GLY C 3 11  ? 0.762   33.586  29.292  1.00 39.03 ?  11  GLY C CA    1 
ATOM   4400 C  C     . GLY C 3 11  ? 2.166   33.039  29.092  1.00 39.23 ?  11  GLY C C     1 
ATOM   4401 O  O     . GLY C 3 11  ? 2.375   32.249  28.181  1.00 37.86 ?  11  GLY C O     1 
ATOM   4402 N  N     . LEU C 3 12  ? 3.124   33.440  29.946  1.00 40.78 ?  12  LEU C N     1 
ATOM   4403 C  CA    . LEU C 3 12  ? 4.501   32.899  29.882  1.00 41.24 ?  12  LEU C CA    1 
ATOM   4404 C  C     . LEU C 3 12  ? 4.778   31.773  30.883  1.00 41.21 ?  12  LEU C C     1 
ATOM   4405 O  O     . LEU C 3 12  ? 4.334   31.836  32.007  1.00 40.75 ?  12  LEU C O     1 
ATOM   4406 C  CB    . LEU C 3 12  ? 5.543   33.999  30.107  1.00 42.24 ?  12  LEU C CB    1 
ATOM   4407 C  CG    . LEU C 3 12  ? 6.999   33.553  29.862  1.00 43.18 ?  12  LEU C CG    1 
ATOM   4408 C  CD1   . LEU C 3 12  ? 7.791   34.666  29.206  1.00 42.93 ?  12  LEU C CD1   1 
ATOM   4409 C  CD2   . LEU C 3 12  ? 7.694   33.064  31.149  1.00 43.87 ?  12  LEU C CD2   1 
ATOM   4410 N  N     . VAL C 3 13  ? 5.548   30.766  30.471  1.00 42.70 ?  13  VAL C N     1 
ATOM   4411 C  CA    . VAL C 3 13  ? 5.860   29.598  31.297  1.00 43.29 ?  13  VAL C CA    1 
ATOM   4412 C  C     . VAL C 3 13  ? 7.332   29.349  31.107  1.00 43.20 ?  13  VAL C C     1 
ATOM   4413 O  O     . VAL C 3 13  ? 7.867   29.681  30.048  1.00 44.21 ?  13  VAL C O     1 
ATOM   4414 C  CB    . VAL C 3 13  ? 5.046   28.347  30.882  1.00 44.04 ?  13  VAL C CB    1 
ATOM   4415 C  CG1   . VAL C 3 13  ? 5.291   27.183  31.849  1.00 44.19 ?  13  VAL C CG1   1 
ATOM   4416 C  CG2   . VAL C 3 13  ? 3.544   28.681  30.731  1.00 44.46 ?  13  VAL C CG2   1 
ATOM   4417 N  N     . GLN C 3 14  ? 7.995   28.772  32.113  1.00 42.90 ?  14  GLN C N     1 
ATOM   4418 C  CA    . GLN C 3 14  ? 9.403   28.374  32.038  1.00 43.33 ?  14  GLN C CA    1 
ATOM   4419 C  C     . GLN C 3 14  ? 9.471   26.969  31.515  1.00 43.12 ?  14  GLN C C     1 
ATOM   4420 O  O     . GLN C 3 14  ? 8.565   26.184  31.789  1.00 43.95 ?  14  GLN C O     1 
ATOM   4421 C  CB    . GLN C 3 14  ? 9.949   28.579  33.449  1.00 46.77 ?  14  GLN C CB    1 
ATOM   4422 C  CG    . GLN C 3 14  ? 9.987   30.111  33.496  1.00 50.05 ?  14  GLN C CG    1 
ATOM   4423 C  CD    . GLN C 3 14  ? 11.282  30.656  32.906  1.00 52.09 ?  14  GLN C CD    1 
ATOM   4424 O  OE1   . GLN C 3 14  ? 11.678  30.346  31.781  1.00 53.06 ?  14  GLN C OE1   1 
ATOM   4425 N  NE2   . GLN C 3 14  ? 11.686  31.795  33.487  1.00 53.94 ?  14  GLN C NE2   1 
ATOM   4426 N  N     . ALA C 3 15  ? 10.442  26.685  30.661  1.00 43.43 ?  15  ALA C N     1 
ATOM   4427 C  CA    . ALA C 3 15  ? 10.599  25.335  30.128  1.00 44.40 ?  15  ALA C CA    1 
ATOM   4428 C  C     . ALA C 3 15  ? 10.471  24.344  31.272  1.00 44.08 ?  15  ALA C C     1 
ATOM   4429 O  O     . ALA C 3 15  ? 11.062  24.537  32.325  1.00 44.27 ?  15  ALA C O     1 
ATOM   4430 C  CB    . ALA C 3 15  ? 11.945  25.177  29.420  1.00 44.90 ?  15  ALA C CB    1 
ATOM   4431 N  N     . GLY C 3 16  ? 9.650   23.320  31.086  1.00 44.21 ?  16  GLY C N     1 
ATOM   4432 C  CA    . GLY C 3 16  ? 9.397   22.342  32.126  1.00 44.51 ?  16  GLY C CA    1 
ATOM   4433 C  C     . GLY C 3 16  ? 8.134   22.609  32.925  1.00 45.10 ?  16  GLY C C     1 
ATOM   4434 O  O     . GLY C 3 16  ? 7.609   21.696  33.566  1.00 45.96 ?  16  GLY C O     1 
ATOM   4435 N  N     . GLY C 3 17  ? 7.648   23.853  32.892  1.00 44.52 ?  17  GLY C N     1 
ATOM   4436 C  CA    . GLY C 3 17  ? 6.425   24.241  33.580  1.00 43.91 ?  17  GLY C CA    1 
ATOM   4437 C  C     . GLY C 3 17  ? 5.073   23.849  32.940  1.00 42.99 ?  17  GLY C C     1 
ATOM   4438 O  O     . GLY C 3 17  ? 5.014   23.161  31.909  1.00 43.85 ?  17  GLY C O     1 
ATOM   4439 N  N     . SER C 3 18  ? 3.985   24.309  33.570  1.00 41.04 ?  18  SER C N     1 
ATOM   4440 C  CA    . SER C 3 18  ? 2.600   23.868  33.252  1.00 40.95 ?  18  SER C CA    1 
ATOM   4441 C  C     . SER C 3 18  ? 1.630   25.033  33.046  1.00 38.92 ?  18  SER C C     1 
ATOM   4442 O  O     . SER C 3 18  ? 1.825   26.094  33.607  1.00 38.77 ?  18  SER C O     1 
ATOM   4443 C  CB    . SER C 3 18  ? 2.069   22.983  34.389  1.00 43.29 ?  18  SER C CB    1 
ATOM   4444 O  OG    . SER C 3 18  ? 2.514   21.649  34.250  1.00 45.58 ?  18  SER C OG    1 
ATOM   4445 N  N     . LEU C 3 19  ? 0.571   24.831  32.258  1.00 36.85 ?  19  LEU C N     1 
ATOM   4446 C  CA    . LEU C 3 19  ? -0.419  25.877  32.037  1.00 35.34 ?  19  LEU C CA    1 
ATOM   4447 C  C     . LEU C 3 19  ? -1.748  25.178  31.791  1.00 34.15 ?  19  LEU C C     1 
ATOM   4448 O  O     . LEU C 3 19  ? -1.752  24.072  31.246  1.00 35.66 ?  19  LEU C O     1 
ATOM   4449 C  CB    . LEU C 3 19  ? -0.031  26.756  30.829  1.00 37.08 ?  19  LEU C CB    1 
ATOM   4450 C  CG    . LEU C 3 19  ? -0.524  28.206  30.739  1.00 38.33 ?  19  LEU C CG    1 
ATOM   4451 C  CD1   . LEU C 3 19  ? -0.094  29.045  31.952  1.00 38.40 ?  19  LEU C CD1   1 
ATOM   4452 C  CD2   . LEU C 3 19  ? -0.055  28.881  29.428  1.00 38.91 ?  19  LEU C CD2   1 
ATOM   4453 N  N     . ARG C 3 20  ? -2.863  25.796  32.162  1.00 31.66 ?  20  ARG C N     1 
ATOM   4454 C  CA    . ARG C 3 20  ? -4.176  25.210  31.848  1.00 31.19 ?  20  ARG C CA    1 
ATOM   4455 C  C     . ARG C 3 20  ? -4.977  26.239  31.077  1.00 32.61 ?  20  ARG C C     1 
ATOM   4456 O  O     . ARG C 3 20  ? -5.194  27.357  31.558  1.00 34.93 ?  20  ARG C O     1 
ATOM   4457 C  CB    . ARG C 3 20  ? -4.936  24.781  33.107  1.00 31.34 ?  20  ARG C CB    1 
ATOM   4458 C  CG    . ARG C 3 20  ? -6.274  24.127  32.819  1.00 33.02 ?  20  ARG C CG    1 
ATOM   4459 C  CD    . ARG C 3 20  ? -7.005  23.961  34.139  1.00 34.33 ?  20  ARG C CD    1 
ATOM   4460 N  NE    . ARG C 3 20  ? -8.199  23.138  34.002  1.00 37.11 ?  20  ARG C NE    1 
ATOM   4461 C  CZ    . ARG C 3 20  ? -9.421  23.552  34.322  1.00 39.56 ?  20  ARG C CZ    1 
ATOM   4462 N  NH1   . ARG C 3 20  ? -9.607  24.811  34.732  1.00 40.58 ?  20  ARG C NH1   1 
ATOM   4463 N  NH2   . ARG C 3 20  ? -10.450 22.706  34.233  1.00 40.25 ?  20  ARG C NH2   1 
ATOM   4464 N  N     . LEU C 3 21  ? -5.396  25.868  29.874  1.00 31.49 ?  21  LEU C N     1 
ATOM   4465 C  CA    . LEU C 3 21  ? -6.215  26.737  29.064  1.00 29.92 ?  21  LEU C CA    1 
ATOM   4466 C  C     . LEU C 3 21  ? -7.669  26.346  29.261  1.00 29.68 ?  21  LEU C C     1 
ATOM   4467 O  O     . LEU C 3 21  ? -7.967  25.162  29.421  1.00 29.78 ?  21  LEU C O     1 
ATOM   4468 C  CB    . LEU C 3 21  ? -5.835  26.607  27.586  1.00 29.58 ?  21  LEU C CB    1 
ATOM   4469 C  CG    . LEU C 3 21  ? -4.355  26.842  27.229  1.00 30.06 ?  21  LEU C CG    1 
ATOM   4470 C  CD1   . LEU C 3 21  ? -4.182  26.789  25.725  1.00 30.43 ?  21  LEU C CD1   1 
ATOM   4471 C  CD2   . LEU C 3 21  ? -3.880  28.177  27.777  1.00 30.87 ?  21  LEU C CD2   1 
ATOM   4472 N  N     . SER C 3 22  ? -8.557  27.333  29.224  1.00 29.98 ?  22  SER C N     1 
ATOM   4473 C  CA    . SER C 3 22  ? -9.994  27.108  29.329  1.00 31.50 ?  22  SER C CA    1 
ATOM   4474 C  C     . SER C 3 22  ? -10.711 27.807  28.232  1.00 32.48 ?  22  SER C C     1 
ATOM   4475 O  O     . SER C 3 22  ? -10.270 28.883  27.777  1.00 33.77 ?  22  SER C O     1 
ATOM   4476 C  CB    . SER C 3 22  ? -10.529 27.637  30.666  1.00 34.29 ?  22  SER C CB    1 
ATOM   4477 O  OG    . SER C 3 22  ? -9.786  27.158  31.778  1.00 36.74 ?  22  SER C OG    1 
ATOM   4478 N  N     . CYS C 3 23  ? -11.799 27.193  27.768  1.00 30.50 ?  23  CYS C N     1 
ATOM   4479 C  CA    . CYS C 3 23  ? -12.674 27.885  26.865  1.00 31.27 ?  23  CYS C CA    1 
ATOM   4480 C  C     . CYS C 3 23  ? -14.097 27.793  27.334  1.00 33.55 ?  23  CYS C C     1 
ATOM   4481 O  O     . CYS C 3 23  ? -14.610 26.694  27.555  1.00 34.92 ?  23  CYS C O     1 
ATOM   4482 C  CB    . CYS C 3 23  ? -12.542 27.309  25.461  1.00 31.03 ?  23  CYS C CB    1 
ATOM   4483 S  SG    . CYS C 3 23  ? -13.580 28.136  24.253  1.00 34.50 ?  23  CYS C SG    1 
ATOM   4484 N  N     . ALA C 3 24  ? -14.735 28.946  27.483  1.00 34.82 ?  24  ALA C N     1 
ATOM   4485 C  CA    . ALA C 3 24  ? -16.148 28.986  27.772  1.00 36.64 ?  24  ALA C CA    1 
ATOM   4486 C  C     . ALA C 3 24  ? -16.971 29.281  26.516  1.00 37.49 ?  24  ALA C C     1 
ATOM   4487 O  O     . ALA C 3 24  ? -16.712 30.253  25.804  1.00 37.94 ?  24  ALA C O     1 
ATOM   4488 C  CB    . ALA C 3 24  ? -16.423 30.024  28.869  1.00 38.25 ?  24  ALA C CB    1 
ATOM   4489 N  N     . ALA C 3 25  ? -17.969 28.446  26.247  1.00 37.41 ?  25  ALA C N     1 
ATOM   4490 C  CA    . ALA C 3 25  ? -18.887 28.732  25.162  1.00 38.51 ?  25  ALA C CA    1 
ATOM   4491 C  C     . ALA C 3 25  ? -20.137 29.367  25.733  1.00 41.16 ?  25  ALA C C     1 
ATOM   4492 O  O     . ALA C 3 25  ? -20.605 28.975  26.805  1.00 42.02 ?  25  ALA C O     1 
ATOM   4493 C  CB    . ALA C 3 25  ? -19.216 27.479  24.389  1.00 37.60 ?  25  ALA C CB    1 
ATOM   4494 N  N     . SER C 3 26  ? -20.677 30.350  25.022  1.00 43.18 ?  26  SER C N     1 
ATOM   4495 C  CA    . SER C 3 26  ? -21.821 31.111  25.529  1.00 44.51 ?  26  SER C CA    1 
ATOM   4496 C  C     . SER C 3 26  ? -23.143 30.433  25.191  1.00 46.02 ?  26  SER C C     1 
ATOM   4497 O  O     . SER C 3 26  ? -24.216 30.898  25.598  1.00 47.23 ?  26  SER C O     1 
ATOM   4498 C  CB    . SER C 3 26  ? -21.803 32.551  24.991  1.00 45.00 ?  26  SER C CB    1 
ATOM   4499 O  OG    . SER C 3 26  ? -21.955 32.582  23.574  1.00 44.92 ?  26  SER C OG    1 
ATOM   4500 N  N     . GLY C 3 27  ? -23.061 29.323  24.473  1.00 45.88 ?  27  GLY C N     1 
ATOM   4501 C  CA    . GLY C 3 27  ? -24.233 28.523  24.192  1.00 45.47 ?  27  GLY C CA    1 
ATOM   4502 C  C     . GLY C 3 27  ? -23.958 27.108  24.641  1.00 45.16 ?  27  GLY C C     1 
ATOM   4503 O  O     . GLY C 3 27  ? -22.823 26.786  25.007  1.00 44.78 ?  27  GLY C O     1 
ATOM   4504 N  N     . ASN C 3 28  ? -24.975 26.259  24.614  1.00 44.73 ?  28  ASN C N     1 
ATOM   4505 C  CA    . ASN C 3 28  ? -24.765 24.856  24.919  1.00 44.67 ?  28  ASN C CA    1 
ATOM   4506 C  C     . ASN C 3 28  ? -23.753 24.224  23.955  1.00 43.02 ?  28  ASN C C     1 
ATOM   4507 O  O     . ASN C 3 28  ? -23.660 24.637  22.791  1.00 44.24 ?  28  ASN C O     1 
ATOM   4508 C  CB    . ASN C 3 28  ? -26.101 24.131  24.891  1.00 46.34 ?  28  ASN C CB    1 
ATOM   4509 C  CG    . ASN C 3 28  ? -26.929 24.437  26.112  1.00 48.29 ?  28  ASN C CG    1 
ATOM   4510 O  OD1   . ASN C 3 28  ? -26.391 24.788  27.170  1.00 49.38 ?  28  ASN C OD1   1 
ATOM   4511 N  ND2   . ASN C 3 28  ? -28.243 24.331  25.979  1.00 48.81 ?  28  ASN C ND2   1 
ATOM   4512 N  N     . ILE C 3 29  ? -22.958 23.269  24.445  1.00 41.09 ?  29  ILE C N     1 
ATOM   4513 C  CA    . ILE C 3 29  ? -21.950 22.627  23.582  1.00 39.89 ?  29  ILE C CA    1 
ATOM   4514 C  C     . ILE C 3 29  ? -22.232 21.154  23.365  1.00 40.01 ?  29  ILE C C     1 
ATOM   4515 O  O     . ILE C 3 29  ? -21.430 20.461  22.727  1.00 37.83 ?  29  ILE C O     1 
ATOM   4516 C  CB    . ILE C 3 29  ? -20.489 22.780  24.133  1.00 38.86 ?  29  ILE C CB    1 
ATOM   4517 C  CG1   . ILE C 3 29  ? -20.276 21.975  25.416  1.00 38.06 ?  29  ILE C CG1   1 
ATOM   4518 C  CG2   . ILE C 3 29  ? -20.136 24.234  24.323  1.00 39.22 ?  29  ILE C CG2   1 
ATOM   4519 C  CD1   . ILE C 3 29  ? -18.844 21.950  25.912  1.00 37.99 ?  29  ILE C CD1   1 
ATOM   4520 N  N     . PHE C 3 30  ? -23.364 20.675  23.874  1.00 42.48 ?  30  PHE C N     1 
ATOM   4521 C  CA    . PHE C 3 30  ? -23.661 19.244  23.789  1.00 44.72 ?  30  PHE C CA    1 
ATOM   4522 C  C     . PHE C 3 30  ? -23.745 18.784  22.347  1.00 42.71 ?  30  PHE C C     1 
ATOM   4523 O  O     . PHE C 3 30  ? -23.444 17.633  22.037  1.00 44.43 ?  30  PHE C O     1 
ATOM   4524 C  CB    . PHE C 3 30  ? -24.980 18.907  24.539  1.00 48.24 ?  30  PHE C CB    1 
ATOM   4525 C  CG    . PHE C 3 30  ? -26.203 19.570  23.959  1.00 51.51 ?  30  PHE C CG    1 
ATOM   4526 C  CD1   . PHE C 3 30  ? -26.674 20.772  24.478  1.00 52.53 ?  30  PHE C CD1   1 
ATOM   4527 C  CD2   . PHE C 3 30  ? -26.885 18.997  22.889  1.00 52.99 ?  30  PHE C CD2   1 
ATOM   4528 C  CE1   . PHE C 3 30  ? -27.782 21.392  23.935  1.00 53.10 ?  30  PHE C CE1   1 
ATOM   4529 C  CE2   . PHE C 3 30  ? -27.999 19.621  22.335  1.00 53.70 ?  30  PHE C CE2   1 
ATOM   4530 C  CZ    . PHE C 3 30  ? -28.444 20.822  22.865  1.00 53.83 ?  30  PHE C CZ    1 
ATOM   4531 N  N     . SER C 3 31  ? -24.170 19.680  21.469  1.00 40.02 ?  31  SER C N     1 
ATOM   4532 C  CA    . SER C 3 31  ? -24.371 19.364  20.071  1.00 38.29 ?  31  SER C CA    1 
ATOM   4533 C  C     . SER C 3 31  ? -23.095 19.417  19.259  1.00 33.05 ?  31  SER C C     1 
ATOM   4534 O  O     . SER C 3 31  ? -23.138 19.211  18.044  1.00 33.78 ?  31  SER C O     1 
ATOM   4535 C  CB    . SER C 3 31  ? -25.386 20.326  19.428  1.00 41.18 ?  31  SER C CB    1 
ATOM   4536 O  OG    . SER C 3 31  ? -24.772 21.578  19.074  1.00 43.08 ?  31  SER C OG    1 
ATOM   4537 N  N     . PHE C 3 32  ? -21.953 19.729  19.871  1.00 28.77 ?  32  PHE C N     1 
ATOM   4538 C  CA    . PHE C 3 32  ? -20.725 19.740  19.070  1.00 23.76 ?  32  PHE C CA    1 
ATOM   4539 C  C     . PHE C 3 32  ? -20.130 18.326  18.958  1.00 21.18 ?  32  PHE C C     1 
ATOM   4540 O  O     . PHE C 3 32  ? -19.762 17.685  19.943  1.00 21.97 ?  32  PHE C O     1 
ATOM   4541 C  CB    . PHE C 3 32  ? -19.722 20.757  19.653  1.00 24.06 ?  32  PHE C CB    1 
ATOM   4542 C  CG    . PHE C 3 32  ? -20.116 22.198  19.390  1.00 25.28 ?  32  PHE C CG    1 
ATOM   4543 C  CD1   . PHE C 3 32  ? -20.319 22.623  18.079  1.00 26.61 ?  32  PHE C CD1   1 
ATOM   4544 C  CD2   . PHE C 3 32  ? -20.292 23.099  20.409  1.00 28.24 ?  32  PHE C CD2   1 
ATOM   4545 C  CE1   . PHE C 3 32  ? -20.706 23.943  17.792  1.00 29.08 ?  32  PHE C CE1   1 
ATOM   4546 C  CE2   . PHE C 3 32  ? -20.695 24.408  20.147  1.00 29.13 ?  32  PHE C CE2   1 
ATOM   4547 C  CZ    . PHE C 3 32  ? -20.901 24.824  18.820  1.00 29.78 ?  32  PHE C CZ    1 
ATOM   4548 N  N     . ASN C 3 33  ? -20.057 17.814  17.739  1.00 17.10 ?  33  ASN C N     1 
ATOM   4549 C  CA    . ASN C 3 33  ? -19.428 16.498  17.510  1.00 15.03 ?  33  ASN C CA    1 
ATOM   4550 C  C     . ASN C 3 33  ? -18.027 16.418  18.105  1.00 15.02 ?  33  ASN C C     1 
ATOM   4551 O  O     . ASN C 3 33  ? -17.657 15.403  18.688  1.00 16.15 ?  33  ASN C O     1 
ATOM   4552 C  CB    . ASN C 3 33  ? -19.327 16.233  15.984  1.00 15.69 ?  33  ASN C CB    1 
ATOM   4553 C  CG    . ASN C 3 33  ? -20.708 16.194  15.352  1.00 17.15 ?  33  ASN C CG    1 
ATOM   4554 O  OD1   . ASN C 3 33  ? -21.411 17.231  15.288  1.00 18.25 ?  33  ASN C OD1   1 
ATOM   4555 N  ND2   . ASN C 3 33  ? -21.129 15.007  14.946  1.00 18.16 ?  33  ASN C ND2   1 
ATOM   4556 N  N     . VAL C 3 34  ? -17.260 17.490  17.918  1.00 14.50 ?  34  VAL C N     1 
ATOM   4557 C  CA    . VAL C 3 34  ? -15.883 17.510  18.378  1.00 15.23 ?  34  VAL C CA    1 
ATOM   4558 C  C     . VAL C 3 34  ? -15.549 18.906  18.879  1.00 16.72 ?  34  VAL C C     1 
ATOM   4559 O  O     . VAL C 3 34  ? -15.991 19.889  18.315  1.00 18.55 ?  34  VAL C O     1 
ATOM   4560 C  CB    . VAL C 3 34  ? -14.891 17.130  17.222  1.00 17.72 ?  34  VAL C CB    1 
ATOM   4561 C  CG1   . VAL C 3 34  ? -13.430 17.243  17.687  1.00 19.10 ?  34  VAL C CG1   1 
ATOM   4562 C  CG2   . VAL C 3 34  ? -15.180 15.775  16.656  1.00 18.85 ?  34  VAL C CG2   1 
ATOM   4563 N  N     . MET C 3 35  ? -14.811 18.989  19.974  1.00 17.68 ?  35  MET C N     1 
ATOM   4564 C  CA    . MET C 3 35  ? -14.223 20.260  20.386  1.00 19.15 ?  35  MET C CA    1 
ATOM   4565 C  C     . MET C 3 35  ? -12.742 20.009  20.463  1.00 18.48 ?  35  MET C C     1 
ATOM   4566 O  O     . MET C 3 35  ? -12.285 18.904  20.713  1.00 19.18 ?  35  MET C O     1 
ATOM   4567 C  CB    . MET C 3 35  ? -14.796 20.780  21.711  1.00 22.96 ?  35  MET C CB    1 
ATOM   4568 C  CG    . MET C 3 35  ? -16.313 21.116  21.569  1.00 26.91 ?  35  MET C CG    1 
ATOM   4569 S  SD    . MET C 3 35  ? -17.019 21.747  22.994  1.00 34.55 ?  35  MET C SD    1 
ATOM   4570 C  CE    . MET C 3 35  ? -16.610 23.491  22.802  1.00 34.67 ?  35  MET C CE    1 
ATOM   4571 N  N     . GLY C 3 36  ? -11.956 21.040  20.248  1.00 18.90 ?  36  GLY C N     1 
ATOM   4572 C  CA    . GLY C 3 36  ? -10.524 20.804  20.269  1.00 19.19 ?  36  GLY C CA    1 
ATOM   4573 C  C     . GLY C 3 36  ? -9.706  22.063  20.399  1.00 19.91 ?  36  GLY C C     1 
ATOM   4574 O  O     . GLY C 3 36  ? -10.235 23.156  20.523  1.00 22.49 ?  36  GLY C O     1 
ATOM   4575 N  N     . TRP C 3 37  ? -8.400  21.878  20.421  1.00 18.95 ?  37  TRP C N     1 
ATOM   4576 C  CA    . TRP C 3 37  ? -7.436  22.967  20.525  1.00 19.54 ?  37  TRP C CA    1 
ATOM   4577 C  C     . TRP C 3 37  ? -6.481  22.876  19.349  1.00 20.61 ?  37  TRP C C     1 
ATOM   4578 O  O     . TRP C 3 37  ? -6.006  21.784  19.032  1.00 21.34 ?  37  TRP C O     1 
ATOM   4579 C  CB    . TRP C 3 37  ? -6.660  22.889  21.829  1.00 21.45 ?  37  TRP C CB    1 
ATOM   4580 C  CG    . TRP C 3 37  ? -7.536  23.174  23.019  1.00 23.54 ?  37  TRP C CG    1 
ATOM   4581 C  CD1   . TRP C 3 37  ? -8.283  22.261  23.751  1.00 23.82 ?  37  TRP C CD1   1 
ATOM   4582 C  CD2   . TRP C 3 37  ? -7.769  24.456  23.605  1.00 24.11 ?  37  TRP C CD2   1 
ATOM   4583 N  NE1   . TRP C 3 37  ? -8.934  22.917  24.779  1.00 24.29 ?  37  TRP C NE1   1 
ATOM   4584 C  CE2   . TRP C 3 37  ? -8.639  24.258  24.714  1.00 25.64 ?  37  TRP C CE2   1 
ATOM   4585 C  CE3   . TRP C 3 37  ? -7.313  25.760  23.317  1.00 25.40 ?  37  TRP C CE3   1 
ATOM   4586 C  CZ2   . TRP C 3 37  ? -9.090  25.320  25.515  1.00 27.00 ?  37  TRP C CZ2   1 
ATOM   4587 C  CZ3   . TRP C 3 37  ? -7.732  26.810  24.129  1.00 27.51 ?  37  TRP C CZ3   1 
ATOM   4588 C  CH2   . TRP C 3 37  ? -8.613  26.585  25.217  1.00 27.80 ?  37  TRP C CH2   1 
ATOM   4589 N  N     . TYR C 3 38  ? -6.234  24.034  18.735  1.00 21.07 ?  38  TYR C N     1 
ATOM   4590 C  CA    . TYR C 3 38  ? -5.267  24.218  17.659  1.00 21.79 ?  38  TYR C CA    1 
ATOM   4591 C  C     . TYR C 3 38  ? -4.225  25.220  18.113  1.00 24.57 ?  38  TYR C C     1 
ATOM   4592 O  O     . TYR C 3 38  ? -4.475  26.024  19.007  1.00 25.32 ?  38  TYR C O     1 
ATOM   4593 C  CB    . TYR C 3 38  ? -5.958  24.724  16.380  1.00 20.59 ?  38  TYR C CB    1 
ATOM   4594 C  CG    . TYR C 3 38  ? -6.744  23.647  15.674  1.00 19.98 ?  38  TYR C CG    1 
ATOM   4595 C  CD1   . TYR C 3 38  ? -7.948  23.152  16.207  1.00 19.93 ?  38  TYR C CD1   1 
ATOM   4596 C  CD2   . TYR C 3 38  ? -6.307  23.114  14.456  1.00 20.29 ?  38  TYR C CD2   1 
ATOM   4597 C  CE1   . TYR C 3 38  ? -8.667  22.147  15.569  1.00 20.27 ?  38  TYR C CE1   1 
ATOM   4598 C  CE2   . TYR C 3 38  ? -7.028  22.080  13.826  1.00 21.30 ?  38  TYR C CE2   1 
ATOM   4599 C  CZ    . TYR C 3 38  ? -8.202  21.619  14.361  1.00 20.71 ?  38  TYR C CZ    1 
ATOM   4600 O  OH    . TYR C 3 38  ? -8.901  20.617  13.739  1.00 22.05 ?  38  TYR C OH    1 
ATOM   4601 N  N     . ARG C 3 39  ? -3.078  25.240  17.454  1.00 24.88 ?  39  ARG C N     1 
ATOM   4602 C  CA    . ARG C 3 39  ? -2.123  26.267  17.788  1.00 25.94 ?  39  ARG C CA    1 
ATOM   4603 C  C     . ARG C 3 39  ? -1.467  26.791  16.527  1.00 27.16 ?  39  ARG C C     1 
ATOM   4604 O  O     . ARG C 3 39  ? -1.344  26.058  15.523  1.00 27.47 ?  39  ARG C O     1 
ATOM   4605 C  CB    . ARG C 3 39  ? -1.054  25.736  18.758  1.00 26.63 ?  39  ARG C CB    1 
ATOM   4606 C  CG    . ARG C 3 39  ? -0.099  24.692  18.174  1.00 28.08 ?  39  ARG C CG    1 
ATOM   4607 C  CD    . ARG C 3 39  ? 0.768   24.161  19.305  1.00 29.60 ?  39  ARG C CD    1 
ATOM   4608 N  NE    . ARG C 3 39  ? 1.690   23.130  18.880  1.00 31.22 ?  39  ARG C NE    1 
ATOM   4609 C  CZ    . ARG C 3 39  ? 2.536   22.482  19.700  1.00 32.90 ?  39  ARG C CZ    1 
ATOM   4610 N  NH1   . ARG C 3 39  ? 2.521   22.693  21.026  1.00 32.73 ?  39  ARG C NH1   1 
ATOM   4611 N  NH2   . ARG C 3 39  ? 3.378   21.580  19.183  1.00 34.37 ?  39  ARG C NH2   1 
ATOM   4612 N  N     . GLN C 3 40  ? -1.107  28.071  16.548  1.00 28.57 ?  40  GLN C N     1 
ATOM   4613 C  CA    . GLN C 3 40  ? -0.419  28.695  15.404  1.00 32.09 ?  40  GLN C CA    1 
ATOM   4614 C  C     . GLN C 3 40  ? 0.795   29.448  15.900  1.00 33.18 ?  40  GLN C C     1 
ATOM   4615 O  O     . GLN C 3 40  ? 0.647   30.445  16.606  1.00 33.52 ?  40  GLN C O     1 
ATOM   4616 C  CB    . GLN C 3 40  ? -1.384  29.627  14.659  1.00 34.39 ?  40  GLN C CB    1 
ATOM   4617 C  CG    . GLN C 3 40  ? -0.950  30.010  13.261  1.00 36.99 ?  40  GLN C CG    1 
ATOM   4618 C  CD    . GLN C 3 40  ? -0.155  31.263  13.291  1.00 40.27 ?  40  GLN C CD    1 
ATOM   4619 O  OE1   . GLN C 3 40  ? -0.447  32.168  14.085  1.00 42.15 ?  40  GLN C OE1   1 
ATOM   4620 N  NE2   . GLN C 3 40  ? 0.816   31.365  12.415  1.00 40.69 ?  40  GLN C NE2   1 
ATOM   4621 N  N     . ALA C 3 41  ? 1.976   28.959  15.506  1.00 33.54 ?  41  ALA C N     1 
ATOM   4622 C  CA    . ALA C 3 41  ? 3.270   29.580  15.831  1.00 35.59 ?  41  ALA C CA    1 
ATOM   4623 C  C     . ALA C 3 41  ? 3.657   30.524  14.690  1.00 36.24 ?  41  ALA C C     1 
ATOM   4624 O  O     . ALA C 3 41  ? 3.162   30.379  13.569  1.00 34.84 ?  41  ALA C O     1 
ATOM   4625 C  CB    . ALA C 3 41  ? 4.338   28.502  16.039  1.00 36.16 ?  41  ALA C CB    1 
ATOM   4626 N  N     . PRO C 3 42  ? 4.558   31.483  14.953  1.00 37.54 ?  42  PRO C N     1 
ATOM   4627 C  CA    . PRO C 3 42  ? 5.009   32.470  13.967  1.00 37.66 ?  42  PRO C CA    1 
ATOM   4628 C  C     . PRO C 3 42  ? 5.388   31.883  12.615  1.00 35.69 ?  42  PRO C C     1 
ATOM   4629 O  O     . PRO C 3 42  ? 6.246   30.998  12.587  1.00 36.40 ?  42  PRO C O     1 
ATOM   4630 C  CB    . PRO C 3 42  ? 6.230   33.089  14.652  1.00 38.59 ?  42  PRO C CB    1 
ATOM   4631 C  CG    . PRO C 3 42  ? 5.844   33.067  16.112  1.00 39.09 ?  42  PRO C CG    1 
ATOM   4632 C  CD    . PRO C 3 42  ? 5.074   31.794  16.305  1.00 38.43 ?  42  PRO C CD    1 
ATOM   4633 N  N     . GLY C 3 43  ? 4.726   32.323  11.535  1.00 34.39 ?  43  GLY C N     1 
ATOM   4634 C  CA    . GLY C 3 43  ? 5.095   31.915  10.193  1.00 32.62 ?  43  GLY C CA    1 
ATOM   4635 C  C     . GLY C 3 43  ? 4.695   30.490  9.886   1.00 32.45 ?  43  GLY C C     1 
ATOM   4636 O  O     . GLY C 3 43  ? 5.151   29.919  8.916   1.00 31.82 ?  43  GLY C O     1 
ATOM   4637 N  N     . LYS C 3 44  ? 3.850   29.894  10.717  1.00 33.65 ?  44  LYS C N     1 
ATOM   4638 C  CA    . LYS C 3 44  ? 3.459   28.507  10.469  1.00 36.21 ?  44  LYS C CA    1 
ATOM   4639 C  C     . LYS C 3 44  ? 1.959   28.408  10.344  1.00 35.01 ?  44  LYS C C     1 
ATOM   4640 O  O     . LYS C 3 44  ? 1.228   29.288  10.797  1.00 33.27 ?  44  LYS C O     1 
ATOM   4641 C  CB    . LYS C 3 44  ? 3.978   27.570  11.588  1.00 40.95 ?  44  LYS C CB    1 
ATOM   4642 C  CG    . LYS C 3 44  ? 4.675   26.298  11.034  1.00 44.81 ?  44  LYS C CG    1 
ATOM   4643 C  CD    . LYS C 3 44  ? 3.744   25.595  10.020  1.00 47.22 ?  44  LYS C CD    1 
ATOM   4644 C  CE    . LYS C 3 44  ? 4.354   24.451  9.247   1.00 48.83 ?  44  LYS C CE    1 
ATOM   4645 N  NZ    . LYS C 3 44  ? 3.481   24.184  8.065   1.00 49.67 ?  44  LYS C NZ    1 
ATOM   4646 N  N     . GLN C 3 45  ? 1.522   27.334  9.695   1.00 36.75 ?  45  GLN C N     1 
ATOM   4647 C  CA    . GLN C 3 45  ? 0.129   26.970  9.609   1.00 38.20 ?  45  GLN C CA    1 
ATOM   4648 C  C     . GLN C 3 45  ? -0.392  26.457  10.941  1.00 36.01 ?  45  GLN C C     1 
ATOM   4649 O  O     . GLN C 3 45  ? 0.274   25.750  11.696  1.00 35.84 ?  45  GLN C O     1 
ATOM   4650 C  CB    . GLN C 3 45  ? -0.106  25.905  8.525   1.00 42.07 ?  45  GLN C CB    1 
ATOM   4651 C  CG    . GLN C 3 45  ? 0.683   26.087  7.216   1.00 45.79 ?  45  GLN C CG    1 
ATOM   4652 C  CD    . GLN C 3 45  ? 0.327   27.368  6.472   1.00 48.09 ?  45  GLN C CD    1 
ATOM   4653 O  OE1   . GLN C 3 45  ? -0.642  28.066  6.831   1.00 49.17 ?  45  GLN C OE1   1 
ATOM   4654 N  NE2   . GLN C 3 45  ? 1.124   27.701  5.443   1.00 48.77 ?  45  GLN C NE2   1 
ATOM   4655 N  N     . ARG C 3 46  ? -1.633  26.817  11.180  1.00 33.90 ?  46  ARG C N     1 
ATOM   4656 C  CA    . ARG C 3 46  ? -2.377  26.354  12.314  1.00 32.53 ?  46  ARG C CA    1 
ATOM   4657 C  C     . ARG C 3 46  ? -2.427  24.804  12.344  1.00 31.35 ?  46  ARG C C     1 
ATOM   4658 O  O     . ARG C 3 46  ? -2.677  24.172  11.285  1.00 32.41 ?  46  ARG C O     1 
ATOM   4659 C  CB    . ARG C 3 46  ? -3.756  26.994  12.225  1.00 32.90 ?  46  ARG C CB    1 
ATOM   4660 C  CG    . ARG C 3 46  ? -4.583  26.823  13.467  1.00 32.38 ?  46  ARG C CG    1 
ATOM   4661 C  CD    . ARG C 3 46  ? -5.976  27.448  13.294  1.00 32.70 ?  46  ARG C CD    1 
ATOM   4662 N  NE    . ARG C 3 46  ? -5.891  28.898  13.199  1.00 33.20 ?  46  ARG C NE    1 
ATOM   4663 C  CZ    . ARG C 3 46  ? -6.884  29.736  13.485  1.00 34.22 ?  46  ARG C CZ    1 
ATOM   4664 N  NH1   . ARG C 3 46  ? -8.058  29.270  13.908  1.00 34.64 ?  46  ARG C NH1   1 
ATOM   4665 N  NH2   . ARG C 3 46  ? -6.685  31.040  13.387  1.00 35.18 ?  46  ARG C NH2   1 
ATOM   4666 N  N     . GLU C 3 47  ? -2.194  24.185  13.525  1.00 28.97 ?  47  GLU C N     1 
ATOM   4667 C  CA    . GLU C 3 47  ? -2.146  22.719  13.605  1.00 28.63 ?  47  GLU C CA    1 
ATOM   4668 C  C     . GLU C 3 47  ? -2.935  22.184  14.769  1.00 25.48 ?  47  GLU C C     1 
ATOM   4669 O  O     . GLU C 3 47  ? -3.033  22.851  15.813  1.00 25.63 ?  47  GLU C O     1 
ATOM   4670 C  CB    . GLU C 3 47  ? -0.701  22.196  13.715  1.00 30.89 ?  47  GLU C CB    1 
ATOM   4671 C  CG    . GLU C 3 47  ? -0.013  22.586  15.001  1.00 34.56 ?  47  GLU C CG    1 
ATOM   4672 C  CD    . GLU C 3 47  ? 1.479   22.306  14.994  1.00 38.35 ?  47  GLU C CD    1 
ATOM   4673 O  OE1   . GLU C 3 47  ? 2.069   22.356  13.891  1.00 40.60 ?  47  GLU C OE1   1 
ATOM   4674 O  OE2   . GLU C 3 47  ? 2.066   22.059  16.086  1.00 39.78 ?  47  GLU C OE2   1 
ATOM   4675 N  N     . LEU C 3 48  ? -3.505  20.990  14.590  1.00 23.61 ?  48  LEU C N     1 
ATOM   4676 C  CA    . LEU C 3 48  ? -4.257  20.320  15.668  1.00 22.35 ?  48  LEU C CA    1 
ATOM   4677 C  C     . LEU C 3 48  ? -3.358  19.983  16.848  1.00 23.33 ?  48  LEU C C     1 
ATOM   4678 O  O     . LEU C 3 48  ? -2.281  19.431  16.670  1.00 25.70 ?  48  LEU C O     1 
ATOM   4679 C  CB    . LEU C 3 48  ? -4.912  19.035  15.147  1.00 22.64 ?  48  LEU C CB    1 
ATOM   4680 C  CG    . LEU C 3 48  ? -5.690  18.213  16.197  1.00 23.45 ?  48  LEU C CG    1 
ATOM   4681 C  CD1   . LEU C 3 48  ? -6.901  18.983  16.768  1.00 24.84 ?  48  LEU C CD1   1 
ATOM   4682 C  CD2   . LEU C 3 48  ? -6.102  16.880  15.569  1.00 25.59 ?  48  LEU C CD2   1 
ATOM   4683 N  N     . VAL C 3 49  ? -3.818  20.286  18.056  1.00 22.21 ?  49  VAL C N     1 
ATOM   4684 C  CA    . VAL C 3 49  ? -3.119  19.871  19.252  1.00 22.69 ?  49  VAL C CA    1 
ATOM   4685 C  C     . VAL C 3 49  ? -3.871  18.721  19.927  1.00 22.51 ?  49  VAL C C     1 
ATOM   4686 O  O     . VAL C 3 49  ? -3.267  17.691  20.251  1.00 23.79 ?  49  VAL C O     1 
ATOM   4687 C  CB    . VAL C 3 49  ? -2.959  21.065  20.249  1.00 24.09 ?  49  VAL C CB    1 
ATOM   4688 C  CG1   . VAL C 3 49  ? -2.298  20.581  21.527  1.00 26.48 ?  49  VAL C CG1   1 
ATOM   4689 C  CG2   . VAL C 3 49  ? -2.116  22.203  19.621  1.00 24.62 ?  49  VAL C CG2   1 
ATOM   4690 N  N     . ALA C 3 50  ? -5.185  18.884  20.150  1.00 20.06 ?  50  ALA C N     1 
ATOM   4691 C  CA    . ALA C 3 50  ? -5.927  17.851  20.854  1.00 20.30 ?  50  ALA C CA    1 
ATOM   4692 C  C     . ALA C 3 50  ? -7.398  18.002  20.516  1.00 19.12 ?  50  ALA C C     1 
ATOM   4693 O  O     . ALA C 3 50  ? -7.857  19.110  20.253  1.00 20.21 ?  50  ALA C O     1 
ATOM   4694 C  CB    . ALA C 3 50  ? -5.751  17.992  22.374  1.00 21.54 ?  50  ALA C CB    1 
ATOM   4695 N  N     . ALA C 3 51  ? -8.150  16.908  20.588  1.00 17.18 ?  51  ALA C N     1 
ATOM   4696 C  CA    . ALA C 3 51  ? -9.589  16.990  20.335  1.00 16.69 ?  51  ALA C CA    1 
ATOM   4697 C  C     . ALA C 3 51  ? -10.307 15.963  21.158  1.00 16.94 ?  51  ALA C C     1 
ATOM   4698 O  O     . ALA C 3 51  ? -9.723  14.967  21.583  1.00 17.86 ?  51  ALA C O     1 
ATOM   4699 C  CB    . ALA C 3 51  ? -9.882  16.783  18.864  1.00 18.05 ?  51  ALA C CB    1 
ATOM   4700 N  N     . ILE C 3 52  ? -11.615 16.182  21.313  1.00 16.55 ?  52  ILE C N     1 
ATOM   4701 C  CA    . ILE C 3 52  ? -12.407 15.282  22.140  1.00 15.98 ?  52  ILE C CA    1 
ATOM   4702 C  C     . ILE C 3 52  ? -13.838 15.237  21.610  1.00 16.18 ?  52  ILE C C     1 
ATOM   4703 O  O     . ILE C 3 52  ? -14.449 16.290  21.289  1.00 17.79 ?  52  ILE C O     1 
ATOM   4704 C  CB    . ILE C 3 52  ? -12.365 15.723  23.624  1.00 17.20 ?  52  ILE C CB    1 
ATOM   4705 C  CG1   . ILE C 3 52  ? -13.064 14.682  24.537  1.00 17.73 ?  52  ILE C CG1   1 
ATOM   4706 C  CG2   . ILE C 3 52  ? -12.938 17.165  23.817  1.00 18.37 ?  52  ILE C CG2   1 
ATOM   4707 C  CD1   . ILE C 3 52  ? -12.750 14.973  26.026  1.00 19.54 ?  52  ILE C CD1   1 
ATOM   4708 N  N     . THR C 3 53  ? -14.399 14.028  21.538  1.00 15.36 ?  53  THR C N     1 
ATOM   4709 C  CA    . THR C 3 53  ? -15.774 13.889  21.101  1.00 15.03 ?  53  THR C CA    1 
ATOM   4710 C  C     . THR C 3 53  ? -16.748 14.209  22.278  1.00 17.06 ?  53  THR C C     1 
ATOM   4711 O  O     . THR C 3 53  ? -16.345 14.393  23.468  1.00 18.73 ?  53  THR C O     1 
ATOM   4712 C  CB    . THR C 3 53  ? -16.082 12.462  20.615  1.00 15.36 ?  53  THR C CB    1 
ATOM   4713 O  OG1   . THR C 3 53  ? -16.003 11.518  21.702  1.00 16.12 ?  53  THR C OG1   1 
ATOM   4714 C  CG2   . THR C 3 53  ? -15.122 12.058  19.458  1.00 16.31 ?  53  THR C CG2   1 
ATOM   4715 N  N     A SER C 3 54  ? -18.042 14.261  21.969  0.52 17.00 ?  54  SER C N     1 
ATOM   4716 N  N     B SER C 3 54  ? -18.046 14.230  21.963  0.48 17.16 ?  54  SER C N     1 
ATOM   4717 C  CA    A SER C 3 54  ? -19.010 14.518  23.031  0.52 18.35 ?  54  SER C CA    1 
ATOM   4718 C  CA    B SER C 3 54  ? -19.059 14.489  22.992  0.48 18.66 ?  54  SER C CA    1 
ATOM   4719 C  C     A SER C 3 54  ? -18.992 13.385  24.061  0.52 18.67 ?  54  SER C C     1 
ATOM   4720 C  C     B SER C 3 54  ? -19.239 13.318  23.958  0.48 18.75 ?  54  SER C C     1 
ATOM   4721 O  O     A SER C 3 54  ? -19.179 13.638  25.274  0.52 19.73 ?  54  SER C O     1 
ATOM   4722 O  O     B SER C 3 54  ? -19.887 13.467  25.020  0.48 20.13 ?  54  SER C O     1 
ATOM   4723 C  CB    A SER C 3 54  ? -20.386 14.719  22.438  0.52 19.50 ?  54  SER C CB    1 
ATOM   4724 C  CB    B SER C 3 54  ? -20.382 14.828  22.339  0.48 20.31 ?  54  SER C CB    1 
ATOM   4725 O  OG    A SER C 3 54  ? -21.264 15.343  23.359  0.52 20.60 ?  54  SER C OG    1 
ATOM   4726 O  OG    B SER C 3 54  ? -21.023 13.639  21.897  0.48 21.72 ?  54  SER C OG    1 
ATOM   4727 N  N     . GLY C 3 55  ? -18.643 12.185  23.601  1.00 18.76 ?  55  GLY C N     1 
ATOM   4728 C  CA    . GLY C 3 55  ? -18.560 11.000  24.459  1.00 19.12 ?  55  GLY C CA    1 
ATOM   4729 C  C     . GLY C 3 55  ? -17.178 10.740  25.063  1.00 20.22 ?  55  GLY C C     1 
ATOM   4730 O  O     . GLY C 3 55  ? -16.908 9.616   25.531  1.00 19.50 ?  55  GLY C O     1 
ATOM   4731 N  N     . ASP C 3 56  ? -16.313 11.766  25.057  1.00 19.20 ?  56  ASP C N     1 
ATOM   4732 C  CA    . ASP C 3 56  ? -15.030 11.808  25.805  1.00 18.62 ?  56  ASP C CA    1 
ATOM   4733 C  C     . ASP C 3 56  ? -13.888 10.974  25.217  1.00 18.98 ?  56  ASP C C     1 
ATOM   4734 O  O     . ASP C 3 56  ? -12.902 10.750  25.875  1.00 19.93 ?  56  ASP C O     1 
ATOM   4735 C  CB    . ASP C 3 56  ? -15.244 11.388  27.266  1.00 19.30 ?  56  ASP C CB    1 
ATOM   4736 C  CG    . ASP C 3 56  ? -16.096 12.378  28.035  1.00 22.86 ?  56  ASP C CG    1 
ATOM   4737 O  OD1   . ASP C 3 56  ? -15.885 13.587  27.871  1.00 24.91 ?  56  ASP C OD1   1 
ATOM   4738 O  OD2   . ASP C 3 56  ? -17.023 11.943  28.767  1.00 24.33 ?  56  ASP C OD2   1 
ATOM   4739 N  N     . THR C 3 57  ? -13.991 10.574  23.953  1.00 18.11 ?  57  THR C N     1 
ATOM   4740 C  CA    . THR C 3 57  ? -12.858 9.969   23.269  1.00 17.46 ?  57  THR C CA    1 
ATOM   4741 C  C     . THR C 3 57  ? -11.912 11.046  22.805  1.00 16.74 ?  57  THR C C     1 
ATOM   4742 O  O     . THR C 3 57  ? -12.361 12.009  22.183  1.00 17.50 ?  57  THR C O     1 
ATOM   4743 C  CB    . THR C 3 57  ? -13.328 9.157   22.076  1.00 19.23 ?  57  THR C CB    1 
ATOM   4744 O  OG1   . THR C 3 57  ? -14.048 8.020   22.604  1.00 20.40 ?  57  THR C OG1   1 
ATOM   4745 C  CG2   . THR C 3 57  ? -12.145 8.723   21.204  1.00 18.79 ?  57  THR C CG2   1 
ATOM   4746 N  N     . THR C 3 58  ? -10.612 10.912  23.125  1.00 17.15 ?  58  THR C N     1 
ATOM   4747 C  CA    . THR C 3 58  ? -9.614  11.961  22.863  1.00 17.10 ?  58  THR C CA    1 
ATOM   4748 C  C     . THR C 3 58  ? -8.609  11.532  21.840  1.00 17.38 ?  58  THR C C     1 
ATOM   4749 O  O     . THR C 3 58  ? -8.381  10.336  21.611  1.00 18.30 ?  58  THR C O     1 
ATOM   4750 C  CB    . THR C 3 58  ? -8.856  12.346  24.160  1.00 18.92 ?  58  THR C CB    1 
ATOM   4751 O  OG1   . THR C 3 58  ? -8.241  11.150  24.626  1.00 20.99 ?  58  THR C OG1   1 
ATOM   4752 C  CG2   . THR C 3 58  ? -9.849  12.831  25.215  1.00 19.42 ?  58  THR C CG2   1 
ATOM   4753 N  N     . THR C 3 59  ? -7.988  12.523  21.227  1.00 17.34 ?  59  THR C N     1 
ATOM   4754 C  CA    . THR C 3 59  ? -6.813  12.269  20.411  1.00 18.09 ?  59  THR C CA    1 
ATOM   4755 C  C     . THR C 3 59  ? -5.875  13.468  20.478  1.00 19.54 ?  59  THR C C     1 
ATOM   4756 O  O     . THR C 3 59  ? -6.289  14.565  20.855  1.00 19.48 ?  59  THR C O     1 
ATOM   4757 C  CB    . THR C 3 59  ? -7.217  11.965  18.958  1.00 19.71 ?  59  THR C CB    1 
ATOM   4758 O  OG1   . THR C 3 59  ? -6.124  11.300  18.326  1.00 23.41 ?  59  THR C OG1   1 
ATOM   4759 C  CG2   . THR C 3 59  ? -7.638  13.225  18.204  1.00 19.80 ?  59  THR C CG2   1 
ATOM   4760 N  N     . TYR C 3 60  ? -4.579  13.221  20.197  1.00 21.22 ?  60  TYR C N     1 
ATOM   4761 C  CA    . TYR C 3 60  ? -3.530  14.205  20.386  1.00 23.02 ?  60  TYR C CA    1 
ATOM   4762 C  C     . TYR C 3 60  ? -2.583  14.153  19.226  1.00 25.62 ?  60  TYR C C     1 
ATOM   4763 O  O     . TYR C 3 60  ? -2.307  13.083  18.680  1.00 27.16 ?  60  TYR C O     1 
ATOM   4764 C  CB    . TYR C 3 60  ? -2.718  13.916  21.671  1.00 23.32 ?  60  TYR C CB    1 
ATOM   4765 C  CG    . TYR C 3 60  ? -3.560  13.959  22.925  1.00 24.41 ?  60  TYR C CG    1 
ATOM   4766 C  CD1   . TYR C 3 60  ? -3.815  15.169  23.554  1.00 25.40 ?  60  TYR C CD1   1 
ATOM   4767 C  CD2   . TYR C 3 60  ? -4.216  12.814  23.397  1.00 25.01 ?  60  TYR C CD2   1 
ATOM   4768 C  CE1   . TYR C 3 60  ? -4.620  15.252  24.661  1.00 24.72 ?  60  TYR C CE1   1 
ATOM   4769 C  CE2   . TYR C 3 60  ? -5.034  12.883  24.529  1.00 25.41 ?  60  TYR C CE2   1 
ATOM   4770 C  CZ    . TYR C 3 60  ? -5.231  14.105  25.137  1.00 25.62 ?  60  TYR C CZ    1 
ATOM   4771 O  OH    . TYR C 3 60  ? -6.028  14.231  26.248  1.00 25.67 ?  60  TYR C OH    1 
ATOM   4772 N  N     . ALA C 3 61  ? -2.059  15.305  18.877  1.00 26.61 ?  61  ALA C N     1 
ATOM   4773 C  CA    . ALA C 3 61  ? -0.937  15.359  17.964  1.00 29.76 ?  61  ALA C CA    1 
ATOM   4774 C  C     . ALA C 3 61  ? 0.237   14.553  18.541  1.00 31.24 ?  61  ALA C C     1 
ATOM   4775 O  O     . ALA C 3 61  ? 0.449   14.537  19.752  1.00 31.44 ?  61  ALA C O     1 
ATOM   4776 C  CB    . ALA C 3 61  ? -0.541  16.803  17.742  1.00 31.04 ?  61  ALA C CB    1 
ATOM   4777 N  N     . ASP C 3 62  ? 0.991   13.876  17.682  1.00 32.76 ?  62  ASP C N     1 
ATOM   4778 C  CA    . ASP C 3 62  ? 2.176   13.115  18.141  1.00 35.40 ?  62  ASP C CA    1 
ATOM   4779 C  C     . ASP C 3 62  ? 3.103   13.939  19.031  1.00 36.88 ?  62  ASP C C     1 
ATOM   4780 O  O     . ASP C 3 62  ? 3.655   13.393  19.977  1.00 38.70 ?  62  ASP C O     1 
ATOM   4781 C  CB    . ASP C 3 62  ? 3.016   12.561  16.961  1.00 38.02 ?  62  ASP C CB    1 
ATOM   4782 C  CG    . ASP C 3 62  ? 2.241   11.554  16.059  1.00 41.41 ?  62  ASP C CG    1 
ATOM   4783 O  OD1   . ASP C 3 62  ? 1.099   11.147  16.359  1.00 42.20 ?  62  ASP C OD1   1 
ATOM   4784 O  OD2   . ASP C 3 62  ? 2.818   11.135  15.035  1.00 43.37 ?  62  ASP C OD2   1 
ATOM   4785 N  N     . SER C 3 63  ? 3.253   15.232  18.754  1.00 35.96 ?  63  SER C N     1 
ATOM   4786 C  CA    . SER C 3 63  ? 4.189   16.048  19.527  1.00 36.91 ?  63  SER C CA    1 
ATOM   4787 C  C     . SER C 3 63  ? 3.790   16.367  20.964  1.00 36.76 ?  63  SER C C     1 
ATOM   4788 O  O     . SER C 3 63  ? 4.636   16.852  21.717  1.00 38.17 ?  63  SER C O     1 
ATOM   4789 C  CB    . SER C 3 63  ? 4.471   17.367  18.800  1.00 38.26 ?  63  SER C CB    1 
ATOM   4790 O  OG    . SER C 3 63  ? 3.302   18.129  18.637  1.00 39.25 ?  63  SER C OG    1 
ATOM   4791 N  N     . VAL C 3 64  ? 2.529   16.111  21.372  1.00 34.47 ?  64  VAL C N     1 
ATOM   4792 C  CA    . VAL C 3 64  ? 2.141   16.475  22.723  1.00 34.92 ?  64  VAL C CA    1 
ATOM   4793 C  C     . VAL C 3 64  ? 1.669   15.272  23.533  1.00 38.93 ?  64  VAL C C     1 
ATOM   4794 O  O     . VAL C 3 64  ? 1.178   15.415  24.671  1.00 38.46 ?  64  VAL C O     1 
ATOM   4795 C  CB    . VAL C 3 64  ? 1.062   17.565  22.694  1.00 34.40 ?  64  VAL C CB    1 
ATOM   4796 C  CG1   . VAL C 3 64  ? 1.578   18.790  21.931  1.00 35.27 ?  64  VAL C CG1   1 
ATOM   4797 C  CG2   . VAL C 3 64  ? -0.213  17.013  22.049  1.00 33.49 ?  64  VAL C CG2   1 
ATOM   4798 N  N     . GLN C 3 65  ? 1.813   14.090  22.949  1.00 42.20 ?  65  GLN C N     1 
ATOM   4799 C  CA    . GLN C 3 65  ? 1.314   12.872  23.563  1.00 43.84 ?  65  GLN C CA    1 
ATOM   4800 C  C     . GLN C 3 65  ? 2.003   12.646  24.909  1.00 43.36 ?  65  GLN C C     1 
ATOM   4801 O  O     . GLN C 3 65  ? 3.221   12.691  25.020  1.00 44.05 ?  65  GLN C O     1 
ATOM   4802 C  CB    . GLN C 3 65  ? 1.515   11.672  22.628  1.00 46.09 ?  65  GLN C CB    1 
ATOM   4803 C  CG    . GLN C 3 65  ? 0.872   10.396  23.118  1.00 47.58 ?  65  GLN C CG    1 
ATOM   4804 C  CD    . GLN C 3 65  ? -0.645  10.488  23.180  1.00 48.59 ?  65  GLN C CD    1 
ATOM   4805 O  OE1   . GLN C 3 65  ? -1.267  11.058  22.314  1.00 48.77 ?  65  GLN C OE1   1 
ATOM   4806 N  NE2   . GLN C 3 65  ? -1.231  9.938   24.220  1.00 49.68 ?  65  GLN C NE2   1 
ATOM   4807 N  N     . GLY C 3 66  ? 1.188   12.425  25.925  1.00 43.23 ?  66  GLY C N     1 
ATOM   4808 C  CA    . GLY C 3 66  ? 1.679   12.236  27.264  1.00 42.95 ?  66  GLY C CA    1 
ATOM   4809 C  C     . GLY C 3 66  ? 1.658   13.499  28.086  1.00 42.74 ?  66  GLY C C     1 
ATOM   4810 O  O     . GLY C 3 66  ? 1.512   13.433  29.310  1.00 45.27 ?  66  GLY C O     1 
ATOM   4811 N  N     . ARG C 3 67  ? 1.845   14.647  27.444  1.00 39.95 ?  67  ARG C N     1 
ATOM   4812 C  CA    . ARG C 3 67  ? 2.095   15.883  28.197  1.00 37.73 ?  67  ARG C CA    1 
ATOM   4813 C  C     . ARG C 3 67  ? 0.855   16.729  28.371  1.00 36.66 ?  67  ARG C C     1 
ATOM   4814 O  O     . ARG C 3 67  ? 0.750   17.493  29.329  1.00 36.33 ?  67  ARG C O     1 
ATOM   4815 C  CB    . ARG C 3 67  ? 3.150   16.738  27.495  1.00 37.77 ?  67  ARG C CB    1 
ATOM   4816 C  CG    . ARG C 3 67  ? 4.444   16.034  27.233  1.00 37.30 ?  67  ARG C CG    1 
ATOM   4817 C  CD    . ARG C 3 67  ? 5.490   17.046  26.725  1.00 37.25 ?  67  ARG C CD    1 
ATOM   4818 N  NE    . ARG C 3 67  ? 5.254   17.401  25.321  1.00 36.69 ?  67  ARG C NE    1 
ATOM   4819 C  CZ    . ARG C 3 67  ? 5.188   18.648  24.858  1.00 36.46 ?  67  ARG C CZ    1 
ATOM   4820 N  NH1   . ARG C 3 67  ? 5.369   19.687  25.676  1.00 36.99 ?  67  ARG C NH1   1 
ATOM   4821 N  NH2   . ARG C 3 67  ? 4.984   18.861  23.567  1.00 36.16 ?  67  ARG C NH2   1 
ATOM   4822 N  N     . PHE C 3 68  ? -0.059  16.616  27.395  1.00 34.90 ?  68  PHE C N     1 
ATOM   4823 C  CA    . PHE C 3 68  ? -1.269  17.433  27.361  1.00 33.83 ?  68  PHE C CA    1 
ATOM   4824 C  C     . PHE C 3 68  ? -2.478  16.551  27.601  1.00 32.34 ?  68  PHE C C     1 
ATOM   4825 O  O     . PHE C 3 68  ? -2.492  15.373  27.222  1.00 33.45 ?  68  PHE C O     1 
ATOM   4826 C  CB    . PHE C 3 68  ? -1.480  18.146  26.004  1.00 32.44 ?  68  PHE C CB    1 
ATOM   4827 C  CG    . PHE C 3 68  ? -0.448  19.217  25.660  1.00 32.50 ?  68  PHE C CG    1 
ATOM   4828 C  CD1   . PHE C 3 68  ? 0.723   19.387  26.385  1.00 33.34 ?  68  PHE C CD1   1 
ATOM   4829 C  CD2   . PHE C 3 68  ? -0.682  20.074  24.598  1.00 33.22 ?  68  PHE C CD2   1 
ATOM   4830 C  CE1   . PHE C 3 68  ? 1.646   20.343  26.018  1.00 34.01 ?  68  PHE C CE1   1 
ATOM   4831 C  CE2   . PHE C 3 68  ? 0.260   21.055  24.222  1.00 33.56 ?  68  PHE C CE2   1 
ATOM   4832 C  CZ    . PHE C 3 68  ? 1.418   21.188  24.961  1.00 34.15 ?  68  PHE C CZ    1 
ATOM   4833 N  N     . THR C 3 69  ? -3.487  17.119  28.246  1.00 30.64 ?  69  THR C N     1 
ATOM   4834 C  CA    . THR C 3 69  ? -4.747  16.403  28.439  1.00 29.87 ?  69  THR C CA    1 
ATOM   4835 C  C     . THR C 3 69  ? -5.909  17.326  28.133  1.00 28.68 ?  69  THR C C     1 
ATOM   4836 O  O     . THR C 3 69  ? -6.027  18.403  28.716  1.00 28.68 ?  69  THR C O     1 
ATOM   4837 C  CB    . THR C 3 69  ? -4.927  15.870  29.864  1.00 31.81 ?  69  THR C CB    1 
ATOM   4838 O  OG1   . THR C 3 69  ? -3.780  15.081  30.251  1.00 34.05 ?  69  THR C OG1   1 
ATOM   4839 C  CG2   . THR C 3 69  ? -6.201  15.022  29.949  1.00 31.11 ?  69  THR C CG2   1 
ATOM   4840 N  N     . ILE C 3 70  ? -6.769  16.898  27.216  1.00 26.07 ?  70  ILE C N     1 
ATOM   4841 C  CA    . ILE C 3 70  ? -7.989  17.644  26.933  1.00 24.22 ?  70  ILE C CA    1 
ATOM   4842 C  C     . ILE C 3 70  ? -9.169  17.032  27.674  1.00 24.88 ?  70  ILE C C     1 
ATOM   4843 O  O     . ILE C 3 70  ? -9.241  15.805  27.836  1.00 25.72 ?  70  ILE C O     1 
ATOM   4844 C  CB    . ILE C 3 70  ? -8.264  17.691  25.404  1.00 23.34 ?  70  ILE C CB    1 
ATOM   4845 C  CG1   . ILE C 3 70  ? -9.414  18.634  25.084  1.00 23.45 ?  70  ILE C CG1   1 
ATOM   4846 C  CG2   . ILE C 3 70  ? -8.468  16.248  24.802  1.00 23.31 ?  70  ILE C CG2   1 
ATOM   4847 C  CD1   . ILE C 3 70  ? -9.595  18.825  23.518  1.00 22.84 ?  70  ILE C CD1   1 
ATOM   4848 N  N     . SER C 3 71  ? -10.088 17.893  28.098  1.00 24.39 ?  71  SER C N     1 
ATOM   4849 C  CA    . SER C 3 71  ? -11.321 17.432  28.768  1.00 26.27 ?  71  SER C CA    1 
ATOM   4850 C  C     . SER C 3 71  ? -12.451 18.387  28.444  1.00 27.45 ?  71  SER C C     1 
ATOM   4851 O  O     . SER C 3 71  ? -12.217 19.510  27.988  1.00 28.47 ?  71  SER C O     1 
ATOM   4852 C  CB    . SER C 3 71  ? -11.125 17.314  30.271  1.00 28.68 ?  71  SER C CB    1 
ATOM   4853 O  OG    . SER C 3 71  ? -10.770 18.568  30.843  1.00 30.59 ?  71  SER C OG    1 
ATOM   4854 N  N     . ARG C 3 72  ? -13.677 17.919  28.655  1.00 27.93 ?  72  ARG C N     1 
ATOM   4855 C  CA    . ARG C 3 72  ? -14.861 18.568  28.131  1.00 29.20 ?  72  ARG C CA    1 
ATOM   4856 C  C     . ARG C 3 72  ? -15.941 18.433  29.159  1.00 31.48 ?  72  ARG C C     1 
ATOM   4857 O  O     . ARG C 3 72  ? -16.138 17.347  29.682  1.00 32.89 ?  72  ARG C O     1 
ATOM   4858 C  CB    . ARG C 3 72  ? -15.282 17.898  26.804  1.00 28.39 ?  72  ARG C CB    1 
ATOM   4859 C  CG    . ARG C 3 72  ? -16.615 18.357  26.257  1.00 28.71 ?  72  ARG C CG    1 
ATOM   4860 C  CD    . ARG C 3 72  ? -16.747 17.843  24.802  1.00 28.27 ?  72  ARG C CD    1 
ATOM   4861 N  NE    . ARG C 3 72  ? -18.034 18.197  24.232  1.00 26.31 ?  72  ARG C NE    1 
ATOM   4862 C  CZ    . ARG C 3 72  ? -18.345 18.078  22.947  1.00 25.05 ?  72  ARG C CZ    1 
ATOM   4863 N  NH1   . ARG C 3 72  ? -17.435 17.581  22.061  1.00 23.03 ?  72  ARG C NH1   1 
ATOM   4864 N  NH2   . ARG C 3 72  ? -19.570 18.436  22.550  1.00 25.72 ?  72  ARG C NH2   1 
ATOM   4865 N  N     . ASP C 3 73  ? -16.624 19.524  29.456  1.00 32.60 ?  73  ASP C N     1 
ATOM   4866 C  CA    . ASP C 3 73  ? -17.791 19.453  30.342  1.00 34.64 ?  73  ASP C CA    1 
ATOM   4867 C  C     . ASP C 3 73  ? -19.056 19.962  29.660  1.00 36.00 ?  73  ASP C C     1 
ATOM   4868 O  O     . ASP C 3 73  ? -19.298 21.169  29.671  1.00 35.99 ?  73  ASP C O     1 
ATOM   4869 C  CB    . ASP C 3 73  ? -17.537 20.287  31.598  1.00 36.14 ?  73  ASP C CB    1 
ATOM   4870 C  CG    . ASP C 3 73  ? -18.573 20.037  32.692  1.00 39.72 ?  73  ASP C CG    1 
ATOM   4871 O  OD1   . ASP C 3 73  ? -18.291 20.416  33.858  1.00 40.69 ?  73  ASP C OD1   1 
ATOM   4872 O  OD2   . ASP C 3 73  ? -19.665 19.490  32.393  1.00 41.55 ?  73  ASP C OD2   1 
ATOM   4873 N  N     . ASN C 3 74  ? -19.878 19.071  29.095  1.00 35.70 ?  74  ASN C N     1 
ATOM   4874 C  CA    . ASN C 3 74  ? -21.080 19.551  28.422  1.00 36.13 ?  74  ASN C CA    1 
ATOM   4875 C  C     . ASN C 3 74  ? -21.990 20.334  29.373  1.00 38.24 ?  74  ASN C C     1 
ATOM   4876 O  O     . ASN C 3 74  ? -22.711 21.212  28.923  1.00 39.16 ?  74  ASN C O     1 
ATOM   4877 C  CB    . ASN C 3 74  ? -21.832 18.397  27.759  1.00 35.32 ?  74  ASN C CB    1 
ATOM   4878 C  CG    . ASN C 3 74  ? -21.093 17.869  26.523  1.00 36.17 ?  74  ASN C CG    1 
ATOM   4879 O  OD1   . ASN C 3 74  ? -20.263 18.580  25.947  1.00 36.02 ?  74  ASN C OD1   1 
ATOM   4880 N  ND2   . ASN C 3 74  ? -21.351 16.619  26.151  1.00 36.57 ?  74  ASN C ND2   1 
ATOM   4881 N  N     . ALA C 3 75  ? -21.929 20.043  30.672  1.00 39.71 ?  75  ALA C N     1 
ATOM   4882 C  CA    . ALA C 3 75  ? -22.764 20.725  31.672  1.00 41.63 ?  75  ALA C CA    1 
ATOM   4883 C  C     . ALA C 3 75  ? -22.301 22.149  32.012  1.00 42.67 ?  75  ALA C C     1 
ATOM   4884 O  O     . ALA C 3 75  ? -23.115 22.987  32.449  1.00 43.42 ?  75  ALA C O     1 
ATOM   4885 C  CB    . ALA C 3 75  ? -22.845 19.875  32.982  1.00 41.83 ?  75  ALA C CB    1 
ATOM   4886 N  N     . LYS C 3 76  ? -21.010 22.423  31.886  1.00 42.32 ?  76  LYS C N     1 
ATOM   4887 C  CA    . LYS C 3 76  ? -20.489 23.783  32.126  1.00 41.40 ?  76  LYS C CA    1 
ATOM   4888 C  C     . LYS C 3 76  ? -20.201 24.532  30.801  1.00 40.96 ?  76  LYS C C     1 
ATOM   4889 O  O     . LYS C 3 76  ? -19.691 25.661  30.813  1.00 41.73 ?  76  LYS C O     1 
ATOM   4890 C  CB    . LYS C 3 76  ? -19.214 23.729  32.967  1.00 41.64 ?  76  LYS C CB    1 
ATOM   4891 N  N     . ASN C 3 77  ? -20.551 23.922  29.669  1.00 39.25 ?  77  ASN C N     1 
ATOM   4892 C  CA    . ASN C 3 77  ? -20.219 24.504  28.368  1.00 37.36 ?  77  ASN C CA    1 
ATOM   4893 C  C     . ASN C 3 77  ? -18.770 24.962  28.309  1.00 34.94 ?  77  ASN C C     1 
ATOM   4894 O  O     . ASN C 3 77  ? -18.475 26.099  27.921  1.00 35.73 ?  77  ASN C O     1 
ATOM   4895 C  CB    . ASN C 3 77  ? -21.135 25.674  28.043  1.00 38.07 ?  77  ASN C CB    1 
ATOM   4896 C  CG    . ASN C 3 77  ? -22.560 25.235  27.856  1.00 39.03 ?  77  ASN C CG    1 
ATOM   4897 O  OD1   . ASN C 3 77  ? -22.804 24.107  27.419  1.00 39.15 ?  77  ASN C OD1   1 
ATOM   4898 N  ND2   . ASN C 3 77  ? -23.514 26.096  28.217  1.00 39.83 ?  77  ASN C ND2   1 
ATOM   4899 N  N     . ALA C 3 78  ? -17.867 24.061  28.654  1.00 32.34 ?  78  ALA C N     1 
ATOM   4900 C  CA    . ALA C 3 78  ? -16.447 24.380  28.699  1.00 31.14 ?  78  ALA C CA    1 
ATOM   4901 C  C     . ALA C 3 78  ? -15.565 23.255  28.195  1.00 29.69 ?  78  ALA C C     1 
ATOM   4902 O  O     . ALA C 3 78  ? -15.954 22.082  28.227  1.00 30.35 ?  78  ALA C O     1 
ATOM   4903 C  CB    . ALA C 3 78  ? -16.047 24.711  30.101  1.00 32.19 ?  78  ALA C CB    1 
ATOM   4904 N  N     A VAL C 3 79  ? -14.390 23.636  27.687  0.50 28.87 ?  79  VAL C N     1 
ATOM   4905 N  N     B VAL C 3 79  ? -14.386 23.608  27.697  0.50 28.72 ?  79  VAL C N     1 
ATOM   4906 C  CA    A VAL C 3 79  ? -13.360 22.691  27.248  0.50 28.39 ?  79  VAL C CA    1 
ATOM   4907 C  CA    B VAL C 3 79  ? -13.407 22.599  27.318  0.50 27.96 ?  79  VAL C CA    1 
ATOM   4908 C  C     A VAL C 3 79  ? -12.039 23.159  27.853  0.50 27.76 ?  79  VAL C C     1 
ATOM   4909 C  C     B VAL C 3 79  ? -12.060 23.128  27.831  0.50 27.53 ?  79  VAL C C     1 
ATOM   4910 O  O     A VAL C 3 79  ? -11.810 24.365  27.989  0.50 28.60 ?  79  VAL C O     1 
ATOM   4911 O  O     B VAL C 3 79  ? -11.847 24.343  27.899  0.50 28.36 ?  79  VAL C O     1 
ATOM   4912 C  CB    A VAL C 3 79  ? -13.285 22.588  25.709  0.50 29.07 ?  79  VAL C CB    1 
ATOM   4913 C  CB    B VAL C 3 79  ? -13.427 22.321  25.792  0.50 28.03 ?  79  VAL C CB    1 
ATOM   4914 C  CG1   A VAL C 3 79  ? -12.288 21.522  25.263  0.50 30.02 ?  79  VAL C CG1   1 
ATOM   4915 C  CG1   B VAL C 3 79  ? -13.126 23.559  25.051  0.50 26.24 ?  79  VAL C CG1   1 
ATOM   4916 C  CG2   A VAL C 3 79  ? -14.625 22.213  25.204  0.50 28.46 ?  79  VAL C CG2   1 
ATOM   4917 C  CG2   B VAL C 3 79  ? -12.477 21.186  25.389  0.50 29.09 ?  79  VAL C CG2   1 
ATOM   4918 N  N     . TYR C 3 80  ? -11.168 22.220  28.208  1.00 26.82 ?  80  TYR C N     1 
ATOM   4919 C  CA    . TYR C 3 80  ? -9.927  22.572  28.893  1.00 27.31 ?  80  TYR C CA    1 
ATOM   4920 C  C     . TYR C 3 80  ? -8.759  21.877  28.269  1.00 26.59 ?  80  TYR C C     1 
ATOM   4921 O  O     . TYR C 3 80  ? -8.941  20.796  27.701  1.00 27.00 ?  80  TYR C O     1 
ATOM   4922 C  CB    . TYR C 3 80  ? -10.010 22.169  30.348  1.00 29.40 ?  80  TYR C CB    1 
ATOM   4923 C  CG    . TYR C 3 80  ? -11.248 22.639  30.997  1.00 32.02 ?  80  TYR C CG    1 
ATOM   4924 C  CD1   . TYR C 3 80  ? -11.377 23.945  31.461  1.00 33.58 ?  80  TYR C CD1   1 
ATOM   4925 C  CD2   . TYR C 3 80  ? -12.325 21.757  31.183  1.00 33.74 ?  80  TYR C CD2   1 
ATOM   4926 C  CE1   . TYR C 3 80  ? -12.552 24.357  32.104  1.00 34.18 ?  80  TYR C CE1   1 
ATOM   4927 C  CE2   . TYR C 3 80  ? -13.466 22.156  31.825  1.00 36.02 ?  80  TYR C CE2   1 
ATOM   4928 C  CZ    . TYR C 3 80  ? -13.586 23.454  32.277  1.00 36.30 ?  80  TYR C CZ    1 
ATOM   4929 O  OH    . TYR C 3 80  ? -14.778 23.789  32.915  1.00 38.90 ?  80  TYR C OH    1 
ATOM   4930 N  N     . LEU C 3 81  ? -7.562  22.455  28.415  1.00 26.13 ?  81  LEU C N     1 
ATOM   4931 C  CA    . LEU C 3 81  ? -6.322  21.838  27.933  1.00 26.43 ?  81  LEU C CA    1 
ATOM   4932 C  C     . LEU C 3 81  ? -5.271  21.989  29.019  1.00 27.87 ?  81  LEU C C     1 
ATOM   4933 O  O     . LEU C 3 81  ? -4.804  23.110  29.262  1.00 29.08 ?  81  LEU C O     1 
ATOM   4934 C  CB    . LEU C 3 81  ? -5.841  22.474  26.613  1.00 26.24 ?  81  LEU C CB    1 
ATOM   4935 C  CG    . LEU C 3 81  ? -4.634  21.741  26.005  1.00 26.66 ?  81  LEU C CG    1 
ATOM   4936 C  CD1   . LEU C 3 81  ? -5.043  20.319  25.527  1.00 27.15 ?  81  LEU C CD1   1 
ATOM   4937 C  CD2   . LEU C 3 81  ? -4.045  22.593  24.870  1.00 26.98 ?  81  LEU C CD2   1 
ATOM   4938 N  N     . GLN C 3 82  ? -4.933  20.883  29.679  1.00 28.94 ?  82  GLN C N     1 
ATOM   4939 C  CA    . GLN C 3 82  ? -3.856  20.893  30.668  1.00 31.03 ?  82  GLN C CA    1 
ATOM   4940 C  C     . GLN C 3 82  ? -2.562  20.611  29.943  1.00 31.50 ?  82  GLN C C     1 
ATOM   4941 O  O     . GLN C 3 82  ? -2.453  19.575  29.293  1.00 31.79 ?  82  GLN C O     1 
ATOM   4942 C  CB    . GLN C 3 82  ? -4.120  19.840  31.759  1.00 31.62 ?  82  GLN C CB    1 
ATOM   4943 C  CG    . GLN C 3 82  ? -2.989  19.772  32.802  1.00 33.25 ?  82  GLN C CG    1 
ATOM   4944 C  CD    . GLN C 3 82  ? -2.868  21.062  33.587  1.00 34.90 ?  82  GLN C CD    1 
ATOM   4945 O  OE1   . GLN C 3 82  ? -3.874  21.627  34.039  1.00 35.46 ?  82  GLN C OE1   1 
ATOM   4946 N  NE2   . GLN C 3 82  ? -1.637  21.536  33.763  1.00 36.12 ?  82  GLN C NE2   1 
ATOM   4947 N  N     . MET C 3 83  ? -1.597  21.527  30.005  1.00 33.40 ?  83  MET C N     1 
ATOM   4948 C  CA    . MET C 3 83  ? -0.315  21.371  29.296  1.00 34.73 ?  83  MET C CA    1 
ATOM   4949 C  C     . MET C 3 83  ? 0.805   21.228  30.290  1.00 36.06 ?  83  MET C C     1 
ATOM   4950 O  O     . MET C 3 83  ? 1.066   22.174  31.006  1.00 37.97 ?  83  MET C O     1 
ATOM   4951 C  CB    . MET C 3 83  ? -0.037  22.585  28.400  1.00 35.17 ?  83  MET C CB    1 
ATOM   4952 C  CG    . MET C 3 83  ? -1.210  22.855  27.436  1.00 37.27 ?  83  MET C CG    1 
ATOM   4953 S  SD    . MET C 3 83  ? -1.088  24.459  26.596  1.00 42.79 ?  83  MET C SD    1 
ATOM   4954 C  CE    . MET C 3 83  ? 0.446   24.324  25.722  1.00 44.83 ?  83  MET C CE    1 
ATOM   4955 N  N     . ASN C 3 84  ? 1.456   20.070  30.315  1.00 36.41 ?  84  ASN C N     1 
ATOM   4956 C  CA    . ASN C 3 84  ? 2.568   19.808  31.252  1.00 38.03 ?  84  ASN C CA    1 
ATOM   4957 C  C     . ASN C 3 84  ? 3.894   19.799  30.491  1.00 38.23 ?  84  ASN C C     1 
ATOM   4958 O  O     . ASN C 3 84  ? 3.872   19.684  29.254  1.00 39.03 ?  84  ASN C O     1 
ATOM   4959 C  CB    . ASN C 3 84  ? 2.312   18.478  31.958  1.00 38.57 ?  84  ASN C CB    1 
ATOM   4960 C  CG    . ASN C 3 84  ? 1.152   18.564  32.950  1.00 39.99 ?  84  ASN C CG    1 
ATOM   4961 O  OD1   . ASN C 3 84  ? 0.716   19.652  33.321  1.00 40.43 ?  84  ASN C OD1   1 
ATOM   4962 N  ND2   . ASN C 3 84  ? 0.676   17.419  33.400  1.00 41.35 ?  84  ASN C ND2   1 
ATOM   4963 N  N     . SER C 3 85  ? 5.026   19.970  31.187  1.00 38.99 ?  85  SER C N     1 
ATOM   4964 C  CA    . SER C 3 85  ? 6.342   19.772  30.577  1.00 39.72 ?  85  SER C CA    1 
ATOM   4965 C  C     . SER C 3 85  ? 6.554   20.627  29.332  1.00 39.85 ?  85  SER C C     1 
ATOM   4966 O  O     . SER C 3 85  ? 6.995   20.135  28.292  1.00 41.30 ?  85  SER C O     1 
ATOM   4967 C  CB    . SER C 3 85  ? 6.548   18.297  30.215  1.00 41.49 ?  85  SER C CB    1 
ATOM   4968 O  OG    . SER C 3 85  ? 6.483   17.459  31.358  1.00 42.90 ?  85  SER C OG    1 
ATOM   4969 N  N     . LEU C 3 86  ? 6.217   21.900  29.426  1.00 39.11 ?  86  LEU C N     1 
ATOM   4970 C  CA    . LEU C 3 86  ? 6.275   22.749  28.265  1.00 40.18 ?  86  LEU C CA    1 
ATOM   4971 C  C     . LEU C 3 86  ? 7.703   23.054  27.846  1.00 41.42 ?  86  LEU C C     1 
ATOM   4972 O  O     . LEU C 3 86  ? 8.616   23.065  28.671  1.00 41.99 ?  86  LEU C O     1 
ATOM   4973 C  CB    . LEU C 3 86  ? 5.497   24.030  28.540  1.00 39.25 ?  86  LEU C CB    1 
ATOM   4974 C  CG    . LEU C 3 86  ? 3.977   23.787  28.542  1.00 38.26 ?  86  LEU C CG    1 
ATOM   4975 C  CD1   . LEU C 3 86  ? 3.214   24.962  29.166  1.00 38.16 ?  86  LEU C CD1   1 
ATOM   4976 C  CD2   . LEU C 3 86  ? 3.532   23.563  27.094  1.00 38.41 ?  86  LEU C CD2   1 
ATOM   4977 N  N     . THR C 3 87  ? 7.923   23.280  26.559  1.00 42.52 ?  87  THR C N     1 
ATOM   4978 C  CA    . THR C 3 87  ? 9.235   23.694  26.082  1.00 43.93 ?  87  THR C CA    1 
ATOM   4979 C  C     . THR C 3 87  ? 8.997   24.795  25.039  1.00 43.26 ?  87  THR C C     1 
ATOM   4980 O  O     . THR C 3 87  ? 7.868   24.980  24.606  1.00 42.64 ?  87  THR C O     1 
ATOM   4981 C  CB    . THR C 3 87  ? 10.014  22.521  25.478  1.00 46.14 ?  87  THR C CB    1 
ATOM   4982 O  OG1   . THR C 3 87  ? 9.532   22.273  24.161  1.00 47.42 ?  87  THR C OG1   1 
ATOM   4983 C  CG2   . THR C 3 87  ? 9.866   21.244  26.312  1.00 46.22 ?  87  THR C CG2   1 
ATOM   4984 N  N     . PRO C 3 88  ? 10.042  25.548  24.629  1.00 42.76 ?  88  PRO C N     1 
ATOM   4985 C  CA    . PRO C 3 88  ? 9.816   26.660  23.686  1.00 42.04 ?  88  PRO C CA    1 
ATOM   4986 C  C     . PRO C 3 88  ? 9.114   26.282  22.366  1.00 41.50 ?  88  PRO C C     1 
ATOM   4987 O  O     . PRO C 3 88  ? 8.504   27.146  21.737  1.00 41.01 ?  88  PRO C O     1 
ATOM   4988 C  CB    . PRO C 3 88  ? 11.238  27.160  23.402  1.00 42.16 ?  88  PRO C CB    1 
ATOM   4989 C  CG    . PRO C 3 88  ? 11.967  26.841  24.583  1.00 42.54 ?  88  PRO C CG    1 
ATOM   4990 C  CD    . PRO C 3 88  ? 11.426  25.547  25.121  1.00 42.13 ?  88  PRO C CD    1 
ATOM   4991 N  N     . GLU C 3 89  ? 9.190   25.018  21.967  1.00 41.89 ?  89  GLU C N     1 
ATOM   4992 C  CA    . GLU C 3 89  ? 8.531   24.584  20.741  1.00 42.40 ?  89  GLU C CA    1 
ATOM   4993 C  C     . GLU C 3 89  ? 7.018   24.646  20.920  1.00 40.26 ?  89  GLU C C     1 
ATOM   4994 O  O     . GLU C 3 89  ? 6.283   24.593  19.944  1.00 40.25 ?  89  GLU C O     1 
ATOM   4995 C  CB    . GLU C 3 89  ? 8.955   23.162  20.344  1.00 46.02 ?  89  GLU C CB    1 
ATOM   4996 C  CG    . GLU C 3 89  ? 8.707   22.162  21.443  1.00 49.60 ?  89  GLU C CG    1 
ATOM   4997 C  CD    . GLU C 3 89  ? 8.928   20.688  21.069  1.00 52.60 ?  89  GLU C CD    1 
ATOM   4998 O  OE1   . GLU C 3 89  ? 10.061  20.340  20.650  1.00 53.57 ?  89  GLU C OE1   1 
ATOM   4999 O  OE2   . GLU C 3 89  ? 7.976   19.867  21.254  1.00 53.07 ?  89  GLU C OE2   1 
ATOM   5000 N  N     . ASP C 3 90  ? 6.550   24.780  22.157  1.00 38.58 ?  90  ASP C N     1 
ATOM   5001 C  CA    . ASP C 3 90  ? 5.098   24.877  22.383  1.00 36.95 ?  90  ASP C CA    1 
ATOM   5002 C  C     . ASP C 3 90  ? 4.592   26.336  22.321  1.00 35.69 ?  90  ASP C C     1 
ATOM   5003 O  O     . ASP C 3 90  ? 3.400   26.595  22.442  1.00 35.67 ?  90  ASP C O     1 
ATOM   5004 C  CB    . ASP C 3 90  ? 4.729   24.246  23.733  1.00 37.16 ?  90  ASP C CB    1 
ATOM   5005 C  CG    . ASP C 3 90  ? 5.058   22.759  23.802  1.00 37.40 ?  90  ASP C CG    1 
ATOM   5006 O  OD1   . ASP C 3 90  ? 4.638   21.984  22.925  1.00 37.12 ?  90  ASP C OD1   1 
ATOM   5007 O  OD2   . ASP C 3 90  ? 5.764   22.358  24.752  1.00 38.53 ?  90  ASP C OD2   1 
ATOM   5008 N  N     . THR C 3 91  ? 5.502   27.299  22.150  1.00 34.81 ?  91  THR C N     1 
ATOM   5009 C  CA    . THR C 3 91  ? 5.086   28.697  22.009  1.00 34.60 ?  91  THR C CA    1 
ATOM   5010 C  C     . THR C 3 91  ? 4.212   28.895  20.778  1.00 33.37 ?  91  THR C C     1 
ATOM   5011 O  O     . THR C 3 91  ? 4.620   28.480  19.690  1.00 35.00 ?  91  THR C O     1 
ATOM   5012 C  CB    . THR C 3 91  ? 6.309   29.609  21.893  1.00 35.59 ?  91  THR C CB    1 
ATOM   5013 O  OG1   . THR C 3 91  ? 7.067   29.485  23.094  1.00 36.84 ?  91  THR C OG1   1 
ATOM   5014 C  CG2   . THR C 3 91  ? 5.914   31.067  21.694  1.00 35.66 ?  91  THR C CG2   1 
ATOM   5015 N  N     . ALA C 3 92  ? 3.022   29.498  20.941  1.00 31.94 ?  92  ALA C N     1 
ATOM   5016 C  CA    . ALA C 3 92  ? 2.069   29.691  19.828  1.00 29.71 ?  92  ALA C CA    1 
ATOM   5017 C  C     . ALA C 3 92  ? 0.820   30.420  20.348  1.00 29.69 ?  92  ALA C C     1 
ATOM   5018 O  O     . ALA C 3 92  ? 0.620   30.533  21.574  1.00 29.38 ?  92  ALA C O     1 
ATOM   5019 C  CB    . ALA C 3 92  ? 1.669   28.312  19.186  1.00 29.39 ?  92  ALA C CB    1 
ATOM   5020 N  N     . VAL C 3 93  ? -0.007  30.936  19.439  1.00 28.42 ?  93  VAL C N     1 
ATOM   5021 C  CA    . VAL C 3 93  ? -1.380  31.303  19.803  1.00 28.76 ?  93  VAL C CA    1 
ATOM   5022 C  C     . VAL C 3 93  ? -2.204  30.018  19.781  1.00 28.12 ?  93  VAL C C     1 
ATOM   5023 O  O     . VAL C 3 93  ? -2.194  29.279  18.789  1.00 28.43 ?  93  VAL C O     1 
ATOM   5024 C  CB    . VAL C 3 93  ? -1.987  32.371  18.852  1.00 30.57 ?  93  VAL C CB    1 
ATOM   5025 C  CG1   . VAL C 3 93  ? -3.414  32.776  19.318  1.00 32.55 ?  93  VAL C CG1   1 
ATOM   5026 C  CG2   . VAL C 3 93  ? -1.079  33.556  18.765  1.00 31.63 ?  93  VAL C CG2   1 
ATOM   5027 N  N     . TYR C 3 94  ? -2.924  29.754  20.861  1.00 26.61 ?  94  TYR C N     1 
ATOM   5028 C  CA    . TYR C 3 94  ? -3.800  28.585  20.968  1.00 25.95 ?  94  TYR C CA    1 
ATOM   5029 C  C     . TYR C 3 94  ? -5.250  28.992  20.755  1.00 25.24 ?  94  TYR C C     1 
ATOM   5030 O  O     . TYR C 3 94  ? -5.735  29.956  21.349  1.00 26.20 ?  94  TYR C O     1 
ATOM   5031 C  CB    . TYR C 3 94  ? -3.602  27.929  22.369  1.00 25.83 ?  94  TYR C CB    1 
ATOM   5032 C  CG    . TYR C 3 94  ? -2.299  27.150  22.441  1.00 26.32 ?  94  TYR C CG    1 
ATOM   5033 C  CD1   . TYR C 3 94  ? -1.053  27.811  22.485  1.00 26.55 ?  94  TYR C CD1   1 
ATOM   5034 C  CD2   . TYR C 3 94  ? -2.299  25.755  22.453  1.00 27.22 ?  94  TYR C CD2   1 
ATOM   5035 C  CE1   . TYR C 3 94  ? 0.155   27.094  22.522  1.00 27.76 ?  94  TYR C CE1   1 
ATOM   5036 C  CE2   . TYR C 3 94  ? -1.104  25.033  22.530  1.00 28.05 ?  94  TYR C CE2   1 
ATOM   5037 C  CZ    . TYR C 3 94  ? 0.116   25.717  22.562  1.00 28.87 ?  94  TYR C CZ    1 
ATOM   5038 O  OH    . TYR C 3 94  ? 1.281   24.995  22.614  1.00 30.49 ?  94  TYR C OH    1 
ATOM   5039 N  N     . PHE C 3 95  ? -5.947  28.199  19.964  1.00 23.30 ?  95  PHE C N     1 
ATOM   5040 C  CA    . PHE C 3 95  ? -7.337  28.461  19.596  1.00 23.70 ?  95  PHE C CA    1 
ATOM   5041 C  C     . PHE C 3 95  ? -8.188  27.277  20.002  1.00 23.50 ?  95  PHE C C     1 
ATOM   5042 O  O     . PHE C 3 95  ? -7.831  26.125  19.740  1.00 24.31 ?  95  PHE C O     1 
ATOM   5043 C  CB    . PHE C 3 95  ? -7.522  28.642  18.077  1.00 25.31 ?  95  PHE C CB    1 
ATOM   5044 C  CG    . PHE C 3 95  ? -6.836  29.852  17.517  1.00 27.58 ?  95  PHE C CG    1 
ATOM   5045 C  CD1   . PHE C 3 95  ? -7.495  31.079  17.451  1.00 29.53 ?  95  PHE C CD1   1 
ATOM   5046 C  CD2   . PHE C 3 95  ? -5.528  29.760  17.070  1.00 28.50 ?  95  PHE C CD2   1 
ATOM   5047 C  CE1   . PHE C 3 95  ? -6.870  32.216  16.907  1.00 31.31 ?  95  PHE C CE1   1 
ATOM   5048 C  CE2   . PHE C 3 95  ? -4.883  30.872  16.526  1.00 30.10 ?  95  PHE C CE2   1 
ATOM   5049 C  CZ    . PHE C 3 95  ? -5.547  32.106  16.467  1.00 31.09 ?  95  PHE C CZ    1 
ATOM   5050 N  N     . CYS C 3 96  ? -9.322  27.546  20.611  1.00 23.41 ?  96  CYS C N     1 
ATOM   5051 C  CA    . CYS C 3 96  ? -10.337 26.527  20.780  1.00 23.41 ?  96  CYS C CA    1 
ATOM   5052 C  C     . CYS C 3 96  ? -11.280 26.484  19.549  1.00 23.09 ?  96  CYS C C     1 
ATOM   5053 O  O     . CYS C 3 96  ? -11.614 27.514  18.953  1.00 24.60 ?  96  CYS C O     1 
ATOM   5054 C  CB    . CYS C 3 96  ? -11.127 26.798  22.072  1.00 26.04 ?  96  CYS C CB    1 
ATOM   5055 S  SG    . CYS C 3 96  ? -12.325 25.468  22.459  1.00 28.96 ?  96  CYS C SG    1 
ATOM   5056 N  N     . ASN C 3 97  ? -11.678 25.267  19.181  1.00 21.34 ?  97  ASN C N     1 
ATOM   5057 C  CA    . ASN C 3 97  ? -12.474 24.988  17.997  1.00 20.99 ?  97  ASN C CA    1 
ATOM   5058 C  C     . ASN C 3 97  ? -13.686 24.147  18.377  1.00 19.74 ?  97  ASN C C     1 
ATOM   5059 O  O     . ASN C 3 97  ? -13.597 23.312  19.261  1.00 20.65 ?  97  ASN C O     1 
ATOM   5060 C  CB    . ASN C 3 97  ? -11.580 24.249  16.982  1.00 21.78 ?  97  ASN C CB    1 
ATOM   5061 C  CG    . ASN C 3 97  ? -12.305 23.787  15.741  1.00 22.28 ?  97  ASN C CG    1 
ATOM   5062 O  OD1   . ASN C 3 97  ? -12.237 22.614  15.420  1.00 22.24 ?  97  ASN C OD1   1 
ATOM   5063 N  ND2   . ASN C 3 97  ? -12.978 24.677  15.041  1.00 23.80 ?  97  ASN C ND2   1 
ATOM   5064 N  N     . ALA C 3 98  ? -14.812 24.336  17.711  1.00 19.57 ?  98  ALA C N     1 
ATOM   5065 C  CA    . ALA C 3 98  ? -15.921 23.409  17.903  1.00 19.89 ?  98  ALA C CA    1 
ATOM   5066 C  C     . ALA C 3 98  ? -16.444 23.068  16.531  1.00 19.29 ?  98  ALA C C     1 
ATOM   5067 O  O     . ALA C 3 98  ? -16.487 23.956  15.659  1.00 21.45 ?  98  ALA C O     1 
ATOM   5068 C  CB    . ALA C 3 98  ? -17.032 24.045  18.787  1.00 21.47 ?  98  ALA C CB    1 
ATOM   5069 N  N     . ARG C 3 99  ? -16.808 21.797  16.312  1.00 17.24 ?  99  ARG C N     1 
ATOM   5070 C  CA    . ARG C 3 99  ? -17.283 21.314  15.020  1.00 16.74 ?  99  ARG C CA    1 
ATOM   5071 C  C     . ARG C 3 99  ? -18.648 20.706  15.165  1.00 17.27 ?  99  ARG C C     1 
ATOM   5072 O  O     . ARG C 3 99  ? -18.862 19.878  16.086  1.00 17.76 ?  99  ARG C O     1 
ATOM   5073 C  CB    . ARG C 3 99  ? -16.341 20.244  14.488  1.00 17.45 ?  99  ARG C CB    1 
ATOM   5074 C  CG    . ARG C 3 99  ? -14.939 20.790  14.184  1.00 18.90 ?  99  ARG C CG    1 
ATOM   5075 C  CD    . ARG C 3 99  ? -13.975 19.619  13.955  1.00 20.85 ?  99  ARG C CD    1 
ATOM   5076 N  NE    . ARG C 3 99  ? -14.393 18.811  12.814  1.00 22.12 ?  99  ARG C NE    1 
ATOM   5077 C  CZ    . ARG C 3 99  ? -14.035 19.060  11.547  1.00 22.33 ?  99  ARG C CZ    1 
ATOM   5078 N  NH1   . ARG C 3 99  ? -13.198 20.079  11.243  1.00 22.20 ?  99  ARG C NH1   1 
ATOM   5079 N  NH2   . ARG C 3 99  ? -14.527 18.312  10.583  1.00 25.04 ?  99  ARG C NH2   1 
ATOM   5080 N  N     . ARG C 3 100 ? -19.543 21.073  14.262  1.00 19.06 ?  100 ARG C N     1 
ATOM   5081 C  CA    . ARG C 3 100 ? -20.867 20.496  14.221  1.00 22.22 ?  100 ARG C CA    1 
ATOM   5082 C  C     . ARG C 3 100 ? -21.145 19.947  12.827  1.00 22.45 ?  100 ARG C C     1 
ATOM   5083 O  O     . ARG C 3 100 ? -20.897 20.628  11.832  1.00 24.34 ?  100 ARG C O     1 
ATOM   5084 C  CB    . ARG C 3 100 ? -21.928 21.526  14.590  1.00 25.77 ?  100 ARG C CB    1 
ATOM   5085 C  CG    . ARG C 3 100 ? -23.304 20.919  14.480  1.00 32.05 ?  100 ARG C CG    1 
ATOM   5086 C  CD    . ARG C 3 100 ? -24.411 21.939  14.627  1.00 37.66 ?  100 ARG C CD    1 
ATOM   5087 N  NE    . ARG C 3 100 ? -24.252 22.742  15.815  1.00 42.28 ?  100 ARG C NE    1 
ATOM   5088 C  CZ    . ARG C 3 100 ? -24.330 24.074  15.817  1.00 44.36 ?  100 ARG C CZ    1 
ATOM   5089 N  NH1   . ARG C 3 100 ? -24.576 24.733  14.673  1.00 45.17 ?  100 ARG C NH1   1 
ATOM   5090 N  NH2   . ARG C 3 100 ? -24.175 24.739  16.953  1.00 44.15 ?  100 ARG C NH2   1 
ATOM   5091 N  N     . ASN C 3 101 ? -21.583 18.701  12.752  1.00 21.49 ?  101 ASN C N     1 
ATOM   5092 C  CA    . ASN C 3 101 ? -21.811 17.981  11.478  1.00 23.72 ?  101 ASN C CA    1 
ATOM   5093 C  C     . ASN C 3 101 ? -23.230 17.488  11.385  1.00 25.91 ?  101 ASN C C     1 
ATOM   5094 O  O     . ASN C 3 101 ? -23.858 17.179  12.396  1.00 24.09 ?  101 ASN C O     1 
ATOM   5095 C  CB    . ASN C 3 101 ? -20.839 16.784  11.360  1.00 23.81 ?  101 ASN C CB    1 
ATOM   5096 C  CG    . ASN C 3 101 ? -19.401 17.212  11.417  1.00 25.27 ?  101 ASN C CG    1 
ATOM   5097 O  OD1   . ASN C 3 101 ? -18.845 17.688  10.407  1.00 27.47 ?  101 ASN C OD1   1 
ATOM   5098 N  ND2   . ASN C 3 101 ? -18.777 17.059  12.561  1.00 24.57 ?  101 ASN C ND2   1 
ATOM   5099 N  N     . PRO C 3 102 ? -23.744 17.401  10.142  1.00 28.24 ?  102 PRO C N     1 
ATOM   5100 C  CA    . PRO C 3 102 ? -25.100 16.879  9.942   1.00 27.75 ?  102 PRO C CA    1 
ATOM   5101 C  C     . PRO C 3 102 ? -25.207 15.364  10.097  1.00 26.18 ?  102 PRO C C     1 
ATOM   5102 O  O     . PRO C 3 102 ? -24.173 14.719  9.922   1.00 25.58 ?  102 PRO C O     1 
ATOM   5103 C  CB    . PRO C 3 102 ? -25.394 17.291  8.498   1.00 27.80 ?  102 PRO C CB    1 
ATOM   5104 C  CG    . PRO C 3 102 ? -23.957 17.144  7.794   1.00 29.29 ?  102 PRO C CG    1 
ATOM   5105 C  CD    . PRO C 3 102 ? -23.025 17.675  8.875   1.00 29.31 ?  102 PRO C CD    1 
ATOM   5106 N  N     . ILE C 3 103 ? -26.392 14.792  10.384  1.00 25.88 ?  103 ILE C N     1 
ATOM   5107 C  CA    . ILE C 3 103 ? -26.498 13.317  10.200  1.00 24.48 ?  103 ILE C CA    1 
ATOM   5108 C  C     . ILE C 3 103 ? -27.194 12.900  8.954   1.00 24.50 ?  103 ILE C C     1 
ATOM   5109 O  O     . ILE C 3 103 ? -27.523 11.713  8.792   1.00 26.28 ?  103 ILE C O     1 
ATOM   5110 C  CB    . ILE C 3 103 ? -27.198 12.617  11.381  1.00 24.10 ?  103 ILE C CB    1 
ATOM   5111 C  CG1   . ILE C 3 103 ? -28.542 13.256  11.619  1.00 23.46 ?  103 ILE C CG1   1 
ATOM   5112 C  CG2   . ILE C 3 103 ? -26.332 12.620  12.685  1.00 24.23 ?  103 ILE C CG2   1 
ATOM   5113 C  CD1   . ILE C 3 103 ? -29.477 12.256  12.108  1.00 22.36 ?  103 ILE C CD1   1 
ATOM   5114 N  N     . ASN C 3 104 ? -27.445 13.848  8.064   1.00 23.57 ?  104 ASN C N     1 
ATOM   5115 C  CA    . ASN C 3 104 ? -28.116 13.525  6.800   1.00 26.54 ?  104 ASN C CA    1 
ATOM   5116 C  C     . ASN C 3 104 ? -27.501 14.441  5.787   1.00 24.32 ?  104 ASN C C     1 
ATOM   5117 O  O     . ASN C 3 104 ? -27.011 15.503  6.141   1.00 23.51 ?  104 ASN C O     1 
ATOM   5118 C  CB    . ASN C 3 104 ? -29.644 13.816  6.855   1.00 30.15 ?  104 ASN C CB    1 
ATOM   5119 C  CG    . ASN C 3 104 ? -29.944 15.313  7.168   1.00 35.43 ?  104 ASN C CG    1 
ATOM   5120 O  OD1   . ASN C 3 104 ? -29.107 16.083  7.719   1.00 38.33 ?  104 ASN C OD1   1 
ATOM   5121 N  ND2   . ASN C 3 104 ? -31.093 15.719  6.821   1.00 39.08 ?  104 ASN C ND2   1 
ATOM   5122 N  N     . GLY C 3 105 ? -27.546 14.051  4.526   1.00 22.62 ?  105 GLY C N     1 
ATOM   5123 C  CA    . GLY C 3 105 ? -27.208 14.979  3.474   1.00 22.44 ?  105 GLY C CA    1 
ATOM   5124 C  C     . GLY C 3 105 ? -25.706 15.020  3.184   1.00 22.09 ?  105 GLY C C     1 
ATOM   5125 O  O     . GLY C 3 105 ? -24.902 14.257  3.719   1.00 22.24 ?  105 GLY C O     1 
ATOM   5126 N  N     . PRO C 3 106 ? -25.316 15.915  2.293   1.00 24.21 ?  106 PRO C N     1 
ATOM   5127 C  CA    . PRO C 3 106 ? -23.902 16.046  1.963   1.00 25.71 ?  106 PRO C CA    1 
ATOM   5128 C  C     . PRO C 3 106 ? -23.115 16.491  3.179   1.00 23.74 ?  106 PRO C C     1 
ATOM   5129 O  O     . PRO C 3 106 ? -23.595 17.202  4.061   1.00 23.99 ?  106 PRO C O     1 
ATOM   5130 C  CB    . PRO C 3 106 ? -23.892 17.105  0.867   1.00 27.35 ?  106 PRO C CB    1 
ATOM   5131 C  CG    . PRO C 3 106 ? -25.293 17.247  0.433   1.00 28.33 ?  106 PRO C CG    1 
ATOM   5132 C  CD    . PRO C 3 106 ? -26.171 16.869  1.559   1.00 25.96 ?  106 PRO C CD    1 
ATOM   5133 N  N     . TYR C 3 107 ? -21.890 16.039  3.224   1.00 21.49 ?  107 TYR C N     1 
ATOM   5134 C  CA    . TYR C 3 107 ? -21.017 16.385  4.335   1.00 20.67 ?  107 TYR C CA    1 
ATOM   5135 C  C     . TYR C 3 107 ? -20.832 17.890  4.446   1.00 22.85 ?  107 TYR C C     1 
ATOM   5136 O  O     . TYR C 3 107 ? -20.608 18.589  3.451   1.00 25.46 ?  107 TYR C O     1 
ATOM   5137 C  CB    . TYR C 3 107 ? -19.657 15.732  4.112   1.00 20.84 ?  107 TYR C CB    1 
ATOM   5138 C  CG    . TYR C 3 107 ? -18.714 15.874  5.258   1.00 19.06 ?  107 TYR C CG    1 
ATOM   5139 C  CD1   . TYR C 3 107 ? -19.009 15.308  6.516   1.00 18.08 ?  107 TYR C CD1   1 
ATOM   5140 C  CD2   . TYR C 3 107 ? -17.524 16.568  5.112   1.00 19.47 ?  107 TYR C CD2   1 
ATOM   5141 C  CE1   . TYR C 3 107 ? -18.097 15.421  7.584   1.00 17.22 ?  107 TYR C CE1   1 
ATOM   5142 C  CE2   . TYR C 3 107 ? -16.601 16.660  6.163   1.00 19.91 ?  107 TYR C CE2   1 
ATOM   5143 C  CZ    . TYR C 3 107 ? -16.906 16.099  7.388   1.00 19.74 ?  107 TYR C CZ    1 
ATOM   5144 O  OH    . TYR C 3 107 ? -15.980 16.165  8.417   1.00 20.04 ?  107 TYR C OH    1 
ATOM   5145 N  N     . TYR C 3 108 ? -20.843 18.414  5.657   1.00 23.90 ?  108 TYR C N     1 
ATOM   5146 C  CA    . TYR C 3 108 ? -20.248 19.749  5.855   1.00 26.92 ?  108 TYR C CA    1 
ATOM   5147 C  C     . TYR C 3 108 ? -19.895 19.887  7.302   1.00 27.41 ?  108 TYR C C     1 
ATOM   5148 O  O     . TYR C 3 108 ? -20.342 19.080  8.122   1.00 28.25 ?  108 TYR C O     1 
ATOM   5149 C  CB    . TYR C 3 108 ? -21.165 20.887  5.454   1.00 30.34 ?  108 TYR C CB    1 
ATOM   5150 C  CG    . TYR C 3 108 ? -22.370 21.004  6.321   1.00 33.11 ?  108 TYR C CG    1 
ATOM   5151 C  CD1   . TYR C 3 108 ? -23.485 20.261  6.054   1.00 33.71 ?  108 TYR C CD1   1 
ATOM   5152 C  CD2   . TYR C 3 108 ? -22.375 21.827  7.435   1.00 35.05 ?  108 TYR C CD2   1 
ATOM   5153 C  CE1   . TYR C 3 108 ? -24.608 20.348  6.845   1.00 35.20 ?  108 TYR C CE1   1 
ATOM   5154 C  CE2   . TYR C 3 108 ? -23.464 21.905  8.245   1.00 36.51 ?  108 TYR C CE2   1 
ATOM   5155 C  CZ    . TYR C 3 108 ? -24.590 21.166  7.946   1.00 37.23 ?  108 TYR C CZ    1 
ATOM   5156 O  OH    . TYR C 3 108 ? -25.695 21.282  8.782   1.00 40.07 ?  108 TYR C OH    1 
ATOM   5157 N  N     . THR C 3 109 ? -19.114 20.908  7.617   1.00 25.70 ?  109 THR C N     1 
ATOM   5158 C  CA    . THR C 3 109 ? -18.799 21.185  9.014   1.00 26.29 ?  109 THR C CA    1 
ATOM   5159 C  C     . THR C 3 109 ? -19.105 22.648  9.297   1.00 26.47 ?  109 THR C C     1 
ATOM   5160 O  O     . THR C 3 109 ? -18.609 23.539  8.589   1.00 28.97 ?  109 THR C O     1 
ATOM   5161 C  CB    . THR C 3 109 ? -17.339 20.893  9.309   1.00 26.83 ?  109 THR C CB    1 
ATOM   5162 O  OG1   . THR C 3 109 ? -17.043 19.526  8.979   1.00 27.83 ?  109 THR C OG1   1 
ATOM   5163 C  CG2   . THR C 3 109 ? -17.024 21.153  10.815  1.00 27.53 ?  109 THR C CG2   1 
ATOM   5164 N  N     . THR C 3 110 ? -19.910 22.923  10.326  1.00 25.14 ?  110 THR C N     1 
ATOM   5165 C  CA    . THR C 3 110 ? -20.005 24.282  10.869  1.00 25.09 ?  110 THR C CA    1 
ATOM   5166 C  C     . THR C 3 110 ? -18.955 24.389  11.946  1.00 23.95 ?  110 THR C C     1 
ATOM   5167 O  O     . THR C 3 110 ? -18.967 23.615  12.904  1.00 23.63 ?  110 THR C O     1 
ATOM   5168 C  CB    . THR C 3 110 ? -21.340 24.579  11.496  1.00 26.90 ?  110 THR C CB    1 
ATOM   5169 O  OG1   . THR C 3 110 ? -22.384 24.335  10.553  1.00 29.44 ?  110 THR C OG1   1 
ATOM   5170 C  CG2   . THR C 3 110 ? -21.375 26.019  11.988  1.00 26.81 ?  110 THR C CG2   1 
ATOM   5171 N  N     . ALA C 3 111 ? -18.006 25.284  11.730  1.00 24.27 ?  111 ALA C N     1 
ATOM   5172 C  CA    . ALA C 3 111 ? -16.922 25.506  12.671  1.00 24.31 ?  111 ALA C CA    1 
ATOM   5173 C  C     . ALA C 3 111 ? -17.068 26.804  13.490  1.00 24.40 ?  111 ALA C C     1 
ATOM   5174 O  O     . ALA C 3 111 ? -17.471 27.858  12.990  1.00 25.24 ?  111 ALA C O     1 
ATOM   5175 C  CB    . ALA C 3 111 ? -15.597 25.529  11.932  1.00 27.12 ?  111 ALA C CB    1 
ATOM   5176 N  N     . TYR C 3 112 ? -16.704 26.709  14.754  1.00 22.71 ?  112 TYR C N     1 
ATOM   5177 C  CA    . TYR C 3 112 ? -16.604 27.875  15.625  1.00 23.40 ?  112 TYR C CA    1 
ATOM   5178 C  C     . TYR C 3 112 ? -15.174 27.958  16.140  1.00 23.27 ?  112 TYR C C     1 
ATOM   5179 O  O     . TYR C 3 112 ? -14.568 26.942  16.422  1.00 23.14 ?  112 TYR C O     1 
ATOM   5180 C  CB    . TYR C 3 112 ? -17.558 27.764  16.806  1.00 24.56 ?  112 TYR C CB    1 
ATOM   5181 C  CG    . TYR C 3 112 ? -19.035 27.835  16.486  1.00 26.84 ?  112 TYR C CG    1 
ATOM   5182 C  CD1   . TYR C 3 112 ? -19.715 26.763  15.945  1.00 28.89 ?  112 TYR C CD1   1 
ATOM   5183 C  CD2   . TYR C 3 112 ? -19.758 28.989  16.770  1.00 27.78 ?  112 TYR C CD2   1 
ATOM   5184 C  CE1   . TYR C 3 112 ? -21.099 26.848  15.658  1.00 29.80 ?  112 TYR C CE1   1 
ATOM   5185 C  CE2   . TYR C 3 112 ? -21.116 29.087  16.509  1.00 29.06 ?  112 TYR C CE2   1 
ATOM   5186 C  CZ    . TYR C 3 112 ? -21.784 28.016  15.951  1.00 30.31 ?  112 TYR C CZ    1 
ATOM   5187 O  OH    . TYR C 3 112 ? -23.155 28.114  15.694  1.00 32.13 ?  112 TYR C OH    1 
ATOM   5188 N  N     . TRP C 3 113 ? -14.674 29.184  16.301  1.00 24.15 ?  113 TRP C N     1 
ATOM   5189 C  CA    . TRP C 3 113 ? -13.325 29.442  16.765  1.00 24.76 ?  113 TRP C CA    1 
ATOM   5190 C  C     . TRP C 3 113 ? -13.328 30.523  17.802  1.00 27.30 ?  113 TRP C C     1 
ATOM   5191 O  O     . TRP C 3 113 ? -14.061 31.506  17.669  1.00 29.58 ?  113 TRP C O     1 
ATOM   5192 C  CB    . TRP C 3 113 ? -12.414 29.909  15.621  1.00 24.77 ?  113 TRP C CB    1 
ATOM   5193 C  CG    . TRP C 3 113 ? -12.146 28.881  14.574  1.00 23.54 ?  113 TRP C CG    1 
ATOM   5194 C  CD1   . TRP C 3 113 ? -12.817 28.705  13.375  1.00 24.69 ?  113 TRP C CD1   1 
ATOM   5195 C  CD2   . TRP C 3 113 ? -11.159 27.857  14.626  1.00 24.02 ?  113 TRP C CD2   1 
ATOM   5196 N  NE1   . TRP C 3 113 ? -12.263 27.645  12.677  1.00 24.42 ?  113 TRP C NE1   1 
ATOM   5197 C  CE2   . TRP C 3 113 ? -11.243 27.114  13.423  1.00 23.73 ?  113 TRP C CE2   1 
ATOM   5198 C  CE3   . TRP C 3 113 ? -10.193 27.503  15.569  1.00 23.94 ?  113 TRP C CE3   1 
ATOM   5199 C  CZ2   . TRP C 3 113 ? -10.392 26.013  13.149  1.00 23.92 ?  113 TRP C CZ2   1 
ATOM   5200 C  CZ3   . TRP C 3 113 ? -9.348  26.429  15.303  1.00 24.87 ?  113 TRP C CZ3   1 
ATOM   5201 C  CH2   . TRP C 3 113 ? -9.449  25.696  14.103  1.00 24.16 ?  113 TRP C CH2   1 
ATOM   5202 N  N     . GLY C 3 114 ? -12.476 30.381  18.808  1.00 28.34 ?  114 GLY C N     1 
ATOM   5203 C  CA    . GLY C 3 114 ? -12.217 31.490  19.738  1.00 30.56 ?  114 GLY C CA    1 
ATOM   5204 C  C     . GLY C 3 114 ? -11.231 32.477  19.132  1.00 33.44 ?  114 GLY C C     1 
ATOM   5205 O  O     . GLY C 3 114 ? -10.728 32.253  18.040  1.00 34.04 ?  114 GLY C O     1 
ATOM   5206 N  N     . GLN C 3 115 ? -10.935 33.564  19.849  1.00 34.89 ?  115 GLN C N     1 
ATOM   5207 C  CA    . GLN C 3 115 ? -10.040 34.593  19.315  1.00 37.54 ?  115 GLN C CA    1 
ATOM   5208 C  C     . GLN C 3 115 ? -8.592  34.232  19.553  1.00 36.55 ?  115 GLN C C     1 
ATOM   5209 O  O     . GLN C 3 115 ? -7.697  34.891  19.040  1.00 37.52 ?  115 GLN C O     1 
ATOM   5210 C  CB    . GLN C 3 115 ? -10.322 35.971  19.931  1.00 41.32 ?  115 GLN C CB    1 
ATOM   5211 C  CG    . GLN C 3 115 ? -11.646 36.612  19.497  1.00 45.03 ?  115 GLN C CG    1 
ATOM   5212 C  CD    . GLN C 3 115 ? -11.597 37.225  18.101  1.00 47.96 ?  115 GLN C CD    1 
ATOM   5213 O  OE1   . GLN C 3 115 ? -12.086 36.640  17.137  1.00 49.40 ?  115 GLN C OE1   1 
ATOM   5214 N  NE2   . GLN C 3 115 ? -11.022 38.420  17.996  1.00 49.15 ?  115 GLN C NE2   1 
ATOM   5215 N  N     . GLY C 3 116 ? -8.359  33.197  20.347  1.00 35.18 ?  116 GLY C N     1 
ATOM   5216 C  CA    . GLY C 3 116 ? -7.003  32.736  20.614  1.00 34.46 ?  116 GLY C CA    1 
ATOM   5217 C  C     . GLY C 3 116 ? -6.383  33.295  21.877  1.00 34.22 ?  116 GLY C C     1 
ATOM   5218 O  O     . GLY C 3 116 ? -6.713  34.401  22.308  1.00 35.39 ?  116 GLY C O     1 
ATOM   5219 N  N     . THR C 3 117 ? -5.461  32.541  22.457  1.00 33.55 ?  117 THR C N     1 
ATOM   5220 C  CA    . THR C 3 117 ? -4.712  33.016  23.604  1.00 34.46 ?  117 THR C CA    1 
ATOM   5221 C  C     . THR C 3 117 ? -3.209  32.723  23.402  1.00 33.06 ?  117 THR C C     1 
ATOM   5222 O  O     . THR C 3 117 ? -2.815  31.601  23.063  1.00 32.96 ?  117 THR C O     1 
ATOM   5223 C  CB    . THR C 3 117 ? -5.263  32.394  24.945  1.00 35.95 ?  117 THR C CB    1 
ATOM   5224 O  OG1   . THR C 3 117 ? -4.602  32.981  26.084  1.00 37.00 ?  117 THR C OG1   1 
ATOM   5225 C  CG2   . THR C 3 117 ? -5.071  30.887  25.015  1.00 36.95 ?  117 THR C CG2   1 
ATOM   5226 N  N     . GLN C 3 118 ? -2.371  33.735  23.628  1.00 32.27 ?  118 GLN C N     1 
ATOM   5227 C  CA    . GLN C 3 118 ? -0.912  33.555  23.496  1.00 32.66 ?  118 GLN C CA    1 
ATOM   5228 C  C     . GLN C 3 118 ? -0.317  32.716  24.625  1.00 32.75 ?  118 GLN C C     1 
ATOM   5229 O  O     . GLN C 3 118 ? -0.562  32.976  25.798  1.00 33.93 ?  118 GLN C O     1 
ATOM   5230 C  CB    . GLN C 3 118 ? -0.191  34.905  23.449  1.00 33.18 ?  118 GLN C CB    1 
ATOM   5231 C  CG    . GLN C 3 118 ? 1.319   34.754  23.315  1.00 33.90 ?  118 GLN C CG    1 
ATOM   5232 C  CD    . GLN C 3 118 ? 1.675   34.377  21.901  1.00 35.01 ?  118 GLN C CD    1 
ATOM   5233 O  OE1   . GLN C 3 118 ? 1.190   35.000  20.961  1.00 36.16 ?  118 GLN C OE1   1 
ATOM   5234 N  NE2   . GLN C 3 118 ? 2.506   33.351  21.733  1.00 36.22 ?  118 GLN C NE2   1 
ATOM   5235 N  N     . VAL C 3 119 ? 0.464   31.721  24.246  1.00 32.77 ?  119 VAL C N     1 
ATOM   5236 C  CA    . VAL C 3 119 ? 1.263   30.926  25.171  1.00 33.43 ?  119 VAL C CA    1 
ATOM   5237 C  C     . VAL C 3 119 ? 2.746   31.094  24.776  1.00 34.83 ?  119 VAL C C     1 
ATOM   5238 O  O     . VAL C 3 119 ? 3.117   30.854  23.632  1.00 35.48 ?  119 VAL C O     1 
ATOM   5239 C  CB    . VAL C 3 119 ? 0.839   29.445  25.150  1.00 32.95 ?  119 VAL C CB    1 
ATOM   5240 C  CG1   . VAL C 3 119 ? 1.896   28.615  25.905  1.00 33.66 ?  119 VAL C CG1   1 
ATOM   5241 C  CG2   . VAL C 3 119 ? -0.579  29.263  25.740  1.00 32.27 ?  119 VAL C CG2   1 
ATOM   5242 N  N     . THR C 3 120 ? 3.587   31.545  25.709  1.00 36.12 ?  120 THR C N     1 
ATOM   5243 C  CA    . THR C 3 120 ? 5.014   31.755  25.457  1.00 38.69 ?  120 THR C CA    1 
ATOM   5244 C  C     . THR C 3 120 ? 5.896   30.985  26.443  1.00 39.39 ?  120 THR C C     1 
ATOM   5245 O  O     . THR C 3 120 ? 5.820   31.197  27.639  1.00 41.08 ?  120 THR C O     1 
ATOM   5246 C  CB    . THR C 3 120 ? 5.345   33.244  25.540  1.00 39.28 ?  120 THR C CB    1 
ATOM   5247 O  OG1   . THR C 3 120 ? 4.583   33.931  24.535  1.00 39.16 ?  120 THR C OG1   1 
ATOM   5248 C  CG2   . THR C 3 120 ? 6.834   33.478  25.329  1.00 39.95 ?  120 THR C CG2   1 
ATOM   5249 N  N     . VAL C 3 121 ? 6.718   30.068  25.954  1.00 40.15 ?  121 VAL C N     1 
ATOM   5250 C  CA    . VAL C 3 121 ? 7.528   29.242  26.837  1.00 41.26 ?  121 VAL C CA    1 
ATOM   5251 C  C     . VAL C 3 121 ? 8.971   29.695  26.750  1.00 44.29 ?  121 VAL C C     1 
ATOM   5252 O  O     . VAL C 3 121 ? 9.589   29.653  25.682  1.00 45.17 ?  121 VAL C O     1 
ATOM   5253 C  CB    . VAL C 3 121 ? 7.419   27.749  26.503  1.00 40.46 ?  121 VAL C CB    1 
ATOM   5254 C  CG1   . VAL C 3 121 ? 8.062   26.926  27.588  1.00 40.70 ?  121 VAL C CG1   1 
ATOM   5255 C  CG2   . VAL C 3 121 ? 5.968   27.339  26.361  1.00 39.89 ?  121 VAL C CG2   1 
ATOM   5256 N  N     . SER C 3 122 ? 9.504   30.104  27.893  1.00 45.58 ?  122 SER C N     1 
ATOM   5257 C  CA    . SER C 3 122 ? 10.897  30.533  27.997  1.00 48.10 ?  122 SER C CA    1 
ATOM   5258 C  C     . SER C 3 122 ? 11.856  29.343  28.142  1.00 50.90 ?  122 SER C C     1 
ATOM   5259 O  O     . SER C 3 122 ? 11.539  28.352  28.810  1.00 51.61 ?  122 SER C O     1 
ATOM   5260 C  CB    . SER C 3 122 ? 11.036  31.474  29.176  1.00 48.81 ?  122 SER C CB    1 
ATOM   5261 O  OG    . SER C 3 122 ? 10.306  32.656  28.935  1.00 49.69 ?  122 SER C OG    1 
ATOM   5262 N  N     . SER C 3 123 ? 13.041  29.444  27.540  1.00 52.85 ?  123 SER C N     1 
ATOM   5263 C  CA    . SER C 3 123 ? 13.988  28.324  27.555  1.00 54.50 ?  123 SER C CA    1 
ATOM   5264 C  C     . SER C 3 123 ? 14.809  28.238  28.845  1.00 55.05 ?  123 SER C C     1 
ATOM   5265 O  O     . SER C 3 123 ? 14.534  28.927  29.833  1.00 55.34 ?  123 SER C O     1 
ATOM   5266 C  CB    . SER C 3 123 ? 14.926  28.420  26.360  1.00 55.34 ?  123 SER C CB    1 
ATOM   5267 O  OG    . SER C 3 123 ? 15.605  29.660  26.378  1.00 56.20 ?  123 SER C OG    1 
HETATM 5268 P  PG    . ATP D 4 .   ? -20.950 -2.073  -0.964  1.00 12.70 ?  401 ATP A PG    1 
HETATM 5269 O  O1G   . ATP D 4 .   ? -19.451 -1.983  -1.166  1.00 13.73 ?  401 ATP A O1G   1 
HETATM 5270 O  O2G   . ATP D 4 .   ? -21.490 -0.739  -0.600  1.00 11.45 ?  401 ATP A O2G   1 
HETATM 5271 O  O3G   . ATP D 4 .   ? -21.350 -3.274  -0.171  1.00 14.01 ?  401 ATP A O3G   1 
HETATM 5272 P  PB    . ATP D 4 .   ? -22.977 -2.255  -3.142  1.00 12.07 ?  401 ATP A PB    1 
HETATM 5273 O  O1B   . ATP D 4 .   ? -23.449 -3.642  -3.286  1.00 12.58 ?  401 ATP A O1B   1 
HETATM 5274 O  O2B   . ATP D 4 .   ? -23.769 -1.259  -2.394  1.00 12.60 ?  401 ATP A O2B   1 
HETATM 5275 O  O3B   . ATP D 4 .   ? -21.479 -2.354  -2.514  1.00 12.57 ?  401 ATP A O3B   1 
HETATM 5276 P  PA    . ATP D 4 .   ? -23.429 -0.736  -5.556  1.00 13.02 ?  401 ATP A PA    1 
HETATM 5277 O  O1A   . ATP D 4 .   ? -24.833 -1.243  -5.591  1.00 13.31 ?  401 ATP A O1A   1 
HETATM 5278 O  O2A   . ATP D 4 .   ? -23.207 0.672   -5.159  1.00 13.13 ?  401 ATP A O2A   1 
HETATM 5279 O  O3A   . ATP D 4 .   ? -22.543 -1.713  -4.589  1.00 12.54 ?  401 ATP A O3A   1 
HETATM 5280 O  "O5'" . ATP D 4 .   ? -22.725 -1.027  -6.931  1.00 13.90 ?  401 ATP A "O5'" 1 
HETATM 5281 C  "C5'" . ATP D 4 .   ? -21.747 -0.174  -7.563  1.00 14.74 ?  401 ATP A "C5'" 1 
HETATM 5282 C  "C4'" . ATP D 4 .   ? -22.093 0.009   -9.052  1.00 14.80 ?  401 ATP A "C4'" 1 
HETATM 5283 O  "O4'" . ATP D 4 .   ? -21.745 -1.207  -9.748  1.00 14.43 ?  401 ATP A "O4'" 1 
HETATM 5284 C  "C3'" . ATP D 4 .   ? -23.578 0.244   -9.391  1.00 15.38 ?  401 ATP A "C3'" 1 
HETATM 5285 O  "O3'" . ATP D 4 .   ? -23.879 1.657   -9.334  1.00 18.51 ?  401 ATP A "O3'" 1 
HETATM 5286 C  "C2'" . ATP D 4 .   ? -23.648 -0.252  -10.823 1.00 17.41 ?  401 ATP A "C2'" 1 
HETATM 5287 O  "O2'" . ATP D 4 .   ? -23.033 0.651   -11.745 1.00 20.06 ?  401 ATP A "O2'" 1 
HETATM 5288 C  "C1'" . ATP D 4 .   ? -22.768 -1.463  -10.708 1.00 16.16 ?  401 ATP A "C1'" 1 
HETATM 5289 N  N9    . ATP D 4 .   ? -23.474 -2.676  -10.220 1.00 13.88 ?  401 ATP A N9    1 
HETATM 5290 C  C8    . ATP D 4 .   ? -23.160 -3.365  -9.098  1.00 14.65 ?  401 ATP A C8    1 
HETATM 5291 N  N7    . ATP D 4 .   ? -23.901 -4.486  -8.991  1.00 13.94 ?  401 ATP A N7    1 
HETATM 5292 C  C5    . ATP D 4 .   ? -24.733 -4.515  -10.091 1.00 13.35 ?  401 ATP A C5    1 
HETATM 5293 C  C6    . ATP D 4 .   ? -25.719 -5.480  -10.528 1.00 14.27 ?  401 ATP A C6    1 
HETATM 5294 N  N6    . ATP D 4 .   ? -25.992 -6.587  -9.796  1.00 15.48 ?  401 ATP A N6    1 
HETATM 5295 N  N1    . ATP D 4 .   ? -26.299 -5.180  -11.712 1.00 14.05 ?  401 ATP A N1    1 
HETATM 5296 C  C2    . ATP D 4 .   ? -25.995 -4.068  -12.407 1.00 14.67 ?  401 ATP A C2    1 
HETATM 5297 N  N3    . ATP D 4 .   ? -25.091 -3.159  -12.051 1.00 14.52 ?  401 ATP A N3    1 
HETATM 5298 C  C4    . ATP D 4 .   ? -24.414 -3.359  -10.896 1.00 13.30 ?  401 ATP A C4    1 
HETATM 5299 MG MG    . MG  E 5 .   ? -23.218 0.227   -1.000  1.00 14.49 2  402 MG  A MG    1 
HETATM 5300 CL CL    . CL  F 6 .   ? -18.753 12.808  14.693  1.00 16.83 -1 403 CL  A CL    1 
HETATM 5301 C  C1    . BTB G 7 .   ? -8.973  -12.586 -0.034  1.00 22.68 ?  404 BTB A C1    1 
HETATM 5302 O  O1    . BTB G 7 .   ? -8.621  -13.855 0.459   1.00 27.58 ?  404 BTB A O1    1 
HETATM 5303 C  C2    . BTB G 7 .   ? -10.429 -12.638 -0.563  1.00 20.86 ?  404 BTB A C2    1 
HETATM 5304 C  C3    . BTB G 7 .   ? -10.452 -13.404 -1.909  1.00 22.54 ?  404 BTB A C3    1 
HETATM 5305 O  O3    . BTB G 7 .   ? -9.477  -12.876 -2.811  1.00 20.99 ?  404 BTB A O3    1 
HETATM 5306 C  C4    . BTB G 7 .   ? -10.821 -11.154 -0.768  1.00 21.17 ?  404 BTB A C4    1 
HETATM 5307 O  O4    . BTB G 7 .   ? -11.974 -11.010 -1.605  1.00 23.14 ?  404 BTB A O4    1 
HETATM 5308 N  N     . BTB G 7 .   ? -11.249 -13.410 0.386   1.00 27.59 ?  404 BTB A N     1 
HETATM 5309 C  C5    . BTB G 7 .   ? -11.331 -12.791 1.715   1.00 28.13 ?  404 BTB A C5    1 
HETATM 5310 C  C6    . BTB G 7 .   ? -11.627 -13.874 2.760   1.00 29.90 ?  404 BTB A C6    1 
HETATM 5311 O  O6    . BTB G 7 .   ? -10.561 -14.779 2.703   1.00 30.28 ?  404 BTB A O6    1 
HETATM 5312 C  C7    . BTB G 7 .   ? -12.650 -13.498 -0.127  1.00 25.01 ?  404 BTB A C7    1 
HETATM 5313 C  C8    . BTB G 7 .   ? -13.060 -14.897 -0.573  1.00 32.21 ?  404 BTB A C8    1 
HETATM 5314 O  O8    . BTB G 7 .   ? -12.626 -15.843 0.331   1.00 32.77 ?  404 BTB A O8    1 
HETATM 5315 C  C1    . BTB H 7 .   ? -12.312 -15.364 -18.267 1.00 30.16 ?  405 BTB A C1    1 
HETATM 5316 O  O1    . BTB H 7 .   ? -11.143 -15.046 -19.056 1.00 30.16 ?  405 BTB A O1    1 
HETATM 5317 C  C2    . BTB H 7 .   ? -11.905 -16.140 -16.981 1.00 30.16 ?  405 BTB A C2    1 
HETATM 5318 C  C3    . BTB H 7 .   ? -10.379 -15.905 -16.997 1.00 30.16 ?  405 BTB A C3    1 
HETATM 5319 O  O3    . BTB H 7 .   ? -9.886  -14.702 -16.361 1.00 30.16 ?  405 BTB A O3    1 
HETATM 5320 C  C4    . BTB H 7 .   ? -12.217 -17.639 -17.205 1.00 30.16 ?  405 BTB A C4    1 
HETATM 5321 O  O4    . BTB H 7 .   ? -11.127 -18.287 -17.823 1.00 30.16 ?  405 BTB A O4    1 
HETATM 5322 N  N     . BTB H 7 .   ? -12.635 -15.830 -15.689 1.00 30.16 ?  405 BTB A N     1 
HETATM 5323 C  C5    . BTB H 7 .   ? -12.338 -14.633 -14.928 1.00 30.16 ?  405 BTB A C5    1 
HETATM 5324 C  C6    . BTB H 7 .   ? -11.356 -15.056 -13.835 1.00 30.16 ?  405 BTB A C6    1 
HETATM 5325 O  O6    . BTB H 7 .   ? -10.897 -16.343 -14.080 1.00 30.16 ?  405 BTB A O6    1 
HETATM 5326 C  C7    . BTB H 7 .   ? -13.852 -16.523 -15.262 1.00 30.16 ?  405 BTB A C7    1 
HETATM 5327 C  C8    . BTB H 7 .   ? -13.887 -17.503 -14.085 1.00 30.16 ?  405 BTB A C8    1 
HETATM 5328 O  O8    . BTB H 7 .   ? -13.397 -18.871 -14.158 1.00 30.16 ?  405 BTB A O8    1 
HETATM 5329 O  O     . HOH I 8 .   ? -54.668 4.476   3.836   1.00 25.26 ?  501 HOH A O     1 
HETATM 5330 O  O     . HOH I 8 .   ? -35.212 3.434   -12.474 1.00 48.94 ?  502 HOH A O     1 
HETATM 5331 O  O     . HOH I 8 .   ? -39.982 11.742  -12.556 1.00 52.59 ?  503 HOH A O     1 
HETATM 5332 O  O     . HOH I 8 .   ? -35.927 5.576   19.574  1.00 41.97 ?  504 HOH A O     1 
HETATM 5333 O  O     . HOH I 8 .   ? -14.415 -20.658 -15.188 1.00 53.41 ?  505 HOH A O     1 
HETATM 5334 O  O     . HOH I 8 .   ? -19.895 -6.924  7.596   1.00 42.79 ?  506 HOH A O     1 
HETATM 5335 O  O     . HOH I 8 .   ? -10.563 -11.931 -21.219 1.00 46.43 ?  507 HOH A O     1 
HETATM 5336 O  O     . HOH I 8 .   ? -34.640 -15.285 5.286   1.00 38.81 ?  508 HOH A O     1 
HETATM 5337 O  O     . HOH I 8 .   ? -41.240 15.798  -9.228  1.00 40.51 ?  509 HOH A O     1 
HETATM 5338 O  O     . HOH I 8 .   ? -24.456 2.535   -6.649  1.00 25.95 ?  510 HOH A O     1 
HETATM 5339 O  O     . HOH I 8 .   ? -45.253 9.275   -5.969  1.00 49.26 ?  511 HOH A O     1 
HETATM 5340 O  O     . HOH I 8 .   ? -17.961 -17.766 -14.603 1.00 31.62 ?  512 HOH A O     1 
HETATM 5341 O  O     . HOH I 8 .   ? -32.409 -14.309 12.729  1.00 54.92 ?  513 HOH A O     1 
HETATM 5342 O  O     . HOH I 8 .   ? -26.155 -17.384 -14.213 1.00 45.87 ?  514 HOH A O     1 
HETATM 5343 O  O     . HOH I 8 .   ? -13.126 5.673   -16.238 1.00 41.00 ?  515 HOH A O     1 
HETATM 5344 O  O     . HOH I 8 .   ? -19.901 7.519   -15.691 1.00 47.60 ?  516 HOH A O     1 
HETATM 5345 O  O     . HOH I 8 .   ? -19.428 -1.944  1.993   1.00 28.79 ?  517 HOH A O     1 
HETATM 5346 O  O     . HOH I 8 .   ? -46.341 14.999  2.824   1.00 45.11 ?  518 HOH A O     1 
HETATM 5347 O  O     . HOH I 8 .   ? -28.977 -14.563 -12.760 1.00 33.10 ?  519 HOH A O     1 
HETATM 5348 O  O     . HOH I 8 .   ? -36.591 -12.740 2.234   1.00 28.52 ?  520 HOH A O     1 
HETATM 5349 O  O     . HOH I 8 .   ? -14.389 -5.597  -9.377  1.00 20.50 ?  521 HOH A O     1 
HETATM 5350 O  O     . HOH I 8 .   ? -27.406 15.132  21.987  1.00 33.73 ?  522 HOH A O     1 
HETATM 5351 O  O     . HOH I 8 .   ? -41.891 -9.233  10.529  1.00 28.45 ?  523 HOH A O     1 
HETATM 5352 O  O     . HOH I 8 .   ? -36.371 -21.144 -0.486  1.00 32.31 ?  524 HOH A O     1 
HETATM 5353 O  O     . HOH I 8 .   ? -27.284 0.680   -21.735 1.00 35.56 ?  525 HOH A O     1 
HETATM 5354 O  O     . HOH I 8 .   ? -22.588 13.230  11.900  1.00 20.73 ?  526 HOH A O     1 
HETATM 5355 O  O     . HOH I 8 .   ? -21.420 -5.493  -27.832 1.00 20.24 ?  527 HOH A O     1 
HETATM 5356 O  O     . HOH I 8 .   ? -38.205 -12.189 8.786   1.00 42.74 ?  528 HOH A O     1 
HETATM 5357 O  O     . HOH I 8 .   ? -29.690 0.086   23.913  1.00 25.84 ?  529 HOH A O     1 
HETATM 5358 O  O     . HOH I 8 .   ? -9.657  -2.335  -28.805 1.00 20.64 ?  530 HOH A O     1 
HETATM 5359 O  O     . HOH I 8 .   ? -24.371 -3.310  13.040  1.00 35.13 ?  531 HOH A O     1 
HETATM 5360 O  O     . HOH I 8 .   ? -38.370 20.709  -2.187  1.00 24.26 ?  532 HOH A O     1 
HETATM 5361 O  O     . HOH I 8 .   ? -21.743 -14.638 8.521   1.00 28.38 ?  533 HOH A O     1 
HETATM 5362 O  O     . HOH I 8 .   ? -9.633  6.519   -14.182 1.00 29.20 ?  534 HOH A O     1 
HETATM 5363 O  O     . HOH I 8 .   ? -24.721 5.829   -25.781 1.00 39.34 ?  535 HOH A O     1 
HETATM 5364 O  O     . HOH I 8 .   ? -28.085 11.771  2.947   1.00 26.97 ?  536 HOH A O     1 
HETATM 5365 O  O     . HOH I 8 .   ? -22.593 1.891   0.105   1.00 14.14 ?  537 HOH A O     1 
HETATM 5366 O  O     . HOH I 8 .   ? -38.374 15.983  3.366   1.00 21.62 ?  538 HOH A O     1 
HETATM 5367 O  O     . HOH I 8 .   ? -18.111 -10.405 -6.660  1.00 18.38 ?  539 HOH A O     1 
HETATM 5368 O  O     . HOH I 8 .   ? -16.545 -9.696  -25.016 1.00 24.63 ?  540 HOH A O     1 
HETATM 5369 O  O     . HOH I 8 .   ? -7.489  -9.187  -28.164 1.00 31.91 ?  541 HOH A O     1 
HETATM 5370 O  O     . HOH I 8 .   ? -32.003 -9.067  -14.828 1.00 22.87 ?  542 HOH A O     1 
HETATM 5371 O  O     . HOH I 8 .   ? -26.819 -24.228 2.321   1.00 33.40 ?  543 HOH A O     1 
HETATM 5372 O  O     . HOH I 8 .   ? -16.238 -15.816 -13.565 1.00 19.66 ?  544 HOH A O     1 
HETATM 5373 O  O     . HOH I 8 .   ? -42.622 9.147   16.962  1.00 28.30 ?  545 HOH A O     1 
HETATM 5374 O  O     . HOH I 8 .   ? -29.143 14.209  25.235  1.00 51.66 ?  546 HOH A O     1 
HETATM 5375 O  O     . HOH I 8 .   ? -12.302 -22.092 -13.323 1.00 42.92 ?  547 HOH A O     1 
HETATM 5376 O  O     . HOH I 8 .   ? -24.109 -0.681  0.642   1.00 14.99 ?  548 HOH A O     1 
HETATM 5377 O  O     . HOH I 8 .   ? -8.602  -3.793  -26.616 1.00 24.21 ?  549 HOH A O     1 
HETATM 5378 O  O     . HOH I 8 .   ? -52.392 -3.007  13.890  1.00 48.52 ?  550 HOH A O     1 
HETATM 5379 O  O     . HOH I 8 .   ? -12.487 0.957   -29.614 1.00 28.24 ?  551 HOH A O     1 
HETATM 5380 O  O     . HOH I 8 .   ? -19.150 5.891   3.490   1.00 19.48 ?  552 HOH A O     1 
HETATM 5381 O  O     . HOH I 8 .   ? -39.305 -2.586  18.699  1.00 28.49 ?  553 HOH A O     1 
HETATM 5382 O  O     . HOH I 8 .   ? -12.827 5.955   -11.363 1.00 39.66 ?  554 HOH A O     1 
HETATM 5383 O  O     . HOH I 8 .   ? -22.306 9.990   22.884  1.00 18.40 ?  555 HOH A O     1 
HETATM 5384 O  O     . HOH I 8 .   ? -43.883 18.174  1.947   1.00 35.59 ?  556 HOH A O     1 
HETATM 5385 O  O     . HOH I 8 .   ? -23.208 2.360   -15.817 1.00 25.73 ?  557 HOH A O     1 
HETATM 5386 O  O     . HOH I 8 .   ? -40.671 14.929  4.947   1.00 34.24 ?  558 HOH A O     1 
HETATM 5387 O  O     . HOH I 8 .   ? -38.115 -11.351 -12.962 1.00 43.06 ?  559 HOH A O     1 
HETATM 5388 O  O     . HOH I 8 .   ? -39.659 0.221   -15.958 1.00 37.61 ?  560 HOH A O     1 
HETATM 5389 O  O     . HOH I 8 .   ? -47.842 11.107  9.276   1.00 28.31 ?  561 HOH A O     1 
HETATM 5390 O  O     . HOH I 8 .   ? -35.484 19.743  -1.894  1.00 32.99 ?  562 HOH A O     1 
HETATM 5391 O  O     . HOH I 8 .   ? -32.856 1.851   -13.753 1.00 38.81 ?  563 HOH A O     1 
HETATM 5392 O  O     . HOH I 8 .   ? -39.287 -13.275 5.506   1.00 48.14 ?  564 HOH A O     1 
HETATM 5393 O  O     . HOH I 8 .   ? -18.394 12.588  9.623   1.00 21.38 ?  565 HOH A O     1 
HETATM 5394 O  O     . HOH I 8 .   ? -32.276 -0.409  -19.484 1.00 41.74 ?  566 HOH A O     1 
HETATM 5395 O  O     . HOH I 8 .   ? -35.579 -13.756 -10.249 1.00 30.19 ?  567 HOH A O     1 
HETATM 5396 O  O     . HOH I 8 .   ? -40.572 8.639   18.809  1.00 31.47 ?  568 HOH A O     1 
HETATM 5397 O  O     . HOH I 8 .   ? -49.688 -3.860  13.722  1.00 33.71 ?  569 HOH A O     1 
HETATM 5398 O  O     . HOH I 8 .   ? -40.419 13.004  -4.946  1.00 20.93 ?  570 HOH A O     1 
HETATM 5399 O  O     . HOH I 8 .   ? -22.531 -18.089 -9.499  1.00 20.55 ?  571 HOH A O     1 
HETATM 5400 O  O     . HOH I 8 .   ? -48.367 8.501   10.026  1.00 29.77 ?  572 HOH A O     1 
HETATM 5401 O  O     . HOH I 8 .   ? -22.221 1.233   -2.687  1.00 11.68 ?  573 HOH A O     1 
HETATM 5402 O  O     . HOH I 8 .   ? -22.236 -12.430 -1.116  1.00 22.62 ?  574 HOH A O     1 
HETATM 5403 O  O     . HOH I 8 .   ? -40.208 14.769  17.051  1.00 31.27 ?  575 HOH A O     1 
HETATM 5404 O  O     . HOH I 8 .   ? -7.454  -5.521  -17.283 1.00 35.08 ?  576 HOH A O     1 
HETATM 5405 O  O     . HOH I 8 .   ? -9.883  -6.638  -8.960  1.00 18.30 ?  577 HOH A O     1 
HETATM 5406 O  O     . HOH I 8 .   ? -28.875 -1.678  -17.978 1.00 27.72 ?  578 HOH A O     1 
HETATM 5407 O  O     . HOH I 8 .   ? -34.644 16.373  -2.009  1.00 25.61 ?  579 HOH A O     1 
HETATM 5408 O  O     . HOH I 8 .   ? -18.293 -23.616 -0.482  1.00 41.89 ?  580 HOH A O     1 
HETATM 5409 O  O     . HOH I 8 .   ? -43.011 4.003   2.458   1.00 22.85 ?  581 HOH A O     1 
HETATM 5410 O  O     . HOH I 8 .   ? -26.582 -15.124 -14.030 1.00 35.12 ?  582 HOH A O     1 
HETATM 5411 O  O     . HOH I 8 .   ? -52.611 -4.933  5.924   1.00 39.21 ?  583 HOH A O     1 
HETATM 5412 O  O     . HOH I 8 .   ? -39.621 -7.617  -17.518 1.00 41.15 ?  584 HOH A O     1 
HETATM 5413 O  O     . HOH I 8 .   ? -40.133 12.399  4.242   1.00 18.85 ?  585 HOH A O     1 
HETATM 5414 O  O     . HOH I 8 .   ? -42.412 17.778  10.470  1.00 21.05 ?  586 HOH A O     1 
HETATM 5415 O  O     . HOH I 8 .   ? -8.059  -15.145 -3.422  1.00 22.52 ?  587 HOH A O     1 
HETATM 5416 O  O     . HOH I 8 .   ? -31.572 3.285   -11.832 1.00 45.30 ?  588 HOH A O     1 
HETATM 5417 O  O     . HOH I 8 .   ? -29.982 3.457   22.285  1.00 24.30 ?  589 HOH A O     1 
HETATM 5418 O  O     . HOH I 8 .   ? -55.346 -3.678  2.975   1.00 42.35 ?  590 HOH A O     1 
HETATM 5419 O  O     . HOH I 8 .   ? -35.272 -7.026  20.066  1.00 46.42 ?  591 HOH A O     1 
HETATM 5420 O  O     . HOH I 8 .   ? -8.135  -19.506 -2.786  1.00 36.77 ?  592 HOH A O     1 
HETATM 5421 O  O     . HOH I 8 .   ? -14.682 -12.588 -22.979 1.00 35.06 ?  593 HOH A O     1 
HETATM 5422 O  O     . HOH I 8 .   ? -27.673 -1.826  -15.441 1.00 18.40 ?  594 HOH A O     1 
HETATM 5423 O  O     . HOH I 8 .   ? -12.558 -7.308  -8.345  1.00 15.97 ?  595 HOH A O     1 
HETATM 5424 O  O     . HOH I 8 .   ? -39.553 2.350   -13.614 1.00 42.03 ?  596 HOH A O     1 
HETATM 5425 O  O     . HOH I 8 .   ? -15.248 7.091   19.324  1.00 15.89 ?  597 HOH A O     1 
HETATM 5426 O  O     . HOH I 8 .   ? -35.143 -0.414  21.340  1.00 36.54 ?  598 HOH A O     1 
HETATM 5427 O  O     . HOH I 8 .   ? -31.257 9.968   -0.453  1.00 26.97 ?  599 HOH A O     1 
HETATM 5428 O  O     . HOH I 8 .   ? -37.648 -4.565  19.708  1.00 34.11 ?  600 HOH A O     1 
HETATM 5429 O  O     . HOH I 8 .   ? -13.600 9.514   -21.812 1.00 42.12 ?  601 HOH A O     1 
HETATM 5430 O  O     . HOH I 8 .   ? -39.032 15.827  15.119  1.00 23.06 ?  602 HOH A O     1 
HETATM 5431 O  O     . HOH I 8 .   ? -44.818 -6.443  1.418   1.00 32.93 ?  603 HOH A O     1 
HETATM 5432 O  O     . HOH I 8 .   ? -13.024 -8.447  -1.407  1.00 30.99 ?  604 HOH A O     1 
HETATM 5433 O  O     . HOH I 8 .   ? -22.890 4.729   -26.998 1.00 49.28 ?  605 HOH A O     1 
HETATM 5434 O  O     . HOH I 8 .   ? -22.068 -24.935 -12.504 1.00 37.29 ?  606 HOH A O     1 
HETATM 5435 O  O     . HOH I 8 .   ? -30.647 -10.441 -11.679 1.00 20.77 ?  607 HOH A O     1 
HETATM 5436 O  O     . HOH I 8 .   ? -29.624 -12.294 -5.246  1.00 18.56 ?  608 HOH A O     1 
HETATM 5437 O  O     . HOH I 8 .   ? -23.056 5.407   0.486   1.00 26.94 ?  609 HOH A O     1 
HETATM 5438 O  O     . HOH I 8 .   ? -16.666 0.448   -11.210 1.00 17.26 ?  610 HOH A O     1 
HETATM 5439 O  O     . HOH I 8 .   ? -21.285 4.808   -13.298 1.00 39.12 ?  611 HOH A O     1 
HETATM 5440 O  O     . HOH I 8 .   ? -23.236 -20.543 -8.358  1.00 22.89 ?  612 HOH A O     1 
HETATM 5441 O  O     . HOH I 8 .   ? -26.216 2.820   -20.429 1.00 30.86 ?  613 HOH A O     1 
HETATM 5442 O  O     . HOH I 8 .   ? -25.614 -5.871  9.469   1.00 34.83 ?  614 HOH A O     1 
HETATM 5443 O  O     . HOH I 8 .   ? -34.146 -20.256 -7.621  1.00 46.07 ?  615 HOH A O     1 
HETATM 5444 O  O     . HOH I 8 .   ? -9.095  -1.390  -10.811 1.00 21.22 ?  616 HOH A O     1 
HETATM 5445 O  O     . HOH I 8 .   ? -13.576 7.138   17.078  1.00 15.25 ?  617 HOH A O     1 
HETATM 5446 O  O     . HOH I 8 .   ? -7.561  -15.747 -5.948  1.00 21.85 ?  618 HOH A O     1 
HETATM 5447 O  O     . HOH I 8 .   ? -42.107 -11.394 6.559   1.00 37.93 ?  619 HOH A O     1 
HETATM 5448 O  O     . HOH I 8 .   ? -16.223 5.629   9.004   1.00 16.06 ?  620 HOH A O     1 
HETATM 5449 O  O     . HOH I 8 .   ? -19.624 -1.041  -31.586 1.00 24.96 ?  621 HOH A O     1 
HETATM 5450 O  O     . HOH I 8 .   ? -43.914 1.123   14.206  1.00 34.02 ?  622 HOH A O     1 
HETATM 5451 O  O     . HOH I 8 .   ? -28.285 -14.698 -10.163 1.00 21.80 ?  623 HOH A O     1 
HETATM 5452 O  O     . HOH I 8 .   ? -52.302 4.367   13.823  1.00 34.52 ?  624 HOH A O     1 
HETATM 5453 O  O     . HOH I 8 .   ? -28.598 11.149  -4.741  1.00 36.60 ?  625 HOH A O     1 
HETATM 5454 O  O     . HOH I 8 .   ? -21.737 3.119   -11.302 1.00 33.56 ?  626 HOH A O     1 
HETATM 5455 O  O     . HOH I 8 .   ? -34.152 13.142  20.244  1.00 22.86 ?  627 HOH A O     1 
HETATM 5456 O  O     . HOH I 8 .   ? -49.824 9.138   12.515  1.00 29.98 ?  628 HOH A O     1 
HETATM 5457 O  O     . HOH I 8 .   ? -21.827 1.063   -29.001 1.00 26.23 ?  629 HOH A O     1 
HETATM 5458 O  O     . HOH I 8 .   ? -6.277  9.698   -22.316 1.00 38.08 ?  630 HOH A O     1 
HETATM 5459 O  O     . HOH I 8 .   ? -14.886 -19.123 2.602   1.00 47.29 ?  631 HOH A O     1 
HETATM 5460 O  O     . HOH I 8 .   ? -18.052 -14.984 -20.625 1.00 46.74 ?  632 HOH A O     1 
HETATM 5461 O  O     . HOH I 8 .   ? -25.071 -1.538  -14.374 1.00 26.42 ?  633 HOH A O     1 
HETATM 5462 O  O     . HOH I 8 .   ? -29.891 17.189  12.818  1.00 40.90 ?  634 HOH A O     1 
HETATM 5463 O  O     . HOH I 8 .   ? -46.187 5.801   8.334   1.00 18.46 ?  635 HOH A O     1 
HETATM 5464 O  O     . HOH I 8 .   ? -26.871 -17.274 18.778  1.00 51.98 ?  636 HOH A O     1 
HETATM 5465 O  O     . HOH I 8 .   ? -6.404  -14.778 -1.051  1.00 34.04 ?  637 HOH A O     1 
HETATM 5466 O  O     . HOH I 8 .   ? -25.286 -5.142  -20.796 1.00 20.88 ?  638 HOH A O     1 
HETATM 5467 O  O     . HOH I 8 .   ? -17.995 10.218  -25.189 1.00 43.09 ?  639 HOH A O     1 
HETATM 5468 O  O     . HOH I 8 .   ? -49.608 4.819   8.762   1.00 40.07 ?  640 HOH A O     1 
HETATM 5469 O  O     . HOH I 8 .   ? -28.351 -5.135  5.605   1.00 23.77 ?  641 HOH A O     1 
HETATM 5470 O  O     . HOH I 8 .   ? -46.123 2.747   14.100  1.00 21.26 ?  642 HOH A O     1 
HETATM 5471 O  O     . HOH I 8 .   ? -40.898 -13.048 11.783  1.00 44.28 ?  643 HOH A O     1 
HETATM 5472 O  O     . HOH I 8 .   ? -22.589 -20.258 -12.720 1.00 39.79 ?  644 HOH A O     1 
HETATM 5473 O  O     . HOH I 8 .   ? -42.173 -13.085 21.457  1.00 49.67 ?  645 HOH A O     1 
HETATM 5474 O  O     . HOH I 8 .   ? -10.891 8.846   -20.634 1.00 33.30 ?  646 HOH A O     1 
HETATM 5475 O  O     . HOH I 8 .   ? -40.020 -1.177  20.882  1.00 40.50 ?  647 HOH A O     1 
HETATM 5476 O  O     . HOH I 8 .   ? -32.544 13.188  4.331   1.00 19.26 ?  648 HOH A O     1 
HETATM 5477 O  O     . HOH I 8 .   ? -47.128 17.544  5.725   1.00 40.50 ?  649 HOH A O     1 
HETATM 5478 O  O     . HOH I 8 .   ? -41.931 18.280  -2.111  1.00 40.89 ?  650 HOH A O     1 
HETATM 5479 O  O     . HOH I 8 .   ? -43.647 -10.599 -0.561  1.00 35.37 ?  651 HOH A O     1 
HETATM 5480 O  O     . HOH I 8 .   ? -25.642 -3.255  -23.109 1.00 30.87 ?  652 HOH A O     1 
HETATM 5481 O  O     . HOH I 8 .   ? -23.223 -22.087 -10.681 1.00 24.94 ?  653 HOH A O     1 
HETATM 5482 O  O     . HOH I 8 .   ? -7.980  8.655   -20.292 1.00 31.04 ?  654 HOH A O     1 
HETATM 5483 O  O     . HOH I 8 .   ? -33.682 5.377   24.587  1.00 35.69 ?  655 HOH A O     1 
HETATM 5484 O  O     . HOH I 8 .   ? -43.306 11.244  -7.135  1.00 29.12 ?  656 HOH A O     1 
HETATM 5485 O  O     . HOH I 8 .   ? -48.049 6.746   21.055  1.00 30.13 ?  657 HOH A O     1 
HETATM 5486 O  O     . HOH I 8 .   ? -19.777 3.944   11.366  1.00 15.85 ?  658 HOH A O     1 
HETATM 5487 O  O     . HOH I 8 .   ? -46.414 14.926  14.732  1.00 35.85 ?  659 HOH A O     1 
HETATM 5488 O  O     . HOH I 8 .   ? -32.187 16.024  13.442  1.00 22.06 ?  660 HOH A O     1 
HETATM 5489 O  O     . HOH I 8 .   ? -49.424 -3.578  -10.902 1.00 38.11 ?  661 HOH A O     1 
HETATM 5490 O  O     . HOH I 8 .   ? -25.128 -20.558 -13.684 1.00 38.02 ?  662 HOH A O     1 
HETATM 5491 O  O     . HOH I 8 .   ? -29.560 -6.851  9.217   1.00 46.40 ?  663 HOH A O     1 
HETATM 5492 O  O     . HOH I 8 .   ? -18.584 -15.800 -16.395 1.00 24.77 ?  664 HOH A O     1 
HETATM 5493 O  O     . HOH I 8 .   ? -51.880 8.016   6.059   1.00 37.86 ?  665 HOH A O     1 
HETATM 5494 O  O     . HOH I 8 .   ? -24.766 -7.588  -22.308 1.00 21.81 ?  666 HOH A O     1 
HETATM 5495 O  O     . HOH I 8 .   ? -48.683 11.705  4.973   1.00 31.98 ?  667 HOH A O     1 
HETATM 5496 O  O     . HOH I 8 .   ? -36.908 -12.273 15.727  1.00 38.72 ?  668 HOH A O     1 
HETATM 5497 O  O     . HOH I 8 .   ? -8.070  -5.173  -12.591 1.00 20.39 ?  669 HOH A O     1 
HETATM 5498 O  O     . HOH I 8 .   ? -17.364 -4.496  -30.273 1.00 14.65 ?  670 HOH A O     1 
HETATM 5499 O  O     . HOH I 8 .   ? -46.802 -8.828  -3.555  1.00 41.53 ?  671 HOH A O     1 
HETATM 5500 O  O     . HOH I 8 .   ? -7.662  1.141   -26.396 1.00 30.87 ?  672 HOH A O     1 
HETATM 5501 O  O     . HOH I 8 .   ? -35.756 -19.141 -3.341  1.00 33.68 ?  673 HOH A O     1 
HETATM 5502 O  O     . HOH I 8 .   ? -23.011 -0.349  -15.304 1.00 32.31 ?  674 HOH A O     1 
HETATM 5503 O  O     . HOH I 8 .   ? -31.775 8.289   -7.415  1.00 27.75 ?  675 HOH A O     1 
HETATM 5504 O  O     . HOH I 8 .   ? -37.901 -6.772  -19.205 1.00 45.55 ?  676 HOH A O     1 
HETATM 5505 O  O     . HOH I 8 .   ? -21.863 -11.120 -20.565 1.00 18.10 ?  677 HOH A O     1 
HETATM 5506 O  O     . HOH I 8 .   ? -24.343 -3.128  15.368  1.00 27.50 ?  678 HOH A O     1 
HETATM 5507 O  O     . HOH I 8 .   ? -25.212 2.957   -11.583 1.00 36.21 ?  679 HOH A O     1 
HETATM 5508 O  O     . HOH I 8 .   ? -42.968 2.631   -10.901 1.00 36.11 ?  680 HOH A O     1 
HETATM 5509 O  O     . HOH I 8 .   ? -21.895 4.220   14.613  1.00 21.67 ?  681 HOH A O     1 
HETATM 5510 O  O     . HOH I 8 .   ? -22.078 -5.429  12.810  1.00 38.64 ?  682 HOH A O     1 
HETATM 5511 O  O     . HOH I 8 .   ? -7.594  -13.516 -10.848 1.00 20.94 ?  683 HOH A O     1 
HETATM 5512 O  O     . HOH I 8 .   ? -14.854 1.718   -30.023 1.00 29.06 ?  684 HOH A O     1 
HETATM 5513 O  O     . HOH I 8 .   ? -22.701 -2.445  2.302   1.00 19.54 ?  685 HOH A O     1 
HETATM 5514 O  O     . HOH I 8 .   ? -6.064  -8.161  -16.390 1.00 48.24 ?  686 HOH A O     1 
HETATM 5515 O  O     . HOH I 8 .   ? -11.974 -22.357 -1.709  1.00 48.83 ?  687 HOH A O     1 
HETATM 5516 O  O     . HOH I 8 .   ? -48.813 -5.319  6.728   1.00 36.86 ?  688 HOH A O     1 
HETATM 5517 O  O     . HOH I 8 .   ? -28.019 -11.610 -15.112 1.00 29.46 ?  689 HOH A O     1 
HETATM 5518 O  O     . HOH I 8 .   ? -11.095 6.953   -27.345 1.00 34.04 ?  690 HOH A O     1 
HETATM 5519 O  O     . HOH I 8 .   ? -26.836 3.849   8.439   1.00 32.60 ?  691 HOH A O     1 
HETATM 5520 O  O     . HOH I 8 .   ? -31.558 -19.921 9.345   1.00 47.82 ?  692 HOH A O     1 
HETATM 5521 O  O     . HOH I 8 .   ? -16.018 1.664   -7.799  1.00 14.52 ?  693 HOH A O     1 
HETATM 5522 O  O     . HOH I 8 .   ? -41.027 -11.176 -1.429  1.00 31.84 ?  694 HOH A O     1 
HETATM 5523 O  O     . HOH I 8 .   ? -15.932 5.732   -28.644 1.00 30.57 ?  695 HOH A O     1 
HETATM 5524 O  O     . HOH I 8 .   ? -34.444 -11.113 -16.569 1.00 41.33 ?  696 HOH A O     1 
HETATM 5525 O  O     . HOH I 8 .   ? -36.354 -13.419 4.716   1.00 28.64 ?  697 HOH A O     1 
HETATM 5526 O  O     . HOH I 8 .   ? -27.078 -2.714  23.014  1.00 53.37 ?  698 HOH A O     1 
HETATM 5527 O  O     . HOH I 8 .   ? -32.494 -11.921 12.863  1.00 46.71 ?  699 HOH A O     1 
HETATM 5528 O  O     . HOH I 8 .   ? -45.533 5.262   -5.921  1.00 44.97 ?  700 HOH A O     1 
HETATM 5529 O  O     . HOH I 8 .   ? -42.481 -6.187  -16.706 1.00 44.70 ?  701 HOH A O     1 
HETATM 5530 O  O     . HOH I 8 .   ? -48.470 4.070   -1.291  1.00 31.08 ?  702 HOH A O     1 
HETATM 5531 O  O     . HOH I 8 .   ? -33.428 -3.642  21.798  1.00 42.10 ?  703 HOH A O     1 
HETATM 5532 O  O     . HOH I 8 .   ? -14.399 2.083   -10.852 1.00 26.63 ?  704 HOH A O     1 
HETATM 5533 O  O     . HOH I 8 .   ? -6.475  -3.191  -17.849 1.00 42.59 ?  705 HOH A O     1 
HETATM 5534 O  O     . HOH I 8 .   ? -44.233 -4.905  6.747   1.00 31.02 ?  706 HOH A O     1 
HETATM 5535 O  O     . HOH I 8 .   ? -48.363 -4.956  3.572   1.00 39.60 ?  707 HOH A O     1 
HETATM 5536 O  O     . HOH I 8 .   ? -29.905 2.202   -10.071 1.00 32.25 ?  708 HOH A O     1 
HETATM 5537 O  O     . HOH I 8 .   ? -43.377 5.113   -0.143  1.00 28.59 ?  709 HOH A O     1 
HETATM 5538 O  O     . HOH I 8 .   ? -36.473 -14.930 -4.567  1.00 37.31 ?  710 HOH A O     1 
HETATM 5539 O  O     . HOH I 8 .   ? -43.824 -9.480  7.155   1.00 42.08 ?  711 HOH A O     1 
HETATM 5540 O  O     . HOH I 8 .   ? -46.342 7.984   -1.707  1.00 45.50 ?  712 HOH A O     1 
HETATM 5541 O  O     . HOH I 8 .   ? -47.723 9.718   2.563   1.00 27.32 ?  713 HOH A O     1 
HETATM 5542 O  O     . HOH I 8 .   ? -3.421  -20.004 -8.266  1.00 49.72 ?  714 HOH A O     1 
HETATM 5543 O  O     . HOH I 8 .   ? -9.612  -10.230 -25.398 1.00 44.58 ?  715 HOH A O     1 
HETATM 5544 O  O     . HOH I 8 .   ? -48.926 13.250  11.176  1.00 48.85 ?  716 HOH A O     1 
HETATM 5545 O  O     . HOH I 8 .   ? -8.495  -14.521 -13.245 1.00 29.64 ?  717 HOH A O     1 
HETATM 5546 O  O     . HOH I 8 .   ? -5.416  1.375   -24.870 1.00 49.62 ?  718 HOH A O     1 
HETATM 5547 O  O     . HOH I 8 .   ? -38.510 10.526  18.201  1.00 31.89 ?  719 HOH A O     1 
HETATM 5548 O  O     . HOH I 8 .   ? -31.188 12.008  1.884   1.00 13.34 ?  720 HOH A O     1 
HETATM 5549 O  O     . HOH I 8 .   ? -11.018 3.374   -27.921 1.00 38.56 ?  721 HOH A O     1 
HETATM 5550 O  O     . HOH I 8 .   ? -33.777 -13.910 -12.839 1.00 42.28 ?  722 HOH A O     1 
HETATM 5551 O  O     . HOH I 8 .   ? -30.618 -4.632  22.501  1.00 48.05 ?  723 HOH A O     1 
HETATM 5552 O  O     . HOH I 8 .   ? -17.706 5.466   -13.496 1.00 41.18 ?  724 HOH A O     1 
HETATM 5553 O  O     . HOH I 8 .   ? -31.305 -12.635 -13.133 1.00 43.89 ?  725 HOH A O     1 
HETATM 5554 O  O     . HOH I 8 .   ? -36.508 -14.666 13.868  1.00 48.93 ?  726 HOH A O     1 
HETATM 5555 O  O     . HOH I 8 .   ? -22.103 5.873   17.231  1.00 28.90 ?  727 HOH A O     1 
HETATM 5556 O  O     . HOH I 8 .   ? -40.954 -13.558 -3.394  1.00 37.22 ?  728 HOH A O     1 
HETATM 5557 O  O     . HOH I 8 .   ? -19.136 3.952   14.979  1.00 30.72 ?  729 HOH A O     1 
HETATM 5558 O  O     . HOH I 8 .   ? -36.708 17.467  13.076  1.00 23.36 ?  730 HOH A O     1 
HETATM 5559 O  O     . HOH I 8 .   ? -17.313 -18.171 5.998   1.00 46.73 ?  731 HOH A O     1 
HETATM 5560 O  O     . HOH I 8 .   ? -32.688 2.877   22.538  1.00 37.40 ?  732 HOH A O     1 
HETATM 5561 O  O     . HOH I 8 .   ? -29.101 -3.272  -20.124 1.00 46.68 ?  733 HOH A O     1 
HETATM 5562 O  O     . HOH I 8 .   ? -22.242 -12.142 9.711   1.00 44.76 ?  734 HOH A O     1 
HETATM 5563 O  O     . HOH I 8 .   ? -11.535 -13.512 -22.843 1.00 44.41 ?  735 HOH A O     1 
HETATM 5564 O  O     . HOH I 8 .   ? -28.650 -8.784  10.571  1.00 46.98 ?  736 HOH A O     1 
HETATM 5565 O  O     . HOH I 8 .   ? -15.559 -17.033 -17.267 1.00 51.83 ?  737 HOH A O     1 
HETATM 5566 O  O     . HOH I 8 .   ? -17.603 4.511   22.591  1.00 19.12 ?  738 HOH A O     1 
HETATM 5567 O  O     . HOH I 8 .   ? -38.452 12.884  18.368  1.00 31.86 ?  739 HOH A O     1 
HETATM 5568 O  O     . HOH I 8 .   ? -26.968 4.974   -22.026 1.00 41.83 ?  740 HOH A O     1 
HETATM 5569 O  O     . HOH I 8 .   ? -29.228 1.749   -17.496 1.00 39.29 ?  741 HOH A O     1 
HETATM 5570 O  O     . HOH I 8 .   ? -35.883 -16.572 -7.162  1.00 41.79 ?  742 HOH A O     1 
HETATM 5571 O  O     . HOH I 8 .   ? -11.662 -12.434 -25.071 1.00 40.98 ?  743 HOH A O     1 
HETATM 5572 O  O     . HOH I 8 .   ? -30.644 16.680  18.539  1.00 34.20 ?  744 HOH A O     1 
HETATM 5573 O  O     . HOH I 8 .   ? -39.002 -15.183 -3.193  1.00 48.27 ?  745 HOH A O     1 
HETATM 5574 O  O     . HOH I 8 .   ? -17.566 9.408   -16.751 1.00 51.71 ?  746 HOH A O     1 
HETATM 5575 O  O     . HOH I 8 .   ? -24.232 -24.713 3.737   1.00 53.58 ?  747 HOH A O     1 
HETATM 5576 O  O     . HOH I 8 .   ? -37.798 -12.148 -10.592 1.00 37.69 ?  748 HOH A O     1 
HETATM 5577 O  O     . HOH I 8 .   ? -29.159 11.050  -9.502  1.00 49.26 ?  749 HOH A O     1 
HETATM 5578 O  O     . HOH I 8 .   ? -30.748 17.052  -5.272  1.00 47.76 ?  750 HOH A O     1 
HETATM 5579 O  O     . HOH I 8 .   ? -28.221 -5.253  9.185   1.00 59.07 ?  751 HOH A O     1 
HETATM 5580 O  O     . HOH I 8 .   ? -9.218  -10.386 -22.514 1.00 49.90 ?  752 HOH A O     1 
HETATM 5581 O  O     . HOH I 8 .   ? -28.668 0.780   -15.095 1.00 27.83 ?  753 HOH A O     1 
HETATM 5582 O  O     . HOH I 8 .   ? -50.935 9.534   4.063   1.00 53.70 ?  754 HOH A O     1 
HETATM 5583 O  O     . HOH I 8 .   ? -25.430 3.983   -16.210 1.00 33.01 ?  755 HOH A O     1 
HETATM 5584 O  O     . HOH I 8 .   ? -24.740 -7.203  -25.258 1.00 30.35 ?  756 HOH A O     1 
HETATM 5585 O  O     . HOH I 8 .   ? -45.774 5.720   -1.698  1.00 37.81 ?  757 HOH A O     1 
HETATM 5586 O  O     . HOH I 8 .   ? -6.156  -3.088  -26.274 1.00 40.56 ?  758 HOH A O     1 
HETATM 5587 O  O     . HOH I 8 .   ? -9.353  -17.234 -2.150  1.00 33.60 ?  759 HOH A O     1 
HETATM 5588 O  O     . HOH I 8 .   ? -29.304 9.601   -6.964  1.00 38.36 ?  760 HOH A O     1 
HETATM 5589 O  O     . HOH I 8 .   ? -40.527 -12.546 -10.159 1.00 48.83 ?  761 HOH A O     1 
HETATM 5590 O  O     . HOH I 8 .   ? -27.266 -13.582 -16.502 1.00 41.34 ?  762 HOH A O     1 
HETATM 5591 O  O     . HOH I 8 .   ? -30.814 1.310   -13.087 1.00 36.44 ?  763 HOH A O     1 
HETATM 5592 O  O     . HOH I 8 .   ? -50.728 -5.238  -10.262 1.00 48.67 ?  764 HOH A O     1 
HETATM 5593 O  O     . HOH I 8 .   ? -24.569 -11.897 -21.138 1.00 31.97 ?  765 HOH A O     1 
HETATM 5594 O  O     . HOH I 8 .   ? -29.987 -10.431 -16.405 1.00 38.14 ?  766 HOH A O     1 
HETATM 5595 O  O     . HOH I 8 .   ? -46.730 17.291  13.565  1.00 44.72 ?  767 HOH A O     1 
HETATM 5596 O  O     . HOH I 8 .   ? -26.200 -9.841  -21.836 1.00 33.18 ?  768 HOH A O     1 
HETATM 5597 O  O     . HOH I 8 .   ? -1.602  -4.872  -25.210 1.00 57.40 ?  769 HOH A O     1 
HETATM 5598 O  O     . HOH I 8 .   ? -26.223 2.196   -14.176 1.00 45.86 ?  770 HOH A O     1 
HETATM 5599 O  O     . HOH I 8 .   ? -19.413 -16.570 9.713   1.00 40.73 ?  771 HOH A O     1 
HETATM 5600 O  O     . HOH I 8 .   ? -48.833 13.868  13.046  1.00 50.80 ?  772 HOH A O     1 
HETATM 5601 O  O     . HOH I 8 .   ? -50.314 7.176   8.542   1.00 31.72 ?  773 HOH A O     1 
HETATM 5602 O  O     . HOH I 8 .   ? -44.905 18.693  9.772   1.00 40.34 ?  774 HOH A O     1 
HETATM 5603 O  O     . HOH I 8 .   ? -42.940 -14.226 0.695   1.00 50.80 ?  775 HOH A O     1 
HETATM 5604 O  O     . HOH I 8 .   ? -28.444 10.169  -1.882  1.00 29.67 ?  776 HOH A O     1 
HETATM 5605 O  O     . HOH I 8 .   ? -29.979 -9.316  -18.866 1.00 46.89 ?  777 HOH A O     1 
HETATM 5606 O  O     . HOH I 8 .   ? -27.214 3.922   -18.042 1.00 34.54 ?  778 HOH A O     1 
HETATM 5607 O  O     . HOH I 8 .   ? -32.017 16.939  20.994  1.00 48.81 ?  779 HOH A O     1 
HETATM 5608 O  O     . HOH I 8 .   ? -31.243 18.041  15.995  1.00 46.91 ?  780 HOH A O     1 
HETATM 5609 O  O     . HOH I 8 .   ? -34.083 17.933  13.350  1.00 24.53 ?  781 HOH A O     1 
HETATM 5610 O  O     . HOH I 8 .   ? -14.486 4.385   -30.844 1.00 34.94 ?  782 HOH A O     1 
HETATM 5611 O  O     . HOH I 8 .   ? -25.051 -4.447  -25.612 1.00 32.84 ?  783 HOH A O     1 
HETATM 5612 O  O     . HOH I 8 .   ? -46.316 13.216  -1.551  1.00 53.19 ?  784 HOH A O     1 
HETATM 5613 O  O     . HOH I 8 .   ? -40.404 -13.244 -0.706  1.00 35.93 ?  785 HOH A O     1 
HETATM 5614 O  O     . HOH I 8 .   ? -13.946 7.647   -27.626 1.00 48.74 ?  786 HOH A O     1 
HETATM 5615 O  O     . HOH I 8 .   ? -23.543 -3.815  -27.911 1.00 24.78 ?  787 HOH A O     1 
HETATM 5616 O  O     . HOH I 8 .   ? -26.112 -5.100  21.437  1.00 39.14 ?  788 HOH A O     1 
HETATM 5617 O  O     . HOH I 8 .   ? -50.538 -6.808  13.824  1.00 50.73 ?  789 HOH A O     1 
HETATM 5618 O  O     . HOH I 8 .   ? -38.508 -14.247 0.807   1.00 34.23 ?  790 HOH A O     1 
HETATM 5619 O  O     . HOH I 8 .   ? -45.291 12.418  -3.752  1.00 57.45 ?  791 HOH A O     1 
HETATM 5620 O  O     . HOH I 8 .   ? -38.076 -16.174 -1.039  1.00 42.41 ?  792 HOH A O     1 
HETATM 5621 O  O     . HOH J 8 .   ? 1.533   26.870  -8.807  1.00 30.24 ?  501 HOH B O     1 
HETATM 5622 O  O     . HOH J 8 .   ? -17.969 -3.436  18.052  1.00 39.72 ?  502 HOH B O     1 
HETATM 5623 O  O     . HOH J 8 .   ? 5.612   -11.780 1.059   1.00 47.90 ?  503 HOH B O     1 
HETATM 5624 O  O     . HOH J 8 .   ? 2.033   25.367  -7.390  1.00 37.54 ?  504 HOH B O     1 
HETATM 5625 O  O     . HOH J 8 .   ? -11.050 -10.876 12.301  1.00 39.13 ?  505 HOH B O     1 
HETATM 5626 O  O     . HOH J 8 .   ? -11.821 20.219  -2.263  1.00 43.93 ?  506 HOH B O     1 
HETATM 5627 O  O     . HOH J 8 .   ? -9.914  9.074   -12.212 1.00 33.65 ?  507 HOH B O     1 
HETATM 5628 O  O     . HOH J 8 .   ? 12.268  8.882   1.746   1.00 38.19 ?  508 HOH B O     1 
HETATM 5629 O  O     . HOH J 8 .   ? 3.754   -9.815  -0.368  1.00 43.47 ?  509 HOH B O     1 
HETATM 5630 O  O     . HOH J 8 .   ? -11.686 16.712  -9.451  1.00 44.19 ?  510 HOH B O     1 
HETATM 5631 O  O     . HOH J 8 .   ? 2.915   -0.820  13.718  1.00 38.03 ?  511 HOH B O     1 
HETATM 5632 O  O     . HOH J 8 .   ? -5.009  19.336  11.377  1.00 31.25 ?  512 HOH B O     1 
HETATM 5633 O  O     . HOH J 8 .   ? -9.422  18.071  -8.110  1.00 33.72 ?  513 HOH B O     1 
HETATM 5634 O  O     . HOH J 8 .   ? -7.607  8.666   23.241  1.00 21.69 ?  514 HOH B O     1 
HETATM 5635 O  O     . HOH J 8 .   ? -5.854  23.310  -6.941  1.00 38.64 ?  515 HOH B O     1 
HETATM 5636 O  O     . HOH J 8 .   ? -20.220 -10.677 8.661   1.00 41.86 ?  516 HOH B O     1 
HETATM 5637 O  O     . HOH J 8 .   ? -13.265 -11.971 9.679   1.00 29.64 ?  517 HOH B O     1 
HETATM 5638 O  O     . HOH J 8 .   ? 7.040   17.825  -4.938  1.00 37.97 ?  518 HOH B O     1 
HETATM 5639 O  O     . HOH J 8 .   ? 13.555  7.764   -15.351 1.00 41.25 ?  519 HOH B O     1 
HETATM 5640 O  O     . HOH J 8 .   ? -4.596  -1.205  18.248  1.00 29.09 ?  520 HOH B O     1 
HETATM 5641 O  O     . HOH J 8 .   ? 15.537  -5.858  -6.546  1.00 43.10 ?  521 HOH B O     1 
HETATM 5642 O  O     . HOH J 8 .   ? 23.882  7.657   -3.565  1.00 44.40 ?  522 HOH B O     1 
HETATM 5643 O  O     . HOH J 8 .   ? -4.114  18.639  -21.337 1.00 45.37 ?  523 HOH B O     1 
HETATM 5644 O  O     . HOH J 8 .   ? -5.176  23.237  5.120   1.00 36.19 ?  524 HOH B O     1 
HETATM 5645 O  O     . HOH J 8 .   ? -4.425  -4.377  -10.422 1.00 27.58 ?  525 HOH B O     1 
HETATM 5646 O  O     . HOH J 8 .   ? 7.553   6.379   8.545   1.00 40.56 ?  526 HOH B O     1 
HETATM 5647 O  O     . HOH J 8 .   ? -12.306 23.665  9.447   1.00 47.70 ?  527 HOH B O     1 
HETATM 5648 O  O     . HOH J 8 .   ? 1.655   0.791   18.338  1.00 36.48 ?  528 HOH B O     1 
HETATM 5649 O  O     . HOH J 8 .   ? 16.517  10.639  -7.864  1.00 37.94 ?  529 HOH B O     1 
HETATM 5650 O  O     . HOH J 8 .   ? -1.859  13.443  -20.856 1.00 34.28 ?  530 HOH B O     1 
HETATM 5651 O  O     . HOH J 8 .   ? 4.727   -1.761  -17.444 1.00 28.79 ?  531 HOH B O     1 
HETATM 5652 O  O     . HOH J 8 .   ? -15.721 4.100   -9.062  1.00 23.32 ?  532 HOH B O     1 
HETATM 5653 O  O     . HOH J 8 .   ? 10.598  4.758   6.773   1.00 57.74 ?  533 HOH B O     1 
HETATM 5654 O  O     . HOH J 8 .   ? -19.644 -8.055  9.587   1.00 44.80 ?  534 HOH B O     1 
HETATM 5655 O  O     . HOH J 8 .   ? -8.679  -6.618  17.703  1.00 38.88 ?  535 HOH B O     1 
HETATM 5656 O  O     . HOH J 8 .   ? 2.678   8.963   -18.289 1.00 34.68 ?  536 HOH B O     1 
HETATM 5657 O  O     . HOH J 8 .   ? 16.346  0.700   2.080   1.00 34.80 ?  537 HOH B O     1 
HETATM 5658 O  O     . HOH J 8 .   ? -11.439 -17.361 3.447   1.00 50.54 ?  538 HOH B O     1 
HETATM 5659 O  O     . HOH J 8 .   ? 23.726  2.277   -1.180  1.00 29.07 ?  539 HOH B O     1 
HETATM 5660 O  O     . HOH J 8 .   ? -0.072  28.178  -11.105 1.00 29.42 ?  540 HOH B O     1 
HETATM 5661 O  O     . HOH J 8 .   ? 2.240   -13.222 -5.783  1.00 41.00 ?  541 HOH B O     1 
HETATM 5662 O  O     . HOH J 8 .   ? -2.804  -2.414  -10.183 1.00 34.71 ?  542 HOH B O     1 
HETATM 5663 O  O     . HOH J 8 .   ? 25.400  8.390   1.957   1.00 29.60 ?  543 HOH B O     1 
HETATM 5664 O  O     . HOH J 8 .   ? -18.244 -8.481  0.406   1.00 23.57 ?  544 HOH B O     1 
HETATM 5665 O  O     . HOH J 8 .   ? -6.983  -12.827 -7.559  1.00 20.70 ?  545 HOH B O     1 
HETATM 5666 O  O     . HOH J 8 .   ? -6.456  2.904   -5.497  1.00 16.31 ?  546 HOH B O     1 
HETATM 5667 O  O     . HOH J 8 .   ? 11.850  -4.581  -4.963  1.00 19.99 ?  547 HOH B O     1 
HETATM 5668 O  O     . HOH J 8 .   ? -18.441 7.761   -8.893  1.00 30.42 ?  548 HOH B O     1 
HETATM 5669 O  O     . HOH J 8 .   ? 3.134   18.263  3.172   1.00 35.04 ?  549 HOH B O     1 
HETATM 5670 O  O     . HOH J 8 .   ? 17.347  -1.056  -0.673  1.00 31.95 ?  550 HOH B O     1 
HETATM 5671 O  O     . HOH J 8 .   ? 4.974   -2.139  7.969   1.00 38.78 ?  551 HOH B O     1 
HETATM 5672 O  O     . HOH J 8 .   ? 18.131  10.845  -5.468  1.00 35.75 ?  552 HOH B O     1 
HETATM 5673 O  O     . HOH J 8 .   ? -10.732 5.541   23.138  1.00 25.44 ?  553 HOH B O     1 
HETATM 5674 O  O     . HOH J 8 .   ? 3.302   7.266   12.750  1.00 31.94 ?  554 HOH B O     1 
HETATM 5675 O  O     . HOH J 8 .   ? -10.090 20.982  -0.491  1.00 28.28 ?  555 HOH B O     1 
HETATM 5676 O  O     . HOH J 8 .   ? 4.950   -4.285  6.459   1.00 32.34 ?  556 HOH B O     1 
HETATM 5677 O  O     . HOH J 8 .   ? -12.052 2.337   15.956  1.00 20.96 ?  557 HOH B O     1 
HETATM 5678 O  O     . HOH J 8 .   ? 6.448   -4.342  -13.524 1.00 30.27 ?  558 HOH B O     1 
HETATM 5679 O  O     . HOH J 8 .   ? 7.682   0.231   -10.285 1.00 20.18 ?  559 HOH B O     1 
HETATM 5680 O  O     . HOH J 8 .   ? 7.442   -10.025 -6.904  1.00 45.82 ?  560 HOH B O     1 
HETATM 5681 O  O     . HOH J 8 .   ? 5.519   8.035   -19.089 1.00 41.32 ?  561 HOH B O     1 
HETATM 5682 O  O     . HOH J 8 .   ? -4.827  18.640  8.748   1.00 21.02 ?  562 HOH B O     1 
HETATM 5683 O  O     . HOH J 8 .   ? 7.725   -4.803  5.996   1.00 32.14 ?  563 HOH B O     1 
HETATM 5684 O  O     . HOH J 8 .   ? -3.466  20.577  7.401   1.00 30.84 ?  564 HOH B O     1 
HETATM 5685 O  O     . HOH J 8 .   ? -7.007  24.723  -3.109  1.00 36.74 ?  565 HOH B O     1 
HETATM 5686 O  O     . HOH J 8 .   ? -15.912 2.621   21.372  1.00 23.28 ?  566 HOH B O     1 
HETATM 5687 O  O     . HOH J 8 .   ? -17.326 18.550  1.317   1.00 30.35 ?  567 HOH B O     1 
HETATM 5688 O  O     . HOH J 8 .   ? -14.483 4.428   -4.609  1.00 13.73 ?  568 HOH B O     1 
HETATM 5689 O  O     . HOH J 8 .   ? 1.315   -10.147 0.489   1.00 27.19 ?  569 HOH B O     1 
HETATM 5690 O  O     . HOH J 8 .   ? 15.641  2.907   5.087   1.00 46.34 ?  570 HOH B O     1 
HETATM 5691 O  O     . HOH J 8 .   ? 9.208   3.270   -16.751 1.00 33.45 ?  571 HOH B O     1 
HETATM 5692 O  O     . HOH J 8 .   ? -4.248  -13.073 3.564   1.00 25.99 ?  572 HOH B O     1 
HETATM 5693 O  O     . HOH J 8 .   ? -2.405  -7.992  12.798  1.00 39.54 ?  573 HOH B O     1 
HETATM 5694 O  O     . HOH J 8 .   ? -0.895  18.473  -2.804  1.00 15.18 ?  574 HOH B O     1 
HETATM 5695 O  O     . HOH J 8 .   ? -10.164 -13.241 6.824   1.00 33.61 ?  575 HOH B O     1 
HETATM 5696 O  O     . HOH J 8 .   ? 15.408  2.362   -9.691  1.00 32.03 ?  576 HOH B O     1 
HETATM 5697 O  O     . HOH J 8 .   ? -5.367  -11.960 -10.944 1.00 28.71 ?  577 HOH B O     1 
HETATM 5698 O  O     . HOH J 8 .   ? -15.597 1.947   -5.018  1.00 12.72 ?  578 HOH B O     1 
HETATM 5699 O  O     . HOH J 8 .   ? -3.571  23.074  -7.727  1.00 38.55 ?  579 HOH B O     1 
HETATM 5700 O  O     . HOH J 8 .   ? -8.608  -4.157  -9.996  1.00 22.78 ?  580 HOH B O     1 
HETATM 5701 O  O     . HOH J 8 .   ? -17.414 16.446  -14.297 1.00 38.87 ?  581 HOH B O     1 
HETATM 5702 O  O     . HOH J 8 .   ? -10.713 6.760   -6.571  1.00 17.90 ?  582 HOH B O     1 
HETATM 5703 O  O     . HOH J 8 .   ? -14.678 9.179   -14.773 1.00 45.87 ?  583 HOH B O     1 
HETATM 5704 O  O     . HOH J 8 .   ? -12.607 14.255  -16.586 1.00 23.94 ?  584 HOH B O     1 
HETATM 5705 O  O     . HOH J 8 .   ? -2.070  -3.048  11.491  1.00 20.83 ?  585 HOH B O     1 
HETATM 5706 O  O     . HOH J 8 .   ? 11.596  19.828  -9.695  1.00 58.86 ?  586 HOH B O     1 
HETATM 5707 O  O     . HOH J 8 .   ? -18.801 8.468   2.667   1.00 19.95 ?  587 HOH B O     1 
HETATM 5708 O  O     . HOH J 8 .   ? 4.956   12.703  3.338   1.00 23.75 ?  588 HOH B O     1 
HETATM 5709 O  O     . HOH J 8 .   ? -15.895 9.428   -18.779 1.00 34.55 ?  589 HOH B O     1 
HETATM 5710 O  O     . HOH J 8 .   ? -21.029 11.366  -6.295  1.00 21.36 ?  590 HOH B O     1 
HETATM 5711 O  O     . HOH J 8 .   ? 15.522  -0.986  -8.440  1.00 33.55 ?  591 HOH B O     1 
HETATM 5712 O  O     . HOH J 8 .   ? -18.220 17.383  -7.137  1.00 36.50 ?  592 HOH B O     1 
HETATM 5713 O  O     . HOH J 8 .   ? 7.883   3.422   3.361   1.00 32.71 ?  593 HOH B O     1 
HETATM 5714 O  O     . HOH J 8 .   ? -13.118 12.404  0.535   1.00 13.95 ?  594 HOH B O     1 
HETATM 5715 O  O     . HOH J 8 .   ? -11.639 6.145   -3.801  1.00 22.37 ?  595 HOH B O     1 
HETATM 5716 O  O     . HOH J 8 .   ? -22.244 4.023   -2.058  1.00 16.01 ?  596 HOH B O     1 
HETATM 5717 O  O     . HOH J 8 .   ? -9.024  28.897  -17.509 1.00 47.61 ?  597 HOH B O     1 
HETATM 5718 O  O     . HOH J 8 .   ? 10.860  5.008   -13.926 1.00 19.49 ?  598 HOH B O     1 
HETATM 5719 O  O     . HOH J 8 .   ? -1.938  21.012  -10.200 1.00 27.20 ?  599 HOH B O     1 
HETATM 5720 O  O     . HOH J 8 .   ? -1.338  -9.447  12.294  1.00 50.06 ?  600 HOH B O     1 
HETATM 5721 O  O     . HOH J 8 .   ? -15.581 -11.751 3.295   1.00 28.46 ?  601 HOH B O     1 
HETATM 5722 O  O     . HOH J 8 .   ? 1.731   20.501  -19.232 1.00 29.79 ?  602 HOH B O     1 
HETATM 5723 O  O     . HOH J 8 .   ? -6.066  0.394   -12.140 1.00 25.60 ?  603 HOH B O     1 
HETATM 5724 O  O     . HOH J 8 .   ? 2.444   13.860  -17.639 1.00 26.01 ?  604 HOH B O     1 
HETATM 5725 O  O     . HOH J 8 .   ? -3.447  -15.456 -2.991  1.00 42.36 ?  605 HOH B O     1 
HETATM 5726 O  O     . HOH J 8 .   ? 5.441   10.490  -15.910 1.00 27.52 ?  606 HOH B O     1 
HETATM 5727 O  O     . HOH J 8 .   ? -17.975 10.070  -3.748  1.00 14.20 ?  607 HOH B O     1 
HETATM 5728 O  O     . HOH J 8 .   ? -6.543  6.016   -22.756 1.00 32.46 ?  608 HOH B O     1 
HETATM 5729 O  O     . HOH J 8 .   ? 5.393   5.197   2.638   1.00 16.70 ?  609 HOH B O     1 
HETATM 5730 O  O     . HOH J 8 .   ? -13.226 7.575   -4.431  1.00 38.42 ?  610 HOH B O     1 
HETATM 5731 O  O     . HOH J 8 .   ? -20.750 4.108   1.958   1.00 26.23 ?  611 HOH B O     1 
HETATM 5732 O  O     . HOH J 8 .   ? -26.443 5.557   -2.935  1.00 25.97 ?  612 HOH B O     1 
HETATM 5733 O  O     . HOH J 8 .   ? 8.638   16.753  -10.840 1.00 42.28 ?  613 HOH B O     1 
HETATM 5734 O  O     . HOH J 8 .   ? -8.140  -7.383  -5.204  1.00 17.40 ?  614 HOH B O     1 
HETATM 5735 O  O     . HOH J 8 .   ? 9.171   -8.282  7.100   1.00 45.39 ?  615 HOH B O     1 
HETATM 5736 O  O     . HOH J 8 .   ? 7.777   18.413  -17.786 1.00 35.02 ?  616 HOH B O     1 
HETATM 5737 O  O     . HOH J 8 .   ? 14.460  -3.307  -8.761  1.00 47.81 ?  617 HOH B O     1 
HETATM 5738 O  O     . HOH J 8 .   ? -11.102 18.471  -10.602 1.00 37.83 ?  618 HOH B O     1 
HETATM 5739 O  O     . HOH J 8 .   ? 6.001   16.624  -7.054  1.00 26.45 ?  619 HOH B O     1 
HETATM 5740 O  O     . HOH J 8 .   ? 10.201  -2.642  -3.657  1.00 18.13 ?  620 HOH B O     1 
HETATM 5741 O  O     . HOH J 8 .   ? -13.918 1.646   13.945  1.00 17.43 ?  621 HOH B O     1 
HETATM 5742 O  O     . HOH J 8 .   ? -4.289  -13.248 10.003  1.00 43.93 ?  622 HOH B O     1 
HETATM 5743 O  O     . HOH J 8 .   ? 0.655   10.744  11.310  1.00 23.70 ?  623 HOH B O     1 
HETATM 5744 O  O     . HOH J 8 .   ? 4.707   0.030   11.420  1.00 35.69 ?  624 HOH B O     1 
HETATM 5745 O  O     . HOH J 8 .   ? -20.011 -14.101 6.309   1.00 23.46 ?  625 HOH B O     1 
HETATM 5746 O  O     . HOH J 8 .   ? -0.485  -12.401 -3.258  1.00 34.25 ?  626 HOH B O     1 
HETATM 5747 O  O     . HOH J 8 .   ? -0.514  25.719  -15.248 1.00 17.75 ?  627 HOH B O     1 
HETATM 5748 O  O     . HOH J 8 .   ? -17.885 2.660   -3.279  1.00 13.98 ?  628 HOH B O     1 
HETATM 5749 O  O     . HOH J 8 .   ? -8.172  27.736  10.285  1.00 53.98 ?  629 HOH B O     1 
HETATM 5750 O  O     . HOH J 8 .   ? -5.226  20.661  -7.774  1.00 23.04 ?  630 HOH B O     1 
HETATM 5751 O  O     . HOH J 8 .   ? -7.337  10.408  -18.465 1.00 25.21 ?  631 HOH B O     1 
HETATM 5752 O  O     . HOH J 8 .   ? -17.067 3.689   10.875  1.00 19.54 ?  632 HOH B O     1 
HETATM 5753 O  O     . HOH J 8 .   ? 0.040   17.418  7.211   1.00 30.38 ?  633 HOH B O     1 
HETATM 5754 O  O     . HOH J 8 .   ? -5.834  22.712  -20.085 1.00 28.08 ?  634 HOH B O     1 
HETATM 5755 O  O     . HOH J 8 .   ? 4.267   22.188  -13.335 1.00 23.83 ?  635 HOH B O     1 
HETATM 5756 O  O     . HOH J 8 .   ? 2.564   4.235   20.116  1.00 39.87 ?  636 HOH B O     1 
HETATM 5757 O  O     . HOH J 8 .   ? 8.142   -2.669  -10.516 1.00 34.88 ?  637 HOH B O     1 
HETATM 5758 O  O     . HOH J 8 .   ? -2.437  -15.514 -7.552  1.00 44.53 ?  638 HOH B O     1 
HETATM 5759 O  O     . HOH J 8 .   ? -13.176 -6.460  -1.691  1.00 28.99 ?  639 HOH B O     1 
HETATM 5760 O  O     . HOH J 8 .   ? -10.802 1.875   20.474  1.00 23.86 ?  640 HOH B O     1 
HETATM 5761 O  O     . HOH J 8 .   ? 13.820  11.542  3.446   1.00 52.17 ?  641 HOH B O     1 
HETATM 5762 O  O     . HOH J 8 .   ? -17.081 17.370  -2.407  0.65 24.83 ?  642 HOH B O     1 
HETATM 5763 O  O     . HOH J 8 .   ? 5.112   4.932   -18.912 1.00 35.74 ?  643 HOH B O     1 
HETATM 5764 O  O     . HOH J 8 .   ? -12.862 -12.572 13.367  1.00 39.01 ?  644 HOH B O     1 
HETATM 5765 O  O     . HOH J 8 .   ? -7.059  24.845  -12.667 1.00 27.91 ?  645 HOH B O     1 
HETATM 5766 O  O     . HOH J 8 .   ? -16.594 -11.692 7.995   1.00 29.23 ?  646 HOH B O     1 
HETATM 5767 O  O     . HOH J 8 .   ? -14.355 -0.967  20.141  1.00 37.54 ?  647 HOH B O     1 
HETATM 5768 O  O     . HOH J 8 .   ? -2.705  7.596   18.892  1.00 36.27 ?  648 HOH B O     1 
HETATM 5769 O  O     . HOH J 8 .   ? 3.740   -9.039  2.281   1.00 23.59 ?  649 HOH B O     1 
HETATM 5770 O  O     . HOH J 8 .   ? 14.212  -1.151  -10.996 1.00 29.72 ?  650 HOH B O     1 
HETATM 5771 O  O     . HOH J 8 .   ? 2.920   36.772  -23.792 1.00 53.42 ?  651 HOH B O     1 
HETATM 5772 O  O     . HOH J 8 .   ? 8.079   -1.467  -17.363 1.00 31.08 ?  652 HOH B O     1 
HETATM 5773 O  O     . HOH J 8 .   ? -16.257 16.759  -16.477 1.00 42.02 ?  653 HOH B O     1 
HETATM 5774 O  O     . HOH J 8 .   ? 11.943  1.015   -15.795 1.00 40.71 ?  654 HOH B O     1 
HETATM 5775 O  O     . HOH J 8 .   ? -2.837  19.479  -1.078  1.00 13.73 ?  655 HOH B O     1 
HETATM 5776 O  O     . HOH J 8 .   ? 17.516  2.740   3.401   1.00 44.80 ?  656 HOH B O     1 
HETATM 5777 O  O     . HOH J 8 .   ? -14.914 8.262   -10.898 1.00 37.64 ?  657 HOH B O     1 
HETATM 5778 O  O     . HOH J 8 .   ? 18.402  3.070   -8.754  1.00 37.75 ?  658 HOH B O     1 
HETATM 5779 O  O     . HOH J 8 .   ? 2.390   21.672  -4.646  1.00 23.30 ?  659 HOH B O     1 
HETATM 5780 O  O     . HOH J 8 .   ? 4.346   23.834  -6.863  1.00 40.41 ?  660 HOH B O     1 
HETATM 5781 O  O     . HOH J 8 .   ? -14.586 24.213  3.838   1.00 44.02 ?  661 HOH B O     1 
HETATM 5782 O  O     . HOH J 8 .   ? -4.949  -14.888 -5.834  1.00 27.53 ?  662 HOH B O     1 
HETATM 5783 O  O     . HOH J 8 .   ? -10.094 27.592  9.542   1.00 41.28 ?  663 HOH B O     1 
HETATM 5784 O  O     . HOH J 8 .   ? -17.937 -15.689 7.610   1.00 30.86 ?  664 HOH B O     1 
HETATM 5785 O  O     . HOH J 8 .   ? 3.205   -11.201 4.058   1.00 36.90 ?  665 HOH B O     1 
HETATM 5786 O  O     . HOH J 8 .   ? 14.555  -4.980  5.728   1.00 41.40 ?  666 HOH B O     1 
HETATM 5787 O  O     . HOH J 8 .   ? -15.504 4.582   16.295  1.00 18.41 ?  667 HOH B O     1 
HETATM 5788 O  O     . HOH J 8 .   ? -16.370 14.115  12.012  1.00 32.46 ?  668 HOH B O     1 
HETATM 5789 O  O     . HOH J 8 .   ? -5.873  -1.743  -8.804  1.00 33.19 ?  669 HOH B O     1 
HETATM 5790 O  O     . HOH J 8 .   ? 15.377  -1.082  3.398   1.00 36.17 ?  670 HOH B O     1 
HETATM 5791 O  O     . HOH J 8 .   ? -22.786 12.876  -2.071  1.00 35.87 ?  671 HOH B O     1 
HETATM 5792 O  O     . HOH J 8 .   ? -3.335  31.556  -25.702 1.00 41.85 ?  672 HOH B O     1 
HETATM 5793 O  O     . HOH J 8 .   ? 6.741   30.305  1.869   1.00 24.00 ?  673 HOH B O     1 
HETATM 5794 O  O     . HOH J 8 .   ? -0.533  -13.427 -5.650  1.00 34.43 ?  674 HOH B O     1 
HETATM 5795 O  O     . HOH J 8 .   ? -0.181  37.879  -25.931 1.00 47.19 ?  675 HOH B O     1 
HETATM 5796 O  O     . HOH J 8 .   ? 20.998  2.018   -2.140  1.00 31.32 ?  676 HOH B O     1 
HETATM 5797 O  O     . HOH J 8 .   ? 14.232  4.337   -15.898 1.00 35.50 ?  677 HOH B O     1 
HETATM 5798 O  O     . HOH J 8 .   ? -3.376  4.743   22.239  1.00 36.18 ?  678 HOH B O     1 
HETATM 5799 O  O     . HOH J 8 .   ? -26.321 11.426  -0.974  1.00 37.56 ?  679 HOH B O     1 
HETATM 5800 O  O     . HOH J 8 .   ? -4.601  -4.955  -15.291 1.00 30.97 ?  680 HOH B O     1 
HETATM 5801 O  O     . HOH J 8 .   ? -3.823  10.486  -22.183 1.00 43.39 ?  681 HOH B O     1 
HETATM 5802 O  O     . HOH J 8 .   ? -0.765  19.746  6.281   1.00 32.56 ?  682 HOH B O     1 
HETATM 5803 O  O     . HOH J 8 .   ? -16.307 -8.190  18.124  1.00 39.27 ?  683 HOH B O     1 
HETATM 5804 O  O     . HOH J 8 .   ? -22.711 4.722   -9.199  1.00 32.04 ?  684 HOH B O     1 
HETATM 5805 O  O     . HOH J 8 .   ? -8.849  20.647  -11.131 1.00 41.78 ?  685 HOH B O     1 
HETATM 5806 O  O     . HOH J 8 .   ? -6.637  42.108  -25.693 1.00 38.42 ?  686 HOH B O     1 
HETATM 5807 O  O     . HOH J 8 .   ? 4.837   21.316  -6.060  1.00 35.88 ?  687 HOH B O     1 
HETATM 5808 O  O     . HOH J 8 .   ? -13.459 22.180  0.797   1.00 45.52 ?  688 HOH B O     1 
HETATM 5809 O  O     . HOH J 8 .   ? 10.507  -2.010  -12.777 1.00 33.42 ?  689 HOH B O     1 
HETATM 5810 O  O     . HOH J 8 .   ? -5.546  24.423  -22.968 1.00 40.25 ?  690 HOH B O     1 
HETATM 5811 O  O     . HOH J 8 .   ? -22.345 -4.853  16.517  1.00 35.34 ?  691 HOH B O     1 
HETATM 5812 O  O     . HOH J 8 .   ? 7.040   -12.503 -2.618  1.00 47.15 ?  692 HOH B O     1 
HETATM 5813 O  O     . HOH J 8 .   ? 9.418   3.107   6.195   1.00 40.15 ?  693 HOH B O     1 
HETATM 5814 O  O     . HOH J 8 .   ? 18.868  8.398   -9.010  1.00 43.10 ?  694 HOH B O     1 
HETATM 5815 O  O     . HOH J 8 .   ? -5.005  26.686  8.005   1.00 47.50 ?  695 HOH B O     1 
HETATM 5816 O  O     . HOH J 8 .   ? -19.802 15.624  0.174   1.00 43.90 ?  696 HOH B O     1 
HETATM 5817 O  O     . HOH J 8 .   ? 11.409  -11.958 1.541   1.00 39.24 ?  697 HOH B O     1 
HETATM 5818 O  O     . HOH J 8 .   ? -7.585  24.484  -5.414  1.00 46.44 ?  698 HOH B O     1 
HETATM 5819 O  O     . HOH J 8 .   ? -20.892 13.400  1.253   1.00 28.68 ?  699 HOH B O     1 
HETATM 5820 O  O     . HOH J 8 .   ? 11.854  -11.234 -1.210  1.00 49.89 ?  700 HOH B O     1 
HETATM 5821 O  O     . HOH J 8 .   ? 7.000   21.281  -13.172 1.00 46.75 ?  701 HOH B O     1 
HETATM 5822 O  O     . HOH J 8 .   ? 14.429  -2.538  5.710   1.00 44.66 ?  702 HOH B O     1 
HETATM 5823 O  O     . HOH J 8 .   ? -26.398 8.298   -2.775  1.00 23.66 ?  703 HOH B O     1 
HETATM 5824 O  O     . HOH J 8 .   ? 7.923   4.802   -18.648 1.00 48.89 ?  704 HOH B O     1 
HETATM 5825 O  O     . HOH J 8 .   ? -5.962  40.835  -28.304 1.00 56.81 ?  705 HOH B O     1 
HETATM 5826 O  O     . HOH J 8 .   ? 11.138  5.647   -16.562 1.00 45.22 ?  706 HOH B O     1 
HETATM 5827 O  O     . HOH J 8 .   ? -14.002 -10.876 1.579   1.00 45.07 ?  707 HOH B O     1 
HETATM 5828 O  O     . HOH J 8 .   ? -9.278  22.720  -12.132 1.00 48.98 ?  708 HOH B O     1 
HETATM 5829 O  O     . HOH J 8 .   ? -11.861 6.882   -8.886  1.00 35.78 ?  709 HOH B O     1 
HETATM 5830 O  O     . HOH J 8 .   ? -2.013  17.834  8.969   1.00 34.86 ?  710 HOH B O     1 
HETATM 5831 O  O     . HOH J 8 .   ? -5.452  -4.151  -12.799 1.00 25.71 ?  711 HOH B O     1 
HETATM 5832 O  O     . HOH J 8 .   ? 15.996  9.022   -15.321 1.00 51.09 ?  712 HOH B O     1 
HETATM 5833 O  O     . HOH J 8 .   ? 1.411   24.424  -16.744 1.00 26.30 ?  713 HOH B O     1 
HETATM 5834 O  O     . HOH J 8 .   ? -16.415 -10.400 1.545   1.00 41.33 ?  714 HOH B O     1 
HETATM 5835 O  O     . HOH J 8 .   ? -0.820  13.114  11.242  1.00 41.34 ?  715 HOH B O     1 
HETATM 5836 O  O     . HOH J 8 .   ? 5.189   19.120  2.133   1.00 45.36 ?  716 HOH B O     1 
HETATM 5837 O  O     . HOH J 8 .   ? -18.829 1.685   -8.192  1.00 26.17 ?  717 HOH B O     1 
HETATM 5838 O  O     . HOH J 8 .   ? 10.847  10.734  1.644   1.00 51.26 ?  718 HOH B O     1 
HETATM 5839 O  O     . HOH J 8 .   ? 10.151  -2.570  -15.130 1.00 42.64 ?  719 HOH B O     1 
HETATM 5840 O  O     . HOH J 8 .   ? 3.192   18.211  -19.930 1.00 42.97 ?  720 HOH B O     1 
HETATM 5841 O  O     . HOH J 8 .   ? 0.658   -11.532 2.832   1.00 39.03 ?  721 HOH B O     1 
HETATM 5842 O  O     . HOH J 8 .   ? -17.838 5.152   -10.589 1.00 37.31 ?  722 HOH B O     1 
HETATM 5843 O  O     . HOH J 8 .   ? -6.954  -1.927  -12.797 1.00 25.23 ?  723 HOH B O     1 
HETATM 5844 O  O     . HOH J 8 .   ? -8.840  12.654  -19.083 1.00 27.83 ?  724 HOH B O     1 
HETATM 5845 O  O     . HOH J 8 .   ? 3.701   11.571  -17.732 1.00 31.38 ?  725 HOH B O     1 
HETATM 5846 O  O     . HOH J 8 .   ? -5.851  -13.966 5.795   1.00 42.15 ?  726 HOH B O     1 
HETATM 5847 O  O     . HOH J 8 .   ? -0.726  37.395  -19.596 1.00 46.49 ?  727 HOH B O     1 
HETATM 5848 O  O     . HOH J 8 .   ? 0.599   23.239  3.983   1.00 58.02 ?  728 HOH B O     1 
HETATM 5849 O  O     . HOH J 8 .   ? 1.165   -12.640 -1.349  1.00 41.80 ?  729 HOH B O     1 
HETATM 5850 O  O     . HOH J 8 .   ? -4.889  5.873   24.029  1.00 49.74 ?  730 HOH B O     1 
HETATM 5851 O  O     . HOH J 8 .   ? 18.868  0.186   -2.958  1.00 33.90 ?  731 HOH B O     1 
HETATM 5852 O  O     . HOH J 8 .   ? -16.420 18.802  -5.579  1.00 48.00 ?  732 HOH B O     1 
HETATM 5853 O  O     . HOH J 8 .   ? 16.650  3.442   -15.850 1.00 49.15 ?  733 HOH B O     1 
HETATM 5854 O  O     . HOH J 8 .   ? 2.147   14.486  -20.051 1.00 42.20 ?  734 HOH B O     1 
HETATM 5855 O  O     . HOH J 8 .   ? -1.138  23.118  7.071   1.00 48.75 ?  735 HOH B O     1 
HETATM 5856 O  O     . HOH J 8 .   ? -21.878 -5.030  19.370  1.00 45.40 ?  736 HOH B O     1 
HETATM 5857 O  O     . HOH J 8 .   ? -21.594 13.927  -7.022  1.00 37.86 ?  737 HOH B O     1 
HETATM 5858 O  O     . HOH J 8 .   ? -16.207 19.527  -1.113  1.00 39.14 ?  738 HOH B O     1 
HETATM 5859 O  O     . HOH J 8 .   ? 6.146   -3.884  -16.212 1.00 41.98 ?  739 HOH B O     1 
HETATM 5860 O  O     . HOH J 8 .   ? 0.882   31.157  -20.459 1.00 29.71 ?  740 HOH B O     1 
HETATM 5861 O  O     . HOH J 8 .   ? -21.458 7.431   -9.505  1.00 33.08 ?  741 HOH B O     1 
HETATM 5862 O  O     . HOH J 8 .   ? 8.276   29.443  -0.360  1.00 43.59 ?  742 HOH B O     1 
HETATM 5863 O  O     . HOH J 8 .   ? 9.133   19.673  -6.393  1.00 52.14 ?  743 HOH B O     1 
HETATM 5864 O  O     . HOH J 8 .   ? -14.447 1.351   23.306  1.00 30.06 ?  744 HOH B O     1 
HETATM 5865 O  O     . HOH J 8 .   ? -14.807 12.063  -14.165 1.00 44.86 ?  745 HOH B O     1 
HETATM 5866 O  O     . HOH J 8 .   ? 18.430  -3.340  0.363   1.00 50.14 ?  746 HOH B O     1 
HETATM 5867 O  O     . HOH J 8 .   ? -7.847  23.505  -8.188  1.00 50.09 ?  747 HOH B O     1 
HETATM 5868 O  O     . HOH J 8 .   ? -0.926  19.909  10.339  1.00 49.12 ?  748 HOH B O     1 
HETATM 5869 O  O     . HOH J 8 .   ? -15.185 22.362  2.502   1.00 42.46 ?  749 HOH B O     1 
HETATM 5870 O  O     . HOH J 8 .   ? 5.330   26.283  1.659   1.00 44.88 ?  750 HOH B O     1 
HETATM 5871 O  O     . HOH J 8 .   ? 0.336   14.551  -21.129 1.00 42.45 ?  751 HOH B O     1 
HETATM 5872 O  O     . HOH J 8 .   ? -22.567 9.763   -7.978  1.00 31.61 ?  752 HOH B O     1 
HETATM 5873 O  O     . HOH J 8 .   ? -15.166 13.426  -15.890 1.00 45.81 ?  753 HOH B O     1 
HETATM 5874 O  O     . HOH J 8 .   ? 3.746   24.182  -15.344 1.00 29.50 ?  754 HOH B O     1 
HETATM 5875 O  O     . HOH J 8 .   ? -7.835  20.653  -8.829  1.00 30.92 ?  755 HOH B O     1 
HETATM 5876 O  O     . HOH J 8 .   ? 1.541   24.543  -19.663 1.00 36.99 ?  756 HOH B O     1 
HETATM 5877 O  O     . HOH J 8 .   ? -23.691 11.470  -9.875  1.00 44.52 ?  757 HOH B O     1 
HETATM 5878 O  O     . HOH J 8 .   ? 5.622   24.253  -17.238 1.00 43.76 ?  758 HOH B O     1 
HETATM 5879 O  O     . HOH K 8 .   ? -23.783 21.494  27.083  1.00 43.53 ?  201 HOH C O     1 
HETATM 5880 O  O     . HOH K 8 .   ? -24.442 22.376  21.153  1.00 55.38 ?  202 HOH C O     1 
HETATM 5881 O  O     . HOH K 8 .   ? -22.825 12.187  21.950  1.00 36.27 ?  203 HOH C O     1 
HETATM 5882 O  O     . HOH K 8 .   ? -0.800  10.908  17.698  1.00 37.41 ?  204 HOH C O     1 
HETATM 5883 O  O     . HOH K 8 .   ? -13.731 34.699  21.351  1.00 52.49 ?  205 HOH C O     1 
HETATM 5884 O  O     . HOH K 8 .   ? -7.290  28.112  32.572  1.00 38.95 ?  206 HOH C O     1 
HETATM 5885 O  O     . HOH K 8 .   ? 5.591   20.365  20.675  1.00 40.27 ?  207 HOH C O     1 
HETATM 5886 O  O     . HOH K 8 .   ? -8.141  20.728  33.130  1.00 40.86 ?  208 HOH C O     1 
HETATM 5887 O  O     . HOH K 8 .   ? -25.087 24.774  12.150  1.00 54.23 ?  209 HOH C O     1 
HETATM 5888 O  O     . HOH K 8 .   ? -11.237 19.202  33.308  1.00 41.34 ?  210 HOH C O     1 
HETATM 5889 O  O     . HOH K 8 .   ? -19.529 11.920  28.106  1.00 38.78 ?  211 HOH C O     1 
HETATM 5890 O  O     . HOH K 8 .   ? -12.355 20.632  17.100  1.00 43.74 ?  212 HOH C O     1 
HETATM 5891 O  O     . HOH K 8 .   ? -26.004 17.884  4.873   1.00 27.62 ?  213 HOH C O     1 
HETATM 5892 O  O     . HOH K 8 .   ? 4.128   25.646  18.849  1.00 38.30 ?  214 HOH C O     1 
HETATM 5893 O  O     . HOH K 8 .   ? -7.386  18.890  12.409  1.00 21.15 ?  215 HOH C O     1 
HETATM 5894 O  O     . HOH K 8 .   ? -16.178 16.645  12.917  1.00 35.02 ?  216 HOH C O     1 
HETATM 5895 O  O     . HOH K 8 .   ? -1.099  18.636  14.411  1.00 43.83 ?  217 HOH C O     1 
HETATM 5896 O  O     . HOH K 8 .   ? -11.526 21.694  13.000  1.00 23.50 ?  218 HOH C O     1 
HETATM 5897 O  O     . HOH K 8 .   ? -23.340 13.648  23.543  1.00 35.11 ?  219 HOH C O     1 
HETATM 5898 O  O     . HOH K 8 .   ? -16.589 31.798  18.538  1.00 39.03 ?  220 HOH C O     1 
HETATM 5899 O  O     . HOH K 8 .   ? -9.845  13.675  29.393  1.00 36.43 ?  221 HOH C O     1 
HETATM 5900 O  O     . HOH K 8 .   ? -3.373  29.308  32.959  1.00 50.79 ?  222 HOH C O     1 
HETATM 5901 O  O     . HOH K 8 .   ? -1.537  16.431  30.954  1.00 37.82 ?  223 HOH C O     1 
HETATM 5902 O  O     . HOH K 8 .   ? -13.443 5.377   22.510  1.00 21.34 ?  224 HOH C O     1 
HETATM 5903 O  O     . HOH K 8 .   ? -17.147 13.245  31.145  1.00 27.08 ?  225 HOH C O     1 
HETATM 5904 O  O     . HOH K 8 .   ? 7.047   28.179  18.513  1.00 44.13 ?  226 HOH C O     1 
HETATM 5905 O  O     . HOH K 8 .   ? -28.320 16.716  10.420  1.00 39.03 ?  227 HOH C O     1 
HETATM 5906 O  O     . HOH K 8 .   ? -11.418 11.066  28.142  1.00 31.67 ?  228 HOH C O     1 
HETATM 5907 O  O     . HOH K 8 .   ? -14.884 7.794   25.338  1.00 21.16 ?  229 HOH C O     1 
HETATM 5908 O  O     . HOH K 8 .   ? 7.759   29.887  14.577  1.00 46.95 ?  230 HOH C O     1 
HETATM 5909 O  O     . HOH K 8 .   ? -12.949 31.723  29.031  1.00 51.25 ?  231 HOH C O     1 
HETATM 5910 O  O     . HOH K 8 .   ? -6.866  11.755  27.074  1.00 31.78 ?  232 HOH C O     1 
HETATM 5911 O  O     . HOH K 8 .   ? -20.012 18.006  0.837   1.00 31.63 ?  233 HOH C O     1 
HETATM 5912 O  O     . HOH K 8 .   ? -17.944 15.355  27.039  1.00 36.03 ?  234 HOH C O     1 
HETATM 5913 O  O     . HOH K 8 .   ? 3.375   32.892  19.149  1.00 35.76 ?  235 HOH C O     1 
HETATM 5914 O  O     . HOH K 8 .   ? 5.210   20.341  33.944  1.00 43.09 ?  236 HOH C O     1 
HETATM 5915 O  O     . HOH K 8 .   ? -20.733 32.653  16.382  1.00 50.10 ?  237 HOH C O     1 
HETATM 5916 O  O     . HOH K 8 .   ? 0.625   20.140  17.506  1.00 40.98 ?  238 HOH C O     1 
HETATM 5917 O  O     . HOH K 8 .   ? -7.982  18.759  30.771  1.00 35.87 ?  239 HOH C O     1 
HETATM 5918 O  O     . HOH K 8 .   ? -2.657  27.291  34.553  1.00 44.72 ?  240 HOH C O     1 
HETATM 5919 O  O     . HOH K 8 .   ? -16.772 20.273  6.163   1.00 38.49 ?  241 HOH C O     1 
HETATM 5920 O  O     . HOH K 8 .   ? -25.853 18.791  13.633  1.00 37.78 ?  242 HOH C O     1 
HETATM 5921 O  O     . HOH K 8 .   ? -3.199  20.017  11.928  1.00 38.17 ?  243 HOH C O     1 
HETATM 5922 O  O     . HOH K 8 .   ? -31.185 15.610  3.967   1.00 30.59 ?  244 HOH C O     1 
HETATM 5923 O  O     . HOH K 8 .   ? -13.837 14.956  29.328  1.00 29.52 ?  245 HOH C O     1 
HETATM 5924 O  O     . HOH K 8 .   ? -18.294 27.098  9.515   1.00 38.26 ?  246 HOH C O     1 
HETATM 5925 O  O     . HOH K 8 .   ? -23.784 14.705  13.864  1.00 19.94 ?  247 HOH C O     1 
HETATM 5926 O  O     . HOH K 8 .   ? -24.204 17.855  15.636  1.00 31.77 ?  248 HOH C O     1 
HETATM 5927 O  O     . HOH K 8 .   ? -13.246 27.706  9.958   1.00 50.09 ?  249 HOH C O     1 
HETATM 5928 O  O     . HOH K 8 .   ? -1.688  12.930  25.883  1.00 36.61 ?  250 HOH C O     1 
HETATM 5929 O  O     . HOH K 8 .   ? -19.370 16.211  29.235  1.00 38.34 ?  251 HOH C O     1 
HETATM 5930 O  O     . HOH K 8 .   ? 2.793   16.140  16.023  1.00 36.98 ?  252 HOH C O     1 
HETATM 5931 O  O     . HOH K 8 .   ? -9.658  34.956  24.035  1.00 50.45 ?  253 HOH C O     1 
HETATM 5932 O  O     . HOH K 8 .   ? 1.850   26.303  14.120  1.00 35.66 ?  254 HOH C O     1 
HETATM 5933 O  O     . HOH K 8 .   ? -23.664 12.768  1.499   1.00 40.96 ?  255 HOH C O     1 
HETATM 5934 O  O     . HOH K 8 .   ? -19.502 28.728  29.545  1.00 49.86 ?  256 HOH C O     1 
HETATM 5935 O  O     . HOH K 8 .   ? -24.487 28.193  13.044  1.00 39.53 ?  257 HOH C O     1 
HETATM 5936 O  O     . HOH K 8 .   ? 3.168   24.855  16.048  1.00 46.03 ?  258 HOH C O     1 
HETATM 5937 O  O     . HOH K 8 .   ? -9.925  8.179   24.178  1.00 23.42 ?  259 HOH C O     1 
HETATM 5938 O  O     . HOH K 8 .   ? -16.371 31.400  15.089  1.00 33.12 ?  260 HOH C O     1 
HETATM 5939 O  O     . HOH K 8 .   ? -20.394 19.696  36.010  1.00 44.25 ?  261 HOH C O     1 
HETATM 5940 O  O     . HOH K 8 .   ? -3.503  36.404  24.709  1.00 50.61 ?  262 HOH C O     1 
HETATM 5941 O  O     . HOH K 8 .   ? 4.614   27.304  7.312   1.00 49.28 ?  263 HOH C O     1 
HETATM 5942 O  O     . HOH K 8 .   ? -15.677 24.287  7.839   1.00 43.12 ?  264 HOH C O     1 
HETATM 5943 O  O     . HOH K 8 .   ? -4.371  34.608  31.614  1.00 55.13 ?  265 HOH C O     1 
HETATM 5944 O  O     . HOH K 8 .   ? -1.795  28.760  3.955   1.00 23.41 ?  266 HOH C O     1 
HETATM 5945 O  O     . HOH K 8 .   ? -20.434 16.513  33.193  1.00 43.63 ?  267 HOH C O     1 
HETATM 5946 O  O     . HOH K 8 .   ? -12.766 23.795  11.875  1.00 36.08 ?  268 HOH C O     1 
HETATM 5947 O  O     . HOH K 8 .   ? -5.656  9.302   23.473  1.00 38.14 ?  269 HOH C O     1 
HETATM 5948 O  O     . HOH K 8 .   ? -14.584 15.377  32.014  1.00 39.97 ?  270 HOH C O     1 
HETATM 5949 O  O     . HOH K 8 .   ? 7.452   34.370  11.179  1.00 44.88 ?  271 HOH C O     1 
HETATM 5950 O  O     . HOH K 8 .   ? -25.347 11.321  1.622   1.00 38.83 ?  272 HOH C O     1 
HETATM 5951 O  O     . HOH K 8 .   ? -19.839 13.525  11.764  1.00 27.39 ?  273 HOH C O     1 
HETATM 5952 O  O     . HOH K 8 .   ? -17.069 20.556  3.339   1.00 35.51 ?  274 HOH C O     1 
HETATM 5953 O  O     . HOH K 8 .   ? 5.755   34.073  19.260  1.00 43.84 ?  275 HOH C O     1 
HETATM 5954 O  O     . HOH K 8 .   ? -2.450  7.076   21.397  1.00 45.71 ?  276 HOH C O     1 
HETATM 5955 O  O     . HOH K 8 .   ? -9.678  14.354  32.034  1.00 49.82 ?  277 HOH C O     1 
HETATM 5956 O  O     . HOH K 8 .   ? -31.005 18.953  10.572  1.00 48.79 ?  278 HOH C O     1 
HETATM 5957 O  O     . HOH K 8 .   ? -30.164 16.218  1.610   1.00 37.08 ?  279 HOH C O     1 
HETATM 5958 O  O     . HOH K 8 .   ? -8.169  11.503  29.198  1.00 40.10 ?  280 HOH C O     1 
HETATM 5959 O  O     . HOH K 8 .   ? -33.574 19.714  11.390  1.00 21.72 ?  281 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
6    N  N     . SER A 7   ? 0.5943 0.5840 0.5918 0.0614  -0.0252 0.0178  55  SER A N     
7    C  CA    . SER A 7   ? 0.5876 0.5819 0.5799 0.0535  -0.0139 0.0093  55  SER A CA    
8    C  C     . SER A 7   ? 0.5839 0.5755 0.5432 0.0522  -0.0169 0.0093  55  SER A C     
9    O  O     . SER A 7   ? 0.5862 0.5800 0.5382 0.0434  -0.0204 -0.0062 55  SER A O     
10   C  CB    . SER A 7   ? 0.5955 0.5924 0.5978 0.0399  0.0005  -0.0020 55  SER A CB    
11   O  OG    . SER A 7   ? 0.6241 0.6029 0.6135 0.0261  0.0114  -0.0102 55  SER A OG    
12   N  N     . LEU A 8   ? 0.5683 0.5628 0.5097 0.0468  -0.0045 0.0252  56  LEU A N     
13   C  CA    . LEU A 8   ? 0.5230 0.5601 0.4709 0.0378  -0.0219 0.0293  56  LEU A CA    
14   C  C     . LEU A 8   ? 0.4903 0.6029 0.4483 0.0301  -0.0259 0.0129  56  LEU A C     
15   O  O     . LEU A 8   ? 0.4802 0.6366 0.4606 0.0292  -0.0453 0.0000  56  LEU A O     
16   C  CB    . LEU A 8   ? 0.5060 0.5225 0.4512 0.0285  -0.0345 0.0353  56  LEU A CB    
17   C  CG    . LEU A 8   ? 0.4925 0.4889 0.4490 0.0088  -0.0298 0.0355  56  LEU A CG    
18   C  CD1   . LEU A 8   ? 0.5033 0.4772 0.4546 -0.0055 -0.0025 0.0261  56  LEU A CD1   
19   C  CD2   . LEU A 8   ? 0.4716 0.4731 0.4367 -0.0009 -0.0542 0.0582  56  LEU A CD2   
20   N  N     . SER A 9   ? 0.4695 0.6123 0.4175 0.0294  -0.0249 0.0238  57  SER A N     
21   C  CA    . SER A 9   ? 0.4177 0.6284 0.3849 0.0462  -0.0086 0.0304  57  SER A CA    
22   C  C     . SER A 9   ? 0.3888 0.6307 0.3373 0.0538  -0.0060 0.0392  57  SER A C     
23   O  O     . SER A 9   ? 0.3920 0.6403 0.3126 0.0711  -0.0027 0.0676  57  SER A O     
24   C  CB    . SER A 9   ? 0.3829 0.6507 0.4105 0.0683  0.0024  0.0291  57  SER A CB    
25   O  OG    . SER A 9   ? 0.3556 0.6576 0.4178 0.1075  0.0158  0.0205  57  SER A OG    
26   N  N     . ARG A 10  ? 0.3693 0.6342 0.3270 0.0405  -0.0142 0.0112  58  ARG A N     
27   C  CA    . ARG A 10  ? 0.3364 0.6337 0.3382 -0.0012 -0.0296 0.0128  58  ARG A CA    
28   C  C     . ARG A 10  ? 0.3114 0.6453 0.3246 0.0000  -0.0488 0.0098  58  ARG A C     
29   O  O     . ARG A 10  ? 0.3103 0.6503 0.3346 -0.0032 -0.0378 0.0129  58  ARG A O     
30   C  CB    . ARG A 10  ? 0.3311 0.6171 0.3694 -0.0366 -0.0080 0.0150  58  ARG A CB    
31   C  CG    . ARG A 10  ? 0.3580 0.6028 0.4103 -0.0752 0.0140  0.0202  58  ARG A CG    
32   C  CD    . ARG A 10  ? 0.3937 0.5999 0.4413 -0.0881 0.0025  0.0212  58  ARG A CD    
33   N  NE    . ARG A 10  ? 0.4414 0.6041 0.4662 -0.1015 -0.0057 0.0200  58  ARG A NE    
34   C  CZ    . ARG A 10  ? 0.4610 0.6044 0.4787 -0.0995 -0.0238 0.0232  58  ARG A CZ    
35   N  NH1   . ARG A 10  ? 0.4973 0.6139 0.4889 -0.0894 -0.0183 0.0284  58  ARG A NH1   
36   N  NH2   . ARG A 10  ? 0.4354 0.5958 0.4788 -0.1235 -0.0516 0.0239  58  ARG A NH2   
37   N  N     . GLU A 11  ? 0.3010 0.6551 0.3257 -0.0038 -0.0757 0.0147  59  GLU A N     
38   C  CA    . GLU A 11  ? 0.3143 0.6550 0.3515 -0.0190 -0.0984 0.0119  59  GLU A CA    
39   C  C     . GLU A 11  ? 0.2897 0.6282 0.3081 0.0017  -0.0764 0.0041  59  GLU A C     
40   O  O     . GLU A 11  ? 0.2313 0.6452 0.2970 0.0029  -0.0677 -0.0263 59  GLU A O     
41   C  CB    . GLU A 11  ? 0.3857 0.6885 0.4207 -0.0400 -0.1258 0.0132  59  GLU A CB    
42   C  CG    . GLU A 11  ? 0.4972 0.7183 0.4884 -0.0455 -0.1179 0.0044  59  GLU A CG    
43   C  CD    . GLU A 11  ? 0.5770 0.7409 0.5601 -0.0384 -0.1140 0.0003  59  GLU A CD    
44   O  OE1   . GLU A 11  ? 0.5919 0.7421 0.6082 -0.0297 -0.1410 -0.0093 59  GLU A OE1   
45   O  OE2   . GLU A 11  ? 0.6298 0.7542 0.5885 -0.0368 -0.0864 0.0091  59  GLU A OE2   
46   N  N     . ALA A 12  ? 0.3051 0.5896 0.2882 0.0397  -0.0495 0.0132  60  ALA A N     
47   C  CA    . ALA A 12  ? 0.3087 0.5505 0.2843 0.0655  -0.0509 0.0253  60  ALA A CA    
48   C  C     . ALA A 12  ? 0.2981 0.5216 0.2682 0.0710  -0.0458 0.0087  60  ALA A C     
49   O  O     . ALA A 12  ? 0.3191 0.5216 0.2617 0.0755  -0.0186 0.0073  60  ALA A O     
50   C  CB    . ALA A 12  ? 0.3522 0.5540 0.3059 0.0807  -0.0185 0.0319  60  ALA A CB    
51   N  N     . LEU A 13  ? 0.2781 0.4933 0.2646 0.0587  -0.0527 -0.0116 61  LEU A N     
52   C  CA    . LEU A 13  ? 0.2423 0.4432 0.2402 0.0400  -0.0529 -0.0266 61  LEU A CA    
53   C  C     . LEU A 13  ? 0.2057 0.4425 0.2419 0.0097  -0.0508 -0.0441 61  LEU A C     
54   O  O     . LEU A 13  ? 0.2233 0.4424 0.2433 -0.0038 -0.0484 -0.0469 61  LEU A O     
55   C  CB    . LEU A 13  ? 0.2280 0.4285 0.2260 0.0450  -0.0242 -0.0069 61  LEU A CB    
56   C  CG    . LEU A 13  ? 0.2122 0.3925 0.2198 0.0446  -0.0154 -0.0052 61  LEU A CG    
57   C  CD1   . LEU A 13  ? 0.2434 0.3715 0.2304 0.0174  -0.0411 -0.0145 61  LEU A CD1   
58   C  CD2   . LEU A 13  ? 0.2573 0.4091 0.2078 0.0402  -0.0069 -0.0126 61  LEU A CD2   
59   N  N     . GLN A 14  ? 0.2277 0.4501 0.2470 -0.0257 -0.0566 -0.0678 62  GLN A N     
60   C  CA    . GLN A 14  ? 0.2339 0.4548 0.2544 -0.0582 -0.0391 -0.0765 62  GLN A CA    
61   C  C     . GLN A 14  ? 0.2187 0.4735 0.2359 -0.0445 -0.0509 -0.0695 62  GLN A C     
62   O  O     . GLN A 14  ? 0.2188 0.4745 0.2490 -0.0601 -0.0238 -0.0944 62  GLN A O     
63   C  CB    . GLN A 14  ? 0.2960 0.4633 0.2992 -0.0832 -0.0136 -0.0639 62  GLN A CB    
64   C  CG    . GLN A 14  ? 0.3539 0.4838 0.3360 -0.1012 -0.0083 -0.0693 62  GLN A CG    
65   C  CD    . GLN A 14  ? 0.4737 0.5232 0.4084 -0.0707 -0.0007 -0.0426 62  GLN A CD    
66   O  OE1   . GLN A 14  ? 0.4912 0.5385 0.4432 -0.0659 -0.0078 -0.0594 62  GLN A OE1   
67   N  NE2   . GLN A 14  ? 0.5355 0.5347 0.4362 -0.0779 0.0167  -0.0187 62  GLN A NE2   
68   N  N     . LYS A 15  ? 0.2174 0.4901 0.2094 -0.0648 -0.0521 -0.0569 63  LYS A N     
69   C  CA    . LYS A 15  ? 0.2364 0.5036 0.2135 -0.0179 -0.0504 -0.0324 63  LYS A CA    
70   C  C     . LYS A 15  ? 0.2258 0.4517 0.2134 -0.0151 -0.0262 -0.0524 63  LYS A C     
71   O  O     . LYS A 15  ? 0.2062 0.4421 0.2234 -0.0177 -0.0161 -0.0551 63  LYS A O     
72   C  CB    . LYS A 15  ? 0.2731 0.5555 0.2249 -0.0063 -0.0622 -0.0025 63  LYS A CB    
73   C  CG    . LYS A 15  ? 0.3049 0.5865 0.2407 0.0066  -0.0531 0.0343  63  LYS A CG    
74   C  CD    . LYS A 15  ? 0.3546 0.6157 0.2685 -0.0004 -0.0621 0.0465  63  LYS A CD    
75   C  CE    . LYS A 15  ? 0.3849 0.6383 0.3176 -0.0086 -0.0688 0.0735  63  LYS A CE    
76   N  NZ    . LYS A 15  ? 0.3987 0.6521 0.3565 -0.0141 -0.0759 0.0793  63  LYS A NZ    
77   N  N     . ASP A 16  ? 0.2208 0.4243 0.2085 -0.0098 -0.0611 -0.0285 64  ASP A N     
78   C  CA    . ASP A 16  ? 0.2359 0.3942 0.2300 -0.0044 -0.0539 -0.0238 64  ASP A CA    
79   C  C     . ASP A 16  ? 0.2114 0.3814 0.2341 -0.0032 -0.0468 -0.0076 64  ASP A C     
80   O  O     . ASP A 16  ? 0.2144 0.3913 0.2298 0.0266  -0.0218 0.0090  64  ASP A O     
81   C  CB    . ASP A 16  ? 0.2741 0.3982 0.2515 -0.0045 -0.0221 -0.0366 64  ASP A CB    
82   C  CG    . ASP A 16  ? 0.3454 0.4333 0.2858 0.0061  0.0213  -0.0292 64  ASP A CG    
83   O  OD1   . ASP A 16  ? 0.3640 0.4492 0.3203 -0.0166 0.0389  -0.0430 64  ASP A OD1   
84   O  OD2   . ASP A 16  ? 0.4033 0.4500 0.2850 -0.0036 0.0376  -0.0191 64  ASP A OD2   
85   N  N     . LEU A 17  ? 0.2127 0.3673 0.2274 -0.0099 -0.0298 -0.0205 65  LEU A N     
86   C  CA    . LEU A 17  ? 0.1894 0.3620 0.2326 -0.0390 -0.0269 -0.0303 65  LEU A CA    
87   C  C     . LEU A 17  ? 0.2049 0.3714 0.2335 -0.0472 -0.0299 -0.0434 65  LEU A C     
88   O  O     . LEU A 17  ? 0.2135 0.3616 0.2464 -0.0274 -0.0223 -0.0266 65  LEU A O     
89   C  CB    . LEU A 17  ? 0.2038 0.3564 0.2186 -0.0459 -0.0009 -0.0311 65  LEU A CB    
90   C  CG    . LEU A 17  ? 0.2055 0.3559 0.2316 -0.0329 -0.0090 -0.0547 65  LEU A CG    
91   C  CD1   . LEU A 17  ? 0.2471 0.3548 0.2412 -0.0256 0.0141  -0.0387 65  LEU A CD1   
92   C  CD2   . LEU A 17  ? 0.2289 0.3832 0.2454 -0.0118 -0.0398 -0.0740 65  LEU A CD2   
93   N  N     . ASP A 18  ? 0.2413 0.3757 0.2284 -0.0466 -0.0418 -0.0840 66  ASP A N     
94   C  CA    . ASP A 18  ? 0.2624 0.3959 0.2220 -0.0395 -0.0338 -0.0926 66  ASP A CA    
95   C  C     . ASP A 18  ? 0.2399 0.3985 0.2238 -0.0175 -0.0266 -0.0592 66  ASP A C     
96   O  O     . ASP A 18  ? 0.2634 0.3965 0.2247 -0.0211 -0.0099 -0.0378 66  ASP A O     
97   C  CB    . ASP A 18  ? 0.2818 0.4397 0.2421 -0.0533 -0.0277 -0.1043 66  ASP A CB    
98   C  CG    . ASP A 18  ? 0.3281 0.4845 0.2959 -0.0795 -0.0319 -0.0988 66  ASP A CG    
99   O  OD1   . ASP A 18  ? 0.3476 0.5074 0.3026 -0.1033 -0.0197 -0.0919 66  ASP A OD1   
100  O  OD2   . ASP A 18  ? 0.3458 0.5097 0.3247 -0.0809 -0.0246 -0.0901 66  ASP A OD2   
101  N  N     . ASP A 19  ? 0.2207 0.4167 0.2183 -0.0033 -0.0374 -0.0323 67  ASP A N     
102  C  CA    . ASP A 19  ? 0.2274 0.4351 0.2226 -0.0014 -0.0254 -0.0480 67  ASP A CA    
103  C  C     . ASP A 19  ? 0.2170 0.4233 0.2107 -0.0008 -0.0261 -0.0365 67  ASP A C     
104  O  O     . ASP A 19  ? 0.2315 0.4762 0.1974 -0.0286 -0.0213 -0.0292 67  ASP A O     
105  C  CB    . ASP A 19  ? 0.2651 0.4652 0.2486 -0.0135 -0.0601 -0.0410 67  ASP A CB    
106  C  CG    . ASP A 19  ? 0.3160 0.5123 0.2911 -0.0116 -0.0621 -0.0265 67  ASP A CG    
107  O  OD1   . ASP A 19  ? 0.3500 0.5384 0.2971 -0.0346 -0.0694 -0.0386 67  ASP A OD1   
108  O  OD2   . ASP A 19  ? 0.3371 0.5443 0.3268 0.0192  -0.0659 -0.0022 67  ASP A OD2   
109  N  N     . ASN A 20  ? 0.1887 0.3676 0.1945 -0.0168 -0.0350 -0.0133 68  ASN A N     
110  C  CA    . ASN A 20  ? 0.1956 0.3318 0.2147 0.0026  -0.0139 0.0065  68  ASN A CA    
111  C  C     . ASN A 20  ? 0.2107 0.2715 0.1790 -0.0163 -0.0063 0.0083  68  ASN A C     
112  O  O     . ASN A 20  ? 0.2182 0.2447 0.1597 -0.0125 -0.0236 -0.0099 68  ASN A O     
113  C  CB    . ASN A 20  ? 0.2043 0.3530 0.2217 0.0097  0.0065  0.0330  68  ASN A CB    
114  C  CG    . ASN A 20  ? 0.2138 0.3963 0.2555 0.0293  -0.0007 0.0523  68  ASN A CG    
115  O  OD1   . ASN A 20  ? 0.2622 0.4353 0.3033 0.0115  0.0222  0.0720  68  ASN A OD1   
116  N  ND2   . ASN A 20  ? 0.2108 0.3917 0.2539 0.0155  -0.0195 0.0428  68  ASN A ND2   
117  N  N     . LEU A 21  ? 0.2259 0.2529 0.1890 -0.0105 -0.0128 0.0153  69  LEU A N     
118  C  CA    . LEU A 21  ? 0.2229 0.2428 0.1716 -0.0164 -0.0014 0.0122  69  LEU A CA    
119  C  C     . LEU A 21  ? 0.2100 0.2440 0.1842 -0.0353 -0.0457 -0.0207 69  LEU A C     
120  O  O     . LEU A 21  ? 0.2289 0.2592 0.2375 -0.0482 -0.0467 -0.0348 69  LEU A O     
121  C  CB    . LEU A 21  ? 0.2380 0.2548 0.1536 -0.0106 0.0336  0.0196  69  LEU A CB    
122  C  CG    . LEU A 21  ? 0.2644 0.2653 0.1855 0.0015  0.0306  0.0341  69  LEU A CG    
123  C  CD1   . LEU A 21  ? 0.2706 0.2989 0.2092 -0.0106 0.0086  0.0516  69  LEU A CD1   
124  C  CD2   . LEU A 21  ? 0.3016 0.2818 0.2258 0.0167  0.0386  0.0413  69  LEU A CD2   
125  N  N     . PHE A 22  ? 0.2144 0.2402 0.1723 -0.0115 -0.0273 -0.0232 70  PHE A N     
126  C  CA    . PHE A 22  ? 0.2291 0.2548 0.1922 -0.0109 -0.0028 -0.0130 70  PHE A CA    
127  C  C     . PHE A 22  ? 0.2291 0.2437 0.1826 -0.0244 -0.0140 -0.0129 70  PHE A C     
128  O  O     . PHE A 22  ? 0.2457 0.2294 0.1826 -0.0330 -0.0108 -0.0216 70  PHE A O     
129  C  CB    . PHE A 22  ? 0.2497 0.2750 0.1755 -0.0085 0.0001  -0.0192 70  PHE A CB    
130  C  CG    . PHE A 22  ? 0.2618 0.2849 0.1808 -0.0049 0.0065  -0.0184 70  PHE A CG    
131  C  CD1   . PHE A 22  ? 0.2861 0.3023 0.1961 0.0029  0.0079  -0.0050 70  PHE A CD1   
132  C  CD2   . PHE A 22  ? 0.2454 0.2904 0.1873 0.0012  0.0250  -0.0038 70  PHE A CD2   
133  C  CE1   . PHE A 22  ? 0.2986 0.2908 0.2029 -0.0260 0.0033  0.0093  70  PHE A CE1   
134  C  CE2   . PHE A 22  ? 0.2406 0.2812 0.1927 0.0116  -0.0007 -0.0004 70  PHE A CE2   
135  C  CZ    . PHE A 22  ? 0.2733 0.2993 0.2082 -0.0252 0.0035  -0.0060 70  PHE A CZ    
136  N  N     . GLY A 23  ? 0.2387 0.2272 0.2054 -0.0236 -0.0123 0.0100  71  GLY A N     
137  C  CA    . GLY A 23  ? 0.2402 0.2266 0.2160 -0.0174 0.0070  -0.0027 71  GLY A CA    
138  C  C     . GLY A 23  ? 0.2113 0.2246 0.2072 -0.0156 0.0014  -0.0167 71  GLY A C     
139  O  O     . GLY A 23  ? 0.2325 0.2524 0.2211 -0.0038 -0.0011 -0.0169 71  GLY A O     
140  N  N     . GLN A 24  ? 0.2038 0.2010 0.1949 -0.0156 0.0232  -0.0089 72  GLN A N     
141  C  CA    . GLN A 24  ? 0.2071 0.1945 0.1964 -0.0214 0.0111  -0.0227 72  GLN A CA    
142  C  C     . GLN A 24  ? 0.2022 0.2132 0.2126 -0.0310 -0.0062 -0.0341 72  GLN A C     
143  O  O     . GLN A 24  ? 0.2264 0.2460 0.2182 -0.0303 -0.0107 -0.0161 72  GLN A O     
144  C  CB    . GLN A 24  ? 0.1932 0.1895 0.2051 -0.0059 -0.0122 -0.0209 72  GLN A CB    
145  C  CG    . GLN A 24  ? 0.1862 0.1782 0.2174 -0.0039 -0.0223 -0.0036 72  GLN A CG    
146  C  CD    . GLN A 24  ? 0.1940 0.1667 0.2157 -0.0203 -0.0074 -0.0032 72  GLN A CD    
147  O  OE1   . GLN A 24  ? 0.2308 0.1784 0.2145 -0.0383 -0.0061 -0.0100 72  GLN A OE1   
148  N  NE2   . GLN A 24  ? 0.1730 0.1829 0.2193 -0.0224 -0.0007 -0.0130 72  GLN A NE2   
149  N  N     . HIS A 25  ? 0.2196 0.2132 0.2271 -0.0628 -0.0083 -0.0464 73  HIS A N     
150  C  CA    . HIS A 25  ? 0.2310 0.2162 0.2598 -0.0728 0.0014  -0.0608 73  HIS A CA    
151  C  C     . HIS A 25  ? 0.2411 0.2425 0.2509 -0.0690 -0.0203 -0.0456 73  HIS A C     
152  O  O     . HIS A 25  ? 0.2649 0.2811 0.2770 -0.0642 -0.0380 -0.0120 73  HIS A O     
153  C  CB    . HIS A 25  ? 0.2392 0.2090 0.2850 -0.0672 -0.0438 -0.0602 73  HIS A CB    
154  C  CG    . HIS A 25  ? 0.2635 0.2267 0.3011 -0.0581 -0.0239 -0.0351 73  HIS A CG    
155  N  ND1   . HIS A 25  ? 0.2732 0.2339 0.3202 -0.0511 -0.0035 -0.0360 73  HIS A ND1   
156  C  CD2   . HIS A 25  ? 0.3027 0.2296 0.3090 -0.0440 -0.0368 -0.0440 73  HIS A CD2   
157  C  CE1   . HIS A 25  ? 0.2845 0.2412 0.3241 -0.0361 -0.0210 -0.0424 73  HIS A CE1   
158  N  NE2   . HIS A 25  ? 0.2936 0.2253 0.3244 -0.0337 -0.0238 -0.0481 73  HIS A NE2   
159  N  N     . LEU A 26  ? 0.2546 0.2524 0.2324 -0.0813 -0.0116 -0.0144 74  LEU A N     
160  C  CA    . LEU A 26  ? 0.2631 0.2638 0.2587 -0.0634 -0.0173 -0.0028 74  LEU A CA    
161  C  C     . LEU A 26  ? 0.2512 0.2621 0.2591 -0.0647 0.0002  0.0033  74  LEU A C     
162  O  O     . LEU A 26  ? 0.2441 0.2893 0.2746 -0.0494 0.0240  0.0096  74  LEU A O     
163  C  CB    . LEU A 26  ? 0.3063 0.2719 0.3175 -0.0392 -0.0431 0.0121  74  LEU A CB    
164  C  CG    . LEU A 26  ? 0.3368 0.2928 0.3547 -0.0317 -0.0469 0.0080  74  LEU A CG    
165  C  CD1   . LEU A 26  ? 0.3577 0.2956 0.3529 -0.0039 -0.0340 0.0065  74  LEU A CD1   
166  C  CD2   . LEU A 26  ? 0.3698 0.3190 0.3763 -0.0385 -0.0373 0.0106  74  LEU A CD2   
167  N  N     . ALA A 27  ? 0.2573 0.2401 0.2350 -0.0679 -0.0047 -0.0134 75  ALA A N     
168  C  CA    . ALA A 27  ? 0.2342 0.2447 0.2524 -0.0600 -0.0342 -0.0340 75  ALA A CA    
169  C  C     . ALA A 27  ? 0.2216 0.2533 0.2395 -0.0438 -0.0234 -0.0554 75  ALA A C     
170  O  O     . ALA A 27  ? 0.2332 0.2698 0.2615 -0.0508 0.0003  -0.0488 75  ALA A O     
171  C  CB    . ALA A 27  ? 0.2164 0.2572 0.2667 -0.0684 -0.0307 -0.0379 75  ALA A CB    
172  N  N     . LYS A 28  ? 0.2337 0.2431 0.2422 -0.0680 -0.0116 -0.0310 76  LYS A N     
173  C  CA    . LYS A 28  ? 0.2548 0.2660 0.2458 -0.0583 0.0044  -0.0319 76  LYS A CA    
174  C  C     . LYS A 28  ? 0.2735 0.2634 0.2583 -0.0751 0.0106  -0.0319 76  LYS A C     
175  O  O     . LYS A 28  ? 0.2996 0.2678 0.2803 -0.0522 0.0245  -0.0291 76  LYS A O     
176  C  CB    . LYS A 28  ? 0.3082 0.2897 0.2653 -0.0749 0.0562  -0.0414 76  LYS A CB    
177  C  CG    . LYS A 28  ? 0.3733 0.3249 0.2697 -0.0780 0.0339  -0.0454 76  LYS A CG    
178  C  CD    . LYS A 28  ? 0.4194 0.3405 0.2519 -0.0772 0.0288  -0.0584 76  LYS A CD    
179  C  CE    . LYS A 28  ? 0.4307 0.3722 0.2583 -0.0690 0.0276  -0.0661 76  LYS A CE    
180  N  NZ    . LYS A 28  ? 0.3949 0.3865 0.2501 -0.0727 0.0337  -0.0716 76  LYS A NZ    
181  N  N     . LYS A 29  ? 0.2702 0.2620 0.2425 -0.1003 -0.0132 -0.0276 77  LYS A N     
182  C  CA    . LYS A 29  ? 0.2725 0.2877 0.2596 -0.1155 -0.0075 -0.0329 77  LYS A CA    
183  C  C     . LYS A 29  ? 0.2402 0.2938 0.2447 -0.0814 0.0061  -0.0160 77  LYS A C     
184  O  O     . LYS A 29  ? 0.2421 0.3243 0.2638 -0.0850 -0.0121 -0.0124 77  LYS A O     
185  C  CB    . LYS A 29  ? 0.3392 0.3267 0.3172 -0.1227 0.0277  -0.0245 77  LYS A CB    
186  C  CG    . LYS A 29  ? 0.4315 0.3822 0.3799 -0.1325 0.0447  -0.0068 77  LYS A CG    
187  C  CD    . LYS A 29  ? 0.4844 0.4268 0.4276 -0.1306 0.0551  -0.0004 77  LYS A CD    
188  C  CE    . LYS A 29  ? 0.5159 0.4612 0.4680 -0.1274 0.0614  0.0148  77  LYS A CE    
189  N  NZ    . LYS A 29  ? 0.5433 0.4848 0.4977 -0.1045 0.0602  0.0214  77  LYS A NZ    
190  N  N     . ILE A 30  ? 0.2416 0.2541 0.2403 -0.0718 0.0074  -0.0052 78  ILE A N     
191  C  CA    . ILE A 30  ? 0.2398 0.2458 0.2390 -0.0303 -0.0045 0.0015  78  ILE A CA    
192  C  C     . ILE A 30  ? 0.2163 0.2367 0.2377 -0.0308 -0.0204 -0.0067 78  ILE A C     
193  O  O     . ILE A 30  ? 0.2230 0.2452 0.2575 -0.0205 -0.0209 -0.0165 78  ILE A O     
194  C  CB    . ILE A 30  ? 0.2294 0.2485 0.2398 -0.0026 -0.0067 0.0124  78  ILE A CB    
195  C  CG1   . ILE A 30  ? 0.2442 0.2429 0.2455 -0.0179 -0.0108 0.0127  78  ILE A CG1   
196  C  CG2   . ILE A 30  ? 0.2431 0.2604 0.2312 -0.0176 -0.0042 0.0201  78  ILE A CG2   
197  C  CD1   . ILE A 30  ? 0.2709 0.2467 0.2558 -0.0037 -0.0183 0.0152  78  ILE A CD1   
198  N  N     A ILE A 31  ? 0.2156 0.2346 0.2275 -0.0385 -0.0301 -0.0076 79  ILE A N     
199  N  N     B ILE A 31  ? 0.1933 0.2221 0.2278 -0.0496 -0.0327 0.0088  79  ILE A N     
200  C  CA    A ILE A 31  ? 0.2146 0.2423 0.2320 -0.0465 -0.0294 -0.0128 79  ILE A CA    
201  C  CA    B ILE A 31  ? 0.1773 0.2230 0.2451 -0.0659 -0.0158 0.0148  79  ILE A CA    
202  C  C     A ILE A 31  ? 0.2009 0.2702 0.2349 -0.0537 -0.0327 -0.0103 79  ILE A C     
203  C  C     B ILE A 31  ? 0.1800 0.2596 0.2384 -0.0588 -0.0213 0.0017  79  ILE A C     
204  O  O     A ILE A 31  ? 0.2097 0.2755 0.2447 -0.0459 -0.0351 -0.0049 79  ILE A O     
205  O  O     B ILE A 31  ? 0.1869 0.2658 0.2539 -0.0410 -0.0325 0.0055  79  ILE A O     
206  C  CB    A ILE A 31  ? 0.2220 0.2285 0.2279 -0.0259 -0.0274 -0.0265 79  ILE A CB    
207  C  CB    B ILE A 31  ? 0.1645 0.2083 0.2607 -0.0355 -0.0180 0.0179  79  ILE A CB    
208  C  CG1   A ILE A 31  ? 0.2340 0.2220 0.2185 -0.0163 -0.0385 -0.0387 79  ILE A CG1   
209  C  CG1   B ILE A 31  ? 0.1533 0.2078 0.2736 -0.0349 -0.0464 0.0113  79  ILE A CG1   
210  C  CG2   A ILE A 31  ? 0.2305 0.2247 0.2373 -0.0183 -0.0227 -0.0316 79  ILE A CG2   
211  C  CG2   B ILE A 31  ? 0.1931 0.2049 0.2757 -0.0149 -0.0217 0.0215  79  ILE A CG2   
212  C  CD1   A ILE A 31  ? 0.2599 0.2138 0.2102 -0.0169 -0.0315 -0.0430 79  ILE A CD1   
213  C  CD1   B ILE A 31  ? 0.1683 0.2015 0.2935 -0.0531 -0.0496 0.0230  79  ILE A CD1   
214  N  N     . LEU A 32  ? 0.1877 0.2987 0.2401 -0.0716 -0.0456 -0.0053 80  LEU A N     
215  C  CA    . LEU A 32  ? 0.2164 0.3407 0.2317 -0.0437 -0.0312 -0.0288 80  LEU A CA    
216  C  C     . LEU A 32  ? 0.2494 0.3411 0.2556 -0.0758 -0.0209 -0.0326 80  LEU A C     
217  O  O     . LEU A 32  ? 0.2601 0.3594 0.2631 -0.0488 -0.0139 -0.0202 80  LEU A O     
218  C  CB    . LEU A 32  ? 0.2515 0.3599 0.2094 -0.0435 -0.0601 -0.0226 80  LEU A CB    
219  C  CG    . LEU A 32  ? 0.2771 0.3902 0.2398 -0.0444 -0.0543 -0.0203 80  LEU A CG    
220  C  CD1   . LEU A 32  ? 0.2838 0.3954 0.2630 -0.0321 -0.0346 -0.0007 80  LEU A CD1   
221  C  CD2   . LEU A 32  ? 0.3214 0.4175 0.2507 -0.0388 -0.0691 -0.0229 80  LEU A CD2   
222  N  N     . ASN A 33  ? 0.2487 0.3104 0.2757 -0.1337 -0.0136 -0.0537 81  ASN A N     
223  C  CA    . ASN A 33  ? 0.2886 0.3202 0.3047 -0.1090 0.0197  -0.0421 81  ASN A CA    
224  C  C     . ASN A 33  ? 0.2553 0.3187 0.2751 -0.0895 0.0044  -0.0386 81  ASN A C     
225  O  O     . ASN A 33  ? 0.2615 0.3400 0.2749 -0.0690 0.0246  -0.0321 81  ASN A O     
226  C  CB    . ASN A 33  ? 0.3252 0.3356 0.3658 -0.1084 0.0254  -0.0379 81  ASN A CB    
227  C  CG    . ASN A 33  ? 0.3689 0.3862 0.4301 -0.0758 -0.0520 -0.0537 81  ASN A CG    
228  O  OD1   . ASN A 33  ? 0.4425 0.4099 0.4511 -0.0585 -0.0835 -0.0606 81  ASN A OD1   
229  N  ND2   . ASN A 33  ? 0.3792 0.4015 0.4633 -0.0658 -0.0791 -0.0677 81  ASN A ND2   
230  N  N     . ALA A 34  ? 0.2417 0.3030 0.2556 -0.0527 -0.0130 -0.0271 82  ALA A N     
231  C  CA    . ALA A 34  ? 0.2296 0.2896 0.2562 -0.0326 -0.0207 -0.0356 82  ALA A CA    
232  C  C     . ALA A 34  ? 0.1843 0.2788 0.2834 -0.0387 -0.0132 -0.0175 82  ALA A C     
233  O  O     . ALA A 34  ? 0.1938 0.2821 0.3054 -0.0235 0.0021  0.0052  82  ALA A O     
234  C  CB    . ALA A 34  ? 0.2564 0.2972 0.2614 0.0027  -0.0271 -0.0512 82  ALA A CB    
235  N  N     . VAL A 35  ? 0.1782 0.2838 0.3061 -0.0558 -0.0152 0.0282  83  VAL A N     
236  C  CA    . VAL A 35  ? 0.1663 0.2932 0.3465 -0.0430 -0.0289 0.0193  83  VAL A CA    
237  C  C     . VAL A 35  ? 0.2010 0.3546 0.3763 -0.0309 -0.0311 0.0234  83  VAL A C     
238  O  O     . VAL A 35  ? 0.2179 0.3536 0.4193 -0.0188 -0.0305 0.0329  83  VAL A O     
239  C  CB    . VAL A 35  ? 0.1891 0.2626 0.3407 -0.0421 -0.0411 0.0194  83  VAL A CB    
240  C  CG1   . VAL A 35  ? 0.2277 0.2855 0.3526 -0.0426 -0.0529 0.0192  83  VAL A CG1   
241  C  CG2   . VAL A 35  ? 0.1960 0.2577 0.3309 -0.0687 -0.0400 -0.0030 83  VAL A CG2   
242  N  N     . PHE A 36  ? 0.1685 0.4036 0.3299 -0.0422 -0.0677 0.0282  84  PHE A N     
243  C  CA    . PHE A 36  ? 0.1992 0.4246 0.3649 -0.0466 -0.0551 0.0026  84  PHE A CA    
244  C  C     . PHE A 36  ? 0.2090 0.4059 0.3636 -0.0350 -0.0292 -0.0114 84  PHE A C     
245  O  O     . PHE A 36  ? 0.2050 0.4169 0.3804 -0.0126 -0.0601 0.0047  84  PHE A O     
246  C  CB    . PHE A 36  ? 0.2188 0.4763 0.3994 -0.0447 -0.0817 -0.0010 84  PHE A CB    
247  C  CG    . PHE A 36  ? 0.2709 0.5201 0.4205 -0.0340 -0.0736 0.0209  84  PHE A CG    
248  C  CD1   . PHE A 36  ? 0.3028 0.5457 0.4430 -0.0209 -0.0699 0.0280  84  PHE A CD1   
249  C  CD2   . PHE A 36  ? 0.2787 0.5376 0.4300 -0.0532 -0.0874 0.0201  84  PHE A CD2   
250  C  CE1   . PHE A 36  ? 0.3296 0.5607 0.4523 -0.0258 -0.0875 0.0382  84  PHE A CE1   
251  C  CE2   . PHE A 36  ? 0.3077 0.5552 0.4469 -0.0377 -0.1031 0.0351  84  PHE A CE2   
252  C  CZ    . PHE A 36  ? 0.3396 0.5621 0.4575 -0.0396 -0.1044 0.0337  84  PHE A CZ    
253  N  N     . GLY A 37  ? 0.2172 0.3717 0.3258 -0.0683 0.0010  -0.0387 85  GLY A N     
254  C  CA    . GLY A 37  ? 0.2385 0.4029 0.3329 -0.0213 -0.0034 -0.0285 85  GLY A CA    
255  C  C     . GLY A 37  ? 0.2661 0.4328 0.3285 0.0077  0.0059  -0.0371 85  GLY A C     
256  O  O     . GLY A 37  ? 0.3176 0.4644 0.3618 0.0347  0.0111  -0.0687 85  GLY A O     
257  N  N     . PHE A 38  ? 0.2587 0.4213 0.3127 0.0191  -0.0134 -0.0384 86  PHE A N     
258  C  CA    . PHE A 38  ? 0.2166 0.3925 0.3025 -0.0004 -0.0122 -0.0086 86  PHE A CA    
259  C  C     . PHE A 38  ? 0.1877 0.3964 0.3039 -0.0162 0.0070  0.0302  86  PHE A C     
260  O  O     . PHE A 38  ? 0.1589 0.4315 0.3415 0.0131  -0.0210 0.0865  86  PHE A O     
261  C  CB    . PHE A 38  ? 0.2117 0.3489 0.2919 -0.0106 -0.0382 -0.0189 86  PHE A CB    
262  C  CG    . PHE A 38  ? 0.2086 0.2855 0.2966 -0.0316 -0.0405 -0.0270 86  PHE A CG    
263  C  CD1   . PHE A 38  ? 0.2129 0.2876 0.3026 -0.0365 0.0368  -0.0386 86  PHE A CD1   
264  C  CD2   . PHE A 38  ? 0.1934 0.2643 0.3092 -0.0070 -0.0425 -0.0228 86  PHE A CD2   
265  C  CE1   . PHE A 38  ? 0.2519 0.2901 0.3220 -0.0314 0.0308  -0.0013 86  PHE A CE1   
266  C  CE2   . PHE A 38  ? 0.1985 0.2531 0.3085 0.0093  0.0040  -0.0196 86  PHE A CE2   
267  C  CZ    . PHE A 38  ? 0.1998 0.2516 0.3154 -0.0263 0.0076  0.0156  86  PHE A CZ    
268  N  N     . ILE A 39  ? 0.2248 0.4005 0.2886 -0.0926 -0.0010 0.0070  87  ILE A N     
269  C  CA    . ILE A 39  ? 0.2144 0.4218 0.3063 -0.0365 -0.0488 0.0256  87  ILE A CA    
270  C  C     . ILE A 39  ? 0.2199 0.4498 0.3429 0.0068  -0.0341 0.0228  87  ILE A C     
271  O  O     . ILE A 39  ? 0.2462 0.4519 0.3507 0.0161  -0.0434 0.0181  87  ILE A O     
272  C  CB    . ILE A 39  ? 0.2377 0.4436 0.3179 0.0054  -0.0327 0.0314  87  ILE A CB    
273  C  CG1   . ILE A 39  ? 0.2581 0.4520 0.3109 -0.0011 -0.0288 0.0087  87  ILE A CG1   
274  C  CG2   . ILE A 39  ? 0.2663 0.4669 0.3413 0.0037  -0.0404 0.0284  87  ILE A CG2   
275  C  CD1   . ILE A 39  ? 0.2719 0.4697 0.3073 -0.0095 -0.0206 -0.0003 87  ILE A CD1   
276  N  N     . ASN A 40  ? 0.1985 0.4624 0.3930 0.0087  -0.0250 0.0234  88  ASN A N     
277  C  CA    . ASN A 40  ? 0.2415 0.4900 0.4062 -0.0010 -0.0360 0.0114  88  ASN A CA    
278  C  C     . ASN A 40  ? 0.2002 0.4741 0.3723 -0.0010 -0.0411 0.0085  88  ASN A C     
279  O  O     . ASN A 40  ? 0.2052 0.4963 0.3615 -0.0070 -0.0299 0.0006  88  ASN A O     
280  C  CB    . ASN A 40  ? 0.3011 0.5166 0.4351 -0.0093 -0.0470 -0.0087 88  ASN A CB    
281  C  CG    . ASN A 40  ? 0.3828 0.5407 0.4817 -0.0176 -0.0283 0.0000  88  ASN A CG    
282  O  OD1   . ASN A 40  ? 0.4181 0.5578 0.5066 -0.0119 -0.0320 0.0067  88  ASN A OD1   
283  N  ND2   . ASN A 40  ? 0.4093 0.5440 0.4969 -0.0263 -0.0143 -0.0043 88  ASN A ND2   
284  N  N     . ASN A 41  ? 0.1674 0.4254 0.3708 -0.0217 -0.0306 0.0286  89  ASN A N     
285  C  CA    . ASN A 41  ? 0.1500 0.3850 0.3723 0.0020  -0.0238 0.0225  89  ASN A CA    
286  C  C     . ASN A 41  ? 0.1470 0.3716 0.4105 -0.0118 -0.0459 0.0081  89  ASN A C     
287  O  O     . ASN A 41  ? 0.1641 0.3771 0.4228 -0.0039 -0.0647 0.0141  89  ASN A O     
288  C  CB    . ASN A 41  ? 0.1707 0.3614 0.3437 0.0072  -0.0165 0.0268  89  ASN A CB    
289  C  CG    . ASN A 41  ? 0.2270 0.3574 0.3607 -0.0142 -0.0002 -0.0008 89  ASN A CG    
290  O  OD1   . ASN A 41  ? 0.2299 0.3459 0.3712 -0.0385 0.0160  -0.0096 89  ASN A OD1   
291  N  ND2   . ASN A 41  ? 0.2842 0.3368 0.3519 -0.0045 0.0038  -0.0089 89  ASN A ND2   
292  N  N     . PRO A 42  ? 0.1701 0.3778 0.4299 -0.0255 -0.0701 -0.0001 90  PRO A N     
293  C  CA    . PRO A 42  ? 0.1682 0.3809 0.4363 0.0005  -0.0725 -0.0189 90  PRO A CA    
294  C  C     . PRO A 42  ? 0.1933 0.4075 0.4420 -0.0423 -0.0769 -0.0335 90  PRO A C     
295  O  O     . PRO A 42  ? 0.2522 0.4294 0.4544 -0.0248 -0.0883 -0.0671 90  PRO A O     
296  C  CB    . PRO A 42  ? 0.1675 0.3743 0.4552 -0.0025 -0.0768 -0.0238 90  PRO A CB    
297  C  CG    . PRO A 42  ? 0.1603 0.3779 0.4574 -0.0178 -0.0596 -0.0193 90  PRO A CG    
298  C  CD    . PRO A 42  ? 0.1351 0.3772 0.4517 -0.0179 -0.0676 -0.0210 90  PRO A CD    
299  N  N     . LYS A 43  ? 0.1649 0.4103 0.4239 -0.0236 -0.0199 -0.0026 91  LYS A N     
300  C  CA    . LYS A 43  ? 0.1970 0.4404 0.4334 -0.0296 -0.0030 -0.0084 91  LYS A CA    
301  C  C     . LYS A 43  ? 0.1634 0.4204 0.3862 -0.0705 0.0019  -0.0113 91  LYS A C     
302  O  O     . LYS A 43  ? 0.2047 0.4386 0.3887 -0.0682 0.0148  -0.0119 91  LYS A O     
303  C  CB    . LYS A 43  ? 0.3000 0.4803 0.4873 -0.0279 0.0258  0.0107  91  LYS A CB    
304  C  CG    . LYS A 43  ? 0.4171 0.5154 0.5343 -0.0156 0.0113  0.0219  91  LYS A CG    
305  C  CD    . LYS A 43  ? 0.4893 0.5555 0.5741 -0.0221 0.0141  0.0319  91  LYS A CD    
306  C  CE    . LYS A 43  ? 0.5522 0.5917 0.6061 -0.0290 0.0101  0.0259  91  LYS A CE    
307  N  NZ    . LYS A 43  ? 0.6084 0.6070 0.6279 -0.0274 0.0056  0.0179  91  LYS A NZ    
308  N  N     . PRO A 44  ? 0.1282 0.3957 0.3645 -0.0682 0.0137  -0.0252 92  PRO A N     
309  C  CA    . PRO A 44  ? 0.1523 0.4053 0.3486 -0.0567 0.0268  -0.0273 92  PRO A CA    
310  C  C     . PRO A 44  ? 0.1887 0.4352 0.3532 -0.0527 0.0295  -0.0265 92  PRO A C     
311  O  O     . PRO A 44  ? 0.2257 0.4651 0.3701 -0.0495 0.0000  -0.0517 92  PRO A O     
312  C  CB    . PRO A 44  ? 0.1788 0.3927 0.3625 -0.0503 0.0273  -0.0242 92  PRO A CB    
313  C  CG    . PRO A 44  ? 0.1973 0.3995 0.3640 -0.0478 0.0070  0.0002  92  PRO A CG    
314  C  CD    . PRO A 44  ? 0.1653 0.3795 0.3655 -0.0697 0.0202  -0.0028 92  PRO A CD    
315  N  N     . LYS A 45  ? 0.1885 0.4483 0.3326 -0.0820 0.0199  0.0185  93  LYS A N     
316  C  CA    . LYS A 45  ? 0.2319 0.4413 0.3548 -0.0813 0.0303  0.0471  93  LYS A CA    
317  C  C     . LYS A 45  ? 0.2175 0.3905 0.3343 -0.0820 0.0324  0.0502  93  LYS A C     
318  O  O     . LYS A 45  ? 0.2390 0.3933 0.3439 -0.0745 0.0509  0.0462  93  LYS A O     
319  C  CB    . LYS A 45  ? 0.3110 0.4796 0.4149 -0.0999 0.0059  0.0483  93  LYS A CB    
320  C  CG    . LYS A 45  ? 0.3826 0.5149 0.4602 -0.0804 -0.0064 0.0550  93  LYS A CG    
321  C  CD    . LYS A 45  ? 0.4670 0.5402 0.4918 -0.0716 0.0055  0.0592  93  LYS A CD    
322  C  CE    . LYS A 45  ? 0.5127 0.5626 0.5308 -0.0626 0.0122  0.0629  93  LYS A CE    
323  N  NZ    . LYS A 45  ? 0.5391 0.5822 0.5529 -0.0601 0.0235  0.0633  93  LYS A NZ    
324  N  N     . LYS A 46  ? 0.1828 0.3609 0.3105 -0.0805 0.0249  0.0419  94  LYS A N     
325  C  CA    . LYS A 46  ? 0.2032 0.3385 0.2978 -0.0423 0.0220  0.0581  94  LYS A CA    
326  C  C     . LYS A 46  ? 0.1887 0.3075 0.2517 -0.0415 0.0210  0.0417  94  LYS A C     
327  O  O     . LYS A 46  ? 0.2005 0.3133 0.2558 -0.0618 0.0098  0.0270  94  LYS A O     
328  C  CB    . LYS A 46  ? 0.2288 0.3492 0.3266 -0.0073 0.0178  0.0679  94  LYS A CB    
329  C  CG    . LYS A 46  ? 0.2223 0.3551 0.3280 -0.0046 0.0324  0.0393  94  LYS A CG    
330  C  CD    . LYS A 46  ? 0.2434 0.3392 0.2975 -0.0163 0.0443  0.0434  94  LYS A CD    
331  C  CE    . LYS A 46  ? 0.2536 0.3126 0.2754 -0.0317 0.0425  0.0365  94  LYS A CE    
332  N  NZ    . LYS A 46  ? 0.2450 0.2990 0.2384 -0.0120 0.0290  0.0560  94  LYS A NZ    
333  N  N     . PRO A 47  ? 0.1932 0.2983 0.2297 -0.0068 0.0123  0.0197  95  PRO A N     
334  C  CA    . PRO A 47  ? 0.1869 0.2986 0.2418 -0.0201 0.0298  0.0013  95  PRO A CA    
335  C  C     . PRO A 47  ? 0.1918 0.2724 0.2434 -0.0264 0.0296  0.0175  95  PRO A C     
336  O  O     . PRO A 47  ? 0.2428 0.2797 0.2343 0.0175  0.0310  0.0475  95  PRO A O     
337  C  CB    . PRO A 47  ? 0.2058 0.3208 0.2480 -0.0180 0.0142  -0.0006 95  PRO A CB    
338  C  CG    . PRO A 47  ? 0.2003 0.3217 0.2413 0.0029  0.0060  -0.0062 95  PRO A CG    
339  C  CD    . PRO A 47  ? 0.1968 0.3189 0.2452 0.0277  -0.0026 -0.0018 95  PRO A CD    
340  N  N     . LEU A 48  ? 0.1730 0.2661 0.2507 -0.0330 0.0151  -0.0188 96  LEU A N     
341  C  CA    . LEU A 48  ? 0.1681 0.2415 0.2387 -0.0313 -0.0133 -0.0141 96  LEU A CA    
342  C  C     . LEU A 48  ? 0.1485 0.2157 0.2275 -0.0211 -0.0081 0.0047  96  LEU A C     
343  O  O     . LEU A 48  ? 0.1641 0.2044 0.2472 -0.0195 0.0055  0.0136  96  LEU A O     
344  C  CB    . LEU A 48  ? 0.2106 0.2412 0.2363 -0.0160 -0.0326 0.0099  96  LEU A CB    
345  C  CG    . LEU A 48  ? 0.2313 0.2307 0.2228 -0.0133 -0.0192 0.0165  96  LEU A CG    
346  C  CD1   . LEU A 48  ? 0.2777 0.2138 0.2355 -0.0129 0.0132  0.0279  96  LEU A CD1   
347  C  CD2   . LEU A 48  ? 0.2907 0.2955 0.2303 -0.0025 -0.0395 0.0058  96  LEU A CD2   
348  N  N     . THR A 49  ? 0.1464 0.2116 0.2138 -0.0058 -0.0115 0.0087  97  THR A N     
349  C  CA    . THR A 49  ? 0.1715 0.2073 0.2106 0.0074  -0.0081 0.0061  97  THR A CA    
350  C  C     . THR A 49  ? 0.1904 0.1933 0.2286 0.0056  0.0197  0.0297  97  THR A C     
351  O  O     . THR A 49  ? 0.2154 0.1980 0.2629 -0.0166 0.0446  0.0424  97  THR A O     
352  C  CB    . THR A 49  ? 0.1842 0.2413 0.2037 0.0139  -0.0140 -0.0201 97  THR A CB    
353  O  OG1   . THR A 49  ? 0.2225 0.2356 0.2174 -0.0022 0.0148  -0.0093 97  THR A OG1   
354  C  CG2   . THR A 49  ? 0.2239 0.2771 0.2138 -0.0071 -0.0352 -0.0146 97  THR A CG2   
355  N  N     . LEU A 50  ? 0.1713 0.1918 0.1962 0.0008  0.0167  0.0167  98  LEU A N     
356  C  CA    . LEU A 50  ? 0.1631 0.1988 0.2010 0.0050  -0.0055 0.0420  98  LEU A CA    
357  C  C     . LEU A 50  ? 0.1491 0.1989 0.2187 -0.0128 -0.0156 0.0019  98  LEU A C     
358  O  O     . LEU A 50  ? 0.1649 0.2062 0.2769 -0.0302 -0.0091 0.0028  98  LEU A O     
359  C  CB    . LEU A 50  ? 0.1831 0.2329 0.2040 -0.0190 -0.0307 0.0392  98  LEU A CB    
360  C  CG    . LEU A 50  ? 0.1917 0.2564 0.2133 -0.0503 -0.0421 0.0398  98  LEU A CG    
361  C  CD1   . LEU A 50  ? 0.2194 0.2881 0.2167 -0.0430 -0.0199 0.0361  98  LEU A CD1   
362  C  CD2   . LEU A 50  ? 0.2573 0.2785 0.2593 -0.0699 -0.0301 0.0486  98  LEU A CD2   
363  N  N     . SER A 51  ? 0.1516 0.1940 0.1998 -0.0028 -0.0081 0.0053  99  SER A N     
364  C  CA    . SER A 51  ? 0.1746 0.2209 0.2035 0.0007  -0.0145 0.0088  99  SER A CA    
365  C  C     . SER A 51  ? 0.1588 0.2118 0.2024 -0.0106 0.0036  -0.0239 99  SER A C     
366  O  O     . SER A 51  ? 0.2000 0.2314 0.2178 -0.0061 -0.0031 -0.0230 99  SER A O     
367  C  CB    . SER A 51  ? 0.1991 0.2765 0.2558 0.0107  -0.0294 0.0484  99  SER A CB    
368  O  OG    . SER A 51  ? 0.2640 0.3188 0.3006 -0.0371 -0.0535 0.0837  99  SER A OG    
369  N  N     . LEU A 52  ? 0.1646 0.1935 0.1805 -0.0233 0.0190  -0.0092 100 LEU A N     
370  C  CA    . LEU A 52  ? 0.1685 0.2221 0.1944 0.0145  -0.0117 -0.0115 100 LEU A CA    
371  C  C     . LEU A 52  ? 0.1608 0.2480 0.2026 -0.0003 0.0100  -0.0181 100 LEU A C     
372  O  O     . LEU A 52  ? 0.1584 0.2588 0.2373 -0.0132 -0.0061 -0.0651 100 LEU A O     
373  C  CB    . LEU A 52  ? 0.1820 0.2553 0.2065 0.0046  -0.0013 0.0072  100 LEU A CB    
374  C  CG    . LEU A 52  ? 0.1840 0.2703 0.2038 0.0249  -0.0011 0.0415  100 LEU A CG    
375  C  CD1   . LEU A 52  ? 0.2098 0.2805 0.2387 0.0317  -0.0045 0.0273  100 LEU A CD1   
376  C  CD2   . LEU A 52  ? 0.2128 0.2641 0.2094 0.0431  -0.0227 0.0503  100 LEU A CD2   
377  N  N     A HIS A 53  ? 0.1514 0.2519 0.1833 0.0000  0.0147  0.0209  101 HIS A N     
378  N  N     B HIS A 53  ? 0.1649 0.2485 0.1837 0.0059  0.0207  0.0014  101 HIS A N     
379  C  CA    A HIS A 53  ? 0.1560 0.2456 0.1861 -0.0095 0.0142  0.0385  101 HIS A CA    
380  C  CA    B HIS A 53  ? 0.1808 0.2424 0.1756 0.0136  0.0275  0.0105  101 HIS A CA    
381  C  C     A HIS A 53  ? 0.1605 0.2096 0.1817 -0.0345 0.0069  0.0318  101 HIS A C     
382  C  C     B HIS A 53  ? 0.1660 0.2232 0.1780 0.0109  0.0130  0.0242  101 HIS A C     
383  O  O     A HIS A 53  ? 0.1919 0.1845 0.1940 -0.0665 -0.0047 0.0293  101 HIS A O     
384  O  O     B HIS A 53  ? 0.1832 0.2225 0.1928 0.0098  0.0041  0.0310  101 HIS A O     
385  C  CB    A HIS A 53  ? 0.1882 0.2727 0.2099 -0.0289 -0.0100 0.0647  101 HIS A CB    
386  C  CB    B HIS A 53  ? 0.2284 0.2571 0.1792 0.0094  0.0278  0.0152  101 HIS A CB    
387  C  CG    A HIS A 53  ? 0.2178 0.2747 0.2372 -0.0459 0.0108  0.0875  101 HIS A CG    
388  C  CG    B HIS A 53  ? 0.2469 0.2746 0.1743 0.0263  0.0580  0.0262  101 HIS A CG    
389  N  ND1   A HIS A 53  ? 0.2451 0.2849 0.2639 -0.0419 0.0302  0.0856  101 HIS A ND1   
390  N  ND1   B HIS A 53  ? 0.2842 0.2870 0.1620 0.0265  0.0647  0.0276  101 HIS A ND1   
391  C  CD2   A HIS A 53  ? 0.2261 0.2680 0.2550 -0.0355 0.0250  0.0801  101 HIS A CD2   
392  C  CD2   B HIS A 53  ? 0.2545 0.2881 0.1769 0.0292  0.0762  0.0208  101 HIS A CD2   
393  C  CE1   A HIS A 53  ? 0.2058 0.2788 0.2760 -0.0726 0.0381  0.0817  101 HIS A CE1   
394  C  CE1   B HIS A 53  ? 0.2949 0.3053 0.1844 0.0282  0.0690  0.0257  101 HIS A CE1   
395  N  NE2   A HIS A 53  ? 0.2559 0.2772 0.2775 -0.0497 0.0273  0.0745  101 HIS A NE2   
396  N  NE2   B HIS A 53  ? 0.2798 0.3065 0.1928 0.0391  0.0797  0.0057  101 HIS A NE2   
397  N  N     . GLY A 54  ? 0.1416 0.2127 0.1787 0.0181  0.0271  0.0272  102 GLY A N     
398  C  CA    . GLY A 54  ? 0.1483 0.2210 0.1982 -0.0071 0.0452  0.0084  102 GLY A CA    
399  C  C     . GLY A 54  ? 0.1508 0.1856 0.1782 -0.0097 0.0170  0.0106  102 GLY A C     
400  O  O     . GLY A 54  ? 0.1971 0.1760 0.1968 -0.0145 0.0052  0.0026  102 GLY A O     
401  N  N     . TRP A 55  ? 0.1868 0.1758 0.1768 -0.0038 0.0338  0.0035  103 TRP A N     
402  C  CA    . TRP A 55  ? 0.2039 0.1777 0.1825 0.0087  0.0437  -0.0154 103 TRP A CA    
403  C  C     . TRP A 55  ? 0.1785 0.1789 0.1695 0.0044  0.0246  -0.0055 103 TRP A C     
404  O  O     . TRP A 55  ? 0.1903 0.1747 0.1739 0.0079  -0.0047 0.0073  103 TRP A O     
405  C  CB    . TRP A 55  ? 0.2071 0.1688 0.1913 0.0225  0.0353  -0.0018 103 TRP A CB    
406  C  CG    . TRP A 55  ? 0.2327 0.1757 0.2165 0.0077  0.0541  0.0143  103 TRP A CG    
407  C  CD1   . TRP A 55  ? 0.2466 0.2016 0.2396 0.0339  0.0616  0.0145  103 TRP A CD1   
408  C  CD2   . TRP A 55  ? 0.2539 0.2036 0.2208 0.0056  0.0340  0.0329  103 TRP A CD2   
409  N  NE1   . TRP A 55  ? 0.2495 0.2166 0.2481 0.0347  0.0651  0.0304  103 TRP A NE1   
410  C  CE2   . TRP A 55  ? 0.2620 0.2298 0.2403 0.0243  0.0381  0.0435  103 TRP A CE2   
411  C  CE3   . TRP A 55  ? 0.2766 0.1952 0.2455 0.0095  0.0093  0.0409  103 TRP A CE3   
412  C  CZ2   . TRP A 55  ? 0.2766 0.2334 0.2534 0.0088  0.0288  0.0592  103 TRP A CZ2   
413  C  CZ3   . TRP A 55  ? 0.2994 0.2307 0.2669 -0.0092 0.0085  0.0441  103 TRP A CZ3   
414  C  CH2   . TRP A 55  ? 0.2885 0.2453 0.2478 0.0081  0.0135  0.0631  103 TRP A CH2   
415  N  N     . THR A 56  ? 0.1704 0.1621 0.1731 -0.0314 0.0017  -0.0143 104 THR A N     
416  C  CA    . THR A 56  ? 0.1520 0.1685 0.1595 -0.0131 -0.0271 0.0142  104 THR A CA    
417  C  C     . THR A 56  ? 0.1418 0.1800 0.1490 -0.0033 -0.0220 0.0207  104 THR A C     
418  O  O     . THR A 56  ? 0.1832 0.1965 0.1477 0.0067  -0.0127 -0.0008 104 THR A O     
419  C  CB    . THR A 56  ? 0.1571 0.1779 0.1691 0.0012  -0.0226 -0.0129 104 THR A CB    
420  O  OG1   . THR A 56  ? 0.1804 0.1840 0.1856 -0.0242 -0.0336 0.0030  104 THR A OG1   
421  C  CG2   . THR A 56  ? 0.1528 0.2182 0.1947 0.0340  -0.0220 -0.0180 104 THR A CG2   
422  N  N     . GLY A 57  ? 0.1560 0.1631 0.1366 0.0002  -0.0312 0.0311  105 GLY A N     
423  C  CA    . GLY A 57  ? 0.1698 0.1890 0.1422 0.0033  -0.0306 0.0157  105 GLY A CA    
424  C  C     . GLY A 57  ? 0.1432 0.1811 0.1536 0.0101  -0.0064 -0.0099 105 GLY A C     
425  O  O     . GLY A 57  ? 0.1651 0.1935 0.1448 -0.0062 0.0097  -0.0047 105 GLY A O     
426  N  N     . THR A 58  ? 0.1351 0.1650 0.1771 -0.0061 -0.0274 -0.0146 106 THR A N     
427  C  CA    . THR A 58  ? 0.1574 0.1525 0.1784 -0.0264 -0.0298 -0.0032 106 THR A CA    
428  C  C     . THR A 58  ? 0.1557 0.1641 0.1541 -0.0235 -0.0141 -0.0218 106 THR A C     
429  O  O     . THR A 58  ? 0.1727 0.1838 0.1597 -0.0280 -0.0041 -0.0263 106 THR A O     
430  C  CB    . THR A 58  ? 0.1876 0.1902 0.2059 -0.0259 -0.0350 0.0026  106 THR A CB    
431  O  OG1   . THR A 58  ? 0.2092 0.2198 0.1982 -0.0447 -0.0129 0.0268  106 THR A OG1   
432  C  CG2   . THR A 58  ? 0.1752 0.2039 0.2248 0.0245  -0.0516 -0.0186 106 THR A CG2   
433  N  N     . GLY A 59  ? 0.1496 0.1717 0.1518 0.0234  -0.0086 -0.0109 107 GLY A N     
434  C  CA    . GLY A 59  ? 0.1434 0.1789 0.1554 0.0091  -0.0097 -0.0162 107 GLY A CA    
435  C  C     . GLY A 59  ? 0.1619 0.1769 0.1467 -0.0052 -0.0100 -0.0009 107 GLY A C     
436  O  O     . GLY A 59  ? 0.1816 0.1721 0.1512 -0.0166 -0.0110 -0.0204 107 GLY A O     
437  N  N     . LYS A 60  ? 0.1517 0.1887 0.1302 0.0179  -0.0078 0.0053  108 LYS A N     
438  C  CA    . LYS A 60  ? 0.1619 0.1696 0.1356 0.0114  -0.0051 -0.0012 108 LYS A CA    
439  C  C     . LYS A 60  ? 0.1653 0.1812 0.1529 0.0097  -0.0079 0.0142  108 LYS A C     
440  O  O     . LYS A 60  ? 0.1555 0.1812 0.1628 0.0021  -0.0200 -0.0100 108 LYS A O     
441  C  CB    . LYS A 60  ? 0.1839 0.1962 0.1410 -0.0067 -0.0107 0.0194  108 LYS A CB    
442  C  CG    . LYS A 60  ? 0.1992 0.2075 0.1499 -0.0085 -0.0073 0.0184  108 LYS A CG    
443  C  CD    . LYS A 60  ? 0.1776 0.2500 0.1804 -0.0240 -0.0142 0.0247  108 LYS A CD    
444  C  CE    . LYS A 60  ? 0.2068 0.2389 0.1782 -0.0131 0.0012  -0.0040 108 LYS A CE    
445  N  NZ    . LYS A 60  ? 0.1809 0.1993 0.1813 -0.0126 0.0355  -0.0124 108 LYS A NZ    
446  N  N     . ASN A 61  ? 0.1609 0.1882 0.1430 -0.0090 -0.0097 0.0259  109 ASN A N     
447  C  CA    . ASN A 61  ? 0.1598 0.1851 0.1611 0.0056  -0.0290 0.0125  109 ASN A CA    
448  C  C     . ASN A 61  ? 0.1718 0.1941 0.1588 0.0142  -0.0360 -0.0112 109 ASN A C     
449  O  O     . ASN A 61  ? 0.1696 0.2161 0.1849 0.0175  -0.0397 -0.0056 109 ASN A O     
450  C  CB    . ASN A 61  ? 0.1684 0.1781 0.1619 -0.0325 -0.0177 -0.0125 109 ASN A CB    
451  C  CG    . ASN A 61  ? 0.1680 0.1854 0.1735 -0.0199 -0.0321 -0.0319 109 ASN A CG    
452  O  OD1   . ASN A 61  ? 0.1773 0.2035 0.1671 -0.0013 -0.0116 -0.0271 109 ASN A OD1   
453  N  ND2   . ASN A 61  ? 0.2400 0.2166 0.1829 0.0052  -0.0446 -0.0392 109 ASN A ND2   
454  N  N     . PHE A 62  ? 0.1679 0.1922 0.1523 -0.0147 -0.0133 -0.0181 110 PHE A N     
455  C  CA    . PHE A 62  ? 0.1769 0.2214 0.1499 0.0057  -0.0212 -0.0228 110 PHE A CA    
456  C  C     . PHE A 62  ? 0.1735 0.2119 0.1758 0.0084  -0.0384 -0.0118 110 PHE A C     
457  O  O     . PHE A 62  ? 0.1966 0.2277 0.1790 0.0105  -0.0510 -0.0223 110 PHE A O     
458  C  CB    . PHE A 62  ? 0.2012 0.2502 0.1128 0.0017  -0.0107 -0.0352 110 PHE A CB    
459  C  CG    . PHE A 62  ? 0.2172 0.2881 0.1528 0.0079  -0.0288 -0.0063 110 PHE A CG    
460  C  CD1   . PHE A 62  ? 0.2440 0.3200 0.1833 0.0327  -0.0372 0.0194  110 PHE A CD1   
461  C  CD2   . PHE A 62  ? 0.2686 0.3051 0.1633 0.0114  -0.0556 -0.0382 110 PHE A CD2   
462  C  CE1   . PHE A 62  ? 0.2624 0.3499 0.1859 0.0209  -0.0191 0.0208  110 PHE A CE1   
463  C  CE2   . PHE A 62  ? 0.2811 0.3272 0.1846 0.0194  -0.0376 -0.0323 110 PHE A CE2   
464  C  CZ    . PHE A 62  ? 0.2792 0.3353 0.1804 0.0196  -0.0157 0.0010  110 PHE A CZ    
465  N  N     A VAL A 63  ? 0.1662 0.1988 0.1896 -0.0020 -0.0261 -0.0215 111 VAL A N     
466  N  N     B VAL A 63  ? 0.1653 0.1981 0.1828 -0.0119 -0.0334 -0.0203 111 VAL A N     
467  C  CA    A VAL A 63  ? 0.1699 0.1966 0.2076 -0.0098 -0.0217 -0.0211 111 VAL A CA    
468  C  CA    B VAL A 63  ? 0.1698 0.1951 0.1956 -0.0326 -0.0388 -0.0175 111 VAL A CA    
469  C  C     A VAL A 63  ? 0.1663 0.2056 0.1999 -0.0070 -0.0203 -0.0115 111 VAL A C     
470  C  C     B VAL A 63  ? 0.1584 0.2000 0.2067 -0.0285 -0.0300 -0.0121 111 VAL A C     
471  O  O     A VAL A 63  ? 0.1797 0.2088 0.1933 0.0029  -0.0288 0.0081  111 VAL A O     
472  O  O     B VAL A 63  ? 0.1574 0.1917 0.2277 -0.0380 -0.0370 0.0073  111 VAL A O     
473  C  CB    A VAL A 63  ? 0.1681 0.1924 0.2228 -0.0062 -0.0089 -0.0300 111 VAL A CB    
474  C  CB    B VAL A 63  ? 0.1753 0.2001 0.1683 -0.0211 -0.0643 -0.0045 111 VAL A CB    
475  C  CG1   A VAL A 63  ? 0.1949 0.1932 0.2400 -0.0012 -0.0006 -0.0305 111 VAL A CG1   
476  C  CG1   B VAL A 63  ? 0.1668 0.2207 0.1461 0.0073  -0.0505 0.0031  111 VAL A CG1   
477  C  CG2   A VAL A 63  ? 0.1589 0.1952 0.2173 -0.0068 -0.0183 -0.0409 111 VAL A CG2   
478  C  CG2   B VAL A 63  ? 0.1814 0.2001 0.1716 -0.0346 -0.0821 -0.0180 111 VAL A CG2   
479  N  N     . SER A 64  ? 0.1724 0.1982 0.2071 -0.0046 -0.0283 -0.0137 112 SER A N     
480  C  CA    . SER A 64  ? 0.1849 0.2124 0.1765 0.0197  -0.0396 0.0075  112 SER A CA    
481  C  C     . SER A 64  ? 0.1589 0.2066 0.1753 0.0098  -0.0112 0.0048  112 SER A C     
482  O  O     . SER A 64  ? 0.1427 0.2162 0.2062 0.0100  -0.0130 -0.0054 112 SER A O     
483  C  CB    . SER A 64  ? 0.2163 0.2325 0.1748 0.0367  -0.0484 0.0186  112 SER A CB    
484  O  OG    . SER A 64  ? 0.2334 0.2535 0.2027 0.0244  -0.0061 0.0179  112 SER A OG    
485  N  N     A LYS A 65  ? 0.1611 0.2047 0.1740 -0.0083 -0.0136 -0.0121 113 LYS A N     
486  N  N     B LYS A 65  ? 0.1663 0.1981 0.1746 -0.0124 -0.0070 0.0018  113 LYS A N     
487  C  CA    A LYS A 65  ? 0.1679 0.2299 0.1821 -0.0126 -0.0237 -0.0119 113 LYS A CA    
488  C  CA    B LYS A 65  ? 0.1797 0.2138 0.1812 -0.0186 -0.0057 0.0132  113 LYS A CA    
489  C  C     A LYS A 65  ? 0.1771 0.2388 0.1971 -0.0023 -0.0325 -0.0099 113 LYS A C     
490  C  C     B LYS A 65  ? 0.1823 0.2303 0.1957 -0.0103 -0.0228 0.0037  113 LYS A C     
491  O  O     A LYS A 65  ? 0.1986 0.2294 0.1976 0.0233  -0.0341 0.0017  113 LYS A O     
492  O  O     B LYS A 65  ? 0.2029 0.2235 0.1962 0.0073  -0.0228 0.0177  113 LYS A O     
493  C  CB    A LYS A 65  ? 0.1583 0.2327 0.1932 -0.0347 -0.0231 -0.0198 113 LYS A CB    
494  C  CB    B LYS A 65  ? 0.1862 0.1979 0.1921 -0.0397 0.0106  0.0284  113 LYS A CB    
495  C  CG    A LYS A 65  ? 0.1762 0.2568 0.2313 -0.0150 -0.0201 -0.0277 113 LYS A CG    
496  C  CG    B LYS A 65  ? 0.2143 0.2056 0.2170 -0.0416 0.0198  0.0247  113 LYS A CG    
497  C  CD    A LYS A 65  ? 0.2008 0.2951 0.2863 -0.0068 -0.0182 -0.0395 113 LYS A CD    
498  C  CD    B LYS A 65  ? 0.2481 0.2369 0.2475 -0.0511 0.0212  0.0043  113 LYS A CD    
499  C  CE    A LYS A 65  ? 0.2079 0.3240 0.3136 0.0273  -0.0039 -0.0469 113 LYS A CE    
500  C  CE    B LYS A 65  ? 0.2797 0.2670 0.2637 -0.0368 0.0205  -0.0257 113 LYS A CE    
501  N  NZ    A LYS A 65  ? 0.2702 0.3515 0.3451 0.0602  -0.0201 -0.0530 113 LYS A NZ    
502  N  NZ    B LYS A 65  ? 0.3337 0.2954 0.2788 -0.0198 0.0143  -0.0382 113 LYS A NZ    
503  N  N     . ILE A 66  ? 0.1746 0.2311 0.1947 -0.0137 -0.0348 -0.0139 114 ILE A N     
504  C  CA    . ILE A 66  ? 0.1778 0.2366 0.1906 0.0062  -0.0354 -0.0153 114 ILE A CA    
505  C  C     . ILE A 66  ? 0.1633 0.2454 0.1797 -0.0012 -0.0325 0.0008  114 ILE A C     
506  O  O     . ILE A 66  ? 0.1633 0.2695 0.1904 0.0033  -0.0411 -0.0066 114 ILE A O     
507  C  CB    . ILE A 66  ? 0.1680 0.2474 0.2093 -0.0050 -0.0400 -0.0323 114 ILE A CB    
508  C  CG1   . ILE A 66  ? 0.1982 0.2753 0.2417 0.0145  -0.0023 -0.0334 114 ILE A CG1   
509  C  CG2   . ILE A 66  ? 0.1809 0.2644 0.2324 -0.0045 -0.0500 -0.0382 114 ILE A CG2   
510  C  CD1   . ILE A 66  ? 0.2222 0.2879 0.2598 0.0513  -0.0256 -0.0305 114 ILE A CD1   
511  N  N     . ILE A 67  ? 0.1809 0.2304 0.1719 -0.0198 -0.0185 0.0052  115 ILE A N     
512  C  CA    . ILE A 67  ? 0.1684 0.2192 0.1667 -0.0066 -0.0172 -0.0025 115 ILE A CA    
513  C  C     . ILE A 67  ? 0.1440 0.2216 0.1874 0.0184  -0.0357 -0.0095 115 ILE A C     
514  O  O     . ILE A 67  ? 0.1485 0.2293 0.2144 0.0144  -0.0297 0.0032  115 ILE A O     
515  C  CB    . ILE A 67  ? 0.1896 0.2115 0.1787 -0.0259 -0.0086 0.0240  115 ILE A CB    
516  C  CG1   . ILE A 67  ? 0.2096 0.2007 0.2014 -0.0278 -0.0390 0.0150  115 ILE A CG1   
517  C  CG2   . ILE A 67  ? 0.2053 0.2507 0.2055 -0.0453 0.0217  0.0295  115 ILE A CG2   
518  C  CD1   . ILE A 67  ? 0.2239 0.2117 0.2213 -0.0157 -0.0440 0.0199  115 ILE A CD1   
519  N  N     . ALA A 68  ? 0.1745 0.2115 0.1850 0.0082  -0.0172 -0.0264 116 ALA A N     
520  C  CA    . ALA A 68  ? 0.1751 0.2255 0.1750 0.0154  -0.0444 -0.0016 116 ALA A CA    
521  C  C     . ALA A 68  ? 0.1776 0.2406 0.1861 0.0218  -0.0230 0.0226  116 ALA A C     
522  O  O     . ALA A 68  ? 0.1698 0.2340 0.2259 0.0432  -0.0345 0.0121  116 ALA A O     
523  C  CB    . ALA A 68  ? 0.1474 0.2346 0.1743 0.0041  -0.0327 -0.0065 116 ALA A CB    
524  N  N     . GLU A 69  ? 0.1628 0.2811 0.1708 -0.0239 -0.0283 0.0110  117 GLU A N     
525  C  CA    . GLU A 69  ? 0.2096 0.3184 0.2127 -0.0062 -0.0502 0.0375  117 GLU A CA    
526  C  C     . GLU A 69  ? 0.2262 0.3110 0.2255 0.0085  -0.0592 0.0351  117 GLU A C     
527  O  O     . GLU A 69  ? 0.2575 0.3141 0.2202 -0.0063 -0.0651 0.0572  117 GLU A O     
528  C  CB    . GLU A 69  ? 0.2094 0.3826 0.2531 -0.0259 -0.0354 0.0461  117 GLU A CB    
529  C  CG    . GLU A 69  ? 0.3078 0.4643 0.3229 -0.0380 0.0051  0.0372  117 GLU A CG    
530  C  CD    . GLU A 69  ? 0.3802 0.5347 0.4195 -0.0447 0.0308  0.0298  117 GLU A CD    
531  O  OE1   . GLU A 69  ? 0.4215 0.5545 0.4397 -0.0252 0.0373  0.0378  117 GLU A OE1   
532  O  OE2   . GLU A 69  ? 0.4816 0.5745 0.4794 -0.0497 0.0538  0.0354  117 GLU A OE2   
533  N  N     . ASN A 70  ? 0.1916 0.3083 0.2158 0.0120  -0.0712 0.0020  118 ASN A N     
534  C  CA    . ASN A 70  ? 0.2125 0.3163 0.2332 -0.0025 -0.0569 -0.0336 118 ASN A CA    
535  C  C     . ASN A 70  ? 0.1898 0.3216 0.2550 -0.0174 -0.0483 -0.0249 118 ASN A C     
536  O  O     . ASN A 70  ? 0.2107 0.3922 0.3018 0.0025  -0.0624 -0.0188 118 ASN A O     
537  C  CB    . ASN A 70  ? 0.2202 0.3236 0.2172 -0.0100 -0.0589 -0.0461 118 ASN A CB    
538  C  CG    . ASN A 70  ? 0.2437 0.3750 0.2347 0.0039  -0.0903 -0.0585 118 ASN A CG    
539  O  OD1   . ASN A 70  ? 0.2667 0.4183 0.2412 0.0208  -0.1066 -0.0653 118 ASN A OD1   
540  N  ND2   . ASN A 70  ? 0.2037 0.3558 0.2406 0.0316  -0.0644 -0.0385 118 ASN A ND2   
541  N  N     . ILE A 71  ? 0.1927 0.2708 0.2299 0.0063  -0.0205 -0.0275 119 ILE A N     
542  C  CA    . ILE A 71  ? 0.1737 0.2536 0.2214 -0.0141 -0.0140 -0.0176 119 ILE A CA    
543  C  C     . ILE A 71  ? 0.1607 0.2715 0.2332 -0.0077 -0.0334 -0.0006 119 ILE A C     
544  O  O     . ILE A 71  ? 0.1749 0.2960 0.2820 0.0088  -0.0441 0.0086  119 ILE A O     
545  C  CB    . ILE A 71  ? 0.1827 0.2424 0.2162 -0.0110 -0.0034 -0.0075 119 ILE A CB    
546  C  CG1   . ILE A 71  ? 0.2191 0.2566 0.2320 0.0045  -0.0021 0.0190  119 ILE A CG1   
547  C  CG2   . ILE A 71  ? 0.1832 0.2629 0.2105 -0.0119 0.0307  -0.0125 119 ILE A CG2   
548  C  CD1   . ILE A 71  ? 0.2377 0.2775 0.2518 0.0051  -0.0051 0.0315  119 ILE A CD1   
549  N  N     . TYR A 72  ? 0.1880 0.2816 0.2022 -0.0237 -0.0435 0.0120  120 TYR A N     
550  C  CA    . TYR A 72  ? 0.1931 0.2824 0.1942 -0.0070 -0.0385 0.0362  120 TYR A CA    
551  C  C     . TYR A 72  ? 0.2007 0.2941 0.2079 0.0165  -0.0519 0.0476  120 TYR A C     
552  O  O     . TYR A 72  ? 0.2252 0.2920 0.2159 0.0129  -0.0302 0.0325  120 TYR A O     
553  C  CB    . TYR A 72  ? 0.1723 0.2836 0.1917 -0.0001 -0.0305 0.0289  120 TYR A CB    
554  C  CG    . TYR A 72  ? 0.1769 0.2922 0.1979 -0.0174 -0.0103 0.0284  120 TYR A CG    
555  C  CD1   . TYR A 72  ? 0.2075 0.3294 0.2109 0.0202  -0.0115 0.0234  120 TYR A CD1   
556  C  CD2   . TYR A 72  ? 0.1850 0.2815 0.1859 -0.0475 -0.0209 0.0283  120 TYR A CD2   
557  C  CE1   . TYR A 72  ? 0.2227 0.3434 0.2287 0.0224  -0.0015 0.0312  120 TYR A CE1   
558  C  CE2   . TYR A 72  ? 0.1979 0.3000 0.2122 -0.0659 -0.0104 0.0177  120 TYR A CE2   
559  C  CZ    . TYR A 72  ? 0.2031 0.3342 0.2097 -0.0446 0.0081  0.0383  120 TYR A CZ    
560  O  OH    . TYR A 72  ? 0.2577 0.3611 0.2427 -0.0636 0.0114  0.0381  120 TYR A OH    
561  N  N     . GLU A 73  ? 0.2385 0.3339 0.2454 0.0018  -0.0843 0.0848  121 GLU A N     
562  C  CA    . GLU A 73  ? 0.2790 0.3522 0.2775 -0.0083 -0.1000 0.0960  121 GLU A CA    
563  C  C     . GLU A 73  ? 0.2397 0.3220 0.2578 -0.0131 -0.0743 0.0903  121 GLU A C     
564  O  O     . GLU A 73  ? 0.2536 0.2890 0.2977 -0.0312 -0.0631 0.0768  121 GLU A O     
565  C  CB    . GLU A 73  ? 0.3409 0.4088 0.3456 0.0189  -0.1220 0.0933  121 GLU A CB    
566  C  CG    . GLU A 73  ? 0.4529 0.4637 0.4017 0.0455  -0.1107 0.0779  121 GLU A CG    
567  C  CD    . GLU A 73  ? 0.5357 0.4904 0.4117 0.1097  -0.1216 0.0584  121 GLU A CD    
568  O  OE1   . GLU A 73  ? 0.5677 0.5131 0.4057 0.1286  -0.1266 0.0342  121 GLU A OE1   
569  O  OE2   . GLU A 73  ? 0.5924 0.4854 0.4309 0.1240  -0.1147 0.0622  121 GLU A OE2   
570  N  N     . GLY A 74  ? 0.2466 0.3252 0.2359 -0.0079 -0.0585 0.0909  122 GLY A N     
571  C  CA    . GLY A 74  ? 0.2290 0.2939 0.2037 0.0083  -0.0467 0.0950  122 GLY A CA    
572  C  C     . GLY A 74  ? 0.2566 0.2734 0.1904 0.0000  -0.0261 0.0626  122 GLY A C     
573  O  O     . GLY A 74  ? 0.2747 0.2686 0.1709 -0.0052 -0.0258 0.0481  122 GLY A O     
574  N  N     . GLY A 75  ? 0.2249 0.2310 0.1791 -0.0099 -0.0361 0.0259  123 GLY A N     
575  C  CA    . GLY A 75  ? 0.2510 0.2211 0.1825 -0.0040 -0.0485 0.0339  123 GLY A CA    
576  C  C     . GLY A 75  ? 0.2174 0.2190 0.1864 -0.0043 -0.0405 0.0184  123 GLY A C     
577  O  O     . GLY A 75  ? 0.1952 0.2349 0.1844 0.0130  -0.0221 0.0338  123 GLY A O     
578  N  N     . LEU A 76  ? 0.2068 0.2221 0.1804 0.0216  -0.0242 0.0135  124 LEU A N     
579  C  CA    . LEU A 76  ? 0.1933 0.2170 0.1880 0.0099  -0.0172 0.0018  124 LEU A CA    
580  C  C     . LEU A 76  ? 0.1941 0.2211 0.1770 0.0184  -0.0071 0.0075  124 LEU A C     
581  O  O     . LEU A 76  ? 0.2122 0.2215 0.1650 0.0304  -0.0021 0.0153  124 LEU A O     
582  C  CB    . LEU A 76  ? 0.1998 0.2372 0.2206 0.0151  -0.0068 -0.0049 124 LEU A CB    
583  C  CG    . LEU A 76  ? 0.1968 0.2545 0.2343 0.0425  -0.0034 0.0049  124 LEU A CG    
584  C  CD1   . LEU A 76  ? 0.2114 0.2815 0.3016 0.0827  0.0131  -0.0032 124 LEU A CD1   
585  C  CD2   . LEU A 76  ? 0.2365 0.2720 0.2345 0.0528  0.0031  0.0266  124 LEU A CD2   
586  N  N     . ASN A 77  ? 0.1827 0.2115 0.1859 0.0111  -0.0219 0.0287  125 ASN A N     
587  C  CA    . ASN A 77  ? 0.1957 0.2178 0.1944 0.0075  -0.0043 0.0432  125 ASN A CA    
588  C  C     . ASN A 77  ? 0.2004 0.1993 0.1987 0.0015  0.0025  0.0219  125 ASN A C     
589  O  O     . ASN A 77  ? 0.2564 0.2121 0.2324 0.0111  0.0051  0.0189  125 ASN A O     
590  C  CB    . ASN A 77  ? 0.1957 0.2671 0.2430 -0.0013 0.0059  0.0747  125 ASN A CB    
591  C  CG    . ASN A 77  ? 0.2510 0.3366 0.2871 0.0066  -0.0224 0.0756  125 ASN A CG    
592  O  OD1   . ASN A 77  ? 0.2485 0.3779 0.3368 -0.0056 -0.0315 0.0659  125 ASN A OD1   
593  N  ND2   . ASN A 77  ? 0.3231 0.3700 0.3132 0.0280  -0.0072 0.0582  125 ASN A ND2   
594  N  N     . SER A 78  ? 0.1875 0.2007 0.1741 0.0157  -0.0025 0.0364  126 SER A N     
595  C  CA    . SER A 78  ? 0.1829 0.1999 0.1661 0.0031  0.0018  0.0235  126 SER A CA    
596  C  C     . SER A 78  ? 0.1879 0.2070 0.1721 0.0201  -0.0231 0.0057  126 SER A C     
597  O  O     . SER A 78  ? 0.1860 0.2244 0.1706 0.0031  -0.0079 0.0108  126 SER A O     
598  C  CB    . SER A 78  ? 0.1428 0.1970 0.2099 0.0039  -0.0064 0.0190  126 SER A CB    
599  O  OG    . SER A 78  ? 0.1839 0.2184 0.2018 0.0129  -0.0115 0.0021  126 SER A OG    
600  N  N     . ASP A 79  ? 0.2145 0.1858 0.1715 0.0494  0.0001  -0.0125 127 ASP A N     
601  C  CA    . ASP A 79  ? 0.2223 0.1801 0.1954 0.0431  0.0146  -0.0059 127 ASP A CA    
602  C  C     . ASP A 79  ? 0.1754 0.1872 0.1956 0.0059  -0.0088 -0.0004 127 ASP A C     
603  O  O     . ASP A 79  ? 0.2159 0.1894 0.1932 0.0156  -0.0160 -0.0015 127 ASP A O     
604  C  CB    . ASP A 79  ? 0.2488 0.1865 0.2394 0.0601  0.0092  0.0132  127 ASP A CB    
605  C  CG    . ASP A 79  ? 0.2973 0.2105 0.2831 0.0482  -0.0049 0.0248  127 ASP A CG    
606  O  OD1   . ASP A 79  ? 0.3435 0.2334 0.3170 0.0518  0.0018  0.0173  127 ASP A OD1   
607  O  OD2   . ASP A 79  ? 0.3291 0.2242 0.2849 0.0416  -0.0311 0.0230  127 ASP A OD2   
608  N  N     . TYR A 80  ? 0.1385 0.1804 0.2100 0.0191  -0.0190 0.0169  128 TYR A N     
609  C  CA    . TYR A 80  ? 0.1293 0.1901 0.2116 0.0151  -0.0003 0.0288  128 TYR A CA    
610  C  C     . TYR A 80  ? 0.1336 0.1845 0.1894 0.0178  -0.0174 0.0387  128 TYR A C     
611  O  O     . TYR A 80  ? 0.1439 0.1972 0.1998 0.0035  -0.0059 0.0554  128 TYR A O     
612  C  CB    . TYR A 80  ? 0.1451 0.2266 0.2392 0.0342  -0.0336 0.0413  128 TYR A CB    
613  C  CG    . TYR A 80  ? 0.1674 0.2756 0.2657 0.0512  -0.0069 0.0560  128 TYR A CG    
614  C  CD1   . TYR A 80  ? 0.1752 0.2997 0.3054 0.0616  0.0327  0.0414  128 TYR A CD1   
615  C  CD2   . TYR A 80  ? 0.2040 0.3068 0.2942 0.0819  -0.0248 0.0779  128 TYR A CD2   
616  C  CE1   . TYR A 80  ? 0.2135 0.3051 0.3345 0.0620  0.0170  0.0662  128 TYR A CE1   
617  C  CE2   . TYR A 80  ? 0.2170 0.2964 0.3166 0.0907  -0.0140 0.0785  128 TYR A CE2   
618  C  CZ    . TYR A 80  ? 0.2295 0.3014 0.3528 0.0984  -0.0056 0.0744  128 TYR A CZ    
619  O  OH    . TYR A 80  ? 0.2969 0.3299 0.4094 0.1012  0.0070  0.0722  128 TYR A OH    
620  N  N     . VAL A 81  ? 0.1251 0.1936 0.1890 0.0348  -0.0280 0.0043  129 VAL A N     
621  C  CA    . VAL A 81  ? 0.1184 0.2063 0.1661 0.0298  -0.0273 0.0144  129 VAL A CA    
622  C  C     . VAL A 81  ? 0.1264 0.1932 0.1819 0.0092  -0.0362 0.0260  129 VAL A C     
623  O  O     . VAL A 81  ? 0.1695 0.2046 0.1871 -0.0215 -0.0266 0.0510  129 VAL A O     
624  C  CB    . VAL A 81  ? 0.1455 0.1944 0.1810 0.0135  -0.0168 0.0025  129 VAL A CB    
625  C  CG1   . VAL A 81  ? 0.1751 0.1819 0.2110 0.0286  -0.0101 0.0302  129 VAL A CG1   
626  C  CG2   . VAL A 81  ? 0.1435 0.1842 0.1893 -0.0080 -0.0221 -0.0039 129 VAL A CG2   
627  N  N     . HIS A 82  ? 0.1446 0.2010 0.1772 0.0145  -0.0406 0.0168  130 HIS A N     
628  C  CA    . HIS A 82  ? 0.1312 0.2037 0.1781 0.0224  -0.0267 0.0136  130 HIS A CA    
629  C  C     . HIS A 82  ? 0.1412 0.1990 0.2182 0.0203  -0.0208 0.0252  130 HIS A C     
630  O  O     . HIS A 82  ? 0.1644 0.2057 0.3054 -0.0126 -0.0221 0.0668  130 HIS A O     
631  C  CB    . HIS A 82  ? 0.1650 0.2283 0.1847 -0.0087 -0.0083 0.0301  130 HIS A CB    
632  C  CG    . HIS A 82  ? 0.1652 0.2211 0.1957 0.0066  -0.0014 0.0438  130 HIS A CG    
633  N  ND1   . HIS A 82  ? 0.1845 0.2362 0.2281 0.0014  -0.0084 0.0335  130 HIS A ND1   
634  C  CD2   . HIS A 82  ? 0.1839 0.2303 0.2170 0.0463  -0.0210 0.0454  130 HIS A CD2   
635  C  CE1   . HIS A 82  ? 0.2087 0.2457 0.2388 0.0308  -0.0038 0.0391  130 HIS A CE1   
636  N  NE2   . HIS A 82  ? 0.2002 0.2391 0.2148 0.0396  0.0014  0.0313  130 HIS A NE2   
637  N  N     . LEU A 83  ? 0.1279 0.2038 0.1993 0.0311  -0.0021 0.0094  131 LEU A N     
638  C  CA    . LEU A 83  ? 0.1281 0.2158 0.1932 0.0133  -0.0041 0.0193  131 LEU A CA    
639  C  C     . LEU A 83  ? 0.1459 0.2040 0.2015 -0.0226 -0.0293 0.0275  131 LEU A C     
640  O  O     . LEU A 83  ? 0.2049 0.2036 0.2451 -0.0160 -0.0616 0.0436  131 LEU A O     
641  C  CB    . LEU A 83  ? 0.1524 0.2285 0.1901 0.0238  0.0219  0.0280  131 LEU A CB    
642  C  CG    . LEU A 83  ? 0.1439 0.2156 0.2036 -0.0044 0.0050  0.0124  131 LEU A CG    
643  C  CD1   . LEU A 83  ? 0.1740 0.1844 0.2266 -0.0052 0.0091  0.0143  131 LEU A CD1   
644  C  CD2   . LEU A 83  ? 0.2149 0.2785 0.2228 0.0202  0.0388  0.0277  131 LEU A CD2   
645  N  N     . PHE A 84  ? 0.1644 0.2022 0.1763 0.0143  -0.0173 0.0078  132 PHE A N     
646  C  CA    . PHE A 84  ? 0.1481 0.2191 0.1808 0.0050  -0.0087 0.0136  132 PHE A CA    
647  C  C     . PHE A 84  ? 0.1330 0.1837 0.2096 0.0010  -0.0164 -0.0178 132 PHE A C     
648  O  O     . PHE A 84  ? 0.1647 0.1715 0.3100 -0.0070 0.0032  -0.0279 132 PHE A O     
649  C  CB    . PHE A 84  ? 0.1802 0.2606 0.1686 0.0270  0.0047  0.0112  132 PHE A CB    
650  C  CG    . PHE A 84  ? 0.1948 0.2903 0.1915 0.0615  -0.0151 0.0294  132 PHE A CG    
651  C  CD1   . PHE A 84  ? 0.2318 0.3011 0.2325 0.0755  0.0341  0.0649  132 PHE A CD1   
652  C  CD2   . PHE A 84  ? 0.1967 0.3404 0.2212 0.1023  -0.0061 0.0010  132 PHE A CD2   
653  C  CE1   . PHE A 84  ? 0.2803 0.3227 0.2405 0.0832  0.0520  0.0509  132 PHE A CE1   
654  C  CE2   . PHE A 84  ? 0.2452 0.3576 0.2653 0.1329  -0.0191 -0.0082 132 PHE A CE2   
655  C  CZ    . PHE A 84  ? 0.2811 0.3452 0.2639 0.1480  0.0187  0.0013  132 PHE A CZ    
656  N  N     . VAL A 85  ? 0.1302 0.1955 0.1689 0.0096  -0.0262 0.0018  133 VAL A N     
657  C  CA    . VAL A 85  ? 0.1424 0.2057 0.1523 0.0159  -0.0170 0.0092  133 VAL A CA    
658  C  C     . VAL A 85  ? 0.1302 0.1897 0.1533 -0.0014 -0.0117 0.0210  133 VAL A C     
659  O  O     . VAL A 85  ? 0.1385 0.1893 0.1834 -0.0076 -0.0099 -0.0017 133 VAL A O     
660  C  CB    . VAL A 85  ? 0.1545 0.2436 0.1645 0.0142  -0.0125 -0.0097 133 VAL A CB    
661  C  CG1   . VAL A 85  ? 0.1611 0.2436 0.2073 0.0323  0.0073  -0.0126 133 VAL A CG1   
662  C  CG2   . VAL A 85  ? 0.1576 0.2532 0.1706 -0.0016 -0.0201 -0.0029 133 VAL A CG2   
663  N  N     . ALA A 86  ? 0.1713 0.1613 0.1450 0.0147  -0.0061 0.0172  134 ALA A N     
664  C  CA    . ALA A 86  ? 0.1682 0.1716 0.1609 -0.0263 -0.0244 0.0256  134 ALA A CA    
665  C  C     . ALA A 86  ? 0.1507 0.1701 0.1553 -0.0096 -0.0022 0.0056  134 ALA A C     
666  O  O     . ALA A 86  ? 0.1722 0.1809 0.1472 0.0073  -0.0043 -0.0011 134 ALA A O     
667  C  CB    . ALA A 86  ? 0.2238 0.1854 0.1631 -0.0111 -0.0166 0.0022  134 ALA A CB    
668  N  N     . THR A 87  ? 0.1390 0.1835 0.1824 0.0113  0.0136  0.0102  135 THR A N     
669  C  CA    . THR A 87  ? 0.1270 0.1798 0.1858 0.0302  0.0204  0.0325  135 THR A CA    
670  C  C     . THR A 87  ? 0.1266 0.1862 0.1822 -0.0056 0.0041  0.0137  135 THR A C     
671  O  O     . THR A 87  ? 0.1547 0.2309 0.2088 -0.0101 -0.0147 0.0275  135 THR A O     
672  C  CB    . THR A 87  ? 0.1562 0.1781 0.1712 0.0335  -0.0097 0.0001  135 THR A CB    
673  O  OG1   . THR A 87  ? 0.1784 0.2008 0.1598 0.0133  -0.0140 -0.0124 135 THR A OG1   
674  C  CG2   . THR A 87  ? 0.1776 0.1789 0.1960 0.0417  0.0128  -0.0127 135 THR A CG2   
675  N  N     . LEU A 88  ? 0.1470 0.1680 0.1623 0.0256  0.0082  0.0041  136 LEU A N     
676  C  CA    . LEU A 88  ? 0.1624 0.1735 0.1478 0.0403  -0.0120 0.0184  136 LEU A CA    
677  C  C     . LEU A 88  ? 0.1661 0.1809 0.1536 0.0215  0.0035  0.0127  136 LEU A C     
678  O  O     . LEU A 88  ? 0.1954 0.1956 0.1827 -0.0297 -0.0029 0.0163  136 LEU A O     
679  C  CB    . LEU A 88  ? 0.1834 0.1818 0.1651 0.0283  -0.0351 0.0289  136 LEU A CB    
680  C  CG    . LEU A 88  ? 0.1846 0.2115 0.1792 -0.0017 -0.0381 0.0446  136 LEU A CG    
681  C  CD1   . LEU A 88  ? 0.1780 0.2319 0.2149 -0.0154 -0.0146 0.0286  136 LEU A CD1   
682  C  CD2   . LEU A 88  ? 0.1988 0.2385 0.1642 0.0207  -0.0328 0.0299  136 LEU A CD2   
683  N  N     . HIS A 89  ? 0.1403 0.1900 0.1305 0.0182  0.0026  0.0046  137 HIS A N     
684  C  CA    . HIS A 89  ? 0.1405 0.1816 0.1423 0.0224  -0.0066 0.0103  137 HIS A CA    
685  C  C     . HIS A 89  ? 0.1741 0.1876 0.1305 0.0125  -0.0028 -0.0028 137 HIS A C     
686  O  O     . HIS A 89  ? 0.2090 0.1847 0.1240 0.0190  -0.0059 -0.0019 137 HIS A O     
687  C  CB    . HIS A 89  ? 0.1533 0.2044 0.1485 0.0030  -0.0289 0.0073  137 HIS A CB    
688  C  CG    . HIS A 89  ? 0.1750 0.2238 0.1478 0.0122  -0.0366 -0.0026 137 HIS A CG    
689  N  ND1   . HIS A 89  ? 0.2195 0.2167 0.1463 0.0255  -0.0480 0.0019  137 HIS A ND1   
690  C  CD2   . HIS A 89  ? 0.2232 0.2276 0.1561 0.0259  -0.0279 0.0162  137 HIS A CD2   
691  C  CE1   . HIS A 89  ? 0.2278 0.2277 0.1696 0.0198  -0.0406 0.0072  137 HIS A CE1   
692  N  NE2   . HIS A 89  ? 0.2552 0.2214 0.1741 0.0165  -0.0473 0.0027  137 HIS A NE2   
693  N  N     . PHE A 90  ? 0.1573 0.2030 0.1256 -0.0124 -0.0162 0.0233  138 PHE A N     
694  C  CA    . PHE A 90  ? 0.1749 0.1885 0.1353 0.0035  -0.0137 0.0242  138 PHE A CA    
695  C  C     . PHE A 90  ? 0.1765 0.1736 0.1369 0.0033  -0.0064 0.0099  138 PHE A C     
696  O  O     . PHE A 90  ? 0.1882 0.1955 0.1383 0.0033  0.0094  0.0091  138 PHE A O     
697  C  CB    . PHE A 90  ? 0.1721 0.2080 0.1459 0.0088  -0.0082 0.0155  138 PHE A CB    
698  C  CG    . PHE A 90  ? 0.1679 0.2264 0.1389 0.0211  0.0019  -0.0024 138 PHE A CG    
699  C  CD1   . PHE A 90  ? 0.1721 0.2217 0.1517 0.0364  0.0125  0.0195  138 PHE A CD1   
700  C  CD2   . PHE A 90  ? 0.1820 0.2451 0.1466 0.0039  -0.0050 -0.0029 138 PHE A CD2   
701  C  CE1   . PHE A 90  ? 0.1760 0.2389 0.1759 -0.0065 0.0190  0.0211  138 PHE A CE1   
702  C  CE2   . PHE A 90  ? 0.1781 0.2492 0.1890 -0.0054 0.0136  0.0092  138 PHE A CE2   
703  C  CZ    . PHE A 90  ? 0.1641 0.2349 0.1811 -0.0041 0.0081  0.0268  138 PHE A CZ    
704  N  N     . PRO A 91  ? 0.1716 0.1695 0.1446 -0.0074 -0.0207 0.0102  139 PRO A N     
705  C  CA    . PRO A 91  ? 0.1655 0.2195 0.1583 0.0073  -0.0193 0.0101  139 PRO A CA    
706  C  C     . PRO A 91  ? 0.1717 0.2558 0.1514 0.0451  -0.0235 0.0061  139 PRO A C     
707  O  O     . PRO A 91  ? 0.2458 0.2855 0.1567 0.0908  -0.0415 -0.0320 139 PRO A O     
708  C  CB    . PRO A 91  ? 0.1647 0.2098 0.1819 -0.0013 -0.0119 0.0259  139 PRO A CB    
709  C  CG    . PRO A 91  ? 0.1652 0.1928 0.1781 -0.0068 -0.0128 0.0333  139 PRO A CG    
710  C  CD    . PRO A 91  ? 0.1774 0.1626 0.1727 -0.0353 -0.0303 0.0424  139 PRO A CD    
711  N  N     . HIS A 92  ? 0.1442 0.2466 0.1225 0.0189  -0.0101 0.0192  140 HIS A N     
712  C  CA    . HIS A 92  ? 0.1604 0.2267 0.1379 -0.0230 -0.0097 0.0328  140 HIS A CA    
713  C  C     . HIS A 92  ? 0.1523 0.2454 0.1305 -0.0071 0.0137  0.0478  140 HIS A C     
714  O  O     . HIS A 92  ? 0.1612 0.2662 0.1293 -0.0009 -0.0143 0.0145  140 HIS A O     
715  C  CB    . HIS A 92  ? 0.1480 0.2477 0.1532 -0.0255 0.0204  0.0100  140 HIS A CB    
716  C  CG    . HIS A 92  ? 0.1328 0.2631 0.1346 -0.0084 0.0178  0.0023  140 HIS A CG    
717  N  ND1   . HIS A 92  ? 0.1733 0.2585 0.1461 -0.0143 -0.0084 -0.0055 140 HIS A ND1   
718  C  CD2   . HIS A 92  ? 0.1713 0.2546 0.1523 -0.0491 0.0210  -0.0008 140 HIS A CD2   
719  C  CE1   . HIS A 92  ? 0.1811 0.2537 0.1419 -0.0289 -0.0123 0.0098  140 HIS A CE1   
720  N  NE2   . HIS A 92  ? 0.1663 0.2529 0.1628 -0.0293 -0.0026 -0.0102 140 HIS A NE2   
721  N  N     . ALA A 93  ? 0.1807 0.2270 0.1175 -0.0168 0.0065  0.0326  141 ALA A N     
722  C  CA    . ALA A 93  ? 0.1837 0.2471 0.1065 -0.0120 0.0093  0.0184  141 ALA A CA    
723  C  C     . ALA A 93  ? 0.1609 0.2374 0.1007 -0.0230 0.0042  0.0184  141 ALA A C     
724  O  O     . ALA A 93  ? 0.1641 0.2354 0.1310 -0.0196 -0.0001 0.0271  141 ALA A O     
725  C  CB    . ALA A 93  ? 0.2224 0.2516 0.1449 -0.0051 0.0380  0.0181  141 ALA A CB    
726  N  N     . SER A 94  ? 0.1708 0.2323 0.1091 -0.0258 -0.0282 0.0065  142 SER A N     
727  C  CA    . SER A 94  ? 0.1647 0.2185 0.1178 -0.0210 -0.0281 0.0246  142 SER A CA    
728  C  C     . SER A 94  ? 0.1732 0.2180 0.1231 0.0040  -0.0127 0.0272  142 SER A C     
729  O  O     . SER A 94  ? 0.2001 0.2223 0.1329 0.0186  -0.0105 0.0146  142 SER A O     
730  C  CB    . SER A 94  ? 0.1785 0.2545 0.1436 -0.0564 -0.0159 0.0222  142 SER A CB    
731  O  OG    . SER A 94  ? 0.1865 0.2571 0.1614 -0.0378 -0.0088 0.0174  142 SER A OG    
732  N  N     . ASN A 95  ? 0.1412 0.1848 0.1360 -0.0005 -0.0177 0.0293  143 ASN A N     
733  C  CA    . ASN A 95  ? 0.1445 0.1984 0.1380 -0.0175 -0.0095 0.0386  143 ASN A CA    
734  C  C     . ASN A 95  ? 0.1560 0.2001 0.1274 -0.0131 -0.0183 0.0288  143 ASN A C     
735  O  O     . ASN A 95  ? 0.1674 0.1995 0.1199 -0.0107 -0.0083 0.0228  143 ASN A O     
736  C  CB    . ASN A 95  ? 0.1706 0.1945 0.1613 -0.0409 -0.0056 0.0306  143 ASN A CB    
737  C  CG    . ASN A 95  ? 0.1872 0.1984 0.1743 -0.0224 0.0178  -0.0034 143 ASN A CG    
738  O  OD1   . ASN A 95  ? 0.2210 0.2047 0.1849 -0.0244 0.0043  -0.0200 143 ASN A OD1   
739  N  ND2   . ASN A 95  ? 0.2154 0.1770 0.1877 -0.0494 0.0044  0.0105  143 ASN A ND2   
740  N  N     A ILE A 96  ? 0.1721 0.1863 0.1369 -0.0374 -0.0056 0.0167  144 ILE A N     
741  N  N     B ILE A 96  ? 0.1577 0.1862 0.1322 -0.0394 -0.0063 0.0129  144 ILE A N     
742  C  CA    A ILE A 96  ? 0.1814 0.1836 0.1481 -0.0239 0.0026  0.0290  144 ILE A CA    
743  C  CA    B ILE A 96  ? 0.1472 0.1906 0.1420 -0.0165 -0.0063 0.0231  144 ILE A CA    
744  C  C     A ILE A 96  ? 0.1758 0.1890 0.1441 -0.0190 0.0096  0.0164  144 ILE A C     
745  C  C     B ILE A 96  ? 0.1419 0.1947 0.1358 -0.0080 -0.0162 0.0133  144 ILE A C     
746  O  O     A ILE A 96  ? 0.1822 0.1916 0.1583 -0.0113 0.0176  0.0191  144 ILE A O     
747  O  O     B ILE A 96  ? 0.1193 0.1965 0.1448 0.0107  -0.0499 0.0252  144 ILE A O     
748  C  CB    A ILE A 96  ? 0.1925 0.1811 0.1495 -0.0278 -0.0200 0.0392  144 ILE A CB    
749  C  CB    B ILE A 96  ? 0.1342 0.1991 0.1344 -0.0227 -0.0311 0.0206  144 ILE A CB    
750  C  CG1   A ILE A 96  ? 0.2082 0.1818 0.1762 -0.0520 -0.0096 0.0541  144 ILE A CG1   
751  C  CG1   B ILE A 96  ? 0.1539 0.2038 0.1551 -0.0415 0.0050  0.0086  144 ILE A CG1   
752  C  CG2   A ILE A 96  ? 0.2144 0.1996 0.1411 -0.0209 -0.0295 0.0454  144 ILE A CG2   
753  C  CG2   B ILE A 96  ? 0.1393 0.2379 0.1347 -0.0243 -0.0416 0.0377  144 ILE A CG2   
754  C  CD1   A ILE A 96  ? 0.2120 0.1837 0.1921 -0.0507 -0.0228 0.0543  144 ILE A CD1   
755  C  CD1   B ILE A 96  ? 0.1970 0.2226 0.1746 -0.0197 0.0127  0.0203  144 ILE A CD1   
756  N  N     . THR A 97  ? 0.1786 0.1901 0.1337 -0.0073 0.0121  0.0050  145 THR A N     
757  C  CA    . THR A 97  ? 0.1949 0.2185 0.1238 0.0000  -0.0060 -0.0004 145 THR A CA    
758  C  C     . THR A 97  ? 0.2056 0.2189 0.1526 0.0000  -0.0168 0.0022  145 THR A C     
759  O  O     . THR A 97  ? 0.1941 0.2204 0.1717 -0.0098 -0.0125 0.0083  145 THR A O     
760  C  CB    . THR A 97  ? 0.2322 0.2705 0.1424 -0.0011 0.0077  -0.0157 145 THR A CB    
761  O  OG1   . THR A 97  ? 0.2662 0.2728 0.1477 0.0039  -0.0063 0.0067  145 THR A OG1   
762  C  CG2   . THR A 97  ? 0.2666 0.3218 0.1727 0.0163  0.0094  -0.0265 145 THR A CG2   
763  N  N     . LEU A 98  ? 0.2022 0.2065 0.1602 -0.0092 -0.0051 0.0209  146 LEU A N     
764  C  CA    . LEU A 98  ? 0.1996 0.2217 0.1885 -0.0156 0.0193  0.0320  146 LEU A CA    
765  C  C     . LEU A 98  ? 0.1760 0.2337 0.1766 0.0177  -0.0087 0.0159  146 LEU A C     
766  O  O     . LEU A 98  ? 0.1900 0.2476 0.1815 0.0327  0.0008  0.0056  146 LEU A O     
767  C  CB    . LEU A 98  ? 0.2244 0.2381 0.2718 -0.0261 0.0456  0.0477  146 LEU A CB    
768  C  CG    . LEU A 98  ? 0.2561 0.2818 0.3488 -0.0170 0.0795  0.0337  146 LEU A CG    
769  C  CD1   . LEU A 98  ? 0.3131 0.3200 0.3802 0.0025  0.0621  0.0312  146 LEU A CD1   
770  C  CD2   . LEU A 98  ? 0.2684 0.2787 0.3918 -0.0811 0.0981  0.0223  146 LEU A CD2   
771  N  N     . TYR A 99  ? 0.1549 0.2253 0.1562 0.0176  -0.0047 0.0232  147 TYR A N     
772  C  CA    . TYR A 99  ? 0.1517 0.2212 0.1610 0.0352  -0.0019 0.0030  147 TYR A CA    
773  C  C     . TYR A 99  ? 0.1578 0.2258 0.1609 0.0347  -0.0011 0.0157  147 TYR A C     
774  O  O     . TYR A 99  ? 0.1611 0.2626 0.1498 0.0176  0.0025  0.0231  147 TYR A O     
775  C  CB    . TYR A 99  ? 0.1436 0.2050 0.1731 0.0104  0.0097  -0.0163 147 TYR A CB    
776  C  CG    . TYR A 99  ? 0.1471 0.1927 0.1394 -0.0010 -0.0018 0.0022  147 TYR A CG    
777  C  CD1   . TYR A 99  ? 0.1677 0.1956 0.1448 0.0034  -0.0109 -0.0095 147 TYR A CD1   
778  C  CD2   . TYR A 99  ? 0.1717 0.2068 0.1344 0.0265  -0.0180 0.0046  147 TYR A CD2   
779  C  CE1   . TYR A 99  ? 0.1704 0.1773 0.1201 0.0173  -0.0168 -0.0016 147 TYR A CE1   
780  C  CE2   . TYR A 99  ? 0.1815 0.1985 0.1235 -0.0166 -0.0161 0.0090  147 TYR A CE2   
781  C  CZ    . TYR A 99  ? 0.1459 0.1876 0.1374 -0.0047 0.0008  -0.0024 147 TYR A CZ    
782  O  OH    . TYR A 99  ? 0.1426 0.2240 0.1582 0.0028  0.0169  -0.0142 147 TYR A OH    
783  N  N     . LYS A 100 ? 0.1528 0.2202 0.1450 0.0066  0.0072  0.0282  148 LYS A N     
784  C  CA    . LYS A 100 ? 0.1584 0.2095 0.1524 0.0044  0.0064  0.0372  148 LYS A CA    
785  C  C     . LYS A 100 ? 0.1540 0.2287 0.1582 0.0295  -0.0074 0.0221  148 LYS A C     
786  O  O     . LYS A 100 ? 0.1555 0.2328 0.1694 0.0091  -0.0024 0.0353  148 LYS A O     
787  C  CB    . LYS A 100 ? 0.1781 0.2311 0.1707 -0.0192 0.0010  0.0441  148 LYS A CB    
788  C  CG    . LYS A 100 ? 0.2046 0.2585 0.1834 -0.0374 0.0181  0.0530  148 LYS A CG    
789  C  CD    . LYS A 100 ? 0.2534 0.2938 0.1881 -0.0422 0.0324  0.0734  148 LYS A CD    
790  C  CE    . LYS A 100 ? 0.2659 0.3368 0.2029 -0.0313 0.0116  0.0931  148 LYS A CE    
791  N  NZ    . LYS A 100 ? 0.3056 0.3796 0.2228 -0.0331 -0.0048 0.0829  148 LYS A NZ    
792  N  N     . ASP A 101 ? 0.1723 0.2493 0.1698 0.0325  -0.0006 0.0120  149 ASP A N     
793  C  CA    . ASP A 101 ? 0.1940 0.2750 0.1717 0.0396  -0.0035 0.0036  149 ASP A CA    
794  C  C     . ASP A 101 ? 0.1657 0.2412 0.1850 0.0410  0.0130  0.0143  149 ASP A C     
795  O  O     . ASP A 101 ? 0.1803 0.2701 0.2008 0.0569  0.0065  -0.0104 149 ASP A O     
796  C  CB    . ASP A 101 ? 0.2370 0.3421 0.1999 0.0155  -0.0187 -0.0283 149 ASP A CB    
797  C  CG    . ASP A 101 ? 0.2979 0.4372 0.2646 0.0117  -0.0147 -0.0489 149 ASP A CG    
798  O  OD1   . ASP A 101 ? 0.3147 0.4899 0.2712 -0.0066 0.0097  -0.0231 149 ASP A OD1   
799  O  OD2   . ASP A 101 ? 0.3522 0.4798 0.3066 0.0378  -0.0126 -0.0914 149 ASP A OD2   
800  N  N     . GLN A 102 ? 0.1802 0.1972 0.1805 0.0076  0.0328  0.0187  150 GLN A N     
801  C  CA    . GLN A 102 ? 0.1620 0.2055 0.1787 -0.0214 0.0001  0.0241  150 GLN A CA    
802  C  C     . GLN A 102 ? 0.1674 0.1841 0.1830 -0.0117 -0.0094 0.0085  150 GLN A C     
803  O  O     . GLN A 102 ? 0.1788 0.2055 0.1963 0.0125  -0.0142 0.0246  150 GLN A O     
804  C  CB    . GLN A 102 ? 0.1773 0.2110 0.2205 -0.0445 0.0096  0.0383  150 GLN A CB    
805  C  CG    . GLN A 102 ? 0.1894 0.2483 0.2714 -0.0677 -0.0128 0.0601  150 GLN A CG    
806  C  CD    . GLN A 102 ? 0.2455 0.2784 0.3071 -0.0572 -0.0294 0.0689  150 GLN A CD    
807  O  OE1   . GLN A 102 ? 0.2808 0.3245 0.3374 -0.0143 -0.0402 0.0625  150 GLN A OE1   
808  N  NE2   . GLN A 102 ? 0.2929 0.2746 0.3273 -0.0602 -0.0017 0.0540  150 GLN A NE2   
809  N  N     . LEU A 103 ? 0.1601 0.1665 0.1784 -0.0174 -0.0040 0.0060  151 LEU A N     
810  C  CA    . LEU A 103 ? 0.1704 0.1679 0.1861 -0.0024 -0.0019 0.0073  151 LEU A CA    
811  C  C     . LEU A 103 ? 0.1630 0.1853 0.1755 0.0113  -0.0103 0.0042  151 LEU A C     
812  O  O     . LEU A 103 ? 0.1870 0.1859 0.1969 0.0269  -0.0164 0.0257  151 LEU A O     
813  C  CB    . LEU A 103 ? 0.1802 0.1760 0.2003 0.0032  -0.0162 0.0073  151 LEU A CB    
814  C  CG    . LEU A 103 ? 0.2062 0.1883 0.1914 0.0019  0.0068  0.0079  151 LEU A CG    
815  C  CD1   . LEU A 103 ? 0.2373 0.2402 0.1571 -0.0094 0.0054  0.0015  151 LEU A CD1   
816  C  CD2   . LEU A 103 ? 0.2326 0.1642 0.2431 0.0242  0.0080  -0.0209 151 LEU A CD2   
817  N  N     . GLN A 104 ? 0.1607 0.2078 0.1735 0.0080  0.0173  0.0115  152 GLN A N     
818  C  CA    . GLN A 104 ? 0.1515 0.2230 0.1863 0.0190  0.0219  0.0214  152 GLN A CA    
819  C  C     . GLN A 104 ? 0.1666 0.2129 0.2004 0.0063  0.0038  0.0109  152 GLN A C     
820  O  O     . GLN A 104 ? 0.1735 0.2205 0.2318 -0.0203 -0.0183 0.0055  152 GLN A O     
821  C  CB    . GLN A 104 ? 0.1872 0.2668 0.2156 0.0407  0.0526  0.0465  152 GLN A CB    
822  C  CG    . GLN A 104 ? 0.2100 0.3138 0.2548 0.0605  0.0282  0.0809  152 GLN A CG    
823  C  CD    . GLN A 104 ? 0.2661 0.3966 0.3106 0.0714  0.0352  0.0861  152 GLN A CD    
824  O  OE1   . GLN A 104 ? 0.2975 0.4615 0.2824 0.0850  0.0298  0.0559  152 GLN A OE1   
825  N  NE2   . GLN A 104 ? 0.3086 0.4259 0.3612 0.0853  0.0358  0.1301  152 GLN A NE2   
826  N  N     . LEU A 105 ? 0.1784 0.1757 0.2060 0.0365  0.0085  0.0021  153 LEU A N     
827  C  CA    . LEU A 105 ? 0.1737 0.1880 0.2003 0.0292  -0.0044 -0.0164 153 LEU A CA    
828  C  C     . LEU A 105 ? 0.1578 0.2050 0.1842 0.0096  -0.0262 -0.0046 153 LEU A C     
829  O  O     . LEU A 105 ? 0.1558 0.2190 0.2153 0.0284  -0.0101 0.0050  153 LEU A O     
830  C  CB    . LEU A 105 ? 0.2028 0.2115 0.2294 0.0012  -0.0017 -0.0522 153 LEU A CB    
831  C  CG    . LEU A 105 ? 0.2086 0.2475 0.2676 -0.0014 -0.0170 -0.0621 153 LEU A CG    
832  C  CD1   . LEU A 105 ? 0.2396 0.2616 0.2906 -0.0279 -0.0080 -0.0867 153 LEU A CD1   
833  C  CD2   . LEU A 105 ? 0.2038 0.2578 0.2788 0.0009  0.0084  -0.0647 153 LEU A CD2   
834  N  N     . TRP A 106 ? 0.1873 0.1962 0.1796 0.0189  -0.0077 0.0088  154 TRP A N     
835  C  CA    . TRP A 106 ? 0.1758 0.1879 0.1822 0.0298  -0.0044 0.0081  154 TRP A CA    
836  C  C     . TRP A 106 ? 0.1684 0.1825 0.1722 0.0288  -0.0163 0.0196  154 TRP A C     
837  O  O     . TRP A 106 ? 0.1751 0.2100 0.2020 0.0214  -0.0006 0.0516  154 TRP A O     
838  C  CB    . TRP A 106 ? 0.1777 0.2213 0.1785 0.0330  0.0242  0.0100  154 TRP A CB    
839  C  CG    . TRP A 106 ? 0.2114 0.2042 0.1899 0.0350  0.0169  0.0023  154 TRP A CG    
840  C  CD1   . TRP A 106 ? 0.2982 0.2073 0.2177 0.0389  0.0086  0.0041  154 TRP A CD1   
841  C  CD2   . TRP A 106 ? 0.3008 0.1923 0.2187 -0.0602 0.0142  0.0092  154 TRP A CD2   
842  N  NE1   . TRP A 106 ? 0.2804 0.2071 0.2347 0.0305  -0.0002 0.0067  154 TRP A NE1   
843  C  CE2   . TRP A 106 ? 0.2467 0.1864 0.2194 -0.0277 0.0257  0.0325  154 TRP A CE2   
844  C  CE3   . TRP A 106 ? 0.5004 0.2396 0.2246 -0.0856 0.0222  0.0266  154 TRP A CE3   
845  C  CZ2   . TRP A 106 ? 0.3645 0.1864 0.2275 -0.1091 0.0114  0.0203  154 TRP A CZ2   
846  C  CZ3   . TRP A 106 ? 0.5738 0.2447 0.2324 -0.0878 0.0194  0.0280  154 TRP A CZ3   
847  C  CH2   . TRP A 106 ? 0.5258 0.2224 0.2336 -0.0907 0.0072  0.0183  154 TRP A CH2   
848  N  N     . ILE A 107 ? 0.1660 0.1734 0.1979 0.0137  -0.0018 0.0206  155 ILE A N     
849  C  CA    . ILE A 107 ? 0.1598 0.1836 0.2081 0.0265  -0.0065 0.0257  155 ILE A CA    
850  C  C     . ILE A 107 ? 0.1618 0.2046 0.1901 0.0190  -0.0097 0.0210  155 ILE A C     
851  O  O     . ILE A 107 ? 0.1694 0.2242 0.1908 0.0067  -0.0234 0.0093  155 ILE A O     
852  C  CB    . ILE A 107 ? 0.1730 0.1755 0.2348 0.0082  -0.0065 0.0254  155 ILE A CB    
853  C  CG1   . ILE A 107 ? 0.2265 0.1669 0.2479 0.0399  -0.0141 0.0035  155 ILE A CG1   
854  C  CG2   . ILE A 107 ? 0.1644 0.2068 0.2556 -0.0038 -0.0113 0.0354  155 ILE A CG2   
855  C  CD1   . ILE A 107 ? 0.2328 0.1585 0.2769 0.0262  -0.0340 -0.0163 155 ILE A CD1   
856  N  N     . ARG A 108 ? 0.1792 0.2169 0.1945 0.0217  0.0133  0.0235  156 ARG A N     
857  C  CA    . ARG A 108 ? 0.1501 0.2612 0.1874 0.0275  0.0304  0.0148  156 ARG A CA    
858  C  C     . ARG A 108 ? 0.1460 0.2531 0.1985 0.0197  0.0115  0.0129  156 ARG A C     
859  O  O     . ARG A 108 ? 0.1399 0.2901 0.2254 0.0236  -0.0041 0.0122  156 ARG A O     
860  C  CB    . ARG A 108 ? 0.1665 0.3149 0.1839 0.0166  0.0415  -0.0202 156 ARG A CB    
861  C  CG    . ARG A 108 ? 0.2441 0.3693 0.1989 0.0365  0.0466  -0.0286 156 ARG A CG    
862  C  CD    . ARG A 108 ? 0.2825 0.4031 0.2200 0.0519  0.0637  -0.0213 156 ARG A CD    
863  N  NE    . ARG A 108 ? 0.3264 0.4001 0.2350 0.0550  0.0578  -0.0288 156 ARG A NE    
864  C  CZ    . ARG A 108 ? 0.2914 0.3921 0.2438 0.0909  0.0448  -0.0081 156 ARG A CZ    
865  N  NH1   . ARG A 108 ? 0.3077 0.3710 0.2565 0.0546  0.0355  0.0259  156 ARG A NH1   
866  N  NH2   . ARG A 108 ? 0.2942 0.4104 0.2538 0.0763  0.0463  -0.0119 156 ARG A NH2   
867  N  N     . GLY A 109 ? 0.1618 0.2156 0.1870 0.0214  -0.0004 0.0028  157 GLY A N     
868  C  CA    . GLY A 109 ? 0.1971 0.2077 0.1811 0.0521  -0.0214 0.0038  157 GLY A CA    
869  C  C     . GLY A 109 ? 0.1931 0.2193 0.2052 0.0294  -0.0165 -0.0061 157 GLY A C     
870  O  O     . GLY A 109 ? 0.1753 0.2424 0.2313 0.0354  -0.0016 0.0074  157 GLY A O     
871  N  N     . ASN A 110 ? 0.1856 0.2015 0.1919 0.0175  -0.0028 -0.0263 158 ASN A N     
872  C  CA    . ASN A 110 ? 0.1483 0.2027 0.2000 0.0302  0.0001  -0.0274 158 ASN A CA    
873  C  C     . ASN A 110 ? 0.1442 0.2246 0.2086 0.0109  -0.0246 -0.0039 158 ASN A C     
874  O  O     . ASN A 110 ? 0.1631 0.2485 0.2246 0.0359  -0.0486 -0.0048 158 ASN A O     
875  C  CB    . ASN A 110 ? 0.1496 0.2361 0.2106 0.0289  0.0042  0.0149  158 ASN A CB    
876  C  CG    . ASN A 110 ? 0.1637 0.2418 0.2100 0.0322  -0.0087 0.0497  158 ASN A CG    
877  O  OD1   . ASN A 110 ? 0.2313 0.2451 0.2337 0.0401  -0.0107 0.0796  158 ASN A OD1   
878  N  ND2   . ASN A 110 ? 0.1746 0.2661 0.2312 0.0324  -0.0146 0.0795  158 ASN A ND2   
879  N  N     . VAL A 111 ? 0.1517 0.2156 0.2098 0.0036  -0.0038 -0.0011 159 VAL A N     
880  C  CA    . VAL A 111 ? 0.1553 0.2258 0.2187 0.0029  0.0006  -0.0087 159 VAL A CA    
881  C  C     . VAL A 111 ? 0.1442 0.2819 0.2269 0.0269  -0.0227 -0.0158 159 VAL A C     
882  O  O     . VAL A 111 ? 0.1558 0.3075 0.2493 0.0211  -0.0275 -0.0267 159 VAL A O     
883  C  CB    . VAL A 111 ? 0.1566 0.2488 0.2282 -0.0149 0.0040  0.0188  159 VAL A CB    
884  C  CG1   . VAL A 111 ? 0.1638 0.2929 0.2452 -0.0239 -0.0103 0.0157  159 VAL A CG1   
885  C  CG2   . VAL A 111 ? 0.1737 0.2488 0.2104 -0.0177 0.0131  0.0055  159 VAL A CG2   
886  N  N     . SER A 112 ? 0.1579 0.2779 0.2389 0.0476  0.0052  -0.0159 160 SER A N     
887  C  CA    . SER A 112 ? 0.1946 0.3076 0.2594 0.0676  -0.0097 -0.0149 160 SER A CA    
888  C  C     . SER A 112 ? 0.1995 0.3438 0.2919 0.0830  -0.0267 -0.0176 160 SER A C     
889  O  O     . SER A 112 ? 0.1996 0.4059 0.3242 0.0808  -0.0192 -0.0167 160 SER A O     
890  C  CB    . SER A 112 ? 0.2187 0.3157 0.2556 0.0599  -0.0041 -0.0041 160 SER A CB    
891  O  OG    . SER A 112 ? 0.2463 0.3429 0.2853 0.0510  0.0134  0.0010  160 SER A OG    
892  N  N     . ALA A 113 ? 0.2119 0.3129 0.2792 0.0870  -0.0315 -0.0064 161 ALA A N     
893  C  CA    . ALA A 113 ? 0.2353 0.3234 0.2825 0.0790  -0.0410 0.0072  161 ALA A CA    
894  C  C     . ALA A 113 ? 0.2253 0.3232 0.2669 0.1107  -0.0537 0.0047  161 ALA A C     
895  O  O     . ALA A 113 ? 0.2846 0.3519 0.3069 0.1159  -0.0751 -0.0157 161 ALA A O     
896  C  CB    . ALA A 113 ? 0.2865 0.3227 0.2906 0.0397  -0.0572 0.0152  161 ALA A CB    
897  N  N     . CYS A 114 ? 0.1959 0.3042 0.2466 0.0577  -0.0323 0.0102  162 CYS A N     
898  C  CA    . CYS A 114 ? 0.1733 0.2964 0.2384 0.0439  -0.0065 0.0166  162 CYS A CA    
899  C  C     . CYS A 114 ? 0.1668 0.2830 0.2355 0.0115  -0.0113 0.0231  162 CYS A C     
900  O  O     . CYS A 114 ? 0.1558 0.2801 0.2234 0.0141  -0.0259 0.0250  162 CYS A O     
901  C  CB    . CYS A 114 ? 0.1943 0.3043 0.2420 0.0233  0.0192  -0.0008 162 CYS A CB    
902  S  SG    . CYS A 114 ? 0.2564 0.3459 0.2650 -0.0035 0.0195  0.0154  162 CYS A SG    
903  N  N     . ALA A 115 ? 0.1568 0.2875 0.2361 0.0044  0.0171  0.0325  163 ALA A N     
904  C  CA    . ALA A 115 ? 0.1526 0.2975 0.2361 0.0009  0.0289  0.0177  163 ALA A CA    
905  C  C     . ALA A 115 ? 0.1219 0.2797 0.2352 0.0176  0.0003  0.0245  163 ALA A C     
906  O  O     . ALA A 115 ? 0.1778 0.2828 0.2396 0.0170  -0.0183 0.0235  163 ALA A O     
907  C  CB    . ALA A 115 ? 0.1401 0.3167 0.2514 0.0081  0.0469  0.0160  163 ALA A CB    
908  N  N     . ARG A 116 ? 0.1283 0.2782 0.2296 0.0222  -0.0053 0.0202  164 ARG A N     
909  C  CA    . ARG A 116 ? 0.1186 0.3081 0.2209 -0.0084 -0.0223 0.0166  164 ARG A CA    
910  C  C     . ARG A 116 ? 0.1218 0.3279 0.2130 -0.0152 -0.0209 0.0196  164 ARG A C     
911  O  O     . ARG A 116 ? 0.1595 0.3910 0.2269 -0.0420 -0.0096 0.0103  164 ARG A O     
912  C  CB    . ARG A 116 ? 0.1024 0.3222 0.2301 -0.0047 -0.0536 0.0251  164 ARG A CB    
913  C  CG    . ARG A 116 ? 0.1340 0.3402 0.2480 -0.0323 -0.0311 0.0307  164 ARG A CG    
914  C  CD    . ARG A 116 ? 0.1437 0.3641 0.2588 -0.0587 -0.0265 0.0296  164 ARG A CD    
915  N  NE    . ARG A 116 ? 0.1707 0.3828 0.2839 -0.0697 -0.0233 0.0221  164 ARG A NE    
916  C  CZ    . ARG A 116 ? 0.1826 0.3970 0.2860 -0.0640 -0.0274 0.0347  164 ARG A CZ    
917  N  NH1   . ARG A 116 ? 0.1760 0.4003 0.2951 -0.0364 -0.0128 0.0363  164 ARG A NH1   
918  N  NH2   . ARG A 116 ? 0.1943 0.4015 0.3064 -0.0680 -0.0276 0.0279  164 ARG A NH2   
919  N  N     . SER A 117 ? 0.1027 0.2739 0.2142 0.0238  -0.0419 0.0227  165 SER A N     
920  C  CA    . SER A 117 ? 0.1102 0.2491 0.2168 0.0163  -0.0375 0.0114  165 SER A CA    
921  C  C     . SER A 117 ? 0.1257 0.2206 0.2342 0.0115  -0.0030 0.0259  165 SER A C     
922  O  O     . SER A 117 ? 0.1486 0.2375 0.2696 0.0029  -0.0010 0.0224  165 SER A O     
923  C  CB    . SER A 117 ? 0.1517 0.2493 0.2312 0.0189  -0.0526 -0.0029 165 SER A CB    
924  O  OG    . SER A 117 ? 0.1760 0.2468 0.2624 0.0286  -0.0162 -0.0088 165 SER A OG    
925  N  N     . ILE A 118 ? 0.1181 0.2066 0.2031 0.0125  -0.0072 0.0047  166 ILE A N     
926  C  CA    . ILE A 118 ? 0.1341 0.2146 0.1824 -0.0032 -0.0274 0.0165  166 ILE A CA    
927  C  C     . ILE A 118 ? 0.1209 0.2059 0.1786 -0.0207 -0.0015 0.0419  166 ILE A C     
928  O  O     . ILE A 118 ? 0.1354 0.2044 0.2163 -0.0269 -0.0117 0.0357  166 ILE A O     
929  C  CB    . ILE A 118 ? 0.1460 0.2342 0.1928 0.0156  -0.0328 -0.0086 166 ILE A CB    
930  C  CG1   . ILE A 118 ? 0.1673 0.2640 0.2102 0.0083  -0.0504 -0.0002 166 ILE A CG1   
931  C  CG2   . ILE A 118 ? 0.1555 0.2426 0.1966 0.0228  -0.0198 0.0038  166 ILE A CG2   
932  C  CD1   . ILE A 118 ? 0.1867 0.2678 0.2278 -0.0146 -0.0681 -0.0038 166 ILE A CD1   
933  N  N     . PHE A 119 ? 0.1258 0.2070 0.1649 -0.0175 -0.0220 0.0365  167 PHE A N     
934  C  CA    . PHE A 119 ? 0.1256 0.1969 0.1803 0.0013  -0.0117 0.0215  167 PHE A CA    
935  C  C     . PHE A 119 ? 0.1255 0.1786 0.2036 0.0019  0.0008  0.0164  167 PHE A C     
936  O  O     . PHE A 119 ? 0.1532 0.1713 0.2448 -0.0014 0.0141  0.0212  167 PHE A O     
937  C  CB    . PHE A 119 ? 0.1425 0.1793 0.1573 0.0255  -0.0117 0.0352  167 PHE A CB    
938  C  CG    . PHE A 119 ? 0.1587 0.1950 0.1734 0.0335  0.0130  0.0412  167 PHE A CG    
939  C  CD1   . PHE A 119 ? 0.1726 0.1899 0.1791 0.0247  -0.0030 0.0417  167 PHE A CD1   
940  C  CD2   . PHE A 119 ? 0.1507 0.2144 0.1939 0.0482  0.0047  0.0288  167 PHE A CD2   
941  C  CE1   . PHE A 119 ? 0.1774 0.2149 0.1850 -0.0039 -0.0005 0.0363  167 PHE A CE1   
942  C  CE2   . PHE A 119 ? 0.1923 0.2092 0.2153 0.0304  -0.0231 0.0255  167 PHE A CE2   
943  C  CZ    . PHE A 119 ? 0.1909 0.2162 0.1999 -0.0036 -0.0016 0.0246  167 PHE A CZ    
944  N  N     . ILE A 120 ? 0.1153 0.1848 0.1952 0.0145  -0.0043 0.0127  168 ILE A N     
945  C  CA    . ILE A 120 ? 0.1119 0.2041 0.1861 0.0127  -0.0080 0.0175  168 ILE A CA    
946  C  C     . ILE A 120 ? 0.1313 0.1960 0.1857 -0.0094 -0.0067 0.0200  168 ILE A C     
947  O  O     . ILE A 120 ? 0.1452 0.1853 0.1833 -0.0138 -0.0148 0.0157  168 ILE A O     
948  C  CB    . ILE A 120 ? 0.1425 0.2290 0.1674 0.0158  -0.0173 0.0191  168 ILE A CB    
949  C  CG1   . ILE A 120 ? 0.1709 0.2434 0.1786 -0.0007 -0.0351 0.0355  168 ILE A CG1   
950  C  CG2   . ILE A 120 ? 0.1676 0.2314 0.1859 0.0308  0.0057  0.0104  168 ILE A CG2   
951  C  CD1   . ILE A 120 ? 0.2098 0.2426 0.1799 0.0064  -0.0184 0.0255  168 ILE A CD1   
952  N  N     . PHE A 121 ? 0.1258 0.1890 0.1773 0.0107  -0.0077 0.0117  169 PHE A N     
953  C  CA    . PHE A 121 ? 0.1449 0.1995 0.1688 0.0089  0.0059  0.0099  169 PHE A CA    
954  C  C     . PHE A 121 ? 0.1473 0.1888 0.1635 -0.0014 0.0093  -0.0032 169 PHE A C     
955  O  O     . PHE A 121 ? 0.1738 0.1878 0.1867 0.0160  -0.0096 -0.0005 169 PHE A O     
956  C  CB    . PHE A 121 ? 0.1781 0.2053 0.1677 0.0020  0.0108  0.0083  169 PHE A CB    
957  C  CG    . PHE A 121 ? 0.1509 0.2196 0.1682 -0.0063 -0.0057 0.0045  169 PHE A CG    
958  C  CD1   . PHE A 121 ? 0.1939 0.2522 0.2030 0.0021  0.0153  -0.0352 169 PHE A CD1   
959  C  CD2   . PHE A 121 ? 0.1766 0.2371 0.1841 -0.0050 0.0008  0.0265  169 PHE A CD2   
960  C  CE1   . PHE A 121 ? 0.2012 0.2760 0.2251 -0.0157 0.0368  -0.0386 169 PHE A CE1   
961  C  CE2   . PHE A 121 ? 0.2081 0.2766 0.1775 -0.0077 0.0160  0.0108  169 PHE A CE2   
962  C  CZ    . PHE A 121 ? 0.1925 0.2821 0.2167 -0.0477 0.0387  -0.0195 169 PHE A CZ    
963  N  N     . ASP A 122 ? 0.1516 0.1999 0.1668 -0.0029 0.0150  -0.0006 170 ASP A N     
964  C  CA    . ASP A 122 ? 0.1380 0.2071 0.1544 0.0149  0.0103  0.0096  170 ASP A CA    
965  C  C     . ASP A 122 ? 0.1480 0.2049 0.1566 -0.0014 -0.0078 -0.0038 170 ASP A C     
966  O  O     . ASP A 122 ? 0.1879 0.1949 0.1772 0.0051  -0.0141 -0.0034 170 ASP A O     
967  C  CB    . ASP A 122 ? 0.1698 0.2281 0.1607 -0.0066 0.0113  0.0092  170 ASP A CB    
968  C  CG    . ASP A 122 ? 0.1886 0.2275 0.1711 -0.0213 0.0000  0.0055  170 ASP A CG    
969  O  OD1   . ASP A 122 ? 0.2038 0.2459 0.1634 -0.0284 0.0011  -0.0005 170 ASP A OD1   
970  O  OD2   . ASP A 122 ? 0.2424 0.2402 0.1704 0.0104  0.0124  -0.0155 170 ASP A OD2   
971  N  N     . GLN A 123 ? 0.1553 0.1823 0.1488 -0.0023 -0.0096 0.0262  171 GLN A N     
972  C  CA    . GLN A 123 ? 0.1695 0.1776 0.1607 -0.0152 -0.0238 0.0109  171 GLN A CA    
973  C  C     . GLN A 123 ? 0.1976 0.1969 0.1757 0.0057  -0.0089 0.0151  171 GLN A C     
974  O  O     . GLN A 123 ? 0.1937 0.1780 0.1684 0.0022  -0.0150 0.0142  171 GLN A O     
975  C  CB    . GLN A 123 ? 0.1836 0.2104 0.1592 -0.0367 0.0032  0.0128  171 GLN A CB    
976  C  CG    . GLN A 123 ? 0.2374 0.2455 0.1884 -0.0551 0.0258  -0.0123 171 GLN A CG    
977  C  CD    . GLN A 123 ? 0.2508 0.2989 0.2221 -0.0352 0.0401  0.0051  171 GLN A CD    
978  O  OE1   . GLN A 123 ? 0.3024 0.3369 0.2433 0.0258  0.0373  0.0020  171 GLN A OE1   
979  N  NE2   . GLN A 123 ? 0.3076 0.3065 0.2068 -0.0331 0.0336  -0.0002 171 GLN A NE2   
980  N  N     A MET A 124 ? 0.1894 0.2180 0.1689 -0.0054 -0.0058 0.0227  172 MET A N     
981  N  N     B MET A 124 ? 0.1670 0.2365 0.1611 0.0000  0.0038  0.0197  172 MET A N     
982  C  CA    A MET A 124 ? 0.1957 0.2368 0.1801 -0.0270 -0.0052 0.0285  172 MET A CA    
983  C  CA    B MET A 124 ? 0.1655 0.2716 0.1790 -0.0229 0.0082  0.0228  172 MET A CA    
984  C  C     A MET A 124 ? 0.2035 0.2336 0.1711 -0.0199 -0.0084 0.0322  172 MET A C     
985  C  C     B MET A 124 ? 0.1872 0.2520 0.1701 -0.0135 -0.0002 0.0285  172 MET A C     
986  O  O     A MET A 124 ? 0.2097 0.2434 0.1764 -0.0236 -0.0097 0.0262  172 MET A O     
987  O  O     B MET A 124 ? 0.2013 0.2665 0.1767 -0.0161 -0.0034 0.0148  172 MET A O     
988  C  CB    A MET A 124 ? 0.2154 0.2598 0.2041 -0.0469 0.0107  0.0269  172 MET A CB    
989  C  CB    B MET A 124 ? 0.1925 0.3329 0.2220 -0.0382 0.0497  0.0102  172 MET A CB    
990  C  CG    A MET A 124 ? 0.2329 0.2739 0.2408 -0.0495 -0.0011 0.0189  172 MET A CG    
991  C  CG    B MET A 124 ? 0.2004 0.3823 0.2694 -0.0434 0.0446  -0.0169 172 MET A CG    
992  S  SD    A MET A 124 ? 0.2888 0.2970 0.2699 -0.0478 -0.0289 -0.0017 172 MET A SD    
993  S  SD    B MET A 124 ? 0.2455 0.4262 0.3160 -0.0352 0.0007  -0.0412 172 MET A SD    
994  C  CE    A MET A 124 ? 0.3231 0.3134 0.2900 -0.0468 -0.0296 -0.0034 172 MET A CE    
995  C  CE    B MET A 124 ? 0.2307 0.4329 0.3092 0.0045  -0.0064 -0.0511 172 MET A CE    
996  N  N     . ASP A 125 ? 0.2113 0.2250 0.1603 -0.0187 -0.0189 0.0414  173 ASP A N     
997  C  CA    . ASP A 125 ? 0.2087 0.2205 0.1822 -0.0126 -0.0024 0.0140  173 ASP A CA    
998  C  C     . ASP A 125 ? 0.2110 0.1993 0.1656 -0.0119 -0.0271 -0.0050 173 ASP A C     
999  O  O     . ASP A 125 ? 0.2556 0.2192 0.2039 -0.0077 -0.0357 0.0059  173 ASP A O     
1000 C  CB    . ASP A 125 ? 0.2442 0.2558 0.1882 0.0063  0.0252  0.0091  173 ASP A CB    
1001 C  CG    . ASP A 125 ? 0.2630 0.3216 0.2433 0.0329  0.0341  0.0214  173 ASP A CG    
1002 O  OD1   . ASP A 125 ? 0.2501 0.3280 0.2480 0.0059  -0.0014 0.0325  173 ASP A OD1   
1003 O  OD2   . ASP A 125 ? 0.3654 0.3750 0.2815 0.0537  0.0403  0.0108  173 ASP A OD2   
1004 N  N     . LYS A 126 ? 0.1994 0.1824 0.1477 -0.0069 -0.0153 -0.0162 174 LYS A N     
1005 C  CA    . LYS A 126 ? 0.1986 0.2151 0.1489 0.0006  -0.0025 0.0252  174 LYS A CA    
1006 C  C     . LYS A 126 ? 0.2243 0.2398 0.1566 0.0006  0.0143  -0.0008 174 LYS A C     
1007 O  O     . LYS A 126 ? 0.2608 0.2636 0.1731 -0.0222 0.0216  -0.0282 174 LYS A O     
1008 C  CB    . LYS A 126 ? 0.1957 0.2317 0.1706 0.0072  0.0175  0.0422  174 LYS A CB    
1009 C  CG    . LYS A 126 ? 0.1996 0.2704 0.1823 0.0133  0.0000  0.0148  174 LYS A CG    
1010 C  CD    . LYS A 126 ? 0.2753 0.2608 0.2228 -0.0135 0.0225  -0.0372 174 LYS A CD    
1011 C  CE    . LYS A 126 ? 0.2908 0.2581 0.1967 -0.0279 0.0253  -0.0278 174 LYS A CE    
1012 N  NZ    . LYS A 126 ? 0.3179 0.2236 0.2150 -0.0503 0.0511  -0.0391 174 LYS A NZ    
1013 N  N     . MET A 127 ? 0.2247 0.2222 0.1395 0.0078  0.0139  0.0152  175 MET A N     
1014 C  CA    . MET A 127 ? 0.2257 0.2245 0.1613 0.0088  0.0142  0.0138  175 MET A CA    
1015 C  C     . MET A 127 ? 0.2298 0.2224 0.1462 -0.0299 -0.0013 0.0181  175 MET A C     
1016 O  O     . MET A 127 ? 0.2385 0.2309 0.1577 -0.0132 0.0049  0.0178  175 MET A O     
1017 C  CB    . MET A 127 ? 0.2414 0.2651 0.2406 0.0479  0.0305  -0.0077 175 MET A CB    
1018 C  CG    . MET A 127 ? 0.2530 0.3178 0.2895 0.0388  -0.0017 0.0301  175 MET A CG    
1019 S  SD    . MET A 127 ? 0.2939 0.3425 0.3163 0.0236  -0.0438 0.0782  175 MET A SD    
1020 C  CE    . MET A 127 ? 0.2974 0.3570 0.3160 0.0287  -0.0308 0.0310  175 MET A CE    
1021 N  N     . HIS A 128 ? 0.2053 0.2214 0.1464 -0.0146 0.0032  0.0180  176 HIS A N     
1022 C  CA    . HIS A 128 ? 0.1960 0.2248 0.1457 -0.0404 0.0089  0.0080  176 HIS A CA    
1023 C  C     . HIS A 128 ? 0.2058 0.2122 0.1639 -0.0318 0.0220  0.0209  176 HIS A C     
1024 O  O     . HIS A 128 ? 0.1915 0.2094 0.1567 -0.0054 -0.0014 0.0134  176 HIS A O     
1025 C  CB    . HIS A 128 ? 0.2497 0.2301 0.1376 -0.0526 -0.0198 0.0016  176 HIS A CB    
1026 C  CG    . HIS A 128 ? 0.2490 0.2614 0.1548 -0.0658 -0.0117 0.0088  176 HIS A CG    
1027 N  ND1   . HIS A 128 ? 0.2289 0.2806 0.1711 -0.0496 -0.0147 -0.0012 176 HIS A ND1   
1028 C  CD2   . HIS A 128 ? 0.2258 0.2738 0.1704 -0.0544 0.0100  0.0056  176 HIS A CD2   
1029 C  CE1   . HIS A 128 ? 0.2698 0.2967 0.1857 -0.0716 0.0076  -0.0234 176 HIS A CE1   
1030 N  NE2   . HIS A 128 ? 0.2501 0.3083 0.1875 -0.0460 0.0264  -0.0214 176 HIS A NE2   
1031 N  N     . ALA A 129 ? 0.2343 0.2185 0.1605 -0.0496 0.0283  0.0256  177 ALA A N     
1032 C  CA    . ALA A 129 ? 0.2522 0.2269 0.1773 -0.0381 0.0092  0.0327  177 ALA A CA    
1033 C  C     . ALA A 129 ? 0.2157 0.2514 0.1686 -0.0408 -0.0031 0.0137  177 ALA A C     
1034 O  O     . ALA A 129 ? 0.2050 0.2562 0.1932 -0.0286 0.0027  0.0502  177 ALA A O     
1035 C  CB    . ALA A 129 ? 0.3137 0.2132 0.2235 -0.0248 0.0051  0.0648  177 ALA A CB    
1036 N  N     . GLY A 130 ? 0.2284 0.2505 0.1337 -0.0178 -0.0046 0.0014  178 GLY A N     
1037 C  CA    . GLY A 130 ? 0.2244 0.2799 0.1469 -0.0207 0.0067  0.0143  178 GLY A CA    
1038 C  C     . GLY A 130 ? 0.2217 0.2631 0.1532 -0.0380 0.0189  0.0175  178 GLY A C     
1039 O  O     . GLY A 130 ? 0.2069 0.2720 0.1778 -0.0160 0.0320  0.0167  178 GLY A O     
1040 N  N     . LEU A 131 ? 0.2239 0.2381 0.1537 -0.0278 0.0163  0.0169  179 LEU A N     
1041 C  CA    . LEU A 131 ? 0.2400 0.2407 0.1617 -0.0027 0.0460  0.0453  179 LEU A CA    
1042 C  C     . LEU A 131 ? 0.2605 0.2398 0.1893 0.0098  0.0124  0.0400  179 LEU A C     
1043 O  O     . LEU A 131 ? 0.2556 0.2512 0.1993 0.0049  0.0301  0.0475  179 LEU A O     
1044 C  CB    . LEU A 131 ? 0.2739 0.2619 0.1935 0.0316  0.0985  0.0478  179 LEU A CB    
1045 C  CG    . LEU A 131 ? 0.3201 0.2629 0.2215 0.0129  0.0868  0.0222  179 LEU A CG    
1046 C  CD1   . LEU A 131 ? 0.3269 0.2653 0.2415 0.0148  0.1046  -0.0209 179 LEU A CD1   
1047 C  CD2   . LEU A 131 ? 0.3264 0.2391 0.2146 -0.0138 0.1017  0.0440  179 LEU A CD2   
1048 N  N     . ILE A 132 ? 0.2255 0.2215 0.1771 -0.0117 -0.0032 0.0195  180 ILE A N     
1049 C  CA    . ILE A 132 ? 0.2298 0.2402 0.1905 -0.0045 -0.0083 0.0104  180 ILE A CA    
1050 C  C     . ILE A 132 ? 0.2110 0.2432 0.1755 -0.0314 -0.0286 0.0094  180 ILE A C     
1051 O  O     . ILE A 132 ? 0.2184 0.2668 0.1929 -0.0298 -0.0464 0.0265  180 ILE A O     
1052 C  CB    . ILE A 132 ? 0.2480 0.2318 0.2131 -0.0068 -0.0041 -0.0189 180 ILE A CB    
1053 C  CG1   . ILE A 132 ? 0.2836 0.2162 0.2210 0.0265  -0.0050 -0.0035 180 ILE A CG1   
1054 C  CG2   . ILE A 132 ? 0.2543 0.2425 0.2461 -0.0172 -0.0198 -0.0289 180 ILE A CG2   
1055 C  CD1   . ILE A 132 ? 0.3283 0.2407 0.2285 0.0175  -0.0047 -0.0166 180 ILE A CD1   
1056 N  N     . ASP A 133 ? 0.2321 0.2364 0.1654 -0.0354 -0.0155 0.0108  181 ASP A N     
1057 C  CA    . ASP A 133 ? 0.2339 0.2820 0.1767 -0.0458 -0.0273 0.0258  181 ASP A CA    
1058 C  C     . ASP A 133 ? 0.2270 0.2982 0.1877 -0.0438 -0.0087 0.0353  181 ASP A C     
1059 O  O     . ASP A 133 ? 0.2237 0.3099 0.2133 -0.0442 -0.0097 0.0485  181 ASP A O     
1060 C  CB    . ASP A 133 ? 0.2554 0.3126 0.1863 -0.0299 -0.0328 0.0343  181 ASP A CB    
1061 C  CG    . ASP A 133 ? 0.2823 0.3593 0.2340 -0.0544 -0.0265 0.0192  181 ASP A CG    
1062 O  OD1   . ASP A 133 ? 0.3272 0.3871 0.2766 -0.0401 -0.0391 0.0251  181 ASP A OD1   
1063 O  OD2   . ASP A 133 ? 0.3122 0.3591 0.2479 -0.0338 -0.0575 0.0335  181 ASP A OD2   
1064 N  N     . ALA A 134 ? 0.2146 0.2838 0.1866 -0.0360 -0.0015 0.0262  182 ALA A N     
1065 C  CA    . ALA A 134 ? 0.2121 0.2875 0.2135 -0.0395 -0.0063 0.0285  182 ALA A CA    
1066 C  C     . ALA A 134 ? 0.2182 0.3002 0.2243 -0.0194 -0.0112 0.0190  182 ALA A C     
1067 O  O     . ALA A 134 ? 0.2547 0.3241 0.2608 0.0056  -0.0020 0.0028  182 ALA A O     
1068 C  CB    . ALA A 134 ? 0.2387 0.2706 0.2311 -0.0398 0.0122  0.0193  182 ALA A CB    
1069 N  N     . ILE A 135 ? 0.1921 0.2875 0.2022 -0.0385 -0.0257 0.0327  183 ILE A N     
1070 C  CA    . ILE A 135 ? 0.2219 0.2881 0.2276 -0.0359 -0.0374 0.0493  183 ILE A CA    
1071 C  C     . ILE A 135 ? 0.2065 0.2550 0.2130 -0.0341 -0.0283 0.0373  183 ILE A C     
1072 O  O     . ILE A 135 ? 0.2112 0.2391 0.2013 -0.0119 -0.0133 0.0161  183 ILE A O     
1073 C  CB    . ILE A 135 ? 0.2754 0.3095 0.2411 -0.0461 -0.0246 0.0566  183 ILE A CB    
1074 C  CG1   . ILE A 135 ? 0.3092 0.3387 0.2203 -0.0179 0.0303  0.0293  183 ILE A CG1   
1075 C  CG2   . ILE A 135 ? 0.3059 0.3121 0.2732 -0.0716 -0.0365 0.0752  183 ILE A CG2   
1076 C  CD1   . ILE A 135 ? 0.3490 0.3849 0.2368 -0.0350 0.0302  0.0483  183 ILE A CD1   
1077 N  N     . LYS A 136 ? 0.2028 0.2333 0.2378 -0.0391 -0.0165 0.0593  184 LYS A N     
1078 C  CA    . LYS A 136 ? 0.1876 0.2496 0.2427 -0.0174 -0.0335 0.0552  184 LYS A CA    
1079 C  C     . LYS A 136 ? 0.2183 0.2651 0.2202 -0.0287 0.0159  0.0346  184 LYS A C     
1080 O  O     . LYS A 136 ? 0.2285 0.2813 0.2228 -0.0273 0.0038  0.0363  184 LYS A O     
1081 C  CB    . LYS A 136 ? 0.2228 0.2641 0.2540 0.0120  -0.0214 0.0546  184 LYS A CB    
1082 C  CG    . LYS A 136 ? 0.2303 0.2501 0.2678 0.0067  -0.0162 0.0641  184 LYS A CG    
1083 C  CD    . LYS A 136 ? 0.2676 0.2717 0.2899 0.0174  -0.0294 0.0734  184 LYS A CD    
1084 C  CE    . LYS A 136 ? 0.3038 0.2924 0.2927 0.0238  -0.0368 0.0819  184 LYS A CE    
1085 N  NZ    . LYS A 136 ? 0.3517 0.2962 0.2882 0.0429  -0.0422 0.0864  184 LYS A NZ    
1086 N  N     . PRO A 137 ? 0.2470 0.2849 0.2160 -0.0351 0.0046  0.0304  185 PRO A N     
1087 C  CA    . PRO A 137 ? 0.2374 0.2897 0.2085 -0.0200 0.0228  0.0207  185 PRO A CA    
1088 C  C     . PRO A 137 ? 0.2251 0.2942 0.2347 -0.0329 0.0357  0.0294  185 PRO A C     
1089 O  O     . PRO A 137 ? 0.2211 0.3182 0.2536 -0.0234 0.0574  0.0296  185 PRO A O     
1090 C  CB    . PRO A 137 ? 0.2568 0.3090 0.2010 -0.0046 -0.0133 0.0042  185 PRO A CB    
1091 C  CG    . PRO A 137 ? 0.2727 0.3150 0.2181 -0.0001 -0.0108 -0.0039 185 PRO A CG    
1092 C  CD    . PRO A 137 ? 0.2610 0.3006 0.2007 -0.0418 0.0178  -0.0041 185 PRO A CD    
1093 N  N     . PHE A 138 ? 0.1880 0.2726 0.2172 -0.0265 0.0331  0.0398  186 PHE A N     
1094 C  CA    . PHE A 138 ? 0.1987 0.2557 0.2130 -0.0263 -0.0180 0.0272  186 PHE A CA    
1095 C  C     . PHE A 138 ? 0.2341 0.2671 0.2398 -0.0129 -0.0194 0.0085  186 PHE A C     
1096 O  O     . PHE A 138 ? 0.2973 0.2788 0.2816 -0.0006 -0.0584 -0.0027 186 PHE A O     
1097 C  CB    . PHE A 138 ? 0.2078 0.2414 0.2118 -0.0195 -0.0355 0.0370  186 PHE A CB    
1098 C  CG    . PHE A 138 ? 0.2319 0.2488 0.2229 -0.0056 -0.0440 0.0172  186 PHE A CG    
1099 C  CD1   . PHE A 138 ? 0.2665 0.2589 0.2281 -0.0189 -0.0350 -0.0029 186 PHE A CD1   
1100 C  CD2   . PHE A 138 ? 0.2531 0.2442 0.2525 -0.0215 -0.0494 -0.0052 186 PHE A CD2   
1101 C  CE1   . PHE A 138 ? 0.2914 0.2666 0.2640 -0.0285 -0.0266 0.0056  186 PHE A CE1   
1102 C  CE2   . PHE A 138 ? 0.2881 0.2535 0.2772 -0.0292 -0.0390 -0.0210 186 PHE A CE2   
1103 C  CZ    . PHE A 138 ? 0.3105 0.2667 0.2806 -0.0390 -0.0204 -0.0083 186 PHE A CZ    
1104 N  N     . LEU A 139 ? 0.1916 0.2620 0.2288 -0.0068 0.0074  0.0062  187 LEU A N     
1105 C  CA    . LEU A 139 ? 0.1729 0.2650 0.2240 -0.0182 0.0248  0.0126  187 LEU A CA    
1106 C  C     . LEU A 139 ? 0.2249 0.2781 0.2301 -0.0373 0.0286  0.0152  187 LEU A C     
1107 O  O     . LEU A 139 ? 0.2267 0.2905 0.2535 -0.0447 0.0210  0.0025  187 LEU A O     
1108 C  CB    . LEU A 139 ? 0.1711 0.2667 0.2267 0.0075  0.0063  0.0353  187 LEU A CB    
1109 C  CG    . LEU A 139 ? 0.1789 0.2498 0.2163 -0.0017 0.0001  0.0488  187 LEU A CG    
1110 C  CD1   . LEU A 139 ? 0.2184 0.2219 0.2302 0.0295  0.0027  0.0282  187 LEU A CD1   
1111 C  CD2   . LEU A 139 ? 0.2021 0.2374 0.1943 -0.0378 -0.0067 0.0517  187 LEU A CD2   
1112 N  N     . ASP A 140 ? 0.2427 0.2751 0.2183 -0.0355 0.0288  0.0260  188 ASP A N     
1113 C  CA    . ASP A 140 ? 0.2761 0.2734 0.2354 -0.0595 0.0421  0.0325  188 ASP A CA    
1114 C  C     . ASP A 140 ? 0.2835 0.2796 0.2779 -0.0796 0.0650  0.0385  188 ASP A C     
1115 O  O     . ASP A 140 ? 0.2733 0.2904 0.2936 -0.0578 0.0606  0.0265  188 ASP A O     
1116 C  CB    . ASP A 140 ? 0.3189 0.2783 0.2307 -0.0561 0.0379  0.0363  188 ASP A CB    
1117 C  CG    . ASP A 140 ? 0.3456 0.3071 0.2516 -0.0495 0.0389  0.0232  188 ASP A CG    
1118 O  OD1   . ASP A 140 ? 0.3662 0.3281 0.2810 -0.0663 0.0466  0.0386  188 ASP A OD1   
1119 O  OD2   . ASP A 140 ? 0.3685 0.3247 0.2378 -0.0548 0.0608  0.0175  188 ASP A OD2   
1120 N  N     . TYR A 141 ? 0.2901 0.2857 0.3179 -0.1070 0.0743  0.0283  189 TYR A N     
1121 C  CA    . TYR A 141 ? 0.2828 0.3020 0.3472 -0.0908 0.0952  0.0213  189 TYR A CA    
1122 C  C     . TYR A 141 ? 0.2667 0.3399 0.3630 -0.0665 0.0855  0.0100  189 TYR A C     
1123 O  O     . TYR A 141 ? 0.3161 0.3722 0.3849 -0.0714 0.0961  -0.0094 189 TYR A O     
1124 C  CB    . TYR A 141 ? 0.3366 0.3043 0.3611 -0.0773 0.0841  0.0148  189 TYR A CB    
1125 C  CG    . TYR A 141 ? 0.3505 0.3069 0.3493 -0.0990 0.0598  0.0188  189 TYR A CG    
1126 C  CD1   . TYR A 141 ? 0.3601 0.3086 0.3498 -0.1065 0.0523  0.0137  189 TYR A CD1   
1127 C  CD2   . TYR A 141 ? 0.3420 0.3244 0.3572 -0.1041 0.0379  0.0219  189 TYR A CD2   
1128 C  CE1   . TYR A 141 ? 0.3627 0.3040 0.3587 -0.0993 0.0408  0.0174  189 TYR A CE1   
1129 C  CE2   . TYR A 141 ? 0.3518 0.3193 0.3593 -0.0931 0.0323  0.0297  189 TYR A CE2   
1130 C  CZ    . TYR A 141 ? 0.3602 0.3138 0.3625 -0.0899 0.0264  0.0239  189 TYR A CZ    
1131 O  OH    . TYR A 141 ? 0.3681 0.3249 0.3821 -0.0859 -0.0020 0.0241  189 TYR A OH    
1132 N  N     . TYR A 142 ? 0.2699 0.3464 0.3576 -0.0314 0.0444  0.0129  190 TYR A N     
1133 C  CA    . TYR A 142 ? 0.2927 0.3586 0.3727 -0.0424 0.0186  -0.0019 190 TYR A CA    
1134 C  C     . TYR A 142 ? 0.2530 0.3684 0.3810 -0.0470 0.0375  -0.0233 190 TYR A C     
1135 O  O     . TYR A 142 ? 0.2535 0.3538 0.3897 -0.0482 0.0370  -0.0333 190 TYR A O     
1136 C  CB    . TYR A 142 ? 0.3284 0.3749 0.3739 -0.0369 -0.0066 -0.0052 190 TYR A CB    
1137 C  CG    . TYR A 142 ? 0.3681 0.3927 0.3680 -0.0261 -0.0108 0.0035  190 TYR A CG    
1138 C  CD1   . TYR A 142 ? 0.4118 0.4078 0.3657 -0.0234 -0.0172 0.0191  190 TYR A CD1   
1139 C  CD2   . TYR A 142 ? 0.3854 0.4055 0.3628 -0.0265 -0.0303 -0.0057 190 TYR A CD2   
1140 C  CE1   . TYR A 142 ? 0.4317 0.4255 0.3674 -0.0269 -0.0221 0.0248  190 TYR A CE1   
1141 C  CE2   . TYR A 142 ? 0.4281 0.4270 0.3681 -0.0114 -0.0111 0.0075  190 TYR A CE2   
1142 C  CZ    . TYR A 142 ? 0.4457 0.4367 0.3704 -0.0231 -0.0103 0.0374  190 TYR A CZ    
1143 O  OH    . TYR A 142 ? 0.4642 0.4665 0.3807 -0.0374 -0.0153 0.0470  190 TYR A OH    
1144 N  N     . ASP A 143 ? 0.2371 0.3829 0.3948 -0.0164 0.0657  -0.0078 191 ASP A N     
1145 C  CA    . ASP A 143 ? 0.2399 0.4144 0.3799 -0.0344 0.0818  0.0040  191 ASP A CA    
1146 C  C     . ASP A 143 ? 0.2384 0.3899 0.3502 -0.0311 0.0602  0.0026  191 ASP A C     
1147 O  O     . ASP A 143 ? 0.2609 0.4013 0.3482 -0.0530 0.0416  -0.0007 191 ASP A O     
1148 C  CB    . ASP A 143 ? 0.3007 0.4615 0.4123 -0.0558 0.1079  0.0174  191 ASP A CB    
1149 C  CG    . ASP A 143 ? 0.3767 0.5102 0.4402 -0.0730 0.1140  0.0226  191 ASP A CG    
1150 O  OD1   . ASP A 143 ? 0.3984 0.5276 0.4472 -0.0767 0.1061  0.0253  191 ASP A OD1   
1151 O  OD2   . ASP A 143 ? 0.4272 0.5396 0.4623 -0.0692 0.1103  0.0287  191 ASP A OD2   
1152 N  N     . LEU A 144 ? 0.2273 0.3758 0.3306 -0.0241 0.0629  0.0129  192 LEU A N     
1153 C  CA    . LEU A 144 ? 0.2089 0.3567 0.2921 0.0091  0.0586  0.0011  192 LEU A CA    
1154 C  C     . LEU A 144 ? 0.2479 0.3277 0.2608 -0.0062 0.0366  0.0152  192 LEU A C     
1155 O  O     . LEU A 144 ? 0.2844 0.3343 0.2760 -0.0451 0.0525  0.0167  192 LEU A O     
1156 C  CB    . LEU A 144 ? 0.2373 0.3973 0.3037 0.0326  0.0463  -0.0027 192 LEU A CB    
1157 C  CG    . LEU A 144 ? 0.2311 0.4166 0.3094 0.0207  0.0410  0.0055  192 LEU A CG    
1158 C  CD1   . LEU A 144 ? 0.2602 0.4328 0.3287 0.0518  0.0467  -0.0110 192 LEU A CD1   
1159 C  CD2   . LEU A 144 ? 0.2768 0.4182 0.3167 -0.0202 0.0276  0.0172  192 LEU A CD2   
1160 N  N     . VAL A 145 ? 0.2402 0.3181 0.2407 0.0040  0.0256  0.0275  193 VAL A N     
1161 C  CA    . VAL A 145 ? 0.2523 0.2997 0.2358 0.0022  0.0352  0.0221  193 VAL A CA    
1162 C  C     . VAL A 145 ? 0.2990 0.3237 0.2265 -0.0084 0.0410  0.0225  193 VAL A C     
1163 O  O     . VAL A 145 ? 0.2850 0.3294 0.2083 -0.0194 0.0432  0.0298  193 VAL A O     
1164 C  CB    . VAL A 145 ? 0.2531 0.2744 0.2672 0.0047  0.0180  0.0044  193 VAL A CB    
1165 C  CG1   . VAL A 145 ? 0.2765 0.3038 0.2843 0.0066  0.0075  0.0073  193 VAL A CG1   
1166 C  CG2   . VAL A 145 ? 0.2669 0.2533 0.2888 0.0197  0.0190  0.0055  193 VAL A CG2   
1167 N  N     . ASP A 146 ? 0.3360 0.3494 0.2564 -0.0127 0.0163  0.0070  194 ASP A N     
1168 C  CA    . ASP A 146 ? 0.3460 0.3592 0.2653 -0.0360 0.0212  0.0066  194 ASP A CA    
1169 C  C     . ASP A 146 ? 0.3377 0.3460 0.2652 -0.0223 0.0391  -0.0013 194 ASP A C     
1170 O  O     . ASP A 146 ? 0.3869 0.3467 0.2825 -0.0108 0.0361  -0.0014 194 ASP A O     
1171 C  CB    . ASP A 146 ? 0.3902 0.3858 0.2672 -0.0556 0.0109  -0.0007 194 ASP A CB    
1172 C  CG    . ASP A 146 ? 0.4260 0.4115 0.2692 -0.0565 0.0219  0.0016  194 ASP A CG    
1173 O  OD1   . ASP A 146 ? 0.4594 0.4184 0.2833 -0.0580 0.0252  -0.0057 194 ASP A OD1   
1174 O  OD2   . ASP A 146 ? 0.4395 0.4366 0.2709 -0.0446 0.0266  0.0221  194 ASP A OD2   
1175 N  N     . GLY A 147 ? 0.3057 0.3294 0.2543 -0.0232 0.0456  -0.0340 195 GLY A N     
1176 C  CA    . GLY A 147 ? 0.3088 0.3301 0.2797 -0.0114 0.0523  -0.0262 195 GLY A CA    
1177 C  C     . GLY A 147 ? 0.2928 0.3433 0.2963 0.0162  0.0427  -0.0077 195 GLY A C     
1178 O  O     . GLY A 147 ? 0.3126 0.3488 0.3212 0.0377  0.0247  0.0132  195 GLY A O     
1179 N  N     . VAL A 148 ? 0.2434 0.3200 0.2908 -0.0057 0.0484  -0.0189 196 VAL A N     
1180 C  CA    . VAL A 148 ? 0.2408 0.3117 0.2727 -0.0196 0.0552  -0.0121 196 VAL A CA    
1181 C  C     . VAL A 148 ? 0.2224 0.3199 0.2553 -0.0033 0.0411  -0.0051 196 VAL A C     
1182 O  O     . VAL A 148 ? 0.2216 0.3182 0.2277 -0.0025 0.0156  -0.0007 196 VAL A O     
1183 C  CB    . VAL A 148 ? 0.2712 0.2982 0.2650 -0.0339 0.0384  -0.0108 196 VAL A CB    
1184 C  CG1   . VAL A 148 ? 0.2611 0.3187 0.2628 -0.0336 0.0392  0.0117  196 VAL A CG1   
1185 C  CG2   . VAL A 148 ? 0.3284 0.2844 0.2782 -0.0057 0.0060  0.0075  196 VAL A CG2   
1186 N  N     . SER A 149 ? 0.1986 0.3174 0.2549 -0.0139 0.0574  -0.0141 197 SER A N     
1187 C  CA    . SER A 149 ? 0.1651 0.3082 0.2654 -0.0203 0.0401  -0.0146 197 SER A CA    
1188 C  C     . SER A 149 ? 0.1673 0.3004 0.2525 -0.0095 0.0416  0.0142  197 SER A C     
1189 O  O     . SER A 149 ? 0.1798 0.3132 0.2594 0.0027  0.0423  0.0220  197 SER A O     
1190 C  CB    . SER A 149 ? 0.1697 0.3280 0.2747 0.0036  0.0545  -0.0020 197 SER A CB    
1191 O  OG    . SER A 149 ? 0.1894 0.3474 0.2950 0.0184  0.0314  -0.0159 197 SER A OG    
1192 N  N     . TYR A 150 ? 0.1423 0.2974 0.2397 0.0122  0.0404  0.0205  198 TYR A N     
1193 C  CA    . TYR A 150 ? 0.1494 0.2879 0.2400 -0.0010 0.0005  0.0124  198 TYR A CA    
1194 C  C     . TYR A 150 ? 0.1573 0.2869 0.2353 0.0129  -0.0026 0.0148  198 TYR A C     
1195 O  O     . TYR A 150 ? 0.1529 0.2940 0.2365 0.0089  -0.0046 0.0129  198 TYR A O     
1196 C  CB    . TYR A 150 ? 0.1698 0.2730 0.2168 -0.0066 -0.0163 0.0415  198 TYR A CB    
1197 C  CG    . TYR A 150 ? 0.1854 0.2665 0.2123 -0.0276 0.0064  0.0409  198 TYR A CG    
1198 C  CD1   . TYR A 150 ? 0.2010 0.2660 0.2177 -0.0189 0.0117  0.0442  198 TYR A CD1   
1199 C  CD2   . TYR A 150 ? 0.1898 0.2891 0.2263 -0.0313 0.0019  0.0223  198 TYR A CD2   
1200 C  CE1   . TYR A 150 ? 0.1967 0.2872 0.2351 -0.0504 -0.0135 0.0529  198 TYR A CE1   
1201 C  CE2   . TYR A 150 ? 0.2115 0.3141 0.2241 -0.0535 -0.0114 0.0199  198 TYR A CE2   
1202 C  CZ    . TYR A 150 ? 0.2315 0.3112 0.2395 -0.0772 -0.0044 0.0330  198 TYR A CZ    
1203 O  OH    . TYR A 150 ? 0.2616 0.3232 0.2571 -0.0998 -0.0137 0.0443  198 TYR A OH    
1204 N  N     . GLN A 151 ? 0.1602 0.2646 0.2373 -0.0115 -0.0118 0.0165  199 GLN A N     
1205 C  CA    . GLN A 151 ? 0.1757 0.2851 0.2417 -0.0328 0.0220  0.0224  199 GLN A CA    
1206 C  C     . GLN A 151 ? 0.1657 0.3023 0.2303 -0.0114 0.0291  0.0220  199 GLN A C     
1207 O  O     . GLN A 151 ? 0.2099 0.3147 0.2333 -0.0001 0.0064  0.0085  199 GLN A O     
1208 C  CB    . GLN A 151 ? 0.1996 0.3070 0.2682 -0.0325 0.0467  0.0211  199 GLN A CB    
1209 C  CG    . GLN A 151 ? 0.2471 0.3356 0.3119 -0.0334 0.0840  0.0356  199 GLN A CG    
1210 C  CD    . GLN A 151 ? 0.3093 0.3732 0.3644 -0.0212 0.0879  0.0395  199 GLN A CD    
1211 O  OE1   . GLN A 151 ? 0.3375 0.4014 0.3977 0.0204  0.0928  0.0470  199 GLN A OE1   
1212 N  NE2   . GLN A 151 ? 0.3211 0.3716 0.3696 -0.0651 0.0888  0.0291  199 GLN A NE2   
1213 N  N     . LYS A 152 ? 0.1373 0.2963 0.2249 -0.0110 -0.0024 0.0452  200 LYS A N     
1214 C  CA    . LYS A 152 ? 0.1179 0.3012 0.2362 -0.0007 0.0039  0.0422  200 LYS A CA    
1215 C  C     . LYS A 152 ? 0.1358 0.2707 0.2288 -0.0061 0.0054  0.0177  200 LYS A C     
1216 O  O     . LYS A 152 ? 0.1576 0.2862 0.2031 -0.0221 -0.0031 0.0348  200 LYS A O     
1217 C  CB    . LYS A 152 ? 0.0989 0.3138 0.2457 -0.0064 -0.0284 0.0455  200 LYS A CB    
1218 C  CG    . LYS A 152 ? 0.1228 0.3320 0.2795 0.0024  -0.0212 0.0478  200 LYS A CG    
1219 C  CD    . LYS A 152 ? 0.1295 0.3658 0.2960 0.0011  -0.0364 0.0433  200 LYS A CD    
1220 C  CE    . LYS A 152 ? 0.1496 0.3900 0.3379 -0.0031 -0.0584 0.0429  200 LYS A CE    
1221 N  NZ    . LYS A 152 ? 0.1699 0.4129 0.3712 0.0198  -0.0604 0.0289  200 LYS A NZ    
1222 N  N     . ALA A 153 ? 0.1271 0.2315 0.2452 0.0044  -0.0099 0.0165  201 ALA A N     
1223 C  CA    . ALA A 153 ? 0.1289 0.2330 0.2440 0.0033  -0.0059 -0.0027 201 ALA A CA    
1224 C  C     . ALA A 153 ? 0.1287 0.2313 0.2607 -0.0099 0.0231  0.0140  201 ALA A C     
1225 O  O     . ALA A 153 ? 0.1526 0.2522 0.2923 -0.0267 0.0431  0.0225  201 ALA A O     
1226 C  CB    . ALA A 153 ? 0.1516 0.2424 0.2356 -0.0146 -0.0049 -0.0070 201 ALA A CB    
1227 N  N     . MET A 154 ? 0.1095 0.2447 0.2535 0.0085  0.0249  0.0259  202 MET A N     
1228 C  CA    . MET A 154 ? 0.1247 0.2431 0.2238 0.0196  0.0133  0.0435  202 MET A CA    
1229 C  C     . MET A 154 ? 0.1310 0.2252 0.2327 0.0114  0.0035  0.0448  202 MET A C     
1230 O  O     . MET A 154 ? 0.1426 0.1934 0.2530 -0.0068 0.0104  0.0459  202 MET A O     
1231 C  CB    . MET A 154 ? 0.1862 0.2804 0.2038 0.0135  0.0129  0.0453  202 MET A CB    
1232 C  CG    . MET A 154 ? 0.1819 0.3159 0.2032 -0.0025 0.0025  0.0359  202 MET A CG    
1233 S  SD    . MET A 154 ? 0.2219 0.3477 0.2481 -0.0020 -0.0266 0.0025  202 MET A SD    
1234 C  CE    . MET A 154 ? 0.2506 0.3726 0.2891 0.0316  -0.0481 -0.0076 202 MET A CE    
1235 N  N     . PHE A 155 ? 0.1268 0.2354 0.2129 0.0115  -0.0044 0.0449  203 PHE A N     
1236 C  CA    . PHE A 155 ? 0.1263 0.2270 0.1981 -0.0026 0.0016  0.0307  203 PHE A CA    
1237 C  C     . PHE A 155 ? 0.1532 0.1913 0.2308 -0.0097 0.0045  0.0277  203 PHE A C     
1238 O  O     . PHE A 155 ? 0.1786 0.1747 0.2776 -0.0153 0.0514  0.0055  203 PHE A O     
1239 C  CB    . PHE A 155 ? 0.1793 0.2348 0.1823 0.0177  -0.0117 0.0229  203 PHE A CB    
1240 C  CG    . PHE A 155 ? 0.1661 0.2323 0.1855 0.0055  0.0102  0.0030  203 PHE A CG    
1241 C  CD1   . PHE A 155 ? 0.1665 0.2365 0.1876 0.0196  0.0318  0.0033  203 PHE A CD1   
1242 C  CD2   . PHE A 155 ? 0.2192 0.2490 0.1956 -0.0225 0.0157  0.0012  203 PHE A CD2   
1243 C  CE1   . PHE A 155 ? 0.1846 0.2330 0.2027 0.0033  -0.0033 0.0236  203 PHE A CE1   
1244 C  CE2   . PHE A 155 ? 0.2260 0.2420 0.1961 -0.0312 0.0303  0.0195  203 PHE A CE2   
1245 C  CZ    . PHE A 155 ? 0.2127 0.2342 0.1899 -0.0049 0.0061  0.0301  203 PHE A CZ    
1246 N  N     . ILE A 156 ? 0.1399 0.2030 0.2256 0.0229  -0.0088 0.0126  204 ILE A N     
1247 C  CA    . ILE A 156 ? 0.1391 0.2099 0.1931 0.0229  -0.0179 0.0192  204 ILE A CA    
1248 C  C     . ILE A 156 ? 0.1354 0.1999 0.1929 -0.0049 -0.0215 0.0218  204 ILE A C     
1249 O  O     . ILE A 156 ? 0.1652 0.1902 0.2238 -0.0114 -0.0227 0.0227  204 ILE A O     
1250 C  CB    . ILE A 156 ? 0.1487 0.2369 0.1889 0.0290  -0.0205 0.0088  204 ILE A CB    
1251 C  CG1   . ILE A 156 ? 0.1509 0.2715 0.1891 -0.0013 -0.0270 0.0047  204 ILE A CG1   
1252 C  CG2   . ILE A 156 ? 0.1855 0.2346 0.1951 0.0277  0.0039  0.0050  204 ILE A CG2   
1253 C  CD1   . ILE A 156 ? 0.1953 0.2975 0.1919 0.0091  -0.0224 0.0230  204 ILE A CD1   
1254 N  N     . PHE A 157 ? 0.1109 0.2151 0.1846 0.0067  -0.0029 0.0194  205 PHE A N     
1255 C  CA    . PHE A 157 ? 0.1436 0.1921 0.1613 0.0154  0.0107  0.0205  205 PHE A CA    
1256 C  C     . PHE A 157 ? 0.1576 0.1887 0.1820 0.0228  0.0138  0.0111  205 PHE A C     
1257 O  O     . PHE A 157 ? 0.1721 0.2091 0.2246 -0.0102 0.0225  -0.0029 205 PHE A O     
1258 C  CB    . PHE A 157 ? 0.2017 0.2136 0.1549 0.0102  0.0085  0.0135  205 PHE A CB    
1259 C  CG    . PHE A 157 ? 0.2294 0.2508 0.1962 0.0159  0.0248  0.0055  205 PHE A CG    
1260 C  CD1   . PHE A 157 ? 0.2517 0.2937 0.2165 0.0017  0.0381  -0.0250 205 PHE A CD1   
1261 C  CD2   . PHE A 157 ? 0.2507 0.2993 0.2125 -0.0148 0.0264  -0.0127 205 PHE A CD2   
1262 C  CE1   . PHE A 157 ? 0.2409 0.3152 0.2200 0.0028  0.0231  -0.0152 205 PHE A CE1   
1263 C  CE2   . PHE A 157 ? 0.2608 0.3106 0.2058 -0.0090 0.0283  -0.0216 205 PHE A CE2   
1264 C  CZ    . PHE A 157 ? 0.2282 0.3098 0.1988 0.0190  0.0231  -0.0042 205 PHE A CZ    
1265 N  N     . LEU A 158 ? 0.1587 0.1871 0.1603 0.0259  0.0121  0.0015  206 LEU A N     
1266 C  CA    . LEU A 158 ? 0.1537 0.1763 0.1537 0.0217  -0.0022 0.0033  206 LEU A CA    
1267 C  C     . LEU A 158 ? 0.1684 0.1896 0.1549 0.0152  -0.0106 0.0075  206 LEU A C     
1268 O  O     . LEU A 158 ? 0.1887 0.1965 0.1711 0.0066  -0.0111 -0.0222 206 LEU A O     
1269 C  CB    . LEU A 158 ? 0.1692 0.1598 0.1691 0.0184  -0.0038 0.0269  206 LEU A CB    
1270 C  CG    . LEU A 158 ? 0.2005 0.1774 0.1875 -0.0249 -0.0188 0.0291  206 LEU A CG    
1271 C  CD1   . LEU A 158 ? 0.2131 0.2053 0.1848 -0.0415 -0.0064 0.0354  206 LEU A CD1   
1272 C  CD2   . LEU A 158 ? 0.2025 0.1822 0.1831 -0.0303 -0.0157 0.0092  206 LEU A CD2   
1273 N  N     . SER A 159 ? 0.1654 0.2155 0.1523 0.0286  -0.0291 0.0004  207 SER A N     
1274 C  CA    A SER A 159 ? 0.1840 0.2158 0.1652 0.0536  -0.0196 0.0018  207 SER A CA    
1275 C  CA    B SER A 159 ? 0.1861 0.2173 0.1611 0.0428  -0.0382 -0.0015 207 SER A CA    
1276 C  C     . SER A 159 ? 0.1849 0.2219 0.1790 0.0367  -0.0199 -0.0082 207 SER A C     
1277 O  O     . SER A 159 ? 0.1838 0.2301 0.1854 0.0324  -0.0069 -0.0166 207 SER A O     
1278 C  CB    A SER A 159 ? 0.2298 0.2212 0.1524 0.0371  -0.0142 0.0079  207 SER A CB    
1279 C  CB    B SER A 159 ? 0.2175 0.2127 0.1478 0.0399  -0.0636 0.0112  207 SER A CB    
1280 O  OG    A SER A 159 ? 0.2430 0.2119 0.1501 0.0160  0.0022  -0.0026 207 SER A OG    
1281 O  OG    B SER A 159 ? 0.2427 0.2063 0.1485 0.0505  -0.0614 0.0018  207 SER A OG    
1282 N  N     . ASN A 160 ? 0.1646 0.2214 0.1878 0.0294  -0.0101 0.0119  208 ASN A N     
1283 C  CA    . ASN A 160 ? 0.1650 0.2144 0.1978 0.0142  0.0111  0.0411  208 ASN A CA    
1284 C  C     . ASN A 160 ? 0.2202 0.2275 0.2232 0.0029  0.0107  0.0303  208 ASN A C     
1285 O  O     . ASN A 160 ? 0.1900 0.2425 0.2316 0.0311  -0.0077 0.0228  208 ASN A O     
1286 C  CB    . ASN A 160 ? 0.1934 0.2377 0.1960 0.0180  0.0031  0.0475  208 ASN A CB    
1287 C  CG    . ASN A 160 ? 0.2471 0.2369 0.1763 0.0168  -0.0092 0.0310  208 ASN A CG    
1288 O  OD1   . ASN A 160 ? 0.2739 0.2505 0.2018 -0.0175 -0.0094 0.0136  208 ASN A OD1   
1289 N  ND2   . ASN A 160 ? 0.2463 0.2407 0.1436 0.0272  -0.0158 0.0292  208 ASN A ND2   
1290 N  N     . ALA A 161 ? 0.3374 0.2241 0.2228 0.0117  0.0480  0.0604  209 ALA A N     
1291 C  CA    . ALA A 161 ? 0.3845 0.2370 0.2561 0.0063  0.0847  0.0716  209 ALA A CA    
1292 C  C     . ALA A 161 ? 0.3221 0.2357 0.2612 0.0107  0.0467  0.0700  209 ALA A C     
1293 O  O     . ALA A 161 ? 0.2787 0.2675 0.3602 0.0301  0.0312  0.0546  209 ALA A O     
1294 C  CB    . ALA A 161 ? 0.4729 0.2681 0.2706 -0.0025 0.1222  0.0779  209 ALA A CB    
1295 N  N     . GLY A 162 ? 0.3168 0.2228 0.2525 0.0222  0.0222  0.0511  210 GLY A N     
1296 C  CA    . GLY A 162 ? 0.3193 0.2068 0.2298 -0.0073 0.0176  0.0373  210 GLY A CA    
1297 C  C     . GLY A 162 ? 0.2723 0.1909 0.2405 -0.0005 0.0205  0.0194  210 GLY A C     
1298 O  O     . GLY A 162 ? 0.2946 0.1956 0.2710 -0.0046 0.0213  0.0147  210 GLY A O     
1299 N  N     . ALA A 163 ? 0.2607 0.1897 0.2054 -0.0148 0.0158  0.0215  211 ALA A N     
1300 C  CA    . ALA A 163 ? 0.2602 0.1694 0.2212 -0.0173 0.0345  0.0084  211 ALA A CA    
1301 C  C     . ALA A 163 ? 0.2661 0.1932 0.2285 -0.0040 0.0291  0.0104  211 ALA A C     
1302 O  O     . ALA A 163 ? 0.2936 0.1973 0.2226 -0.0264 0.0164  0.0140  211 ALA A O     
1303 C  CB    . ALA A 163 ? 0.2558 0.1886 0.2521 -0.0103 0.0419  0.0138  211 ALA A CB    
1304 N  N     . GLU A 164 ? 0.2899 0.1814 0.2429 0.0179  0.0203  0.0142  212 GLU A N     
1305 C  CA    . GLU A 164 ? 0.3127 0.2201 0.2583 0.0215  0.0023  0.0117  212 GLU A CA    
1306 C  C     . GLU A 164 ? 0.3289 0.2330 0.2491 -0.0013 -0.0079 0.0121  212 GLU A C     
1307 O  O     . GLU A 164 ? 0.3431 0.2356 0.2612 0.0027  -0.0223 0.0035  212 GLU A O     
1308 C  CB    . GLU A 164 ? 0.3198 0.2519 0.2889 0.0795  0.0028  0.0214  212 GLU A CB    
1309 C  CG    . GLU A 164 ? 0.3515 0.3131 0.3344 0.0869  0.0237  0.0111  212 GLU A CG    
1310 C  CD    . GLU A 164 ? 0.3786 0.3668 0.3700 0.1026  0.0374  -0.0016 212 GLU A CD    
1311 O  OE1   . GLU A 164 ? 0.3919 0.4057 0.4155 0.1124  0.0652  -0.0144 212 GLU A OE1   
1312 O  OE2   . GLU A 164 ? 0.3741 0.3837 0.3474 0.0764  0.0181  0.0152  212 GLU A OE2   
1313 N  N     . ARG A 165 ? 0.3136 0.2164 0.2367 -0.0109 -0.0053 0.0339  213 ARG A N     
1314 C  CA    . ARG A 165 ? 0.3413 0.2362 0.2606 -0.0297 0.0150  0.0451  213 ARG A CA    
1315 C  C     . ARG A 165 ? 0.3213 0.1975 0.2600 -0.0160 0.0207  0.0487  213 ARG A C     
1316 O  O     . ARG A 165 ? 0.3281 0.1977 0.2949 -0.0205 0.0235  0.0406  213 ARG A O     
1317 C  CB    . ARG A 165 ? 0.3839 0.3049 0.3012 -0.0268 0.0042  0.0229  213 ARG A CB    
1318 C  CG    . ARG A 165 ? 0.4560 0.3826 0.3757 -0.0371 -0.0291 0.0068  213 ARG A CG    
1319 C  CD    . ARG A 165 ? 0.5475 0.4589 0.4398 -0.0385 -0.0448 0.0119  213 ARG A CD    
1320 N  NE    . ARG A 165 ? 0.6213 0.5298 0.4972 -0.0285 -0.0276 0.0135  213 ARG A NE    
1321 C  CZ    . ARG A 165 ? 0.6696 0.5704 0.5412 -0.0132 -0.0008 0.0186  213 ARG A CZ    
1322 N  NH1   . ARG A 165 ? 0.6951 0.5843 0.5484 -0.0082 0.0254  0.0096  213 ARG A NH1   
1323 N  NH2   . ARG A 165 ? 0.6701 0.5821 0.5609 -0.0088 0.0022  0.0321  213 ARG A NH2   
1324 N  N     . ILE A 166 ? 0.3017 0.1945 0.2256 0.0014  0.0158  0.0727  214 ILE A N     
1325 C  CA    . ILE A 166 ? 0.2890 0.2055 0.2349 -0.0069 0.0013  0.0486  214 ILE A CA    
1326 C  C     . ILE A 166 ? 0.2910 0.2079 0.2538 -0.0062 -0.0024 0.0316  214 ILE A C     
1327 O  O     . ILE A 166 ? 0.3238 0.2042 0.2424 -0.0124 0.0013  0.0204  214 ILE A O     
1328 C  CB    . ILE A 166 ? 0.2863 0.1744 0.2288 -0.0002 -0.0112 0.0355  214 ILE A CB    
1329 C  CG1   . ILE A 166 ? 0.2987 0.1723 0.2627 0.0057  -0.0110 0.0348  214 ILE A CG1   
1330 C  CG2   . ILE A 166 ? 0.2935 0.1911 0.2233 0.0004  -0.0090 0.0268  214 ILE A CG2   
1331 C  CD1   . ILE A 166 ? 0.2890 0.1497 0.2638 0.0306  -0.0080 0.0488  214 ILE A CD1   
1332 N  N     . THR A 167 ? 0.2762 0.2032 0.2729 0.0042  0.0199  0.0391  215 THR A N     
1333 C  CA    . THR A 167 ? 0.2575 0.2135 0.2755 -0.0184 0.0291  0.0285  215 THR A CA    
1334 C  C     . THR A 167 ? 0.2953 0.2108 0.2778 0.0209  0.0352  0.0161  215 THR A C     
1335 O  O     . THR A 167 ? 0.3088 0.1915 0.2900 0.0147  0.0157  0.0017  215 THR A O     
1336 C  CB    . THR A 167 ? 0.2852 0.2299 0.3176 -0.0144 0.0320  0.0063  215 THR A CB    
1337 O  OG1   . THR A 167 ? 0.3319 0.2198 0.3445 -0.0029 0.0219  -0.0185 215 THR A OG1   
1338 C  CG2   . THR A 167 ? 0.2743 0.2540 0.3394 0.0010  0.0244  -0.0199 215 THR A CG2   
1339 N  N     . ASP A 168 ? 0.3119 0.2054 0.2974 0.0481  0.0541  0.0441  216 ASP A N     
1340 C  CA    . ASP A 168 ? 0.3608 0.2303 0.3232 0.0436  0.0239  0.0522  216 ASP A CA    
1341 C  C     . ASP A 168 ? 0.3609 0.2161 0.3099 0.0210  0.0449  0.0282  216 ASP A C     
1342 O  O     . ASP A 168 ? 0.3788 0.2211 0.3077 0.0270  0.0531  0.0044  216 ASP A O     
1343 C  CB    . ASP A 168 ? 0.4090 0.2764 0.3701 0.0403  -0.0098 0.0649  216 ASP A CB    
1344 C  CG    . ASP A 168 ? 0.5024 0.3429 0.4333 0.0167  -0.0057 0.0645  216 ASP A CG    
1345 O  OD1   . ASP A 168 ? 0.4973 0.3628 0.4705 0.0094  0.0044  0.0708  216 ASP A OD1   
1346 O  OD2   . ASP A 168 ? 0.5607 0.3684 0.4501 0.0278  -0.0303 0.0474  216 ASP A OD2   
1347 N  N     . VAL A 169 ? 0.3500 0.2255 0.3039 -0.0103 0.0524  0.0288  217 VAL A N     
1348 C  CA    . VAL A 169 ? 0.3366 0.2234 0.3013 -0.0218 0.0480  0.0217  217 VAL A CA    
1349 C  C     . VAL A 169 ? 0.3238 0.2083 0.3155 -0.0423 0.0382  0.0319  217 VAL A C     
1350 O  O     . VAL A 169 ? 0.3511 0.2274 0.3522 -0.0321 0.0300  0.0277  217 VAL A O     
1351 C  CB    . VAL A 169 ? 0.3455 0.2205 0.2978 -0.0396 0.0403  0.0277  217 VAL A CB    
1352 C  CG1   . VAL A 169 ? 0.3471 0.2193 0.3149 -0.0292 0.0189  0.0090  217 VAL A CG1   
1353 C  CG2   . VAL A 169 ? 0.3902 0.2320 0.3016 -0.0368 0.0603  0.0304  217 VAL A CG2   
1354 N  N     . ALA A 170 ? 0.2885 0.1896 0.3098 -0.0475 0.0209  0.0443  218 ALA A N     
1355 C  CA    . ALA A 170 ? 0.2826 0.1825 0.3096 -0.0163 0.0181  0.0214  218 ALA A CA    
1356 C  C     . ALA A 170 ? 0.3094 0.1956 0.3155 -0.0177 0.0177  0.0051  218 ALA A C     
1357 O  O     . ALA A 170 ? 0.3382 0.2113 0.3135 0.0062  0.0144  -0.0163 218 ALA A O     
1358 C  CB    . ALA A 170 ? 0.2995 0.1782 0.2923 0.0032  -0.0041 0.0273  218 ALA A CB    
1359 N  N     . LEU A 171 ? 0.3197 0.2177 0.3159 0.0005  0.0141  0.0256  219 LEU A N     
1360 C  CA    . LEU A 171 ? 0.3518 0.2389 0.3415 0.0040  0.0014  0.0027  219 LEU A CA    
1361 C  C     . LEU A 171 ? 0.3714 0.2198 0.3697 -0.0081 0.0123  -0.0093 219 LEU A C     
1362 O  O     . LEU A 171 ? 0.3954 0.2109 0.3697 -0.0001 0.0210  -0.0192 219 LEU A O     
1363 C  CB    . LEU A 171 ? 0.3563 0.2893 0.3407 0.0406  -0.0114 0.0131  219 LEU A CB    
1364 C  CG    . LEU A 171 ? 0.3885 0.3437 0.3560 0.0129  -0.0221 0.0351  219 LEU A CG    
1365 C  CD1   . LEU A 171 ? 0.3758 0.3663 0.3722 -0.0230 0.0109  0.0441  219 LEU A CD1   
1366 C  CD2   . LEU A 171 ? 0.4098 0.3625 0.3528 0.0267  -0.0433 0.0349  219 LEU A CD2   
1367 N  N     . ASP A 172 ? 0.3762 0.2110 0.3874 -0.0245 0.0224  -0.0030 220 ASP A N     
1368 C  CA    . ASP A 172 ? 0.4184 0.2528 0.4325 -0.0483 0.0305  -0.0086 220 ASP A CA    
1369 C  C     . ASP A 172 ? 0.4165 0.2299 0.4210 -0.0486 0.0406  -0.0285 220 ASP A C     
1370 O  O     . ASP A 172 ? 0.4321 0.2267 0.4293 -0.0347 0.0482  -0.0271 220 ASP A O     
1371 C  CB    . ASP A 172 ? 0.4929 0.3202 0.4927 -0.0707 0.0424  0.0086  220 ASP A CB    
1372 C  CG    . ASP A 172 ? 0.5729 0.4244 0.5468 -0.0541 0.0622  0.0101  220 ASP A CG    
1373 O  OD1   . ASP A 172 ? 0.6188 0.4614 0.5739 -0.0671 0.0588  0.0191  220 ASP A OD1   
1374 O  OD2   . ASP A 172 ? 0.5983 0.5012 0.5599 -0.0417 0.0697  0.0067  220 ASP A OD2   
1375 N  N     . PHE A 173 ? 0.3771 0.2171 0.4021 -0.0573 0.0395  -0.0348 221 PHE A N     
1376 C  CA    . PHE A 173 ? 0.3711 0.2089 0.4089 -0.0383 0.0347  -0.0403 221 PHE A CA    
1377 C  C     . PHE A 173 ? 0.3882 0.2177 0.4082 -0.0581 0.0165  -0.0439 221 PHE A C     
1378 O  O     . PHE A 173 ? 0.4300 0.2388 0.4224 -0.0610 0.0085  -0.0392 221 PHE A O     
1379 C  CB    . PHE A 173 ? 0.3702 0.2048 0.4151 -0.0269 0.0337  -0.0398 221 PHE A CB    
1380 C  CG    . PHE A 173 ? 0.3601 0.2086 0.4294 -0.0619 0.0290  -0.0471 221 PHE A CG    
1381 C  CD1   . PHE A 173 ? 0.3669 0.2278 0.4381 -0.0522 0.0381  -0.0067 221 PHE A CD1   
1382 C  CD2   . PHE A 173 ? 0.3527 0.2269 0.4375 -0.0721 0.0276  -0.0486 221 PHE A CD2   
1383 C  CE1   . PHE A 173 ? 0.3715 0.2396 0.4400 -0.0479 0.0399  -0.0144 221 PHE A CE1   
1384 C  CE2   . PHE A 173 ? 0.3687 0.2253 0.4344 -0.0574 0.0468  -0.0417 221 PHE A CE2   
1385 C  CZ    . PHE A 173 ? 0.3804 0.2299 0.4459 -0.0515 0.0417  -0.0229 221 PHE A CZ    
1386 N  N     . TRP A 174 ? 0.3322 0.2157 0.4030 -0.0595 0.0148  -0.0544 222 TRP A N     
1387 C  CA    . TRP A 174 ? 0.3568 0.2367 0.4105 -0.0429 0.0173  -0.0850 222 TRP A CA    
1388 C  C     . TRP A 174 ? 0.3836 0.2644 0.4254 -0.0174 0.0335  -0.1087 222 TRP A C     
1389 O  O     . TRP A 174 ? 0.3902 0.2800 0.4265 -0.0395 0.0349  -0.1102 222 TRP A O     
1390 C  CB    . TRP A 174 ? 0.3641 0.2686 0.4190 -0.0614 0.0339  -0.0832 222 TRP A CB    
1391 C  CG    . TRP A 174 ? 0.3840 0.3002 0.4346 -0.0593 0.0289  -0.0928 222 TRP A CG    
1392 C  CD1   . TRP A 174 ? 0.3952 0.3375 0.4440 -0.0543 0.0355  -0.0952 222 TRP A CD1   
1393 C  CD2   . TRP A 174 ? 0.3918 0.3162 0.4553 -0.0549 0.0162  -0.1089 222 TRP A CD2   
1394 N  NE1   . TRP A 174 ? 0.3993 0.3490 0.4531 -0.0542 0.0327  -0.0899 222 TRP A NE1   
1395 C  CE2   . TRP A 174 ? 0.3885 0.3338 0.4614 -0.0507 0.0299  -0.1057 222 TRP A CE2   
1396 C  CE3   . TRP A 174 ? 0.4078 0.3436 0.4708 -0.0488 0.0150  -0.1155 222 TRP A CE3   
1397 C  CZ2   . TRP A 174 ? 0.4153 0.3517 0.4771 -0.0527 0.0263  -0.0953 222 TRP A CZ2   
1398 C  CZ3   . TRP A 174 ? 0.4232 0.3551 0.4787 -0.0589 0.0231  -0.1115 222 TRP A CZ3   
1399 C  CH2   . TRP A 174 ? 0.4283 0.3642 0.4837 -0.0546 0.0256  -0.0944 222 TRP A CH2   
1400 N  N     . ARG A 175 ? 0.4159 0.2725 0.4509 -0.0068 0.0367  -0.1079 223 ARG A N     
1401 C  CA    . ARG A 175 ? 0.4620 0.2923 0.4814 -0.0020 0.0177  -0.1028 223 ARG A CA    
1402 C  C     . ARG A 175 ? 0.4968 0.3071 0.5043 -0.0092 0.0213  -0.1087 223 ARG A C     
1403 O  O     . ARG A 175 ? 0.5122 0.3103 0.5102 0.0066  0.0265  -0.1233 223 ARG A O     
1404 C  CB    . ARG A 175 ? 0.4589 0.3075 0.4912 0.0119  -0.0202 -0.0861 223 ARG A CB    
1405 C  CG    . ARG A 175 ? 0.4799 0.3265 0.5012 0.0326  -0.0379 -0.0821 223 ARG A CG    
1406 C  CD    . ARG A 175 ? 0.5110 0.3661 0.5178 0.0559  -0.0425 -0.0765 223 ARG A CD    
1407 N  NE    . ARG A 175 ? 0.5613 0.4119 0.5375 0.0762  -0.0489 -0.0731 223 ARG A NE    
1408 C  CZ    . ARG A 175 ? 0.6013 0.4718 0.5535 0.0589  -0.0440 -0.0647 223 ARG A CZ    
1409 N  NH1   . ARG A 175 ? 0.6052 0.4933 0.5623 0.0507  -0.0512 -0.0649 223 ARG A NH1   
1410 N  NH2   . ARG A 175 ? 0.6254 0.4985 0.5571 0.0524  -0.0390 -0.0587 223 ARG A NH2   
1411 N  N     . SER A 176 ? 0.5083 0.3145 0.5190 -0.0271 0.0140  -0.0992 224 SER A N     
1412 C  CA    . SER A 176 ? 0.5376 0.3435 0.5298 -0.0664 0.0122  -0.0948 224 SER A CA    
1413 C  C     . SER A 176 ? 0.5459 0.3460 0.5360 -0.0715 0.0211  -0.1008 224 SER A C     
1414 O  O     . SER A 176 ? 0.5652 0.3483 0.5520 -0.0873 0.0241  -0.1073 224 SER A O     
1415 C  CB    . SER A 176 ? 0.5632 0.3736 0.5304 -0.0958 0.0145  -0.0825 224 SER A CB    
1416 O  OG    . SER A 176 ? 0.5946 0.3900 0.5393 -0.0906 0.0229  -0.0669 224 SER A OG    
1417 N  N     . GLY A 177 ? 0.5371 0.3426 0.5190 -0.0525 0.0222  -0.0949 225 GLY A N     
1418 C  CA    . GLY A 177 ? 0.5376 0.3527 0.4981 -0.0346 -0.0007 -0.1131 225 GLY A CA    
1419 C  C     . GLY A 177 ? 0.5434 0.3684 0.4819 -0.0245 -0.0269 -0.1174 225 GLY A C     
1420 O  O     . GLY A 177 ? 0.5567 0.3919 0.4830 -0.0267 -0.0476 -0.1329 225 GLY A O     
1421 N  N     . LYS A 178 ? 0.5224 0.3420 0.4630 -0.0112 -0.0268 -0.1090 226 LYS A N     
1422 C  CA    . LYS A 178 ? 0.5147 0.3412 0.4504 -0.0206 -0.0267 -0.0755 226 LYS A CA    
1423 C  C     . LYS A 178 ? 0.4877 0.3085 0.4091 -0.0388 -0.0271 -0.0753 226 LYS A C     
1424 O  O     . LYS A 178 ? 0.4921 0.3075 0.4029 -0.0375 -0.0259 -0.0615 226 LYS A O     
1425 C  CB    . LYS A 178 ? 0.5387 0.3830 0.4759 -0.0013 -0.0235 -0.0379 226 LYS A CB    
1426 C  CG    . LYS A 178 ? 0.5734 0.4219 0.5028 0.0038  -0.0220 -0.0101 226 LYS A CG    
1427 C  CD    . LYS A 178 ? 0.6089 0.4668 0.5296 0.0140  -0.0252 0.0056  226 LYS A CD    
1428 C  CE    . LYS A 178 ? 0.6326 0.5072 0.5511 0.0240  -0.0269 0.0118  226 LYS A CE    
1429 N  NZ    . LYS A 178 ? 0.6449 0.5264 0.5680 0.0303  -0.0214 0.0142  226 LYS A NZ    
1430 N  N     . GLN A 179 ? 0.4694 0.2967 0.3796 -0.0431 -0.0294 -0.0835 227 GLN A N     
1431 C  CA    . GLN A 179 ? 0.4555 0.3125 0.3662 -0.0491 -0.0332 -0.0710 227 GLN A CA    
1432 C  C     . GLN A 179 ? 0.4259 0.2538 0.3498 -0.0685 -0.0203 -0.0521 227 GLN A C     
1433 O  O     . GLN A 179 ? 0.4437 0.2451 0.3556 -0.0455 0.0046  -0.0297 227 GLN A O     
1434 C  CB    . GLN A 179 ? 0.5062 0.3911 0.3781 -0.0543 -0.0462 -0.0800 227 GLN A CB    
1435 C  CG    . GLN A 179 ? 0.5419 0.4587 0.3949 -0.0488 -0.0577 -0.0716 227 GLN A CG    
1436 C  CD    . GLN A 179 ? 0.5775 0.5126 0.4166 -0.0497 -0.0542 -0.0638 227 GLN A CD    
1437 O  OE1   . GLN A 179 ? 0.6060 0.5497 0.4172 -0.0359 -0.0546 -0.0526 227 GLN A OE1   
1438 N  NE2   . GLN A 179 ? 0.5686 0.5289 0.4223 -0.0613 -0.0407 -0.0667 227 GLN A NE2   
1439 N  N     . ARG A 180 ? 0.3865 0.2317 0.3354 -0.0773 -0.0420 -0.0686 228 ARG A N     
1440 C  CA    . ARG A 180 ? 0.3408 0.2227 0.3189 -0.0830 -0.0245 -0.0520 228 ARG A CA    
1441 C  C     . ARG A 180 ? 0.3467 0.2387 0.3228 -0.0829 -0.0081 -0.0551 228 ARG A C     
1442 O  O     . ARG A 180 ? 0.3338 0.2302 0.3096 -0.0920 0.0056  -0.0507 228 ARG A O     
1443 C  CB    . ARG A 180 ? 0.3316 0.2343 0.3040 -0.0623 -0.0173 -0.0208 228 ARG A CB    
1444 C  CG    . ARG A 180 ? 0.3063 0.2004 0.2846 -0.0652 -0.0287 -0.0142 228 ARG A CG    
1445 C  CD    . ARG A 180 ? 0.2984 0.1973 0.2597 -0.0538 -0.0244 -0.0073 228 ARG A CD    
1446 N  NE    . ARG A 180 ? 0.2731 0.1981 0.2578 -0.0556 -0.0134 -0.0141 228 ARG A NE    
1447 C  CZ    . ARG A 180 ? 0.2567 0.2030 0.2399 -0.0390 -0.0095 -0.0388 228 ARG A CZ    
1448 N  NH1   . ARG A 180 ? 0.2396 0.2009 0.2462 -0.0372 -0.0126 -0.0254 228 ARG A NH1   
1449 N  NH2   . ARG A 180 ? 0.2422 0.1778 0.2141 -0.0469 0.0114  -0.0409 228 ARG A NH2   
1450 N  N     . GLU A 181 ? 0.3513 0.2663 0.3506 -0.0896 -0.0191 -0.0601 229 GLU A N     
1451 C  CA    . GLU A 181 ? 0.3744 0.3230 0.3717 -0.0753 -0.0165 -0.0606 229 GLU A CA    
1452 C  C     . GLU A 181 ? 0.3814 0.3388 0.3868 -0.1060 -0.0060 -0.0911 229 GLU A C     
1453 O  O     . GLU A 181 ? 0.3836 0.3586 0.3942 -0.0859 -0.0003 -0.1002 229 GLU A O     
1454 C  CB    . GLU A 181 ? 0.4116 0.3586 0.4068 -0.0414 -0.0179 -0.0455 229 GLU A CB    
1455 C  CG    . GLU A 181 ? 0.4676 0.3981 0.4429 -0.0253 -0.0157 -0.0381 229 GLU A CG    
1456 C  CD    . GLU A 181 ? 0.5328 0.4388 0.4740 -0.0274 -0.0121 -0.0325 229 GLU A CD    
1457 O  OE1   . GLU A 181 ? 0.5746 0.4729 0.5019 -0.0070 0.0023  -0.0327 229 GLU A OE1   
1458 O  OE2   . GLU A 181 ? 0.5371 0.4443 0.4631 -0.0192 -0.0323 -0.0316 229 GLU A OE2   
1459 N  N     . ASP A 182 ? 0.3948 0.3304 0.3880 -0.1366 0.0105  -0.0941 230 ASP A N     
1460 C  CA    . ASP A 182 ? 0.4264 0.3525 0.4055 -0.1331 0.0154  -0.0976 230 ASP A CA    
1461 C  C     . ASP A 182 ? 0.3973 0.3237 0.3830 -0.1326 0.0177  -0.0690 230 ASP A C     
1462 O  O     . ASP A 182 ? 0.4036 0.3282 0.4028 -0.1151 0.0137  -0.0623 230 ASP A O     
1463 C  CB    . ASP A 182 ? 0.4781 0.4070 0.4450 -0.1417 0.0177  -0.0886 230 ASP A CB    
1464 C  CG    . ASP A 182 ? 0.5214 0.4762 0.4777 -0.1414 0.0186  -0.0793 230 ASP A CG    
1465 O  OD1   . ASP A 182 ? 0.5431 0.5060 0.4951 -0.1424 0.0242  -0.0926 230 ASP A OD1   
1466 O  OD2   . ASP A 182 ? 0.5366 0.5003 0.4870 -0.1540 0.0111  -0.0618 230 ASP A OD2   
1467 N  N     . ILE A 183 ? 0.3682 0.2807 0.3546 -0.1383 0.0080  -0.0677 231 ILE A N     
1468 C  CA    . ILE A 183 ? 0.3458 0.2597 0.3404 -0.1141 0.0280  -0.0384 231 ILE A CA    
1469 C  C     . ILE A 183 ? 0.3516 0.2832 0.3475 -0.0996 0.0380  -0.0038 231 ILE A C     
1470 O  O     . ILE A 183 ? 0.3563 0.2959 0.3413 -0.0762 0.0286  0.0127  231 ILE A O     
1471 C  CB    . ILE A 183 ? 0.3487 0.2279 0.3275 -0.1102 0.0182  -0.0660 231 ILE A CB    
1472 C  CG1   . ILE A 183 ? 0.3291 0.2205 0.3379 -0.1065 0.0186  -0.0599 231 ILE A CG1   
1473 C  CG2   . ILE A 183 ? 0.3899 0.2430 0.3333 -0.0882 0.0153  -0.0813 231 ILE A CG2   
1474 C  CD1   . ILE A 183 ? 0.3113 0.2246 0.3354 -0.0904 0.0092  -0.0556 231 ILE A CD1   
1475 N  N     . LYS A 184 ? 0.3692 0.3015 0.3709 -0.1123 0.0573  0.0156  232 LYS A N     
1476 C  CA    . LYS A 184 ? 0.3655 0.3033 0.3925 -0.1016 0.0683  0.0086  232 LYS A CA    
1477 C  C     . LYS A 184 ? 0.3636 0.2650 0.3958 -0.1097 0.0774  0.0209  232 LYS A C     
1478 O  O     . LYS A 184 ? 0.3732 0.2599 0.3926 -0.1196 0.0683  0.0198  232 LYS A O     
1479 C  CB    . LYS A 184 ? 0.4174 0.3461 0.4207 -0.0812 0.0508  -0.0262 232 LYS A CB    
1480 C  CG    . LYS A 184 ? 0.4844 0.4038 0.4535 -0.0709 0.0354  -0.0473 232 LYS A CG    
1481 C  CD    . LYS A 184 ? 0.5373 0.4576 0.4837 -0.0687 0.0187  -0.0493 232 LYS A CD    
1482 C  CE    . LYS A 184 ? 0.5723 0.4988 0.5072 -0.0725 0.0074  -0.0729 232 LYS A CE    
1483 N  NZ    . LYS A 184 ? 0.6006 0.5282 0.5155 -0.0724 -0.0092 -0.0828 232 LYS A NZ    
1484 N  N     . LEU A 185 ? 0.3750 0.2635 0.3998 -0.0857 0.0840  0.0142  233 LEU A N     
1485 C  CA    . LEU A 185 ? 0.3743 0.2690 0.4185 -0.0631 0.0637  0.0028  233 LEU A CA    
1486 C  C     . LEU A 185 ? 0.3649 0.2627 0.4171 -0.0788 0.0617  0.0151  233 LEU A C     
1487 O  O     . LEU A 185 ? 0.3534 0.2645 0.4053 -0.0861 0.0364  0.0251  233 LEU A O     
1488 C  CB    . LEU A 185 ? 0.3634 0.2776 0.4410 -0.0435 0.0459  -0.0107 233 LEU A CB    
1489 C  CG    . LEU A 185 ? 0.3717 0.2853 0.4681 -0.0664 0.0474  -0.0246 233 LEU A CG    
1490 C  CD1   . LEU A 185 ? 0.3616 0.2785 0.4774 -0.1020 0.0502  -0.0306 233 LEU A CD1   
1491 C  CD2   . LEU A 185 ? 0.3879 0.3093 0.4807 -0.0517 0.0515  -0.0367 233 LEU A CD2   
1492 N  N     . LYS A 186 ? 0.3919 0.2822 0.4325 -0.0768 0.0636  0.0121  234 LYS A N     
1493 C  CA    . LYS A 186 ? 0.4108 0.3051 0.4367 -0.1081 0.0530  0.0270  234 LYS A CA    
1494 C  C     . LYS A 186 ? 0.4243 0.2858 0.4089 -0.0851 0.0562  0.0400  234 LYS A C     
1495 O  O     . LYS A 186 ? 0.4274 0.2973 0.4180 -0.0721 0.0534  0.0513  234 LYS A O     
1496 C  CB    . LYS A 186 ? 0.4375 0.3626 0.4690 -0.1181 0.0508  0.0264  234 LYS A CB    
1497 C  CG    . LYS A 186 ? 0.4919 0.4153 0.5051 -0.1281 0.0342  0.0415  234 LYS A CG    
1498 C  CD    . LYS A 186 ? 0.5453 0.4656 0.5410 -0.1184 0.0324  0.0461  234 LYS A CD    
1499 C  CE    . LYS A 186 ? 0.5805 0.5008 0.5558 -0.1132 0.0271  0.0469  234 LYS A CE    
1500 N  NZ    . LYS A 186 ? 0.6095 0.5156 0.5620 -0.1092 0.0200  0.0440  234 LYS A NZ    
1501 N  N     . ASP A 187 ? 0.4366 0.2712 0.3833 -0.0827 0.0411  0.0276  235 ASP A N     
1502 C  CA    . ASP A 187 ? 0.4597 0.2617 0.3626 -0.0611 0.0180  0.0300  235 ASP A CA    
1503 C  C     . ASP A 187 ? 0.4450 0.2426 0.3443 -0.0444 0.0161  0.0427  235 ASP A C     
1504 O  O     . ASP A 187 ? 0.4631 0.2376 0.3465 -0.0419 0.0223  0.0403  235 ASP A O     
1505 C  CB    . ASP A 187 ? 0.4979 0.2666 0.3875 -0.0760 0.0017  0.0272  235 ASP A CB    
1506 C  CG    . ASP A 187 ? 0.5313 0.2687 0.4183 -0.0830 -0.0013 0.0452  235 ASP A CG    
1507 O  OD1   . ASP A 187 ? 0.5802 0.2691 0.4452 -0.0702 -0.0255 0.0506  235 ASP A OD1   
1508 O  OD2   . ASP A 187 ? 0.5183 0.2797 0.4063 -0.0776 0.0112  0.0416  235 ASP A OD2   
1509 N  N     . ILE A 188 ? 0.4149 0.2249 0.3330 -0.0476 0.0221  0.0442  236 ILE A N     
1510 C  CA    . ILE A 188 ? 0.3946 0.2377 0.3371 -0.0221 0.0126  0.0333  236 ILE A CA    
1511 C  C     . ILE A 188 ? 0.3884 0.2393 0.3569 -0.0272 0.0116  0.0434  236 ILE A C     
1512 O  O     . ILE A 188 ? 0.3749 0.2408 0.3427 -0.0433 -0.0032 0.0332  236 ILE A O     
1513 C  CB    . ILE A 188 ? 0.3908 0.2639 0.3358 -0.0366 0.0046  0.0411  236 ILE A CB    
1514 C  CG1   . ILE A 188 ? 0.4144 0.3052 0.3580 -0.0118 -0.0084 0.0237  236 ILE A CG1   
1515 C  CG2   . ILE A 188 ? 0.3821 0.2533 0.3289 -0.0502 0.0052  0.0594  236 ILE A CG2   
1516 C  CD1   . ILE A 188 ? 0.4077 0.3155 0.3574 -0.0005 -0.0010 0.0432  236 ILE A CD1   
1517 N  N     . GLU A 189 ? 0.3940 0.2590 0.3768 -0.0297 0.0494  0.0474  237 GLU A N     
1518 C  CA    . GLU A 189 ? 0.4075 0.3096 0.4022 -0.0132 0.0620  0.0616  237 GLU A CA    
1519 C  C     . GLU A 189 ? 0.4045 0.3352 0.4025 0.0054  0.0574  0.0703  237 GLU A C     
1520 O  O     . GLU A 189 ? 0.3968 0.3472 0.4062 -0.0037 0.0494  0.0723  237 GLU A O     
1521 C  CB    . GLU A 189 ? 0.4179 0.3289 0.4311 0.0109  0.0684  0.0485  237 GLU A CB    
1522 C  CG    . GLU A 189 ? 0.4442 0.3464 0.4820 0.0195  0.0702  0.0243  237 GLU A CG    
1523 C  CD    . GLU A 189 ? 0.4992 0.3678 0.5397 0.0127  0.0714  0.0094  237 GLU A CD    
1524 O  OE1   . GLU A 189 ? 0.5357 0.3730 0.5690 -0.0030 0.0606  0.0159  237 GLU A OE1   
1525 O  OE2   . GLU A 189 ? 0.4915 0.3753 0.5547 0.0280  0.0771  -0.0056 237 GLU A OE2   
1526 N  N     . HIS A 190 ? 0.4386 0.3378 0.4097 0.0168  0.0370  0.0861  238 HIS A N     
1527 C  CA    . HIS A 190 ? 0.4926 0.3645 0.4263 0.0251  0.0380  0.0734  238 HIS A CA    
1528 C  C     . HIS A 190 ? 0.4820 0.3410 0.3885 0.0284  0.0482  0.0774  238 HIS A C     
1529 O  O     . HIS A 190 ? 0.5141 0.3339 0.3861 0.0235  0.0422  0.0873  238 HIS A O     
1530 C  CB    . HIS A 190 ? 0.5594 0.4173 0.4676 0.0386  0.0333  0.0653  238 HIS A CB    
1531 C  CG    . HIS A 190 ? 0.6308 0.4923 0.5209 0.0427  0.0431  0.0581  238 HIS A CG    
1532 N  ND1   . HIS A 190 ? 0.6702 0.5263 0.5442 0.0395  0.0302  0.0613  238 HIS A ND1   
1533 C  CD2   . HIS A 190 ? 0.6519 0.5173 0.5438 0.0396  0.0547  0.0601  238 HIS A CD2   
1534 C  CE1   . HIS A 190 ? 0.6735 0.5369 0.5508 0.0372  0.0353  0.0647  238 HIS A CE1   
1535 N  NE2   . HIS A 190 ? 0.6679 0.5344 0.5544 0.0375  0.0497  0.0631  238 HIS A NE2   
1536 N  N     . ALA A 191 ? 0.4464 0.3194 0.3589 0.0151  0.0708  0.0659  239 ALA A N     
1537 C  CA    . ALA A 191 ? 0.4397 0.3103 0.3539 0.0224  0.0682  0.0513  239 ALA A CA    
1538 C  C     . ALA A 191 ? 0.4482 0.3320 0.3699 0.0154  0.0427  0.0691  239 ALA A C     
1539 O  O     . ALA A 191 ? 0.4436 0.3560 0.3813 0.0309  0.0309  0.0663  239 ALA A O     
1540 C  CB    . ALA A 191 ? 0.4297 0.3008 0.3540 0.0405  0.0564  0.0475  239 ALA A CB    
1541 N  N     . LEU A 192 ? 0.4485 0.3109 0.3659 0.0071  0.0409  0.0822  240 LEU A N     
1542 C  CA    . LEU A 192 ? 0.4618 0.3254 0.3734 -0.0088 0.0348  0.0713  240 LEU A CA    
1543 C  C     . LEU A 192 ? 0.5033 0.3780 0.4043 -0.0301 0.0648  0.0645  240 LEU A C     
1544 O  O     . LEU A 192 ? 0.5342 0.3885 0.4269 -0.0466 0.0668  0.0838  240 LEU A O     
1545 C  CB    . LEU A 192 ? 0.4477 0.2977 0.3668 0.0125  0.0088  0.0466  240 LEU A CB    
1546 C  CG    . LEU A 192 ? 0.4523 0.2970 0.3751 0.0242  -0.0139 0.0352  240 LEU A CG    
1547 C  CD1   . LEU A 192 ? 0.4928 0.2877 0.3802 0.0264  -0.0335 0.0317  240 LEU A CD1   
1548 C  CD2   . LEU A 192 ? 0.4660 0.3200 0.3923 0.0335  0.0079  0.0415  240 LEU A CD2   
1549 N  N     . SER A 193 ? 0.5178 0.4121 0.4245 -0.0413 0.0789  0.0626  241 SER A N     
1550 C  CA    . SER A 193 ? 0.5587 0.4692 0.4680 -0.0271 0.0818  0.0596  241 SER A CA    
1551 C  C     . SER A 193 ? 0.5718 0.5224 0.5009 -0.0149 0.0782  0.0536  241 SER A C     
1552 O  O     . SER A 193 ? 0.5626 0.5253 0.4912 -0.0008 0.0805  0.0566  241 SER A O     
1553 C  CB    . SER A 193 ? 0.5953 0.4808 0.4856 -0.0220 0.0900  0.0562  241 SER A CB    
1554 O  OG    . SER A 193 ? 0.6444 0.4996 0.5012 -0.0129 0.0827  0.0554  241 SER A OG    
1555 N  N     . VAL A 194 ? 0.5892 0.5643 0.5374 0.0052  0.0578  0.0411  242 VAL A N     
1556 C  CA    . VAL A 194 ? 0.6104 0.5954 0.5605 0.0068  0.0575  0.0276  242 VAL A CA    
1557 C  C     . VAL A 194 ? 0.6029 0.6146 0.5378 0.0100  0.0443  0.0214  242 VAL A C     
1558 O  O     . VAL A 194 ? 0.5936 0.6233 0.5283 0.0180  0.0250  0.0229  242 VAL A O     
1559 C  CB    . VAL A 194 ? 0.6267 0.6050 0.5962 0.0074  0.0739  0.0180  242 VAL A CB    
1560 C  CG1   . VAL A 194 ? 0.6459 0.6109 0.6130 0.0096  0.0813  0.0215  242 VAL A CG1   
1561 C  CG2   . VAL A 194 ? 0.6294 0.6108 0.6085 0.0102  0.0722  0.0111  242 VAL A CG2   
1562 N  N     . SER A 195 ? 0.6006 0.6190 0.5156 -0.0028 0.0557  0.0271  243 SER A N     
1563 C  CA    . SER A 195 ? 0.5975 0.6221 0.4971 -0.0055 0.0519  0.0360  243 SER A CA    
1564 C  C     . SER A 195 ? 0.6011 0.6130 0.4918 -0.0013 0.0505  0.0364  243 SER A C     
1565 O  O     . SER A 195 ? 0.6005 0.6186 0.4766 0.0014  0.0691  0.0398  243 SER A O     
1566 C  CB    . SER A 195 ? 0.6011 0.6310 0.4878 -0.0163 0.0335  0.0462  243 SER A CB    
1567 O  OG    . SER A 195 ? 0.5976 0.6250 0.4648 -0.0148 0.0254  0.0488  243 SER A OG    
1568 N  N     . VAL A 196 ? 0.5955 0.5936 0.4958 -0.0068 0.0418  0.0365  244 VAL A N     
1569 C  CA    . VAL A 196 ? 0.6002 0.5823 0.5112 -0.0116 0.0273  0.0389  244 VAL A CA    
1570 C  C     . VAL A 196 ? 0.5950 0.5793 0.5156 -0.0025 0.0237  0.0592  244 VAL A C     
1571 O  O     . VAL A 196 ? 0.5908 0.5695 0.5007 0.0026  0.0290  0.0666  244 VAL A O     
1572 C  CB    . VAL A 196 ? 0.6105 0.5832 0.5289 -0.0150 0.0058  0.0185  244 VAL A CB    
1573 C  CG1   . VAL A 196 ? 0.6143 0.5862 0.5386 -0.0121 -0.0072 0.0096  244 VAL A CG1   
1574 C  CG2   . VAL A 196 ? 0.6089 0.5798 0.5287 -0.0287 0.0025  0.0156  244 VAL A CG2   
1575 N  N     . PHE A 197 ? 0.5949 0.5795 0.5282 -0.0050 0.0247  0.0818  245 PHE A N     
1576 C  CA    . PHE A 197 ? 0.6180 0.5964 0.5498 0.0014  0.0157  0.0835  245 PHE A CA    
1577 C  C     . PHE A 197 ? 0.6262 0.5975 0.5458 -0.0093 0.0153  0.0962  245 PHE A C     
1578 O  O     . PHE A 197 ? 0.6246 0.6006 0.5403 -0.0214 0.0204  0.0953  245 PHE A O     
1579 C  CB    . PHE A 197 ? 0.6289 0.6085 0.5762 0.0175  0.0088  0.0725  245 PHE A CB    
1580 C  CG    . PHE A 197 ? 0.6487 0.6188 0.5999 0.0331  0.0101  0.0582  245 PHE A CG    
1581 C  CD1   . PHE A 197 ? 0.6591 0.6235 0.6090 0.0429  0.0109  0.0530  245 PHE A CD1   
1582 C  CD2   . PHE A 197 ? 0.6430 0.6212 0.6057 0.0357  0.0198  0.0473  245 PHE A CD2   
1583 C  CE1   . PHE A 197 ? 0.6575 0.6220 0.6167 0.0478  0.0099  0.0534  245 PHE A CE1   
1584 C  CE2   . PHE A 197 ? 0.6460 0.6193 0.6161 0.0378  0.0191  0.0474  245 PHE A CE2   
1585 C  CZ    . PHE A 197 ? 0.6520 0.6210 0.6189 0.0452  0.0188  0.0502  245 PHE A CZ    
1586 N  N     . ASN A 198 ? 0.6363 0.5988 0.5491 -0.0125 0.0163  0.1079  246 ASN A N     
1587 C  CA    . ASN A 198 ? 0.6379 0.5999 0.5454 -0.0124 0.0182  0.1150  246 ASN A CA    
1588 C  C     . ASN A 198 ? 0.6578 0.6130 0.5614 -0.0201 0.0223  0.1185  246 ASN A C     
1589 O  O     . ASN A 198 ? 0.6374 0.5952 0.5476 -0.0284 0.0295  0.1356  246 ASN A O     
1590 C  CB    . ASN A 198 ? 0.6271 0.5927 0.5329 -0.0061 0.0188  0.1061  246 ASN A CB    
1591 C  CG    . ASN A 198 ? 0.6121 0.5830 0.5144 0.0037  0.0220  0.1064  246 ASN A CG    
1592 O  OD1   . ASN A 198 ? 0.6057 0.5692 0.5108 0.0131  0.0248  0.0989  246 ASN A OD1   
1593 N  ND2   . ASN A 198 ? 0.6014 0.5822 0.5016 0.0177  0.0274  0.1126  246 ASN A ND2   
1594 N  N     . ASN A 199 ? 0.6943 0.6355 0.5896 -0.0147 0.0208  0.1091  247 ASN A N     
1595 C  CA    . ASN A 199 ? 0.7267 0.6582 0.6159 -0.0084 0.0150  0.1003  247 ASN A CA    
1596 C  C     . ASN A 199 ? 0.7179 0.6602 0.6116 0.0028  0.0120  0.1096  247 ASN A C     
1597 O  O     . ASN A 199 ? 0.7132 0.6588 0.6027 0.0161  0.0158  0.1184  247 ASN A O     
1598 C  CB    . ASN A 199 ? 0.7632 0.6748 0.6460 -0.0119 0.0111  0.0865  247 ASN A CB    
1599 C  CG    . ASN A 199 ? 0.7905 0.6931 0.6686 -0.0009 0.0062  0.0745  247 ASN A CG    
1600 O  OD1   . ASN A 199 ? 0.7931 0.6986 0.6797 -0.0016 0.0052  0.0670  247 ASN A OD1   
1601 N  ND2   . ASN A 199 ? 0.7962 0.6960 0.6714 0.0089  0.0057  0.0742  247 ASN A ND2   
1602 N  N     . LYS A 200 ? 0.7101 0.6628 0.6190 0.0044  0.0046  0.1024  248 LYS A N     
1603 C  CA    . LYS A 200 ? 0.7028 0.6678 0.6358 0.0064  -0.0024 0.0795  248 LYS A CA    
1604 C  C     . LYS A 200 ? 0.6814 0.6568 0.6383 0.0066  -0.0078 0.0691  248 LYS A C     
1605 O  O     . LYS A 200 ? 0.6625 0.6470 0.6323 0.0157  -0.0140 0.0704  248 LYS A O     
1606 C  CB    . LYS A 200 ? 0.7089 0.6828 0.6522 0.0092  0.0006  0.0659  248 LYS A CB    
1607 C  CG    . LYS A 200 ? 0.7195 0.6987 0.6707 0.0069  0.0012  0.0549  248 LYS A CG    
1608 C  CD    . LYS A 200 ? 0.7273 0.7129 0.6880 0.0054  0.0008  0.0469  248 LYS A CD    
1609 C  CE    . LYS A 200 ? 0.7379 0.7257 0.7027 0.0077  0.0010  0.0446  248 LYS A CE    
1610 N  NZ    . LYS A 200 ? 0.7495 0.7338 0.7117 0.0151  -0.0015 0.0440  248 LYS A NZ    
1611 N  N     . ASN A 201 ? 0.6789 0.6522 0.6441 0.0002  0.0003  0.0606  249 ASN A N     
1612 C  CA    . ASN A 201 ? 0.6777 0.6444 0.6529 -0.0055 0.0081  0.0461  249 ASN A CA    
1613 C  C     . ASN A 201 ? 0.6582 0.6091 0.6375 -0.0254 -0.0078 0.0417  249 ASN A C     
1614 O  O     . ASN A 201 ? 0.6445 0.5937 0.6291 -0.0212 -0.0160 0.0399  249 ASN A O     
1615 C  CB    . ASN A 201 ? 0.6993 0.6653 0.6724 -0.0004 0.0255  0.0307  249 ASN A CB    
1616 C  CG    . ASN A 201 ? 0.7176 0.6852 0.6892 0.0024  0.0372  0.0166  249 ASN A CG    
1617 O  OD1   . ASN A 201 ? 0.7223 0.6908 0.6948 0.0070  0.0416  0.0065  249 ASN A OD1   
1618 N  ND2   . ASN A 201 ? 0.7255 0.6921 0.7000 0.0020  0.0412  0.0183  249 ASN A ND2   
1619 N  N     . SER A 202 ? 0.6470 0.5720 0.6289 -0.0396 -0.0132 0.0456  250 SER A N     
1620 C  CA    . SER A 202 ? 0.6367 0.5447 0.6151 -0.0503 -0.0211 0.0448  250 SER A CA    
1621 C  C     . SER A 202 ? 0.6032 0.4948 0.5888 -0.0465 -0.0406 0.0666  250 SER A C     
1622 O  O     . SER A 202 ? 0.5826 0.4927 0.6030 -0.0306 -0.0458 0.0716  250 SER A O     
1623 C  CB    . SER A 202 ? 0.6541 0.5627 0.6237 -0.0601 -0.0225 0.0299  250 SER A CB    
1624 O  OG    . SER A 202 ? 0.6628 0.5743 0.6299 -0.0681 -0.0301 0.0215  250 SER A OG    
1625 N  N     . GLY A 203 ? 0.5768 0.4420 0.5350 -0.0447 -0.0602 0.0884  251 GLY A N     
1626 C  CA    . GLY A 203 ? 0.5407 0.3949 0.4864 -0.0542 -0.0711 0.1048  251 GLY A CA    
1627 C  C     . GLY A 203 ? 0.4906 0.3588 0.4398 -0.0550 -0.0878 0.1239  251 GLY A C     
1628 O  O     . GLY A 203 ? 0.4802 0.3683 0.4289 -0.0819 -0.0927 0.1324  251 GLY A O     
1629 N  N     . PHE A 204 ? 0.4519 0.3289 0.4010 -0.0312 -0.0937 0.1270  252 PHE A N     
1630 C  CA    . PHE A 204 ? 0.4096 0.3117 0.3801 -0.0369 -0.0665 0.1061  252 PHE A CA    
1631 C  C     . PHE A 204 ? 0.4008 0.3160 0.3579 -0.0418 -0.0610 0.0754  252 PHE A C     
1632 O  O     . PHE A 204 ? 0.4089 0.2969 0.3540 -0.0504 -0.0680 0.0607  252 PHE A O     
1633 C  CB    . PHE A 204 ? 0.3820 0.2921 0.3827 -0.0294 -0.0459 0.1044  252 PHE A CB    
1634 C  CG    . PHE A 204 ? 0.3797 0.2972 0.3665 -0.0194 -0.0340 0.1014  252 PHE A CG    
1635 C  CD1   . PHE A 204 ? 0.3933 0.2950 0.3686 -0.0245 -0.0217 0.0876  252 PHE A CD1   
1636 C  CD2   . PHE A 204 ? 0.3843 0.3124 0.3455 -0.0276 -0.0073 0.0836  252 PHE A CD2   
1637 C  CE1   . PHE A 204 ? 0.3936 0.3089 0.3492 -0.0463 -0.0134 0.0957  252 PHE A CE1   
1638 C  CE2   . PHE A 204 ? 0.3954 0.3152 0.3453 -0.0384 -0.0081 0.0730  252 PHE A CE2   
1639 C  CZ    . PHE A 204 ? 0.3863 0.3193 0.3385 -0.0416 -0.0121 0.0967  252 PHE A CZ    
1640 N  N     . TRP A 205 ? 0.3781 0.3149 0.3254 -0.0639 -0.0560 0.0548  253 TRP A N     
1641 C  CA    . TRP A 205 ? 0.3678 0.3241 0.2903 -0.0525 -0.0440 0.0421  253 TRP A CA    
1642 C  C     . TRP A 205 ? 0.3760 0.3312 0.2787 -0.0490 -0.0365 0.0622  253 TRP A C     
1643 O  O     . TRP A 205 ? 0.3751 0.3468 0.2681 -0.0655 -0.0484 0.0611  253 TRP A O     
1644 C  CB    . TRP A 205 ? 0.3546 0.3161 0.2915 -0.0621 -0.0229 0.0237  253 TRP A CB    
1645 C  CG    . TRP A 205 ? 0.3532 0.2960 0.3094 -0.0316 -0.0003 0.0062  253 TRP A CG    
1646 C  CD1   . TRP A 205 ? 0.3565 0.2947 0.3311 -0.0299 0.0232  -0.0026 253 TRP A CD1   
1647 C  CD2   . TRP A 205 ? 0.3287 0.2683 0.2939 -0.0204 -0.0209 0.0176  253 TRP A CD2   
1648 N  NE1   . TRP A 205 ? 0.3676 0.2818 0.3243 -0.0100 0.0253  0.0006  253 TRP A NE1   
1649 C  CE2   . TRP A 205 ? 0.3575 0.2776 0.3027 -0.0145 -0.0269 0.0104  253 TRP A CE2   
1650 C  CE3   . TRP A 205 ? 0.3531 0.2637 0.2943 -0.0262 -0.0468 0.0062  253 TRP A CE3   
1651 C  CZ2   . TRP A 205 ? 0.3238 0.2704 0.2892 -0.0257 -0.0264 0.0213  253 TRP A CZ2   
1652 C  CZ3   . TRP A 205 ? 0.3488 0.2651 0.2967 -0.0327 -0.0504 0.0049  253 TRP A CZ3   
1653 C  CH2   . TRP A 205 ? 0.3308 0.2703 0.2922 -0.0204 -0.0427 0.0063  253 TRP A CH2   
1654 N  N     . HIS A 206 ? 0.3994 0.3422 0.2923 -0.0551 -0.0044 0.0726  254 HIS A N     
1655 C  CA    . HIS A 206 ? 0.4134 0.3624 0.3153 -0.0530 -0.0077 0.0989  254 HIS A CA    
1656 C  C     . HIS A 206 ? 0.4098 0.3622 0.3166 -0.0661 0.0058  0.0924  254 HIS A C     
1657 O  O     . HIS A 206 ? 0.4271 0.3366 0.3233 -0.0737 -0.0090 0.0937  254 HIS A O     
1658 C  CB    . HIS A 206 ? 0.4400 0.3880 0.3382 -0.0616 -0.0319 0.1070  254 HIS A CB    
1659 C  CG    . HIS A 206 ? 0.4811 0.4183 0.4003 -0.0809 -0.0213 0.0863  254 HIS A CG    
1660 N  ND1   . HIS A 206 ? 0.4898 0.4320 0.4344 -0.0907 -0.0168 0.0767  254 HIS A ND1   
1661 C  CD2   . HIS A 206 ? 0.5056 0.4329 0.4345 -0.0972 -0.0149 0.0744  254 HIS A CD2   
1662 C  CE1   . HIS A 206 ? 0.5207 0.4383 0.4467 -0.0948 -0.0135 0.0690  254 HIS A CE1   
1663 N  NE2   . HIS A 206 ? 0.5241 0.4375 0.4521 -0.0990 -0.0163 0.0660  254 HIS A NE2   
1664 N  N     . SER A 207 ? 0.3782 0.3783 0.3164 -0.0568 0.0406  0.0898  255 SER A N     
1665 C  CA    . SER A 207 ? 0.3970 0.3814 0.3265 -0.0597 0.0333  0.0808  255 SER A CA    
1666 C  C     . SER A 207 ? 0.4263 0.4064 0.3217 -0.0537 0.0435  0.1006  255 SER A C     
1667 O  O     . SER A 207 ? 0.4506 0.3976 0.3420 -0.0586 0.0413  0.0973  255 SER A O     
1668 C  CB    . SER A 207 ? 0.3834 0.3652 0.3396 -0.0674 0.0470  0.0629  255 SER A CB    
1669 O  OG    . SER A 207 ? 0.3953 0.3537 0.3369 -0.0997 0.0684  0.0719  255 SER A OG    
1670 N  N     . SER A 208 ? 0.4304 0.4437 0.3023 -0.0597 0.0515  0.1083  256 SER A N     
1671 C  CA    . SER A 208 ? 0.4606 0.4882 0.3029 -0.0646 0.0702  0.1015  256 SER A CA    
1672 C  C     . SER A 208 ? 0.4991 0.5190 0.3260 -0.0586 0.0742  0.1026  256 SER A C     
1673 O  O     . SER A 208 ? 0.5529 0.5267 0.3303 -0.0470 0.0639  0.0992  256 SER A O     
1674 C  CB    . SER A 208 ? 0.4747 0.5155 0.3243 -0.0724 0.0603  0.0699  256 SER A CB    
1675 O  OG    . SER A 208 ? 0.5112 0.5369 0.3503 -0.0739 0.0461  0.0507  256 SER A OG    
1676 N  N     . LEU A 209 ? 0.4887 0.5339 0.3511 -0.0531 0.0961  0.1159  257 LEU A N     
1677 C  CA    . LEU A 209 ? 0.4913 0.5460 0.3831 -0.0471 0.1235  0.1268  257 LEU A CA    
1678 C  C     . LEU A 209 ? 0.4921 0.5466 0.4157 -0.0782 0.1386  0.1453  257 LEU A C     
1679 O  O     . LEU A 209 ? 0.4974 0.5648 0.4247 -0.0696 0.1450  0.1435  257 LEU A O     
1680 C  CB    . LEU A 209 ? 0.5117 0.5530 0.3858 -0.0149 0.1173  0.1199  257 LEU A CB    
1681 C  CG    . LEU A 209 ? 0.5547 0.5639 0.4014 -0.0001 0.1096  0.0981  257 LEU A CG    
1682 C  CD1   . LEU A 209 ? 0.5655 0.5672 0.4004 0.0128  0.1120  0.0766  257 LEU A CD1   
1683 C  CD2   . LEU A 209 ? 0.5637 0.5653 0.4066 0.0030  0.1080  0.0956  257 LEU A CD2   
1684 N  N     . ILE A 210 ? 0.4940 0.5384 0.4430 -0.1157 0.1245  0.1531  258 ILE A N     
1685 C  CA    . ILE A 210 ? 0.5040 0.5251 0.4723 -0.1246 0.0878  0.1531  258 ILE A CA    
1686 C  C     . ILE A 210 ? 0.5169 0.5034 0.4896 -0.1494 0.0696  0.1665  258 ILE A C     
1687 O  O     . ILE A 210 ? 0.5012 0.5040 0.4853 -0.1615 0.0731  0.1725  258 ILE A O     
1688 C  CB    . ILE A 210 ? 0.4955 0.5209 0.4820 -0.1255 0.0720  0.1534  258 ILE A CB    
1689 C  CG1   . ILE A 210 ? 0.4861 0.5009 0.4758 -0.1366 0.0651  0.1704  258 ILE A CG1   
1690 C  CG2   . ILE A 210 ? 0.5018 0.5275 0.5024 -0.1106 0.0573  0.1353  258 ILE A CG2   
1691 C  CD1   . ILE A 210 ? 0.4726 0.4939 0.4791 -0.1377 0.0604  0.1716  258 ILE A CD1   
1692 N  N     . ASP A 211 ? 0.5423 0.4814 0.5085 -0.1681 0.0556  0.1593  259 ASP A N     
1693 C  CA    . ASP A 211 ? 0.5691 0.4564 0.5242 -0.1699 0.0405  0.1519  259 ASP A CA    
1694 C  C     . ASP A 211 ? 0.5646 0.4295 0.5160 -0.1867 0.0385  0.1396  259 ASP A C     
1695 O  O     . ASP A 211 ? 0.5987 0.4184 0.5318 -0.2005 0.0468  0.1481  259 ASP A O     
1696 C  CB    . ASP A 211 ? 0.5988 0.4713 0.5496 -0.1526 0.0259  0.1480  259 ASP A CB    
1697 C  CG    . ASP A 211 ? 0.6252 0.4855 0.5760 -0.1392 0.0147  0.1408  259 ASP A CG    
1698 O  OD1   . ASP A 211 ? 0.6245 0.4853 0.5771 -0.1324 -0.0041 0.1460  259 ASP A OD1   
1699 O  OD2   . ASP A 211 ? 0.6550 0.5038 0.5958 -0.1234 0.0038  0.1233  259 ASP A OD2   
1700 N  N     . ARG A 212 ? 0.5083 0.4029 0.4870 -0.1910 0.0336  0.1410  260 ARG A N     
1701 C  CA    . ARG A 212 ? 0.4612 0.4091 0.4577 -0.1689 0.0364  0.1175  260 ARG A CA    
1702 C  C     . ARG A 212 ? 0.4344 0.3733 0.4109 -0.1277 0.0294  0.0978  260 ARG A C     
1703 O  O     . ARG A 212 ? 0.4329 0.3737 0.3912 -0.1073 0.0202  0.1029  260 ARG A O     
1704 C  CB    . ARG A 212 ? 0.4876 0.4503 0.4857 -0.1732 0.0379  0.1014  260 ARG A CB    
1705 C  CG    . ARG A 212 ? 0.5315 0.4906 0.5123 -0.1509 0.0394  0.0867  260 ARG A CG    
1706 C  CD    . ARG A 212 ? 0.5784 0.5316 0.5349 -0.1226 0.0407  0.0754  260 ARG A CD    
1707 N  NE    . ARG A 212 ? 0.6259 0.5762 0.5665 -0.1008 0.0204  0.0579  260 ARG A NE    
1708 C  CZ    . ARG A 212 ? 0.6515 0.6044 0.5847 -0.0944 0.0163  0.0416  260 ARG A CZ    
1709 N  NH1   . ARG A 212 ? 0.6566 0.6166 0.5993 -0.0835 0.0255  0.0235  260 ARG A NH1   
1710 N  NH2   . ARG A 212 ? 0.6688 0.6124 0.5812 -0.0914 0.0113  0.0423  260 ARG A NH2   
1711 N  N     . ASN A 213 ? 0.4241 0.3460 0.3764 -0.0799 0.0292  0.0715  261 ASN A N     
1712 C  CA    . ASN A 213 ? 0.3930 0.3284 0.3345 -0.0515 0.0282  0.0420  261 ASN A CA    
1713 C  C     . ASN A 213 ? 0.3580 0.2951 0.2913 -0.0481 0.0246  0.0402  261 ASN A C     
1714 O  O     . ASN A 213 ? 0.3582 0.2871 0.3157 -0.0635 0.0320  0.0181  261 ASN A O     
1715 C  CB    . ASN A 213 ? 0.3952 0.3451 0.3429 -0.0126 0.0272  0.0338  261 ASN A CB    
1716 C  CG    . ASN A 213 ? 0.4242 0.3609 0.3376 0.0214  0.0130  0.0577  261 ASN A CG    
1717 O  OD1   . ASN A 213 ? 0.4088 0.3538 0.2978 0.0372  0.0055  0.0880  261 ASN A OD1   
1718 N  ND2   . ASN A 213 ? 0.4595 0.3823 0.3689 0.0290  0.0171  0.0575  261 ASN A ND2   
1719 N  N     . LEU A 214 ? 0.3211 0.2589 0.2416 -0.0542 0.0099  0.0542  262 LEU A N     
1720 C  CA    . LEU A 214 ? 0.2605 0.2532 0.1957 -0.0371 0.0177  0.0476  262 LEU A CA    
1721 C  C     . LEU A 214 ? 0.2409 0.2536 0.2035 -0.0291 0.0273  0.0325  262 LEU A C     
1722 O  O     . LEU A 214 ? 0.2552 0.2660 0.2217 -0.0113 0.0165  0.0465  262 LEU A O     
1723 C  CB    . LEU A 214 ? 0.2818 0.2826 0.2027 -0.0463 0.0241  0.0321  262 LEU A CB    
1724 C  CG    . LEU A 214 ? 0.2686 0.3005 0.2016 -0.0354 0.0304  0.0277  262 LEU A CG    
1725 C  CD1   . LEU A 214 ? 0.3106 0.3114 0.2167 -0.0291 -0.0015 0.0241  262 LEU A CD1   
1726 C  CD2   . LEU A 214 ? 0.2986 0.3140 0.2242 -0.0052 0.0591  0.0268  262 LEU A CD2   
1727 N  N     A ILE A 215 ? 0.2291 0.2478 0.2094 -0.0160 0.0277  0.0182  263 ILE A N     
1728 N  N     B ILE A 215 ? 0.2360 0.2400 0.2092 -0.0301 0.0172  0.0131  263 ILE A N     
1729 C  CA    A ILE A 215 ? 0.2213 0.2536 0.2251 -0.0043 0.0230  0.0266  263 ILE A CA    
1730 C  CA    B ILE A 215 ? 0.2336 0.2322 0.2220 -0.0309 0.0050  0.0050  263 ILE A CA    
1731 C  C     A ILE A 215 ? 0.2344 0.2452 0.2329 -0.0228 0.0208  0.0283  263 ILE A C     
1732 C  C     B ILE A 215 ? 0.2441 0.2282 0.2244 -0.0357 0.0109  0.0162  263 ILE A C     
1733 O  O     A ILE A 215 ? 0.2665 0.2520 0.2556 -0.0308 0.0309  0.0277  263 ILE A O     
1734 O  O     B ILE A 215 ? 0.2712 0.2141 0.2266 -0.0389 0.0228  0.0257  263 ILE A O     
1735 C  CB    A ILE A 215 ? 0.2203 0.2667 0.2279 0.0080  0.0297  0.0316  263 ILE A CB    
1736 C  CB    B ILE A 215 ? 0.2251 0.2263 0.2279 -0.0319 -0.0091 -0.0171 263 ILE A CB    
1737 C  CG1   A ILE A 215 ? 0.2150 0.2842 0.2475 -0.0033 0.0109  0.0403  263 ILE A CG1   
1738 C  CG1   B ILE A 215 ? 0.2092 0.2230 0.2416 -0.0345 -0.0340 -0.0363 263 ILE A CG1   
1739 C  CG2   A ILE A 215 ? 0.2378 0.2713 0.2263 0.0212  0.0342  0.0319  263 ILE A CG2   
1740 C  CG2   B ILE A 215 ? 0.2357 0.2295 0.2275 -0.0289 -0.0117 -0.0186 263 ILE A CG2   
1741 C  CD1   A ILE A 215 ? 0.2070 0.2978 0.2481 -0.0327 0.0174  0.0454  263 ILE A CD1   
1742 C  CD1   B ILE A 215 ? 0.2172 0.2071 0.2442 -0.0352 -0.0543 -0.0650 263 ILE A CD1   
1743 N  N     . ASP A 216 ? 0.2193 0.2424 0.2241 -0.0492 0.0168  0.0126  264 ASP A N     
1744 C  CA    . ASP A 216 ? 0.2254 0.2475 0.2525 -0.0425 0.0274  0.0009  264 ASP A CA    
1745 C  C     . ASP A 216 ? 0.2292 0.2393 0.2497 -0.0380 0.0304  -0.0199 264 ASP A C     
1746 O  O     . ASP A 216 ? 0.2665 0.2316 0.2668 -0.0806 0.0369  -0.0266 264 ASP A O     
1747 C  CB    . ASP A 216 ? 0.2184 0.2542 0.2509 -0.0295 0.0400  0.0169  264 ASP A CB    
1748 C  CG    . ASP A 216 ? 0.2421 0.2587 0.2785 -0.0318 0.0774  0.0327  264 ASP A CG    
1749 O  OD1   . ASP A 216 ? 0.2972 0.2769 0.3101 -0.0229 0.1011  0.0230  264 ASP A OD1   
1750 O  OD2   . ASP A 216 ? 0.2554 0.2634 0.2825 -0.0555 0.0500  0.0288  264 ASP A OD2   
1751 N  N     . TYR A 217 ? 0.1953 0.2406 0.2440 -0.0260 0.0260  -0.0262 265 TYR A N     
1752 C  CA    . TYR A 217 ? 0.2217 0.2439 0.2433 -0.0340 0.0121  -0.0380 265 TYR A CA    
1753 C  C     . TYR A 217 ? 0.2331 0.2126 0.2329 -0.0380 0.0332  -0.0242 265 TYR A C     
1754 O  O     . TYR A 217 ? 0.2353 0.2028 0.2377 -0.0520 0.0242  -0.0259 265 TYR A O     
1755 C  CB    . TYR A 217 ? 0.2025 0.3016 0.2590 -0.0384 -0.0164 -0.0414 265 TYR A CB    
1756 C  CG    . TYR A 217 ? 0.2129 0.3374 0.2701 -0.0882 -0.0194 -0.0318 265 TYR A CG    
1757 C  CD1   . TYR A 217 ? 0.2356 0.3600 0.3155 -0.1055 -0.0060 -0.0403 265 TYR A CD1   
1758 C  CD2   . TYR A 217 ? 0.2264 0.3542 0.2592 -0.0736 -0.0209 -0.0065 265 TYR A CD2   
1759 C  CE1   . TYR A 217 ? 0.2577 0.3891 0.3577 -0.0858 -0.0118 -0.0543 265 TYR A CE1   
1760 C  CE2   . TYR A 217 ? 0.2418 0.3696 0.2986 -0.0632 0.0010  -0.0301 265 TYR A CE2   
1761 C  CZ    . TYR A 217 ? 0.2513 0.3977 0.3597 -0.0904 -0.0026 -0.0447 265 TYR A CZ    
1762 O  OH    . TYR A 217 ? 0.2757 0.4298 0.4090 -0.0919 -0.0145 -0.0462 265 TYR A OH    
1763 N  N     A PHE A 218 ? 0.2371 0.2148 0.2396 -0.0290 0.0432  -0.0002 266 PHE A N     
1764 N  N     B PHE A 218 ? 0.2336 0.2228 0.2405 -0.0326 0.0416  -0.0100 266 PHE A N     
1765 C  CA    A PHE A 218 ? 0.2614 0.2012 0.2262 -0.0059 0.0529  0.0175  266 PHE A CA    
1766 C  CA    B PHE A 218 ? 0.2453 0.2208 0.2299 -0.0173 0.0455  -0.0056 266 PHE A CA    
1767 C  C     A PHE A 218 ? 0.2590 0.2010 0.2217 -0.0341 0.0410  0.0015  266 PHE A C     
1768 C  C     B PHE A 218 ? 0.2235 0.2186 0.2218 -0.0411 0.0325  -0.0090 266 PHE A C     
1769 O  O     A PHE A 218 ? 0.2960 0.1861 0.2523 -0.0314 0.0711  0.0019  266 PHE A O     
1770 O  O     B PHE A 218 ? 0.2157 0.2269 0.2491 -0.0544 0.0405  -0.0086 266 PHE A O     
1771 C  CB    A PHE A 218 ? 0.2745 0.1995 0.2434 0.0129  0.0442  0.0436  266 PHE A CB    
1772 C  CB    B PHE A 218 ? 0.2598 0.2248 0.2405 -0.0155 0.0369  0.0045  266 PHE A CB    
1773 C  CG    A PHE A 218 ? 0.2792 0.2087 0.2516 0.0259  0.0584  0.0575  266 PHE A CG    
1774 C  CG    B PHE A 218 ? 0.2513 0.2351 0.2554 -0.0272 0.0300  0.0077  266 PHE A CG    
1775 C  CD1   A PHE A 218 ? 0.2774 0.2211 0.2532 0.0365  0.0387  0.0738  266 PHE A CD1   
1776 C  CD1   B PHE A 218 ? 0.2373 0.2522 0.2670 -0.0232 0.0357  0.0281  266 PHE A CD1   
1777 C  CD2   A PHE A 218 ? 0.3086 0.2199 0.2614 0.0119  0.0563  0.0654  266 PHE A CD2   
1778 C  CD2   B PHE A 218 ? 0.2633 0.2323 0.2586 -0.0563 0.0271  0.0219  266 PHE A CD2   
1779 C  CE1   A PHE A 218 ? 0.2693 0.2126 0.2537 0.0459  0.0388  0.0928  266 PHE A CE1   
1780 C  CE1   B PHE A 218 ? 0.1980 0.2477 0.2617 -0.0178 0.0566  0.0427  266 PHE A CE1   
1781 C  CE2   A PHE A 218 ? 0.3075 0.2238 0.2495 0.0248  0.0255  0.0834  266 PHE A CE2   
1782 C  CE2   B PHE A 218 ? 0.1954 0.2198 0.2349 -0.0768 0.0835  0.0428  266 PHE A CE2   
1783 C  CZ    A PHE A 218 ? 0.2841 0.2245 0.2497 0.0289  0.0237  0.0983  266 PHE A CZ    
1784 C  CZ    B PHE A 218 ? 0.2019 0.2494 0.2579 -0.0375 0.0576  0.0459  266 PHE A CZ    
1785 N  N     . VAL A 219 ? 0.2056 0.2087 0.2029 -0.0266 0.0444  0.0038  267 VAL A N     
1786 C  CA    . VAL A 219 ? 0.1890 0.1782 0.1949 -0.0297 0.0276  0.0084  267 VAL A CA    
1787 C  C     . VAL A 219 ? 0.1836 0.1725 0.2287 -0.0345 0.0092  0.0135  267 VAL A C     
1788 O  O     . VAL A 219 ? 0.1813 0.1794 0.2337 -0.0206 -0.0054 0.0059  267 VAL A O     
1789 C  CB    . VAL A 219 ? 0.1744 0.1998 0.1887 -0.0214 0.0158  -0.0023 267 VAL A CB    
1790 C  CG1   . VAL A 219 ? 0.2345 0.2208 0.1696 -0.0135 -0.0092 -0.0023 267 VAL A CG1   
1791 C  CG2   . VAL A 219 ? 0.1602 0.2192 0.2328 -0.0159 0.0127  0.0012  267 VAL A CG2   
1792 N  N     . PRO A 220 ? 0.2000 0.1555 0.2441 -0.0226 0.0206  0.0174  268 PRO A N     
1793 C  CA    . PRO A 220 ? 0.2056 0.1413 0.2432 -0.0207 0.0425  0.0141  268 PRO A CA    
1794 C  C     . PRO A 220 ? 0.2164 0.1816 0.2302 -0.0032 0.0212  0.0118  268 PRO A C     
1795 O  O     . PRO A 220 ? 0.2327 0.2117 0.2369 -0.0199 0.0136  -0.0029 268 PRO A O     
1796 C  CB    . PRO A 220 ? 0.2533 0.1422 0.2764 -0.0532 0.0084  0.0122  268 PRO A CB    
1797 C  CG    . PRO A 220 ? 0.2455 0.1602 0.2940 -0.0308 0.0077  0.0029  268 PRO A CG    
1798 C  CD    . PRO A 220 ? 0.2295 0.1597 0.2783 -0.0140 -0.0019 0.0078  268 PRO A CD    
1799 N  N     . PHE A 221 ? 0.2153 0.1620 0.2188 0.0054  0.0336  0.0184  269 PHE A N     
1800 C  CA    . PHE A 221 ? 0.2107 0.1463 0.2132 0.0078  0.0439  -0.0036 269 PHE A CA    
1801 C  C     . PHE A 221 ? 0.2178 0.1950 0.1949 0.0260  0.0378  -0.0071 269 PHE A C     
1802 O  O     . PHE A 221 ? 0.2801 0.2219 0.1961 0.0404  -0.0034 -0.0097 269 PHE A O     
1803 C  CB    . PHE A 221 ? 0.1938 0.1337 0.2205 -0.0157 0.0105  -0.0017 269 PHE A CB    
1804 C  CG    . PHE A 221 ? 0.1933 0.1675 0.2272 -0.0214 -0.0057 0.0049  269 PHE A CG    
1805 C  CD1   . PHE A 221 ? 0.1895 0.1734 0.2454 -0.0247 0.0203  0.0219  269 PHE A CD1   
1806 C  CD2   . PHE A 221 ? 0.1887 0.1798 0.2332 -0.0133 -0.0466 0.0146  269 PHE A CD2   
1807 C  CE1   . PHE A 221 ? 0.1858 0.1957 0.2607 -0.0206 -0.0022 0.0114  269 PHE A CE1   
1808 C  CE2   . PHE A 221 ? 0.1964 0.2034 0.2436 -0.0118 -0.0296 0.0174  269 PHE A CE2   
1809 C  CZ    . PHE A 221 ? 0.2001 0.2029 0.2513 -0.0150 -0.0434 -0.0074 269 PHE A CZ    
1810 N  N     . LEU A 222 ? 0.2141 0.1868 0.2074 -0.0007 0.0261  -0.0306 270 LEU A N     
1811 C  CA    . LEU A 222 ? 0.2202 0.1706 0.2053 -0.0180 0.0274  -0.0353 270 LEU A CA    
1812 C  C     . LEU A 222 ? 0.2101 0.1526 0.2131 0.0001  0.0167  -0.0125 270 LEU A C     
1813 O  O     . LEU A 222 ? 0.1963 0.1621 0.2325 0.0073  -0.0082 0.0084  270 LEU A O     
1814 C  CB    . LEU A 222 ? 0.2599 0.1980 0.2255 -0.0607 0.0176  -0.0370 270 LEU A CB    
1815 C  CG    . LEU A 222 ? 0.2902 0.2612 0.2460 -0.0441 0.0017  -0.0303 270 LEU A CG    
1816 C  CD1   . LEU A 222 ? 0.3152 0.2971 0.2497 -0.0620 0.0060  -0.0454 270 LEU A CD1   
1817 C  CD2   . LEU A 222 ? 0.3098 0.3019 0.2625 -0.0245 -0.0036 0.0210  270 LEU A CD2   
1818 N  N     . PRO A 223 ? 0.2224 0.1592 0.2019 0.0056  0.0296  0.0069  271 PRO A N     
1819 C  CA    . PRO A 223 ? 0.2261 0.1817 0.1868 0.0163  0.0117  0.0101  271 PRO A CA    
1820 C  C     . PRO A 223 ? 0.2513 0.1910 0.1819 -0.0006 -0.0052 -0.0026 271 PRO A C     
1821 O  O     . PRO A 223 ? 0.2268 0.1798 0.2038 -0.0013 0.0063  -0.0026 271 PRO A O     
1822 C  CB    . PRO A 223 ? 0.2080 0.1496 0.2133 0.0202  0.0203  0.0040  271 PRO A CB    
1823 C  CG    . PRO A 223 ? 0.2290 0.1606 0.2292 0.0323  0.0507  0.0254  271 PRO A CG    
1824 C  CD    . PRO A 223 ? 0.2311 0.1590 0.2235 0.0265  0.0266  0.0248  271 PRO A CD    
1825 N  N     . LEU A 224 ? 0.2466 0.1836 0.1554 -0.0056 0.0022  0.0011  272 LEU A N     
1826 C  CA    . LEU A 224 ? 0.2395 0.1779 0.1518 0.0055  0.0021  0.0010  272 LEU A CA    
1827 C  C     . LEU A 224 ? 0.2369 0.2223 0.1565 0.0229  -0.0151 0.0085  272 LEU A C     
1828 O  O     . LEU A 224 ? 0.2226 0.2515 0.1627 0.0057  -0.0212 0.0229  272 LEU A O     
1829 C  CB    . LEU A 224 ? 0.2423 0.1653 0.1752 0.0352  -0.0015 -0.0078 272 LEU A CB    
1830 C  CG    . LEU A 224 ? 0.2660 0.1818 0.1965 0.0379  -0.0279 -0.0069 272 LEU A CG    
1831 C  CD1   . LEU A 224 ? 0.2830 0.1822 0.1927 0.0238  -0.0317 -0.0084 272 LEU A CD1   
1832 C  CD2   . LEU A 224 ? 0.2497 0.1952 0.2259 0.0204  0.0166  0.0207  272 LEU A CD2   
1833 N  N     . GLU A 225 ? 0.2566 0.2204 0.1478 -0.0119 0.0182  -0.0130 273 GLU A N     
1834 C  CA    . GLU A 225 ? 0.2442 0.2024 0.1831 -0.0121 0.0320  -0.0315 273 GLU A CA    
1835 C  C     . GLU A 225 ? 0.2352 0.1956 0.1837 -0.0124 0.0386  -0.0244 273 GLU A C     
1836 O  O     . GLU A 225 ? 0.2280 0.1838 0.1725 -0.0132 0.0150  -0.0174 273 GLU A O     
1837 C  CB    . GLU A 225 ? 0.2749 0.1921 0.1887 -0.0430 0.0169  -0.0208 273 GLU A CB    
1838 C  CG    . GLU A 225 ? 0.3234 0.2296 0.2179 -0.0636 0.0301  -0.0265 273 GLU A CG    
1839 C  CD    . GLU A 225 ? 0.3779 0.2863 0.2678 -0.0699 0.0286  -0.0370 273 GLU A CD    
1840 O  OE1   . GLU A 225 ? 0.4232 0.3112 0.2953 -0.0894 0.0182  -0.0314 273 GLU A OE1   
1841 O  OE2   . GLU A 225 ? 0.4042 0.3030 0.3131 -0.0436 0.0119  -0.0725 273 GLU A OE2   
1842 N  N     . TYR A 226 ? 0.2134 0.2024 0.1660 -0.0018 0.0276  -0.0133 274 TYR A N     
1843 C  CA    . TYR A 226 ? 0.2269 0.2167 0.1710 0.0095  0.0158  -0.0154 274 TYR A CA    
1844 C  C     . TYR A 226 ? 0.2321 0.1887 0.1791 0.0010  0.0036  -0.0293 274 TYR A C     
1845 O  O     . TYR A 226 ? 0.2383 0.1733 0.1732 -0.0034 0.0033  -0.0205 274 TYR A O     
1846 C  CB    . TYR A 226 ? 0.2556 0.2292 0.1634 0.0265  0.0260  -0.0032 274 TYR A CB    
1847 C  CG    . TYR A 226 ? 0.2775 0.2221 0.1620 0.0231  0.0120  -0.0245 274 TYR A CG    
1848 C  CD1   . TYR A 226 ? 0.2909 0.2329 0.1778 0.0166  0.0245  -0.0054 274 TYR A CD1   
1849 C  CD2   . TYR A 226 ? 0.3725 0.2484 0.1709 0.0133  0.0307  -0.0237 274 TYR A CD2   
1850 C  CE1   . TYR A 226 ? 0.3179 0.2501 0.1692 0.0389  0.0418  -0.0129 274 TYR A CE1   
1851 C  CE2   . TYR A 226 ? 0.3918 0.2787 0.1881 -0.0046 0.0637  -0.0315 274 TYR A CE2   
1852 C  CZ    . TYR A 226 ? 0.3686 0.2811 0.1904 0.0124  0.0760  -0.0266 274 TYR A CZ    
1853 O  OH    . TYR A 226 ? 0.4234 0.3236 0.2247 0.0467  0.0957  -0.0099 274 TYR A OH    
1854 N  N     . LYS A 227 ? 0.2352 0.1976 0.1771 0.0045  0.0016  -0.0441 275 LYS A N     
1855 C  CA    . LYS A 227 ? 0.2242 0.1802 0.1775 -0.0155 0.0046  -0.0478 275 LYS A CA    
1856 C  C     . LYS A 227 ? 0.2217 0.1929 0.1755 0.0067  -0.0042 -0.0319 275 LYS A C     
1857 O  O     . LYS A 227 ? 0.2281 0.2154 0.1768 0.0191  -0.0214 -0.0211 275 LYS A O     
1858 C  CB    . LYS A 227 ? 0.2863 0.2016 0.2127 -0.0744 -0.0125 -0.0445 275 LYS A CB    
1859 C  CG    . LYS A 227 ? 0.3418 0.2279 0.2439 -0.0978 0.0017  -0.0265 275 LYS A CG    
1860 C  CD    . LYS A 227 ? 0.4021 0.2720 0.2785 -0.1269 0.0149  -0.0234 275 LYS A CD    
1861 C  CE    . LYS A 227 ? 0.4864 0.3044 0.3318 -0.1173 0.0025  -0.0120 275 LYS A CE    
1862 N  NZ    . LYS A 227 ? 0.5484 0.3296 0.3550 -0.1025 -0.0038 -0.0158 275 LYS A NZ    
1863 N  N     . HIS A 228 ? 0.2124 0.1994 0.1732 0.0020  0.0313  -0.0385 276 HIS A N     
1864 C  CA    . HIS A 228 ? 0.2036 0.1918 0.1669 -0.0268 0.0169  -0.0034 276 HIS A CA    
1865 C  C     . HIS A 228 ? 0.1961 0.1971 0.1664 -0.0302 -0.0037 -0.0199 276 HIS A C     
1866 O  O     . HIS A 228 ? 0.1931 0.2064 0.1824 0.0042  -0.0132 -0.0145 276 HIS A O     
1867 C  CB    . HIS A 228 ? 0.2255 0.1766 0.1640 -0.0272 0.0148  0.0127  276 HIS A CB    
1868 C  CG    . HIS A 228 ? 0.2465 0.1979 0.1788 -0.0406 0.0051  0.0005  276 HIS A CG    
1869 N  ND1   . HIS A 228 ? 0.2633 0.2128 0.1927 -0.0345 0.0073  -0.0148 276 HIS A ND1   
1870 C  CD2   . HIS A 228 ? 0.2747 0.2052 0.1856 -0.0431 0.0057  -0.0183 276 HIS A CD2   
1871 C  CE1   . HIS A 228 ? 0.2830 0.2162 0.2057 -0.0312 0.0076  -0.0183 276 HIS A CE1   
1872 N  NE2   . HIS A 228 ? 0.3040 0.2209 0.1986 -0.0240 0.0016  -0.0097 276 HIS A NE2   
1873 N  N     . LEU A 229 ? 0.1807 0.1966 0.1507 -0.0287 0.0024  -0.0273 277 LEU A N     
1874 C  CA    . LEU A 229 ? 0.1675 0.2185 0.1524 -0.0175 -0.0152 -0.0134 277 LEU A CA    
1875 C  C     . LEU A 229 ? 0.1758 0.1928 0.1403 0.0043  -0.0045 -0.0289 277 LEU A C     
1876 O  O     . LEU A 229 ? 0.2100 0.1818 0.1727 0.0066  -0.0023 -0.0275 277 LEU A O     
1877 C  CB    . LEU A 229 ? 0.1823 0.2725 0.1485 -0.0229 -0.0244 -0.0248 277 LEU A CB    
1878 C  CG    . LEU A 229 ? 0.2346 0.3559 0.1688 -0.0195 -0.0089 -0.0231 277 LEU A CG    
1879 C  CD1   . LEU A 229 ? 0.2153 0.3612 0.1894 -0.0149 -0.0483 -0.0163 277 LEU A CD1   
1880 C  CD2   . LEU A 229 ? 0.3058 0.4060 0.1676 -0.0182 -0.0219 -0.0513 277 LEU A CD2   
1881 N  N     . LYS A 230 ? 0.1660 0.2186 0.1448 0.0147  -0.0030 -0.0095 278 LYS A N     
1882 C  CA    . LYS A 230 ? 0.1919 0.2066 0.1518 0.0253  -0.0014 -0.0286 278 LYS A CA    
1883 C  C     . LYS A 230 ? 0.1817 0.2074 0.1542 -0.0037 0.0086  -0.0134 278 LYS A C     
1884 O  O     . LYS A 230 ? 0.2142 0.2142 0.1755 0.0018  -0.0044 -0.0074 278 LYS A O     
1885 C  CB    . LYS A 230 ? 0.2324 0.1938 0.1799 0.0341  -0.0152 -0.0609 278 LYS A CB    
1886 C  CG    . LYS A 230 ? 0.2507 0.2203 0.2071 0.0203  0.0127  -0.0654 278 LYS A CG    
1887 C  CD    . LYS A 230 ? 0.3541 0.2543 0.2907 0.0109  0.0001  -0.0902 278 LYS A CD    
1888 C  CE    . LYS A 230 ? 0.4426 0.2995 0.3460 0.0114  0.0289  -0.0980 278 LYS A CE    
1889 N  NZ    . LYS A 230 ? 0.5101 0.3410 0.3770 0.0189  0.0404  -0.1040 278 LYS A NZ    
1890 N  N     . MET A 231 ? 0.1743 0.2171 0.1655 -0.0277 -0.0123 -0.0146 279 MET A N     
1891 C  CA    . MET A 231 ? 0.1776 0.2124 0.1722 -0.0352 -0.0097 -0.0236 279 MET A CA    
1892 C  C     . MET A 231 ? 0.2073 0.2090 0.1595 -0.0227 -0.0139 -0.0089 279 MET A C     
1893 O  O     . MET A 231 ? 0.2283 0.2133 0.1590 -0.0228 -0.0173 -0.0043 279 MET A O     
1894 C  CB    . MET A 231 ? 0.1899 0.2122 0.1894 -0.0299 -0.0110 -0.0256 279 MET A CB    
1895 C  CG    . MET A 231 ? 0.2425 0.2339 0.2144 -0.0614 -0.0069 -0.0373 279 MET A CG    
1896 S  SD    . MET A 231 ? 0.2939 0.3009 0.2599 -0.0773 -0.0270 0.0109  279 MET A SD    
1897 C  CE    . MET A 231 ? 0.3776 0.3443 0.2968 -0.0681 -0.0280 -0.0070 279 MET A CE    
1898 N  N     . CYS A 232 ? 0.1972 0.2172 0.1436 -0.0038 -0.0049 -0.0247 280 CYS A N     
1899 C  CA    . CYS A 232 ? 0.2269 0.2428 0.1488 -0.0259 -0.0109 -0.0034 280 CYS A CA    
1900 C  C     . CYS A 232 ? 0.2002 0.2369 0.1472 -0.0178 -0.0140 -0.0068 280 CYS A C     
1901 O  O     . CYS A 232 ? 0.2093 0.2258 0.1673 -0.0010 0.0111  -0.0088 280 CYS A O     
1902 C  CB    . CYS A 232 ? 0.2252 0.2591 0.1452 -0.0303 0.0144  -0.0037 280 CYS A CB    
1903 S  SG    . CYS A 232 ? 0.2751 0.3088 0.2118 -0.0002 0.0146  -0.0145 280 CYS A SG    
1904 N  N     . ILE A 233 ? 0.1688 0.2306 0.1356 -0.0065 -0.0121 -0.0034 281 ILE A N     
1905 C  CA    . ILE A 233 ? 0.1836 0.2151 0.1467 0.0165  -0.0056 -0.0099 281 ILE A CA    
1906 C  C     . ILE A 233 ? 0.1990 0.2084 0.1582 0.0152  -0.0103 -0.0139 281 ILE A C     
1907 O  O     . ILE A 233 ? 0.2178 0.2026 0.1729 -0.0057 -0.0132 0.0007  281 ILE A O     
1908 C  CB    . ILE A 233 ? 0.1726 0.2103 0.1405 0.0030  -0.0070 -0.0113 281 ILE A CB    
1909 C  CG1   . ILE A 233 ? 0.1987 0.1945 0.1464 0.0121  -0.0155 -0.0165 281 ILE A CG1   
1910 C  CG2   . ILE A 233 ? 0.2058 0.2298 0.1578 -0.0283 0.0008  0.0112  281 ILE A CG2   
1911 C  CD1   . ILE A 233 ? 0.2099 0.1916 0.1823 0.0173  -0.0171 -0.0192 281 ILE A CD1   
1912 N  N     . ARG A 234 ? 0.1906 0.2222 0.1432 -0.0028 -0.0249 -0.0275 282 ARG A N     
1913 C  CA    . ARG A 234 ? 0.2161 0.2102 0.1525 -0.0061 -0.0273 -0.0071 282 ARG A CA    
1914 C  C     . ARG A 234 ? 0.1980 0.2216 0.1611 0.0056  -0.0354 0.0150  282 ARG A C     
1915 O  O     . ARG A 234 ? 0.2192 0.2164 0.1924 0.0158  -0.0369 0.0227  282 ARG A O     
1916 C  CB    . ARG A 234 ? 0.1895 0.1991 0.1512 -0.0085 -0.0343 -0.0273 282 ARG A CB    
1917 C  CG    . ARG A 234 ? 0.2102 0.1969 0.1831 -0.0014 -0.0424 -0.0245 282 ARG A CG    
1918 C  CD    . ARG A 234 ? 0.2118 0.2096 0.1933 -0.0121 -0.0272 -0.0417 282 ARG A CD    
1919 N  NE    . ARG A 234 ? 0.2156 0.2303 0.1676 -0.0057 -0.0025 -0.0299 282 ARG A NE    
1920 C  CZ    . ARG A 234 ? 0.2323 0.2357 0.1718 -0.0382 -0.0142 -0.0308 282 ARG A CZ    
1921 N  NH1   . ARG A 234 ? 0.2333 0.2181 0.1601 -0.0494 -0.0052 -0.0081 282 ARG A NH1   
1922 N  NH2   . ARG A 234 ? 0.2423 0.2571 0.1749 -0.0088 -0.0152 -0.0059 282 ARG A NH2   
1923 N  N     . VAL A 235 ? 0.1748 0.2117 0.1848 0.0015  -0.0098 -0.0125 283 VAL A N     
1924 C  CA    . VAL A 235 ? 0.1963 0.1988 0.2242 0.0037  0.0010  0.0068  283 VAL A CA    
1925 C  C     . VAL A 235 ? 0.2118 0.1875 0.2194 0.0007  -0.0160 -0.0019 283 VAL A C     
1926 O  O     . VAL A 235 ? 0.2445 0.1918 0.2230 0.0174  -0.0047 0.0062  283 VAL A O     
1927 C  CB    . VAL A 235 ? 0.2057 0.2053 0.2457 0.0116  0.0128  0.0219  283 VAL A CB    
1928 C  CG1   . VAL A 235 ? 0.2432 0.2004 0.2524 0.0119  0.0135  0.0176  283 VAL A CG1   
1929 C  CG2   . VAL A 235 ? 0.2097 0.2076 0.2458 -0.0124 0.0178  0.0135  283 VAL A CG2   
1930 N  N     . GLU A 236 ? 0.2022 0.1835 0.2054 -0.0131 -0.0033 -0.0162 284 GLU A N     
1931 C  CA    . GLU A 236 ? 0.2258 0.1807 0.2037 -0.0151 -0.0173 -0.0034 284 GLU A CA    
1932 C  C     . GLU A 236 ? 0.2148 0.1857 0.1841 0.0003  -0.0198 0.0041  284 GLU A C     
1933 O  O     . GLU A 236 ? 0.2263 0.1924 0.2024 0.0050  -0.0144 0.0219  284 GLU A O     
1934 C  CB    . GLU A 236 ? 0.2431 0.1816 0.2144 -0.0190 -0.0290 -0.0034 284 GLU A CB    
1935 C  CG    . GLU A 236 ? 0.2782 0.2042 0.2274 -0.0219 -0.0354 -0.0282 284 GLU A CG    
1936 C  CD    . GLU A 236 ? 0.3380 0.2530 0.2568 -0.0484 -0.0036 -0.0265 284 GLU A CD    
1937 O  OE1   . GLU A 236 ? 0.3255 0.2757 0.2595 -0.0211 -0.0060 -0.0121 284 GLU A OE1   
1938 O  OE2   . GLU A 236 ? 0.3989 0.2671 0.2988 -0.0589 0.0481  -0.0533 284 GLU A OE2   
1939 N  N     . MET A 237 ? 0.2341 0.2150 0.1574 0.0073  0.0044  0.0056  285 MET A N     
1940 C  CA    . MET A 237 ? 0.2357 0.1853 0.1703 0.0178  -0.0068 0.0193  285 MET A CA    
1941 C  C     . MET A 237 ? 0.2338 0.2134 0.2098 0.0075  -0.0124 0.0225  285 MET A C     
1942 O  O     . MET A 237 ? 0.2470 0.2045 0.2335 -0.0009 -0.0125 0.0296  285 MET A O     
1943 C  CB    . MET A 237 ? 0.2339 0.1958 0.1812 0.0348  -0.0018 0.0003  285 MET A CB    
1944 C  CG    . MET A 237 ? 0.2356 0.2032 0.1942 0.0260  -0.0080 -0.0271 285 MET A CG    
1945 S  SD    . MET A 237 ? 0.2330 0.2321 0.1888 -0.0015 -0.0091 -0.0135 285 MET A SD    
1946 C  CE    . MET A 237 ? 0.2174 0.2472 0.1843 -0.0229 -0.0310 -0.0316 285 MET A CE    
1947 N  N     . GLN A 238 ? 0.2133 0.2498 0.2164 0.0049  -0.0232 0.0118  286 GLN A N     
1948 C  CA    . GLN A 238 ? 0.2269 0.2751 0.2614 0.0352  -0.0247 0.0133  286 GLN A CA    
1949 C  C     . GLN A 238 ? 0.2529 0.2545 0.2620 0.0592  -0.0275 0.0291  286 GLN A C     
1950 O  O     . GLN A 238 ? 0.3111 0.2567 0.2932 0.0517  -0.0167 0.0293  286 GLN A O     
1951 C  CB    . GLN A 238 ? 0.2307 0.3306 0.3095 0.0358  -0.0597 -0.0072 286 GLN A CB    
1952 C  CG    . GLN A 238 ? 0.3098 0.4002 0.3687 0.0171  -0.0632 0.0070  286 GLN A CG    
1953 C  CD    . GLN A 238 ? 0.4070 0.4574 0.3951 -0.0129 -0.0629 0.0163  286 GLN A CD    
1954 O  OE1   . GLN A 238 ? 0.4499 0.4932 0.3964 -0.0405 -0.0338 0.0225  286 GLN A OE1   
1955 N  NE2   . GLN A 238 ? 0.4246 0.4633 0.3994 -0.0043 -0.0934 0.0225  286 GLN A NE2   
1956 N  N     . SER A 239 ? 0.2535 0.2384 0.2548 0.0370  -0.0179 0.0247  287 SER A N     
1957 C  CA    . SER A 239 ? 0.3111 0.2502 0.2853 0.0514  0.0144  0.0177  287 SER A CA    
1958 C  C     . SER A 239 ? 0.3263 0.2375 0.2949 0.0556  0.0195  0.0022  287 SER A C     
1959 O  O     . SER A 239 ? 0.3500 0.2530 0.3367 0.0515  0.0042  0.0077  287 SER A O     
1960 C  CB    . SER A 239 ? 0.3840 0.3062 0.3146 0.0679  -0.0045 0.0268  287 SER A CB    
1961 O  OG    . SER A 239 ? 0.4867 0.3450 0.3618 0.0816  0.0154  0.0232  287 SER A OG    
1962 N  N     . ARG A 240 ? 0.3366 0.2354 0.2692 0.0236  0.0288  -0.0108 288 ARG A N     
1963 C  CA    . ARG A 240 ? 0.3621 0.2302 0.2898 0.0085  0.0218  0.0081  288 ARG A CA    
1964 C  C     . ARG A 240 ? 0.3983 0.2391 0.3106 0.0118  0.0539  0.0179  288 ARG A C     
1965 O  O     . ARG A 240 ? 0.4563 0.2434 0.3449 -0.0158 0.0494  0.0047  288 ARG A O     
1966 C  CB    . ARG A 240 ? 0.3587 0.2418 0.2872 -0.0254 -0.0002 0.0055  288 ARG A CB    
1967 C  CG    . ARG A 240 ? 0.3577 0.2608 0.2714 -0.0020 -0.0194 0.0155  288 ARG A CG    
1968 C  CD    . ARG A 240 ? 0.3494 0.2957 0.2637 -0.0138 -0.0387 0.0093  288 ARG A CD    
1969 N  NE    . ARG A 240 ? 0.3566 0.3025 0.2752 -0.0223 -0.0298 -0.0003 288 ARG A NE    
1970 C  CZ    . ARG A 240 ? 0.3348 0.2815 0.2856 -0.0269 -0.0026 -0.0142 288 ARG A CZ    
1971 N  NH1   . ARG A 240 ? 0.3275 0.2753 0.2998 -0.0331 0.0166  0.0049  288 ARG A NH1   
1972 N  NH2   . ARG A 240 ? 0.3730 0.2915 0.3087 0.0005  0.0058  -0.0136 288 ARG A NH2   
1973 N  N     . GLY A 241 ? 0.3957 0.2483 0.2974 0.0490  0.0683  0.0302  289 GLY A N     
1974 C  CA    . GLY A 241 ? 0.3811 0.2669 0.2862 0.0750  0.0733  0.0319  289 GLY A CA    
1975 C  C     . GLY A 241 ? 0.3741 0.2816 0.2771 0.0585  0.0774  0.0412  289 GLY A C     
1976 O  O     . GLY A 241 ? 0.4097 0.3061 0.3017 0.0540  0.0780  0.0489  289 GLY A O     
1977 N  N     . TYR A 242 ? 0.3162 0.2663 0.2627 0.0318  0.0628  0.0334  290 TYR A N     
1978 C  CA    . TYR A 242 ? 0.2972 0.2599 0.2485 0.0108  0.0303  0.0313  290 TYR A CA    
1979 C  C     . TYR A 242 ? 0.3102 0.2658 0.2594 -0.0042 0.0191  0.0174  290 TYR A C     
1980 O  O     . TYR A 242 ? 0.3297 0.2812 0.2946 -0.0037 0.0465  -0.0238 290 TYR A O     
1981 C  CB    . TYR A 242 ? 0.2712 0.2611 0.2500 0.0274  0.0179  0.0348  290 TYR A CB    
1982 C  CG    . TYR A 242 ? 0.2884 0.2965 0.2508 -0.0003 0.0195  0.0132  290 TYR A CG    
1983 C  CD1   . TYR A 242 ? 0.2744 0.3109 0.2511 0.0015  0.0215  0.0024  290 TYR A CD1   
1984 C  CD2   . TYR A 242 ? 0.3228 0.3275 0.2611 0.0082  -0.0012 -0.0042 290 TYR A CD2   
1985 C  CE1   . TYR A 242 ? 0.2978 0.3372 0.2731 0.0058  0.0311  -0.0078 290 TYR A CE1   
1986 C  CE2   . TYR A 242 ? 0.3561 0.3408 0.2651 -0.0030 0.0121  -0.0053 290 TYR A CE2   
1987 C  CZ    . TYR A 242 ? 0.3303 0.3570 0.2782 -0.0130 0.0057  -0.0047 290 TYR A CZ    
1988 O  OH    . TYR A 242 ? 0.3527 0.3958 0.2914 -0.0184 -0.0213 0.0197  290 TYR A OH    
1989 N  N     . GLU A 243 ? 0.3087 0.2829 0.2642 0.0078  0.0079  0.0376  291 GLU A N     
1990 C  CA    . GLU A 243 ? 0.3213 0.3200 0.2551 0.0113  0.0131  0.0195  291 GLU A CA    
1991 C  C     . GLU A 243 ? 0.2866 0.2698 0.2375 0.0192  -0.0063 0.0055  291 GLU A C     
1992 O  O     . GLU A 243 ? 0.3169 0.2702 0.2476 -0.0039 -0.0155 0.0143  291 GLU A O     
1993 C  CB    . GLU A 243 ? 0.3908 0.4063 0.3098 0.0246  0.0158  0.0331  291 GLU A CB    
1994 C  CG    . GLU A 243 ? 0.4717 0.4895 0.3839 0.0266  -0.0016 0.0127  291 GLU A CG    
1995 C  CD    . GLU A 243 ? 0.5462 0.5654 0.4500 0.0328  -0.0103 -0.0178 291 GLU A CD    
1996 O  OE1   . GLU A 243 ? 0.5827 0.6099 0.4726 0.0273  -0.0040 -0.0229 291 GLU A OE1   
1997 O  OE2   . GLU A 243 ? 0.5742 0.5923 0.4734 0.0400  -0.0303 -0.0361 291 GLU A OE2   
1998 N  N     . ILE A 244 ? 0.2730 0.2481 0.1943 0.0379  -0.0375 0.0009  292 ILE A N     
1999 C  CA    . ILE A 244 ? 0.2343 0.2573 0.1939 0.0428  -0.0076 -0.0294 292 ILE A CA    
2000 C  C     . ILE A 244 ? 0.2362 0.2501 0.1672 0.0085  -0.0232 -0.0476 292 ILE A C     
2001 O  O     . ILE A 244 ? 0.2649 0.2776 0.1631 -0.0128 -0.0104 -0.0401 292 ILE A O     
2002 C  CB    . ILE A 244 ? 0.2237 0.2889 0.2003 0.0342  -0.0004 -0.0253 292 ILE A CB    
2003 C  CG1   . ILE A 244 ? 0.2450 0.3166 0.2119 0.0178  0.0105  -0.0295 292 ILE A CG1   
2004 C  CG2   . ILE A 244 ? 0.2387 0.2960 0.1904 0.0133  -0.0358 -0.0236 292 ILE A CG2   
2005 C  CD1   . ILE A 244 ? 0.2456 0.3403 0.2053 -0.0022 -0.0103 -0.0153 292 ILE A CD1   
2006 N  N     . ASP A 245 ? 0.2431 0.2450 0.1632 0.0090  -0.0229 -0.0138 293 ASP A N     
2007 C  CA    . ASP A 245 ? 0.2166 0.2327 0.1400 -0.0202 -0.0149 -0.0297 293 ASP A CA    
2008 C  C     . ASP A 245 ? 0.2227 0.2267 0.1524 -0.0248 -0.0175 -0.0255 293 ASP A C     
2009 O  O     . ASP A 245 ? 0.2354 0.2044 0.1582 -0.0195 -0.0076 -0.0166 293 ASP A O     
2010 C  CB    . ASP A 245 ? 0.2274 0.2513 0.1637 -0.0346 -0.0113 -0.0423 293 ASP A CB    
2011 C  CG    . ASP A 245 ? 0.2482 0.2780 0.1676 -0.0384 0.0048  -0.0296 293 ASP A CG    
2012 O  OD1   . ASP A 245 ? 0.2472 0.2858 0.1903 -0.0377 0.0075  -0.0469 293 ASP A OD1   
2013 O  OD2   . ASP A 245 ? 0.2741 0.2850 0.1826 -0.0527 0.0194  -0.0282 293 ASP A OD2   
2014 N  N     . GLU A 246 ? 0.1964 0.2120 0.1407 -0.0137 -0.0086 -0.0156 294 GLU A N     
2015 C  CA    . GLU A 246 ? 0.2168 0.2048 0.1469 -0.0290 0.0074  -0.0225 294 GLU A CA    
2016 C  C     . GLU A 246 ? 0.1970 0.2104 0.1314 -0.0367 0.0099  -0.0281 294 GLU A C     
2017 O  O     . GLU A 246 ? 0.2404 0.2255 0.1289 -0.0084 0.0069  -0.0216 294 GLU A O     
2018 C  CB    . GLU A 246 ? 0.2083 0.2337 0.1630 -0.0310 -0.0090 -0.0278 294 GLU A CB    
2019 C  CG    . GLU A 246 ? 0.2405 0.2692 0.1643 -0.0292 0.0175  -0.0214 294 GLU A CG    
2020 C  CD    . GLU A 246 ? 0.2596 0.2978 0.1711 -0.0173 0.0155  -0.0221 294 GLU A CD    
2021 O  OE1   . GLU A 246 ? 0.2740 0.2913 0.1515 -0.0383 0.0101  -0.0266 294 GLU A OE1   
2022 O  OE2   . GLU A 246 ? 0.2767 0.3299 0.1813 0.0140  0.0368  -0.0115 294 GLU A OE2   
2023 N  N     . ASP A 247 ? 0.1672 0.2079 0.1554 -0.0247 0.0179  -0.0559 295 ASP A N     
2024 C  CA    . ASP A 247 ? 0.1818 0.2543 0.1552 -0.0257 0.0045  -0.0443 295 ASP A CA    
2025 C  C     . ASP A 247 ? 0.2004 0.2402 0.1550 0.0068  -0.0064 -0.0364 295 ASP A C     
2026 O  O     . ASP A 247 ? 0.2198 0.2803 0.1584 0.0113  -0.0038 -0.0305 295 ASP A O     
2027 C  CB    . ASP A 247 ? 0.1911 0.2855 0.1987 0.0062  0.0208  -0.0507 295 ASP A CB    
2028 C  CG    . ASP A 247 ? 0.2292 0.3192 0.2246 -0.0026 0.0077  -0.0513 295 ASP A CG    
2029 O  OD1   . ASP A 247 ? 0.2566 0.3439 0.2609 0.0098  -0.0153 -0.0522 295 ASP A OD1   
2030 O  OD2   . ASP A 247 ? 0.2475 0.3379 0.2319 -0.0302 0.0061  -0.0294 295 ASP A OD2   
2031 N  N     . ILE A 248 ? 0.2097 0.2217 0.1474 -0.0143 0.0024  -0.0539 296 ILE A N     
2032 C  CA    . ILE A 248 ? 0.2086 0.2344 0.1432 -0.0351 0.0015  -0.0334 296 ILE A CA    
2033 C  C     . ILE A 248 ? 0.1935 0.2281 0.1490 -0.0179 -0.0085 -0.0110 296 ILE A C     
2034 O  O     . ILE A 248 ? 0.2089 0.2315 0.1459 -0.0210 -0.0244 -0.0053 296 ILE A O     
2035 C  CB    . ILE A 248 ? 0.2167 0.2563 0.1488 -0.0430 0.0132  -0.0392 296 ILE A CB    
2036 C  CG1   . ILE A 248 ? 0.2356 0.2642 0.1597 -0.0376 0.0186  -0.0159 296 ILE A CG1   
2037 C  CG2   . ILE A 248 ? 0.2329 0.2624 0.1508 -0.0542 -0.0024 -0.0450 296 ILE A CG2   
2038 C  CD1   . ILE A 248 ? 0.2814 0.2634 0.1774 -0.0481 -0.0014 -0.0122 296 ILE A CD1   
2039 N  N     . VAL A 249 ? 0.2003 0.2172 0.1392 -0.0317 0.0123  -0.0155 297 VAL A N     
2040 C  CA    . VAL A 249 ? 0.1788 0.2045 0.1510 -0.0141 0.0086  -0.0079 297 VAL A CA    
2041 C  C     . VAL A 249 ? 0.1928 0.2129 0.1519 -0.0093 0.0128  -0.0268 297 VAL A C     
2042 O  O     . VAL A 249 ? 0.2150 0.2276 0.1423 -0.0131 0.0082  -0.0259 297 VAL A O     
2043 C  CB    . VAL A 249 ? 0.1855 0.2063 0.1701 -0.0219 0.0066  0.0084  297 VAL A CB    
2044 C  CG1   . VAL A 249 ? 0.1841 0.2082 0.1749 -0.0411 0.0248  0.0175  297 VAL A CG1   
2045 C  CG2   . VAL A 249 ? 0.1900 0.2107 0.1766 -0.0010 0.0084  0.0055  297 VAL A CG2   
2046 N  N     . SER A 250 ? 0.2026 0.2202 0.1545 -0.0048 0.0113  -0.0244 298 SER A N     
2047 C  CA    . SER A 250 ? 0.2433 0.2468 0.1785 0.0187  -0.0213 -0.0362 298 SER A CA    
2048 C  C     . SER A 250 ? 0.2158 0.2806 0.1650 0.0141  -0.0037 -0.0171 298 SER A C     
2049 O  O     . SER A 250 ? 0.2467 0.3157 0.1921 0.0107  0.0020  0.0274  298 SER A O     
2050 C  CB    . SER A 250 ? 0.3035 0.2592 0.2235 -0.0006 -0.0091 -0.0584 298 SER A CB    
2051 O  OG    . SER A 250 ? 0.3785 0.2771 0.2483 0.0233  -0.0076 -0.0520 298 SER A OG    
2052 N  N     . ARG A 251 ? 0.1901 0.3043 0.1737 0.0135  0.0026  -0.0303 299 ARG A N     
2053 C  CA    . ARG A 251 ? 0.1969 0.3045 0.1681 0.0124  0.0149  -0.0280 299 ARG A CA    
2054 C  C     . ARG A 251 ? 0.2058 0.3016 0.1584 0.0198  0.0100  -0.0246 299 ARG A C     
2055 O  O     . ARG A 251 ? 0.2259 0.3293 0.1734 0.0298  -0.0061 0.0064  299 ARG A O     
2056 C  CB    . ARG A 251 ? 0.2114 0.3263 0.1826 0.0095  0.0378  -0.0034 299 ARG A CB    
2057 C  CG    . ARG A 251 ? 0.2623 0.3735 0.2285 0.0147  0.0492  -0.0087 299 ARG A CG    
2058 C  CD    . ARG A 251 ? 0.2908 0.4169 0.2431 0.0356  0.0632  -0.0173 299 ARG A CD    
2059 N  NE    . ARG A 251 ? 0.2985 0.4662 0.2751 0.0286  0.0488  -0.0151 299 ARG A NE    
2060 C  CZ    . ARG A 251 ? 0.3332 0.5173 0.3076 0.0360  0.0083  -0.0419 299 ARG A CZ    
2061 N  NH1   . ARG A 251 ? 0.3363 0.5383 0.3348 0.0234  -0.0041 -0.0483 299 ARG A NH1   
2062 N  NH2   . ARG A 251 ? 0.3566 0.5419 0.3202 0.0297  0.0006  -0.0473 299 ARG A NH2   
2063 N  N     . VAL A 252 ? 0.1959 0.2741 0.1583 0.0116  0.0170  -0.0230 300 VAL A N     
2064 C  CA    . VAL A 252 ? 0.1905 0.2461 0.1443 -0.0283 0.0001  -0.0251 300 VAL A CA    
2065 C  C     . VAL A 252 ? 0.1886 0.2445 0.1333 -0.0159 -0.0136 -0.0211 300 VAL A C     
2066 O  O     . VAL A 252 ? 0.2273 0.2836 0.1401 -0.0353 0.0044  -0.0214 300 VAL A O     
2067 C  CB    . VAL A 252 ? 0.2002 0.2260 0.1487 -0.0140 0.0133  -0.0188 300 VAL A CB    
2068 C  CG1   . VAL A 252 ? 0.2224 0.2216 0.1568 0.0065  -0.0043 -0.0196 300 VAL A CG1   
2069 C  CG2   . VAL A 252 ? 0.2244 0.2618 0.1486 -0.0310 0.0073  0.0078  300 VAL A CG2   
2070 N  N     . ALA A 253 ? 0.1819 0.2245 0.1447 0.0087  0.0050  -0.0009 301 ALA A N     
2071 C  CA    . ALA A 253 ? 0.2062 0.2234 0.1501 0.0311  -0.0134 0.0000  301 ALA A CA    
2072 C  C     . ALA A 253 ? 0.2146 0.2128 0.1495 0.0302  0.0030  -0.0050 301 ALA A C     
2073 O  O     . ALA A 253 ? 0.2396 0.2339 0.1564 -0.0091 -0.0204 -0.0073 301 ALA A O     
2074 C  CB    . ALA A 253 ? 0.2063 0.2321 0.1670 0.0022  -0.0179 -0.0160 301 ALA A CB    
2075 N  N     . GLU A 254 ? 0.2218 0.2298 0.1663 0.0394  -0.0178 -0.0125 302 GLU A N     
2076 C  CA    . GLU A 254 ? 0.2396 0.2557 0.1650 0.0422  0.0002  -0.0200 302 GLU A CA    
2077 C  C     . GLU A 254 ? 0.2248 0.2471 0.1773 0.0116  0.0032  -0.0063 302 GLU A C     
2078 O  O     . GLU A 254 ? 0.2567 0.2620 0.2015 0.0058  0.0022  -0.0087 302 GLU A O     
2079 C  CB    . GLU A 254 ? 0.2984 0.2897 0.1867 0.0365  0.0016  -0.0459 302 GLU A CB    
2080 C  CG    . GLU A 254 ? 0.3810 0.3362 0.2230 0.0372  0.0133  -0.0640 302 GLU A CG    
2081 C  CD    . GLU A 254 ? 0.4825 0.4165 0.2766 0.0394  0.0048  -0.0610 302 GLU A CD    
2082 O  OE1   . GLU A 254 ? 0.5117 0.4507 0.3060 0.0550  0.0424  -0.0526 302 GLU A OE1   
2083 O  OE2   . GLU A 254 ? 0.5402 0.4377 0.3086 0.0359  -0.0180 -0.0591 302 GLU A OE2   
2084 N  N     . MET A 255 ? 0.2182 0.2378 0.1534 0.0146  0.0084  0.0122  303 MET A N     
2085 C  CA    . MET A 255 ? 0.2052 0.2222 0.1452 0.0426  -0.0184 -0.0169 303 MET A CA    
2086 C  C     . MET A 255 ? 0.2131 0.2018 0.1599 0.0449  0.0063  -0.0300 303 MET A C     
2087 O  O     . MET A 255 ? 0.2497 0.2122 0.1814 0.0206  -0.0143 -0.0173 303 MET A O     
2088 C  CB    . MET A 255 ? 0.2278 0.2244 0.1712 0.0434  -0.0155 -0.0139 303 MET A CB    
2089 C  CG    . MET A 255 ? 0.2347 0.2078 0.1954 0.0135  -0.0265 -0.0101 303 MET A CG    
2090 S  SD    . MET A 255 ? 0.2380 0.2175 0.1942 0.0206  0.0065  -0.0056 303 MET A SD    
2091 C  CE    . MET A 255 ? 0.2588 0.2106 0.1788 0.0344  -0.0139 -0.0219 303 MET A CE    
2092 N  N     . THR A 256 ? 0.2091 0.1783 0.1650 0.0208  -0.0085 -0.0023 304 THR A N     
2093 C  CA    . THR A 256 ? 0.2059 0.1815 0.1814 0.0201  -0.0125 0.0052  304 THR A CA    
2094 C  C     . THR A 256 ? 0.1976 0.1700 0.2045 0.0385  -0.0024 -0.0149 304 THR A C     
2095 O  O     . THR A 256 ? 0.2145 0.1729 0.2223 0.0162  0.0116  -0.0244 304 THR A O     
2096 C  CB    . THR A 256 ? 0.2166 0.2128 0.1937 0.0068  -0.0023 -0.0110 304 THR A CB    
2097 O  OG1   . THR A 256 ? 0.2317 0.2313 0.2093 0.0058  -0.0174 -0.0385 304 THR A OG1   
2098 C  CG2   . THR A 256 ? 0.2358 0.2375 0.2149 -0.0301 -0.0066 0.0228  304 THR A CG2   
2099 N  N     . PHE A 257 ? 0.2219 0.1595 0.2192 0.0276  -0.0030 -0.0139 305 PHE A N     
2100 C  CA    . PHE A 257 ? 0.2339 0.1586 0.2135 0.0010  -0.0025 -0.0192 305 PHE A CA    
2101 C  C     . PHE A 257 ? 0.2391 0.1858 0.2253 0.0044  -0.0169 0.0059  305 PHE A C     
2102 O  O     . PHE A 257 ? 0.2416 0.2034 0.2402 0.0152  -0.0155 0.0063  305 PHE A O     
2103 C  CB    . PHE A 257 ? 0.2319 0.1675 0.2045 0.0027  -0.0040 -0.0357 305 PHE A CB    
2104 C  CG    . PHE A 257 ? 0.2451 0.1780 0.2027 0.0056  -0.0060 -0.0247 305 PHE A CG    
2105 C  CD1   . PHE A 257 ? 0.2529 0.1934 0.2040 0.0041  -0.0193 -0.0199 305 PHE A CD1   
2106 C  CD2   . PHE A 257 ? 0.2762 0.1988 0.2023 -0.0050 -0.0199 -0.0111 305 PHE A CD2   
2107 C  CE1   . PHE A 257 ? 0.2779 0.2072 0.1904 0.0104  -0.0205 -0.0132 305 PHE A CE1   
2108 C  CE2   . PHE A 257 ? 0.2999 0.2165 0.2222 -0.0006 -0.0327 -0.0105 305 PHE A CE2   
2109 C  CZ    . PHE A 257 ? 0.2667 0.2018 0.1973 0.0113  -0.0207 -0.0105 305 PHE A CZ    
2110 N  N     . PHE A 258 ? 0.2384 0.1865 0.2284 -0.0197 -0.0227 0.0330  306 PHE A N     
2111 C  CA    . PHE A 258 ? 0.2671 0.1864 0.2393 0.0067  -0.0238 0.0298  306 PHE A CA    
2112 C  C     . PHE A 258 ? 0.2628 0.1979 0.2714 0.0180  -0.0211 0.0302  306 PHE A C     
2113 O  O     . PHE A 258 ? 0.2603 0.1925 0.2667 0.0161  -0.0382 0.0106  306 PHE A O     
2114 C  CB    . PHE A 258 ? 0.2984 0.2035 0.2359 0.0144  -0.0245 0.0326  306 PHE A CB    
2115 C  CG    . PHE A 258 ? 0.3009 0.2097 0.2463 -0.0075 -0.0393 0.0267  306 PHE A CG    
2116 C  CD1   . PHE A 258 ? 0.2973 0.2030 0.2437 -0.0163 -0.0630 0.0095  306 PHE A CD1   
2117 C  CD2   . PHE A 258 ? 0.3327 0.2240 0.2583 -0.0013 -0.0264 0.0161  306 PHE A CD2   
2118 C  CE1   . PHE A 258 ? 0.3239 0.2076 0.2322 -0.0066 -0.0555 0.0036  306 PHE A CE1   
2119 C  CE2   . PHE A 258 ? 0.3186 0.2244 0.2618 0.0148  -0.0388 0.0079  306 PHE A CE2   
2120 C  CZ    . PHE A 258 ? 0.3080 0.2009 0.2530 -0.0097 -0.0429 -0.0021 306 PHE A CZ    
2121 N  N     . PRO A 259 ? 0.3064 0.2137 0.3060 0.0106  -0.0418 0.0506  307 PRO A N     
2122 C  CA    . PRO A 259 ? 0.3288 0.2067 0.3478 0.0151  -0.0665 0.0674  307 PRO A CA    
2123 C  C     . PRO A 259 ? 0.3390 0.2007 0.3940 0.0501  -0.0719 0.0593  307 PRO A C     
2124 O  O     . PRO A 259 ? 0.3435 0.1925 0.4008 0.0514  -0.0231 0.0422  307 PRO A O     
2125 C  CB    . PRO A 259 ? 0.3491 0.2245 0.3576 -0.0146 -0.0560 0.0757  307 PRO A CB    
2126 C  CG    . PRO A 259 ? 0.3479 0.2440 0.3450 -0.0212 -0.0596 0.0781  307 PRO A CG    
2127 C  CD    . PRO A 259 ? 0.3257 0.2342 0.3191 -0.0065 -0.0505 0.0727  307 PRO A CD    
2128 N  N     . LYS A 260 ? 0.3519 0.2650 0.4468 0.0743  -0.0907 0.0531  308 LYS A N     
2129 C  CA    . LYS A 260 ? 0.3856 0.3266 0.4886 0.0896  -0.0930 0.0350  308 LYS A CA    
2130 C  C     . LYS A 260 ? 0.4190 0.3433 0.5161 0.1115  -0.0641 0.0232  308 LYS A C     
2131 O  O     . LYS A 260 ? 0.4232 0.3443 0.5098 0.1383  -0.0306 0.0004  308 LYS A O     
2132 C  CB    . LYS A 260 ? 0.4267 0.3771 0.5104 0.0805  -0.1035 0.0445  308 LYS A CB    
2133 C  CG    . LYS A 260 ? 0.4686 0.4261 0.5330 0.0605  -0.1195 0.0550  308 LYS A CG    
2134 C  CD    . LYS A 260 ? 0.5151 0.4708 0.5493 0.0620  -0.1176 0.0643  308 LYS A CD    
2135 C  CE    . LYS A 260 ? 0.5505 0.4960 0.5641 0.0532  -0.0995 0.0538  308 LYS A CE    
2136 N  NZ    . LYS A 260 ? 0.5818 0.5134 0.5745 0.0449  -0.0903 0.0389  308 LYS A NZ    
2137 N  N     . GLU A 261 ? 0.4490 0.3536 0.5415 0.0879  -0.0644 0.0133  309 GLU A N     
2138 C  CA    . GLU A 261 ? 0.4988 0.3692 0.5681 0.0676  -0.0501 0.0100  309 GLU A CA    
2139 C  C     . GLU A 261 ? 0.4680 0.3126 0.5490 0.0467  -0.0542 0.0001  309 GLU A C     
2140 O  O     . GLU A 261 ? 0.4562 0.3262 0.5666 0.0390  -0.0750 -0.0159 309 GLU A O     
2141 C  CB    . GLU A 261 ? 0.5721 0.4359 0.5974 0.0744  -0.0339 0.0156  309 GLU A CB    
2142 C  CG    . GLU A 261 ? 0.6362 0.5136 0.6271 0.0648  -0.0224 0.0145  309 GLU A CG    
2143 C  CD    . GLU A 261 ? 0.6949 0.5711 0.6475 0.0516  -0.0133 0.0099  309 GLU A CD    
2144 O  OE1   . GLU A 261 ? 0.7186 0.5942 0.6585 0.0387  -0.0088 0.0091  309 GLU A OE1   
2145 O  OE2   . GLU A 261 ? 0.7197 0.5889 0.6528 0.0470  -0.0094 0.0093  309 GLU A OE2   
2146 N  N     . GLU A 262 ? 0.4488 0.2500 0.5275 0.0645  -0.0309 0.0040  310 GLU A N     
2147 C  CA    . GLU A 262 ? 0.4279 0.2309 0.5022 0.0515  -0.0092 0.0056  310 GLU A CA    
2148 C  C     . GLU A 262 ? 0.3736 0.2235 0.4536 0.0446  -0.0066 -0.0253 310 GLU A C     
2149 O  O     . GLU A 262 ? 0.3853 0.2297 0.4491 0.0436  -0.0062 -0.0357 310 GLU A O     
2150 C  CB    . GLU A 262 ? 0.4812 0.2485 0.5266 0.0393  0.0030  0.0255  310 GLU A CB    
2151 C  CG    . GLU A 262 ? 0.5157 0.2791 0.5577 0.0284  -0.0112 0.0573  310 GLU A CG    
2152 C  CD    . GLU A 262 ? 0.5277 0.3083 0.5911 0.0286  -0.0282 0.0764  310 GLU A CD    
2153 O  OE1   . GLU A 262 ? 0.5181 0.3105 0.5941 0.0324  -0.0335 0.0881  310 GLU A OE1   
2154 O  OE2   . GLU A 262 ? 0.5533 0.3469 0.6194 0.0170  -0.0291 0.0711  310 GLU A OE2   
2155 N  N     . ARG A 263 ? 0.3043 0.2208 0.4063 0.0065  0.0044  -0.0497 311 ARG A N     
2156 C  CA    . ARG A 263 ? 0.2821 0.2456 0.3799 0.0093  0.0141  -0.0395 311 ARG A CA    
2157 C  C     . ARG A 263 ? 0.2854 0.2296 0.3352 0.0086  -0.0049 -0.0258 311 ARG A C     
2158 O  O     . ARG A 263 ? 0.2958 0.2311 0.3542 0.0119  0.0213  -0.0383 311 ARG A O     
2159 C  CB    . ARG A 263 ? 0.2711 0.2659 0.3803 0.0078  0.0104  -0.0603 311 ARG A CB    
2160 C  CG    . ARG A 263 ? 0.2748 0.2780 0.3926 0.0101  -0.0164 -0.0856 311 ARG A CG    
2161 C  CD    . ARG A 263 ? 0.2736 0.3195 0.3943 0.0299  -0.0327 -0.0826 311 ARG A CD    
2162 N  NE    . ARG A 263 ? 0.2620 0.3510 0.4172 0.0357  -0.0225 -0.0749 311 ARG A NE    
2163 C  CZ    . ARG A 263 ? 0.3002 0.3619 0.4263 0.0447  -0.0323 -0.0819 311 ARG A CZ    
2164 N  NH1   . ARG A 263 ? 0.2966 0.3820 0.4303 0.0436  -0.0132 -0.0940 311 ARG A NH1   
2165 N  NH2   . ARG A 263 ? 0.3251 0.3642 0.4306 0.0584  -0.0408 -0.0739 311 ARG A NH2   
2166 N  N     . VAL A 264 ? 0.2676 0.2032 0.2963 0.0202  -0.0093 -0.0193 312 VAL A N     
2167 C  CA    . VAL A 264 ? 0.2832 0.1788 0.2800 0.0260  -0.0161 -0.0049 312 VAL A CA    
2168 C  C     . VAL A 264 ? 0.2923 0.1734 0.2459 0.0272  0.0082  -0.0171 312 VAL A C     
2169 O  O     . VAL A 264 ? 0.3214 0.1712 0.2272 -0.0021 -0.0129 -0.0301 312 VAL A O     
2170 C  CB    . VAL A 264 ? 0.3324 0.2155 0.3055 0.0063  -0.0301 0.0228  312 VAL A CB    
2171 C  CG1   . VAL A 264 ? 0.3616 0.2226 0.2988 -0.0203 -0.0069 0.0256  312 VAL A CG1   
2172 C  CG2   . VAL A 264 ? 0.3544 0.2254 0.3295 -0.0094 -0.0621 0.0168  312 VAL A CG2   
2173 N  N     . PHE A 265 ? 0.2495 0.1591 0.2147 0.0094  -0.0020 -0.0131 313 PHE A N     
2174 C  CA    . PHE A 265 ? 0.2309 0.1437 0.1896 -0.0062 0.0157  -0.0067 313 PHE A CA    
2175 C  C     . PHE A 265 ? 0.2298 0.1583 0.1870 0.0027  -0.0013 0.0025  313 PHE A C     
2176 O  O     . PHE A 265 ? 0.2117 0.1649 0.2088 0.0257  -0.0055 -0.0132 313 PHE A O     
2177 C  CB    . PHE A 265 ? 0.2381 0.1578 0.2052 -0.0236 0.0103  -0.0085 313 PHE A CB    
2178 C  CG    . PHE A 265 ? 0.2569 0.1754 0.2150 -0.0242 0.0230  -0.0059 313 PHE A CG    
2179 C  CD1   . PHE A 265 ? 0.2535 0.1994 0.2303 -0.0363 0.0153  -0.0240 313 PHE A CD1   
2180 C  CD2   . PHE A 265 ? 0.2832 0.2034 0.2540 -0.0279 0.0363  0.0082  313 PHE A CD2   
2181 C  CE1   . PHE A 265 ? 0.2697 0.2040 0.2494 -0.0283 0.0375  -0.0088 313 PHE A CE1   
2182 C  CE2   . PHE A 265 ? 0.2836 0.2105 0.2607 -0.0244 0.0156  -0.0135 313 PHE A CE2   
2183 C  CZ    . PHE A 265 ? 0.2613 0.2113 0.2667 -0.0226 0.0355  -0.0044 313 PHE A CZ    
2184 N  N     A SER A 266 ? 0.2538 0.1672 0.1869 -0.0105 -0.0165 0.0000  314 SER A N     
2185 N  N     B SER A 266 ? 0.2455 0.1506 0.1849 -0.0120 -0.0091 0.0018  314 SER A N     
2186 C  CA    A SER A 266 ? 0.2408 0.1630 0.1778 -0.0004 -0.0375 0.0045  314 SER A CA    
2187 C  CA    B SER A 266 ? 0.2398 0.1343 0.1762 -0.0079 -0.0309 0.0074  314 SER A CA    
2188 C  C     A SER A 266 ? 0.2113 0.1610 0.1755 -0.0093 -0.0283 -0.0065 314 SER A C     
2189 C  C     B SER A 266 ? 0.2130 0.1374 0.1764 0.0015  -0.0263 -0.0078 314 SER A C     
2190 O  O     A SER A 266 ? 0.2069 0.1714 0.1887 -0.0382 -0.0219 -0.0088 314 SER A O     
2191 O  O     B SER A 266 ? 0.2080 0.1298 0.1819 0.0175  -0.0234 -0.0105 314 SER A O     
2192 C  CB    A SER A 266 ? 0.2348 0.1740 0.1824 0.0175  -0.0253 0.0084  314 SER A CB    
2193 C  CB    B SER A 266 ? 0.2369 0.1319 0.1725 -0.0258 -0.0238 0.0213  314 SER A CB    
2194 O  OG    A SER A 266 ? 0.2177 0.1960 0.1865 0.0247  -0.0278 -0.0101 314 SER A OG    
2195 O  OG    B SER A 266 ? 0.2133 0.1309 0.1771 -0.0637 -0.0124 0.0214  314 SER A OG    
2196 N  N     . ASP A 267 ? 0.1932 0.1506 0.1731 -0.0037 -0.0284 -0.0127 315 ASP A N     
2197 C  CA    . ASP A 267 ? 0.1839 0.1743 0.1928 -0.0022 -0.0288 -0.0148 315 ASP A CA    
2198 C  C     . ASP A 267 ? 0.1826 0.1617 0.1753 -0.0038 -0.0017 0.0139  315 ASP A C     
2199 O  O     . ASP A 267 ? 0.2081 0.1766 0.1817 0.0075  0.0000  0.0038  315 ASP A O     
2200 C  CB    . ASP A 267 ? 0.1841 0.1909 0.2275 -0.0044 -0.0364 -0.0055 315 ASP A CB    
2201 C  CG    . ASP A 267 ? 0.2218 0.2177 0.2468 -0.0047 -0.0318 0.0213  315 ASP A CG    
2202 O  OD1   . ASP A 267 ? 0.2417 0.2095 0.2278 0.0114  -0.0193 0.0247  315 ASP A OD1   
2203 O  OD2   . ASP A 267 ? 0.2438 0.2196 0.2916 0.0087  -0.0363 0.0267  315 ASP A OD2   
2204 N  N     . LYS A 268 ? 0.1877 0.1548 0.1694 0.0173  -0.0259 -0.0097 316 LYS A N     
2205 C  CA    . LYS A 268 ? 0.1566 0.1411 0.1782 -0.0007 -0.0085 -0.0204 316 LYS A CA    
2206 C  C     . LYS A 268 ? 0.1711 0.1345 0.1732 -0.0092 0.0167  -0.0082 316 LYS A C     
2207 O  O     . LYS A 268 ? 0.1672 0.1493 0.1726 0.0060  -0.0033 0.0050  316 LYS A O     
2208 C  CB    . LYS A 268 ? 0.1341 0.1811 0.1873 -0.0162 -0.0266 -0.0231 316 LYS A CB    
2209 C  CG    . LYS A 268 ? 0.1580 0.1994 0.1991 -0.0183 -0.0165 -0.0114 316 LYS A CG    
2210 C  CD    . LYS A 268 ? 0.1716 0.2111 0.1766 -0.0330 0.0079  -0.0145 316 LYS A CD    
2211 C  CE    . LYS A 268 ? 0.1785 0.2126 0.1584 -0.0386 0.0353  0.0062  316 LYS A CE    
2212 N  NZ    . LYS A 268 ? 0.2024 0.2224 0.1637 -0.0439 0.0136  -0.0295 316 LYS A NZ    
2213 N  N     . GLY A 269 ? 0.1911 0.1613 0.1714 -0.0222 0.0070  -0.0147 317 GLY A N     
2214 C  CA    . GLY A 269 ? 0.1969 0.1509 0.1621 -0.0089 -0.0193 -0.0163 317 GLY A CA    
2215 C  C     . GLY A 269 ? 0.1882 0.1655 0.1582 -0.0025 -0.0090 -0.0084 317 GLY A C     
2216 O  O     . GLY A 269 ? 0.2102 0.1972 0.1605 0.0207  0.0208  -0.0124 317 GLY A O     
2217 N  N     A CYS A 270 ? 0.1677 0.1523 0.1364 -0.0140 -0.0168 0.0139  318 CYS A N     
2218 N  N     B CYS A 270 ? 0.1884 0.1636 0.1727 -0.0040 -0.0168 0.0090  318 CYS A N     
2219 C  CA    A CYS A 270 ? 0.1965 0.1823 0.1287 -0.0234 -0.0173 -0.0004 318 CYS A CA    
2220 C  CA    B CYS A 270 ? 0.2050 0.1762 0.1901 -0.0077 -0.0219 0.0113  318 CYS A CA    
2221 C  C     A CYS A 270 ? 0.2090 0.1603 0.1416 -0.0185 0.0117  -0.0015 318 CYS A C     
2222 C  C     B CYS A 270 ? 0.1932 0.1553 0.1722 -0.0034 0.0015  0.0029  318 CYS A C     
2223 O  O     A CYS A 270 ? 0.2826 0.1943 0.1530 -0.0467 -0.0018 -0.0075 318 CYS A O     
2224 O  O     B CYS A 270 ? 0.2087 0.1687 0.1679 -0.0067 0.0064  0.0044  318 CYS A O     
2225 C  CB    A CYS A 270 ? 0.2082 0.2320 0.1413 -0.0505 -0.0383 -0.0062 318 CYS A CB    
2226 C  CB    B CYS A 270 ? 0.2267 0.2094 0.2376 -0.0207 -0.0476 0.0250  318 CYS A CB    
2227 S  SG    A CYS A 270 ? 0.2375 0.2837 0.1655 -0.0347 -0.0402 0.0230  318 CYS A SG    
2228 S  SG    B CYS A 270 ? 0.2476 0.2456 0.2865 -0.0106 -0.0655 0.0440  318 CYS A SG    
2229 N  N     . LYS A 271 ? 0.1654 0.1389 0.1640 -0.0189 -0.0009 -0.0087 319 LYS A N     
2230 C  CA    . LYS A 271 ? 0.1602 0.1453 0.1578 -0.0415 0.0206  -0.0227 319 LYS A CA    
2231 C  C     . LYS A 271 ? 0.1484 0.1648 0.1453 -0.0284 0.0110  -0.0066 319 LYS A C     
2232 O  O     . LYS A 271 ? 0.1599 0.2084 0.1587 0.0013  -0.0025 -0.0234 319 LYS A O     
2233 C  CB    . LYS A 271 ? 0.1373 0.1710 0.1405 -0.0166 0.0266  -0.0320 319 LYS A CB    
2234 C  CG    . LYS A 271 ? 0.1525 0.2015 0.1560 -0.0141 0.0274  -0.0486 319 LYS A CG    
2235 C  CD    . LYS A 271 ? 0.1528 0.2243 0.1547 -0.0242 0.0455  -0.0465 319 LYS A CD    
2236 C  CE    . LYS A 271 ? 0.1463 0.2227 0.1615 -0.0282 0.0313  -0.0533 319 LYS A CE    
2237 N  NZ    . LYS A 271 ? 0.1613 0.1904 0.1653 -0.0116 0.0132  -0.0305 319 LYS A NZ    
2238 N  N     . THR A 272 ? 0.1553 0.1700 0.1416 -0.0590 0.0021  -0.0143 320 THR A N     
2239 C  CA    . THR A 272 ? 0.1604 0.2127 0.1466 -0.0497 -0.0024 -0.0403 320 THR A CA    
2240 C  C     . THR A 272 ? 0.1730 0.2466 0.1491 -0.0393 -0.0012 -0.0412 320 THR A C     
2241 O  O     . THR A 272 ? 0.1766 0.3122 0.1736 -0.0336 0.0069  -0.0552 320 THR A O     
2242 C  CB    . THR A 272 ? 0.1778 0.2027 0.1543 -0.0073 -0.0017 -0.0359 320 THR A CB    
2243 O  OG1   . THR A 272 ? 0.1897 0.2092 0.1641 0.0054  -0.0088 -0.0262 320 THR A OG1   
2244 C  CG2   . THR A 272 ? 0.1931 0.2144 0.1438 -0.0210 0.0143  -0.0367 320 THR A CG2   
2245 N  N     . VAL A 273 ? 0.1945 0.2073 0.1313 -0.0118 -0.0113 -0.0333 321 VAL A N     
2246 C  CA    . VAL A 273 ? 0.2173 0.2128 0.1441 -0.0218 -0.0107 -0.0360 321 VAL A CA    
2247 C  C     . VAL A 273 ? 0.1909 0.2151 0.1438 0.0035  -0.0055 -0.0301 321 VAL A C     
2248 O  O     . VAL A 273 ? 0.2041 0.2355 0.1596 -0.0026 0.0052  -0.0115 321 VAL A O     
2249 C  CB    . VAL A 273 ? 0.1995 0.1970 0.1471 -0.0132 -0.0254 -0.0237 321 VAL A CB    
2250 C  CG1   . VAL A 273 ? 0.2590 0.2250 0.1505 -0.0244 -0.0207 -0.0338 321 VAL A CG1   
2251 C  CG2   . VAL A 273 ? 0.2150 0.1777 0.1582 0.0021  -0.0198 -0.0136 321 VAL A CG2   
2252 N  N     . PHE A 274 ? 0.2150 0.2319 0.1498 0.0297  -0.0173 0.0025  322 PHE A N     
2253 C  CA    . PHE A 274 ? 0.2061 0.2470 0.1728 0.0141  -0.0195 0.0032  322 PHE A CA    
2254 C  C     . PHE A 274 ? 0.2124 0.2423 0.1784 -0.0030 -0.0234 0.0074  322 PHE A C     
2255 O  O     . PHE A 274 ? 0.2335 0.2553 0.1904 -0.0133 -0.0193 0.0392  322 PHE A O     
2256 C  CB    . PHE A 274 ? 0.2152 0.2559 0.1853 0.0054  -0.0119 -0.0155 322 PHE A CB    
2257 C  CG    . PHE A 274 ? 0.2189 0.2337 0.1693 -0.0233 -0.0096 -0.0118 322 PHE A CG    
2258 C  CD1   . PHE A 274 ? 0.2453 0.2420 0.1869 -0.0396 -0.0069 -0.0033 322 PHE A CD1   
2259 C  CD2   . PHE A 274 ? 0.2399 0.2487 0.2128 -0.0439 -0.0015 -0.0078 322 PHE A CD2   
2260 C  CE1   . PHE A 274 ? 0.2543 0.2635 0.2004 -0.0349 0.0027  -0.0104 322 PHE A CE1   
2261 C  CE2   . PHE A 274 ? 0.2455 0.2378 0.2092 -0.0419 -0.0033 -0.0222 322 PHE A CE2   
2262 C  CZ    . PHE A 274 ? 0.2668 0.2535 0.2105 -0.0334 0.0020  -0.0114 322 PHE A CZ    
2263 N  N     . THR A 275 ? 0.1881 0.2401 0.1957 -0.0214 -0.0195 -0.0234 323 THR A N     
2264 C  CA    . THR A 275 ? 0.2192 0.2907 0.1890 -0.0275 -0.0299 -0.0327 323 THR A CA    
2265 C  C     . THR A 275 ? 0.2057 0.2610 0.1997 -0.0340 -0.0187 -0.0231 323 THR A C     
2266 O  O     . THR A 275 ? 0.2312 0.2596 0.2202 -0.0391 -0.0275 0.0020  323 THR A O     
2267 C  CB    . THR A 275 ? 0.2600 0.3586 0.1875 -0.0204 -0.0622 -0.0717 323 THR A CB    
2268 O  OG1   . THR A 275 ? 0.3524 0.4037 0.2445 0.0039  -0.0423 -0.0444 323 THR A OG1   
2269 C  CG2   . THR A 275 ? 0.2756 0.3751 0.2182 -0.0395 -0.0795 -0.0612 323 THR A CG2   
2270 N  N     . LYS A 276 ? 0.1950 0.2441 0.1927 -0.0027 -0.0100 -0.0287 324 LYS A N     
2271 C  CA    . LYS A 276 ? 0.1973 0.2251 0.1807 -0.0047 -0.0020 -0.0112 324 LYS A CA    
2272 C  C     . LYS A 276 ? 0.1821 0.2411 0.1811 -0.0021 -0.0221 -0.0149 324 LYS A C     
2273 O  O     . LYS A 276 ? 0.1753 0.2479 0.2042 0.0045  -0.0021 -0.0136 324 LYS A O     
2274 C  CB    . LYS A 276 ? 0.2283 0.2118 0.1957 -0.0024 -0.0187 0.0084  324 LYS A CB    
2275 C  CG    . LYS A 276 ? 0.2590 0.2101 0.1991 -0.0043 0.0047  0.0156  324 LYS A CG    
2276 C  CD    . LYS A 276 ? 0.2734 0.2051 0.2211 0.0158  -0.0012 -0.0142 324 LYS A CD    
2277 C  CE    . LYS A 276 ? 0.2783 0.2159 0.2312 0.0083  -0.0066 -0.0098 324 LYS A CE    
2278 N  NZ    . LYS A 276 ? 0.2692 0.2264 0.2332 0.0025  -0.0381 -0.0010 324 LYS A NZ    
2279 N  N     . LEU A 277 ? 0.1916 0.2534 0.1746 0.0001  0.0035  -0.0081 325 LEU A N     
2280 C  CA    . LEU A 277 ? 0.1850 0.2574 0.1751 -0.0170 -0.0011 0.0254  325 LEU A CA    
2281 C  C     . LEU A 277 ? 0.2435 0.2886 0.1939 -0.0194 -0.0063 0.0097  325 LEU A C     
2282 O  O     . LEU A 277 ? 0.2540 0.3080 0.1742 -0.0410 -0.0092 0.0146  325 LEU A O     
2283 C  CB    . LEU A 277 ? 0.2025 0.2595 0.1993 -0.0349 0.0076  0.0190  325 LEU A CB    
2284 C  CG    . LEU A 277 ? 0.2138 0.2227 0.2154 -0.0240 0.0052  -0.0301 325 LEU A CG    
2285 C  CD1   . LEU A 277 ? 0.2189 0.2347 0.2383 0.0026  0.0175  -0.0152 325 LEU A CD1   
2286 C  CD2   . LEU A 277 ? 0.2505 0.2508 0.1910 -0.0025 -0.0099 -0.0323 325 LEU A CD2   
2287 N  N     . ASP A 278 ? 0.2418 0.2780 0.2066 -0.0457 -0.0160 0.0040  326 ASP A N     
2288 C  CA    . ASP A 278 ? 0.2239 0.2938 0.2217 -0.0527 0.0024  -0.0331 326 ASP A CA    
2289 C  C     . ASP A 278 ? 0.2098 0.2982 0.2098 -0.0463 0.0042  -0.0152 326 ASP A C     
2290 O  O     . ASP A 278 ? 0.2297 0.2962 0.2574 -0.0380 0.0288  0.0009  326 ASP A O     
2291 C  CB    . ASP A 278 ? 0.2557 0.3302 0.2506 -0.0386 0.0321  -0.0432 326 ASP A CB    
2292 C  CG    . ASP A 278 ? 0.3102 0.3871 0.2798 0.0093  0.0032  -0.0538 326 ASP A CG    
2293 O  OD1   . ASP A 278 ? 0.3369 0.4018 0.2820 0.0355  -0.0343 -0.0573 326 ASP A OD1   
2294 O  OD2   . ASP A 278 ? 0.3415 0.4169 0.2988 0.0348  0.0263  -0.0539 326 ASP A OD2   
2295 N  N     . TYR A 279 ? 0.1947 0.3030 0.1755 -0.0220 -0.0317 -0.0224 327 TYR A N     
2296 C  CA    . TYR A 279 ? 0.1984 0.3420 0.1895 -0.0056 -0.0070 -0.0159 327 TYR A CA    
2297 C  C     . TYR A 279 ? 0.2161 0.3673 0.1980 -0.0252 0.0112  -0.0260 327 TYR A C     
2298 O  O     . TYR A 279 ? 0.2242 0.4057 0.2162 -0.0221 -0.0035 -0.0440 327 TYR A O     
2299 C  CB    . TYR A 279 ? 0.2006 0.3673 0.1893 0.0242  -0.0149 -0.0104 327 TYR A CB    
2300 C  CG    . TYR A 279 ? 0.2085 0.3927 0.2025 0.0087  -0.0138 -0.0104 327 TYR A CG    
2301 C  CD1   . TYR A 279 ? 0.1871 0.4167 0.2237 -0.0008 -0.0060 0.0001  327 TYR A CD1   
2302 C  CD2   . TYR A 279 ? 0.2384 0.4077 0.2069 -0.0042 -0.0267 -0.0160 327 TYR A CD2   
2303 C  CE1   . TYR A 279 ? 0.1740 0.4177 0.2035 -0.0313 -0.0122 0.0013  327 TYR A CE1   
2304 C  CE2   . TYR A 279 ? 0.2590 0.4129 0.2147 -0.0022 -0.0286 0.0012  327 TYR A CE2   
2305 C  CZ    . TYR A 279 ? 0.2335 0.4150 0.1892 -0.0215 -0.0172 -0.0003 327 TYR A CZ    
2306 O  OH    . TYR A 279 ? 0.2637 0.4059 0.1822 -0.0571 -0.0325 -0.0291 327 TYR A OH    
2307 N  N     . TYR A 280 ? 0.2361 0.3350 0.1881 -0.0411 -0.0055 -0.0455 328 TYR A N     
2308 C  CA    . TYR A 280 ? 0.2541 0.3277 0.1900 -0.0287 0.0076  -0.0452 328 TYR A CA    
2309 C  C     . TYR A 280 ? 0.2931 0.3584 0.1622 -0.0002 0.0246  -0.0333 328 TYR A C     
2310 O  O     . TYR A 280 ? 0.3391 0.4133 0.1564 0.0181  0.0059  -0.0342 328 TYR A O     
2311 C  CB    . TYR A 280 ? 0.2520 0.3038 0.2344 -0.0497 -0.0138 -0.0637 328 TYR A CB    
2312 C  CG    . TYR A 280 ? 0.2531 0.3020 0.2550 -0.0454 0.0152  -0.0471 328 TYR A CG    
2313 C  CD1   . TYR A 280 ? 0.2624 0.2937 0.2735 -0.0635 0.0173  -0.0427 328 TYR A CD1   
2314 C  CD2   . TYR A 280 ? 0.3054 0.3217 0.2874 -0.0145 0.0276  -0.0252 328 TYR A CD2   
2315 C  CE1   . TYR A 280 ? 0.3172 0.3188 0.3105 -0.0445 0.0475  -0.0222 328 TYR A CE1   
2316 C  CE2   . TYR A 280 ? 0.3580 0.3446 0.3250 -0.0076 0.0445  -0.0025 328 TYR A CE2   
2317 C  CZ    . TYR A 280 ? 0.3518 0.3434 0.3411 -0.0020 0.0626  0.0044  328 TYR A CZ    
2318 O  OH    . TYR A 280 ? 0.4052 0.3705 0.3885 0.0193  0.0768  0.0155  328 TYR A OH    
2319 N  N     . TYR A 281 ? 0.2855 0.3369 0.1834 -0.0087 0.0162  -0.0072 329 TYR A N     
2320 C  CA    . TYR A 281 ? 0.2957 0.3504 0.2111 -0.0261 0.0149  0.0106  329 TYR A CA    
2321 C  C     . TYR A 281 ? 0.3716 0.3819 0.2191 -0.0507 0.0005  0.0093  329 TYR A C     
2322 O  O     . TYR A 281 ? 0.3756 0.4141 0.2148 -0.0426 -0.0234 -0.0105 329 TYR A O     
2323 C  CB    . TYR A 281 ? 0.2442 0.3215 0.2338 -0.0358 0.0298  0.0228  329 TYR A CB    
2324 C  CG    . TYR A 281 ? 0.2505 0.3039 0.2383 -0.0271 0.0088  0.0111  329 TYR A CG    
2325 C  CD1   . TYR A 281 ? 0.2248 0.2930 0.2283 -0.0386 0.0054  0.0248  329 TYR A CD1   
2326 C  CD2   . TYR A 281 ? 0.2310 0.2998 0.2419 -0.0361 0.0216  0.0017  329 TYR A CD2   
2327 C  CE1   . TYR A 281 ? 0.2228 0.2977 0.2289 -0.0271 -0.0074 0.0244  329 TYR A CE1   
2328 C  CE2   . TYR A 281 ? 0.2471 0.2992 0.2499 -0.0250 -0.0201 0.0066  329 TYR A CE2   
2329 C  CZ    . TYR A 281 ? 0.2588 0.2878 0.2358 -0.0351 -0.0345 0.0105  329 TYR A CZ    
2330 O  OH    . TYR A 281 ? 0.2904 0.2838 0.2521 -0.0271 -0.0216 0.0017  329 TYR A OH    
2331 N  N     . ASP A 282 ? 0.4688 0.4032 0.2672 -0.0527 0.0111  0.0219  330 ASP A N     
2332 C  CA    . ASP A 282 ? 0.5583 0.4489 0.3185 -0.0540 0.0072  0.0344  330 ASP A CA    
2333 C  C     . ASP A 282 ? 0.6232 0.4620 0.3399 -0.0256 0.0049  0.0350  330 ASP A C     
2334 O  O     . ASP A 282 ? 0.6764 0.5000 0.3963 -0.0047 0.0038  0.0498  330 ASP A O     
2335 C  CB    . ASP A 282 ? 0.5895 0.4921 0.3645 -0.0639 0.0193  0.0245  330 ASP A CB    
2336 C  CG    . ASP A 282 ? 0.6218 0.5400 0.4029 -0.0720 0.0149  0.0288  330 ASP A CG    
2337 O  OD1   . ASP A 282 ? 0.6182 0.5485 0.4173 -0.0956 0.0129  0.0297  330 ASP A OD1   
2338 O  OD2   . ASP A 282 ? 0.6563 0.5689 0.4307 -0.0513 0.0135  0.0243  330 ASP A OD2   
2339 N  N     . ASN B 5   ? 0.6223 0.5868 0.5222 0.1540  -0.0983 0.0416  236 ASN B N     
2340 C  CA    . ASN B 5   ? 0.6111 0.5770 0.5063 0.1602  -0.1055 0.0478  236 ASN B CA    
2341 C  C     . ASN B 5   ? 0.5534 0.5448 0.4512 0.1565  -0.1279 0.0471  236 ASN B C     
2342 O  O     . ASN B 5   ? 0.5546 0.5469 0.4349 0.1424  -0.1450 0.0247  236 ASN B O     
2343 C  CB    . ASN B 5   ? 0.6390 0.5943 0.5375 0.1634  -0.0742 0.0569  236 ASN B CB    
2344 C  CG    . ASN B 5   ? 0.6839 0.6131 0.5676 0.1407  -0.0402 0.0625  236 ASN B CG    
2345 O  OD1   . ASN B 5   ? 0.7002 0.6209 0.5871 0.1297  -0.0249 0.0633  236 ASN B OD1   
2346 N  ND2   . ASN B 5   ? 0.7064 0.6215 0.5698 0.1351  -0.0305 0.0557  236 ASN B ND2   
2347 N  N     . SER B 6   ? 0.5030 0.5226 0.4133 0.1433  -0.1159 0.0471  237 SER B N     
2348 C  CA    . SER B 6   ? 0.4859 0.5098 0.3819 0.1059  -0.0825 0.0600  237 SER B CA    
2349 C  C     . SER B 6   ? 0.4539 0.4837 0.3277 0.0802  -0.0840 0.0668  237 SER B C     
2350 O  O     . SER B 6   ? 0.4698 0.5004 0.3148 0.0837  -0.0772 0.0668  237 SER B O     
2351 C  CB    . SER B 6   ? 0.5218 0.5284 0.4272 0.0887  -0.0341 0.0627  237 SER B CB    
2352 O  OG    . SER B 6   ? 0.5434 0.5421 0.4543 0.0866  -0.0178 0.0646  237 SER B OG    
2353 N  N     . TYR B 7   ? 0.4123 0.4494 0.2903 0.0646  -0.0877 0.0669  238 TYR B N     
2354 C  CA    . TYR B 7   ? 0.3887 0.4521 0.2686 0.0351  -0.0782 0.0513  238 TYR B CA    
2355 C  C     . TYR B 7   ? 0.4108 0.4609 0.2548 0.0214  -0.0647 0.0374  238 TYR B C     
2356 O  O     . TYR B 7   ? 0.3888 0.4470 0.2329 0.0173  -0.0719 0.0354  238 TYR B O     
2357 C  CB    . TYR B 7   ? 0.3753 0.4546 0.2704 0.0205  -0.0932 0.0439  238 TYR B CB    
2358 C  CG    . TYR B 7   ? 0.3655 0.4756 0.2878 -0.0158 -0.0958 0.0332  238 TYR B CG    
2359 C  CD1   . TYR B 7   ? 0.3525 0.4941 0.2998 -0.0203 -0.0980 0.0292  238 TYR B CD1   
2360 C  CD2   . TYR B 7   ? 0.3795 0.4949 0.2937 -0.0277 -0.0775 0.0252  238 TYR B CD2   
2361 C  CE1   . TYR B 7   ? 0.3827 0.5118 0.3084 -0.0299 -0.0805 0.0278  238 TYR B CE1   
2362 C  CE2   . TYR B 7   ? 0.3884 0.5082 0.3009 -0.0292 -0.0510 0.0300  238 TYR B CE2   
2363 C  CZ    . TYR B 7   ? 0.3806 0.5204 0.3179 -0.0408 -0.0362 0.0328  238 TYR B CZ    
2364 O  OH    . TYR B 7   ? 0.4018 0.5376 0.3625 -0.0407 -0.0076 0.0262  238 TYR B OH    
2365 N  N     . TYR B 8   ? 0.4339 0.4878 0.2760 0.0081  -0.0517 0.0240  239 TYR B N     
2366 C  CA    . TYR B 8   ? 0.4553 0.5121 0.3165 0.0158  -0.0422 0.0195  239 TYR B CA    
2367 C  C     . TYR B 8   ? 0.4777 0.5331 0.3464 0.0445  -0.0208 0.0376  239 TYR B C     
2368 O  O     . TYR B 8   ? 0.5074 0.5283 0.3485 0.0643  -0.0023 0.0625  239 TYR B O     
2369 C  CB    . TYR B 8   ? 0.4594 0.5153 0.3287 0.0059  -0.0655 -0.0091 239 TYR B CB    
2370 C  CG    . TYR B 8   ? 0.4808 0.5388 0.3717 0.0041  -0.0649 -0.0116 239 TYR B CG    
2371 C  CD1   . TYR B 8   ? 0.4944 0.5526 0.4044 0.0044  -0.0685 -0.0195 239 TYR B CD1   
2372 C  CD2   . TYR B 8   ? 0.4965 0.5618 0.3912 0.0004  -0.0663 -0.0075 239 TYR B CD2   
2373 C  CE1   . TYR B 8   ? 0.4986 0.5650 0.4275 0.0086  -0.0657 -0.0203 239 TYR B CE1   
2374 C  CE2   . TYR B 8   ? 0.4906 0.5753 0.4141 0.0154  -0.0782 -0.0067 239 TYR B CE2   
2375 C  CZ    . TYR B 8   ? 0.4955 0.5860 0.4372 0.0156  -0.0677 -0.0157 239 TYR B CZ    
2376 O  OH    . TYR B 8   ? 0.5080 0.6095 0.4639 0.0213  -0.0511 -0.0244 239 TYR B OH    
2377 N  N     . SER B 9   ? 0.4693 0.5545 0.3732 0.0565  -0.0193 0.0435  240 SER B N     
2378 C  CA    . SER B 9   ? 0.4753 0.5856 0.4132 0.0640  -0.0211 0.0450  240 SER B CA    
2379 C  C     . SER B 9   ? 0.5151 0.6200 0.4510 0.0624  0.0050  0.0397  240 SER B C     
2380 O  O     . SER B 9   ? 0.4812 0.6223 0.4292 0.0674  0.0248  0.0376  240 SER B O     
2381 C  CB    . SER B 9   ? 0.4557 0.5800 0.4224 0.0611  -0.0418 0.0489  240 SER B CB    
2382 O  OG    . SER B 9   ? 0.4305 0.5803 0.4272 0.0597  -0.0498 0.0612  240 SER B OG    
2383 N  N     . SER B 10  ? 0.5803 0.6496 0.5184 0.0588  -0.0035 0.0288  241 SER B N     
2384 C  CA    . SER B 10  ? 0.6436 0.6799 0.5807 0.0476  -0.0086 0.0255  241 SER B CA    
2385 C  C     . SER B 10  ? 0.6943 0.7094 0.6206 0.0441  -0.0152 0.0129  241 SER B C     
2386 O  O     . SER B 10  ? 0.7009 0.7110 0.6229 0.0458  -0.0064 0.0104  241 SER B O     
2387 C  CB    . SER B 10  ? 0.6458 0.6833 0.6022 0.0424  -0.0053 0.0330  241 SER B CB    
2388 O  OG    . SER B 10  ? 0.6519 0.6900 0.6202 0.0301  -0.0020 0.0323  241 SER B OG    
2389 N  N     . PRO B 11  ? 0.7215 0.7336 0.6549 0.0364  -0.0279 0.0086  242 PRO B N     
2390 C  CA    . PRO B 11  ? 0.7343 0.7453 0.6764 0.0327  -0.0274 0.0060  242 PRO B CA    
2391 C  C     . PRO B 11  ? 0.7473 0.7596 0.6988 0.0295  -0.0158 -0.0009 242 PRO B C     
2392 O  O     . PRO B 11  ? 0.7497 0.7619 0.7069 0.0292  -0.0209 -0.0066 242 PRO B O     
2393 C  CB    . PRO B 11  ? 0.7341 0.7447 0.6722 0.0313  -0.0329 0.0073  242 PRO B CB    
2394 C  CG    . PRO B 11  ? 0.7290 0.7461 0.6671 0.0326  -0.0333 0.0113  242 PRO B CG    
2395 C  CD    . PRO B 11  ? 0.7285 0.7424 0.6622 0.0344  -0.0325 0.0118  242 PRO B CD    
2396 N  N     . ALA B 12  ? 0.7526 0.7700 0.7052 0.0276  0.0114  0.0032  243 ALA B N     
2397 C  CA    . ALA B 12  ? 0.7684 0.7823 0.7155 0.0259  0.0309  0.0038  243 ALA B CA    
2398 C  C     . ALA B 12  ? 0.7792 0.7892 0.7204 0.0288  0.0398  0.0066  243 ALA B C     
2399 O  O     . ALA B 12  ? 0.7794 0.7944 0.7240 0.0417  0.0466  0.0043  243 ALA B O     
2400 C  CB    . ALA B 12  ? 0.7739 0.7860 0.7223 0.0245  0.0370  0.0038  243 ALA B CB    
2401 N  N     . GLN B 13  ? 0.7819 0.7849 0.7147 0.0124  0.0440  0.0101  244 GLN B N     
2402 C  CA    . GLN B 13  ? 0.7741 0.7748 0.7100 -0.0038 0.0487  0.0129  244 GLN B CA    
2403 C  C     . GLN B 13  ? 0.7432 0.7475 0.6730 -0.0109 0.0664  0.0213  244 GLN B C     
2404 O  O     . GLN B 13  ? 0.7269 0.7498 0.6790 -0.0005 0.0701  0.0171  244 GLN B O     
2405 C  CB    . GLN B 13  ? 0.7901 0.7878 0.7369 -0.0081 0.0415  0.0075  244 GLN B CB    
2406 C  CG    . GLN B 13  ? 0.8076 0.8082 0.7632 -0.0139 0.0300  0.0016  244 GLN B CG    
2407 C  CD    . GLN B 13  ? 0.8267 0.8292 0.7835 -0.0225 0.0190  0.0039  244 GLN B CD    
2408 O  OE1   . GLN B 13  ? 0.8314 0.8390 0.7912 -0.0313 0.0172  0.0075  244 GLN B OE1   
2409 N  NE2   . GLN B 13  ? 0.8295 0.8335 0.7929 -0.0240 0.0122  0.0045  244 GLN B NE2   
2410 N  N     . GLN B 14  ? 0.7270 0.7145 0.6316 -0.0214 0.0733  0.0323  245 GLN B N     
2411 C  CA    . GLN B 14  ? 0.6999 0.6738 0.5956 -0.0262 0.0654  0.0391  245 GLN B CA    
2412 C  C     . GLN B 14  ? 0.6242 0.6067 0.5246 -0.0205 0.0607  0.0604  245 GLN B C     
2413 O  O     . GLN B 14  ? 0.6420 0.6126 0.5304 -0.0133 0.0660  0.0700  245 GLN B O     
2414 C  CB    . GLN B 14  ? 0.7387 0.7032 0.6288 -0.0265 0.0541  0.0324  245 GLN B CB    
2415 C  CG    . GLN B 14  ? 0.7758 0.7328 0.6568 -0.0302 0.0449  0.0285  245 GLN B CG    
2416 C  CD    . GLN B 14  ? 0.8099 0.7580 0.6800 -0.0278 0.0337  0.0260  245 GLN B CD    
2417 O  OE1   . GLN B 14  ? 0.8204 0.7637 0.6917 -0.0278 0.0376  0.0256  245 GLN B OE1   
2418 N  NE2   . GLN B 14  ? 0.8218 0.7686 0.6876 -0.0249 0.0240  0.0276  245 GLN B NE2   
2419 N  N     . VAL B 15  ? 0.5147 0.5256 0.4427 -0.0287 0.0486  0.0703  246 VAL B N     
2420 C  CA    . VAL B 15  ? 0.4077 0.4495 0.3727 -0.0524 0.0395  0.0744  246 VAL B CA    
2421 C  C     . VAL B 15  ? 0.3537 0.4192 0.3446 -0.0596 -0.0035 0.0589  246 VAL B C     
2422 O  O     . VAL B 15  ? 0.3585 0.4192 0.3206 -0.0773 -0.0298 0.0365  246 VAL B O     
2423 C  CB    . VAL B 15  ? 0.3897 0.4329 0.3652 -0.0603 0.0567  0.0748  246 VAL B CB    
2424 C  CG1   . VAL B 15  ? 0.3704 0.4125 0.3517 -0.0572 0.0653  0.0875  246 VAL B CG1   
2425 C  CG2   . VAL B 15  ? 0.4089 0.4329 0.3568 -0.0728 0.0558  0.0747  246 VAL B CG2   
2426 N  N     . PRO B 16  ? 0.3221 0.3849 0.3407 -0.0660 -0.0124 0.0777  247 PRO B N     
2427 C  CA    . PRO B 16  ? 0.3206 0.3778 0.3389 -0.0649 -0.0236 0.0870  247 PRO B CA    
2428 C  C     . PRO B 16  ? 0.3357 0.3776 0.3280 -0.0679 -0.0241 0.0859  247 PRO B C     
2429 O  O     . PRO B 16  ? 0.3580 0.3683 0.3436 -0.0759 -0.0172 0.0869  247 PRO B O     
2430 C  CB    . PRO B 16  ? 0.2952 0.3669 0.3474 -0.0454 -0.0442 0.0995  247 PRO B CB    
2431 C  CG    . PRO B 16  ? 0.3324 0.3733 0.3579 -0.0474 -0.0202 0.0802  247 PRO B CG    
2432 C  CD    . PRO B 16  ? 0.3318 0.3800 0.3429 -0.0423 -0.0206 0.0909  247 PRO B CD    
2433 N  N     . LYS B 17  ? 0.3341 0.3919 0.3052 -0.0500 -0.0619 0.0942  248 LYS B N     
2434 C  CA    . LYS B 17  ? 0.3322 0.3990 0.3254 -0.0658 -0.0876 0.0789  248 LYS B CA    
2435 C  C     . LYS B 17  ? 0.3018 0.3753 0.3145 -0.0365 -0.0757 0.0816  248 LYS B C     
2436 O  O     . LYS B 17  ? 0.2967 0.3861 0.3459 -0.0175 -0.0788 0.0938  248 LYS B O     
2437 C  CB    . LYS B 17  ? 0.4065 0.4628 0.3872 -0.0457 -0.0872 0.0608  248 LYS B CB    
2438 C  CG    . LYS B 17  ? 0.4642 0.5109 0.4417 -0.0236 -0.0645 0.0519  248 LYS B CG    
2439 C  CD    . LYS B 17  ? 0.5252 0.5391 0.4848 -0.0162 -0.0525 0.0427  248 LYS B CD    
2440 C  CE    . LYS B 17  ? 0.5645 0.5550 0.5268 -0.0124 -0.0380 0.0374  248 LYS B CE    
2441 N  NZ    . LYS B 17  ? 0.5883 0.5571 0.5514 -0.0118 -0.0338 0.0336  248 LYS B NZ    
2442 N  N     . ASN B 18  ? 0.2648 0.3205 0.2747 -0.0410 -0.0825 0.0722  249 ASN B N     
2443 C  CA    . ASN B 18  ? 0.2419 0.2761 0.2769 -0.0586 -0.0564 0.0535  249 ASN B CA    
2444 C  C     . ASN B 18  ? 0.2379 0.2417 0.2564 -0.0442 -0.0317 0.0348  249 ASN B C     
2445 O  O     . ASN B 18  ? 0.2694 0.2236 0.2551 -0.0594 -0.0317 0.0303  249 ASN B O     
2446 C  CB    . ASN B 18  ? 0.2481 0.2625 0.2868 -0.0717 -0.0592 0.0560  249 ASN B CB    
2447 C  CG    . ASN B 18  ? 0.2431 0.2619 0.2752 -0.0631 -0.0436 0.0363  249 ASN B CG    
2448 O  OD1   . ASN B 18  ? 0.2242 0.2752 0.2770 -0.0431 -0.0425 0.0282  249 ASN B OD1   
2449 N  ND2   . ASN B 18  ? 0.2772 0.2640 0.2994 -0.0823 -0.0316 0.0267  249 ASN B ND2   
2450 N  N     . PRO B 19  ? 0.2136 0.2225 0.2602 -0.0443 -0.0234 0.0285  250 PRO B N     
2451 C  CA    . PRO B 19  ? 0.2185 0.2048 0.2496 -0.0182 -0.0149 0.0306  250 PRO B CA    
2452 C  C     . PRO B 19  ? 0.2303 0.2005 0.2292 -0.0141 0.0153  0.0214  250 PRO B C     
2453 O  O     . PRO B 19  ? 0.2261 0.1759 0.2443 -0.0187 0.0139  0.0192  250 PRO B O     
2454 C  CB    . PRO B 19  ? 0.2454 0.2075 0.2714 0.0177  -0.0137 0.0285  250 PRO B CB    
2455 C  CG    . PRO B 19  ? 0.2687 0.2205 0.2973 0.0170  -0.0283 0.0172  250 PRO B CG    
2456 C  CD    . PRO B 19  ? 0.2376 0.2245 0.2874 -0.0021 -0.0412 0.0082  250 PRO B CD    
2457 N  N     . ALA B 20  ? 0.2453 0.2184 0.2028 -0.0326 0.0026  0.0255  251 ALA B N     
2458 C  CA    . ALA B 20  ? 0.2246 0.2128 0.2078 -0.0168 0.0352  0.0285  251 ALA B CA    
2459 C  C     . ALA B 20  ? 0.2029 0.2149 0.2096 -0.0190 0.0090  -0.0005 251 ALA B C     
2460 O  O     . ALA B 20  ? 0.2320 0.2227 0.2136 -0.0193 0.0131  0.0187  251 ALA B O     
2461 C  CB    . ALA B 20  ? 0.2289 0.2205 0.2018 -0.0177 0.0229  0.0266  251 ALA B CB    
2462 N  N     . LEU B 21  ? 0.2200 0.2075 0.1939 -0.0079 -0.0003 -0.0092 252 LEU B N     
2463 C  CA    . LEU B 21  ? 0.2181 0.2076 0.1937 -0.0048 -0.0032 -0.0151 252 LEU B CA    
2464 C  C     . LEU B 21  ? 0.2418 0.2117 0.2041 -0.0057 0.0078  -0.0084 252 LEU B C     
2465 O  O     . LEU B 21  ? 0.2491 0.2147 0.2266 0.0032  0.0099  -0.0104 252 LEU B O     
2466 C  CB    . LEU B 21  ? 0.2685 0.2177 0.2400 -0.0305 -0.0167 -0.0369 252 LEU B CB    
2467 C  CG    . LEU B 21  ? 0.2997 0.2307 0.2605 -0.0346 -0.0011 -0.0450 252 LEU B CG    
2468 C  CD1   . LEU B 21  ? 0.3442 0.2137 0.2973 -0.0634 0.0093  -0.0675 252 LEU B CD1   
2469 C  CD2   . LEU B 21  ? 0.3186 0.2730 0.2765 -0.0409 -0.0137 -0.0467 252 LEU B CD2   
2470 N  N     . GLU B 22  ? 0.2703 0.2305 0.2242 -0.0261 0.0177  0.0094  253 GLU B N     
2471 C  CA    . GLU B 22  ? 0.2754 0.2404 0.2105 -0.0322 0.0088  0.0283  253 GLU B CA    
2472 C  C     . GLU B 22  ? 0.2385 0.2408 0.2239 -0.0281 0.0153  0.0005  253 GLU B C     
2473 O  O     . GLU B 22  ? 0.2481 0.2446 0.2218 -0.0206 0.0487  0.0004  253 GLU B O     
2474 C  CB    . GLU B 22  ? 0.2995 0.2862 0.2240 -0.0631 0.0294  0.0545  253 GLU B CB    
2475 C  CG    . GLU B 22  ? 0.3537 0.3407 0.2730 -0.0569 0.0277  0.0474  253 GLU B CG    
2476 C  CD    . GLU B 22  ? 0.4269 0.4132 0.3512 -0.0436 0.0165  0.0178  253 GLU B CD    
2477 O  OE1   . GLU B 22  ? 0.4703 0.4451 0.3619 -0.0105 0.0201  -0.0061 253 GLU B OE1   
2478 O  OE2   . GLU B 22  ? 0.4817 0.4365 0.3922 -0.0463 -0.0166 0.0014  253 GLU B OE2   
2479 N  N     . ALA B 23  ? 0.2300 0.2123 0.2208 -0.0223 0.0011  0.0122  254 ALA B N     
2480 C  CA    . ALA B 23  ? 0.2318 0.1983 0.2289 -0.0324 0.0013  -0.0122 254 ALA B CA    
2481 C  C     . ALA B 23  ? 0.2170 0.1993 0.2499 -0.0430 -0.0053 -0.0018 254 ALA B C     
2482 O  O     . ALA B 23  ? 0.2047 0.2118 0.2629 -0.0337 -0.0082 -0.0055 254 ALA B O     
2483 C  CB    . ALA B 23  ? 0.2486 0.1774 0.2190 -0.0360 0.0239  -0.0099 254 ALA B CB    
2484 N  N     . PHE B 24  ? 0.1932 0.1625 0.2665 -0.0327 0.0110  0.0222  255 PHE B N     
2485 C  CA    . PHE B 24  ? 0.2054 0.1694 0.2545 -0.0128 0.0274  0.0199  255 PHE B CA    
2486 C  C     . PHE B 24  ? 0.2130 0.1859 0.2574 -0.0091 0.0267  0.0077  255 PHE B C     
2487 O  O     . PHE B 24  ? 0.1959 0.1708 0.2792 0.0060  0.0280  0.0089  255 PHE B O     
2488 C  CB    . PHE B 24  ? 0.2106 0.1499 0.2407 -0.0329 0.0187  0.0326  255 PHE B CB    
2489 C  CG    . PHE B 24  ? 0.1972 0.1554 0.2269 -0.0232 0.0095  0.0073  255 PHE B CG    
2490 C  CD1   . PHE B 24  ? 0.1909 0.1783 0.2295 -0.0144 0.0074  0.0097  255 PHE B CD1   
2491 C  CD2   . PHE B 24  ? 0.1903 0.1716 0.2214 -0.0208 0.0114  -0.0065 255 PHE B CD2   
2492 C  CE1   . PHE B 24  ? 0.1778 0.1977 0.2278 -0.0364 0.0114  0.0033  255 PHE B CE1   
2493 C  CE2   . PHE B 24  ? 0.1786 0.1841 0.2193 -0.0106 0.0139  -0.0116 255 PHE B CE2   
2494 C  CZ    . PHE B 24  ? 0.1818 0.1969 0.2124 -0.0271 0.0080  -0.0027 255 PHE B CZ    
2495 N  N     . LEU B 25  ? 0.2282 0.2086 0.2337 -0.0165 0.0429  -0.0046 256 LEU B N     
2496 C  CA    . LEU B 25  ? 0.2014 0.2340 0.2317 -0.0021 0.0285  -0.0259 256 LEU B CA    
2497 C  C     . LEU B 25  ? 0.2156 0.2486 0.2341 -0.0098 0.0204  -0.0190 256 LEU B C     
2498 O  O     . LEU B 25  ? 0.2364 0.2669 0.2464 0.0009  0.0427  -0.0051 256 LEU B O     
2499 C  CB    . LEU B 25  ? 0.2136 0.2439 0.2337 0.0076  0.0011  -0.0160 256 LEU B CB    
2500 C  CG    . LEU B 25  ? 0.2426 0.2470 0.2340 -0.0074 0.0076  -0.0072 256 LEU B CG    
2501 C  CD1   . LEU B 25  ? 0.2501 0.2677 0.2220 -0.0076 -0.0296 -0.0039 256 LEU B CD1   
2502 C  CD2   . LEU B 25  ? 0.2480 0.2324 0.2637 -0.0364 -0.0106 -0.0406 256 LEU B CD2   
2503 N  N     . ALA B 26  ? 0.2217 0.2410 0.2527 -0.0378 0.0269  -0.0273 257 ALA B N     
2504 C  CA    . ALA B 26  ? 0.2109 0.2307 0.2568 -0.0394 0.0239  -0.0281 257 ALA B CA    
2505 C  C     . ALA B 26  ? 0.2225 0.2474 0.2575 -0.0086 0.0337  -0.0193 257 ALA B C     
2506 O  O     . ALA B 26  ? 0.2414 0.2711 0.2667 0.0228  0.0272  -0.0244 257 ALA B O     
2507 C  CB    . ALA B 26  ? 0.2348 0.2212 0.2549 -0.0549 0.0203  0.0013  257 ALA B CB    
2508 N  N     . GLN B 27  ? 0.2098 0.2593 0.2664 -0.0142 0.0138  -0.0299 258 GLN B N     
2509 C  CA    . GLN B 27  ? 0.2029 0.2703 0.2730 -0.0194 0.0329  -0.0367 258 GLN B CA    
2510 C  C     . GLN B 27  ? 0.1855 0.2800 0.2652 -0.0258 0.0341  -0.0279 258 GLN B C     
2511 O  O     . GLN B 27  ? 0.1831 0.2944 0.2548 -0.0259 0.0342  -0.0191 258 GLN B O     
2512 C  CB    . GLN B 27  ? 0.2077 0.3113 0.3056 -0.0226 0.0410  -0.0361 258 GLN B CB    
2513 C  CG    . GLN B 27  ? 0.2147 0.3523 0.3551 -0.0390 0.0336  -0.0500 258 GLN B CG    
2514 C  CD    . GLN B 27  ? 0.3064 0.3803 0.4256 -0.0594 0.0328  -0.0178 258 GLN B CD    
2515 O  OE1   . GLN B 27  ? 0.3542 0.4018 0.4490 -0.0557 0.0389  0.0041  258 GLN B OE1   
2516 N  NE2   . GLN B 27  ? 0.3122 0.3927 0.4638 -0.0800 0.0481  -0.0062 258 GLN B NE2   
2517 N  N     . PHE B 28  ? 0.1772 0.2574 0.2538 -0.0425 0.0187  -0.0158 259 PHE B N     
2518 C  CA    . PHE B 28  ? 0.1569 0.2364 0.2469 -0.0339 0.0160  -0.0118 259 PHE B CA    
2519 C  C     . PHE B 28  ? 0.2218 0.2603 0.2265 -0.0151 0.0246  0.0055  259 PHE B C     
2520 O  O     . PHE B 28  ? 0.2094 0.2887 0.2385 -0.0116 0.0136  -0.0020 259 PHE B O     
2521 C  CB    . PHE B 28  ? 0.1739 0.2441 0.2614 -0.0155 -0.0017 0.0016  259 PHE B CB    
2522 C  CG    . PHE B 28  ? 0.1988 0.2374 0.2226 -0.0045 -0.0064 0.0006  259 PHE B CG    
2523 C  CD1   . PHE B 28  ? 0.2208 0.2570 0.2112 -0.0003 -0.0013 -0.0070 259 PHE B CD1   
2524 C  CD2   . PHE B 28  ? 0.2251 0.2660 0.2163 -0.0050 -0.0184 -0.0055 259 PHE B CD2   
2525 C  CE1   . PHE B 28  ? 0.2078 0.2671 0.2043 -0.0190 -0.0046 -0.0116 259 PHE B CE1   
2526 C  CE2   . PHE B 28  ? 0.2127 0.2585 0.2158 0.0089  -0.0332 -0.0121 259 PHE B CE2   
2527 C  CZ    . PHE B 28  ? 0.2031 0.2743 0.2085 -0.0073 -0.0139 -0.0126 259 PHE B CZ    
2528 N  N     . SER B 29  ? 0.2678 0.2815 0.2155 -0.0011 0.0348  0.0034  260 SER B N     
2529 C  CA    . SER B 29  ? 0.2979 0.3309 0.2365 0.0293  0.0532  0.0041  260 SER B CA    
2530 C  C     . SER B 29  ? 0.2665 0.3506 0.2464 0.0524  0.0638  0.0124  260 SER B C     
2531 O  O     . SER B 29  ? 0.3007 0.3733 0.2587 0.0911  0.0514  0.0171  260 SER B O     
2532 C  CB    . SER B 29  ? 0.3453 0.3491 0.2632 0.0527  0.1017  0.0017  260 SER B CB    
2533 O  OG    . SER B 29  ? 0.3994 0.3827 0.2999 0.0406  0.0862  0.0213  260 SER B OG    
2534 N  N     . GLN B 30  ? 0.2445 0.3533 0.2523 0.0331  0.0471  0.0096  261 GLN B N     
2535 C  CA    . GLN B 30  ? 0.2306 0.3916 0.2846 0.0113  0.0345  0.0255  261 GLN B CA    
2536 C  C     . GLN B 30  ? 0.2063 0.4134 0.2747 0.0001  0.0190  0.0228  261 GLN B C     
2537 O  O     . GLN B 30  ? 0.2173 0.4156 0.2985 0.0240  0.0081  0.0169  261 GLN B O     
2538 C  CB    . GLN B 30  ? 0.2672 0.4296 0.3404 -0.0123 0.0052  0.0340  261 GLN B CB    
2539 C  CG    . GLN B 30  ? 0.3598 0.4687 0.4017 -0.0163 -0.0076 0.0307  261 GLN B CG    
2540 C  CD    . GLN B 30  ? 0.4898 0.5085 0.4561 -0.0053 -0.0170 0.0330  261 GLN B CD    
2541 O  OE1   . GLN B 30  ? 0.5401 0.5218 0.4830 0.0020  -0.0310 0.0151  261 GLN B OE1   
2542 N  NE2   . GLN B 30  ? 0.5400 0.5246 0.4854 0.0015  -0.0294 0.0377  261 GLN B NE2   
2543 N  N     . LEU B 31  ? 0.1853 0.4429 0.2563 -0.0271 0.0418  0.0587  262 LEU B N     
2544 C  CA    . LEU B 31  ? 0.2316 0.4676 0.2735 -0.0353 0.0342  0.0679  262 LEU B CA    
2545 C  C     . LEU B 31  ? 0.2545 0.4536 0.2613 -0.0463 0.0005  0.0770  262 LEU B C     
2546 O  O     . LEU B 31  ? 0.2227 0.4640 0.2668 -0.0230 -0.0106 0.0796  262 LEU B O     
2547 C  CB    . LEU B 31  ? 0.2263 0.4946 0.3218 -0.0252 0.0362  0.0470  262 LEU B CB    
2548 C  CG    . LEU B 31  ? 0.2009 0.5025 0.3549 0.0042  0.0477  0.0345  262 LEU B CG    
2549 C  CD1   . LEU B 31  ? 0.1591 0.4953 0.3425 0.0236  0.0457  0.0610  262 LEU B CD1   
2550 C  CD2   . LEU B 31  ? 0.2130 0.5074 0.3736 -0.0018 0.0585  0.0177  262 LEU B CD2   
2551 N  N     . GLU B 32  ? 0.3430 0.4325 0.2746 -0.0716 -0.0247 0.0624  263 GLU B N     
2552 C  CA    . GLU B 32  ? 0.4084 0.4160 0.2893 -0.0704 -0.0473 0.0298  263 GLU B CA    
2553 C  C     . GLU B 32  ? 0.4189 0.3795 0.3200 -0.0504 -0.0115 0.0180  263 GLU B C     
2554 O  O     . GLU B 32  ? 0.4309 0.3847 0.3532 -0.0493 -0.0389 0.0270  263 GLU B O     
2555 C  CB    . GLU B 32  ? 0.4799 0.4388 0.3016 -0.0751 -0.0509 0.0227  263 GLU B CB    
2556 C  CG    . GLU B 32  ? 0.4884 0.4622 0.3132 -0.0863 -0.0295 -0.0016 263 GLU B CG    
2557 C  CD    . GLU B 32  ? 0.4724 0.4658 0.3126 -0.0743 0.0088  -0.0233 263 GLU B CD    
2558 O  OE1   . GLU B 32  ? 0.4761 0.4397 0.2914 -0.0441 0.0457  -0.0158 263 GLU B OE1   
2559 O  OE2   . GLU B 32  ? 0.4469 0.4965 0.3352 -0.0574 0.0226  -0.0464 263 GLU B OE2   
2560 N  N     . ASP B 33  ? 0.3911 0.3401 0.3127 -0.0558 0.0284  0.0085  264 ASP B N     
2561 C  CA    . ASP B 33  ? 0.3893 0.3523 0.3489 -0.0552 0.0706  0.0167  264 ASP B CA    
2562 C  C     . ASP B 33  ? 0.3170 0.3524 0.3553 -0.0419 0.0781  0.0108  264 ASP B C     
2563 O  O     . ASP B 33  ? 0.3320 0.3690 0.3894 -0.0079 0.1063  0.0019  264 ASP B O     
2564 C  CB    . ASP B 33  ? 0.4432 0.3853 0.3848 -0.0710 0.0823  0.0395  264 ASP B CB    
2565 C  CG    . ASP B 33  ? 0.5229 0.4366 0.4280 -0.0750 0.0693  0.0494  264 ASP B CG    
2566 O  OD1   . ASP B 33  ? 0.5806 0.4678 0.4302 -0.0649 0.0760  0.0350  264 ASP B OD1   
2567 O  OD2   . ASP B 33  ? 0.5219 0.4668 0.4527 -0.0933 0.0522  0.0688  264 ASP B OD2   
2568 N  N     . LYS B 34  ? 0.2526 0.3198 0.3201 -0.0556 0.0756  -0.0001 265 LYS B N     
2569 C  CA    . LYS B 34  ? 0.2488 0.3160 0.3294 -0.0436 0.0616  -0.0030 265 LYS B CA    
2570 C  C     . LYS B 34  ? 0.2172 0.3119 0.3045 -0.0369 0.0368  -0.0055 265 LYS B C     
2571 O  O     . LYS B 34  ? 0.2170 0.3273 0.3289 -0.0226 0.0240  -0.0103 265 LYS B O     
2572 C  CB    . LYS B 34  ? 0.3302 0.3254 0.3635 -0.0353 0.0426  0.0018  265 LYS B CB    
2573 C  CG    . LYS B 34  ? 0.4022 0.3830 0.4065 -0.0270 0.0452  0.0055  265 LYS B CG    
2574 C  CD    . LYS B 34  ? 0.4661 0.4334 0.4564 -0.0001 0.0129  0.0070  265 LYS B CD    
2575 C  CE    . LYS B 34  ? 0.5132 0.4765 0.4999 -0.0075 -0.0003 0.0135  265 LYS B CE    
2576 N  NZ    . LYS B 34  ? 0.5319 0.4932 0.5262 -0.0046 -0.0079 0.0157  265 LYS B NZ    
2577 N  N     . PHE B 35  ? 0.1958 0.2936 0.2545 -0.0651 0.0252  -0.0056 266 PHE B N     
2578 C  CA    . PHE B 35  ? 0.1587 0.2931 0.2410 -0.0377 0.0263  -0.0012 266 PHE B CA    
2579 C  C     . PHE B 35  ? 0.1593 0.3007 0.2597 -0.0127 0.0229  0.0043  266 PHE B C     
2580 O  O     . PHE B 35  ? 0.1770 0.2910 0.2797 -0.0154 0.0113  0.0072  266 PHE B O     
2581 C  CB    . PHE B 35  ? 0.1479 0.3032 0.2276 -0.0092 0.0064  0.0132  266 PHE B CB    
2582 C  CG    . PHE B 35  ? 0.1485 0.3145 0.2288 0.0078  0.0047  0.0259  266 PHE B CG    
2583 C  CD1   . PHE B 35  ? 0.1487 0.3460 0.2366 0.0309  0.0048  0.0379  266 PHE B CD1   
2584 C  CD2   . PHE B 35  ? 0.1900 0.3060 0.2439 -0.0117 0.0013  0.0075  266 PHE B CD2   
2585 C  CE1   . PHE B 35  ? 0.1265 0.3534 0.2625 0.0127  -0.0052 0.0144  266 PHE B CE1   
2586 C  CE2   . PHE B 35  ? 0.2002 0.3152 0.2481 -0.0270 0.0040  0.0116  266 PHE B CE2   
2587 C  CZ    . PHE B 35  ? 0.1708 0.3341 0.2618 -0.0116 0.0025  0.0103  266 PHE B CZ    
2588 N  N     . PRO B 36  ? 0.1737 0.3252 0.2658 -0.0226 0.0150  -0.0059 267 PRO B N     
2589 C  CA    . PRO B 36  ? 0.1875 0.3329 0.3019 -0.0173 0.0490  -0.0152 267 PRO B CA    
2590 C  C     . PRO B 36  ? 0.1901 0.3212 0.2998 -0.0079 0.0545  -0.0210 267 PRO B C     
2591 O  O     . PRO B 36  ? 0.1956 0.3334 0.3113 -0.0116 0.0427  -0.0017 267 PRO B O     
2592 C  CB    . PRO B 36  ? 0.1824 0.3724 0.3043 -0.0377 0.0525  -0.0220 267 PRO B CB    
2593 C  CG    . PRO B 36  ? 0.1827 0.3774 0.3105 -0.0060 0.0424  -0.0327 267 PRO B CG    
2594 C  CD    . PRO B 36  ? 0.1613 0.3477 0.2936 -0.0207 0.0169  -0.0176 267 PRO B CD    
2595 N  N     . GLY B 37  ? 0.1809 0.2931 0.3028 0.0033  0.0410  -0.0456 268 GLY B N     
2596 C  CA    . GLY B 37  ? 0.1913 0.2999 0.3171 0.0216  0.0496  -0.0427 268 GLY B CA    
2597 C  C     . GLY B 37  ? 0.2016 0.2996 0.3002 0.0063  0.0575  -0.0142 268 GLY B C     
2598 O  O     . GLY B 37  ? 0.2238 0.3090 0.3274 0.0168  0.0461  -0.0194 268 GLY B O     
2599 N  N     . GLN B 38  ? 0.1636 0.2905 0.2863 0.0010  0.0153  -0.0147 269 GLN B N     
2600 C  CA    . GLN B 38  ? 0.1501 0.2760 0.2668 0.0148  -0.0030 -0.0181 269 GLN B CA    
2601 C  C     . GLN B 38  ? 0.1959 0.3105 0.2661 0.0181  0.0187  -0.0271 269 GLN B C     
2602 O  O     . GLN B 38  ? 0.2378 0.3416 0.2635 -0.0088 0.0209  -0.0248 269 GLN B O     
2603 C  CB    . GLN B 38  ? 0.1747 0.2642 0.2419 -0.0037 0.0049  -0.0165 269 GLN B CB    
2604 C  CG    . GLN B 38  ? 0.1709 0.2585 0.2173 -0.0234 -0.0079 -0.0106 269 GLN B CG    
2605 C  CD    . GLN B 38  ? 0.1688 0.2737 0.2348 -0.0150 -0.0069 -0.0186 269 GLN B CD    
2606 O  OE1   . GLN B 38  ? 0.1655 0.3007 0.2512 -0.0440 -0.0059 0.0006  269 GLN B OE1   
2607 N  NE2   . GLN B 38  ? 0.1879 0.2767 0.2570 -0.0076 0.0007  -0.0192 269 GLN B NE2   
2608 N  N     . SER B 39  ? 0.1832 0.3128 0.2702 -0.0027 0.0180  -0.0347 270 SER B N     
2609 C  CA    . SER B 39  ? 0.2188 0.3348 0.2647 -0.0029 0.0094  -0.0293 270 SER B CA    
2610 C  C     . SER B 39  ? 0.2391 0.3220 0.2555 0.0089  0.0120  -0.0437 270 SER B C     
2611 O  O     . SER B 39  ? 0.2438 0.3070 0.2470 0.0328  0.0080  -0.0567 270 SER B O     
2612 C  CB    . SER B 39  ? 0.3127 0.3569 0.2907 -0.0324 -0.0224 0.0113  270 SER B CB    
2613 O  OG    . SER B 39  ? 0.3569 0.3866 0.2990 -0.0307 -0.0471 0.0209  270 SER B OG    
2614 N  N     . SER B 40  ? 0.2588 0.3184 0.2429 -0.0040 0.0121  -0.0262 271 SER B N     
2615 C  CA    . SER B 40  ? 0.2721 0.3249 0.2281 0.0280  0.0306  -0.0397 271 SER B CA    
2616 C  C     . SER B 40  ? 0.2672 0.3028 0.2173 0.0327  0.0046  -0.0233 271 SER B C     
2617 O  O     . SER B 40  ? 0.2831 0.2931 0.2209 0.0367  0.0203  -0.0336 271 SER B O     
2618 C  CB    . SER B 40  ? 0.3720 0.3577 0.2778 0.0171  0.0370  -0.0664 271 SER B CB    
2619 O  OG    . SER B 40  ? 0.4378 0.4071 0.3126 0.0249  0.0434  -0.0798 271 SER B OG    
2620 N  N     . PHE B 41  ? 0.2576 0.2813 0.2196 0.0169  -0.0172 -0.0350 272 PHE B N     
2621 C  CA    . PHE B 41  ? 0.2379 0.2492 0.2163 0.0128  0.0052  -0.0421 272 PHE B CA    
2622 C  C     . PHE B 41  ? 0.2225 0.2569 0.2084 0.0158  -0.0060 -0.0316 272 PHE B C     
2623 O  O     . PHE B 41  ? 0.2072 0.2584 0.2420 0.0194  0.0017  -0.0248 272 PHE B O     
2624 C  CB    . PHE B 41  ? 0.2579 0.2425 0.2356 0.0163  -0.0077 -0.0366 272 PHE B CB    
2625 C  CG    . PHE B 41  ? 0.2457 0.2592 0.2608 0.0283  -0.0103 -0.0233 272 PHE B CG    
2626 C  CD1   . PHE B 41  ? 0.2692 0.2648 0.2476 0.0188  -0.0407 -0.0130 272 PHE B CD1   
2627 C  CD2   . PHE B 41  ? 0.2612 0.2700 0.2765 0.0226  -0.0344 -0.0233 272 PHE B CD2   
2628 C  CE1   . PHE B 41  ? 0.2838 0.2825 0.2632 0.0202  -0.0534 -0.0174 272 PHE B CE1   
2629 C  CE2   . PHE B 41  ? 0.2514 0.2814 0.2884 0.0180  -0.0355 -0.0182 272 PHE B CE2   
2630 C  CZ    . PHE B 41  ? 0.2708 0.2921 0.2756 0.0249  -0.0615 -0.0323 272 PHE B CZ    
2631 N  N     . LEU B 42  ? 0.2328 0.2584 0.1917 0.0011  -0.0210 -0.0326 273 LEU B N     
2632 C  CA    . LEU B 42  ? 0.2237 0.2437 0.1799 0.0116  -0.0347 -0.0186 273 LEU B CA    
2633 C  C     . LEU B 42  ? 0.2238 0.2438 0.1963 0.0208  -0.0015 -0.0036 273 LEU B C     
2634 O  O     . LEU B 42  ? 0.2308 0.2313 0.2033 0.0046  -0.0015 -0.0107 273 LEU B O     
2635 C  CB    . LEU B 42  ? 0.2106 0.2497 0.1819 0.0105  -0.0150 -0.0370 273 LEU B CB    
2636 C  CG    . LEU B 42  ? 0.2196 0.2376 0.1977 0.0135  -0.0089 -0.0131 273 LEU B CG    
2637 C  CD1   . LEU B 42  ? 0.2301 0.2550 0.2287 0.0274  -0.0432 -0.0079 273 LEU B CD1   
2638 C  CD2   . LEU B 42  ? 0.2512 0.2366 0.2196 0.0084  -0.0195 -0.0086 273 LEU B CD2   
2639 N  N     . TRP B 43  ? 0.1996 0.2415 0.1910 0.0051  -0.0030 -0.0158 274 TRP B N     
2640 C  CA    . TRP B 43  ? 0.1843 0.2585 0.1979 0.0119  0.0024  -0.0016 274 TRP B CA    
2641 C  C     . TRP B 43  ? 0.1980 0.2488 0.2020 0.0112  0.0040  -0.0153 274 TRP B C     
2642 O  O     . TRP B 43  ? 0.2275 0.2256 0.2202 0.0096  -0.0021 -0.0358 274 TRP B O     
2643 C  CB    . TRP B 43  ? 0.1803 0.2897 0.2001 -0.0157 0.0052  0.0014  274 TRP B CB    
2644 C  CG    . TRP B 43  ? 0.1824 0.2838 0.2043 -0.0036 0.0040  0.0122  274 TRP B CG    
2645 C  CD1   . TRP B 43  ? 0.2009 0.2772 0.2090 0.0173  -0.0204 0.0107  274 TRP B CD1   
2646 C  CD2   . TRP B 43  ? 0.1887 0.2613 0.2060 0.0103  0.0219  0.0030  274 TRP B CD2   
2647 N  NE1   . TRP B 43  ? 0.1910 0.2720 0.2168 0.0100  -0.0019 -0.0104 274 TRP B NE1   
2648 C  CE2   . TRP B 43  ? 0.1905 0.2630 0.2075 0.0096  0.0147  -0.0060 274 TRP B CE2   
2649 C  CE3   . TRP B 43  ? 0.2129 0.2479 0.2124 -0.0016 0.0168  -0.0083 274 TRP B CE3   
2650 C  CZ2   . TRP B 43  ? 0.2178 0.2557 0.2297 -0.0046 0.0046  -0.0132 274 TRP B CZ2   
2651 C  CZ3   . TRP B 43  ? 0.1812 0.2659 0.2357 0.0093  -0.0160 -0.0111 274 TRP B CZ3   
2652 C  CH2   . TRP B 43  ? 0.2073 0.2777 0.2386 0.0055  0.0087  -0.0043 274 TRP B CH2   
2653 N  N     . GLN B 44  ? 0.2058 0.2410 0.2082 -0.0029 0.0006  -0.0163 275 GLN B N     
2654 C  CA    . GLN B 44  ? 0.2085 0.2559 0.2076 -0.0037 -0.0071 -0.0382 275 GLN B CA    
2655 C  C     . GLN B 44  ? 0.2201 0.2356 0.1961 0.0035  -0.0058 -0.0133 275 GLN B C     
2656 O  O     . GLN B 44  ? 0.2384 0.2260 0.2051 0.0087  -0.0060 -0.0180 275 GLN B O     
2657 C  CB    . GLN B 44  ? 0.2493 0.3106 0.2502 -0.0167 -0.0276 -0.0611 275 GLN B CB    
2658 C  CG    . GLN B 44  ? 0.3788 0.3879 0.3464 -0.0182 -0.0187 -0.0635 275 GLN B CG    
2659 C  CD    . GLN B 44  ? 0.5037 0.4574 0.4242 0.0075  0.0029  -0.0544 275 GLN B CD    
2660 O  OE1   . GLN B 44  ? 0.5605 0.4863 0.4864 0.0128  0.0066  -0.0537 275 GLN B OE1   
2661 N  NE2   . GLN B 44  ? 0.5272 0.4945 0.4272 0.0215  0.0339  -0.0542 275 GLN B NE2   
2662 N  N     . ARG B 45  ? 0.2157 0.2304 0.1691 0.0213  0.0188  -0.0200 276 ARG B N     
2663 C  CA    . ARG B 45  ? 0.2120 0.2053 0.1977 0.0097  -0.0054 -0.0364 276 ARG B CA    
2664 C  C     . ARG B 45  ? 0.2020 0.2067 0.1865 0.0022  -0.0214 -0.0299 276 ARG B C     
2665 O  O     . ARG B 45  ? 0.2032 0.1918 0.1998 0.0116  0.0009  0.0020  276 ARG B O     
2666 C  CB    . ARG B 45  ? 0.2044 0.1727 0.2076 0.0209  -0.0116 -0.0341 276 ARG B CB    
2667 C  CG    . ARG B 45  ? 0.2596 0.2143 0.2641 0.0190  0.0027  -0.0540 276 ARG B CG    
2668 C  CD    . ARG B 45  ? 0.2810 0.2477 0.3487 0.0192  -0.0214 -0.0606 276 ARG B CD    
2669 N  NE    . ARG B 45  ? 0.3220 0.2866 0.4146 0.0138  -0.0225 -0.0460 276 ARG B NE    
2670 C  CZ    . ARG B 45  ? 0.3535 0.2970 0.4501 0.0185  -0.0300 -0.0346 276 ARG B CZ    
2671 N  NH1   . ARG B 45  ? 0.3302 0.2968 0.4713 0.0012  -0.0355 0.0011  276 ARG B NH1   
2672 N  NH2   . ARG B 45  ? 0.4070 0.3292 0.4754 0.0233  -0.0348 -0.0396 276 ARG B NH2   
2673 N  N     . GLY B 46  ? 0.1934 0.2132 0.1550 -0.0232 -0.0210 -0.0268 277 GLY B N     
2674 C  CA    . GLY B 46  ? 0.2017 0.2268 0.1670 -0.0275 -0.0093 -0.0136 277 GLY B CA    
2675 C  C     . GLY B 46  ? 0.1904 0.2362 0.1817 -0.0177 -0.0010 -0.0062 277 GLY B C     
2676 O  O     . GLY B 46  ? 0.1978 0.2399 0.1720 0.0048  0.0064  -0.0212 277 GLY B O     
2677 N  N     . ARG B 47  ? 0.2061 0.2308 0.1627 -0.0027 -0.0085 -0.0006 278 ARG B N     
2678 C  CA    . ARG B 47  ? 0.2100 0.2255 0.1697 0.0132  0.0107  0.0227  278 ARG B CA    
2679 C  C     . ARG B 47  ? 0.2147 0.2226 0.1649 0.0074  0.0023  0.0158  278 ARG B C     
2680 O  O     . ARG B 47  ? 0.2314 0.2077 0.1842 0.0293  0.0190  -0.0131 278 ARG B O     
2681 C  CB    . ARG B 47  ? 0.2296 0.2301 0.2023 0.0178  0.0525  0.0241  278 ARG B CB    
2682 C  CG    . ARG B 47  ? 0.3118 0.2543 0.2456 -0.0061 0.0921  0.0252  278 ARG B CG    
2683 C  CD    . ARG B 47  ? 0.3881 0.2978 0.2859 -0.0065 0.1223  0.0223  278 ARG B CD    
2684 N  NE    . ARG B 47  ? 0.5362 0.3782 0.3635 -0.0601 0.1110  0.0645  278 ARG B NE    
2685 C  CZ    . ARG B 47  ? 0.5963 0.4131 0.4305 -0.0482 0.0997  0.0740  278 ARG B CZ    
2686 N  NH1   . ARG B 47  ? 0.6166 0.4404 0.4715 -0.0223 0.0924  0.0746  278 ARG B NH1   
2687 N  NH2   . ARG B 47  ? 0.6187 0.3957 0.4425 -0.0486 0.1118  0.0780  278 ARG B NH2   
2688 N  N     . LYS B 48  ? 0.2218 0.2399 0.1313 -0.0139 -0.0241 0.0015  279 LYS B N     
2689 C  CA    . LYS B 48  ? 0.1963 0.2559 0.1516 0.0027  0.0050  -0.0212 279 LYS B CA    
2690 C  C     . LYS B 48  ? 0.2208 0.2465 0.1429 0.0084  0.0046  -0.0023 279 LYS B C     
2691 O  O     . LYS B 48  ? 0.2092 0.2371 0.1661 0.0295  0.0149  0.0091  279 LYS B O     
2692 C  CB    . LYS B 48  ? 0.2197 0.2803 0.1587 -0.0025 0.0136  -0.0383 279 LYS B CB    
2693 C  CG    . LYS B 48  ? 0.2595 0.3466 0.1958 -0.0049 0.0232  -0.0766 279 LYS B CG    
2694 C  CD    . LYS B 48  ? 0.3340 0.4066 0.2322 -0.0486 0.0486  -0.0830 279 LYS B CD    
2695 C  CE    . LYS B 48  ? 0.3519 0.4547 0.2505 -0.0467 0.0657  -0.0968 279 LYS B CE    
2696 N  NZ    . LYS B 48  ? 0.3913 0.4985 0.2624 -0.0245 0.0499  -0.0771 279 LYS B NZ    
2697 N  N     . PHE B 49  ? 0.2327 0.2159 0.1466 -0.0046 0.0198  -0.0115 280 PHE B N     
2698 C  CA    . PHE B 49  ? 0.2180 0.2016 0.1563 -0.0031 0.0186  -0.0208 280 PHE B CA    
2699 C  C     . PHE B 49  ? 0.2009 0.1953 0.1728 0.0082  0.0082  -0.0134 280 PHE B C     
2700 O  O     . PHE B 49  ? 0.1805 0.1953 0.1819 0.0073  0.0025  -0.0029 280 PHE B O     
2701 C  CB    . PHE B 49  ? 0.2083 0.2016 0.1279 -0.0083 0.0081  0.0020  280 PHE B CB    
2702 C  CG    . PHE B 49  ? 0.2280 0.2251 0.1370 -0.0257 0.0070  -0.0048 280 PHE B CG    
2703 C  CD1   . PHE B 49  ? 0.2891 0.2745 0.1630 -0.0711 0.0137  -0.0079 280 PHE B CD1   
2704 C  CD2   . PHE B 49  ? 0.2347 0.2079 0.1447 0.0268  0.0194  -0.0278 280 PHE B CD2   
2705 C  CE1   . PHE B 49  ? 0.3023 0.2804 0.1659 -0.0410 0.0091  -0.0196 280 PHE B CE1   
2706 C  CE2   . PHE B 49  ? 0.2092 0.2304 0.1527 0.0342  0.0313  -0.0064 280 PHE B CE2   
2707 C  CZ    . PHE B 49  ? 0.2554 0.2475 0.1545 -0.0139 0.0245  -0.0070 280 PHE B CZ    
2708 N  N     . LEU B 50  ? 0.1829 0.2070 0.1566 -0.0163 -0.0059 -0.0111 281 LEU B N     
2709 C  CA    . LEU B 50  ? 0.1907 0.2171 0.1523 -0.0145 -0.0223 -0.0132 281 LEU B CA    
2710 C  C     . LEU B 50  ? 0.1776 0.2100 0.1542 -0.0032 0.0069  -0.0196 281 LEU B C     
2711 O  O     . LEU B 50  ? 0.1898 0.2023 0.1644 0.0032  -0.0137 -0.0304 281 LEU B O     
2712 C  CB    . LEU B 50  ? 0.1946 0.2455 0.1672 -0.0154 -0.0457 0.0006  281 LEU B CB    
2713 C  CG    . LEU B 50  ? 0.1532 0.2651 0.1753 0.0013  -0.0182 0.0021  281 LEU B CG    
2714 C  CD1   . LEU B 50  ? 0.1652 0.2970 0.1927 -0.0225 -0.0250 -0.0110 281 LEU B CD1   
2715 C  CD2   . LEU B 50  ? 0.1995 0.2702 0.1741 -0.0052 0.0057  -0.0109 281 LEU B CD2   
2716 N  N     . GLN B 51  ? 0.1852 0.2139 0.1519 0.0053  -0.0114 0.0144  282 GLN B N     
2717 C  CA    . GLN B 51  ? 0.2024 0.2539 0.1526 0.0257  -0.0065 0.0303  282 GLN B CA    
2718 C  C     . GLN B 51  ? 0.2099 0.2393 0.1708 0.0110  -0.0058 0.0211  282 GLN B C     
2719 O  O     . GLN B 51  ? 0.2299 0.2200 0.1790 0.0273  -0.0209 0.0097  282 GLN B O     
2720 C  CB    . GLN B 51  ? 0.2566 0.3522 0.1579 0.0204  0.0183  0.0419  282 GLN B CB    
2721 C  CG    . GLN B 51  ? 0.3147 0.4327 0.1987 -0.0519 0.0428  -0.0236 282 GLN B CG    
2722 C  CD    . GLN B 51  ? 0.3683 0.4794 0.2538 -0.1079 0.0572  -0.0490 282 GLN B CD    
2723 O  OE1   . GLN B 51  ? 0.4018 0.5166 0.2921 -0.1524 0.0498  -0.0736 282 GLN B OE1   
2724 N  NE2   . GLN B 51  ? 0.3781 0.4624 0.2391 -0.1226 0.0417  -0.0727 282 GLN B NE2   
2725 N  N     . LYS B 52  ? 0.1964 0.2434 0.1514 -0.0117 -0.0201 -0.0139 283 LYS B N     
2726 C  CA    . LYS B 52  ? 0.1988 0.2582 0.1823 -0.0162 -0.0101 -0.0175 283 LYS B CA    
2727 C  C     . LYS B 52  ? 0.1755 0.2273 0.1620 0.0184  -0.0445 -0.0105 283 LYS B C     
2728 O  O     . LYS B 52  ? 0.1939 0.2477 0.2030 0.0262  -0.0454 0.0065  283 LYS B O     
2729 C  CB    . LYS B 52  ? 0.2093 0.2804 0.2260 -0.0241 -0.0225 -0.0282 283 LYS B CB    
2730 C  CG    . LYS B 52  ? 0.2341 0.3256 0.2408 -0.0201 -0.0303 -0.0094 283 LYS B CG    
2731 C  CD    . LYS B 52  ? 0.2392 0.3431 0.2754 -0.0131 -0.0721 -0.0027 283 LYS B CD    
2732 C  CE    . LYS B 52  ? 0.2954 0.3621 0.3456 -0.0241 -0.0439 -0.0104 283 LYS B CE    
2733 N  NZ    . LYS B 52  ? 0.3361 0.3904 0.3967 -0.0065 -0.0092 -0.0107 283 LYS B NZ    
2734 N  N     . HIS B 53  ? 0.2007 0.2021 0.1441 -0.0113 -0.0136 0.0015  284 HIS B N     
2735 C  CA    A HIS B 53  ? 0.2096 0.2029 0.1701 -0.0049 -0.0186 0.0009  284 HIS B CA    
2736 C  CA    B HIS B 53  ? 0.2056 0.2116 0.1668 0.0062  -0.0211 0.0058  284 HIS B CA    
2737 C  C     . HIS B 53  ? 0.2033 0.2234 0.1844 0.0019  -0.0102 -0.0029 284 HIS B C     
2738 O  O     . HIS B 53  ? 0.1891 0.2440 0.2065 0.0055  0.0053  0.0147  284 HIS B O     
2739 C  CB    A HIS B 53  ? 0.2166 0.2117 0.1773 -0.0093 -0.0122 -0.0092 284 HIS B CB    
2740 C  CB    B HIS B 53  ? 0.2083 0.2316 0.1700 0.0218  -0.0259 0.0072  284 HIS B CB    
2741 C  CG    A HIS B 53  ? 0.2146 0.2082 0.1717 -0.0144 0.0074  0.0047  284 HIS B CG    
2742 C  CG    B HIS B 53  ? 0.2075 0.2436 0.1624 0.0346  -0.0200 0.0262  284 HIS B CG    
2743 N  ND1   A HIS B 53  ? 0.2450 0.2155 0.1804 -0.0122 0.0106  0.0141  284 HIS B ND1   
2744 N  ND1   B HIS B 53  ? 0.2181 0.2666 0.1710 0.0271  -0.0138 0.0171  284 HIS B ND1   
2745 C  CD2   A HIS B 53  ? 0.2052 0.2018 0.1772 -0.0328 0.0234  0.0188  284 HIS B CD2   
2746 C  CD2   B HIS B 53  ? 0.1849 0.2450 0.1546 0.0051  -0.0013 0.0377  284 HIS B CD2   
2747 C  CE1   A HIS B 53  ? 0.2176 0.1954 0.1636 -0.0179 0.0631  0.0280  284 HIS B CE1   
2748 C  CE1   B HIS B 53  ? 0.1691 0.2683 0.1455 0.0186  -0.0267 0.0113  284 HIS B CE1   
2749 N  NE2   A HIS B 53  ? 0.2118 0.1769 0.1568 -0.0387 0.0649  0.0217  284 HIS B NE2   
2750 N  NE2   B HIS B 53  ? 0.2006 0.2779 0.1603 0.0208  -0.0239 0.0276  284 HIS B NE2   
2751 N  N     . LEU B 54  ? 0.2064 0.2351 0.1869 -0.0070 -0.0083 -0.0036 285 LEU B N     
2752 C  CA    . LEU B 54  ? 0.1813 0.2406 0.2199 0.0042  0.0039  -0.0026 285 LEU B CA    
2753 C  C     . LEU B 54  ? 0.2059 0.2624 0.2342 0.0017  0.0015  0.0114  285 LEU B C     
2754 O  O     . LEU B 54  ? 0.2101 0.2689 0.2638 -0.0150 0.0032  0.0318  285 LEU B O     
2755 C  CB    . LEU B 54  ? 0.1747 0.2530 0.2273 -0.0029 -0.0232 -0.0047 285 LEU B CB    
2756 C  CG    . LEU B 54  ? 0.1839 0.2749 0.2149 0.0076  -0.0041 -0.0114 285 LEU B CG    
2757 C  CD1   . LEU B 54  ? 0.1860 0.3098 0.2474 -0.0226 0.0250  0.0074  285 LEU B CD1   
2758 C  CD2   . LEU B 54  ? 0.2559 0.2793 0.2356 0.0030  -0.0389 -0.0288 285 LEU B CD2   
2759 N  N     . ASN B 55  ? 0.2149 0.2741 0.2149 0.0041  -0.0249 0.0333  286 ASN B N     
2760 C  CA    . ASN B 55  ? 0.2304 0.3048 0.2521 0.0512  -0.0323 0.0384  286 ASN B CA    
2761 C  C     . ASN B 55  ? 0.2185 0.3112 0.2631 0.0437  -0.0220 0.0601  286 ASN B C     
2762 O  O     . ASN B 55  ? 0.2477 0.3436 0.2909 0.0449  -0.0132 0.0841  286 ASN B O     
2763 C  CB    . ASN B 55  ? 0.3142 0.3706 0.2787 0.0529  -0.0283 0.0742  286 ASN B CB    
2764 C  CG    . ASN B 55  ? 0.4030 0.4332 0.3490 0.0371  -0.0052 0.0776  286 ASN B CG    
2765 O  OD1   . ASN B 55  ? 0.4312 0.4638 0.3762 -0.0171 0.0452  0.1159  286 ASN B OD1   
2766 N  ND2   . ASN B 55  ? 0.4258 0.4695 0.3664 0.0682  -0.0219 0.0561  286 ASN B ND2   
2767 N  N     . ALA B 56  ? 0.2044 0.2900 0.2564 0.0203  0.0076  0.0473  287 ALA B N     
2768 C  CA    . ALA B 56  ? 0.2324 0.2943 0.2624 0.0202  -0.0020 0.0550  287 ALA B CA    
2769 C  C     . ALA B 56  ? 0.2895 0.3245 0.3068 0.0388  0.0276  0.0630  287 ALA B C     
2770 O  O     . ALA B 56  ? 0.3136 0.3224 0.3444 0.0462  0.0195  0.0497  287 ALA B O     
2771 C  CB    . ALA B 56  ? 0.2481 0.2799 0.2541 -0.0263 0.0144  0.0694  287 ALA B CB    
2772 N  N     . SER B 57  ? 0.3588 0.3785 0.3415 0.0689  0.0732  0.0797  288 SER B N     
2773 C  CA    . SER B 57  ? 0.4491 0.4256 0.3969 0.0699  0.0733  0.0638  288 SER B CA    
2774 C  C     . SER B 57  ? 0.4544 0.4353 0.4197 0.0549  0.1112  0.0727  288 SER B C     
2775 O  O     . SER B 57  ? 0.5018 0.4474 0.4434 0.0426  0.1285  0.0510  288 SER B O     
2776 C  CB    . SER B 57  ? 0.5047 0.4661 0.4330 0.0692  0.0121  0.0375  288 SER B CB    
2777 O  OG    . SER B 57  ? 0.5615 0.5097 0.4761 0.0507  -0.0420 0.0323  288 SER B OG    
2778 N  N     . ASN B 58  ? 0.4084 0.4155 0.4112 0.0482  0.1056  0.1084  289 ASN B N     
2779 C  CA    . ASN B 58  ? 0.4177 0.4309 0.3956 0.0386  0.0692  0.1149  289 ASN B CA    
2780 C  C     . ASN B 58  ? 0.3722 0.4064 0.3241 0.0001  0.0327  0.1243  289 ASN B C     
2781 O  O     . ASN B 58  ? 0.3577 0.4092 0.3099 0.0089  -0.0338 0.1233  289 ASN B O     
2782 C  CB    . ASN B 58  ? 0.5120 0.4672 0.4461 0.0524  0.0549  0.1218  289 ASN B CB    
2783 C  CG    . ASN B 58  ? 0.5874 0.5132 0.4780 0.0582  0.0350  0.1281  289 ASN B CG    
2784 O  OD1   . ASN B 58  ? 0.6256 0.5335 0.4994 0.0693  0.0260  0.1449  289 ASN B OD1   
2785 N  ND2   . ASN B 58  ? 0.6180 0.5253 0.4936 0.0558  0.0302  0.1158  289 ASN B ND2   
2786 N  N     . PRO B 59  ? 0.3787 0.3849 0.2937 -0.0057 0.0085  0.0919  290 PRO B N     
2787 C  CA    . PRO B 59  ? 0.3468 0.3570 0.2677 -0.0247 -0.0266 0.0996  290 PRO B CA    
2788 C  C     . PRO B 59  ? 0.3214 0.3302 0.2233 -0.0508 -0.0374 0.0859  290 PRO B C     
2789 O  O     . PRO B 59  ? 0.3630 0.3374 0.2530 -0.1030 -0.0200 0.0573  290 PRO B O     
2790 C  CB    . PRO B 59  ? 0.3771 0.3654 0.2795 -0.0258 -0.0334 0.0940  290 PRO B CB    
2791 C  CG    . PRO B 59  ? 0.4210 0.3878 0.2843 -0.0204 -0.0295 0.0712  290 PRO B CG    
2792 C  CD    . PRO B 59  ? 0.4013 0.3896 0.2907 0.0017  -0.0070 0.0741  290 PRO B CD    
2793 N  N     . THR B 60  ? 0.3012 0.3134 0.2044 0.0137  -0.0502 0.0876  291 THR B N     
2794 C  CA    . THR B 60  ? 0.2889 0.3137 0.1903 0.0016  -0.0408 0.0534  291 THR B CA    
2795 C  C     . THR B 60  ? 0.2407 0.2562 0.1889 0.0027  -0.0300 0.0329  291 THR B C     
2796 O  O     . THR B 60  ? 0.2185 0.2218 0.1673 -0.0016 -0.0238 0.0345  291 THR B O     
2797 C  CB    . THR B 60  ? 0.3075 0.3831 0.2247 -0.0070 -0.0617 0.0283  291 THR B CB    
2798 O  OG1   . THR B 60  ? 0.3608 0.3957 0.2311 -0.0399 -0.0449 -0.0485 291 THR B OG1   
2799 C  CG2   . THR B 60  ? 0.3359 0.4298 0.2370 0.0043  -0.0776 0.0558  291 THR B CG2   
2800 N  N     . GLU B 61  ? 0.2019 0.2251 0.1849 -0.0132 -0.0263 0.0131  292 GLU B N     
2801 C  CA    . GLU B 61  ? 0.2071 0.2240 0.1868 -0.0111 -0.0203 -0.0122 292 GLU B CA    
2802 C  C     . GLU B 61  ? 0.1902 0.2046 0.1574 0.0012  0.0239  0.0081  292 GLU B C     
2803 O  O     . GLU B 61  ? 0.1921 0.2037 0.1665 -0.0241 0.0325  0.0144  292 GLU B O     
2804 C  CB    . GLU B 61  ? 0.2378 0.2508 0.2084 -0.0221 0.0312  -0.0455 292 GLU B CB    
2805 C  CG    . GLU B 61  ? 0.2732 0.2833 0.2404 -0.0441 0.0561  -0.0455 292 GLU B CG    
2806 C  CD    . GLU B 61  ? 0.3232 0.3212 0.2947 -0.0051 0.0468  -0.0267 292 GLU B CD    
2807 O  OE1   . GLU B 61  ? 0.3390 0.3259 0.3537 0.0030  0.0886  0.0358  292 GLU B OE1   
2808 O  OE2   . GLU B 61  ? 0.4266 0.3532 0.3419 -0.0101 0.0142  -0.0697 292 GLU B OE2   
2809 N  N     . PRO B 62  ? 0.1836 0.2212 0.1539 -0.0167 0.0227  -0.0012 293 PRO B N     
2810 C  CA    . PRO B 62  ? 0.1480 0.2215 0.1470 -0.0020 0.0196  -0.0044 293 PRO B CA    
2811 C  C     . PRO B 62  ? 0.1769 0.2092 0.1650 -0.0097 0.0002  -0.0009 293 PRO B C     
2812 O  O     . PRO B 62  ? 0.1957 0.2334 0.2128 -0.0066 -0.0096 -0.0109 293 PRO B O     
2813 C  CB    . PRO B 62  ? 0.2210 0.2603 0.1656 -0.0282 0.0100  -0.0044 293 PRO B CB    
2814 C  CG    . PRO B 62  ? 0.2119 0.2740 0.1720 -0.0194 0.0152  0.0169  293 PRO B CG    
2815 C  CD    . PRO B 62  ? 0.2069 0.2531 0.1848 0.0019  0.0206  0.0173  293 PRO B CD    
2816 N  N     . ALA B 63  ? 0.1722 0.2078 0.1635 0.0195  0.0139  0.0036  294 ALA B N     
2817 C  CA    . ALA B 63  ? 0.2132 0.1783 0.1790 0.0251  -0.0046 0.0092  294 ALA B CA    
2818 C  C     . ALA B 63  ? 0.2332 0.1835 0.1858 0.0147  -0.0371 -0.0022 294 ALA B C     
2819 O  O     . ALA B 63  ? 0.3126 0.2007 0.2136 0.0161  -0.0595 -0.0260 294 ALA B O     
2820 C  CB    . ALA B 63  ? 0.2039 0.1976 0.1868 0.0130  0.0000  0.0085  294 ALA B CB    
2821 N  N     . THR B 64  ? 0.1808 0.1650 0.1748 0.0263  -0.0258 -0.0043 295 THR B N     
2822 C  CA    . THR B 64  ? 0.1855 0.1594 0.1701 0.0144  -0.0024 0.0372  295 THR B CA    
2823 C  C     . THR B 64  ? 0.1735 0.1701 0.1576 0.0069  -0.0198 -0.0124 295 THR B C     
2824 O  O     . THR B 64  ? 0.2093 0.1871 0.1660 0.0182  -0.0425 -0.0238 295 THR B O     
2825 C  CB    . THR B 64  ? 0.2247 0.1677 0.1836 0.0061  0.0038  0.0176  295 THR B CB    
2826 O  OG1   . THR B 64  ? 0.2417 0.1950 0.2060 0.0133  -0.0078 -0.0215 295 THR B OG1   
2827 C  CG2   . THR B 64  ? 0.2295 0.1691 0.1792 0.0693  -0.0091 0.0231  295 THR B CG2   
2828 N  N     A ILE B 65  ? 0.1550 0.1632 0.1696 0.0109  0.0091  -0.0050 296 ILE B N     
2829 N  N     B ILE B 65  ? 0.1652 0.1745 0.1647 0.0094  -0.0131 -0.0069 296 ILE B N     
2830 C  CA    A ILE B 65  ? 0.1424 0.1648 0.1664 0.0148  0.0310  0.0072  296 ILE B CA    
2831 C  CA    B ILE B 65  ? 0.1573 0.1860 0.1617 -0.0142 -0.0053 0.0021  296 ILE B CA    
2832 C  C     A ILE B 65  ? 0.1257 0.1675 0.1733 0.0324  0.0113  -0.0151 296 ILE B C     
2833 C  C     B ILE B 65  ? 0.1527 0.1670 0.1652 -0.0086 -0.0181 -0.0104 296 ILE B C     
2834 O  O     A ILE B 65  ? 0.1353 0.1938 0.1859 0.0234  0.0045  -0.0083 296 ILE B O     
2835 O  O     B ILE B 65  ? 0.1830 0.1648 0.1558 -0.0316 -0.0322 -0.0089 296 ILE B O     
2836 C  CB    A ILE B 65  ? 0.1787 0.1748 0.1709 0.0087  0.0294  0.0146  296 ILE B CB    
2837 C  CB    B ILE B 65  ? 0.1795 0.2246 0.1655 -0.0460 -0.0118 -0.0037 296 ILE B CB    
2838 C  CG1   A ILE B 65  ? 0.2450 0.1678 0.1742 -0.0002 -0.0017 0.0529  296 ILE B CG1   
2839 C  CG1   B ILE B 65  ? 0.1978 0.2533 0.1596 -0.0572 -0.0190 0.0094  296 ILE B CG1   
2840 C  CG2   A ILE B 65  ? 0.1719 0.1844 0.1609 0.0231  0.0342  -0.0031 296 ILE B CG2   
2841 C  CG2   B ILE B 65  ? 0.1795 0.2318 0.1633 -0.0594 -0.0225 -0.0080 296 ILE B CG2   
2842 C  CD1   A ILE B 65  ? 0.2875 0.1819 0.1781 -0.0068 -0.0051 0.0751  296 ILE B CD1   
2843 C  CD1   B ILE B 65  ? 0.2068 0.2616 0.1554 -0.0531 -0.0435 0.0222  296 ILE B CD1   
2844 N  N     . ILE B 66  ? 0.1419 0.1631 0.1912 0.0163  -0.0108 0.0015  297 ILE B N     
2845 C  CA    . ILE B 66  ? 0.1124 0.1712 0.2128 0.0028  0.0107  0.0061  297 ILE B CA    
2846 C  C     . ILE B 66  ? 0.1186 0.2021 0.1934 -0.0063 -0.0115 -0.0044 297 ILE B C     
2847 O  O     . ILE B 66  ? 0.1541 0.2484 0.1944 -0.0106 -0.0130 -0.0382 297 ILE B O     
2848 C  CB    . ILE B 66  ? 0.1246 0.1875 0.2177 -0.0067 0.0099  0.0047  297 ILE B CB    
2849 C  CG1   . ILE B 66  ? 0.1559 0.1935 0.2206 -0.0214 0.0084  -0.0046 297 ILE B CG1   
2850 C  CG2   . ILE B 66  ? 0.1510 0.2157 0.2458 0.0205  -0.0074 0.0217  297 ILE B CG2   
2851 C  CD1   . ILE B 66  ? 0.1712 0.1872 0.2218 -0.0368 0.0004  -0.0089 297 ILE B CD1   
2852 N  N     . PHE B 67  ? 0.1227 0.1934 0.2081 -0.0060 -0.0031 0.0109  298 PHE B N     
2853 C  CA    . PHE B 67  ? 0.1178 0.1722 0.1921 -0.0055 0.0071  0.0053  298 PHE B CA    
2854 C  C     . PHE B 67  ? 0.1274 0.1661 0.1707 0.0047  -0.0019 -0.0003 298 PHE B C     
2855 O  O     . PHE B 67  ? 0.1404 0.2001 0.1796 0.0379  -0.0001 0.0030  298 PHE B O     
2856 C  CB    . PHE B 67  ? 0.1213 0.1714 0.1994 -0.0173 -0.0080 0.0041  298 PHE B CB    
2857 C  CG    . PHE B 67  ? 0.1323 0.1722 0.1874 0.0048  0.0092  0.0063  298 PHE B CG    
2858 C  CD1   . PHE B 67  ? 0.1508 0.2001 0.1715 0.0007  0.0009  -0.0018 298 PHE B CD1   
2859 C  CD2   . PHE B 67  ? 0.1952 0.1908 0.2134 0.0154  0.0074  -0.0041 298 PHE B CD2   
2860 C  CE1   . PHE B 67  ? 0.1752 0.2177 0.2046 -0.0080 -0.0062 0.0083  298 PHE B CE1   
2861 C  CE2   . PHE B 67  ? 0.2321 0.2158 0.2176 -0.0132 0.0128  -0.0167 298 PHE B CE2   
2862 C  CZ    . PHE B 67  ? 0.1860 0.2110 0.2097 -0.0357 0.0153  0.0057  298 PHE B CZ    
2863 N  N     . THR B 68  ? 0.1263 0.1684 0.1994 0.0386  -0.0139 0.0019  299 THR B N     
2864 C  CA    . THR B 68  ? 0.1116 0.1928 0.1978 0.0219  -0.0166 -0.0037 299 THR B CA    
2865 C  C     . THR B 68  ? 0.1229 0.1998 0.1963 0.0269  -0.0051 -0.0075 299 THR B C     
2866 O  O     . THR B 68  ? 0.1340 0.2616 0.2043 0.0306  -0.0005 0.0040  299 THR B O     
2867 C  CB    . THR B 68  ? 0.1679 0.2090 0.2005 -0.0083 -0.0210 0.0086  299 THR B CB    
2868 O  OG1   . THR B 68  ? 0.1778 0.2221 0.2139 0.0193  -0.0050 0.0182  299 THR B OG1   
2869 C  CG2   . THR B 68  ? 0.1917 0.2238 0.2111 -0.0197 -0.0112 -0.0239 299 THR B CG2   
2870 N  N     . ALA B 69  ? 0.1334 0.2012 0.2186 0.0234  -0.0212 -0.0050 300 ALA B N     
2871 C  CA    . ALA B 69  ? 0.1363 0.1856 0.2273 0.0381  -0.0135 0.0143  300 ALA B CA    
2872 C  C     . ALA B 69  ? 0.1217 0.1941 0.2454 0.0478  0.0008  0.0160  300 ALA B C     
2873 O  O     . ALA B 69  ? 0.1389 0.2188 0.2635 0.0316  0.0058  0.0106  300 ALA B O     
2874 C  CB    . ALA B 69  ? 0.1695 0.1889 0.2294 0.0023  -0.0147 0.0146  300 ALA B CB    
2875 N  N     . ALA B 70  ? 0.1335 0.2202 0.2574 0.0445  -0.0023 0.0085  301 ALA B N     
2876 C  CA    . ALA B 70  ? 0.1751 0.2234 0.2592 0.0556  -0.0166 0.0230  301 ALA B CA    
2877 C  C     . ALA B 70  ? 0.1654 0.2125 0.2594 0.0454  -0.0063 0.0274  301 ALA B C     
2878 O  O     . ALA B 70  ? 0.1816 0.2177 0.2675 0.0406  -0.0107 0.0203  301 ALA B O     
2879 C  CB    . ALA B 70  ? 0.2176 0.2208 0.2715 0.0539  -0.0240 0.0075  301 ALA B CB    
2880 N  N     . ARG B 71  ? 0.1735 0.2501 0.2705 0.0521  -0.0242 0.0188  302 ARG B N     
2881 C  CA    . ARG B 71  ? 0.1855 0.2678 0.2921 0.0353  -0.0538 0.0500  302 ARG B CA    
2882 C  C     . ARG B 71  ? 0.1937 0.2458 0.3111 0.0206  -0.0450 0.0255  302 ARG B C     
2883 O  O     . ARG B 71  ? 0.2334 0.2337 0.3211 0.0130  -0.0528 0.0230  302 ARG B O     
2884 C  CB    . ARG B 71  ? 0.2089 0.3057 0.3075 0.0442  -0.0660 0.0639  302 ARG B CB    
2885 C  CG    . ARG B 71  ? 0.2430 0.3447 0.3283 0.0039  -0.0544 0.0761  302 ARG B CG    
2886 C  CD    . ARG B 71  ? 0.3421 0.4062 0.3708 -0.0013 -0.0579 0.0587  302 ARG B CD    
2887 N  NE    . ARG B 71  ? 0.4108 0.4635 0.4110 0.0114  -0.0540 0.0474  302 ARG B NE    
2888 C  CZ    . ARG B 71  ? 0.4340 0.4964 0.4217 -0.0030 -0.0748 0.0262  302 ARG B CZ    
2889 N  NH1   . ARG B 71  ? 0.4590 0.5070 0.4404 -0.0108 -0.0938 0.0291  302 ARG B NH1   
2890 N  NH2   . ARG B 71  ? 0.4136 0.5075 0.4177 0.0006  -0.0636 0.0274  302 ARG B NH2   
2891 N  N     . GLU B 72  ? 0.1566 0.2434 0.3134 0.0189  -0.0072 0.0051  303 GLU B N     
2892 C  CA    . GLU B 72  ? 0.1645 0.2561 0.3361 0.0484  -0.0015 0.0049  303 GLU B CA    
2893 C  C     . GLU B 72  ? 0.1681 0.2612 0.3313 0.0228  -0.0250 0.0243  303 GLU B C     
2894 O  O     . GLU B 72  ? 0.1832 0.2675 0.3538 0.0035  -0.0438 0.0330  303 GLU B O     
2895 C  CB    . GLU B 72  ? 0.1789 0.2854 0.3617 0.0552  -0.0002 -0.0053 303 GLU B CB    
2896 C  CG    . GLU B 72  ? 0.1987 0.3200 0.3903 0.0631  -0.0074 -0.0096 303 GLU B CG    
2897 C  CD    . GLU B 72  ? 0.2072 0.3856 0.4371 0.0700  -0.0249 -0.0205 303 GLU B CD    
2898 O  OE1   . GLU B 72  ? 0.2314 0.4031 0.4512 0.0586  -0.0230 -0.0186 303 GLU B OE1   
2899 O  OE2   . GLU B 72  ? 0.2535 0.4305 0.4775 0.0837  -0.0278 -0.0369 303 GLU B OE2   
2900 N  N     . GLY B 73  ? 0.1561 0.2423 0.2925 0.0433  -0.0364 0.0194  304 GLY B N     
2901 C  CA    . GLY B 73  ? 0.1733 0.2597 0.2822 0.0407  -0.0160 0.0158  304 GLY B CA    
2902 C  C     . GLY B 73  ? 0.1649 0.2509 0.2668 0.0183  -0.0234 0.0128  304 GLY B C     
2903 O  O     . GLY B 73  ? 0.1571 0.2215 0.2741 0.0127  -0.0436 -0.0097 304 GLY B O     
2904 N  N     . ARG B 74  ? 0.1761 0.2723 0.2497 0.0166  -0.0110 0.0159  305 ARG B N     
2905 C  CA    . ARG B 74  ? 0.2012 0.2821 0.2491 0.0062  -0.0154 0.0207  305 ARG B CA    
2906 C  C     . ARG B 74  ? 0.1731 0.2644 0.2512 0.0094  -0.0212 0.0102  305 ARG B C     
2907 O  O     . ARG B 74  ? 0.1766 0.2645 0.2616 0.0265  -0.0430 0.0037  305 ARG B O     
2908 C  CB    . ARG B 74  ? 0.2601 0.3273 0.2664 0.0051  -0.0190 0.0172  305 ARG B CB    
2909 C  CG    . ARG B 74  ? 0.3021 0.3583 0.2711 -0.0071 -0.0582 0.0308  305 ARG B CG    
2910 C  CD    . ARG B 74  ? 0.3443 0.4164 0.2909 0.0068  -0.0689 0.0259  305 ARG B CD    
2911 N  NE    . ARG B 74  ? 0.3866 0.4293 0.2927 0.0144  -0.0700 0.0255  305 ARG B NE    
2912 C  CZ    . ARG B 74  ? 0.4479 0.4529 0.3418 0.0326  -0.0720 0.0276  305 ARG B CZ    
2913 N  NH1   . ARG B 74  ? 0.4646 0.4767 0.3528 0.0271  -0.0587 0.0310  305 ARG B NH1   
2914 N  NH2   . ARG B 74  ? 0.4771 0.4429 0.3622 0.0416  -0.0770 0.0273  305 ARG B NH2   
2915 N  N     A GLU B 75  ? 0.1484 0.2577 0.2398 -0.0039 -0.0127 0.0184  306 GLU B N     
2916 N  N     B GLU B 75  ? 0.1728 0.2645 0.2478 0.0040  -0.0113 0.0062  306 GLU B N     
2917 C  CA    A GLU B 75  ? 0.1234 0.2665 0.2492 -0.0021 -0.0328 0.0060  306 GLU B CA    
2918 C  CA    B GLU B 75  ? 0.1722 0.2735 0.2576 0.0039  -0.0161 -0.0074 306 GLU B CA    
2919 C  C     A GLU B 75  ? 0.1283 0.2564 0.2580 0.0173  -0.0339 0.0069  306 GLU B C     
2920 C  C     B GLU B 75  ? 0.1517 0.2603 0.2588 0.0113  -0.0237 -0.0036 306 GLU B C     
2921 O  O     A GLU B 75  ? 0.1421 0.2309 0.2599 0.0232  -0.0278 0.0048  306 GLU B O     
2922 O  O     B GLU B 75  ? 0.1668 0.2444 0.2629 0.0101  -0.0163 -0.0087 306 GLU B O     
2923 C  CB    A GLU B 75  ? 0.1422 0.2992 0.2586 -0.0022 -0.0638 -0.0015 306 GLU B CB    
2924 C  CB    B GLU B 75  ? 0.2119 0.3025 0.2728 0.0055  -0.0175 -0.0218 306 GLU B CB    
2925 C  CG    A GLU B 75  ? 0.2143 0.3251 0.2631 0.0319  -0.0803 0.0074  306 GLU B CG    
2926 C  CG    B GLU B 75  ? 0.2602 0.3276 0.2828 0.0228  -0.0220 -0.0260 306 GLU B CG    
2927 C  CD    A GLU B 75  ? 0.3287 0.3663 0.2939 0.0351  -0.0709 0.0081  306 GLU B CD    
2928 C  CD    B GLU B 75  ? 0.3010 0.3589 0.3016 0.0223  -0.0231 -0.0390 306 GLU B CD    
2929 O  OE1   A GLU B 75  ? 0.3885 0.4052 0.3147 0.0202  -0.0678 -0.0223 306 GLU B OE1   
2930 O  OE1   B GLU B 75  ? 0.3246 0.3888 0.3163 0.0289  -0.0232 -0.0478 306 GLU B OE1   
2931 O  OE2   A GLU B 75  ? 0.3574 0.3795 0.2923 0.0182  -0.0471 0.0156  306 GLU B OE2   
2932 O  OE2   B GLU B 75  ? 0.3087 0.3659 0.3074 0.0278  -0.0312 -0.0550 306 GLU B OE2   
2933 N  N     . THR B 76  ? 0.1235 0.2526 0.2427 0.0080  -0.0306 -0.0003 307 THR B N     
2934 C  CA    . THR B 76  ? 0.1230 0.2357 0.2404 0.0126  -0.0177 -0.0024 307 THR B CA    
2935 C  C     . THR B 76  ? 0.1189 0.2350 0.2245 -0.0072 -0.0112 -0.0018 307 THR B C     
2936 O  O     . THR B 76  ? 0.1474 0.2317 0.2223 0.0121  -0.0078 0.0073  307 THR B O     
2937 C  CB    . THR B 76  ? 0.1260 0.2610 0.2513 0.0165  -0.0253 -0.0051 307 THR B CB    
2938 O  OG1   . THR B 76  ? 0.1416 0.2699 0.2806 0.0268  -0.0176 -0.0081 307 THR B OG1   
2939 C  CG2   . THR B 76  ? 0.1380 0.2630 0.2597 0.0242  -0.0378 0.0228  307 THR B CG2   
2940 N  N     . LEU B 77  ? 0.1150 0.2500 0.2431 -0.0331 -0.0018 -0.0034 308 LEU B N     
2941 C  CA    . LEU B 77  ? 0.1303 0.2332 0.2333 -0.0312 0.0190  0.0124  308 LEU B CA    
2942 C  C     . LEU B 77  ? 0.1376 0.2256 0.2153 -0.0005 -0.0165 0.0145  308 LEU B C     
2943 O  O     . LEU B 77  ? 0.1252 0.2107 0.2153 0.0109  -0.0138 0.0281  308 LEU B O     
2944 C  CB    . LEU B 77  ? 0.1344 0.2246 0.2300 -0.0220 0.0074  0.0220  308 LEU B CB    
2945 C  CG    . LEU B 77  ? 0.1297 0.2203 0.1960 -0.0340 0.0158  0.0283  308 LEU B CG    
2946 C  CD1   . LEU B 77  ? 0.1712 0.2161 0.1657 -0.0116 -0.0286 0.0222  308 LEU B CD1   
2947 C  CD2   . LEU B 77  ? 0.1687 0.2215 0.2173 -0.0406 0.0235  0.0296  308 LEU B CD2   
2948 N  N     A LYS B 78  ? 0.1457 0.2383 0.2072 -0.0084 -0.0001 0.0102  309 LYS B N     
2949 N  N     B LYS B 78  ? 0.1427 0.2287 0.2136 -0.0081 -0.0068 -0.0049 309 LYS B N     
2950 C  CA    A LYS B 78  ? 0.1774 0.2476 0.2024 -0.0148 -0.0058 0.0178  309 LYS B CA    
2951 C  CA    B LYS B 78  ? 0.1775 0.2272 0.2147 -0.0167 -0.0261 -0.0135 309 LYS B CA    
2952 C  C     A LYS B 78  ? 0.1684 0.2309 0.2112 -0.0040 -0.0119 0.0096  309 LYS B C     
2953 C  C     B LYS B 78  ? 0.1700 0.2208 0.2202 -0.0117 -0.0152 -0.0038 309 LYS B C     
2954 O  O     A LYS B 78  ? 0.1681 0.2349 0.2286 0.0170  -0.0222 0.0134  309 LYS B O     
2955 O  O     B LYS B 78  ? 0.1789 0.2252 0.2437 -0.0016 -0.0084 -0.0004 309 LYS B O     
2956 C  CB    A LYS B 78  ? 0.2015 0.2871 0.1944 -0.0246 -0.0039 0.0293  309 LYS B CB    
2957 C  CB    B LYS B 78  ? 0.1991 0.2432 0.2134 -0.0208 -0.0555 -0.0356 309 LYS B CB    
2958 C  CG    A LYS B 78  ? 0.2502 0.3317 0.2150 -0.0208 -0.0140 0.0245  309 LYS B CG    
2959 C  CG    B LYS B 78  ? 0.2406 0.2671 0.2427 -0.0233 -0.0873 -0.0669 309 LYS B CG    
2960 C  CD    A LYS B 78  ? 0.2827 0.3681 0.2243 -0.0299 -0.0264 0.0297  309 LYS B CD    
2961 C  CD    B LYS B 78  ? 0.3069 0.3153 0.2937 -0.0117 -0.0897 -0.0731 309 LYS B CD    
2962 C  CE    A LYS B 78  ? 0.3226 0.3955 0.2235 -0.0325 -0.0405 0.0168  309 LYS B CE    
2963 C  CE    B LYS B 78  ? 0.3506 0.3540 0.3443 -0.0054 -0.0783 -0.0663 309 LYS B CE    
2964 N  NZ    A LYS B 78  ? 0.3353 0.4174 0.2246 -0.0262 -0.0586 0.0107  309 LYS B NZ    
2965 N  NZ    B LYS B 78  ? 0.3850 0.3862 0.3726 0.0143  -0.0747 -0.0584 309 LYS B NZ    
2966 N  N     . CYS B 79  ? 0.1592 0.2147 0.2011 -0.0120 -0.0212 -0.0108 310 CYS B N     
2967 C  CA    . CYS B 79  ? 0.1647 0.2295 0.2418 -0.0077 -0.0261 0.0098  310 CYS B CA    
2968 C  C     . CYS B 79  ? 0.1631 0.2182 0.2249 -0.0035 -0.0258 -0.0100 310 CYS B C     
2969 O  O     . CYS B 79  ? 0.1601 0.2148 0.2153 -0.0015 -0.0210 -0.0139 310 CYS B O     
2970 C  CB    . CYS B 79  ? 0.1795 0.2864 0.2921 -0.0461 -0.0560 0.0498  310 CYS B CB    
2971 S  SG    . CYS B 79  ? 0.2200 0.3734 0.3547 -0.0402 -0.0124 0.0430  310 CYS B SG    
2972 N  N     . LEU B 80  ? 0.1370 0.2030 0.2004 -0.0160 -0.0016 -0.0101 311 LEU B N     
2973 C  CA    . LEU B 80  ? 0.1423 0.1929 0.1840 -0.0045 -0.0079 -0.0084 311 LEU B CA    
2974 C  C     . LEU B 80  ? 0.1476 0.1851 0.1839 0.0109  0.0085  0.0073  311 LEU B C     
2975 O  O     . LEU B 80  ? 0.1617 0.1978 0.1927 0.0144  -0.0014 0.0083  311 LEU B O     
2976 C  CB    . LEU B 80  ? 0.1805 0.2125 0.1970 0.0063  -0.0266 -0.0374 311 LEU B CB    
2977 C  CG    . LEU B 80  ? 0.2195 0.2252 0.2145 0.0118  -0.0190 -0.0247 311 LEU B CG    
2978 C  CD1   . LEU B 80  ? 0.1817 0.2654 0.2222 0.0014  0.0007  -0.0122 311 LEU B CD1   
2979 C  CD2   . LEU B 80  ? 0.3130 0.2540 0.2657 0.0383  -0.0397 -0.0287 311 LEU B CD2   
2980 N  N     A SER B 81  ? 0.1532 0.2051 0.1800 -0.0008 0.0304  -0.0046 312 SER B N     
2981 N  N     B SER B 81  ? 0.1497 0.1834 0.1807 0.0051  0.0072  -0.0015 312 SER B N     
2982 C  CA    A SER B 81  ? 0.1370 0.1728 0.1791 -0.0064 0.0191  0.0202  312 SER B CA    
2983 C  CA    B SER B 81  ? 0.1397 0.1611 0.1787 0.0014  -0.0061 0.0034  312 SER B CA    
2984 C  C     A SER B 81  ? 0.1509 0.1779 0.1851 0.0030  -0.0112 0.0017  312 SER B C     
2985 C  C     B SER B 81  ? 0.1502 0.1622 0.1827 -0.0037 -0.0140 -0.0032 312 SER B C     
2986 O  O     A SER B 81  ? 0.1563 0.1809 0.1989 0.0013  -0.0326 0.0180  312 SER B O     
2987 O  O     B SER B 81  ? 0.1536 0.1649 0.1889 -0.0036 -0.0211 0.0015  312 SER B O     
2988 C  CB    A SER B 81  ? 0.1565 0.1848 0.1788 -0.0248 -0.0028 0.0156  312 SER B CB    
2989 C  CB    B SER B 81  ? 0.1343 0.1573 0.1728 -0.0037 -0.0228 -0.0052 312 SER B CB    
2990 O  OG    A SER B 81  ? 0.1353 0.1872 0.1870 -0.0064 -0.0034 0.0125  312 SER B OG    
2991 O  OG    B SER B 81  ? 0.1080 0.1458 0.1666 0.0103  -0.0293 -0.0116 312 SER B OG    
2992 N  N     . HIS B 82  ? 0.1562 0.1495 0.1801 -0.0247 -0.0116 -0.0025 313 HIS B N     
2993 C  CA    . HIS B 82  ? 0.1535 0.1735 0.1808 -0.0241 -0.0267 -0.0034 313 HIS B CA    
2994 C  C     . HIS B 82  ? 0.1450 0.1974 0.1895 0.0042  -0.0180 -0.0087 313 HIS B C     
2995 O  O     . HIS B 82  ? 0.1711 0.1995 0.1961 0.0065  -0.0230 0.0001  313 HIS B O     
2996 C  CB    . HIS B 82  ? 0.1959 0.2036 0.2101 -0.0314 -0.0440 -0.0140 313 HIS B CB    
2997 C  CG    . HIS B 82  ? 0.2506 0.2376 0.2434 -0.0398 -0.0499 -0.0228 313 HIS B CG    
2998 N  ND1   . HIS B 82  ? 0.2968 0.2722 0.2909 -0.0340 -0.0195 -0.0326 313 HIS B ND1   
2999 C  CD2   . HIS B 82  ? 0.2820 0.2410 0.2656 -0.0275 -0.0858 -0.0050 313 HIS B CD2   
3000 C  CE1   . HIS B 82  ? 0.3159 0.2504 0.2791 -0.0256 -0.0311 -0.0266 313 HIS B CE1   
3001 N  NE2   . HIS B 82  ? 0.3171 0.2549 0.2862 -0.0199 -0.0525 -0.0146 313 HIS B NE2   
3002 N  N     . HIS B 83  ? 0.1514 0.2218 0.1796 -0.0119 -0.0173 -0.0223 314 HIS B N     
3003 C  CA    . HIS B 83  ? 0.1338 0.2429 0.2138 -0.0011 0.0064  -0.0006 314 HIS B CA    
3004 C  C     . HIS B 83  ? 0.1614 0.2090 0.1986 -0.0188 0.0012  -0.0049 314 HIS B C     
3005 O  O     . HIS B 83  ? 0.1848 0.1934 0.1963 0.0048  -0.0176 0.0068  314 HIS B O     
3006 C  CB    . HIS B 83  ? 0.1423 0.3000 0.2551 -0.0229 0.0126  0.0234  314 HIS B CB    
3007 C  CG    . HIS B 83  ? 0.1802 0.3461 0.3575 -0.0478 -0.0089 0.0712  314 HIS B CG    
3008 N  ND1   . HIS B 83  ? 0.2708 0.3656 0.3961 -0.0754 -0.0057 0.0682  314 HIS B ND1   
3009 C  CD2   . HIS B 83  ? 0.2319 0.3709 0.4057 -0.0707 -0.0219 0.0676  314 HIS B CD2   
3010 C  CE1   . HIS B 83  ? 0.2605 0.3868 0.4176 -0.0517 -0.0262 0.0809  314 HIS B CE1   
3011 N  NE2   . HIS B 83  ? 0.2625 0.3946 0.4288 -0.0548 -0.0146 0.0653  314 HIS B NE2   
3012 N  N     . VAL B 84  ? 0.1417 0.1857 0.1717 -0.0204 -0.0018 -0.0218 315 VAL B N     
3013 C  CA    . VAL B 84  ? 0.1470 0.1896 0.1865 -0.0125 -0.0058 -0.0196 315 VAL B CA    
3014 C  C     . VAL B 84  ? 0.1673 0.1865 0.1793 0.0139  0.0124  0.0000  315 VAL B C     
3015 O  O     . VAL B 84  ? 0.1752 0.1749 0.2025 -0.0107 -0.0151 0.0093  315 VAL B O     
3016 C  CB    . VAL B 84  ? 0.1298 0.1834 0.1963 -0.0135 -0.0067 -0.0280 315 VAL B CB    
3017 C  CG1   . VAL B 84  ? 0.1375 0.1909 0.2073 -0.0162 -0.0190 -0.0286 315 VAL B CG1   
3018 C  CG2   . VAL B 84  ? 0.1442 0.2148 0.2157 -0.0053 0.0130  -0.0366 315 VAL B CG2   
3019 N  N     . ALA B 85  ? 0.1652 0.1870 0.1658 -0.0162 0.0218  -0.0159 316 ALA B N     
3020 C  CA    . ALA B 85  ? 0.1686 0.1804 0.1626 -0.0032 0.0248  -0.0045 316 ALA B CA    
3021 C  C     . ALA B 85  ? 0.1646 0.1766 0.1799 0.0076  0.0016  0.0097  316 ALA B C     
3022 O  O     . ALA B 85  ? 0.1896 0.1708 0.1908 0.0022  -0.0216 0.0217  316 ALA B O     
3023 C  CB    . ALA B 85  ? 0.1893 0.1900 0.1623 0.0061  0.0220  -0.0030 316 ALA B CB    
3024 N  N     . ASP B 86  ? 0.1662 0.1701 0.1917 -0.0333 0.0055  0.0042  317 ASP B N     
3025 C  CA    . ASP B 86  ? 0.1694 0.1871 0.2171 -0.0333 -0.0065 0.0147  317 ASP B CA    
3026 C  C     . ASP B 86  ? 0.1913 0.1793 0.2110 -0.0007 0.0064  0.0318  317 ASP B C     
3027 O  O     . ASP B 86  ? 0.2220 0.1660 0.2246 0.0037  -0.0111 0.0091  317 ASP B O     
3028 C  CB    . ASP B 86  ? 0.1685 0.2022 0.2576 -0.0508 -0.0030 0.0208  317 ASP B CB    
3029 C  CG    . ASP B 86  ? 0.2341 0.2628 0.3209 -0.0464 0.0349  0.0262  317 ASP B CG    
3030 O  OD1   . ASP B 86  ? 0.2851 0.2690 0.2992 -0.0290 0.0291  0.0124  317 ASP B OD1   
3031 O  OD2   . ASP B 86  ? 0.3239 0.3167 0.4219 -0.0615 0.0694  0.0026  317 ASP B OD2   
3032 N  N     . ALA B 87  ? 0.1796 0.1942 0.1956 -0.0072 -0.0120 0.0260  318 ALA B N     
3033 C  CA    . ALA B 87  ? 0.2124 0.1949 0.1884 -0.0114 -0.0088 0.0047  318 ALA B CA    
3034 C  C     . ALA B 87  ? 0.2187 0.1889 0.1859 -0.0119 -0.0241 0.0130  318 ALA B C     
3035 O  O     . ALA B 87  ? 0.2486 0.1791 0.1786 0.0268  -0.0194 0.0154  318 ALA B O     
3036 C  CB    . ALA B 87  ? 0.2486 0.1966 0.1910 0.0134  -0.0035 -0.0088 318 ALA B CB    
3037 N  N     . TYR B 88  ? 0.1783 0.1951 0.2022 -0.0586 -0.0317 0.0148  319 TYR B N     
3038 C  CA    . TYR B 88  ? 0.1877 0.1833 0.2127 -0.0476 -0.0210 0.0103  319 TYR B CA    
3039 C  C     . TYR B 88  ? 0.1899 0.1903 0.2092 -0.0103 -0.0469 0.0139  319 TYR B C     
3040 O  O     . TYR B 88  ? 0.2140 0.1906 0.2355 -0.0062 -0.0501 0.0161  319 TYR B O     
3041 C  CB    . TYR B 88  ? 0.1892 0.2176 0.1937 -0.0620 -0.0198 0.0033  319 TYR B CB    
3042 C  CG    . TYR B 88  ? 0.1930 0.2255 0.1950 -0.0322 -0.0270 0.0270  319 TYR B CG    
3043 C  CD1   . TYR B 88  ? 0.1913 0.2450 0.1915 -0.0521 -0.0342 0.0455  319 TYR B CD1   
3044 C  CD2   . TYR B 88  ? 0.2439 0.2551 0.1777 -0.0170 -0.0235 0.0102  319 TYR B CD2   
3045 C  CE1   . TYR B 88  ? 0.1764 0.2616 0.2159 -0.0230 -0.0094 0.0490  319 TYR B CE1   
3046 C  CE2   . TYR B 88  ? 0.2319 0.2927 0.2151 -0.0051 -0.0093 0.0135  319 TYR B CE2   
3047 C  CZ    . TYR B 88  ? 0.1850 0.3174 0.2300 -0.0142 -0.0174 0.0264  319 TYR B CZ    
3048 O  OH    . TYR B 88  ? 0.2254 0.3992 0.2891 0.0053  -0.0175 0.0373  319 TYR B OH    
3049 N  N     . THR B 89  ? 0.1933 0.2067 0.1698 -0.0170 -0.0064 0.0073  320 THR B N     
3050 C  CA    . THR B 89  ? 0.1735 0.2022 0.1565 0.0057  0.0134  0.0045  320 THR B CA    
3051 C  C     . THR B 89  ? 0.2020 0.1848 0.1711 -0.0237 0.0094  0.0201  320 THR B C     
3052 O  O     . THR B 89  ? 0.2247 0.2139 0.1698 -0.0376 -0.0123 -0.0081 320 THR B O     
3053 C  CB    . THR B 89  ? 0.1905 0.2454 0.1724 -0.0128 0.0254  -0.0043 320 THR B CB    
3054 O  OG1   . THR B 89  ? 0.2073 0.2090 0.1938 -0.0194 0.0060  0.0288  320 THR B OG1   
3055 C  CG2   . THR B 89  ? 0.2179 0.3054 0.1658 -0.0438 0.0295  -0.0056 320 THR B CG2   
3056 N  N     A SER B 90  ? 0.1923 0.1898 0.1910 -0.0210 0.0287  0.0167  321 SER B N     
3057 N  N     B SER B 90  ? 0.1817 0.1871 0.1852 -0.0251 0.0284  0.0203  321 SER B N     
3058 C  CA    A SER B 90  ? 0.2117 0.1957 0.2045 -0.0252 0.0497  0.0218  321 SER B CA    
3059 C  CA    B SER B 90  ? 0.1975 0.1976 0.1925 -0.0347 0.0477  0.0318  321 SER B CA    
3060 C  C     A SER B 90  ? 0.2245 0.1965 0.2075 -0.0546 0.0411  0.0281  321 SER B C     
3061 C  C     B SER B 90  ? 0.2177 0.2185 0.1960 -0.0452 0.0410  0.0348  321 SER B C     
3062 O  O     A SER B 90  ? 0.2453 0.2115 0.2289 -0.0590 0.0245  0.0272  321 SER B O     
3063 O  O     B SER B 90  ? 0.2410 0.2769 0.2059 -0.0168 0.0115  0.0289  321 SER B O     
3064 C  CB    A SER B 90  ? 0.2322 0.1990 0.2102 -0.0107 0.0770  -0.0028 321 SER B CB    
3065 C  CB    B SER B 90  ? 0.2435 0.2025 0.2050 -0.0344 0.0639  0.0268  321 SER B CB    
3066 O  OG    A SER B 90  ? 0.2456 0.2024 0.2251 -0.0095 0.0753  -0.0233 321 SER B OG    
3067 O  OG    B SER B 90  ? 0.2674 0.2111 0.2056 -0.0294 0.0570  0.0465  321 SER B OG    
3068 N  N     . SER B 91  ? 0.2583 0.1863 0.2055 -0.0272 0.0165  0.0496  322 SER B N     
3069 C  CA    . SER B 91  ? 0.3284 0.2324 0.2459 -0.0614 0.0102  0.0223  322 SER B CA    
3070 C  C     . SER B 91  ? 0.3132 0.2479 0.2514 -0.0787 0.0243  0.0394  322 SER B C     
3071 O  O     . SER B 91  ? 0.2991 0.2714 0.2647 -0.0714 0.0285  0.0576  322 SER B O     
3072 C  CB    . SER B 91  ? 0.3570 0.2686 0.2579 -0.0920 0.0564  0.0059  322 SER B CB    
3073 O  OG    . SER B 91  ? 0.3477 0.3459 0.2877 -0.0774 0.0423  0.0052  322 SER B OG    
3074 N  N     . GLN B 92  ? 0.3669 0.2658 0.2424 -0.0825 -0.0154 0.0197  323 GLN B N     
3075 C  CA    . GLN B 92  ? 0.3762 0.2703 0.2423 -0.0522 0.0132  -0.0074 323 GLN B CA    
3076 C  C     . GLN B 92  ? 0.4248 0.2566 0.2474 -0.0511 0.0666  -0.0156 323 GLN B C     
3077 O  O     . GLN B 92  ? 0.4583 0.2744 0.2415 -0.0317 0.1342  -0.0187 323 GLN B O     
3078 C  CB    . GLN B 92  ? 0.3495 0.2984 0.2825 -0.0754 -0.0374 0.0209  323 GLN B CB    
3079 C  CG    . GLN B 92  ? 0.3016 0.2974 0.3050 -0.0897 -0.0713 0.0214  323 GLN B CG    
3080 C  CD    . GLN B 92  ? 0.3473 0.3055 0.3643 -0.0934 -0.0590 -0.0109 323 GLN B CD    
3081 O  OE1   . GLN B 92  ? 0.3976 0.3439 0.4300 -0.0779 -0.0444 -0.0234 323 GLN B OE1   
3082 N  NE2   . GLN B 92  ? 0.3430 0.3159 0.3860 -0.0901 -0.0366 -0.0068 323 GLN B NE2   
3083 N  N     . LYS B 93  ? 0.3741 0.2004 0.2113 -0.0914 0.0731  -0.0218 324 LYS B N     
3084 C  CA    . LYS B 93  ? 0.2818 0.1899 0.2316 -0.0573 0.0661  -0.0149 324 LYS B CA    
3085 C  C     . LYS B 93  ? 0.2243 0.2003 0.2156 -0.0513 0.0235  0.0068  324 LYS B C     
3086 O  O     . LYS B 93  ? 0.2046 0.2351 0.2398 -0.0303 -0.0005 0.0231  324 LYS B O     
3087 C  CB    . LYS B 93  ? 0.2760 0.1952 0.2540 -0.0395 0.0656  -0.0082 324 LYS B CB    
3088 C  CG    . LYS B 93  ? 0.2650 0.2115 0.2482 -0.0063 0.0697  -0.0232 324 LYS B CG    
3089 C  CD    . LYS B 93  ? 0.2240 0.1815 0.2351 0.0058  0.0468  -0.0353 324 LYS B CD    
3090 C  CE    . LYS B 93  ? 0.2109 0.1578 0.2359 0.0058  0.0095  -0.0011 324 LYS B CE    
3091 N  NZ    . LYS B 93  ? 0.2110 0.1339 0.2095 0.0240  -0.0116 0.0121  324 LYS B NZ    
3092 N  N     . VAL B 94  ? 0.1960 0.1799 0.2027 -0.0526 0.0201  -0.0141 325 VAL B N     
3093 C  CA    . VAL B 94  ? 0.2129 0.1684 0.2200 -0.0417 -0.0138 0.0216  325 VAL B CA    
3094 C  C     . VAL B 94  ? 0.2122 0.1729 0.2305 -0.0362 -0.0034 0.0173  325 VAL B C     
3095 O  O     . VAL B 94  ? 0.2139 0.1987 0.2357 -0.0253 -0.0012 -0.0024 325 VAL B O     
3096 C  CB    . VAL B 94  ? 0.2057 0.1581 0.2523 -0.0310 -0.0008 0.0403  325 VAL B CB    
3097 C  CG1   . VAL B 94  ? 0.2321 0.1662 0.2751 -0.0293 0.0122  0.0504  325 VAL B CG1   
3098 C  CG2   . VAL B 94  ? 0.2220 0.1955 0.2622 -0.0099 0.0061  0.0077  325 VAL B CG2   
3099 N  N     . SER B 95  ? 0.1974 0.1584 0.2315 -0.0241 -0.0090 0.0430  326 SER B N     
3100 C  CA    . SER B 95  ? 0.1785 0.1835 0.2552 -0.0386 -0.0128 0.0267  326 SER B CA    
3101 C  C     . SER B 95  ? 0.1629 0.1899 0.1940 -0.0352 0.0053  0.0073  326 SER B C     
3102 O  O     . SER B 95  ? 0.1581 0.2093 0.1980 -0.0332 0.0011  -0.0052 326 SER B O     
3103 C  CB    . SER B 95  ? 0.1712 0.2134 0.3622 -0.0511 -0.0604 0.0400  326 SER B CB    
3104 O  OG    . SER B 95  ? 0.2768 0.2977 0.4219 -0.0399 -0.0460 0.0038  326 SER B OG    
3105 N  N     . PRO B 96  ? 0.1778 0.1837 0.1776 -0.0368 0.0128  -0.0004 327 PRO B N     
3106 C  CA    . PRO B 96  ? 0.2073 0.1799 0.1688 -0.0206 0.0497  -0.0101 327 PRO B CA    
3107 C  C     . PRO B 96  ? 0.1945 0.1834 0.1537 -0.0192 0.0150  -0.0150 327 PRO B C     
3108 O  O     . PRO B 96  ? 0.2106 0.1997 0.1914 -0.0419 -0.0266 -0.0151 327 PRO B O     
3109 C  CB    . PRO B 96  ? 0.2467 0.1938 0.2261 0.0203  0.0499  -0.0042 327 PRO B CB    
3110 C  CG    . PRO B 96  ? 0.2518 0.1709 0.2404 0.0169  0.0428  -0.0023 327 PRO B CG    
3111 C  CD    . PRO B 96  ? 0.2113 0.1647 0.2164 -0.0020 0.0217  -0.0102 327 PRO B CD    
3112 N  N     . ILE B 97  ? 0.1841 0.1792 0.1488 -0.0250 0.0174  -0.0040 328 ILE B N     
3113 C  CA    . ILE B 97  ? 0.1748 0.1847 0.1718 -0.0018 0.0047  -0.0086 328 ILE B CA    
3114 C  C     . ILE B 97  ? 0.1818 0.1904 0.1871 -0.0178 -0.0400 -0.0135 328 ILE B C     
3115 O  O     . ILE B 97  ? 0.2433 0.2135 0.2124 0.0169  -0.0646 -0.0226 328 ILE B O     
3116 C  CB    . ILE B 97  ? 0.1770 0.1820 0.1837 -0.0023 0.0178  0.0277  328 ILE B CB    
3117 C  CG1   . ILE B 97  ? 0.1671 0.1736 0.2062 0.0147  0.0167  -0.0057 328 ILE B CG1   
3118 C  CG2   . ILE B 97  ? 0.2094 0.2105 0.1723 -0.0231 0.0146  0.0284  328 ILE B CG2   
3119 C  CD1   . ILE B 97  ? 0.1955 0.1745 0.2466 -0.0048 -0.0072 -0.0438 328 ILE B CD1   
3120 N  N     . GLN B 98  ? 0.1767 0.2085 0.2098 0.0032  -0.0463 0.0179  329 GLN B N     
3121 C  CA    . GLN B 98  ? 0.1794 0.2258 0.2155 -0.0023 -0.0476 0.0060  329 GLN B CA    
3122 C  C     . GLN B 98  ? 0.2049 0.2087 0.1854 -0.0185 -0.0359 -0.0077 329 GLN B C     
3123 O  O     . GLN B 98  ? 0.2962 0.2134 0.1959 0.0131  -0.0230 -0.0305 329 GLN B O     
3124 C  CB    . GLN B 98  ? 0.2006 0.2506 0.2790 -0.0017 -0.0192 0.0091  329 GLN B CB    
3125 C  CG    . GLN B 98  ? 0.2181 0.2967 0.3524 -0.0014 -0.0372 -0.0104 329 GLN B CG    
3126 C  CD    . GLN B 98  ? 0.3156 0.3574 0.4263 -0.0191 -0.0609 -0.0223 329 GLN B CD    
3127 O  OE1   . GLN B 98  ? 0.3757 0.3993 0.4823 -0.0393 -0.0452 -0.0475 329 GLN B OE1   
3128 N  NE2   . GLN B 98  ? 0.3716 0.4057 0.4481 -0.0480 -0.0691 -0.0029 329 GLN B NE2   
3129 N  N     . ILE B 99  ? 0.1669 0.2053 0.1754 -0.0218 -0.0125 -0.0006 330 ILE B N     
3130 C  CA    . ILE B 99  ? 0.1697 0.2168 0.2024 0.0015  0.0011  0.0038  330 ILE B CA    
3131 C  C     . ILE B 99  ? 0.1947 0.2203 0.1827 0.0075  -0.0154 0.0061  330 ILE B C     
3132 O  O     . ILE B 99  ? 0.2246 0.2194 0.1798 0.0149  -0.0483 -0.0223 330 ILE B O     
3133 C  CB    . ILE B 99  ? 0.1731 0.2573 0.2748 0.0172  0.0395  0.0278  330 ILE B CB    
3134 C  CG1   . ILE B 99  ? 0.1994 0.3154 0.2977 0.0301  0.0182  0.0221  330 ILE B CG1   
3135 C  CG2   . ILE B 99  ? 0.2290 0.2890 0.3089 0.0066  0.0404  0.0461  330 ILE B CG2   
3136 C  CD1   . ILE B 99  ? 0.2145 0.3480 0.3000 0.0326  0.0100  0.0034  330 ILE B CD1   
3137 N  N     . ASP B 100 ? 0.2055 0.2474 0.1964 0.0141  -0.0132 0.0247  331 ASP B N     
3138 C  CA    . ASP B 100 ? 0.2141 0.2756 0.2113 0.0132  -0.0171 0.0279  331 ASP B CA    
3139 C  C     . ASP B 100 ? 0.2202 0.2793 0.2027 0.0238  -0.0101 0.0226  331 ASP B C     
3140 O  O     . ASP B 100 ? 0.2635 0.3033 0.2088 0.0150  -0.0286 0.0116  331 ASP B O     
3141 C  CB    . ASP B 100 ? 0.1948 0.3126 0.2696 0.0041  -0.0287 0.0113  331 ASP B CB    
3142 C  CG    . ASP B 100 ? 0.1939 0.3518 0.3111 -0.0130 -0.0354 0.0028  331 ASP B CG    
3143 O  OD1   . ASP B 100 ? 0.2010 0.3668 0.2859 -0.0037 -0.0127 0.0286  331 ASP B OD1   
3144 O  OD2   . ASP B 100 ? 0.2571 0.3804 0.3930 -0.0057 -0.0151 -0.0075 331 ASP B OD2   
3145 N  N     . GLY B 101 ? 0.1968 0.2717 0.1973 0.0450  -0.0080 0.0312  332 GLY B N     
3146 C  CA    . GLY B 101 ? 0.2042 0.2748 0.2038 0.0391  -0.0229 0.0333  332 GLY B CA    
3147 C  C     . GLY B 101 ? 0.2053 0.3188 0.2113 0.0477  0.0032  0.0458  332 GLY B C     
3148 O  O     . GLY B 101 ? 0.2304 0.3373 0.2253 0.0434  -0.0132 0.0473  332 GLY B O     
3149 N  N     . ALA B 102 ? 0.1887 0.3536 0.2166 0.0564  0.0103  0.0563  333 ALA B N     
3150 C  CA    . ALA B 102 ? 0.1916 0.4200 0.2573 0.0334  -0.0040 0.0811  333 ALA B CA    
3151 C  C     . ALA B 102 ? 0.2140 0.4761 0.2709 0.0256  -0.0142 0.0805  333 ALA B C     
3152 O  O     . ALA B 102 ? 0.2407 0.4864 0.2624 0.0389  -0.0464 0.0476  333 ALA B O     
3153 C  CB    . ALA B 102 ? 0.1848 0.4392 0.2929 0.0451  -0.0133 0.0698  333 ALA B CB    
3154 N  N     . GLY B 103 ? 0.2044 0.5243 0.2890 0.0383  -0.0169 0.1052  334 GLY B N     
3155 C  CA    . GLY B 103 ? 0.2273 0.5648 0.2922 0.0411  -0.0252 0.1140  334 GLY B CA    
3156 C  C     . GLY B 103 ? 0.2380 0.5948 0.2724 0.0160  -0.0394 0.1255  334 GLY B C     
3157 O  O     . GLY B 103 ? 0.2701 0.6472 0.2719 -0.0135 -0.0658 0.1322  334 GLY B O     
3158 N  N     . ARG B 104 ? 0.2066 0.5701 0.2460 0.0447  -0.0433 0.1018  335 ARG B N     
3159 C  CA    . ARG B 104 ? 0.2431 0.5455 0.2248 0.0653  -0.0401 0.0907  335 ARG B CA    
3160 C  C     . ARG B 104 ? 0.2484 0.5415 0.2110 0.0667  -0.0492 0.0939  335 ARG B C     
3161 O  O     . ARG B 104 ? 0.2290 0.5450 0.2054 0.0503  -0.0257 0.0975  335 ARG B O     
3162 C  CB    . ARG B 104 ? 0.2533 0.5091 0.2254 0.0726  -0.0288 0.0758  335 ARG B CB    
3163 C  CG    . ARG B 104 ? 0.2503 0.4783 0.2205 0.0379  -0.0393 0.0684  335 ARG B CG    
3164 C  CD    . ARG B 104 ? 0.2388 0.4548 0.2263 0.0326  -0.0357 0.0457  335 ARG B CD    
3165 N  NE    . ARG B 104 ? 0.2241 0.4456 0.2232 0.0327  -0.0185 0.0264  335 ARG B NE    
3166 C  CZ    . ARG B 104 ? 0.2733 0.4626 0.2349 0.0377  -0.0060 0.0355  335 ARG B CZ    
3167 N  NH1   . ARG B 104 ? 0.3060 0.4709 0.2080 0.0544  -0.0114 0.0163  335 ARG B NH1   
3168 N  NH2   . ARG B 104 ? 0.2908 0.4647 0.2631 0.0264  -0.0140 0.0243  335 ARG B NH2   
3169 N  N     . THR B 105 ? 0.2705 0.5502 0.2158 0.0927  -0.0320 0.0832  336 THR B N     
3170 C  CA    . THR B 105 ? 0.3089 0.5440 0.2385 0.1316  0.0009  0.0831  336 THR B CA    
3171 C  C     . THR B 105 ? 0.3302 0.5252 0.2515 0.1314  0.0023  0.0976  336 THR B C     
3172 O  O     . THR B 105 ? 0.3525 0.5187 0.2723 0.1029  0.0188  0.0824  336 THR B O     
3173 C  CB    . THR B 105 ? 0.3686 0.5714 0.2621 0.1407  0.0044  0.0573  336 THR B CB    
3174 O  OG1   . THR B 105 ? 0.3789 0.5858 0.2756 0.1920  -0.0018 0.0685  336 THR B OG1   
3175 C  CG2   . THR B 105 ? 0.3920 0.5782 0.2779 0.1325  -0.0042 0.0230  336 THR B CG2   
3176 N  N     . TRP B 106 ? 0.3277 0.5054 0.2293 0.1442  -0.0155 0.1196  337 TRP B N     
3177 C  CA    . TRP B 106 ? 0.3344 0.4984 0.2437 0.1397  -0.0299 0.1229  337 TRP B CA    
3178 C  C     . TRP B 106 ? 0.3066 0.4909 0.2279 0.0821  -0.0260 0.1243  337 TRP B C     
3179 O  O     . TRP B 106 ? 0.3416 0.5033 0.2147 0.0551  -0.0323 0.1204  337 TRP B O     
3180 C  CB    . TRP B 106 ? 0.3674 0.5125 0.3053 0.1579  -0.0554 0.1019  337 TRP B CB    
3181 C  CG    . TRP B 106 ? 0.4482 0.5485 0.4016 0.1252  -0.0377 0.0657  337 TRP B CG    
3182 C  CD1   . TRP B 106 ? 0.4866 0.5628 0.4490 0.1359  -0.0424 0.0474  337 TRP B CD1   
3183 C  CD2   . TRP B 106 ? 0.4999 0.5626 0.4503 0.1147  -0.0332 0.0566  337 TRP B CD2   
3184 N  NE1   . TRP B 106 ? 0.5102 0.5751 0.4674 0.1233  -0.0443 0.0442  337 TRP B NE1   
3185 C  CE2   . TRP B 106 ? 0.5061 0.5698 0.4679 0.1230  -0.0434 0.0513  337 TRP B CE2   
3186 C  CE3   . TRP B 106 ? 0.5376 0.5705 0.4773 0.1119  -0.0316 0.0457  337 TRP B CE3   
3187 C  CZ2   . TRP B 106 ? 0.5316 0.5761 0.4845 0.1142  -0.0415 0.0536  337 TRP B CZ2   
3188 C  CZ3   . TRP B 106 ? 0.5502 0.5808 0.4921 0.1151  -0.0331 0.0492  337 TRP B CZ3   
3189 C  CH2   . TRP B 106 ? 0.5447 0.5791 0.4903 0.1250  -0.0331 0.0548  337 TRP B CH2   
3190 N  N     . GLN B 107 ? 0.2322 0.4745 0.2331 0.0528  -0.0330 0.1039  338 GLN B N     
3191 C  CA    . GLN B 107 ? 0.2008 0.4543 0.2304 0.0189  -0.0242 0.0892  338 GLN B CA    
3192 C  C     . GLN B 107 ? 0.2182 0.4234 0.2121 0.0271  -0.0267 0.0651  338 GLN B C     
3193 O  O     . GLN B 107 ? 0.2216 0.4444 0.2145 0.0530  -0.0353 0.0480  338 GLN B O     
3194 C  CB    . GLN B 107 ? 0.1830 0.4698 0.2532 -0.0148 0.0035  0.0758  338 GLN B CB    
3195 C  CG    . GLN B 107 ? 0.2078 0.4927 0.2711 -0.0144 -0.0114 0.0522  338 GLN B CG    
3196 C  CD    . GLN B 107 ? 0.2236 0.5232 0.2745 -0.0036 -0.0247 0.0291  338 GLN B CD    
3197 O  OE1   . GLN B 107 ? 0.2244 0.5007 0.2626 0.0247  -0.0347 0.0081  338 GLN B OE1   
3198 N  NE2   . GLN B 107 ? 0.2499 0.5555 0.2965 -0.0069 -0.0176 0.0210  338 GLN B NE2   
3199 N  N     . ASP B 108 ? 0.2215 0.3824 0.1848 0.0272  -0.0249 0.0463  339 ASP B N     
3200 C  CA    . ASP B 108 ? 0.2129 0.3323 0.1710 0.0246  -0.0267 0.0337  339 ASP B CA    
3201 C  C     . ASP B 108 ? 0.1967 0.2841 0.1684 0.0037  -0.0388 0.0156  339 ASP B C     
3202 O  O     . ASP B 108 ? 0.2164 0.2836 0.1634 -0.0117 -0.0148 0.0138  339 ASP B O     
3203 C  CB    . ASP B 108 ? 0.2421 0.3334 0.1900 0.0232  -0.0164 0.0502  339 ASP B CB    
3204 C  CG    . ASP B 108 ? 0.2813 0.3359 0.1970 0.0292  -0.0035 0.0572  339 ASP B CG    
3205 O  OD1   . ASP B 108 ? 0.3254 0.3598 0.2421 0.0174  -0.0183 0.0566  339 ASP B OD1   
3206 O  OD2   . ASP B 108 ? 0.3006 0.3191 0.2047 0.0342  0.0152  0.0622  339 ASP B OD2   
3207 N  N     . SER B 109 ? 0.1708 0.2730 0.1812 0.0243  -0.0280 -0.0118 340 SER B N     
3208 C  CA    . SER B 109 ? 0.2053 0.2431 0.1722 0.0077  -0.0400 -0.0061 340 SER B CA    
3209 C  C     . SER B 109 ? 0.1824 0.2386 0.1636 0.0229  -0.0078 0.0069  340 SER B C     
3210 O  O     . SER B 109 ? 0.1881 0.2332 0.1728 0.0257  -0.0167 0.0194  340 SER B O     
3211 C  CB    . SER B 109 ? 0.2392 0.2731 0.1903 0.0250  -0.0806 0.0068  340 SER B CB    
3212 O  OG    . SER B 109 ? 0.2890 0.2901 0.2006 0.0562  -0.0405 -0.0076 340 SER B OG    
3213 N  N     . ASP B 110 ? 0.1599 0.2282 0.1600 0.0128  -0.0109 -0.0009 341 ASP B N     
3214 C  CA    . ASP B 110 ? 0.1808 0.2259 0.1666 0.0131  0.0067  -0.0007 341 ASP B CA    
3215 C  C     . ASP B 110 ? 0.1810 0.2410 0.1450 -0.0208 -0.0111 0.0041  341 ASP B C     
3216 O  O     . ASP B 110 ? 0.1732 0.2658 0.1562 -0.0212 0.0128  0.0249  341 ASP B O     
3217 C  CB    . ASP B 110 ? 0.2040 0.2348 0.1689 -0.0216 0.0101  0.0198  341 ASP B CB    
3218 C  CG    . ASP B 110 ? 0.2644 0.2907 0.1967 -0.0278 -0.0009 0.0229  341 ASP B CG    
3219 O  OD1   . ASP B 110 ? 0.2613 0.2749 0.2368 -0.0132 -0.0054 0.0133  341 ASP B OD1   
3220 O  OD2   . ASP B 110 ? 0.3084 0.3334 0.2428 -0.0630 -0.0082 0.0090  341 ASP B OD2   
3221 N  N     . THR B 111 ? 0.1756 0.2330 0.1353 -0.0445 -0.0142 -0.0029 342 THR B N     
3222 C  CA    . THR B 111 ? 0.1869 0.2467 0.1325 -0.0453 -0.0170 0.0089  342 THR B CA    
3223 C  C     . THR B 111 ? 0.1860 0.2383 0.1395 -0.0123 -0.0114 0.0098  342 THR B C     
3224 O  O     . THR B 111 ? 0.1871 0.2421 0.1601 -0.0140 -0.0052 0.0082  342 THR B O     
3225 C  CB    . THR B 111 ? 0.2228 0.3047 0.1466 -0.0769 -0.0300 0.0226  342 THR B CB    
3226 O  OG1   . THR B 111 ? 0.2478 0.3332 0.1712 -0.0629 -0.0134 0.0132  342 THR B OG1   
3227 C  CG2   . THR B 111 ? 0.2535 0.3480 0.1963 -0.0619 -0.0349 0.0312  342 THR B CG2   
3228 N  N     . VAL B 112 ? 0.1608 0.2446 0.1390 -0.0040 -0.0054 0.0040  343 VAL B N     
3229 C  CA    . VAL B 112 ? 0.1617 0.2531 0.1463 0.0044  0.0000  -0.0037 343 VAL B CA    
3230 C  C     . VAL B 112 ? 0.1514 0.2395 0.1600 -0.0182 -0.0040 0.0079  343 VAL B C     
3231 O  O     . VAL B 112 ? 0.1447 0.2690 0.1696 -0.0244 -0.0042 0.0374  343 VAL B O     
3232 C  CB    . VAL B 112 ? 0.1603 0.2825 0.1435 0.0244  -0.0139 0.0225  343 VAL B CB    
3233 C  CG1   . VAL B 112 ? 0.1812 0.3053 0.1511 0.0365  0.0278  0.0195  343 VAL B CG1   
3234 C  CG2   . VAL B 112 ? 0.1656 0.3229 0.1676 0.0046  -0.0509 0.0342  343 VAL B CG2   
3235 N  N     . LYS B 113 ? 0.1507 0.2054 0.1464 -0.0209 -0.0211 -0.0327 344 LYS B N     
3236 C  CA    . LYS B 113 ? 0.1497 0.2073 0.1641 -0.0273 -0.0404 -0.0137 344 LYS B CA    
3237 C  C     . LYS B 113 ? 0.1772 0.1961 0.1507 -0.0078 0.0026  0.0071  344 LYS B C     
3238 O  O     . LYS B 113 ? 0.1845 0.2007 0.1377 0.0102  -0.0101 0.0274  344 LYS B O     
3239 C  CB    . LYS B 113 ? 0.1208 0.2493 0.1789 -0.0387 -0.0384 -0.0020 344 LYS B CB    
3240 C  CG    . LYS B 113 ? 0.1254 0.2370 0.2042 -0.0480 -0.0498 -0.0233 344 LYS B CG    
3241 C  CD    . LYS B 113 ? 0.1155 0.2559 0.2183 -0.0520 -0.0279 -0.0153 344 LYS B CD    
3242 C  CE    . LYS B 113 ? 0.1277 0.2400 0.2447 -0.0242 -0.0390 -0.0190 344 LYS B CE    
3243 N  NZ    . LYS B 113 ? 0.1341 0.2433 0.2386 -0.0215 -0.0334 -0.0438 344 LYS B NZ    
3244 N  N     . LEU B 114 ? 0.1739 0.1879 0.1494 -0.0084 0.0140  -0.0334 345 LEU B N     
3245 C  CA    . LEU B 114 ? 0.1559 0.2010 0.1374 -0.0157 0.0042  -0.0198 345 LEU B CA    
3246 C  C     . LEU B 114 ? 0.1340 0.2351 0.1458 -0.0130 -0.0072 -0.0155 345 LEU B C     
3247 O  O     . LEU B 114 ? 0.1744 0.2353 0.1373 -0.0082 -0.0158 0.0086  345 LEU B O     
3248 C  CB    . LEU B 114 ? 0.1858 0.2283 0.1396 0.0036  -0.0021 -0.0171 345 LEU B CB    
3249 C  CG    . LEU B 114 ? 0.1822 0.2497 0.1289 0.0097  -0.0226 0.0029  345 LEU B CG    
3250 C  CD1   . LEU B 114 ? 0.1743 0.2934 0.1442 -0.0033 -0.0263 0.0023  345 LEU B CD1   
3251 C  CD2   . LEU B 114 ? 0.2067 0.2457 0.1483 0.0045  -0.0032 0.0095  345 LEU B CD2   
3252 N  N     . LEU B 115 ? 0.1234 0.2547 0.1622 -0.0291 0.0042  -0.0129 346 LEU B N     
3253 C  CA    . LEU B 115 ? 0.1254 0.2716 0.1569 -0.0309 -0.0145 0.0038  346 LEU B CA    
3254 C  C     . LEU B 115 ? 0.1648 0.2629 0.1496 -0.0095 -0.0164 0.0091  346 LEU B C     
3255 O  O     . LEU B 115 ? 0.1904 0.2439 0.1536 -0.0209 -0.0199 0.0116  346 LEU B O     
3256 C  CB    . LEU B 115 ? 0.1391 0.3342 0.1986 -0.0527 -0.0310 0.0336  346 LEU B CB    
3257 C  CG    . LEU B 115 ? 0.1903 0.3653 0.2592 -0.0615 -0.0505 0.0437  346 LEU B CG    
3258 C  CD1   . LEU B 115 ? 0.2321 0.3779 0.2924 -0.0673 -0.0388 0.0495  346 LEU B CD1   
3259 C  CD2   . LEU B 115 ? 0.2214 0.3728 0.2634 -0.0359 -0.0319 0.0846  346 LEU B CD2   
3260 N  N     . VAL B 116 ? 0.1495 0.2616 0.1434 -0.0112 -0.0140 0.0047  347 VAL B N     
3261 C  CA    . VAL B 116 ? 0.1728 0.2400 0.1439 -0.0109 -0.0070 0.0087  347 VAL B CA    
3262 C  C     . VAL B 116 ? 0.1677 0.2096 0.1226 -0.0045 -0.0050 0.0125  347 VAL B C     
3263 O  O     . VAL B 116 ? 0.1797 0.2208 0.1383 -0.0215 0.0013  0.0063  347 VAL B O     
3264 C  CB    . VAL B 116 ? 0.1892 0.2260 0.1381 0.0220  -0.0091 0.0112  347 VAL B CB    
3265 C  CG1   . VAL B 116 ? 0.2307 0.2284 0.1362 0.0335  -0.0090 0.0147  347 VAL B CG1   
3266 C  CG2   . VAL B 116 ? 0.2243 0.2594 0.1666 0.0262  0.0067  0.0279  347 VAL B CG2   
3267 N  N     . ASP B 117 ? 0.1458 0.2210 0.1264 -0.0208 -0.0207 0.0061  348 ASP B N     
3268 C  CA    . ASP B 117 ? 0.1488 0.2189 0.1371 -0.0233 0.0059  -0.0121 348 ASP B CA    
3269 C  C     . ASP B 117 ? 0.1902 0.2033 0.1259 -0.0251 0.0242  -0.0200 348 ASP B C     
3270 O  O     . ASP B 117 ? 0.1918 0.2159 0.1447 -0.0336 0.0023  -0.0119 348 ASP B O     
3271 C  CB    . ASP B 117 ? 0.1383 0.2420 0.1383 -0.0166 -0.0167 0.0121  348 ASP B CB    
3272 C  CG    . ASP B 117 ? 0.1605 0.2516 0.1601 -0.0310 -0.0151 0.0109  348 ASP B CG    
3273 O  OD1   . ASP B 117 ? 0.1812 0.2649 0.1677 -0.0030 -0.0279 0.0085  348 ASP B OD1   
3274 O  OD2   . ASP B 117 ? 0.1958 0.2742 0.1813 -0.0044 0.0139  0.0195  348 ASP B OD2   
3275 N  N     . LEU B 118 ? 0.1672 0.1981 0.1413 -0.0394 0.0027  -0.0205 349 LEU B N     
3276 C  CA    . LEU B 118 ? 0.1918 0.2051 0.1298 -0.0336 -0.0049 -0.0106 349 LEU B CA    
3277 C  C     . LEU B 118 ? 0.1877 0.2113 0.1433 -0.0452 -0.0060 -0.0151 349 LEU B C     
3278 O  O     . LEU B 118 ? 0.2297 0.1926 0.1670 -0.0283 0.0109  -0.0153 349 LEU B O     
3279 C  CB    . LEU B 118 ? 0.2108 0.2517 0.1080 -0.0028 0.0130  -0.0085 349 LEU B CB    
3280 C  CG    . LEU B 118 ? 0.2437 0.2746 0.1400 0.0210  0.0146  -0.0145 349 LEU B CG    
3281 C  CD1   . LEU B 118 ? 0.2840 0.2878 0.1464 -0.0160 0.0212  -0.0157 349 LEU B CD1   
3282 C  CD2   . LEU B 118 ? 0.2672 0.2886 0.1932 0.0378  -0.0043 -0.0507 349 LEU B CD2   
3283 N  N     . GLU B 119 ? 0.1738 0.2055 0.1405 -0.0384 0.0066  -0.0149 350 GLU B N     
3284 C  CA    . GLU B 119 ? 0.1767 0.2502 0.1467 -0.0136 -0.0198 0.0052  350 GLU B CA    
3285 C  C     . GLU B 119 ? 0.1917 0.2383 0.1457 -0.0230 -0.0108 -0.0096 350 GLU B C     
3286 O  O     . GLU B 119 ? 0.2000 0.2197 0.1575 -0.0276 0.0035  -0.0076 350 GLU B O     
3287 C  CB    . GLU B 119 ? 0.2004 0.3275 0.1785 0.0114  -0.0354 0.0272  350 GLU B CB    
3288 C  CG    . GLU B 119 ? 0.2837 0.4150 0.2379 -0.0406 -0.0665 0.0458  350 GLU B CG    
3289 C  CD    . GLU B 119 ? 0.4350 0.4935 0.3112 -0.0532 -0.1464 0.0433  350 GLU B CD    
3290 O  OE1   . GLU B 119 ? 0.5069 0.5329 0.3567 -0.0807 -0.1535 -0.0060 350 GLU B OE1   
3291 O  OE2   . GLU B 119 ? 0.5013 0.5415 0.3852 -0.0598 -0.1257 0.0499  350 GLU B OE2   
3292 N  N     . LEU B 120 ? 0.1674 0.2240 0.1433 -0.0223 -0.0181 -0.0187 351 LEU B N     
3293 C  CA    . LEU B 120 ? 0.1682 0.2090 0.1536 -0.0344 -0.0143 -0.0126 351 LEU B CA    
3294 C  C     . LEU B 120 ? 0.1768 0.1984 0.1528 -0.0192 -0.0038 -0.0186 351 LEU B C     
3295 O  O     . LEU B 120 ? 0.2014 0.1971 0.1652 -0.0109 0.0152  0.0049  351 LEU B O     
3296 C  CB    . LEU B 120 ? 0.1619 0.1876 0.1558 -0.0214 -0.0110 -0.0035 351 LEU B CB    
3297 C  CG    . LEU B 120 ? 0.1518 0.1936 0.1507 -0.0297 0.0084  0.0081  351 LEU B CG    
3298 C  CD1   . LEU B 120 ? 0.1670 0.2141 0.1715 -0.0208 0.0085  0.0069  351 LEU B CD1   
3299 C  CD2   . LEU B 120 ? 0.1847 0.1970 0.1646 -0.0146 0.0140  0.0032  351 LEU B CD2   
3300 N  N     . SER B 121 ? 0.1606 0.2145 0.1518 -0.0038 -0.0097 -0.0258 352 SER B N     
3301 C  CA    . SER B 121 ? 0.1586 0.2315 0.1713 -0.0154 0.0030  -0.0150 352 SER B CA    
3302 C  C     . SER B 121 ? 0.1874 0.2083 0.1587 -0.0051 -0.0023 -0.0242 352 SER B C     
3303 O  O     . SER B 121 ? 0.2011 0.1989 0.1736 0.0098  -0.0016 0.0076  352 SER B O     
3304 C  CB    . SER B 121 ? 0.1402 0.2964 0.2188 0.0277  0.0287  0.0034  352 SER B CB    
3305 O  OG    . SER B 121 ? 0.2591 0.3771 0.2625 -0.0207 0.0329  0.0182  352 SER B OG    
3306 N  N     . TYR B 122 ? 0.1977 0.2038 0.1513 -0.0364 0.0008  -0.0241 353 TYR B N     
3307 C  CA    . TYR B 122 ? 0.2438 0.1913 0.1458 -0.0321 -0.0041 -0.0211 353 TYR B CA    
3308 C  C     . TYR B 122 ? 0.2027 0.2198 0.1652 -0.0116 -0.0054 -0.0147 353 TYR B C     
3309 O  O     . TYR B 122 ? 0.2269 0.2247 0.1704 -0.0317 0.0197  -0.0009 353 TYR B O     
3310 C  CB    . TYR B 122 ? 0.3008 0.1802 0.1621 -0.0351 -0.0188 -0.0224 353 TYR B CB    
3311 C  CG    . TYR B 122 ? 0.3372 0.2013 0.2017 -0.0508 -0.0121 -0.0039 353 TYR B CG    
3312 C  CD1   . TYR B 122 ? 0.3502 0.2054 0.2128 -0.0541 -0.0037 -0.0368 353 TYR B CD1   
3313 C  CD2   . TYR B 122 ? 0.3523 0.2191 0.2825 -0.0911 -0.0366 -0.0109 353 TYR B CD2   
3314 C  CE1   . TYR B 122 ? 0.3885 0.2379 0.2440 -0.0625 -0.0175 -0.0322 353 TYR B CE1   
3315 C  CE2   . TYR B 122 ? 0.4071 0.2516 0.3317 -0.0944 -0.0275 -0.0237 353 TYR B CE2   
3316 C  CZ    . TYR B 122 ? 0.4133 0.2414 0.3189 -0.0988 -0.0364 -0.0432 353 TYR B CZ    
3317 O  OH    . TYR B 122 ? 0.4792 0.2721 0.3942 -0.0964 -0.0365 -0.0298 353 TYR B OH    
3318 N  N     . GLY B 123 ? 0.1663 0.2391 0.1668 -0.0078 -0.0090 -0.0273 354 GLY B N     
3319 C  CA    . GLY B 123 ? 0.1840 0.2144 0.1827 -0.0024 -0.0096 -0.0250 354 GLY B CA    
3320 C  C     . GLY B 123 ? 0.1827 0.1967 0.1737 -0.0048 -0.0169 -0.0034 354 GLY B C     
3321 O  O     . GLY B 123 ? 0.2209 0.1839 0.1876 -0.0164 0.0038  0.0199  354 GLY B O     
3322 N  N     . PHE B 124 ? 0.1623 0.2007 0.1541 -0.0188 -0.0212 -0.0237 355 PHE B N     
3323 C  CA    . PHE B 124 ? 0.1945 0.2064 0.1601 0.0067  -0.0229 -0.0175 355 PHE B CA    
3324 C  C     . PHE B 124 ? 0.1972 0.2321 0.1614 0.0392  0.0087  0.0005  355 PHE B C     
3325 O  O     . PHE B 124 ? 0.2694 0.2591 0.1738 0.0787  0.0008  0.0128  355 PHE B O     
3326 C  CB    . PHE B 124 ? 0.1616 0.1906 0.1616 -0.0073 -0.0052 -0.0214 355 PHE B CB    
3327 C  CG    . PHE B 124 ? 0.1481 0.1902 0.1497 -0.0178 0.0141  -0.0109 355 PHE B CG    
3328 C  CD1   . PHE B 124 ? 0.1612 0.2140 0.1582 0.0051  0.0047  -0.0041 355 PHE B CD1   
3329 C  CD2   . PHE B 124 ? 0.1833 0.1763 0.1443 -0.0167 -0.0127 -0.0157 355 PHE B CD2   
3330 C  CE1   . PHE B 124 ? 0.1928 0.2121 0.1805 0.0151  0.0012  0.0055  355 PHE B CE1   
3331 C  CE2   . PHE B 124 ? 0.1805 0.1922 0.1581 -0.0176 -0.0109 0.0054  355 PHE B CE2   
3332 C  CZ    . PHE B 124 ? 0.1714 0.1881 0.1598 -0.0063 0.0053  0.0053  355 PHE B CZ    
3333 N  N     . GLU B 125 ? 0.1927 0.2333 0.1972 0.0418  0.0167  -0.0048 356 GLU B N     
3334 C  CA    . GLU B 125 ? 0.2189 0.2300 0.2313 0.0363  0.0299  -0.0080 356 GLU B CA    
3335 C  C     . GLU B 125 ? 0.2493 0.2272 0.2564 0.0527  0.0209  0.0078  356 GLU B C     
3336 O  O     . GLU B 125 ? 0.2924 0.2490 0.3245 0.0497  0.0328  0.0245  356 GLU B O     
3337 C  CB    . GLU B 125 ? 0.2210 0.2384 0.2454 0.0153  0.0474  -0.0102 356 GLU B CB    
3338 C  CG    . GLU B 125 ? 0.2239 0.2837 0.2643 -0.0220 0.0610  -0.0219 356 GLU B CG    
3339 C  CD    . GLU B 125 ? 0.2888 0.3394 0.2921 -0.0247 0.0708  -0.0337 356 GLU B CD    
3340 O  OE1   . GLU B 125 ? 0.3236 0.3992 0.2519 -0.0219 0.0501  -0.0225 356 GLU B OE1   
3341 O  OE2   . GLU B 125 ? 0.3476 0.3509 0.3424 -0.0077 0.1012  -0.0368 356 GLU B OE2   
3342 N  N     . ASN B 126 ? 0.2570 0.2141 0.2453 0.0305  0.0275  -0.0025 357 ASN B N     
3343 C  CA    . ASN B 126 ? 0.3181 0.2205 0.2454 -0.0061 0.0403  0.0195  357 ASN B CA    
3344 C  C     . ASN B 126 ? 0.3450 0.2463 0.2672 -0.0349 0.0633  0.0029  357 ASN B C     
3345 O  O     . ASN B 126 ? 0.4082 0.3022 0.3072 -0.1004 0.0883  -0.0122 357 ASN B O     
3346 C  CB    . ASN B 126 ? 0.3730 0.2156 0.2816 -0.0259 0.0369  -0.0025 357 ASN B CB    
3347 C  CG    . ASN B 126 ? 0.4336 0.2374 0.3136 -0.0162 0.0398  -0.0159 357 ASN B CG    
3348 O  OD1   . ASN B 126 ? 0.4930 0.2689 0.3637 -0.0189 0.0644  -0.0111 357 ASN B OD1   
3349 N  ND2   . ASN B 126 ? 0.4361 0.2381 0.3016 -0.0109 0.0220  -0.0330 357 ASN B ND2   
3350 N  N     . GLY B 127 ? 0.3350 0.2266 0.2458 0.0428  0.0713  0.0125  358 GLY B N     
3351 C  CA    . GLY B 127 ? 0.3261 0.2300 0.2240 0.0628  0.0388  0.0296  358 GLY B CA    
3352 C  C     . GLY B 127 ? 0.3021 0.2218 0.2283 0.0496  0.0340  0.0328  358 GLY B C     
3353 O  O     . GLY B 127 ? 0.3407 0.2291 0.2454 0.0673  0.0506  0.0476  358 GLY B O     
3354 N  N     . GLN B 128 ? 0.2244 0.2031 0.2104 0.0241  0.0135  0.0189  359 GLN B N     
3355 C  CA    . GLN B 128 ? 0.2012 0.1786 0.1760 0.0078  0.0037  0.0113  359 GLN B CA    
3356 C  C     . GLN B 128 ? 0.1936 0.1861 0.1739 -0.0077 0.0088  0.0028  359 GLN B C     
3357 O  O     . GLN B 128 ? 0.1866 0.2101 0.1864 0.0014  0.0092  0.0086  359 GLN B O     
3358 C  CB    . GLN B 128 ? 0.2031 0.1801 0.1810 -0.0109 0.0013  0.0095  359 GLN B CB    
3359 C  CG    . GLN B 128 ? 0.2202 0.1992 0.1758 -0.0076 -0.0135 0.0094  359 GLN B CG    
3360 C  CD    . GLN B 128 ? 0.2292 0.1975 0.1836 -0.0030 0.0043  -0.0133 359 GLN B CD    
3361 O  OE1   . GLN B 128 ? 0.2359 0.2583 0.1964 -0.0063 0.0312  -0.0113 359 GLN B OE1   
3362 N  NE2   . GLN B 128 ? 0.2325 0.1763 0.2022 -0.0182 -0.0187 -0.0343 359 GLN B NE2   
3363 N  N     . LYS B 129 ? 0.1768 0.1629 0.1636 -0.0048 0.0203  -0.0122 360 LYS B N     
3364 C  CA    . LYS B 129 ? 0.2072 0.1672 0.1570 0.0165  0.0017  0.0043  360 LYS B CA    
3365 C  C     . LYS B 129 ? 0.1772 0.1782 0.1612 0.0187  0.0038  0.0014  360 LYS B C     
3366 O  O     . LYS B 129 ? 0.1956 0.1905 0.1758 0.0027  -0.0330 0.0079  360 LYS B O     
3367 C  CB    . LYS B 129 ? 0.2563 0.1681 0.1917 0.0532  0.0010  0.0104  360 LYS B CB    
3368 C  CG    . LYS B 129 ? 0.3268 0.2504 0.2628 0.0631  -0.0018 0.0112  360 LYS B CG    
3369 C  CD    . LYS B 129 ? 0.3832 0.3261 0.3112 0.0462  0.0003  0.0096  360 LYS B CD    
3370 C  CE    . LYS B 129 ? 0.4342 0.3887 0.3813 0.0360  -0.0123 -0.0096 360 LYS B CE    
3371 N  NZ    . LYS B 129 ? 0.4717 0.4212 0.4210 0.0251  -0.0095 -0.0180 360 LYS B NZ    
3372 N  N     . ALA B 130 ? 0.1590 0.1502 0.1751 0.0262  0.0075  0.0134  361 ALA B N     
3373 C  CA    . ALA B 130 ? 0.1592 0.1585 0.1675 0.0222  -0.0003 0.0165  361 ALA B CA    
3374 C  C     . ALA B 130 ? 0.1668 0.1542 0.1684 0.0055  -0.0160 0.0047  361 ALA B C     
3375 O  O     . ALA B 130 ? 0.2073 0.1720 0.1665 -0.0285 -0.0189 0.0100  361 ALA B O     
3376 C  CB    . ALA B 130 ? 0.1640 0.1927 0.1678 0.0064  0.0360  0.0106  361 ALA B CB    
3377 N  N     . ALA B 131 ? 0.1626 0.1507 0.1696 0.0066  -0.0049 0.0154  362 ALA B N     
3378 C  CA    . ALA B 131 ? 0.1698 0.1563 0.1699 0.0138  0.0118  0.0243  362 ALA B CA    
3379 C  C     . ALA B 131 ? 0.1404 0.1597 0.1763 -0.0157 0.0064  0.0032  362 ALA B C     
3380 O  O     . ALA B 131 ? 0.1657 0.1766 0.1883 0.0036  -0.0233 -0.0197 362 ALA B O     
3381 C  CB    . ALA B 131 ? 0.1777 0.1581 0.1617 -0.0079 0.0089  0.0017  362 ALA B CB    
3382 N  N     . VAL B 132 ? 0.1443 0.1547 0.1842 0.0102  -0.0123 0.0059  363 VAL B N     
3383 C  CA    . VAL B 132 ? 0.1516 0.1728 0.1787 0.0013  -0.0009 0.0061  363 VAL B CA    
3384 C  C     . VAL B 132 ? 0.1558 0.1671 0.1673 -0.0116 -0.0158 0.0021  363 VAL B C     
3385 O  O     . VAL B 132 ? 0.1929 0.1682 0.1614 -0.0061 -0.0256 -0.0063 363 VAL B O     
3386 C  CB    . VAL B 132 ? 0.1511 0.2193 0.2093 -0.0013 0.0018  -0.0192 363 VAL B CB    
3387 C  CG1   . VAL B 132 ? 0.1823 0.2385 0.2224 -0.0259 0.0125  -0.0292 363 VAL B CG1   
3388 C  CG2   . VAL B 132 ? 0.1689 0.2027 0.2271 0.0258  -0.0004 -0.0012 363 VAL B CG2   
3389 N  N     . VAL B 133 ? 0.1742 0.1440 0.1702 0.0051  -0.0070 0.0271  364 VAL B N     
3390 C  CA    . VAL B 133 ? 0.1630 0.1538 0.1861 0.0204  -0.0039 0.0238  364 VAL B CA    
3391 C  C     . VAL B 133 ? 0.1682 0.1762 0.1815 0.0195  -0.0126 -0.0077 364 VAL B C     
3392 O  O     . VAL B 133 ? 0.1779 0.1633 0.1989 0.0127  -0.0283 -0.0023 364 VAL B O     
3393 C  CB    . VAL B 133 ? 0.1764 0.1870 0.2140 0.0197  0.0198  0.0300  364 VAL B CB    
3394 C  CG1   . VAL B 133 ? 0.2006 0.2063 0.2250 0.0029  0.0198  0.0374  364 VAL B CG1   
3395 C  CG2   . VAL B 133 ? 0.1684 0.1927 0.2412 0.0165  0.0075  0.0188  364 VAL B CG2   
3396 N  N     . HIS B 134 ? 0.1576 0.1998 0.1801 0.0349  -0.0142 -0.0025 365 HIS B N     
3397 C  CA    . HIS B 134 ? 0.1490 0.1993 0.1875 0.0266  -0.0074 -0.0041 365 HIS B CA    
3398 C  C     . HIS B 134 ? 0.1634 0.2152 0.1758 0.0084  0.0096  -0.0081 365 HIS B C     
3399 O  O     . HIS B 134 ? 0.1668 0.2281 0.1722 0.0230  -0.0013 -0.0103 365 HIS B O     
3400 C  CB    . HIS B 134 ? 0.1494 0.2183 0.1951 0.0108  -0.0430 0.0289  365 HIS B CB    
3401 C  CG    . HIS B 134 ? 0.1715 0.2154 0.1905 0.0124  -0.0169 0.0212  365 HIS B CG    
3402 N  ND1   . HIS B 134 ? 0.1925 0.2400 0.2111 0.0253  -0.0165 0.0098  365 HIS B ND1   
3403 C  CD2   . HIS B 134 ? 0.2217 0.2422 0.2044 0.0177  -0.0233 0.0227  365 HIS B CD2   
3404 C  CE1   . HIS B 134 ? 0.2129 0.2386 0.2181 0.0076  -0.0100 0.0057  365 HIS B CE1   
3405 N  NE2   . HIS B 134 ? 0.2190 0.2470 0.2015 0.0094  -0.0142 0.0037  365 HIS B NE2   
3406 N  N     . HIS B 135 ? 0.1613 0.2187 0.1899 0.0152  -0.0136 0.0202  366 HIS B N     
3407 C  CA    . HIS B 135 ? 0.1550 0.2409 0.2004 0.0185  -0.0296 0.0195  366 HIS B CA    
3408 C  C     . HIS B 135 ? 0.1566 0.2317 0.1947 0.0032  -0.0193 0.0086  366 HIS B C     
3409 O  O     . HIS B 135 ? 0.1857 0.2493 0.1883 0.0003  -0.0241 -0.0009 366 HIS B O     
3410 C  CB    . HIS B 135 ? 0.1666 0.2983 0.2383 0.0272  -0.0212 -0.0123 366 HIS B CB    
3411 C  CG    . HIS B 135 ? 0.1978 0.3669 0.3006 0.0231  -0.0094 -0.0665 366 HIS B CG    
3412 N  ND1   . HIS B 135 ? 0.1923 0.4083 0.3242 0.0087  0.0226  -0.0652 366 HIS B ND1   
3413 C  CD2   . HIS B 135 ? 0.2485 0.4207 0.3734 0.0244  -0.0005 -0.0795 366 HIS B CD2   
3414 C  CE1   . HIS B 135 ? 0.2446 0.4451 0.3663 0.0082  0.0216  -0.0996 366 HIS B CE1   
3415 N  NE2   . HIS B 135 ? 0.2536 0.4534 0.3927 0.0200  0.0095  -0.0880 366 HIS B NE2   
3416 N  N     . PHE B 136 ? 0.1533 0.2236 0.2013 -0.0007 -0.0208 0.0158  367 PHE B N     
3417 C  CA    . PHE B 136 ? 0.1598 0.2348 0.1858 0.0033  -0.0235 0.0151  367 PHE B CA    
3418 C  C     . PHE B 136 ? 0.1542 0.2374 0.1798 0.0007  -0.0111 0.0248  367 PHE B C     
3419 O  O     . PHE B 136 ? 0.1853 0.2368 0.1785 -0.0023 -0.0115 0.0187  367 PHE B O     
3420 C  CB    . PHE B 136 ? 0.1608 0.2451 0.1636 0.0092  -0.0196 0.0017  367 PHE B CB    
3421 C  CG    . PHE B 136 ? 0.1683 0.2477 0.1995 -0.0038 -0.0317 0.0005  367 PHE B CG    
3422 C  CD1   . PHE B 136 ? 0.1664 0.2572 0.2398 0.0020  -0.0071 -0.0127 367 PHE B CD1   
3423 C  CD2   . PHE B 136 ? 0.1808 0.2475 0.2039 0.0109  -0.0437 0.0177  367 PHE B CD2   
3424 C  CE1   . PHE B 136 ? 0.1892 0.2631 0.2253 0.0030  0.0064  -0.0247 367 PHE B CE1   
3425 C  CE2   . PHE B 136 ? 0.1965 0.2481 0.1874 0.0015  -0.0393 0.0320  367 PHE B CE2   
3426 C  CZ    . PHE B 136 ? 0.1766 0.2572 0.1806 0.0021  -0.0154 0.0039  367 PHE B CZ    
3427 N  N     . GLU B 137 ? 0.1694 0.2163 0.1808 0.0081  -0.0212 0.0223  368 GLU B N     
3428 C  CA    . GLU B 137 ? 0.2097 0.2272 0.1937 0.0302  -0.0164 0.0177  368 GLU B CA    
3429 C  C     . GLU B 137 ? 0.1946 0.2409 0.1924 0.0209  -0.0227 0.0198  368 GLU B C     
3430 O  O     . GLU B 137 ? 0.2400 0.2400 0.2101 0.0357  -0.0209 0.0278  368 GLU B O     
3431 C  CB    . GLU B 137 ? 0.2173 0.2226 0.2233 0.0133  -0.0273 0.0022  368 GLU B CB    
3432 C  CG    . GLU B 137 ? 0.2272 0.2416 0.2466 0.0167  -0.0365 -0.0070 368 GLU B CG    
3433 C  CD    . GLU B 137 ? 0.2583 0.2547 0.2465 0.0388  -0.0452 -0.0022 368 GLU B CD    
3434 O  OE1   . GLU B 137 ? 0.2333 0.2629 0.2325 0.0517  -0.0033 -0.0103 368 GLU B OE1   
3435 O  OE2   . GLU B 137 ? 0.3004 0.2718 0.2971 0.0231  -0.0656 0.0233  368 GLU B OE2   
3436 N  N     . SER B 138 ? 0.1657 0.2421 0.1726 0.0414  -0.0317 -0.0047 369 SER B N     
3437 C  CA    . SER B 138 ? 0.1590 0.2661 0.1851 0.0454  -0.0460 -0.0141 369 SER B CA    
3438 C  C     . SER B 138 ? 0.1804 0.2672 0.1914 0.0533  -0.0300 -0.0136 369 SER B C     
3439 O  O     . SER B 138 ? 0.1860 0.2886 0.1896 0.0329  -0.0311 0.0021  369 SER B O     
3440 C  CB    . SER B 138 ? 0.1422 0.3146 0.2225 0.0701  -0.0362 -0.0002 369 SER B CB    
3441 O  OG    . SER B 138 ? 0.1766 0.3639 0.2559 0.0701  -0.0162 -0.0075 369 SER B OG    
3442 N  N     . PHE B 139 ? 0.1696 0.2653 0.1860 0.0395  -0.0086 -0.0024 370 PHE B N     
3443 C  CA    . PHE B 139 ? 0.1645 0.2537 0.1667 0.0489  -0.0156 0.0262  370 PHE B CA    
3444 C  C     . PHE B 139 ? 0.1960 0.2637 0.1877 0.0358  -0.0189 0.0046  370 PHE B C     
3445 O  O     . PHE B 139 ? 0.2102 0.2676 0.1897 0.0657  0.0098  0.0164  370 PHE B O     
3446 C  CB    . PHE B 139 ? 0.1781 0.2489 0.1794 0.0621  -0.0392 0.0579  370 PHE B CB    
3447 C  CG    . PHE B 139 ? 0.2235 0.2680 0.1764 0.0891  -0.0032 0.0568  370 PHE B CG    
3448 C  CD1   . PHE B 139 ? 0.2332 0.2721 0.1912 0.0668  -0.0080 0.0337  370 PHE B CD1   
3449 C  CD2   . PHE B 139 ? 0.4188 0.2974 0.2079 0.0657  0.0475  0.0619  370 PHE B CD2   
3450 C  CE1   . PHE B 139 ? 0.2435 0.2756 0.1848 0.0887  0.0135  0.0385  370 PHE B CE1   
3451 C  CE2   . PHE B 139 ? 0.4760 0.3001 0.2278 0.0432  0.0713  0.0464  370 PHE B CE2   
3452 C  CZ    . PHE B 139 ? 0.3841 0.2897 0.2134 0.0633  0.0489  0.0315  370 PHE B CZ    
3453 N  N     . PRO B 140 ? 0.1825 0.2722 0.1744 0.0071  -0.0166 -0.0025 371 PRO B N     
3454 C  CA    . PRO B 140 ? 0.1854 0.2751 0.1602 -0.0076 -0.0078 -0.0122 371 PRO B CA    
3455 C  C     . PRO B 140 ? 0.2060 0.2763 0.1864 -0.0028 -0.0266 0.0011  371 PRO B C     
3456 O  O     . PRO B 140 ? 0.1966 0.2806 0.1916 0.0188  -0.0251 0.0291  371 PRO B O     
3457 C  CB    . PRO B 140 ? 0.1935 0.2913 0.1782 0.0020  -0.0284 -0.0233 371 PRO B CB    
3458 C  CG    . PRO B 140 ? 0.2163 0.2962 0.1784 -0.0162 -0.0163 0.0171  371 PRO B CG    
3459 C  CD    . PRO B 140 ? 0.2089 0.2887 0.1690 0.0096  -0.0219 0.0042  371 PRO B CD    
3460 N  N     . ALA B 141 ? 0.1891 0.2614 0.1918 -0.0124 -0.0102 -0.0184 372 ALA B N     
3461 C  CA    . ALA B 141 ? 0.2280 0.2434 0.1902 -0.0060 -0.0251 -0.0005 372 ALA B CA    
3462 C  C     . ALA B 141 ? 0.1939 0.2616 0.1754 0.0073  -0.0108 -0.0002 372 ALA B C     
3463 O  O     . ALA B 141 ? 0.2096 0.2976 0.1623 0.0255  -0.0144 0.0032  372 ALA B O     
3464 C  CB    . ALA B 141 ? 0.2679 0.2269 0.2104 -0.0097 -0.0185 -0.0006 372 ALA B CB    
3465 N  N     . GLY B 142 ? 0.1827 0.2640 0.1819 0.0127  -0.0005 0.0159  373 GLY B N     
3466 C  CA    . GLY B 142 ? 0.1906 0.2882 0.1937 0.0224  0.0077  0.0081  373 GLY B CA    
3467 C  C     . GLY B 142 ? 0.1830 0.3032 0.1924 0.0380  -0.0141 -0.0078 373 GLY B C     
3468 O  O     . GLY B 142 ? 0.1853 0.3215 0.2035 0.0567  -0.0140 -0.0296 373 GLY B O     
3469 N  N     . SER B 143 ? 0.1835 0.3064 0.1747 0.0334  -0.0093 -0.0211 374 SER B N     
3470 C  CA    . SER B 143 ? 0.1791 0.2761 0.1703 0.0230  -0.0226 -0.0178 374 SER B CA    
3471 C  C     . SER B 143 ? 0.1809 0.2663 0.1629 0.0395  -0.0244 -0.0079 374 SER B C     
3472 O  O     . SER B 143 ? 0.2165 0.2476 0.1659 0.0444  -0.0326 -0.0307 374 SER B O     
3473 C  CB    . SER B 143 ? 0.1918 0.2767 0.1774 0.0229  -0.0294 -0.0195 374 SER B CB    
3474 O  OG    . SER B 143 ? 0.2135 0.3009 0.1928 0.0164  -0.0336 -0.0186 374 SER B OG    
3475 N  N     . THR B 144 ? 0.1719 0.2506 0.1466 0.0309  -0.0165 -0.0116 375 THR B N     
3476 C  CA    . THR B 144 ? 0.1876 0.2432 0.1551 0.0521  -0.0104 -0.0218 375 THR B CA    
3477 C  C     . THR B 144 ? 0.1711 0.2329 0.1562 0.0443  -0.0148 -0.0165 375 THR B C     
3478 O  O     . THR B 144 ? 0.1820 0.2492 0.1632 0.0540  -0.0165 -0.0138 375 THR B O     
3479 C  CB    . THR B 144 ? 0.1807 0.2244 0.1807 0.0208  -0.0324 -0.0225 375 THR B CB    
3480 O  OG1   . THR B 144 ? 0.2176 0.2159 0.1865 0.0296  -0.0206 -0.0130 375 THR B OG1   
3481 C  CG2   . THR B 144 ? 0.1753 0.2593 0.2225 0.0342  -0.0363 0.0022  375 THR B CG2   
3482 N  N     . LEU B 145 ? 0.1519 0.2029 0.1875 0.0196  -0.0332 -0.0223 376 LEU B N     
3483 C  CA    . LEU B 145 ? 0.1666 0.1892 0.2038 0.0126  -0.0270 -0.0102 376 LEU B CA    
3484 C  C     . LEU B 145 ? 0.1606 0.1836 0.1632 0.0060  -0.0303 -0.0019 376 LEU B C     
3485 O  O     . LEU B 145 ? 0.1643 0.1924 0.1563 0.0030  -0.0212 -0.0073 376 LEU B O     
3486 C  CB    . LEU B 145 ? 0.1941 0.1781 0.2264 -0.0014 -0.0214 -0.0136 376 LEU B CB    
3487 C  CG    . LEU B 145 ? 0.2643 0.1980 0.2271 -0.0088 -0.0380 0.0019  376 LEU B CG    
3488 C  CD1   . LEU B 145 ? 0.2849 0.2272 0.2605 -0.0138 -0.0276 0.0385  376 LEU B CD1   
3489 C  CD2   . LEU B 145 ? 0.3294 0.2189 0.2468 -0.0235 -0.0691 -0.0075 376 LEU B CD2   
3490 N  N     . ILE B 146 ? 0.1765 0.1957 0.1552 0.0236  -0.0146 -0.0312 377 ILE B N     
3491 C  CA    . ILE B 146 ? 0.1532 0.1954 0.1467 0.0155  -0.0227 -0.0274 377 ILE B CA    
3492 C  C     . ILE B 146 ? 0.1398 0.1950 0.1384 0.0167  -0.0217 -0.0258 377 ILE B C     
3493 O  O     . ILE B 146 ? 0.1567 0.1950 0.1650 0.0415  -0.0226 -0.0247 377 ILE B O     
3494 C  CB    . ILE B 146 ? 0.1451 0.2197 0.1885 0.0022  -0.0158 -0.0256 377 ILE B CB    
3495 C  CG1   . ILE B 146 ? 0.1663 0.2010 0.1892 0.0062  -0.0057 -0.0253 377 ILE B CG1   
3496 C  CG2   . ILE B 146 ? 0.1270 0.2741 0.2107 -0.0183 -0.0346 -0.0325 377 ILE B CG2   
3497 C  CD1   . ILE B 146 ? 0.1734 0.2178 0.2030 0.0100  -0.0002 -0.0109 377 ILE B CD1   
3498 N  N     . PHE B 147 ? 0.1508 0.2127 0.1320 0.0016  -0.0028 -0.0220 378 PHE B N     
3499 C  CA    . PHE B 147 ? 0.1250 0.2358 0.1569 -0.0045 -0.0007 -0.0347 378 PHE B CA    
3500 C  C     . PHE B 147 ? 0.1377 0.2299 0.1520 0.0091  -0.0229 -0.0337 378 PHE B C     
3501 O  O     . PHE B 147 ? 0.1398 0.2860 0.1740 0.0054  -0.0116 0.0088  378 PHE B O     
3502 C  CB    . PHE B 147 ? 0.1223 0.2390 0.1831 -0.0009 -0.0103 -0.0363 378 PHE B CB    
3503 C  CG    . PHE B 147 ? 0.1351 0.2501 0.1932 0.0037  -0.0171 -0.0511 378 PHE B CG    
3504 C  CD1   . PHE B 147 ? 0.1402 0.2519 0.2152 -0.0324 -0.0016 -0.0581 378 PHE B CD1   
3505 C  CD2   . PHE B 147 ? 0.1672 0.2650 0.1913 -0.0051 -0.0390 -0.0647 378 PHE B CD2   
3506 C  CE1   . PHE B 147 ? 0.1728 0.2791 0.2167 -0.0431 -0.0039 -0.0518 378 PHE B CE1   
3507 C  CE2   . PHE B 147 ? 0.1733 0.2811 0.1845 -0.0099 -0.0137 -0.0561 378 PHE B CE2   
3508 C  CZ    . PHE B 147 ? 0.1702 0.2783 0.1898 -0.0304 -0.0111 -0.0463 378 PHE B CZ    
3509 N  N     . TYR B 148 ? 0.1344 0.2184 0.1577 0.0154  -0.0179 -0.0045 379 TYR B N     
3510 C  CA    . TYR B 148 ? 0.1494 0.1951 0.1572 -0.0071 -0.0082 0.0021  379 TYR B CA    
3511 C  C     . TYR B 148 ? 0.1350 0.2240 0.1566 0.0118  -0.0267 -0.0318 379 TYR B C     
3512 O  O     . TYR B 148 ? 0.1755 0.2676 0.1646 0.0261  -0.0394 -0.0321 379 TYR B O     
3513 C  CB    . TYR B 148 ? 0.1820 0.1999 0.1589 -0.0155 0.0084  0.0014  379 TYR B CB    
3514 C  CG    . TYR B 148 ? 0.1793 0.2165 0.1548 -0.0393 -0.0022 -0.0269 379 TYR B CG    
3515 C  CD1   . TYR B 148 ? 0.2146 0.2201 0.1993 -0.0211 0.0049  -0.0369 379 TYR B CD1   
3516 C  CD2   . TYR B 148 ? 0.1996 0.2498 0.1488 -0.0409 0.0077  -0.0454 379 TYR B CD2   
3517 C  CE1   . TYR B 148 ? 0.2322 0.2178 0.1894 -0.0234 -0.0035 -0.0468 379 TYR B CE1   
3518 C  CE2   . TYR B 148 ? 0.2037 0.2597 0.1708 -0.0115 0.0098  -0.0288 379 TYR B CE2   
3519 C  CZ    . TYR B 148 ? 0.2128 0.2259 0.1913 -0.0086 0.0153  -0.0503 379 TYR B CZ    
3520 O  OH    . TYR B 148 ? 0.2050 0.2294 0.1994 -0.0173 0.0150  -0.0659 379 TYR B OH    
3521 N  N     . LYS B 149 ? 0.1610 0.1984 0.1679 -0.0191 -0.0042 -0.0386 380 LYS B N     
3522 C  CA    . LYS B 149 ? 0.1570 0.1898 0.1540 -0.0166 0.0080  -0.0154 380 LYS B CA    
3523 C  C     . LYS B 149 ? 0.1463 0.2218 0.1447 -0.0128 -0.0086 0.0038  380 LYS B C     
3524 O  O     . LYS B 149 ? 0.1597 0.2436 0.1639 0.0134  -0.0144 0.0061  380 LYS B O     
3525 C  CB    . LYS B 149 ? 0.1650 0.1747 0.1650 0.0002  -0.0113 -0.0269 380 LYS B CB    
3526 C  CG    . LYS B 149 ? 0.1993 0.1738 0.1739 -0.0022 -0.0249 -0.0498 380 LYS B CG    
3527 C  CD    . LYS B 149 ? 0.1878 0.1798 0.1725 -0.0001 -0.0288 -0.0671 380 LYS B CD    
3528 C  CE    . LYS B 149 ? 0.1748 0.2045 0.1843 0.0153  -0.0208 -0.0551 380 LYS B CE    
3529 N  NZ    . LYS B 149 ? 0.2019 0.2553 0.1818 0.0328  -0.0222 -0.0148 380 LYS B NZ    
3530 N  N     . TYR B 150 ? 0.1246 0.2207 0.1459 -0.0121 0.0090  -0.0089 381 TYR B N     
3531 C  CA    . TYR B 150 ? 0.1220 0.2114 0.1431 -0.0115 -0.0087 -0.0206 381 TYR B CA    
3532 C  C     . TYR B 150 ? 0.1488 0.2110 0.1512 0.0041  0.0013  -0.0257 381 TYR B C     
3533 O  O     . TYR B 150 ? 0.2007 0.2236 0.1617 0.0042  0.0087  -0.0203 381 TYR B O     
3534 C  CB    . TYR B 150 ? 0.1505 0.2006 0.1515 -0.0077 -0.0224 -0.0049 381 TYR B CB    
3535 C  CG    . TYR B 150 ? 0.1786 0.1758 0.1327 -0.0002 -0.0213 -0.0115 381 TYR B CG    
3536 C  CD1   . TYR B 150 ? 0.1744 0.1765 0.1529 -0.0186 -0.0232 -0.0245 381 TYR B CD1   
3537 C  CD2   . TYR B 150 ? 0.1593 0.1842 0.1292 0.0139  -0.0244 -0.0296 381 TYR B CD2   
3538 C  CE1   . TYR B 150 ? 0.1713 0.1990 0.1340 -0.0254 -0.0301 -0.0146 381 TYR B CE1   
3539 C  CE2   . TYR B 150 ? 0.1846 0.1754 0.1509 -0.0151 -0.0120 -0.0131 381 TYR B CE2   
3540 C  CZ    . TYR B 150 ? 0.2016 0.1800 0.1410 -0.0235 -0.0276 -0.0142 381 TYR B CZ    
3541 O  OH    . TYR B 150 ? 0.2627 0.1947 0.1511 -0.0100 -0.0392 -0.0224 381 TYR B OH    
3542 N  N     . CYS B 151 ? 0.1444 0.1979 0.1676 0.0053  -0.0078 -0.0410 382 CYS B N     
3543 C  CA    . CYS B 151 ? 0.1290 0.2068 0.1629 0.0176  -0.0157 -0.0359 382 CYS B CA    
3544 C  C     . CYS B 151 ? 0.1527 0.2017 0.1651 0.0045  -0.0110 -0.0300 382 CYS B C     
3545 O  O     . CYS B 151 ? 0.1650 0.2388 0.1644 0.0290  -0.0054 -0.0392 382 CYS B O     
3546 C  CB    . CYS B 151 ? 0.1354 0.2213 0.1811 0.0159  -0.0444 -0.0263 382 CYS B CB    
3547 S  SG    . CYS B 151 ? 0.1749 0.2421 0.1694 0.0111  -0.0096 -0.0170 382 CYS B SG    
3548 N  N     . ASP B 152 ? 0.1221 0.1944 0.1761 0.0103  -0.0232 -0.0024 383 ASP B N     
3549 C  CA    . ASP B 152 ? 0.1514 0.2027 0.1591 0.0270  -0.0085 0.0182  383 ASP B CA    
3550 C  C     . ASP B 152 ? 0.1824 0.1672 0.1469 0.0249  -0.0073 0.0055  383 ASP B C     
3551 O  O     . ASP B 152 ? 0.1731 0.1808 0.1786 0.0071  -0.0242 0.0000  383 ASP B O     
3552 C  CB    . ASP B 152 ? 0.1346 0.2165 0.1784 0.0084  0.0043  -0.0081 383 ASP B CB    
3553 C  CG    . ASP B 152 ? 0.1611 0.2054 0.1861 0.0112  -0.0097 0.0033  383 ASP B CG    
3554 O  OD1   . ASP B 152 ? 0.1861 0.2012 0.1908 0.0090  -0.0161 -0.0057 383 ASP B OD1   
3555 O  OD2   . ASP B 152 ? 0.1670 0.2075 0.1904 0.0275  -0.0294 -0.0042 383 ASP B OD2   
3556 N  N     . HIS B 153 ? 0.1628 0.1769 0.1342 0.0157  -0.0049 -0.0039 384 HIS B N     
3557 C  CA    . HIS B 153 ? 0.1697 0.1713 0.1334 -0.0039 -0.0135 -0.0029 384 HIS B CA    
3558 C  C     . HIS B 153 ? 0.1864 0.1844 0.1743 -0.0093 -0.0042 0.0242  384 HIS B C     
3559 O  O     . HIS B 153 ? 0.2246 0.1994 0.1717 -0.0213 -0.0062 0.0196  384 HIS B O     
3560 C  CB    . HIS B 153 ? 0.2042 0.1995 0.1456 -0.0365 0.0049  -0.0115 384 HIS B CB    
3561 C  CG    . HIS B 153 ? 0.1733 0.1994 0.1428 -0.0134 -0.0256 0.0072  384 HIS B CG    
3562 N  ND1   . HIS B 153 ? 0.1838 0.2093 0.1530 -0.0128 -0.0178 0.0173  384 HIS B ND1   
3563 C  CD2   . HIS B 153 ? 0.1858 0.2550 0.1890 -0.0378 -0.0620 0.0105  384 HIS B CD2   
3564 C  CE1   . HIS B 153 ? 0.1993 0.2095 0.1838 -0.0024 -0.0245 0.0039  384 HIS B CE1   
3565 N  NE2   . HIS B 153 ? 0.2393 0.2490 0.2257 -0.0456 -0.0464 0.0027  384 HIS B NE2   
3566 N  N     . GLU B 154 ? 0.1604 0.2098 0.1902 0.0129  -0.0295 -0.0011 385 GLU B N     
3567 C  CA    . GLU B 154 ? 0.1587 0.2260 0.2304 0.0439  -0.0374 -0.0259 385 GLU B CA    
3568 C  C     . GLU B 154 ? 0.1720 0.2131 0.1926 0.0274  -0.0247 -0.0173 385 GLU B C     
3569 O  O     . GLU B 154 ? 0.2035 0.2202 0.1877 0.0147  -0.0331 -0.0029 385 GLU B O     
3570 C  CB    . GLU B 154 ? 0.2016 0.2863 0.2859 0.0243  -0.0692 -0.0615 385 GLU B CB    
3571 C  CG    . GLU B 154 ? 0.2633 0.3578 0.3266 0.0152  -0.0673 -0.0269 385 GLU B CG    
3572 C  CD    . GLU B 154 ? 0.2609 0.4063 0.3135 0.0035  -0.0949 0.0036  385 GLU B CD    
3573 O  OE1   . GLU B 154 ? 0.2449 0.3698 0.2661 -0.0002 -0.0684 -0.0130 385 GLU B OE1   
3574 O  OE2   . GLU B 154 ? 0.3046 0.4854 0.3421 -0.0256 -0.1031 0.0473  385 GLU B OE2   
3575 N  N     . ASN B 155 ? 0.1490 0.2078 0.1752 0.0120  -0.0323 -0.0281 386 ASN B N     
3576 C  CA    . ASN B 155 ? 0.1479 0.2388 0.1796 -0.0040 0.0006  -0.0224 386 ASN B CA    
3577 C  C     . ASN B 155 ? 0.1498 0.2239 0.1581 0.0009  -0.0027 -0.0210 386 ASN B C     
3578 O  O     . ASN B 155 ? 0.1844 0.2425 0.1780 0.0169  0.0074  -0.0081 386 ASN B O     
3579 C  CB    . ASN B 155 ? 0.1536 0.3072 0.2197 -0.0348 0.0014  -0.0248 386 ASN B CB    
3580 C  CG    . ASN B 155 ? 0.2086 0.3993 0.2475 -0.0213 0.0140  -0.0219 386 ASN B CG    
3581 O  OD1   . ASN B 155 ? 0.2132 0.4808 0.2977 -0.0020 -0.0343 -0.0138 386 ASN B OD1   
3582 N  ND2   . ASN B 155 ? 0.2374 0.4295 0.2368 -0.0410 0.0371  -0.0323 386 ASN B ND2   
3583 N  N     . ALA B 156 ? 0.1316 0.1839 0.1719 0.0019  -0.0163 -0.0050 387 ALA B N     
3584 C  CA    . ALA B 156 ? 0.1486 0.1971 0.1654 0.0040  0.0030  -0.0207 387 ALA B CA    
3585 C  C     . ALA B 156 ? 0.1636 0.1965 0.1654 -0.0031 -0.0177 -0.0124 387 ALA B C     
3586 O  O     . ALA B 156 ? 0.2065 0.2152 0.1619 0.0068  -0.0273 -0.0014 387 ALA B O     
3587 C  CB    . ALA B 156 ? 0.1244 0.2280 0.1574 -0.0210 0.0165  -0.0073 387 ALA B CB    
3588 N  N     . ALA B 157 ? 0.1685 0.1836 0.1569 -0.0283 -0.0158 -0.0291 388 ALA B N     
3589 C  CA    . ALA B 157 ? 0.1691 0.1711 0.1634 -0.0361 -0.0156 -0.0243 388 ALA B CA    
3590 C  C     . ALA B 157 ? 0.1799 0.1700 0.1858 -0.0011 0.0026  -0.0104 388 ALA B C     
3591 O  O     . ALA B 157 ? 0.2263 0.1819 0.2327 0.0038  0.0061  -0.0306 388 ALA B O     
3592 C  CB    . ALA B 157 ? 0.1828 0.2177 0.1747 -0.0427 -0.0261 -0.0180 388 ALA B CB    
3593 N  N     . PHE B 158 ? 0.1737 0.1892 0.1546 -0.0186 0.0157  -0.0113 389 PHE B N     
3594 C  CA    . PHE B 158 ? 0.1823 0.1954 0.1579 -0.0205 0.0075  -0.0107 389 PHE B CA    
3595 C  C     . PHE B 158 ? 0.1843 0.2227 0.1569 0.0110  0.0149  -0.0058 389 PHE B C     
3596 O  O     . PHE B 158 ? 0.2022 0.2274 0.1814 0.0300  0.0014  -0.0164 389 PHE B O     
3597 C  CB    . PHE B 158 ? 0.1702 0.1971 0.1705 -0.0221 0.0194  -0.0309 389 PHE B CB    
3598 C  CG    . PHE B 158 ? 0.1715 0.1841 0.1876 0.0175  0.0060  -0.0485 389 PHE B CG    
3599 C  CD1   . PHE B 158 ? 0.1524 0.1984 0.1959 0.0077  0.0063  -0.0417 389 PHE B CD1   
3600 C  CD2   . PHE B 158 ? 0.2015 0.1948 0.2130 0.0006  -0.0017 -0.0545 389 PHE B CD2   
3601 C  CE1   . PHE B 158 ? 0.1409 0.1932 0.2085 0.0029  0.0141  -0.0409 389 PHE B CE1   
3602 C  CE2   . PHE B 158 ? 0.1945 0.2109 0.2225 -0.0039 -0.0014 -0.0324 389 PHE B CE2   
3603 C  CZ    . PHE B 158 ? 0.1663 0.1994 0.2168 0.0045  -0.0135 -0.0210 389 PHE B CZ    
3604 N  N     . LYS B 159 ? 0.2055 0.2397 0.1610 0.0260  0.0148  0.0113  390 LYS B N     
3605 C  CA    . LYS B 159 ? 0.1803 0.2436 0.1787 0.0000  0.0099  -0.0177 390 LYS B CA    
3606 C  C     . LYS B 159 ? 0.2159 0.2181 0.1892 0.0215  0.0073  -0.0129 390 LYS B C     
3607 O  O     . LYS B 159 ? 0.2752 0.2244 0.1830 0.0324  0.0119  -0.0269 390 LYS B O     
3608 C  CB    . LYS B 159 ? 0.1975 0.2809 0.2075 0.0105  -0.0037 -0.0068 390 LYS B CB    
3609 C  CG    . LYS B 159 ? 0.1848 0.2995 0.2301 0.0089  -0.0130 -0.0047 390 LYS B CG    
3610 C  CD    . LYS B 159 ? 0.2259 0.3189 0.2446 0.0045  -0.0110 0.0061  390 LYS B CD    
3611 C  CE    . LYS B 159 ? 0.2278 0.3250 0.2275 -0.0145 -0.0084 0.0152  390 LYS B CE    
3612 N  NZ    . LYS B 159 ? 0.2570 0.3380 0.2538 0.0139  -0.0303 -0.0023 390 LYS B NZ    
3613 N  N     A ASP B 160 ? 0.1946 0.2066 0.1890 -0.0048 -0.0119 0.0076  391 ASP B N     
3614 N  N     B ASP B 160 ? 0.1905 0.2094 0.2004 0.0083  -0.0388 0.0067  391 ASP B N     
3615 C  CA    A ASP B 160 ? 0.2170 0.1981 0.1936 0.0158  0.0032  0.0119  391 ASP B CA    
3616 C  CA    B ASP B 160 ? 0.2228 0.2065 0.2174 0.0363  -0.0414 0.0156  391 ASP B CA    
3617 C  C     A ASP B 160 ? 0.2130 0.1911 0.1883 -0.0031 -0.0089 0.0009  391 ASP B C     
3618 C  C     B ASP B 160 ? 0.2171 0.2135 0.1978 -0.0006 -0.0309 0.0153  391 ASP B C     
3619 O  O     A ASP B 160 ? 0.2431 0.1859 0.1907 -0.0213 -0.0191 -0.0157 391 ASP B O     
3620 O  O     B ASP B 160 ? 0.2541 0.2438 0.2001 -0.0196 -0.0177 0.0328  391 ASP B O     
3621 C  CB    A ASP B 160 ? 0.2573 0.2120 0.2029 -0.0022 0.0255  0.0281  391 ASP B CB    
3622 C  CB    B ASP B 160 ? 0.2858 0.2140 0.2578 0.0358  -0.0517 0.0221  391 ASP B CB    
3623 C  CG    A ASP B 160 ? 0.2971 0.2450 0.2320 -0.0092 0.0286  0.0072  391 ASP B CG    
3624 C  CG    B ASP B 160 ? 0.3470 0.2394 0.3110 0.0461  -0.0626 0.0011  391 ASP B CG    
3625 O  OD1   A ASP B 160 ? 0.3333 0.2671 0.2301 -0.0230 0.0060  -0.0004 391 ASP B OD1   
3626 O  OD1   B ASP B 160 ? 0.3777 0.2724 0.3335 0.0198  -0.0461 0.0002  391 ASP B OD1   
3627 O  OD2   A ASP B 160 ? 0.3106 0.2629 0.2564 -0.0188 0.0285  0.0029  391 ASP B OD2   
3628 O  OD2   B ASP B 160 ? 0.3622 0.2403 0.3304 0.0502  -0.0936 -0.0324 391 ASP B OD2   
3629 N  N     . VAL B 161 ? 0.1987 0.1968 0.1698 0.0172  -0.0112 0.0028  392 VAL B N     
3630 C  CA    . VAL B 161 ? 0.1851 0.1717 0.1578 0.0181  -0.0129 -0.0106 392 VAL B CA    
3631 C  C     . VAL B 161 ? 0.1669 0.1745 0.1753 -0.0018 -0.0124 -0.0210 392 VAL B C     
3632 O  O     . VAL B 161 ? 0.1744 0.1994 0.1861 -0.0070 -0.0133 -0.0123 392 VAL B O     
3633 C  CB    . VAL B 161 ? 0.2006 0.1936 0.1686 -0.0041 0.0037  -0.0122 392 VAL B CB    
3634 C  CG1   . VAL B 161 ? 0.2135 0.2179 0.1920 0.0270  0.0056  -0.0257 392 VAL B CG1   
3635 C  CG2   . VAL B 161 ? 0.2096 0.2014 0.1804 -0.0044 -0.0031 0.0096  392 VAL B CG2   
3636 N  N     . ALA B 162 ? 0.1483 0.1689 0.1829 0.0095  -0.0047 -0.0157 393 ALA B N     
3637 C  CA    . ALA B 162 ? 0.1863 0.1846 0.1760 0.0095  0.0200  -0.0190 393 ALA B CA    
3638 C  C     . ALA B 162 ? 0.1727 0.1847 0.1798 -0.0079 -0.0114 -0.0113 393 ALA B C     
3639 O  O     . ALA B 162 ? 0.1944 0.1995 0.2155 -0.0221 -0.0362 0.0022  393 ALA B O     
3640 C  CB    . ALA B 162 ? 0.2131 0.1915 0.1835 0.0124  0.0361  -0.0166 393 ALA B CB    
3641 N  N     . LEU B 163 ? 0.1558 0.1836 0.1805 0.0008  -0.0084 -0.0044 394 LEU B N     
3642 C  CA    . LEU B 163 ? 0.1470 0.1826 0.1802 0.0041  0.0095  0.0070  394 LEU B CA    
3643 C  C     . LEU B 163 ? 0.1322 0.1666 0.1821 0.0075  -0.0129 -0.0220 394 LEU B C     
3644 O  O     . LEU B 163 ? 0.1601 0.1781 0.2052 0.0010  -0.0476 -0.0403 394 LEU B O     
3645 C  CB    . LEU B 163 ? 0.1632 0.2256 0.2093 -0.0101 0.0342  0.0070  394 LEU B CB    
3646 C  CG    . LEU B 163 ? 0.1951 0.2875 0.2317 0.0203  0.0307  0.0237  394 LEU B CG    
3647 C  CD1   . LEU B 163 ? 0.2749 0.3264 0.2319 0.0630  -0.0011 -0.0171 394 LEU B CD1   
3648 C  CD2   . LEU B 163 ? 0.2567 0.3311 0.2352 0.0401  -0.0084 -0.0101 394 LEU B CD2   
3649 N  N     . VAL B 164 ? 0.1075 0.1939 0.1704 0.0095  0.0030  -0.0094 395 VAL B N     
3650 C  CA    . VAL B 164 ? 0.1216 0.2006 0.1876 -0.0026 -0.0024 -0.0095 395 VAL B CA    
3651 C  C     . VAL B 164 ? 0.1425 0.1867 0.1729 -0.0077 -0.0261 -0.0146 395 VAL B C     
3652 O  O     . VAL B 164 ? 0.2171 0.1918 0.1963 -0.0210 -0.0507 -0.0038 395 VAL B O     
3653 C  CB    . VAL B 164 ? 0.1400 0.2221 0.1677 0.0012  0.0191  -0.0291 395 VAL B CB    
3654 C  CG1   . VAL B 164 ? 0.1314 0.2652 0.1966 0.0147  0.0136  -0.0509 395 VAL B CG1   
3655 C  CG2   . VAL B 164 ? 0.1767 0.2030 0.1593 -0.0050 -0.0205 0.0206  395 VAL B CG2   
3656 N  N     . LEU B 165 ? 0.1345 0.1579 0.1790 0.0100  -0.0030 0.0059  396 LEU B N     
3657 C  CA    . LEU B 165 ? 0.1484 0.1527 0.2033 0.0122  -0.0073 0.0103  396 LEU B CA    
3658 C  C     . LEU B 165 ? 0.1513 0.1798 0.1967 0.0279  -0.0060 -0.0086 396 LEU B C     
3659 O  O     . LEU B 165 ? 0.1842 0.1970 0.1901 0.0274  -0.0219 -0.0131 396 LEU B O     
3660 C  CB    . LEU B 165 ? 0.1561 0.1659 0.2333 -0.0213 0.0117  -0.0129 396 LEU B CB    
3661 C  CG    . LEU B 165 ? 0.1977 0.1923 0.2637 -0.0406 0.0374  -0.0264 396 LEU B CG    
3662 C  CD1   . LEU B 165 ? 0.2174 0.1760 0.2958 -0.0524 0.0331  -0.0421 396 LEU B CD1   
3663 C  CD2   . LEU B 165 ? 0.2166 0.2190 0.2581 -0.0440 0.0113  -0.0469 396 LEU B CD2   
3664 N  N     . THR B 166 ? 0.1352 0.1801 0.2018 0.0257  -0.0212 0.0020  397 THR B N     
3665 C  CA    . THR B 166 ? 0.1233 0.1819 0.1979 0.0099  -0.0150 0.0186  397 THR B CA    
3666 C  C     . THR B 166 ? 0.1510 0.1822 0.1915 0.0167  -0.0038 0.0098  397 THR B C     
3667 O  O     . THR B 166 ? 0.1767 0.2030 0.1962 0.0120  0.0233  0.0107  397 THR B O     
3668 C  CB    . THR B 166 ? 0.1753 0.2247 0.1895 -0.0152 -0.0197 0.0230  397 THR B CB    
3669 O  OG1   . THR B 166 ? 0.1563 0.2217 0.1829 -0.0073 0.0055  -0.0014 397 THR B OG1   
3670 C  CG2   . THR B 166 ? 0.2016 0.2369 0.2100 -0.0305 -0.0416 0.0359  397 THR B CG2   
3671 N  N     . VAL B 167 ? 0.1629 0.1856 0.2008 0.0259  -0.0088 -0.0068 398 VAL B N     
3672 C  CA    . VAL B 167 ? 0.1605 0.1881 0.1946 0.0087  -0.0027 -0.0036 398 VAL B CA    
3673 C  C     . VAL B 167 ? 0.1540 0.2154 0.1809 0.0110  -0.0075 -0.0058 398 VAL B C     
3674 O  O     . VAL B 167 ? 0.1636 0.2157 0.1850 0.0338  0.0013  0.0059  398 VAL B O     
3675 C  CB    . VAL B 167 ? 0.1693 0.1687 0.2019 0.0194  0.0123  0.0080  398 VAL B CB    
3676 C  CG1   . VAL B 167 ? 0.2199 0.1631 0.2111 0.0353  0.0221  0.0178  398 VAL B CG1   
3677 C  CG2   . VAL B 167 ? 0.1566 0.2002 0.2266 0.0115  -0.0108 -0.0074 398 VAL B CG2   
3678 N  N     . LEU B 168 ? 0.1428 0.2257 0.1955 0.0191  -0.0408 -0.0200 399 LEU B N     
3679 C  CA    . LEU B 168 ? 0.1442 0.2208 0.2056 0.0127  -0.0475 0.0058  399 LEU B CA    
3680 C  C     . LEU B 168 ? 0.1737 0.2407 0.2157 0.0189  -0.0335 0.0115  399 LEU B C     
3681 O  O     . LEU B 168 ? 0.1971 0.2700 0.2105 0.0247  -0.0088 0.0207  399 LEU B O     
3682 C  CB    . LEU B 168 ? 0.1411 0.2519 0.2165 0.0089  -0.0436 -0.0009 399 LEU B CB    
3683 C  CG    . LEU B 168 ? 0.1617 0.3047 0.2210 0.0217  -0.0532 0.0194  399 LEU B CG    
3684 C  CD1   . LEU B 168 ? 0.1900 0.3293 0.2460 0.0074  -0.0264 0.0230  399 LEU B CD1   
3685 C  CD2   . LEU B 168 ? 0.1986 0.3327 0.2310 0.0204  -0.0733 0.0092  399 LEU B CD2   
3686 N  N     . LEU B 169 ? 0.1927 0.2119 0.2105 0.0060  -0.0238 0.0004  400 LEU B N     
3687 C  CA    . LEU B 169 ? 0.1989 0.2083 0.2013 0.0237  -0.0255 0.0301  400 LEU B CA    
3688 C  C     . LEU B 169 ? 0.2246 0.2265 0.2601 0.0440  -0.0341 0.0361  400 LEU B C     
3689 O  O     . LEU B 169 ? 0.2326 0.2247 0.2965 0.0327  -0.0477 0.0267  400 LEU B O     
3690 C  CB    . LEU B 169 ? 0.2157 0.2386 0.2102 0.0079  -0.0053 0.0200  400 LEU B CB    
3691 C  CG    . LEU B 169 ? 0.1953 0.2321 0.2066 0.0186  0.0126  0.0135  400 LEU B CG    
3692 C  CD1   . LEU B 169 ? 0.2610 0.2429 0.2177 0.0006  0.0284  0.0013  400 LEU B CD1   
3693 C  CD2   . LEU B 169 ? 0.1763 0.2373 0.2264 0.0360  -0.0090 0.0287  400 LEU B CD2   
3694 N  N     . GLU B 170 ? 0.2207 0.2429 0.2875 0.0564  -0.0412 0.0656  401 GLU B N     
3695 C  CA    . GLU B 170 ? 0.2566 0.3025 0.3278 0.0604  -0.0359 0.0825  401 GLU B CA    
3696 C  C     . GLU B 170 ? 0.2723 0.3136 0.3612 0.0670  -0.0161 0.0756  401 GLU B C     
3697 O  O     . GLU B 170 ? 0.3052 0.3359 0.3895 0.0668  -0.0200 0.0727  401 GLU B O     
3698 C  CB    . GLU B 170 ? 0.3142 0.3397 0.3685 0.0611  -0.0359 0.1101  401 GLU B CB    
3699 C  CG    . GLU B 170 ? 0.3814 0.3918 0.4042 0.0541  -0.0138 0.1117  401 GLU B CG    
3700 C  CD    . GLU B 170 ? 0.4681 0.4481 0.4607 0.0625  -0.0097 0.0868  401 GLU B CD    
3701 O  OE1   . GLU B 170 ? 0.5234 0.4528 0.4900 0.0702  0.0034  0.0835  401 GLU B OE1   
3702 O  OE2   . GLU B 170 ? 0.4796 0.4875 0.4734 0.0618  -0.0146 0.0779  401 GLU B OE2   
3703 N  N     . GLU B 171 ? 0.2796 0.2860 0.3716 0.0487  0.0129  0.0567  402 GLU B N     
3704 C  CA    . GLU B 171 ? 0.3013 0.3236 0.4069 0.0541  0.0282  0.0396  402 GLU B CA    
3705 C  C     . GLU B 171 ? 0.2612 0.3073 0.4026 0.0668  0.0376  0.0385  402 GLU B C     
3706 O  O     . GLU B 171 ? 0.2609 0.2930 0.3799 0.0625  0.0507  0.0462  402 GLU B O     
3707 C  CB    . GLU B 171 ? 0.3758 0.4007 0.4365 0.0558  0.0172  0.0195  402 GLU B CB    
3708 C  CG    . GLU B 171 ? 0.4290 0.4702 0.4678 0.0321  -0.0023 0.0015  402 GLU B CG    
3709 C  CD    . GLU B 171 ? 0.5104 0.5418 0.4968 0.0089  -0.0365 -0.0069 402 GLU B CD    
3710 O  OE1   . GLU B 171 ? 0.5571 0.5700 0.5114 0.0178  -0.0754 -0.0158 402 GLU B OE1   
3711 O  OE2   . GLU B 171 ? 0.5102 0.5574 0.4992 -0.0141 -0.0226 -0.0111 402 GLU B OE2   
3712 N  N     . GLU B 172 ? 0.2493 0.3151 0.4382 0.0898  0.0518  0.0434  403 GLU B N     
3713 C  CA    . GLU B 172 ? 0.2432 0.3418 0.4697 0.0943  0.0193  0.0363  403 GLU B CA    
3714 C  C     . GLU B 172 ? 0.2331 0.3158 0.4608 0.0678  0.0110  0.0187  403 GLU B C     
3715 O  O     . GLU B 172 ? 0.1921 0.3009 0.4649 0.0354  0.0117  0.0178  403 GLU B O     
3716 C  CB    . GLU B 172 ? 0.2638 0.4048 0.5136 0.0908  0.0219  0.0366  403 GLU B CB    
3717 C  CG    . GLU B 172 ? 0.3275 0.4631 0.5571 0.0864  -0.0133 0.0322  403 GLU B CG    
3718 C  CD    . GLU B 172 ? 0.3920 0.5228 0.6006 0.0837  -0.0411 0.0485  403 GLU B CD    
3719 O  OE1   . GLU B 172 ? 0.3613 0.5536 0.6068 0.1279  -0.0718 0.0597  403 GLU B OE1   
3720 O  OE2   . GLU B 172 ? 0.4678 0.5454 0.6228 0.0679  -0.0558 0.0493  403 GLU B OE2   
3721 N  N     . THR B 173 ? 0.2460 0.3034 0.4530 0.0814  -0.0023 0.0134  404 THR B N     
3722 C  CA    . THR B 173 ? 0.2537 0.3019 0.4589 0.0581  0.0118  -0.0143 404 THR B CA    
3723 C  C     . THR B 173 ? 0.2557 0.2843 0.4621 0.0323  0.0057  -0.0147 404 THR B C     
3724 O  O     . THR B 173 ? 0.2781 0.2804 0.4736 -0.0069 -0.0021 -0.0121 404 THR B O     
3725 C  CB    . THR B 173 ? 0.2825 0.3318 0.4922 0.0545  0.0415  -0.0303 404 THR B CB    
3726 O  OG1   . THR B 173 ? 0.3022 0.3472 0.5159 0.0526  0.0455  -0.0339 404 THR B OG1   
3727 C  CG2   . THR B 173 ? 0.2834 0.3506 0.5019 0.0402  0.0583  -0.0212 404 THR B CG2   
3728 N  N     . LEU B 174 ? 0.2342 0.2632 0.4439 0.0466  -0.0216 -0.0261 405 LEU B N     
3729 C  CA    . LEU B 174 ? 0.2487 0.2650 0.4562 0.0439  -0.0312 0.0003  405 LEU B CA    
3730 C  C     . LEU B 174 ? 0.2811 0.3132 0.4744 0.0123  -0.0698 -0.0117 405 LEU B C     
3731 O  O     . LEU B 174 ? 0.3047 0.3211 0.4790 0.0017  -0.0711 0.0041  405 LEU B O     
3732 C  CB    . LEU B 174 ? 0.2801 0.2491 0.4549 0.0358  -0.0311 0.0425  405 LEU B CB    
3733 C  CG    . LEU B 174 ? 0.2674 0.2500 0.4524 0.0230  -0.0100 0.0357  405 LEU B CG    
3734 C  CD1   . LEU B 174 ? 0.2697 0.2654 0.4553 -0.0014 0.0089  0.0201  405 LEU B CD1   
3735 C  CD2   . LEU B 174 ? 0.2668 0.2440 0.4479 0.0430  0.0080  0.0417  405 LEU B CD2   
3736 N  N     . GLU B 175 ? 0.3080 0.3533 0.4987 0.0218  -0.0787 -0.0317 406 GLU B N     
3737 C  CA    . GLU B 175 ? 0.3659 0.4158 0.5152 0.0137  -0.0746 -0.0442 406 GLU B CA    
3738 C  C     . GLU B 175 ? 0.3249 0.4249 0.4949 0.0166  -0.0683 -0.0553 406 GLU B C     
3739 O  O     . GLU B 175 ? 0.2891 0.4217 0.4767 0.0287  -0.0681 -0.0637 406 GLU B O     
3740 C  CB    . GLU B 175 ? 0.4504 0.4881 0.5626 0.0118  -0.0685 -0.0351 406 GLU B CB    
3741 C  CG    . GLU B 175 ? 0.5114 0.5485 0.5987 0.0222  -0.0642 -0.0275 406 GLU B CG    
3742 C  CD    . GLU B 175 ? 0.5906 0.6091 0.6281 0.0328  -0.0567 -0.0218 406 GLU B CD    
3743 O  OE1   . GLU B 175 ? 0.6221 0.6269 0.6324 0.0412  -0.0436 -0.0215 406 GLU B OE1   
3744 O  OE2   . GLU B 175 ? 0.6117 0.6320 0.6408 0.0358  -0.0693 -0.0174 406 GLU B OE2   
3745 N  N     . ALA B 176 ? 0.3378 0.4507 0.5016 0.0060  -0.0642 -0.0410 407 ALA B N     
3746 C  CA    . ALA B 176 ? 0.3320 0.4675 0.5012 -0.0125 -0.0327 -0.0384 407 ALA B CA    
3747 C  C     . ALA B 176 ? 0.3006 0.4526 0.4700 -0.0080 -0.0101 -0.0547 407 ALA B C     
3748 O  O     . ALA B 176 ? 0.3161 0.4463 0.4673 -0.0347 -0.0009 -0.0461 407 ALA B O     
3749 C  CB    . ALA B 176 ? 0.3374 0.4747 0.5131 -0.0215 -0.0271 -0.0347 407 ALA B CB    
3750 N  N     . SER B 177 ? 0.2698 0.4392 0.4376 0.0111  0.0204  -0.0836 408 SER B N     
3751 C  CA    . SER B 177 ? 0.2642 0.4179 0.4139 0.0328  0.0613  -0.1008 408 SER B CA    
3752 C  C     . SER B 177 ? 0.2602 0.3893 0.3690 0.0143  0.0537  -0.1032 408 SER B C     
3753 O  O     . SER B 177 ? 0.2671 0.3955 0.3478 0.0180  0.0363  -0.1295 408 SER B O     
3754 C  CB    . SER B 177 ? 0.3504 0.4329 0.4626 0.0405  0.0639  -0.0847 408 SER B CB    
3755 O  OG    . SER B 177 ? 0.4000 0.4441 0.4944 0.0427  0.0715  -0.0870 408 SER B OG    
3756 N  N     . VAL B 178 ? 0.2690 0.3347 0.3250 0.0198  0.0472  -0.1033 409 VAL B N     
3757 C  CA    . VAL B 178 ? 0.2850 0.3026 0.3049 0.0376  0.0254  -0.0647 409 VAL B CA    
3758 C  C     . VAL B 178 ? 0.2785 0.2861 0.2930 0.0305  0.0118  -0.0414 409 VAL B C     
3759 O  O     . VAL B 178 ? 0.2931 0.2931 0.3143 0.0360  0.0008  -0.0318 409 VAL B O     
3760 C  CB    . VAL B 178 ? 0.3087 0.2815 0.3003 0.0381  0.0157  -0.0435 409 VAL B CB    
3761 C  CG1   . VAL B 178 ? 0.3102 0.2498 0.2872 0.0772  -0.0099 -0.0396 409 VAL B CG1   
3762 C  CG2   . VAL B 178 ? 0.2940 0.2870 0.3002 0.0450  0.0357  -0.0226 409 VAL B CG2   
3763 N  N     . GLY B 179 ? 0.2552 0.2827 0.2626 0.0433  0.0404  -0.0204 410 GLY B N     
3764 C  CA    . GLY B 179 ? 0.2358 0.3037 0.2554 0.0324  0.0271  -0.0078 410 GLY B CA    
3765 C  C     . GLY B 179 ? 0.2383 0.2957 0.2241 0.0062  0.0275  0.0020  410 GLY B C     
3766 O  O     . GLY B 179 ? 0.2654 0.2902 0.2102 -0.0023 0.0057  -0.0042 410 GLY B O     
3767 N  N     . PRO B 180 ? 0.2481 0.3023 0.2174 -0.0140 0.0393  0.0151  411 PRO B N     
3768 C  CA    . PRO B 180 ? 0.2131 0.2944 0.2150 0.0083  0.0262  0.0074  411 PRO B CA    
3769 C  C     . PRO B 180 ? 0.2258 0.2648 0.2085 0.0018  0.0073  -0.0028 411 PRO B C     
3770 O  O     . PRO B 180 ? 0.2524 0.2718 0.2134 0.0182  0.0078  -0.0001 411 PRO B O     
3771 C  CB    . PRO B 180 ? 0.2429 0.3053 0.2364 0.0090  0.0252  0.0353  411 PRO B CB    
3772 C  CG    . PRO B 180 ? 0.2722 0.3229 0.2376 0.0163  0.0234  0.0234  411 PRO B CG    
3773 C  CD    . PRO B 180 ? 0.2740 0.3094 0.2151 0.0150  0.0154  0.0264  411 PRO B CD    
3774 N  N     . ARG B 181 ? 0.2391 0.2500 0.2318 -0.0148 0.0039  -0.0190 412 ARG B N     
3775 C  CA    . ARG B 181 ? 0.2523 0.2572 0.2357 -0.0298 -0.0095 -0.0189 412 ARG B CA    
3776 C  C     . ARG B 181 ? 0.2297 0.2385 0.2247 -0.0164 -0.0098 -0.0235 412 ARG B C     
3777 O  O     . ARG B 181 ? 0.2314 0.2306 0.2107 -0.0359 -0.0059 -0.0151 412 ARG B O     
3778 C  CB    . ARG B 181 ? 0.3122 0.3133 0.2707 -0.0077 -0.0104 -0.0091 412 ARG B CB    
3779 C  CG    . ARG B 181 ? 0.4174 0.3854 0.3214 0.0103  -0.0095 -0.0095 412 ARG B CG    
3780 C  CD    . ARG B 181 ? 0.4905 0.4462 0.3982 0.0522  -0.0086 -0.0139 412 ARG B CD    
3781 N  NE    . ARG B 181 ? 0.5557 0.4879 0.4384 0.1046  0.0108  -0.0353 412 ARG B NE    
3782 C  CZ    . ARG B 181 ? 0.5602 0.4909 0.4251 0.1623  0.0394  -0.0683 412 ARG B CZ    
3783 N  NH1   . ARG B 181 ? 0.5450 0.4787 0.4429 0.1827  0.0484  -0.0655 412 ARG B NH1   
3784 N  NH2   . ARG B 181 ? 0.5678 0.5018 0.4325 0.1686  0.0564  -0.0870 412 ARG B NH2   
3785 N  N     . GLU B 182 ? 0.2082 0.2427 0.2398 -0.0085 -0.0129 -0.0270 413 GLU B N     
3786 C  CA    . GLU B 182 ? 0.2253 0.2632 0.2598 0.0309  0.0143  -0.0281 413 GLU B CA    
3787 C  C     . GLU B 182 ? 0.2148 0.2554 0.2319 -0.0074 0.0137  -0.0346 413 GLU B C     
3788 O  O     . GLU B 182 ? 0.2362 0.2590 0.2211 0.0299  0.0145  -0.0384 413 GLU B O     
3789 C  CB    . GLU B 182 ? 0.2945 0.2958 0.3239 0.0859  0.0291  -0.0229 413 GLU B CB    
3790 C  CG    . GLU B 182 ? 0.3299 0.3367 0.3707 0.1088  0.0382  -0.0037 413 GLU B CG    
3791 C  CD    . GLU B 182 ? 0.3912 0.3906 0.4255 0.0879  0.0652  0.0073  413 GLU B CD    
3792 O  OE1   . GLU B 182 ? 0.4160 0.4073 0.4504 0.0678  0.1026  -0.0083 413 GLU B OE1   
3793 O  OE2   . GLU B 182 ? 0.4155 0.4214 0.4586 0.0952  0.0592  0.0183  413 GLU B OE2   
3794 N  N     . THR B 183 ? 0.1962 0.2368 0.2250 -0.0157 0.0181  -0.0591 414 THR B N     
3795 C  CA    . THR B 183 ? 0.1805 0.2342 0.2281 -0.0186 0.0198  -0.0466 414 THR B CA    
3796 C  C     . THR B 183 ? 0.1606 0.2191 0.2139 -0.0045 0.0081  -0.0168 414 THR B C     
3797 O  O     . THR B 183 ? 0.1813 0.2235 0.2018 0.0151  -0.0078 -0.0034 414 THR B O     
3798 C  CB    . THR B 183 ? 0.1930 0.2389 0.2302 -0.0156 0.0442  -0.0467 414 THR B CB    
3799 O  OG1   . THR B 183 ? 0.2024 0.2721 0.2513 0.0031  0.0324  -0.0414 414 THR B OG1   
3800 C  CG2   . THR B 183 ? 0.2221 0.2327 0.2420 0.0267  0.0227  -0.0531 414 THR B CG2   
3801 N  N     . GLU B 184 ? 0.1279 0.2232 0.2021 0.0008  -0.0008 -0.0095 415 GLU B N     
3802 C  CA    . GLU B 184 ? 0.1347 0.2379 0.2116 0.0067  -0.0090 0.0075  415 GLU B CA    
3803 C  C     . GLU B 184 ? 0.1592 0.2257 0.1916 0.0178  0.0116  -0.0065 415 GLU B C     
3804 O  O     . GLU B 184 ? 0.1795 0.2475 0.1891 0.0207  0.0064  -0.0238 415 GLU B O     
3805 C  CB    . GLU B 184 ? 0.1233 0.2624 0.2175 0.0138  -0.0098 -0.0050 415 GLU B CB    
3806 C  CG    . GLU B 184 ? 0.1600 0.2783 0.2262 0.0304  -0.0103 0.0146  415 GLU B CG    
3807 C  CD    . GLU B 184 ? 0.2026 0.2980 0.2122 0.0169  -0.0119 0.0343  415 GLU B CD    
3808 O  OE1   . GLU B 184 ? 0.2357 0.3536 0.2348 0.0004  -0.0247 0.0501  415 GLU B OE1   
3809 O  OE2   . GLU B 184 ? 0.2127 0.2914 0.2105 0.0201  0.0024  0.0197  415 GLU B OE2   
3810 N  N     . GLU B 185 ? 0.1874 0.2057 0.2019 0.0239  -0.0007 -0.0140 416 GLU B N     
3811 C  CA    . GLU B 185 ? 0.1907 0.2070 0.1978 0.0059  -0.0083 -0.0428 416 GLU B CA    
3812 C  C     . GLU B 185 ? 0.1787 0.2137 0.2024 0.0125  0.0066  -0.0110 416 GLU B C     
3813 O  O     . GLU B 185 ? 0.1989 0.2254 0.2036 0.0188  0.0053  0.0098  416 GLU B O     
3814 C  CB    . GLU B 185 ? 0.2415 0.2288 0.2174 0.0290  -0.0365 -0.0515 416 GLU B CB    
3815 C  CG    . GLU B 185 ? 0.2838 0.2639 0.2280 0.0183  -0.0397 -0.0530 416 GLU B CG    
3816 C  CD    . GLU B 185 ? 0.3440 0.3206 0.2865 0.0022  -0.0282 -0.0782 416 GLU B CD    
3817 O  OE1   . GLU B 185 ? 0.3810 0.3266 0.3133 0.0369  -0.0249 -0.1049 416 GLU B OE1   
3818 O  OE2   . GLU B 185 ? 0.3554 0.3398 0.3018 -0.0200 -0.0199 -0.0885 416 GLU B OE2   
3819 N  N     . LYS B 186 ? 0.1705 0.2138 0.2120 0.0183  -0.0162 -0.0320 417 LYS B N     
3820 C  CA    . LYS B 186 ? 0.1800 0.2243 0.2110 0.0328  -0.0001 -0.0053 417 LYS B CA    
3821 C  C     . LYS B 186 ? 0.1768 0.2130 0.2043 0.0283  -0.0175 0.0111  417 LYS B C     
3822 O  O     . LYS B 186 ? 0.1899 0.2377 0.1918 0.0447  -0.0094 0.0275  417 LYS B O     
3823 C  CB    . LYS B 186 ? 0.1741 0.2562 0.2360 0.0379  0.0344  -0.0143 417 LYS B CB    
3824 C  CG    . LYS B 186 ? 0.1963 0.2861 0.2664 0.0566  0.0491  -0.0344 417 LYS B CG    
3825 C  CD    . LYS B 186 ? 0.2145 0.3055 0.2935 0.0709  0.0779  -0.0390 417 LYS B CD    
3826 C  CE    . LYS B 186 ? 0.2869 0.3440 0.3419 0.0750  0.0573  -0.0192 417 LYS B CE    
3827 N  NZ    . LYS B 186 ? 0.3433 0.3812 0.3846 0.0707  0.0436  -0.0094 417 LYS B NZ    
3828 N  N     . VAL B 187 ? 0.1627 0.1787 0.2078 0.0222  -0.0022 -0.0023 418 VAL B N     
3829 C  CA    . VAL B 187 ? 0.1832 0.1796 0.2035 0.0265  0.0040  0.0169  418 VAL B CA    
3830 C  C     . VAL B 187 ? 0.1599 0.1869 0.1858 0.0209  -0.0097 0.0193  418 VAL B C     
3831 O  O     . VAL B 187 ? 0.1770 0.2319 0.1809 0.0174  -0.0095 0.0115  418 VAL B O     
3832 C  CB    . VAL B 187 ? 0.1622 0.1803 0.2009 0.0230  0.0092  0.0127  418 VAL B CB    
3833 C  CG1   . VAL B 187 ? 0.1680 0.1909 0.2157 0.0320  -0.0068 0.0075  418 VAL B CG1   
3834 C  CG2   . VAL B 187 ? 0.1828 0.2073 0.2260 0.0127  0.0158  -0.0049 418 VAL B CG2   
3835 N  N     . ARG B 188 ? 0.1601 0.1909 0.2035 -0.0003 -0.0172 0.0148  419 ARG B N     
3836 C  CA    . ARG B 188 ? 0.1449 0.1920 0.1834 -0.0028 -0.0077 0.0080  419 ARG B CA    
3837 C  C     . ARG B 188 ? 0.1686 0.2086 0.1955 0.0159  0.0043  0.0074  419 ARG B C     
3838 O  O     . ARG B 188 ? 0.1614 0.2344 0.1885 0.0188  0.0008  0.0171  419 ARG B O     
3839 C  CB    . ARG B 188 ? 0.1655 0.1898 0.1960 -0.0244 -0.0103 -0.0075 419 ARG B CB    
3840 C  CG    . ARG B 188 ? 0.1955 0.1765 0.1964 -0.0352 0.0103  -0.0142 419 ARG B CG    
3841 C  CD    . ARG B 188 ? 0.2038 0.1969 0.1957 0.0057  0.0005  -0.0309 419 ARG B CD    
3842 N  NE    . ARG B 188 ? 0.2410 0.1827 0.2370 0.0018  -0.0040 -0.0021 419 ARG B NE    
3843 C  CZ    . ARG B 188 ? 0.2227 0.2104 0.2409 -0.0009 -0.0164 -0.0102 419 ARG B CZ    
3844 N  NH1   . ARG B 188 ? 0.2092 0.2292 0.2368 -0.0135 -0.0005 0.0000  419 ARG B NH1   
3845 N  NH2   . ARG B 188 ? 0.2226 0.2227 0.2616 0.0033  -0.0279 -0.0052 419 ARG B NH2   
3846 N  N     . ASP B 189 ? 0.1964 0.1898 0.2012 0.0230  -0.0058 0.0129  420 ASP B N     
3847 C  CA    . ASP B 189 ? 0.2324 0.1892 0.2191 0.0236  -0.0176 -0.0084 420 ASP B CA    
3848 C  C     . ASP B 189 ? 0.2043 0.2138 0.2113 0.0091  -0.0086 0.0042  420 ASP B C     
3849 O  O     . ASP B 189 ? 0.2275 0.2267 0.2125 0.0180  0.0025  0.0109  420 ASP B O     
3850 C  CB    . ASP B 189 ? 0.2872 0.2099 0.2614 0.0438  0.0007  -0.0102 420 ASP B CB    
3851 C  CG    . ASP B 189 ? 0.3856 0.2406 0.3004 0.0345  0.0026  -0.0095 420 ASP B CG    
3852 O  OD1   . ASP B 189 ? 0.3964 0.2473 0.2963 0.0453  -0.0701 -0.0033 420 ASP B OD1   
3853 O  OD2   . ASP B 189 ? 0.4775 0.2655 0.3289 -0.0001 0.0299  -0.0176 420 ASP B OD2   
3854 N  N     . LEU B 190 ? 0.1622 0.2198 0.2286 0.0177  -0.0361 0.0114  421 LEU B N     
3855 C  CA    . LEU B 190 ? 0.1819 0.2253 0.2184 -0.0059 -0.0174 0.0244  421 LEU B CA    
3856 C  C     . LEU B 190 ? 0.2034 0.2162 0.2004 0.0109  -0.0143 0.0110  421 LEU B C     
3857 O  O     . LEU B 190 ? 0.2038 0.2659 0.2045 0.0128  -0.0159 0.0200  421 LEU B O     
3858 C  CB    . LEU B 190 ? 0.1788 0.2423 0.2405 -0.0116 -0.0286 0.0412  421 LEU B CB    
3859 C  CG    . LEU B 190 ? 0.1804 0.2502 0.2668 -0.0185 -0.0608 0.0439  421 LEU B CG    
3860 C  CD1   . LEU B 190 ? 0.2391 0.2481 0.2689 0.0134  -0.0706 0.0355  421 LEU B CD1   
3861 C  CD2   . LEU B 190 ? 0.2147 0.2886 0.2934 -0.0387 -0.0362 0.0431  421 LEU B CD2   
3862 N  N     . LEU B 191 ? 0.1683 0.2152 0.2001 0.0423  -0.0041 -0.0012 422 LEU B N     
3863 C  CA    . LEU B 191 ? 0.1974 0.2096 0.1798 0.0317  -0.0035 0.0059  422 LEU B CA    
3864 C  C     . LEU B 191 ? 0.1953 0.2158 0.1762 0.0152  0.0075  0.0102  422 LEU B C     
3865 O  O     . LEU B 191 ? 0.2020 0.2308 0.1779 0.0071  0.0057  -0.0034 422 LEU B O     
3866 C  CB    . LEU B 191 ? 0.2135 0.2132 0.1960 0.0250  -0.0076 0.0299  422 LEU B CB    
3867 C  CG    . LEU B 191 ? 0.2511 0.2260 0.2120 0.0077  -0.0455 0.0194  422 LEU B CG    
3868 C  CD1   . LEU B 191 ? 0.2560 0.2431 0.2094 0.0327  -0.0322 0.0569  422 LEU B CD1   
3869 C  CD2   . LEU B 191 ? 0.2743 0.2595 0.2238 -0.0084 -0.0705 0.0003  422 LEU B CD2   
3870 N  N     . TRP B 192 ? 0.1859 0.2323 0.1962 -0.0038 -0.0096 0.0388  423 TRP B N     
3871 C  CA    . TRP B 192 ? 0.2099 0.2253 0.1910 -0.0111 -0.0140 0.0150  423 TRP B CA    
3872 C  C     . TRP B 192 ? 0.2444 0.2764 0.2035 0.0038  -0.0205 0.0440  423 TRP B C     
3873 O  O     . TRP B 192 ? 0.2359 0.3099 0.2080 0.0067  -0.0141 0.0630  423 TRP B O     
3874 C  CB    . TRP B 192 ? 0.2131 0.2293 0.2161 -0.0183 -0.0246 -0.0168 423 TRP B CB    
3875 C  CG    . TRP B 192 ? 0.1849 0.2123 0.2119 -0.0093 -0.0086 -0.0070 423 TRP B CG    
3876 C  CD1   . TRP B 192 ? 0.2059 0.2039 0.2210 -0.0176 -0.0248 0.0017  423 TRP B CD1   
3877 C  CD2   . TRP B 192 ? 0.1919 0.2075 0.1936 0.0117  0.0000  0.0153  423 TRP B CD2   
3878 N  NE1   . TRP B 192 ? 0.2207 0.2188 0.2051 0.0043  -0.0201 0.0195  423 TRP B NE1   
3879 C  CE2   . TRP B 192 ? 0.2133 0.2067 0.2030 0.0153  0.0068  0.0147  423 TRP B CE2   
3880 C  CE3   . TRP B 192 ? 0.1992 0.2142 0.1874 0.0202  -0.0126 0.0168  423 TRP B CE3   
3881 C  CZ2   . TRP B 192 ? 0.2053 0.2000 0.1793 0.0117  0.0083  0.0126  423 TRP B CZ2   
3882 C  CZ3   . TRP B 192 ? 0.2247 0.2256 0.1952 0.0230  0.0011  -0.0015 423 TRP B CZ3   
3883 C  CH2   . TRP B 192 ? 0.2096 0.2108 0.1746 0.0011  0.0217  -0.0023 423 TRP B CH2   
3884 N  N     . ALA B 193 ? 0.2147 0.2757 0.2124 0.0179  -0.0513 0.0575  424 ALA B N     
3885 C  CA    . ALA B 193 ? 0.2311 0.2967 0.2168 0.0407  -0.0413 0.0533  424 ALA B CA    
3886 C  C     . ALA B 193 ? 0.2416 0.3022 0.1958 0.0140  -0.0295 0.0561  424 ALA B C     
3887 O  O     . ALA B 193 ? 0.3287 0.3247 0.2084 0.0063  -0.0072 0.0655  424 ALA B O     
3888 C  CB    . ALA B 193 ? 0.2470 0.3121 0.2386 0.0638  -0.0377 0.0537  424 ALA B CB    
3889 N  N     . LYS B 194 ? 0.2426 0.3050 0.1948 0.0235  -0.0156 0.0418  425 LYS B N     
3890 C  CA    . LYS B 194 ? 0.2498 0.3165 0.1978 0.0022  -0.0041 0.0401  425 LYS B CA    
3891 C  C     . LYS B 194 ? 0.2669 0.3162 0.1801 0.0152  -0.0135 0.0196  425 LYS B C     
3892 O  O     . LYS B 194 ? 0.3315 0.3450 0.1774 0.0188  -0.0277 0.0043  425 LYS B O     
3893 C  CB    . LYS B 194 ? 0.2836 0.3631 0.2603 -0.0114 0.0217  0.0339  425 LYS B CB    
3894 C  CG    . LYS B 194 ? 0.3132 0.4146 0.2874 0.0026  0.0378  0.0434  425 LYS B CG    
3895 C  CD    . LYS B 194 ? 0.3882 0.4582 0.3596 0.0204  0.0663  0.0587  425 LYS B CD    
3896 C  CE    . LYS B 194 ? 0.4880 0.4767 0.4132 0.0342  0.0835  0.0442  425 LYS B CE    
3897 N  NZ    . LYS B 194 ? 0.5318 0.4804 0.4313 0.0701  0.1049  0.0203  425 LYS B NZ    
3898 N  N     . PHE B 195 ? 0.2221 0.3086 0.1977 0.0109  -0.0067 0.0217  426 PHE B N     
3899 C  CA    . PHE B 195 ? 0.2234 0.2804 0.2096 -0.0168 0.0096  0.0307  426 PHE B CA    
3900 C  C     . PHE B 195 ? 0.2251 0.2905 0.2224 -0.0320 0.0005  0.0311  426 PHE B C     
3901 O  O     . PHE B 195 ? 0.2432 0.3182 0.2339 -0.0217 0.0112  0.0411  426 PHE B O     
3902 C  CB    . PHE B 195 ? 0.2080 0.2500 0.2057 -0.0051 -0.0222 0.0286  426 PHE B CB    
3903 C  CG    . PHE B 195 ? 0.2046 0.2296 0.2128 0.0071  -0.0270 0.0185  426 PHE B CG    
3904 C  CD1   . PHE B 195 ? 0.2070 0.2535 0.2178 0.0065  -0.0188 0.0147  426 PHE B CD1   
3905 C  CD2   . PHE B 195 ? 0.2362 0.2413 0.2428 -0.0191 -0.0529 0.0365  426 PHE B CD2   
3906 C  CE1   . PHE B 195 ? 0.2088 0.2630 0.2207 0.0109  -0.0135 0.0185  426 PHE B CE1   
3907 C  CE2   . PHE B 195 ? 0.2289 0.2629 0.2497 -0.0382 -0.0348 0.0414  426 PHE B CE2   
3908 C  CZ    . PHE B 195 ? 0.2128 0.2583 0.2413 -0.0080 -0.0224 0.0135  426 PHE B CZ    
3909 N  N     A THR B 196 ? 0.2537 0.3002 0.2371 -0.0334 -0.0103 0.0313  427 THR B N     
3910 N  N     B THR B 196 ? 0.2363 0.2880 0.2209 -0.0315 -0.0147 0.0389  427 THR B N     
3911 C  CA    A THR B 196 ? 0.2525 0.3032 0.2675 -0.0227 -0.0122 0.0299  427 THR B CA    
3912 C  CA    B THR B 196 ? 0.2330 0.2727 0.2193 -0.0268 -0.0262 0.0615  427 THR B CA    
3913 C  C     A THR B 196 ? 0.2982 0.3234 0.3044 -0.0014 -0.0081 0.0503  427 THR B C     
3914 C  C     B THR B 196 ? 0.2416 0.2642 0.2270 -0.0217 -0.0486 0.0903  427 THR B C     
3915 O  O     A THR B 196 ? 0.3183 0.3131 0.3030 0.0276  -0.0009 0.0610  427 THR B O     
3916 O  O     B THR B 196 ? 0.2563 0.2726 0.2432 -0.0330 -0.0463 0.1022  427 THR B O     
3917 C  CB    A THR B 196 ? 0.2436 0.2917 0.2647 -0.0080 -0.0173 0.0195  427 THR B CB    
3918 C  CB    B THR B 196 ? 0.2266 0.2714 0.2187 -0.0021 -0.0048 0.0464  427 THR B CB    
3919 O  OG1   A THR B 196 ? 0.2324 0.2829 0.2533 -0.0168 0.0124  -0.0022 427 THR B OG1   
3920 O  OG1   B THR B 196 ? 0.2240 0.2754 0.2289 -0.0078 -0.0104 0.0338  427 THR B OG1   
3921 C  CG2   A THR B 196 ? 0.2066 0.2868 0.2824 -0.0080 -0.0318 0.0299  427 THR B CG2   
3922 C  CG2   B THR B 196 ? 0.2035 0.2661 0.1974 0.0332  0.0154  0.0347  427 THR B CG2   
3923 N  N     A ASN B 197 ? 0.3285 0.3488 0.3334 0.0060  -0.0077 0.0551  428 ASN B N     
3924 N  N     B ASN B 197 ? 0.2431 0.2569 0.2115 -0.0139 -0.0622 0.0925  428 ASN B N     
3925 C  CA    A ASN B 197 ? 0.3670 0.3841 0.3608 0.0261  -0.0159 0.0596  428 ASN B CA    
3926 C  CA    B ASN B 197 ? 0.2331 0.2669 0.2182 -0.0059 -0.0679 0.0910  428 ASN B CA    
3927 C  C     A ASN B 197 ? 0.3770 0.3683 0.3768 0.0539  -0.0231 0.0680  428 ASN B C     
3928 C  C     B ASN B 197 ? 0.2571 0.2530 0.2165 0.0034  -0.0592 0.1049  428 ASN B C     
3929 O  O     A ASN B 197 ? 0.4054 0.3870 0.4001 0.0428  -0.0187 0.0546  428 ASN B O     
3930 O  O     B ASN B 197 ? 0.2602 0.2391 0.2216 0.0258  -0.0315 0.1156  428 ASN B O     
3931 C  CB    A ASN B 197 ? 0.4144 0.4244 0.3781 0.0270  -0.0032 0.0583  428 ASN B CB    
3932 C  CB    B ASN B 197 ? 0.2547 0.2981 0.2354 -0.0077 -0.0842 0.0832  428 ASN B CB    
3933 C  CG    A ASN B 197 ? 0.4519 0.4652 0.4006 0.0229  0.0132  0.0495  428 ASN B CG    
3934 C  CG    B ASN B 197 ? 0.2810 0.3255 0.2544 0.0045  -0.0748 0.0856  428 ASN B CG    
3935 O  OD1   A ASN B 197 ? 0.4635 0.4875 0.4086 0.0251  0.0040  0.0443  428 ASN B OD1   
3936 O  OD1   B ASN B 197 ? 0.2974 0.3285 0.2675 0.0200  -0.0619 0.0783  428 ASN B OD1   
3937 N  ND2   A ASN B 197 ? 0.4674 0.4803 0.4157 0.0261  0.0259  0.0405  428 ASN B ND2   
3938 N  ND2   B ASN B 197 ? 0.3017 0.3448 0.2636 0.0102  -0.0846 0.0871  428 ASN B ND2   
3939 N  N     A SER B 198 ? 0.3709 0.3493 0.3798 0.0700  -0.0380 0.0828  429 SER B N     
3940 N  N     B SER B 198 ? 0.2765 0.2696 0.2203 -0.0067 -0.0507 0.0996  429 SER B N     
3941 C  CA    A SER B 198 ? 0.3675 0.3530 0.3797 0.0564  -0.0448 0.0734  429 SER B CA    
3942 C  CA    B SER B 198 ? 0.3079 0.2813 0.2471 0.0115  -0.0406 0.0920  429 SER B CA    
3943 C  C     A SER B 198 ? 0.3468 0.3393 0.3826 0.0388  -0.0311 0.0463  429 SER B C     
3944 C  C     B SER B 198 ? 0.3098 0.2882 0.2287 0.0091  -0.0517 0.0933  429 SER B C     
3945 O  O     A SER B 198 ? 0.3430 0.3306 0.3843 0.0197  -0.0251 0.0541  429 SER B O     
3946 O  O     B SER B 198 ? 0.3166 0.3030 0.2268 0.0052  -0.0510 0.0883  429 SER B O     
3947 C  CB    A SER B 198 ? 0.3736 0.3760 0.3909 0.0563  -0.0630 0.0874  429 SER B CB    
3948 C  CB    B SER B 198 ? 0.3334 0.2840 0.2791 0.0252  -0.0293 0.0823  429 SER B CB    
3949 O  OG    A SER B 198 ? 0.3944 0.4032 0.4024 0.0246  -0.0631 0.0820  429 SER B OG    
3950 O  OG    B SER B 198 ? 0.3496 0.3022 0.3089 0.0316  -0.0107 0.0516  429 SER B OG    
3951 N  N     A ASP B 199 ? 0.3628 0.3401 0.3837 0.0262  -0.0240 0.0216  430 ASP B N     
3952 N  N     B ASP B 199 ? 0.3037 0.2893 0.2140 0.0053  -0.0649 0.0951  430 ASP B N     
3953 C  CA    A ASP B 199 ? 0.3762 0.3419 0.3896 0.0131  -0.0203 0.0030  430 ASP B CA    
3954 C  CA    B ASP B 199 ? 0.3210 0.2927 0.2252 0.0220  -0.0614 0.0754  430 ASP B CA    
3955 C  C     A ASP B 199 ? 0.3775 0.3244 0.3966 -0.0021 -0.0148 0.0179  430 ASP B C     
3956 C  C     B ASP B 199 ? 0.3214 0.2941 0.2284 0.0401  -0.0501 0.0829  430 ASP B C     
3957 O  O     A ASP B 199 ? 0.3807 0.3366 0.4070 -0.0097 -0.0212 0.0106  430 ASP B O     
3958 O  O     B ASP B 199 ? 0.3266 0.2991 0.2348 0.0309  -0.0358 0.0797  430 ASP B O     
3959 C  CB    A ASP B 199 ? 0.4216 0.3774 0.3971 0.0171  -0.0193 -0.0203 430 ASP B CB    
3960 C  CB    B ASP B 199 ? 0.3568 0.3012 0.2587 0.0043  -0.0427 0.0523  430 ASP B CB    
3961 C  CG    A ASP B 199 ? 0.4856 0.4129 0.4095 0.0017  -0.0094 -0.0424 430 ASP B CG    
3962 C  CG    B ASP B 199 ? 0.3850 0.3059 0.2881 -0.0021 -0.0121 0.0260  430 ASP B CG    
3963 O  OD1   A ASP B 199 ? 0.5069 0.4359 0.4112 0.0070  -0.0139 -0.0417 430 ASP B OD1   
3964 O  OD1   B ASP B 199 ? 0.3825 0.3036 0.2980 -0.0016 -0.0114 0.0182  430 ASP B OD1   
3965 O  OD2   A ASP B 199 ? 0.5211 0.4337 0.4203 0.0031  0.0075  -0.0556 430 ASP B OD2   
3966 O  OD2   B ASP B 199 ? 0.4099 0.3139 0.3026 -0.0008 0.0029  0.0150  430 ASP B OD2   
3967 N  N     A THR B 200 ? 0.3751 0.3125 0.3959 -0.0125 0.0165  0.0338  431 THR B N     
3968 N  N     B THR B 200 ? 0.3232 0.2887 0.2301 0.0581  -0.0515 0.0806  431 THR B N     
3969 C  CA    A THR B 200 ? 0.3685 0.3173 0.3989 -0.0165 0.0176  0.0621  431 THR B CA    
3970 C  CA    B THR B 200 ? 0.3070 0.2843 0.2259 0.0581  -0.0500 0.0721  431 THR B CA    
3971 C  C     A THR B 200 ? 0.3338 0.2966 0.3723 -0.0292 0.0290  0.0795  431 THR B C     
3972 C  C     B THR B 200 ? 0.3019 0.2774 0.2300 0.0669  -0.0351 0.0573  431 THR B C     
3973 O  O     A THR B 200 ? 0.3373 0.3003 0.3701 -0.0269 0.0421  0.0935  431 THR B O     
3974 O  O     B THR B 200 ? 0.3109 0.2600 0.2123 0.0600  -0.0079 0.0688  431 THR B O     
3975 C  CB    A THR B 200 ? 0.4187 0.3476 0.4335 -0.0202 0.0107  0.0654  431 THR B CB    
3976 C  CB    B THR B 200 ? 0.2935 0.2911 0.2142 0.0415  -0.0780 0.0820  431 THR B CB    
3977 O  OG1   A THR B 200 ? 0.4598 0.3750 0.4664 -0.0078 0.0034  0.0658  431 THR B OG1   
3978 O  OG1   B THR B 200 ? 0.3217 0.2950 0.2193 0.0288  -0.0890 0.0933  431 THR B OG1   
3979 C  CG2   A THR B 200 ? 0.4225 0.3421 0.4329 -0.0188 0.0168  0.0709  431 THR B CG2   
3980 C  CG2   B THR B 200 ? 0.2703 0.2972 0.2048 0.0243  -0.0841 0.0793  431 THR B CG2   
3981 N  N     A PRO B 201 ? 0.3185 0.2842 0.3629 -0.0331 0.0224  0.0719  432 PRO B N     
3982 N  N     B PRO B 201 ? 0.2830 0.2881 0.2494 0.0792  -0.0424 0.0409  432 PRO B N     
3983 C  CA    A PRO B 201 ? 0.3034 0.2777 0.3529 -0.0177 0.0221  0.0572  432 PRO B CA    
3984 C  CA    B PRO B 201 ? 0.2821 0.2946 0.2619 0.0805  -0.0386 0.0247  432 PRO B CA    
3985 C  C     A PRO B 201 ? 0.3019 0.2379 0.3114 -0.0065 0.0295  0.0590  432 PRO B C     
3986 C  C     B PRO B 201 ? 0.2817 0.2882 0.2592 0.0717  -0.0357 0.0303  432 PRO B C     
3987 O  O     A PRO B 201 ? 0.3455 0.2252 0.3213 -0.0086 0.0309  0.0685  432 PRO B O     
3988 O  O     B PRO B 201 ? 0.2776 0.2744 0.2481 0.0615  -0.0403 0.0282  432 PRO B O     
3989 C  CB    A PRO B 201 ? 0.3217 0.3101 0.3836 -0.0142 0.0238  0.0522  432 PRO B CB    
3990 C  CB    B PRO B 201 ? 0.2845 0.3008 0.2781 0.0816  -0.0368 0.0172  432 PRO B CB    
3991 C  CG    A PRO B 201 ? 0.3409 0.3183 0.3963 -0.0062 0.0124  0.0533  432 PRO B CG    
3992 C  CG    B PRO B 201 ? 0.2933 0.3057 0.2748 0.0840  -0.0377 0.0248  432 PRO B CG    
3993 C  CD    A PRO B 201 ? 0.3272 0.3050 0.3799 -0.0213 0.0219  0.0594  432 PRO B CD    
3994 C  CD    B PRO B 201 ? 0.2873 0.2970 0.2628 0.0861  -0.0461 0.0316  432 PRO B CD    
3995 N  N     A THR B 202 ? 0.2917 0.2071 0.2704 0.0029  0.0247  0.0424  433 THR B N     
3996 N  N     B THR B 202 ? 0.3102 0.3018 0.2698 0.0613  -0.0273 0.0470  433 THR B N     
3997 C  CA    A THR B 202 ? 0.2978 0.1964 0.2512 0.0056  0.0422  0.0341  433 THR B CA    
3998 C  CA    B THR B 202 ? 0.3164 0.3106 0.2822 0.0601  -0.0269 0.0536  433 THR B CA    
3999 C  C     A THR B 202 ? 0.2875 0.2295 0.2402 -0.0005 0.0418  0.0340  433 THR B C     
4000 C  C     B THR B 202 ? 0.3276 0.3050 0.2749 0.0660  -0.0489 0.0470  433 THR B C     
4001 O  O     A THR B 202 ? 0.3019 0.2520 0.2536 0.0180  0.0312  0.0231  433 THR B O     
4002 O  O     B THR B 202 ? 0.3187 0.2983 0.2744 0.0824  -0.0711 0.0537  433 THR B O     
4003 C  CB    A THR B 202 ? 0.3280 0.1905 0.2628 -0.0045 0.0654  0.0516  433 THR B CB    
4004 C  CB    B THR B 202 ? 0.3271 0.3262 0.3022 0.0507  -0.0117 0.0564  433 THR B CB    
4005 O  OG1   A THR B 202 ? 0.3420 0.1882 0.2521 -0.0322 0.0760  0.0544  433 THR B OG1   
4006 O  OG1   B THR B 202 ? 0.3367 0.3435 0.3260 0.0275  -0.0092 0.0520  433 THR B OG1   
4007 C  CG2   A THR B 202 ? 0.3456 0.1959 0.2918 0.0012  0.0624  0.0502  433 THR B CG2   
4008 C  CG2   B THR B 202 ? 0.3349 0.3345 0.3044 0.0452  -0.0087 0.0561  433 THR B CG2   
4009 N  N     A SER B 203 ? 0.2876 0.2364 0.2242 0.0037  0.0542  0.0373  434 SER B N     
4010 N  N     B SER B 203 ? 0.3477 0.2963 0.2729 0.0535  -0.0535 0.0410  434 SER B N     
4011 C  CA    A SER B 203 ? 0.2706 0.2433 0.2064 0.0154  0.0147  0.0377  434 SER B CA    
4012 C  CA    B SER B 203 ? 0.3351 0.2739 0.2671 0.0530  -0.0810 0.0391  434 SER B CA    
4013 C  C     A SER B 203 ? 0.2209 0.2133 0.1776 -0.0035 0.0110  0.0259  434 SER B C     
4014 C  C     B SER B 203 ? 0.2884 0.2421 0.2483 0.0434  -0.0893 0.0259  434 SER B C     
4015 O  O     A SER B 203 ? 0.2506 0.1985 0.1990 0.0094  0.0352  0.0203  434 SER B O     
4016 O  O     B SER B 203 ? 0.2524 0.2040 0.2624 0.0569  -0.1357 0.0084  434 SER B O     
4017 C  CB    A SER B 203 ? 0.3023 0.3062 0.2320 0.0136  -0.0073 0.0268  434 SER B CB    
4018 C  CB    B SER B 203 ? 0.3373 0.2768 0.2693 0.0501  -0.1047 0.0492  434 SER B CB    
4019 O  OG    A SER B 203 ? 0.3553 0.3532 0.2626 0.0484  -0.0223 -0.0070 434 SER B OG    
4020 O  OG    B SER B 203 ? 0.3465 0.2806 0.2766 0.0520  -0.1153 0.0416  434 SER B OG    
4021 N  N     A PHE B 204 ? 0.2028 0.1866 0.1419 -0.0112 -0.0199 -0.0034 435 PHE B N     
4022 N  N     B PHE B 204 ? 0.2716 0.2338 0.2213 0.0404  -0.0553 0.0346  435 PHE B N     
4023 C  CA    A PHE B 204 ? 0.1902 0.2032 0.1617 -0.0035 0.0052  0.0186  435 PHE B CA    
4024 C  CA    B PHE B 204 ? 0.2218 0.2139 0.1677 0.0295  -0.0426 0.0633  435 PHE B CA    
4025 C  C     A PHE B 204 ? 0.1869 0.2067 0.1493 -0.0129 0.0111  0.0113  435 PHE B C     
4026 C  C     B PHE B 204 ? 0.2785 0.2342 0.1492 0.0353  0.0007  0.0700  435 PHE B C     
4027 O  O     A PHE B 204 ? 0.2035 0.2084 0.1381 -0.0313 -0.0019 0.0295  435 PHE B O     
4028 O  O     B PHE B 204 ? 0.2762 0.2163 0.1238 0.0551  -0.0200 0.0682  435 PHE B O     
4029 C  CB    A PHE B 204 ? 0.1982 0.2350 0.1582 0.0137  0.0097  0.0020  435 PHE B CB    
4030 C  CB    B PHE B 204 ? 0.2312 0.2413 0.1844 0.0034  -0.0200 0.0433  435 PHE B CB    
4031 C  CG    A PHE B 204 ? 0.1974 0.2452 0.1735 0.0194  -0.0194 0.0071  435 PHE B CG    
4032 C  CG    B PHE B 204 ? 0.2224 0.2554 0.1916 0.0120  -0.0136 0.0490  435 PHE B CG    
4033 C  CD1   A PHE B 204 ? 0.2405 0.2665 0.1669 0.0412  -0.0466 0.0043  435 PHE B CD1   
4034 C  CD1   B PHE B 204 ? 0.2263 0.2513 0.1937 0.0363  -0.0119 0.0528  435 PHE B CD1   
4035 C  CD2   A PHE B 204 ? 0.1965 0.2607 0.1937 0.0068  0.0017  -0.0052 435 PHE B CD2   
4036 C  CD2   B PHE B 204 ? 0.2223 0.2767 0.1944 0.0429  -0.0179 0.0691  435 PHE B CD2   
4037 C  CE1   A PHE B 204 ? 0.2537 0.2726 0.1991 0.0361  -0.0642 -0.0046 435 PHE B CE1   
4038 C  CE1   B PHE B 204 ? 0.2153 0.2368 0.1875 0.0748  -0.0402 0.0837  435 PHE B CE1   
4039 C  CE2   A PHE B 204 ? 0.1938 0.2649 0.1964 0.0058  -0.0442 -0.0111 435 PHE B CE2   
4040 C  CE2   B PHE B 204 ? 0.1979 0.2708 0.1958 0.0666  -0.0213 0.0935  435 PHE B CE2   
4041 C  CZ    A PHE B 204 ? 0.2186 0.2620 0.1916 0.0334  -0.0524 -0.0133 435 PHE B CZ    
4042 C  CZ    B PHE B 204 ? 0.2021 0.2383 0.1995 0.0631  -0.0518 0.0869  435 PHE B CZ    
4043 N  N     A ASN B 205 ? 0.1834 0.2110 0.1725 -0.0046 -0.0017 0.0241  436 ASN B N     
4044 N  N     B ASN B 205 ? 0.2820 0.2614 0.1859 -0.0212 0.0275  0.0784  436 ASN B N     
4045 C  CA    A ASN B 205 ? 0.1634 0.2033 0.1705 0.0040  0.0057  0.0204  436 ASN B CA    
4046 C  CA    B ASN B 205 ? 0.2574 0.2888 0.2160 -0.0421 0.0306  0.0719  436 ASN B CA    
4047 C  C     A ASN B 205 ? 0.1682 0.2121 0.1774 0.0121  0.0094  0.0274  436 ASN B C     
4048 C  C     B ASN B 205 ? 0.2377 0.3103 0.2360 -0.0514 0.0697  0.0492  436 ASN B C     
4049 O  O     A ASN B 205 ? 0.1648 0.2399 0.2050 -0.0099 0.0206  0.0010  436 ASN B O     
4050 O  O     B ASN B 205 ? 0.1890 0.3309 0.2269 -0.0762 0.0518  -0.0054 436 ASN B O     
4051 C  CB    A ASN B 205 ? 0.1793 0.2151 0.1536 -0.0219 -0.0145 0.0354  436 ASN B CB    
4052 C  CB    B ASN B 205 ? 0.2588 0.2987 0.2466 -0.0689 0.0072  0.0885  436 ASN B CB    
4053 C  CG    A ASN B 205 ? 0.1901 0.2337 0.1367 0.0078  -0.0196 0.0453  436 ASN B CG    
4054 C  CG    B ASN B 205 ? 0.2933 0.3196 0.2858 -0.0640 -0.0085 0.0896  436 ASN B CG    
4055 O  OD1   A ASN B 205 ? 0.2441 0.2420 0.1705 -0.0118 0.0295  0.0427  436 ASN B OD1   
4056 O  OD1   B ASN B 205 ? 0.3195 0.3483 0.3078 -0.0372 0.0236  0.0770  436 ASN B OD1   
4057 N  ND2   A ASN B 205 ? 0.2089 0.2560 0.1408 -0.0101 -0.0293 0.0100  436 ASN B ND2   
4058 N  ND2   B ASN B 205 ? 0.3179 0.3300 0.2986 -0.0942 -0.0190 0.0960  436 ASN B ND2   
4059 N  N     A HIS B 206 ? 0.2088 0.1949 0.1700 0.0393  0.0163  0.0254  437 HIS B N     
4060 N  N     B HIS B 206 ? 0.2590 0.3280 0.2673 -0.0556 0.0802  0.0314  437 HIS B N     
4061 C  CA    A HIS B 206 ? 0.2185 0.2240 0.1557 0.0290  0.0173  0.0453  437 HIS B CA    
4062 C  CA    B HIS B 206 ? 0.2500 0.3374 0.2707 -0.0559 0.0268  0.0391  437 HIS B CA    
4063 C  C     A HIS B 206 ? 0.1701 0.2488 0.1534 0.0205  0.0059  0.0174  437 HIS B C     
4064 C  C     B HIS B 206 ? 0.2560 0.3501 0.2695 -0.0353 0.0134  0.0463  437 HIS B C     
4065 O  O     A HIS B 206 ? 0.1819 0.2611 0.1790 0.0042  -0.0044 0.0261  437 HIS B O     
4066 O  O     B HIS B 206 ? 0.2054 0.3367 0.2602 -0.0532 -0.0268 0.0557  437 HIS B O     
4067 C  CB    A HIS B 206 ? 0.2471 0.2561 0.1573 0.0288  0.0039  0.0712  437 HIS B CB    
4068 C  CB    B HIS B 206 ? 0.2377 0.3234 0.2963 -0.0395 0.0253  0.0165  437 HIS B CB    
4069 C  CG    A HIS B 206 ? 0.3064 0.3407 0.1874 -0.0089 0.0071  0.0663  437 HIS B CG    
4070 C  CG    B HIS B 206 ? 0.2463 0.3154 0.2918 -0.0236 0.0566  0.0262  437 HIS B CG    
4071 N  ND1   A HIS B 206 ? 0.3520 0.3827 0.1957 -0.0035 0.0100  0.0352  437 HIS B ND1   
4072 N  ND1   B HIS B 206 ? 0.2752 0.3190 0.2912 -0.0285 0.0555  0.0457  437 HIS B ND1   
4073 C  CD2   A HIS B 206 ? 0.3594 0.3836 0.2132 -0.0261 0.0183  0.0524  437 HIS B CD2   
4074 C  CD2   B HIS B 206 ? 0.2293 0.3165 0.2975 -0.0162 0.0651  0.0253  437 HIS B CD2   
4075 C  CE1   A HIS B 206 ? 0.3546 0.4090 0.2144 -0.0123 0.0051  0.0212  437 HIS B CE1   
4076 C  CE1   B HIS B 206 ? 0.2415 0.3170 0.2808 -0.0320 0.0567  0.0487  437 HIS B CE1   
4077 N  NE2   A HIS B 206 ? 0.3784 0.4113 0.2326 -0.0394 0.0284  0.0279  437 HIS B NE2   
4078 N  NE2   B HIS B 206 ? 0.2357 0.3163 0.2919 -0.0197 0.0569  0.0456  437 HIS B NE2   
4079 N  N     A MET B 207 ? 0.1861 0.2240 0.1516 0.0082  0.0242  0.0272  438 MET B N     
4080 N  N     B MET B 207 ? 0.2898 0.3761 0.2716 -0.0035 -0.0009 0.0415  438 MET B N     
4081 C  CA    A MET B 207 ? 0.1804 0.2402 0.1727 0.0156  0.0308  0.0382  438 MET B CA    
4082 C  CA    B MET B 207 ? 0.3045 0.3857 0.2652 0.0088  0.0119  0.0343  438 MET B CA    
4083 C  C     A MET B 207 ? 0.2124 0.2902 0.1861 -0.0116 -0.0093 0.0153  438 MET B C     
4084 C  C     B MET B 207 ? 0.2898 0.3787 0.2533 0.0098  -0.0018 0.0436  438 MET B C     
4085 O  O     A MET B 207 ? 0.2432 0.3035 0.1888 0.0032  -0.0252 -0.0124 438 MET B O     
4086 O  O     B MET B 207 ? 0.3154 0.4003 0.2884 0.0212  0.0115  0.0734  438 MET B O     
4087 C  CB    A MET B 207 ? 0.1942 0.2219 0.1608 0.0245  0.0345  0.0414  438 MET B CB    
4088 C  CB    B MET B 207 ? 0.3357 0.3923 0.2636 0.0180  0.0252  0.0209  438 MET B CB    
4089 C  CG    A MET B 207 ? 0.2480 0.1964 0.1645 0.0291  0.0050  0.0307  438 MET B CG    
4090 C  CG    B MET B 207 ? 0.3479 0.3966 0.2590 0.0311  0.0528  0.0028  438 MET B CG    
4091 S  SD    A MET B 207 ? 0.2531 0.1943 0.1766 -0.0390 -0.0276 0.0301  438 MET B SD    
4092 S  SD    B MET B 207 ? 0.3484 0.3980 0.2511 0.0318  0.0902  -0.0188 438 MET B SD    
4093 C  CE    A MET B 207 ? 0.2821 0.2037 0.2414 -0.0208 0.0047  0.0216  438 MET B CE    
4094 C  CE    B MET B 207 ? 0.3423 0.3953 0.2609 0.0257  0.1035  -0.0197 438 MET B CE    
4095 N  N     . ASP B 208 ? 0.2705 0.3480 0.2028 0.0136  -0.0230 0.0195  439 ASP B N     
4096 C  CA    . ASP B 208 ? 0.2797 0.3400 0.2230 0.0278  -0.0286 0.0513  439 ASP B CA    
4097 C  C     . ASP B 208 ? 0.2564 0.2919 0.2281 0.0260  -0.0219 0.0571  439 ASP B C     
4098 O  O     . ASP B 208 ? 0.2484 0.2734 0.2551 0.0346  -0.0205 0.0531  439 ASP B O     
4099 C  CB    . ASP B 208 ? 0.3069 0.3985 0.2284 0.0214  -0.0238 0.0750  439 ASP B CB    
4100 C  CG    . ASP B 208 ? 0.3050 0.4204 0.2270 0.0209  0.0070  0.0600  439 ASP B CG    
4101 O  OD1   . ASP B 208 ? 0.3141 0.4014 0.2384 -0.0103 0.0019  0.0415  439 ASP B OD1   
4102 O  OD2   . ASP B 208 ? 0.3218 0.4505 0.2388 0.0148  0.0030  0.0483  439 ASP B OD2   
4103 N  N     . SER B 209 ? 0.2159 0.2640 0.2304 0.0184  -0.0011 0.0581  440 SER B N     
4104 C  CA    . SER B 209 ? 0.2275 0.1992 0.2589 0.0313  0.0257  0.0264  440 SER B CA    
4105 C  C     . SER B 209 ? 0.2033 0.1912 0.2385 -0.0062 0.0234  0.0216  440 SER B C     
4106 O  O     . SER B 209 ? 0.2329 0.2070 0.2384 0.0047  0.0190  0.0162  440 SER B O     
4107 C  CB    . SER B 209 ? 0.2852 0.2143 0.3269 -0.0143 0.0227  0.0034  440 SER B CB    
4108 O  OG    . SER B 209 ? 0.2648 0.2131 0.3491 -0.0197 0.0347  0.0022  440 SER B OG    
4109 N  N     . ASP B 210 ? 0.2065 0.1779 0.2479 0.0311  -0.0020 0.0380  441 ASP B N     
4110 C  CA    . ASP B 210 ? 0.2048 0.1747 0.2314 0.0047  0.0117  0.0249  441 ASP B CA    
4111 C  C     . ASP B 210 ? 0.2187 0.2063 0.2559 0.0075  -0.0111 0.0099  441 ASP B C     
4112 O  O     . ASP B 210 ? 0.2336 0.2033 0.2739 0.0371  -0.0221 0.0153  441 ASP B O     
4113 C  CB    . ASP B 210 ? 0.2189 0.1971 0.2282 -0.0282 0.0093  0.0250  441 ASP B CB    
4114 C  CG    . ASP B 210 ? 0.2959 0.2529 0.2381 -0.0263 0.0059  0.0363  441 ASP B CG    
4115 O  OD1   . ASP B 210 ? 0.3255 0.2531 0.2578 -0.0216 -0.0010 0.0368  441 ASP B OD1   
4116 O  OD2   . ASP B 210 ? 0.3676 0.2910 0.2598 -0.0160 0.0106  0.0395  441 ASP B OD2   
4117 N  N     . LYS B 211 ? 0.1934 0.2273 0.2341 0.0070  -0.0168 0.0049  442 LYS B N     
4118 C  CA    . LYS B 211 ? 0.2345 0.2313 0.2350 0.0183  -0.0035 0.0111  442 LYS B CA    
4119 C  C     . LYS B 211 ? 0.2207 0.2226 0.2376 -0.0060 -0.0211 0.0164  442 LYS B C     
4120 O  O     . LYS B 211 ? 0.2416 0.2150 0.2260 0.0056  -0.0094 0.0262  442 LYS B O     
4121 C  CB    . LYS B 211 ? 0.2292 0.2399 0.2427 0.0011  -0.0047 0.0182  442 LYS B CB    
4122 C  CG    . LYS B 211 ? 0.2317 0.2591 0.2342 -0.0187 0.0037  0.0276  442 LYS B CG    
4123 C  CD    . LYS B 211 ? 0.2471 0.2742 0.2426 -0.0158 -0.0051 0.0167  442 LYS B CD    
4124 C  CE    . LYS B 211 ? 0.2831 0.2972 0.2557 0.0162  0.0024  0.0473  442 LYS B CE    
4125 N  NZ    . LYS B 211 ? 0.3200 0.3320 0.2629 -0.0062 0.0259  0.0447  442 LYS B NZ    
4126 N  N     . LEU B 212 ? 0.1851 0.1977 0.2059 0.0136  -0.0374 0.0254  443 LEU B N     
4127 C  CA    . LEU B 212 ? 0.1761 0.1786 0.2027 0.0129  -0.0370 0.0326  443 LEU B CA    
4128 C  C     . LEU B 212 ? 0.1886 0.1721 0.2060 -0.0146 -0.0395 0.0354  443 LEU B C     
4129 O  O     . LEU B 212 ? 0.1937 0.1688 0.2229 -0.0150 -0.0434 0.0542  443 LEU B O     
4130 C  CB    . LEU B 212 ? 0.1659 0.1564 0.1986 0.0384  -0.0032 0.0254  443 LEU B CB    
4131 C  CG    . LEU B 212 ? 0.1927 0.1640 0.2236 0.0075  -0.0238 0.0376  443 LEU B CG    
4132 C  CD1   . LEU B 212 ? 0.2212 0.1673 0.2523 -0.0166 -0.0425 0.0249  443 LEU B CD1   
4133 C  CD2   . LEU B 212 ? 0.2013 0.2031 0.2161 0.0337  -0.0406 0.0487  443 LEU B CD2   
4134 N  N     . SER B 213 ? 0.2038 0.1646 0.2071 -0.0134 -0.0622 0.0266  444 SER B N     
4135 C  CA    . SER B 213 ? 0.2099 0.1443 0.2193 -0.0153 -0.0471 0.0128  444 SER B CA    
4136 C  C     . SER B 213 ? 0.1814 0.1402 0.2086 0.0113  -0.0302 0.0202  444 SER B C     
4137 O  O     . SER B 213 ? 0.1737 0.1506 0.1997 -0.0034 -0.0178 0.0090  444 SER B O     
4138 C  CB    . SER B 213 ? 0.2045 0.1895 0.2525 -0.0232 -0.0236 0.0090  444 SER B CB    
4139 O  OG    . SER B 213 ? 0.2475 0.2541 0.2705 -0.0250 -0.0150 0.0275  444 SER B OG    
4140 N  N     . GLY B 214 ? 0.1775 0.1438 0.2001 -0.0006 -0.0300 0.0131  445 GLY B N     
4141 C  CA    . GLY B 214 ? 0.1749 0.1325 0.1809 0.0140  -0.0195 -0.0014 445 GLY B CA    
4142 C  C     . GLY B 214 ? 0.1530 0.1609 0.1561 -0.0118 -0.0248 -0.0108 445 GLY B C     
4143 O  O     . GLY B 214 ? 0.1854 0.1883 0.1728 -0.0045 -0.0403 0.0191  445 GLY B O     
4144 N  N     . LEU B 215 ? 0.1466 0.1811 0.1526 -0.0196 -0.0303 -0.0032 446 LEU B N     
4145 C  CA    . LEU B 215 ? 0.1406 0.1908 0.1344 -0.0106 -0.0303 0.0220  446 LEU B CA    
4146 C  C     . LEU B 215 ? 0.1477 0.1801 0.1537 -0.0043 -0.0142 0.0060  446 LEU B C     
4147 O  O     . LEU B 215 ? 0.1592 0.1695 0.1376 0.0034  -0.0232 0.0122  446 LEU B O     
4148 C  CB    . LEU B 215 ? 0.1562 0.2075 0.1456 -0.0232 -0.0484 0.0239  446 LEU B CB    
4149 C  CG    . LEU B 215 ? 0.1638 0.2044 0.1653 -0.0259 -0.0432 -0.0119 446 LEU B CG    
4150 C  CD1   . LEU B 215 ? 0.2127 0.2132 0.1893 -0.0317 -0.0127 -0.0124 446 LEU B CD1   
4151 C  CD2   . LEU B 215 ? 0.2001 0.2430 0.1800 -0.0376 -0.0505 -0.0004 446 LEU B CD2   
4152 N  N     . TRP B 216 ? 0.1313 0.1756 0.1682 0.0004  -0.0016 0.0199  447 TRP B N     
4153 C  CA    . TRP B 216 ? 0.1628 0.1595 0.1725 0.0154  -0.0053 0.0157  447 TRP B CA    
4154 C  C     . TRP B 216 ? 0.1353 0.1669 0.1518 0.0050  -0.0103 0.0202  447 TRP B C     
4155 O  O     . TRP B 216 ? 0.1540 0.1772 0.1459 0.0062  -0.0112 0.0177  447 TRP B O     
4156 C  CB    . TRP B 216 ? 0.1672 0.1587 0.1714 0.0321  0.0065  0.0052  447 TRP B CB    
4157 C  CG    . TRP B 216 ? 0.1551 0.1615 0.1482 0.0316  -0.0309 0.0138  447 TRP B CG    
4158 C  CD1   . TRP B 216 ? 0.1818 0.1853 0.1487 0.0307  -0.0114 -0.0048 447 TRP B CD1   
4159 C  CD2   . TRP B 216 ? 0.1358 0.1788 0.1601 0.0235  -0.0272 -0.0070 447 TRP B CD2   
4160 N  NE1   . TRP B 216 ? 0.1623 0.1991 0.1903 0.0208  -0.0176 -0.0060 447 TRP B NE1   
4161 C  CE2   . TRP B 216 ? 0.1528 0.1936 0.1636 0.0309  -0.0220 0.0084  447 TRP B CE2   
4162 C  CE3   . TRP B 216 ? 0.1436 0.1785 0.1822 0.0218  -0.0205 0.0152  447 TRP B CE3   
4163 C  CZ2   . TRP B 216 ? 0.1726 0.2073 0.1570 0.0520  -0.0139 0.0140  447 TRP B CZ2   
4164 C  CZ3   . TRP B 216 ? 0.1561 0.1875 0.1895 0.0404  -0.0054 -0.0117 447 TRP B CZ3   
4165 C  CH2   . TRP B 216 ? 0.1837 0.1943 0.1705 0.0316  -0.0091 0.0034  447 TRP B CH2   
4166 N  N     . SER B 217 ? 0.1479 0.1657 0.1596 -0.0028 -0.0222 0.0115  448 SER B N     
4167 C  CA    . SER B 217 ? 0.1350 0.1774 0.1556 0.0090  -0.0208 -0.0040 448 SER B CA    
4168 C  C     . SER B 217 ? 0.1557 0.1374 0.1291 -0.0098 -0.0093 -0.0161 448 SER B C     
4169 O  O     . SER B 217 ? 0.2172 0.1516 0.1309 0.0112  0.0046  0.0173  448 SER B O     
4170 C  CB    . SER B 217 ? 0.1352 0.2608 0.1546 0.0491  -0.0251 -0.0107 448 SER B CB    
4171 O  OG    . SER B 217 ? 0.1777 0.2487 0.1875 0.0035  -0.0374 -0.0291 448 SER B OG    
4172 N  N     . ARG B 218 ? 0.1406 0.1195 0.1518 -0.0018 -0.0205 -0.0182 449 ARG B N     
4173 C  CA    . ARG B 218 ? 0.1469 0.1450 0.1528 0.0207  0.0004  -0.0160 449 ARG B CA    
4174 C  C     . ARG B 218 ? 0.1608 0.1628 0.1670 0.0228  -0.0006 -0.0030 449 ARG B C     
4175 O  O     . ARG B 218 ? 0.1587 0.1749 0.2005 0.0150  -0.0073 0.0136  449 ARG B O     
4176 C  CB    . ARG B 218 ? 0.1447 0.1748 0.1405 0.0035  -0.0029 0.0048  449 ARG B CB    
4177 C  CG    . ARG B 218 ? 0.1349 0.2059 0.1424 0.0058  0.0108  -0.0145 449 ARG B CG    
4178 C  CD    . ARG B 218 ? 0.1245 0.1920 0.1365 -0.0091 0.0072  -0.0185 449 ARG B CD    
4179 N  NE    . ARG B 218 ? 0.1194 0.1736 0.1623 -0.0138 -0.0130 -0.0020 449 ARG B NE    
4180 C  CZ    . ARG B 218 ? 0.1480 0.1594 0.1676 -0.0056 -0.0122 -0.0153 449 ARG B CZ    
4181 N  NH1   . ARG B 218 ? 0.1303 0.1811 0.1653 -0.0106 -0.0059 0.0023  449 ARG B NH1   
4182 N  NH2   . ARG B 218 ? 0.1729 0.1458 0.1672 -0.0144 -0.0044 -0.0120 449 ARG B NH2   
4183 N  N     . ILE B 219 ? 0.1235 0.1501 0.1553 0.0018  -0.0036 -0.0092 450 ILE B N     
4184 C  CA    . ILE B 219 ? 0.1394 0.1728 0.1511 -0.0107 -0.0084 0.0015  450 ILE B CA    
4185 C  C     . ILE B 219 ? 0.1611 0.1927 0.1523 -0.0041 -0.0177 -0.0040 450 ILE B C     
4186 O  O     . ILE B 219 ? 0.1822 0.2299 0.1759 -0.0252 0.0047  -0.0337 450 ILE B O     
4187 C  CB    . ILE B 219 ? 0.1550 0.1599 0.1638 -0.0061 -0.0143 -0.0101 450 ILE B CB    
4188 C  CG1   . ILE B 219 ? 0.1361 0.1739 0.1697 -0.0158 -0.0400 0.0164  450 ILE B CG1   
4189 C  CG2   . ILE B 219 ? 0.1861 0.1708 0.1624 0.0033  0.0284  -0.0389 450 ILE B CG2   
4190 C  CD1   . ILE B 219 ? 0.1715 0.2076 0.1758 -0.0217 -0.0402 -0.0019 450 ILE B CD1   
4191 N  N     . SER B 220 ? 0.1577 0.1885 0.1413 -0.0037 0.0093  -0.0229 451 SER B N     
4192 C  CA    . SER B 220 ? 0.1517 0.1736 0.1428 -0.0043 0.0053  -0.0185 451 SER B CA    
4193 C  C     . SER B 220 ? 0.1705 0.1947 0.1561 -0.0346 -0.0071 -0.0126 451 SER B C     
4194 O  O     . SER B 220 ? 0.2394 0.2033 0.1627 -0.0062 -0.0165 -0.0158 451 SER B O     
4195 C  CB    . SER B 220 ? 0.1687 0.1694 0.1650 -0.0378 -0.0053 0.0000  451 SER B CB    
4196 O  OG    . SER B 220 ? 0.1922 0.1750 0.1636 -0.0349 0.0004  -0.0004 451 SER B OG    
4197 N  N     . HIS B 221 ? 0.1440 0.2139 0.1462 -0.0128 0.0092  0.0199  452 HIS B N     
4198 C  CA    . HIS B 221 ? 0.1660 0.1896 0.1589 -0.0061 0.0116  0.0157  452 HIS B CA    
4199 C  C     . HIS B 221 ? 0.1447 0.2117 0.1577 -0.0404 0.0042  -0.0114 452 HIS B C     
4200 O  O     . HIS B 221 ? 0.1816 0.2433 0.1564 -0.0426 0.0070  -0.0286 452 HIS B O     
4201 C  CB    . HIS B 221 ? 0.1899 0.1785 0.1763 0.0018  0.0121  0.0330  452 HIS B CB    
4202 C  CG    . HIS B 221 ? 0.1730 0.1861 0.1788 0.0006  -0.0102 -0.0060 452 HIS B CG    
4203 N  ND1   . HIS B 221 ? 0.1884 0.2190 0.2243 0.0165  -0.0126 -0.0110 452 HIS B ND1   
4204 C  CD2   . HIS B 221 ? 0.1914 0.1879 0.2000 -0.0070 0.0266  -0.0163 452 HIS B CD2   
4205 C  CE1   . HIS B 221 ? 0.1791 0.2305 0.2454 0.0157  -0.0061 -0.0041 452 HIS B CE1   
4206 N  NE2   . HIS B 221 ? 0.1890 0.2055 0.2370 0.0027  0.0344  -0.0104 452 HIS B NE2   
4207 N  N     . LEU B 222 ? 0.1286 0.2117 0.1707 -0.0129 0.0093  0.0029  453 LEU B N     
4208 C  CA    . LEU B 222 ? 0.1651 0.2157 0.1942 -0.0326 0.0051  -0.0214 453 LEU B CA    
4209 C  C     . LEU B 222 ? 0.1620 0.2372 0.2055 0.0025  -0.0129 -0.0490 453 LEU B C     
4210 O  O     . LEU B 222 ? 0.2033 0.2889 0.2636 0.0628  -0.0659 -0.0742 453 LEU B O     
4211 C  CB    . LEU B 222 ? 0.2488 0.2367 0.2427 -0.0394 0.0419  -0.0241 453 LEU B CB    
4212 C  CG    . LEU B 222 ? 0.3044 0.2434 0.2388 -0.0306 0.0557  -0.0165 453 LEU B CG    
4213 C  CD1   . LEU B 222 ? 0.3355 0.2742 0.2745 0.0007  0.0837  -0.0209 453 LEU B CD1   
4214 C  CD2   . LEU B 222 ? 0.2378 0.2132 0.2162 -0.0339 0.0285  -0.0006 453 LEU B CD2   
4215 N  N     . VAL B 223 ? 0.1560 0.2052 0.1987 -0.0038 0.0028  -0.0098 454 VAL B N     
4216 C  CA    . VAL B 223 ? 0.1513 0.2211 0.1966 0.0049  0.0103  -0.0150 454 VAL B CA    
4217 C  C     . VAL B 223 ? 0.1650 0.2322 0.1977 -0.0144 0.0050  -0.0440 454 VAL B C     
4218 O  O     . VAL B 223 ? 0.2178 0.2585 0.2415 -0.0405 0.0273  -0.0820 454 VAL B O     
4219 C  CB    . VAL B 223 ? 0.1658 0.2238 0.2125 -0.0015 0.0006  -0.0041 454 VAL B CB    
4220 C  CG1   . VAL B 223 ? 0.1978 0.2379 0.2290 0.0132  -0.0350 -0.0069 454 VAL B CG1   
4221 C  CG2   . VAL B 223 ? 0.1867 0.2430 0.2168 -0.0033 0.0161  0.0058  454 VAL B CG2   
4222 N  N     . LEU B 224 ? 0.1083 0.2092 0.1984 0.0036  0.0024  -0.0075 455 LEU B N     
4223 C  CA    . LEU B 224 ? 0.1366 0.2065 0.2029 0.0232  0.0081  0.0026  455 LEU B CA    
4224 C  C     . LEU B 224 ? 0.1412 0.2157 0.1925 0.0172  0.0223  -0.0180 455 LEU B C     
4225 O  O     . LEU B 224 ? 0.1533 0.2120 0.1953 0.0208  -0.0029 0.0005  455 LEU B O     
4226 C  CB    . LEU B 224 ? 0.1543 0.2140 0.2227 0.0309  -0.0200 0.0332  455 LEU B CB    
4227 C  CG    . LEU B 224 ? 0.2045 0.2107 0.2390 0.0448  -0.0299 0.0319  455 LEU B CG    
4228 C  CD1   . LEU B 224 ? 0.1994 0.2169 0.2567 0.0439  0.0119  0.0786  455 LEU B CD1   
4229 C  CD2   . LEU B 224 ? 0.2539 0.2152 0.2428 0.0107  -0.0713 0.0027  455 LEU B CD2   
4230 N  N     . PRO B 225 ? 0.1537 0.2166 0.1983 0.0187  0.0290  -0.0116 456 PRO B N     
4231 C  CA    . PRO B 225 ? 0.1497 0.2213 0.2179 0.0244  0.0038  -0.0194 456 PRO B CA    
4232 C  C     . PRO B 225 ? 0.1373 0.2326 0.2172 0.0272  -0.0014 0.0183  456 PRO B C     
4233 O  O     . PRO B 225 ? 0.1623 0.2391 0.2163 0.0066  -0.0017 0.0165  456 PRO B O     
4234 C  CB    . PRO B 225 ? 0.1763 0.2166 0.1956 0.0437  0.0034  -0.0428 456 PRO B CB    
4235 C  CG    . PRO B 225 ? 0.1824 0.2566 0.2070 0.0618  0.0221  -0.0371 456 PRO B CG    
4236 C  CD    . PRO B 225 ? 0.1669 0.2402 0.2122 0.0490  0.0413  -0.0439 456 PRO B CD    
4237 N  N     . VAL B 226 ? 0.1406 0.2248 0.2267 0.0034  -0.0075 -0.0008 457 VAL B N     
4238 C  CA    . VAL B 226 ? 0.1276 0.2438 0.2408 0.0043  -0.0096 -0.0074 457 VAL B CA    
4239 C  C     . VAL B 226 ? 0.1339 0.2578 0.2619 0.0134  0.0045  -0.0077 457 VAL B C     
4240 O  O     . VAL B 226 ? 0.1579 0.2339 0.2713 0.0501  0.0076  -0.0019 457 VAL B O     
4241 C  CB    . VAL B 226 ? 0.1443 0.2112 0.2413 0.0237  -0.0124 -0.0112 457 VAL B CB    
4242 C  CG1   . VAL B 226 ? 0.1585 0.2016 0.2561 -0.0019 -0.0236 0.0005  457 VAL B CG1   
4243 C  CG2   . VAL B 226 ? 0.1413 0.2275 0.2266 0.0510  -0.0155 0.0058  457 VAL B CG2   
4244 N  N     . GLN B 227 ? 0.1364 0.2736 0.2648 -0.0111 0.0217  -0.0109 458 GLN B N     
4245 C  CA    . GLN B 227 ? 0.1584 0.2715 0.2749 0.0353  0.0186  -0.0244 458 GLN B CA    
4246 C  C     . GLN B 227 ? 0.1274 0.2681 0.2781 0.0323  0.0070  -0.0027 458 GLN B C     
4247 O  O     . GLN B 227 ? 0.1354 0.2775 0.2726 0.0176  0.0013  0.0147  458 GLN B O     
4248 C  CB    . GLN B 227 ? 0.1716 0.2722 0.2812 0.0344  0.0106  -0.0555 458 GLN B CB    
4249 C  CG    . GLN B 227 ? 0.2155 0.2711 0.3197 0.0272  -0.0002 -0.0601 458 GLN B CG    
4250 C  CD    . GLN B 227 ? 0.2232 0.2797 0.3516 0.0124  0.0008  -0.0639 458 GLN B CD    
4251 O  OE1   . GLN B 227 ? 0.2836 0.2910 0.3850 -0.0086 -0.0102 -0.0394 458 GLN B OE1   
4252 N  NE2   . GLN B 227 ? 0.2588 0.2895 0.3756 0.0065  0.0044  -0.0699 458 GLN B NE2   
4253 N  N     . PRO B 228 ? 0.1284 0.2724 0.2878 0.0301  -0.0135 0.0083  459 PRO B N     
4254 C  CA    . PRO B 228 ? 0.1600 0.2869 0.2764 0.0056  -0.0218 0.0256  459 PRO B CA    
4255 C  C     . PRO B 228 ? 0.1638 0.3082 0.2618 0.0006  -0.0023 0.0273  459 PRO B C     
4256 O  O     . PRO B 228 ? 0.1762 0.3327 0.2835 0.0164  0.0202  -0.0092 459 PRO B O     
4257 C  CB    . PRO B 228 ? 0.1802 0.2804 0.2951 0.0170  -0.0223 0.0019  459 PRO B CB    
4258 C  CG    . PRO B 228 ? 0.1845 0.2741 0.3038 0.0338  -0.0113 0.0039  459 PRO B CG    
4259 C  CD    . PRO B 228 ? 0.1457 0.2700 0.2957 0.0610  -0.0051 0.0062  459 PRO B CD    
4260 N  N     . VAL B 229 ? 0.1632 0.3083 0.2558 0.0116  -0.0090 0.0351  460 VAL B N     
4261 C  CA    . VAL B 229 ? 0.1462 0.3084 0.2706 0.0312  -0.0048 0.0293  460 VAL B CA    
4262 C  C     . VAL B 229 ? 0.1562 0.3253 0.3000 0.0281  0.0053  0.0168  460 VAL B C     
4263 O  O     . VAL B 229 ? 0.1600 0.3137 0.2932 0.0010  -0.0167 0.0242  460 VAL B O     
4264 C  CB    . VAL B 229 ? 0.1672 0.2940 0.2786 -0.0014 -0.0254 0.0259  460 VAL B CB    
4265 C  CG1   . VAL B 229 ? 0.1845 0.2970 0.3067 -0.0237 -0.0042 0.0159  460 VAL B CG1   
4266 C  CG2   . VAL B 229 ? 0.1745 0.2960 0.2705 0.0132  -0.0621 0.0179  460 VAL B CG2   
4267 N  N     . SER B 230 ? 0.1383 0.3563 0.3146 0.0076  -0.0087 -0.0029 461 SER B N     
4268 C  CA    . SER B 230 ? 0.1592 0.3867 0.3330 0.0195  -0.0049 -0.0169 461 SER B CA    
4269 C  C     . SER B 230 ? 0.1424 0.3915 0.3243 0.0001  -0.0144 0.0018  461 SER B C     
4270 O  O     . SER B 230 ? 0.1510 0.4125 0.3136 0.0059  -0.0403 0.0276  461 SER B O     
4271 C  CB    . SER B 230 ? 0.2387 0.4066 0.3583 0.0460  -0.0085 -0.0765 461 SER B CB    
4272 O  OG    . SER B 230 ? 0.3124 0.4587 0.4079 0.0398  -0.0289 -0.0552 461 SER B OG    
4273 N  N     . SER B 231 ? 0.1686 0.3874 0.3425 -0.0307 0.0053  0.0014  462 SER B N     
4274 C  CA    . SER B 231 ? 0.1924 0.3822 0.3619 -0.0401 -0.0172 0.0122  462 SER B CA    
4275 C  C     . SER B 231 ? 0.1723 0.3525 0.3535 -0.0166 -0.0354 0.0154  462 SER B C     
4276 O  O     . SER B 231 ? 0.1897 0.3556 0.3769 -0.0477 -0.0249 -0.0052 462 SER B O     
4277 C  CB    . SER B 231 ? 0.2490 0.3953 0.3887 -0.0518 -0.0274 0.0310  462 SER B CB    
4278 O  OG    . SER B 231 ? 0.3117 0.4056 0.4146 -0.0610 -0.0352 0.0404  462 SER B OG    
4279 N  N     . ILE B 232 ? 0.1357 0.3218 0.3383 0.0226  -0.0321 0.0266  463 ILE B N     
4280 C  CA    . ILE B 232 ? 0.1233 0.3136 0.3125 0.0056  -0.0445 0.0241  463 ILE B CA    
4281 C  C     . ILE B 232 ? 0.1361 0.3191 0.3096 0.0188  -0.0463 0.0049  463 ILE B C     
4282 O  O     . ILE B 232 ? 0.1863 0.3246 0.3343 0.0125  -0.0518 -0.0262 463 ILE B O     
4283 C  CB    . ILE B 232 ? 0.1340 0.3008 0.3062 0.0138  -0.0325 0.0288  463 ILE B CB    
4284 C  CG1   . ILE B 232 ? 0.1685 0.2996 0.3159 -0.0009 -0.0441 0.0409  463 ILE B CG1   
4285 C  CG2   . ILE B 232 ? 0.1456 0.2990 0.2933 0.0137  -0.0156 0.0199  463 ILE B CG2   
4286 C  CD1   . ILE B 232 ? 0.1729 0.2966 0.3107 0.0071  -0.0557 0.0289  463 ILE B CD1   
4287 N  N     . GLU B 233 ? 0.1159 0.3205 0.2915 0.0391  -0.0418 0.0095  464 GLU B N     
4288 C  CA    . GLU B 233 ? 0.1461 0.3262 0.2956 0.0047  -0.0483 0.0014  464 GLU B CA    
4289 C  C     . GLU B 233 ? 0.1425 0.3561 0.3080 -0.0028 -0.0519 0.0088  464 GLU B C     
4290 O  O     . GLU B 233 ? 0.1632 0.3762 0.3032 0.0253  -0.0390 0.0014  464 GLU B O     
4291 C  CB    . GLU B 233 ? 0.1555 0.3214 0.2920 0.0227  -0.0184 -0.0367 464 GLU B CB    
4292 C  CG    . GLU B 233 ? 0.1254 0.3195 0.3011 0.0296  -0.0200 -0.0344 464 GLU B CG    
4293 C  CD    . GLU B 233 ? 0.1678 0.3293 0.3038 0.0146  -0.0265 -0.0297 464 GLU B CD    
4294 O  OE1   . GLU B 233 ? 0.1950 0.3335 0.2954 0.0176  -0.0122 -0.0102 464 GLU B OE1   
4295 O  OE2   . GLU B 233 ? 0.1630 0.3350 0.3133 -0.0179 -0.0030 -0.0110 464 GLU B OE2   
4296 N  N     . GLU B 234 ? 0.1218 0.3567 0.3256 -0.0333 -0.0485 0.0255  465 GLU B N     
4297 C  CA    . GLU B 234 ? 0.1406 0.3770 0.3436 -0.0259 -0.0409 0.0259  465 GLU B CA    
4298 C  C     . GLU B 234 ? 0.1919 0.3920 0.3696 -0.0255 -0.0482 -0.0021 465 GLU B C     
4299 O  O     . GLU B 234 ? 0.2309 0.4031 0.3751 -0.0135 -0.0640 -0.0048 465 GLU B O     
4300 C  CB    . GLU B 234 ? 0.1096 0.4023 0.3470 -0.0173 -0.0319 0.0316  465 GLU B CB    
4301 C  CG    . GLU B 234 ? 0.1294 0.4390 0.3605 -0.0024 -0.0263 0.0241  465 GLU B CG    
4302 C  CD    . GLU B 234 ? 0.1682 0.4733 0.3518 -0.0218 -0.0435 0.0064  465 GLU B CD    
4303 O  OE1   . GLU B 234 ? 0.1855 0.4702 0.3509 -0.0126 -0.0567 0.0061  465 GLU B OE1   
4304 O  OE2   . GLU B 234 ? 0.1676 0.5016 0.3528 -0.0321 -0.0479 -0.0070 465 GLU B OE2   
4305 N  N     . GLN B 235 ? 0.2502 0.3972 0.4109 -0.0078 -0.0422 -0.0209 466 GLN B N     
4306 C  CA    . GLN B 235 ? 0.3104 0.4228 0.4577 -0.0096 -0.0610 -0.0318 466 GLN B CA    
4307 C  C     . GLN B 235 ? 0.3208 0.4225 0.4732 -0.0024 -0.0834 -0.0439 466 GLN B C     
4308 O  O     . GLN B 235 ? 0.3525 0.4358 0.4811 -0.0163 -0.0954 -0.0504 466 GLN B O     
4309 C  CB    . GLN B 235 ? 0.3922 0.4559 0.4998 -0.0119 -0.0372 -0.0253 466 GLN B CB    
4310 C  CG    . GLN B 235 ? 0.4455 0.4865 0.5371 -0.0018 -0.0079 -0.0136 466 GLN B CG    
4311 C  CD    . GLN B 235 ? 0.5219 0.5276 0.5849 0.0096  0.0163  -0.0130 466 GLN B CD    
4312 O  OE1   . GLN B 235 ? 0.5517 0.5418 0.6056 0.0210  0.0155  -0.0082 466 GLN B OE1   
4313 N  NE2   . GLN B 235 ? 0.5554 0.5459 0.5989 -0.0050 0.0317  -0.0049 466 GLN B NE2   
4314 N  N     . GLY B 236 ? 0.2735 0.4171 0.4810 0.0097  -0.0953 -0.0364 467 GLY B N     
4315 C  CA    . GLY B 236 ? 0.3225 0.4255 0.4941 0.0071  -0.0917 -0.0301 467 GLY B CA    
4316 C  C     . GLY B 236 ? 0.3535 0.4541 0.5177 0.0047  -0.0729 -0.0300 467 GLY B C     
4317 O  O     . GLY B 236 ? 0.3664 0.4537 0.5273 0.0201  -0.0525 -0.0196 467 GLY B O     
4318 N  N     . CYS B 237 ? 0.3749 0.4901 0.5252 0.0032  -0.0730 -0.0269 468 CYS B N     
4319 C  CA    . CYS B 237 ? 0.4185 0.5310 0.5456 -0.0076 -0.0599 -0.0334 468 CYS B CA    
4320 C  C     . CYS B 237 ? 0.5223 0.5870 0.6093 -0.0208 -0.0410 -0.0328 468 CYS B C     
4321 O  O     . CYS B 237 ? 0.5542 0.6048 0.6213 -0.0399 -0.0337 -0.0488 468 CYS B O     
4322 C  CB    . CYS B 237 ? 0.3778 0.5214 0.5096 -0.0085 -0.0651 -0.0303 468 CYS B CB    
4323 S  SG    . CYS B 237 ? 0.3300 0.5085 0.4776 -0.0010 -0.0415 -0.0205 468 CYS B SG    
4324 N  N     . LEU B 238 ? 0.6048 0.6272 0.6541 -0.0230 -0.0553 -0.0184 469 LEU B N     
4325 C  CA    . LEU B 238 ? 0.6688 0.6682 0.6986 -0.0297 -0.0683 -0.0150 469 LEU B CA    
4326 C  C     . LEU B 238 ? 0.7141 0.6969 0.7371 -0.0335 -0.0725 -0.0124 469 LEU B C     
4327 O  O     . LEU B 238 ? 0.7291 0.7036 0.7456 -0.0421 -0.0690 -0.0035 469 LEU B O     
4328 C  CB    . LEU B 238 ? 0.6834 0.6788 0.7025 -0.0382 -0.0676 -0.0194 469 LEU B CB    
4329 C  CG    . LEU B 238 ? 0.6888 0.6784 0.7032 -0.0412 -0.0709 -0.0223 469 LEU B CG    
4330 C  CD1   . LEU B 238 ? 0.6955 0.6812 0.7054 -0.0378 -0.0715 -0.0293 469 LEU B CD1   
4331 C  CD2   . LEU B 238 ? 0.6878 0.6764 0.6989 -0.0472 -0.0735 -0.0236 469 LEU B CD2   
4332 N  N     . PHE B 239 ? 0.7259 0.7152 0.7599 -0.0266 -0.0811 -0.0213 470 PHE B N     
4333 C  CA    . PHE B 239 ? 0.7498 0.7371 0.7847 -0.0166 -0.0669 -0.0291 470 PHE B CA    
4334 C  C     . PHE B 239 ? 0.7471 0.7473 0.7913 -0.0152 -0.0750 -0.0340 470 PHE B C     
4335 O  O     . PHE B 239 ? 0.7484 0.7510 0.7970 -0.0194 -0.0812 -0.0350 470 PHE B O     
4336 C  CB    . PHE B 239 ? 0.7645 0.7459 0.7989 -0.0128 -0.0504 -0.0300 470 PHE B CB    
4337 C  CG    . PHE B 239 ? 0.7666 0.7506 0.8074 -0.0052 -0.0431 -0.0367 470 PHE B CG    
4338 C  CD1   . PHE B 239 ? 0.7542 0.7512 0.8113 -0.0149 -0.0361 -0.0393 470 PHE B CD1   
4339 C  CD2   . PHE B 239 ? 0.7689 0.7503 0.8108 0.0022  -0.0395 -0.0357 470 PHE B CD2   
4340 C  CE1   . PHE B 239 ? 0.7533 0.7490 0.8114 -0.0160 -0.0305 -0.0390 470 PHE B CE1   
4341 C  CE2   . PHE B 239 ? 0.7616 0.7447 0.8103 -0.0018 -0.0424 -0.0357 470 PHE B CE2   
4342 C  CZ    . PHE B 239 ? 0.7518 0.7437 0.8093 -0.0102 -0.0372 -0.0359 470 PHE B CZ    
4343 N  N     . VAL C 3   ? 0.5842 0.5624 0.4952 -0.0029 -0.0611 -0.0518 3   VAL C N     
4344 C  CA    . VAL C 3   ? 0.6048 0.5529 0.4959 -0.0100 -0.0566 -0.0443 3   VAL C CA    
4345 C  C     . VAL C 3   ? 0.5761 0.5308 0.4710 0.0002  -0.0441 -0.0457 3   VAL C C     
4346 O  O     . VAL C 3   ? 0.5871 0.5245 0.4452 0.0128  -0.0637 -0.0469 3   VAL C O     
4347 C  CB    . VAL C 3   ? 0.6465 0.5682 0.5154 -0.0218 -0.0573 -0.0400 3   VAL C CB    
4348 C  CG1   . VAL C 3   ? 0.6606 0.5732 0.5244 -0.0288 -0.0677 -0.0365 3   VAL C CG1   
4349 C  CG2   . VAL C 3   ? 0.6452 0.5627 0.5259 -0.0191 -0.0620 -0.0302 3   VAL C CG2   
4350 N  N     . GLN C 4   ? 0.5255 0.5233 0.4718 -0.0207 -0.0404 -0.0515 4   GLN C N     
4351 C  CA    . GLN C 4   ? 0.5202 0.5199 0.4914 -0.0109 -0.0100 -0.0454 4   GLN C CA    
4352 C  C     . GLN C 4   ? 0.4589 0.4719 0.4470 -0.0233 0.0151  -0.0530 4   GLN C C     
4353 O  O     . GLN C 4   ? 0.4370 0.4804 0.4326 -0.0096 0.0185  -0.0496 4   GLN C O     
4354 C  CB    . GLN C 4   ? 0.5830 0.5600 0.5570 -0.0010 -0.0178 -0.0366 4   GLN C CB    
4355 C  CG    . GLN C 4   ? 0.6478 0.6083 0.6142 -0.0016 -0.0227 -0.0291 4   GLN C CG    
4356 C  CD    . GLN C 4   ? 0.6967 0.6516 0.6587 -0.0001 -0.0162 -0.0207 4   GLN C CD    
4357 O  OE1   . GLN C 4   ? 0.7134 0.6654 0.6751 -0.0071 -0.0136 -0.0147 4   GLN C OE1   
4358 N  NE2   . GLN C 4   ? 0.7122 0.6683 0.6722 0.0097  -0.0089 -0.0237 4   GLN C NE2   
4359 N  N     . LEU C 5   ? 0.4325 0.4207 0.4245 -0.0412 0.0302  -0.0623 5   LEU C N     
4360 C  CA    . LEU C 5   ? 0.4172 0.3884 0.3930 -0.0690 0.0104  -0.0935 5   LEU C CA    
4361 C  C     . LEU C 5   ? 0.4650 0.3982 0.4157 -0.0641 -0.0218 -0.1041 5   LEU C C     
4362 O  O     . LEU C 5   ? 0.4656 0.4064 0.4271 -0.0701 -0.0301 -0.1105 5   LEU C O     
4363 C  CB    . LEU C 5   ? 0.3897 0.3555 0.3577 -0.0747 0.0299  -0.0980 5   LEU C CB    
4364 C  CG    . LEU C 5   ? 0.3814 0.3465 0.3375 -0.0670 0.0538  -0.0918 5   LEU C CG    
4365 C  CD1   . LEU C 5   ? 0.3728 0.3304 0.3271 -0.0576 0.0839  -0.0830 5   LEU C CD1   
4366 C  CD2   . LEU C 5   ? 0.3846 0.3606 0.3427 -0.0663 0.0716  -0.0885 5   LEU C CD2   
4367 N  N     . VAL C 6   ? 0.5114 0.4134 0.4309 -0.0569 -0.0612 -0.1016 6   VAL C N     
4368 C  CA    . VAL C 6   ? 0.5452 0.4189 0.4394 -0.0527 -0.0873 -0.1131 6   VAL C CA    
4369 C  C     . VAL C 6   ? 0.5651 0.4166 0.4408 -0.0573 -0.0989 -0.1132 6   VAL C C     
4370 O  O     . VAL C 6   ? 0.5807 0.4178 0.4279 -0.0467 -0.0909 -0.1192 6   VAL C O     
4371 C  CB    . VAL C 6   ? 0.5644 0.4413 0.4445 -0.0287 -0.0937 -0.1122 6   VAL C CB    
4372 C  CG1   . VAL C 6   ? 0.5674 0.4395 0.4437 -0.0287 -0.1024 -0.1158 6   VAL C CG1   
4373 C  CG2   . VAL C 6   ? 0.5740 0.4488 0.4487 -0.0162 -0.0980 -0.1049 6   VAL C CG2   
4374 N  N     . GLU C 7   ? 0.5647 0.4142 0.4515 -0.0845 -0.1136 -0.1087 7   GLU C N     
4375 C  CA    . GLU C 7   ? 0.5759 0.4129 0.4479 -0.1013 -0.1272 -0.1016 7   GLU C CA    
4376 C  C     . GLU C 7   ? 0.6094 0.4382 0.4718 -0.1039 -0.1301 -0.1044 7   GLU C C     
4377 O  O     . GLU C 7   ? 0.6376 0.4416 0.5065 -0.0846 -0.1301 -0.0919 7   GLU C O     
4378 C  CB    . GLU C 7   ? 0.5706 0.3924 0.4486 -0.1155 -0.0950 -0.0770 7   GLU C CB    
4379 C  CG    . GLU C 7   ? 0.5801 0.3795 0.4489 -0.1233 -0.0541 -0.0605 7   GLU C CG    
4380 C  CD    . GLU C 7   ? 0.5758 0.3680 0.4518 -0.1505 -0.0126 -0.0505 7   GLU C CD    
4381 O  OE1   . GLU C 7   ? 0.5647 0.3392 0.4507 -0.1708 0.0208  -0.0411 7   GLU C OE1   
4382 O  OE2   . GLU C 7   ? 0.5807 0.3847 0.4511 -0.1415 -0.0105 -0.0469 7   GLU C OE2   
4383 N  N     . THR C 8   ? 0.5894 0.4578 0.4321 -0.1112 -0.1466 -0.1294 8   THR C N     
4384 C  CA    . THR C 8   ? 0.5817 0.4875 0.4353 -0.1152 -0.1288 -0.1318 8   THR C CA    
4385 C  C     . THR C 8   ? 0.5245 0.4870 0.4186 -0.1434 -0.1163 -0.1244 8   THR C C     
4386 O  O     . THR C 8   ? 0.4686 0.4812 0.4056 -0.1596 -0.1005 -0.1099 8   THR C O     
4387 C  CB    . THR C 8   ? 0.6162 0.5199 0.4508 -0.0904 -0.1107 -0.1293 8   THR C CB    
4388 O  OG1   . THR C 8   ? 0.6336 0.5421 0.4532 -0.0935 -0.1050 -0.1274 8   THR C OG1   
4389 C  CG2   . THR C 8   ? 0.6288 0.5398 0.4560 -0.0746 -0.1082 -0.1299 8   THR C CG2   
4390 N  N     . GLY C 9   ? 0.5235 0.4909 0.4291 -0.1584 -0.1084 -0.1156 9   GLY C N     
4391 C  CA    . GLY C 9   ? 0.5225 0.4916 0.4279 -0.1644 -0.1072 -0.1201 9   GLY C CA    
4392 C  C     . GLY C 9   ? 0.5438 0.5059 0.4431 -0.1607 -0.1060 -0.1195 9   GLY C C     
4393 O  O     . GLY C 9   ? 0.5598 0.5218 0.4523 -0.1411 -0.1105 -0.1188 9   GLY C O     
4394 N  N     . GLY C 10  ? 0.5472 0.5117 0.4435 -0.1784 -0.0972 -0.1236 10  GLY C N     
4395 C  CA    . GLY C 10  ? 0.5429 0.5229 0.4448 -0.1903 -0.0858 -0.1236 10  GLY C CA    
4396 C  C     . GLY C 10  ? 0.5349 0.5350 0.4496 -0.1958 -0.0834 -0.1231 10  GLY C C     
4397 O  O     . GLY C 10  ? 0.5531 0.5580 0.4498 -0.1915 -0.0842 -0.1448 10  GLY C O     
4398 N  N     . GLY C 11  ? 0.5130 0.5342 0.4523 -0.1968 -0.0822 -0.0917 11  GLY C N     
4399 C  CA    . GLY C 11  ? 0.4876 0.5408 0.4543 -0.1930 -0.1051 -0.0592 11  GLY C CA    
4400 C  C     . GLY C 11  ? 0.4766 0.5510 0.4630 -0.1907 -0.0925 -0.0199 11  GLY C C     
4401 O  O     . GLY C 11  ? 0.4478 0.5485 0.4422 -0.2025 -0.1129 -0.0083 11  GLY C O     
4402 N  N     . LEU C 12  ? 0.4905 0.5724 0.4865 -0.1556 -0.0881 -0.0022 12  LEU C N     
4403 C  CA    . LEU C 12  ? 0.4776 0.5856 0.5037 -0.1460 -0.0820 0.0013  12  LEU C CA    
4404 C  C     . LEU C 12  ? 0.4652 0.6013 0.4992 -0.1426 -0.0985 -0.0221 12  LEU C C     
4405 O  O     . LEU C 12  ? 0.4517 0.6053 0.4913 -0.1544 -0.1049 -0.0549 12  LEU C O     
4406 C  CB    . LEU C 12  ? 0.4974 0.5856 0.5218 -0.1280 -0.0774 0.0182  12  LEU C CB    
4407 C  CG    . LEU C 12  ? 0.5257 0.5808 0.5340 -0.1202 -0.0696 0.0305  12  LEU C CG    
4408 C  CD1   . LEU C 12  ? 0.5243 0.5699 0.5371 -0.1254 -0.0451 0.0383  12  LEU C CD1   
4409 C  CD2   . LEU C 12  ? 0.5462 0.5808 0.5398 -0.1220 -0.0717 0.0350  12  LEU C CD2   
4410 N  N     . VAL C 13  ? 0.4963 0.6206 0.5056 -0.1130 -0.1026 -0.0071 13  VAL C N     
4411 C  CA    . VAL C 13  ? 0.4947 0.6383 0.5119 -0.1098 -0.1274 -0.0010 13  VAL C CA    
4412 C  C     . VAL C 13  ? 0.4782 0.6578 0.5054 -0.1317 -0.1734 -0.0120 13  VAL C C     
4413 O  O     . VAL C 13  ? 0.4856 0.6854 0.5089 -0.1424 -0.1884 -0.0079 13  VAL C O     
4414 C  CB    . VAL C 13  ? 0.5081 0.6368 0.5284 -0.1016 -0.1117 0.0160  13  VAL C CB    
4415 C  CG1   . VAL C 13  ? 0.5083 0.6330 0.5377 -0.1011 -0.1112 0.0211  13  VAL C CG1   
4416 C  CG2   . VAL C 13  ? 0.5209 0.6412 0.5272 -0.0811 -0.1098 0.0193  13  VAL C CG2   
4417 N  N     . GLN C 14  ? 0.4844 0.6449 0.5007 -0.1173 -0.1922 -0.0208 14  GLN C N     
4418 C  CA    . GLN C 14  ? 0.4854 0.6438 0.5172 -0.1432 -0.2134 -0.0482 14  GLN C CA    
4419 C  C     . GLN C 14  ? 0.4761 0.6486 0.5137 -0.1424 -0.2143 -0.0703 14  GLN C C     
4420 O  O     . GLN C 14  ? 0.5129 0.6497 0.5075 -0.1450 -0.1966 -0.0886 14  GLN C O     
4421 C  CB    . GLN C 14  ? 0.5499 0.6658 0.5614 -0.1251 -0.1750 -0.0293 14  GLN C CB    
4422 C  CG    . GLN C 14  ? 0.6140 0.6873 0.6005 -0.1163 -0.1333 -0.0276 14  GLN C CG    
4423 C  CD    . GLN C 14  ? 0.6567 0.6961 0.6266 -0.1244 -0.1180 -0.0285 14  GLN C CD    
4424 O  OE1   . GLN C 14  ? 0.6689 0.6997 0.6475 -0.1154 -0.0918 -0.0245 14  GLN C OE1   
4425 N  NE2   . GLN C 14  ? 0.7005 0.7060 0.6430 -0.1089 -0.0957 -0.0238 14  GLN C NE2   
4426 N  N     . ALA C 15  ? 0.4700 0.6524 0.5275 -0.1456 -0.2134 -0.0696 15  ALA C N     
4427 C  CA    . ALA C 15  ? 0.4688 0.6710 0.5471 -0.1377 -0.1829 -0.0446 15  ALA C CA    
4428 C  C     . ALA C 15  ? 0.4487 0.6841 0.5420 -0.1405 -0.2037 -0.0151 15  ALA C C     
4429 O  O     . ALA C 15  ? 0.4462 0.6943 0.5414 -0.1493 -0.2106 -0.0178 15  ALA C O     
4430 C  CB    . ALA C 15  ? 0.4750 0.6737 0.5572 -0.1316 -0.1439 -0.0475 15  ALA C CB    
4431 N  N     . GLY C 16  ? 0.4374 0.6958 0.5465 -0.1360 -0.2005 0.0099  16  GLY C N     
4432 C  CA    . GLY C 16  ? 0.4453 0.7065 0.5395 -0.1287 -0.2040 0.0245  16  GLY C CA    
4433 C  C     . GLY C 16  ? 0.4600 0.7168 0.5370 -0.1390 -0.2057 0.0318  16  GLY C C     
4434 O  O     . GLY C 16  ? 0.4690 0.7343 0.5427 -0.1394 -0.2141 0.0366  16  GLY C O     
4435 N  N     . GLY C 17  ? 0.4607 0.7107 0.5202 -0.1492 -0.2076 0.0213  17  GLY C N     
4436 C  CA    . GLY C 17  ? 0.4637 0.7066 0.4980 -0.1601 -0.2084 0.0127  17  GLY C CA    
4437 C  C     . GLY C 17  ? 0.4660 0.6996 0.4679 -0.1721 -0.2172 0.0068  17  GLY C C     
4438 O  O     . GLY C 17  ? 0.4822 0.7190 0.4649 -0.1510 -0.2004 0.0195  17  GLY C O     
4439 N  N     . SER C 18  ? 0.4436 0.6662 0.4495 -0.1697 -0.2137 -0.0012 18  SER C N     
4440 C  CA    . SER C 18  ? 0.4770 0.6466 0.4323 -0.1848 -0.1717 0.0073  18  SER C CA    
4441 C  C     . SER C 18  ? 0.4891 0.6123 0.3773 -0.1983 -0.1474 0.0025  18  SER C C     
4442 O  O     . SER C 18  ? 0.4994 0.6133 0.3603 -0.2137 -0.1638 -0.0026 18  SER C O     
4443 C  CB    . SER C 18  ? 0.5216 0.6456 0.4778 -0.1661 -0.1362 0.0145  18  SER C CB    
4444 O  OG    . SER C 18  ? 0.5607 0.6627 0.5084 -0.1557 -0.1156 0.0128  18  SER C OG    
4445 N  N     . LEU C 19  ? 0.4810 0.5836 0.3355 -0.1947 -0.1149 0.0148  19  LEU C N     
4446 C  CA    . LEU C 19  ? 0.4743 0.5578 0.3108 -0.1936 -0.0979 0.0132  19  LEU C CA    
4447 C  C     . LEU C 19  ? 0.4514 0.5480 0.2983 -0.2014 -0.0830 -0.0010 19  LEU C C     
4448 O  O     . LEU C 19  ? 0.4615 0.5529 0.3403 -0.1818 -0.0768 -0.0003 19  LEU C O     
4449 C  CB    . LEU C 19  ? 0.5329 0.5528 0.3231 -0.1573 -0.0882 0.0195  19  LEU C CB    
4450 C  CG    . LEU C 19  ? 0.5725 0.5522 0.3316 -0.1265 -0.0789 0.0272  19  LEU C CG    
4451 C  CD1   . LEU C 19  ? 0.5688 0.5543 0.3360 -0.1359 -0.0956 0.0238  19  LEU C CD1   
4452 C  CD2   . LEU C 19  ? 0.5889 0.5461 0.3435 -0.1221 -0.0551 0.0282  19  LEU C CD2   
4453 N  N     . ARG C 20  ? 0.4250 0.5375 0.2405 -0.2116 -0.0684 0.0017  20  ARG C N     
4454 C  CA    . ARG C 20  ? 0.4338 0.5330 0.2183 -0.1944 -0.0523 -0.0006 20  ARG C CA    
4455 C  C     . ARG C 20  ? 0.4744 0.5305 0.2342 -0.1697 -0.0466 -0.0391 20  ARG C C     
4456 O  O     . ARG C 20  ? 0.5382 0.5321 0.2570 -0.1640 -0.0556 -0.0283 20  ARG C O     
4457 C  CB    . ARG C 20  ? 0.4164 0.5418 0.2327 -0.2013 -0.0370 0.0166  20  ARG C CB    
4458 C  CG    . ARG C 20  ? 0.4407 0.5638 0.2501 -0.1809 -0.0200 0.0434  20  ARG C CG    
4459 C  CD    . ARG C 20  ? 0.4407 0.5925 0.2710 -0.1712 -0.0269 0.0510  20  ARG C CD    
4460 N  NE    . ARG C 20  ? 0.4752 0.6308 0.3041 -0.1265 -0.0233 0.0499  20  ARG C NE    
4461 C  CZ    . ARG C 20  ? 0.5090 0.6530 0.3411 -0.0973 -0.0811 0.0360  20  ARG C CZ    
4462 N  NH1   . ARG C 20  ? 0.5341 0.6515 0.3564 -0.0794 -0.0946 0.0269  20  ARG C NH1   
4463 N  NH2   . ARG C 20  ? 0.5125 0.6701 0.3466 -0.1021 -0.0863 0.0312  20  ARG C NH2   
4464 N  N     . LEU C 21  ? 0.4565 0.5173 0.2227 -0.1725 -0.0251 -0.0638 21  LEU C N     
4465 C  CA    . LEU C 21  ? 0.4438 0.4865 0.2064 -0.1857 0.0009  -0.0651 21  LEU C CA    
4466 C  C     . LEU C 21  ? 0.4348 0.4767 0.2163 -0.1808 -0.0007 -0.0774 21  LEU C C     
4467 O  O     . LEU C 21  ? 0.4334 0.4741 0.2241 -0.1810 0.0116  -0.0702 21  LEU C O     
4468 C  CB    . LEU C 21  ? 0.4460 0.4836 0.1941 -0.1909 0.0126  -0.0652 21  LEU C CB    
4469 C  CG    . LEU C 21  ? 0.4478 0.4850 0.2092 -0.1832 0.0095  -0.0619 21  LEU C CG    
4470 C  CD1   . LEU C 21  ? 0.4456 0.4975 0.2132 -0.1710 0.0039  -0.0372 21  LEU C CD1   
4471 C  CD2   . LEU C 21  ? 0.4599 0.4864 0.2267 -0.1871 0.0331  -0.0710 21  LEU C CD2   
4472 N  N     . SER C 22  ? 0.4419 0.4788 0.2184 -0.1687 -0.0080 -0.0880 22  SER C N     
4473 C  CA    . SER C 22  ? 0.4581 0.5003 0.2383 -0.1408 0.0058  -0.0780 22  SER C CA    
4474 C  C     . SER C 22  ? 0.4423 0.5025 0.2892 -0.1409 -0.0123 -0.0768 22  SER C C     
4475 O  O     . SER C 22  ? 0.4423 0.5198 0.3210 -0.1515 -0.0470 -0.0460 22  SER C O     
4476 C  CB    . SER C 22  ? 0.5224 0.5380 0.2426 -0.1287 0.0007  -0.0668 22  SER C CB    
4477 O  OG    . SER C 22  ? 0.5604 0.5609 0.2748 -0.1248 -0.0128 -0.0592 22  SER C OG    
4478 N  N     . CYS C 23  ? 0.4048 0.4856 0.2684 -0.1097 -0.0168 -0.1088 23  CYS C N     
4479 C  CA    . CYS C 23  ? 0.4086 0.4919 0.2877 -0.0864 -0.0167 -0.1062 23  CYS C CA    
4480 C  C     . CYS C 23  ? 0.4306 0.5036 0.3406 -0.0747 -0.0130 -0.0800 23  CYS C C     
4481 O  O     . CYS C 23  ? 0.4335 0.5216 0.3717 -0.0787 -0.0089 -0.0591 23  CYS C O     
4482 C  CB    . CYS C 23  ? 0.4005 0.5039 0.2747 -0.0623 -0.0293 -0.0914 23  CYS C CB    
4483 S  SG    . CYS C 23  ? 0.4442 0.5452 0.3215 -0.0141 -0.0540 -0.0530 23  CYS C SG    
4484 N  N     . ALA C 24  ? 0.4487 0.5113 0.3631 -0.0547 -0.0013 -0.0679 24  ALA C N     
4485 C  CA    . ALA C 24  ? 0.4771 0.5306 0.3844 -0.0224 0.0124  -0.0507 24  ALA C CA    
4486 C  C     . ALA C 24  ? 0.4860 0.5362 0.4021 -0.0123 0.0492  -0.0212 24  ALA C C     
4487 O  O     . ALA C 24  ? 0.4987 0.5425 0.4004 -0.0050 0.0497  -0.0118 24  ALA C O     
4488 C  CB    . ALA C 24  ? 0.5071 0.5461 0.3999 -0.0118 0.0030  -0.0657 24  ALA C CB    
4489 N  N     . ALA C 25  ? 0.4655 0.5394 0.4165 -0.0037 0.0778  -0.0023 25  ALA C N     
4490 C  CA    . ALA C 25  ? 0.4607 0.5508 0.4515 0.0035  0.1010  0.0018  25  ALA C CA    
4491 C  C     . ALA C 25  ? 0.5100 0.5653 0.4887 0.0190  0.0986  -0.0021 25  ALA C C     
4492 O  O     . ALA C 25  ? 0.5267 0.5727 0.4971 0.0217  0.1077  -0.0087 25  ALA C O     
4493 C  CB    . ALA C 25  ? 0.4302 0.5493 0.4493 -0.0088 0.1229  0.0111  25  ALA C CB    
4494 N  N     . SER C 26  ? 0.5400 0.5792 0.5215 0.0340  0.0906  -0.0083 26  SER C N     
4495 C  CA    . SER C 26  ? 0.5568 0.5894 0.5450 0.0451  0.0803  -0.0121 26  SER C CA    
4496 C  C     . SER C 26  ? 0.5766 0.6027 0.5694 0.0432  0.0728  -0.0213 26  SER C C     
4497 O  O     . SER C 26  ? 0.5882 0.6182 0.5883 0.0273  0.0708  -0.0192 26  SER C O     
4498 C  CB    . SER C 26  ? 0.5748 0.5932 0.5416 0.0590  0.0705  -0.0105 26  SER C CB    
4499 O  OG    . SER C 26  ? 0.5804 0.5875 0.5391 0.0804  0.0716  -0.0159 26  SER C OG    
4500 N  N     . GLY C 27  ? 0.5791 0.5974 0.5668 0.0494  0.0689  -0.0308 27  GLY C N     
4501 C  CA    . GLY C 27  ? 0.5649 0.5980 0.5648 0.0672  0.0815  -0.0271 27  GLY C CA    
4502 C  C     . GLY C 27  ? 0.5627 0.6000 0.5532 0.0728  0.0950  -0.0264 27  GLY C C     
4503 O  O     . GLY C 27  ? 0.5579 0.5971 0.5465 0.0920  0.0709  -0.0211 27  GLY C O     
4504 N  N     . ASN C 28  ? 0.5551 0.5997 0.5447 0.0701  0.1187  -0.0361 28  ASN C N     
4505 C  CA    . ASN C 28  ? 0.5572 0.6004 0.5397 0.0635  0.1424  -0.0458 28  ASN C CA    
4506 C  C     . ASN C 28  ? 0.5305 0.5790 0.5252 0.0818  0.1736  -0.0542 28  ASN C C     
4507 O  O     . ASN C 28  ? 0.5505 0.5900 0.5404 0.1001  0.1518  -0.0358 28  ASN C O     
4508 C  CB    . ASN C 28  ? 0.5809 0.6233 0.5566 0.0518  0.1314  -0.0545 28  ASN C CB    
4509 C  CG    . ASN C 28  ? 0.6107 0.6471 0.5770 0.0417  0.1093  -0.0489 28  ASN C CG    
4510 O  OD1   . ASN C 28  ? 0.6287 0.6574 0.5899 0.0420  0.1004  -0.0522 28  ASN C OD1   
4511 N  ND2   . ASN C 28  ? 0.6151 0.6568 0.5827 0.0410  0.0979  -0.0440 28  ASN C ND2   
4512 N  N     . ILE C 29  ? 0.4971 0.5509 0.5133 0.0637  0.2036  -0.0733 29  ILE C N     
4513 C  CA    . ILE C 29  ? 0.4708 0.5314 0.5135 0.0293  0.2081  -0.0740 29  ILE C CA    
4514 C  C     . ILE C 29  ? 0.4675 0.5151 0.5377 -0.0036 0.2084  -0.0762 29  ILE C C     
4515 O  O     . ILE C 29  ? 0.4493 0.4684 0.5197 0.0131  0.2250  -0.0973 29  ILE C O     
4516 C  CB    . ILE C 29  ? 0.4472 0.5287 0.5005 0.0312  0.1820  -0.0658 29  ILE C CB    
4517 C  CG1   . ILE C 29  ? 0.4248 0.5350 0.4862 0.0358  0.1864  -0.0688 29  ILE C CG1   
4518 C  CG2   . ILE C 29  ? 0.4589 0.5304 0.5007 0.0304  0.1502  -0.0659 29  ILE C CG2   
4519 C  CD1   . ILE C 29  ? 0.4220 0.5402 0.4810 0.0459  0.1935  -0.0700 29  ILE C CD1   
4520 N  N     . PHE C 30  ? 0.4844 0.5443 0.5852 -0.0281 0.1833  -0.0709 30  PHE C N     
4521 C  CA    . PHE C 30  ? 0.5107 0.5655 0.6228 -0.0165 0.1678  -0.0701 30  PHE C CA    
4522 C  C     . PHE C 30  ? 0.4680 0.5385 0.6165 -0.0131 0.1941  -0.0775 30  PHE C C     
4523 O  O     . PHE C 30  ? 0.5060 0.5530 0.6293 -0.0180 0.2122  -0.0762 30  PHE C O     
4524 C  CB    . PHE C 30  ? 0.5678 0.6108 0.6545 0.0016  0.1372  -0.0701 30  PHE C CB    
4525 C  CG    . PHE C 30  ? 0.6255 0.6487 0.6829 0.0116  0.1086  -0.0748 30  PHE C CG    
4526 C  CD1   . PHE C 30  ? 0.6427 0.6612 0.6920 0.0211  0.0984  -0.0808 30  PHE C CD1   
4527 C  CD2   . PHE C 30  ? 0.6481 0.6660 0.6993 0.0146  0.0982  -0.0764 30  PHE C CD2   
4528 C  CE1   . PHE C 30  ? 0.6495 0.6682 0.6999 0.0231  0.0920  -0.0826 30  PHE C CE1   
4529 C  CE2   . PHE C 30  ? 0.6565 0.6761 0.7080 0.0222  0.0970  -0.0783 30  PHE C CE2   
4530 C  CZ    . PHE C 30  ? 0.6599 0.6775 0.7078 0.0265  0.0939  -0.0788 30  PHE C CZ    
4531 N  N     . SER C 31  ? 0.4144 0.5075 0.5986 -0.0221 0.1648  -0.0872 31  SER C N     
4532 C  CA    . SER C 31  ? 0.3783 0.4857 0.5909 -0.0152 0.1000  -0.0950 31  SER C CA    
4533 C  C     . SER C 31  ? 0.2842 0.4355 0.5358 -0.0111 0.0767  -0.1115 31  SER C C     
4534 O  O     . SER C 31  ? 0.2544 0.4603 0.5689 -0.0178 0.0398  -0.1024 31  SER C O     
4535 C  CB    . SER C 31  ? 0.4355 0.5087 0.6204 -0.0062 0.0807  -0.0820 31  SER C CB    
4536 O  OG    . SER C 31  ? 0.4720 0.5295 0.6352 0.0108  0.0609  -0.0904 31  SER C OG    
4537 N  N     . PHE C 32  ? 0.2740 0.3553 0.4639 -0.0068 0.0657  -0.1125 32  PHE C N     
4538 C  CA    . PHE C 32  ? 0.2449 0.2881 0.3696 -0.0244 0.0672  -0.0882 32  PHE C CA    
4539 C  C     . PHE C 32  ? 0.2290 0.2714 0.3045 -0.0239 0.0486  -0.0701 32  PHE C C     
4540 O  O     . PHE C 32  ? 0.2743 0.2804 0.2802 -0.0136 0.0465  -0.0754 32  PHE C O     
4541 C  CB    . PHE C 32  ? 0.2640 0.2722 0.3781 -0.0405 0.0687  -0.0585 32  PHE C CB    
4542 C  CG    . PHE C 32  ? 0.2844 0.2702 0.4060 -0.0334 0.0919  -0.0432 32  PHE C CG    
4543 C  CD1   . PHE C 32  ? 0.3142 0.2628 0.4339 -0.0375 0.0833  -0.0174 32  PHE C CD1   
4544 C  CD2   . PHE C 32  ? 0.3546 0.2804 0.4380 -0.0342 0.0947  -0.0118 32  PHE C CD2   
4545 C  CE1   . PHE C 32  ? 0.3631 0.2937 0.4481 -0.0169 0.0765  -0.0172 32  PHE C CE1   
4546 C  CE2   . PHE C 32  ? 0.3882 0.2773 0.4413 -0.0267 0.1074  0.0091  32  PHE C CE2   
4547 C  CZ    . PHE C 32  ? 0.3878 0.2930 0.4508 -0.0060 0.0856  -0.0189 32  PHE C CZ    
4548 N  N     . ASN C 33  ? 0.1840 0.2147 0.2511 -0.0065 0.0370  -0.0606 33  ASN C N     
4549 C  CA    . ASN C 33  ? 0.1669 0.1982 0.2061 0.0127  0.0124  -0.0509 33  ASN C CA    
4550 C  C     . ASN C 33  ? 0.1766 0.1970 0.1972 -0.0191 -0.0036 -0.0293 33  ASN C C     
4551 O  O     . ASN C 33  ? 0.2123 0.1956 0.2057 -0.0121 -0.0126 -0.0037 33  ASN C O     
4552 C  CB    . ASN C 33  ? 0.1841 0.2073 0.2049 -0.0102 -0.0071 -0.0385 33  ASN C CB    
4553 C  CG    . ASN C 33  ? 0.1951 0.2204 0.2359 -0.0017 -0.0167 -0.0384 33  ASN C CG    
4554 O  OD1   . ASN C 33  ? 0.2225 0.2266 0.2442 0.0004  -0.0125 -0.0190 33  ASN C OD1   
4555 N  ND2   . ASN C 33  ? 0.2113 0.2294 0.2492 -0.0284 -0.0331 -0.0565 33  ASN C ND2   
4556 N  N     . VAL C 34  ? 0.1528 0.1961 0.2022 -0.0375 0.0038  -0.0341 34  VAL C N     
4557 C  CA    . VAL C 34  ? 0.1595 0.2124 0.2068 -0.0297 0.0199  -0.0321 34  VAL C CA    
4558 C  C     . VAL C 34  ? 0.2046 0.2095 0.2211 -0.0478 0.0310  -0.0093 34  VAL C C     
4559 O  O     . VAL C 34  ? 0.2354 0.2076 0.2620 -0.0436 0.0060  -0.0245 34  VAL C O     
4560 C  CB    . VAL C 34  ? 0.1925 0.2605 0.2203 -0.0206 0.0378  -0.0555 34  VAL C CB    
4561 C  CG1   . VAL C 34  ? 0.1858 0.2968 0.2433 -0.0145 0.0235  -0.0318 34  VAL C CG1   
4562 C  CG2   . VAL C 34  ? 0.2212 0.2602 0.2346 -0.0279 0.0315  -0.0804 34  VAL C CG2   
4563 N  N     . MET C 35  ? 0.2090 0.2201 0.2428 -0.0488 -0.0068 -0.0176 35  MET C N     
4564 C  CA    . MET C 35  ? 0.2109 0.2667 0.2503 -0.0796 0.0100  -0.0337 35  MET C CA    
4565 C  C     . MET C 35  ? 0.2068 0.2613 0.2339 -0.0949 0.0044  -0.0332 35  MET C C     
4566 O  O     . MET C 35  ? 0.2258 0.2734 0.2296 -0.0689 0.0059  0.0049  35  MET C O     
4567 C  CB    . MET C 35  ? 0.2398 0.3173 0.3154 -0.0893 0.0488  -0.0719 35  MET C CB    
4568 C  CG    . MET C 35  ? 0.2733 0.3700 0.3790 -0.1260 0.1252  -0.0964 35  MET C CG    
4569 S  SD    . MET C 35  ? 0.4050 0.4148 0.4931 -0.0662 0.1390  -0.0865 35  MET C SD    
4570 C  CE    . MET C 35  ? 0.4286 0.3953 0.4936 -0.0842 0.1201  -0.1061 35  MET C CE    
4571 N  N     . GLY C 36  ? 0.2006 0.2793 0.2382 -0.1085 0.0157  -0.0288 36  GLY C N     
4572 C  CA    . GLY C 36  ? 0.1874 0.2916 0.2502 -0.1267 0.0243  -0.0222 36  GLY C CA    
4573 C  C     . GLY C 36  ? 0.2298 0.3017 0.2251 -0.1186 0.0045  -0.0107 36  GLY C C     
4574 O  O     . GLY C 36  ? 0.2657 0.3363 0.2526 -0.1113 -0.0065 0.0166  36  GLY C O     
4575 N  N     . TRP C 37  ? 0.2153 0.3111 0.1937 -0.1261 -0.0131 -0.0110 37  TRP C N     
4576 C  CA    . TRP C 37  ? 0.2229 0.3528 0.1667 -0.1224 -0.0055 -0.0153 37  TRP C CA    
4577 C  C     . TRP C 37  ? 0.2353 0.3720 0.1756 -0.1202 0.0123  -0.0033 37  TRP C C     
4578 O  O     . TRP C 37  ? 0.2443 0.3806 0.1860 -0.1036 -0.0003 -0.0031 37  TRP C O     
4579 C  CB    . TRP C 37  ? 0.2530 0.3873 0.1746 -0.0999 -0.0190 -0.0108 37  TRP C CB    
4580 C  CG    . TRP C 37  ? 0.2834 0.4078 0.2032 -0.1030 -0.0123 -0.0214 37  TRP C CG    
4581 C  CD1   . TRP C 37  ? 0.2818 0.4098 0.2135 -0.1001 -0.0239 -0.0230 37  TRP C CD1   
4582 C  CD2   . TRP C 37  ? 0.3013 0.4035 0.2115 -0.1172 -0.0241 -0.0447 37  TRP C CD2   
4583 N  NE1   . TRP C 37  ? 0.3014 0.3981 0.2234 -0.1109 -0.0220 -0.0415 37  TRP C NE1   
4584 C  CE2   . TRP C 37  ? 0.3293 0.4154 0.2295 -0.1143 -0.0225 -0.0546 37  TRP C CE2   
4585 C  CE3   . TRP C 37  ? 0.3275 0.4133 0.2241 -0.1194 -0.0305 -0.0500 37  TRP C CE3   
4586 C  CZ2   . TRP C 37  ? 0.3642 0.4280 0.2338 -0.1123 -0.0347 -0.0730 37  TRP C CZ2   
4587 C  CZ3   . TRP C 37  ? 0.3665 0.4340 0.2447 -0.1113 -0.0289 -0.0457 37  TRP C CZ3   
4588 C  CH2   . TRP C 37  ? 0.3876 0.4357 0.2331 -0.1055 -0.0212 -0.0627 37  TRP C CH2   
4589 N  N     . TYR C 38  ? 0.2450 0.3752 0.1805 -0.1584 0.0265  0.0010  38  TYR C N     
4590 C  CA    . TYR C 38  ? 0.2470 0.3896 0.1912 -0.1591 0.0042  -0.0011 38  TYR C CA    
4591 C  C     . TYR C 38  ? 0.2797 0.4343 0.2194 -0.1528 -0.0034 -0.0016 38  TYR C C     
4592 O  O     . TYR C 38  ? 0.2880 0.4561 0.2179 -0.1603 -0.0078 -0.0101 38  TYR C O     
4593 C  CB    . TYR C 38  ? 0.2418 0.3637 0.1766 -0.1292 -0.0209 -0.0010 38  TYR C CB    
4594 C  CG    . TYR C 38  ? 0.2317 0.3349 0.1924 -0.1188 -0.0107 0.0075  38  TYR C CG    
4595 C  CD1   . TYR C 38  ? 0.2160 0.3311 0.2100 -0.1038 -0.0185 0.0120  38  TYR C CD1   
4596 C  CD2   . TYR C 38  ? 0.2389 0.3369 0.1953 -0.0808 -0.0270 0.0230  38  TYR C CD2   
4597 C  CE1   . TYR C 38  ? 0.2386 0.3407 0.1910 -0.0874 -0.0295 0.0059  38  TYR C CE1   
4598 C  CE2   . TYR C 38  ? 0.2389 0.3455 0.2251 -0.0951 -0.0238 0.0189  38  TYR C CE2   
4599 C  CZ    . TYR C 38  ? 0.2372 0.3413 0.2084 -0.1011 -0.0312 -0.0066 38  TYR C CZ    
4600 O  OH    . TYR C 38  ? 0.2752 0.3425 0.2202 -0.1104 -0.0322 -0.0114 38  TYR C OH    
4601 N  N     . ARG C 39  ? 0.2724 0.4414 0.2317 -0.1629 -0.0014 -0.0065 39  ARG C N     
4602 C  CA    . ARG C 39  ? 0.2779 0.4606 0.2470 -0.1893 -0.0039 0.0046  39  ARG C CA    
4603 C  C     . ARG C 39  ? 0.3032 0.4898 0.2391 -0.1988 0.0024  0.0033  39  ARG C C     
4604 O  O     . ARG C 39  ? 0.3205 0.4871 0.2361 -0.1946 0.0188  -0.0227 39  ARG C O     
4605 C  CB    . ARG C 39  ? 0.2903 0.4647 0.2568 -0.1525 -0.0297 -0.0002 39  ARG C CB    
4606 C  CG    . ARG C 39  ? 0.3075 0.4888 0.2706 -0.1421 -0.0259 0.0086  39  ARG C CG    
4607 C  CD    . ARG C 39  ? 0.3143 0.5051 0.3055 -0.1292 -0.0359 0.0022  39  ARG C CD    
4608 N  NE    . ARG C 39  ? 0.3162 0.5247 0.3455 -0.1202 -0.0343 0.0019  39  ARG C NE    
4609 C  CZ    . ARG C 39  ? 0.3591 0.5346 0.3563 -0.1107 -0.0564 -0.0101 39  ARG C CZ    
4610 N  NH1   . ARG C 39  ? 0.3501 0.5342 0.3593 -0.1561 -0.0817 -0.0193 39  ARG C NH1   
4611 N  NH2   . ARG C 39  ? 0.3962 0.5409 0.3690 -0.0863 -0.0597 -0.0312 39  ARG C NH2   
4612 N  N     . GLN C 40  ? 0.3229 0.5117 0.2508 -0.2146 0.0125  0.0354  40  GLN C N     
4613 C  CA    . GLN C 40  ? 0.3838 0.5394 0.2960 -0.2405 0.0188  0.0298  40  GLN C CA    
4614 C  C     . GLN C 40  ? 0.3900 0.5667 0.3038 -0.2487 0.0365  0.0143  40  GLN C C     
4615 O  O     . GLN C 40  ? 0.4071 0.5686 0.2978 -0.2646 0.0478  0.0127  40  GLN C O     
4616 C  CB    . GLN C 40  ? 0.4399 0.5389 0.3276 -0.2585 0.0247  0.0315  40  GLN C CB    
4617 C  CG    . GLN C 40  ? 0.4857 0.5381 0.3819 -0.2595 0.0099  0.0134  40  GLN C CG    
4618 C  CD    . GLN C 40  ? 0.5419 0.5524 0.4358 -0.2216 -0.0090 0.0040  40  GLN C CD    
4619 O  OE1   . GLN C 40  ? 0.5790 0.5546 0.4679 -0.2237 -0.0219 -0.0118 40  GLN C OE1   
4620 N  NE2   . GLN C 40  ? 0.5252 0.5624 0.4586 -0.2083 -0.0146 0.0179  40  GLN C NE2   
4621 N  N     . ALA C 41  ? 0.3761 0.5859 0.3124 -0.2395 0.0305  -0.0078 41  ALA C N     
4622 C  CA    . ALA C 41  ? 0.3984 0.6177 0.3361 -0.1905 0.0104  -0.0318 41  ALA C CA    
4623 C  C     . ALA C 41  ? 0.3880 0.6260 0.3629 -0.2123 0.0212  -0.0473 41  ALA C C     
4624 O  O     . ALA C 41  ? 0.3441 0.6279 0.3519 -0.2296 0.0418  -0.0607 41  ALA C O     
4625 C  CB    . ALA C 41  ? 0.4255 0.6276 0.3209 -0.1694 -0.0220 -0.0383 41  ALA C CB    
4626 N  N     . PRO C 42  ? 0.4130 0.6276 0.3858 -0.2190 0.0117  -0.0383 42  PRO C N     
4627 C  CA    . PRO C 42  ? 0.4118 0.6227 0.3963 -0.2133 -0.0014 -0.0145 42  PRO C CA    
4628 C  C     . PRO C 42  ? 0.3612 0.6078 0.3872 -0.2020 -0.0112 0.0255  42  PRO C C     
4629 O  O     . PRO C 42  ? 0.3693 0.6101 0.4037 -0.2135 -0.0066 0.0323  42  PRO C O     
4630 C  CB    . PRO C 42  ? 0.4462 0.6266 0.3935 -0.2144 0.0000  -0.0276 42  PRO C CB    
4631 C  CG    . PRO C 42  ? 0.4536 0.6343 0.3973 -0.2088 0.0136  -0.0344 42  PRO C CG    
4632 C  CD    . PRO C 42  ? 0.4408 0.6301 0.3892 -0.2215 0.0125  -0.0424 42  PRO C CD    
4633 N  N     . GLY C 43  ? 0.3311 0.5943 0.3814 -0.1769 -0.0249 0.0560  43  GLY C N     
4634 C  CA    . GLY C 43  ? 0.3143 0.5704 0.3547 -0.1537 -0.0704 0.0851  43  GLY C CA    
4635 C  C     . GLY C 43  ? 0.3544 0.5602 0.3182 -0.1228 -0.0668 0.1089  43  GLY C C     
4636 O  O     . GLY C 43  ? 0.3691 0.5520 0.2877 -0.1062 -0.0504 0.1391  43  GLY C O     
4637 N  N     . LYS C 44  ? 0.4011 0.5733 0.3042 -0.1079 -0.0632 0.1075  44  LYS C N     
4638 C  CA    . LYS C 44  ? 0.4490 0.5969 0.3298 -0.0937 -0.0468 0.0953  44  LYS C CA    
4639 C  C     . LYS C 44  ? 0.4127 0.6012 0.3162 -0.1278 -0.0494 0.0908  44  LYS C C     
4640 O  O     . LYS C 44  ? 0.3646 0.5985 0.3010 -0.1261 -0.0676 0.1003  44  LYS C O     
4641 C  CB    . LYS C 44  ? 0.5395 0.6143 0.4021 -0.0591 -0.0393 0.0747  44  LYS C CB    
4642 C  CG    . LYS C 44  ? 0.5952 0.6413 0.4662 -0.0367 -0.0347 0.0589  44  LYS C CG    
4643 C  CD    . LYS C 44  ? 0.6318 0.6571 0.5051 -0.0252 -0.0316 0.0416  44  LYS C CD    
4644 C  CE    . LYS C 44  ? 0.6546 0.6669 0.5339 -0.0231 -0.0284 0.0332  44  LYS C CE    
4645 N  NZ    . LYS C 44  ? 0.6595 0.6732 0.5544 -0.0275 -0.0218 0.0373  44  LYS C NZ    
4646 N  N     . GLN C 45  ? 0.4411 0.6183 0.3367 -0.1489 -0.0083 0.0938  45  GLN C N     
4647 C  CA    . GLN C 45  ? 0.4631 0.6260 0.3623 -0.1639 0.0050  0.0876  45  GLN C CA    
4648 C  C     . GLN C 45  ? 0.4244 0.6068 0.3372 -0.1718 -0.0040 0.0823  45  GLN C C     
4649 O  O     . GLN C 45  ? 0.4059 0.6102 0.3456 -0.1865 -0.0032 0.0954  45  GLN C O     
4650 C  CB    . GLN C 45  ? 0.5253 0.6534 0.4198 -0.1467 0.0180  0.0799  45  GLN C CB    
4651 C  CG    . GLN C 45  ? 0.5893 0.6746 0.4759 -0.1082 0.0206  0.0979  45  GLN C CG    
4652 C  CD    . GLN C 45  ? 0.6194 0.6959 0.5118 -0.0665 0.0357  0.1131  45  GLN C CD    
4653 O  OE1   . GLN C 45  ? 0.6238 0.7112 0.5331 -0.0537 0.0163  0.1191  45  GLN C OE1   
4654 N  NE2   . GLN C 45  ? 0.6275 0.7022 0.5232 -0.0479 0.0628  0.1107  45  GLN C NE2   
4655 N  N     . ARG C 46  ? 0.4004 0.5815 0.3060 -0.1770 -0.0279 0.0838  46  ARG C N     
4656 C  CA    . ARG C 46  ? 0.4041 0.5532 0.2786 -0.1769 -0.0094 0.0794  46  ARG C CA    
4657 C  C     . ARG C 46  ? 0.4037 0.5362 0.2512 -0.1719 -0.0218 0.0485  46  ARG C C     
4658 O  O     . ARG C 46  ? 0.4452 0.5432 0.2431 -0.1839 -0.0332 0.0401  46  ARG C O     
4659 C  CB    . ARG C 46  ? 0.4256 0.5417 0.2826 -0.1627 -0.0040 0.1001  46  ARG C CB    
4660 C  CG    . ARG C 46  ? 0.4299 0.5216 0.2787 -0.1459 0.0203  0.1206  46  ARG C CG    
4661 C  CD    . ARG C 46  ? 0.4377 0.5115 0.2932 -0.1249 0.0084  0.1114  46  ARG C CD    
4662 N  NE    . ARG C 46  ? 0.4457 0.5106 0.3053 -0.1144 0.0063  0.1108  46  ARG C NE    
4663 C  CZ    . ARG C 46  ? 0.4632 0.5128 0.3240 -0.1167 0.0052  0.1074  46  ARG C CZ    
4664 N  NH1   . ARG C 46  ? 0.4394 0.5298 0.3469 -0.1137 0.0227  0.0896  46  ARG C NH1   
4665 N  NH2   . ARG C 46  ? 0.5035 0.5070 0.3264 -0.0881 -0.0191 0.1182  46  ARG C NH2   
4666 N  N     . GLU C 47  ? 0.3498 0.5109 0.2399 -0.1559 0.0188  0.0423  47  GLU C N     
4667 C  CA    . GLU C 47  ? 0.3202 0.5150 0.2528 -0.1194 0.0127  0.0231  47  GLU C CA    
4668 C  C     . GLU C 47  ? 0.2673 0.4598 0.2411 -0.1104 0.0075  0.0219  47  GLU C C     
4669 O  O     . GLU C 47  ? 0.2873 0.4471 0.2394 -0.1420 0.0170  0.0089  47  GLU C O     
4670 C  CB    . GLU C 47  ? 0.3336 0.5587 0.2812 -0.1046 0.0294  -0.0080 47  GLU C CB    
4671 C  CG    . GLU C 47  ? 0.3862 0.6033 0.3237 -0.0768 0.0375  -0.0050 47  GLU C CG    
4672 C  CD    . GLU C 47  ? 0.4465 0.6451 0.3658 -0.0682 0.0635  0.0097  47  GLU C CD    
4673 O  OE1   . GLU C 47  ? 0.4812 0.6618 0.3995 -0.0473 0.0741  -0.0043 47  GLU C OE1   
4674 O  OE2   . GLU C 47  ? 0.4667 0.6544 0.3905 -0.0649 0.0650  0.0180  47  GLU C OE2   
4675 N  N     . LEU C 48  ? 0.2400 0.4304 0.2266 -0.1007 -0.0075 0.0242  48  LEU C N     
4676 C  CA    . LEU C 48  ? 0.2370 0.3977 0.2146 -0.0967 -0.0074 0.0214  48  LEU C CA    
4677 C  C     . LEU C 48  ? 0.2348 0.4271 0.2243 -0.0715 -0.0126 0.0036  48  LEU C C     
4678 O  O     . LEU C 48  ? 0.2588 0.4671 0.2505 -0.0573 -0.0378 -0.0100 48  LEU C O     
4679 C  CB    . LEU C 48  ? 0.2585 0.3625 0.2394 -0.1008 0.0039  0.0306  48  LEU C CB    
4680 C  CG    . LEU C 48  ? 0.2806 0.3570 0.2535 -0.1197 -0.0020 0.0048  48  LEU C CG    
4681 C  CD1   . LEU C 48  ? 0.3008 0.3732 0.2698 -0.1245 0.0030  0.0009  48  LEU C CD1   
4682 C  CD2   . LEU C 48  ? 0.3565 0.3502 0.2657 -0.1042 -0.0290 -0.0095 48  LEU C CD2   
4683 N  N     . VAL C 49  ? 0.2276 0.4150 0.2013 -0.0965 -0.0144 0.0017  49  VAL C N     
4684 C  CA    . VAL C 49  ? 0.2299 0.4094 0.2228 -0.1293 -0.0305 0.0190  49  VAL C CA    
4685 C  C     . VAL C 49  ? 0.2278 0.3905 0.2371 -0.1166 -0.0275 0.0304  49  VAL C C     
4686 O  O     . VAL C 49  ? 0.2453 0.3898 0.2686 -0.1052 -0.0468 0.0450  49  VAL C O     
4687 C  CB    . VAL C 49  ? 0.2801 0.4082 0.2271 -0.1594 -0.0456 0.0218  49  VAL C CB    
4688 C  CG1   . VAL C 49  ? 0.3195 0.4303 0.2565 -0.1334 -0.0463 0.0344  49  VAL C CG1   
4689 C  CG2   . VAL C 49  ? 0.3077 0.4040 0.2238 -0.1775 -0.0490 0.0371  49  VAL C CG2   
4690 N  N     . ALA C 50  ? 0.1982 0.3686 0.1955 -0.1057 -0.0194 0.0216  50  ALA C N     
4691 C  CA    . ALA C 50  ? 0.2219 0.3522 0.1971 -0.1202 -0.0218 0.0049  50  ALA C CA    
4692 C  C     . ALA C 50  ? 0.2005 0.3374 0.1885 -0.0916 -0.0086 0.0126  50  ALA C C     
4693 O  O     . ALA C 50  ? 0.2217 0.3400 0.2061 -0.0961 -0.0186 0.0301  50  ALA C O     
4694 C  CB    . ALA C 50  ? 0.2444 0.3665 0.2075 -0.0947 -0.0271 0.0305  50  ALA C CB    
4695 N  N     . ALA C 51  ? 0.1705 0.3166 0.1658 -0.0802 0.0057  0.0024  51  ALA C N     
4696 C  CA    . ALA C 51  ? 0.1669 0.3122 0.1552 -0.0599 0.0115  0.0005  51  ALA C CA    
4697 C  C     . ALA C 51  ? 0.1772 0.2953 0.1711 -0.0679 -0.0174 -0.0121 51  ALA C C     
4698 O  O     . ALA C 51  ? 0.2039 0.3013 0.1735 -0.0528 -0.0178 -0.0077 51  ALA C O     
4699 C  CB    . ALA C 51  ? 0.2049 0.3249 0.1560 -0.0445 0.0016  -0.0061 51  ALA C CB    
4700 N  N     . ILE C 52  ? 0.1755 0.2856 0.1677 -0.0519 -0.0028 -0.0175 52  ILE C N     
4701 C  CA    . ILE C 52  ? 0.1914 0.2593 0.1565 -0.0544 0.0046  -0.0161 52  ILE C CA    
4702 C  C     . ILE C 52  ? 0.1956 0.2504 0.1686 -0.0633 0.0165  -0.0066 52  ILE C C     
4703 O  O     . ILE C 52  ? 0.2277 0.2601 0.1882 -0.0675 -0.0017 -0.0017 52  ILE C O     
4704 C  CB    . ILE C 52  ? 0.2263 0.2701 0.1571 -0.0470 0.0103  -0.0241 52  ILE C CB    
4705 C  CG1   . ILE C 52  ? 0.2298 0.2937 0.1502 -0.0753 0.0083  -0.0138 52  ILE C CG1   
4706 C  CG2   . ILE C 52  ? 0.2396 0.2773 0.1810 -0.0626 0.0059  -0.0494 52  ILE C CG2   
4707 C  CD1   . ILE C 52  ? 0.2562 0.3203 0.1659 -0.0506 0.0040  -0.0248 52  ILE C CD1   
4708 N  N     . THR C 53  ? 0.1855 0.2345 0.1636 -0.0732 -0.0009 -0.0132 53  THR C N     
4709 C  CA    . THR C 53  ? 0.1624 0.2479 0.1606 -0.0415 0.0094  -0.0325 53  THR C CA    
4710 C  C     . THR C 53  ? 0.1829 0.2937 0.1714 -0.0427 0.0233  -0.0352 53  THR C C     
4711 O  O     . THR C 53  ? 0.2190 0.3155 0.1770 -0.0622 0.0251  -0.0499 53  THR C O     
4712 C  CB    . THR C 53  ? 0.1810 0.2576 0.1448 -0.0367 0.0026  -0.0006 53  THR C CB    
4713 O  OG1   . THR C 53  ? 0.2013 0.2663 0.1450 -0.0279 -0.0126 0.0177  53  THR C OG1   
4714 C  CG2   . THR C 53  ? 0.1878 0.2920 0.1397 -0.0252 0.0062  0.0076  53  THR C CG2   
4715 N  N     A SER C 54  ? 0.1587 0.3021 0.1852 -0.0308 0.0295  -0.0407 54  SER C N     
4716 N  N     B SER C 54  ? 0.1629 0.2992 0.1900 -0.0352 0.0182  -0.0498 54  SER C N     
4717 C  CA    A SER C 54  ? 0.1805 0.3174 0.1992 -0.0132 0.0316  -0.0409 54  SER C CA    
4718 C  CA    B SER C 54  ? 0.1876 0.3104 0.2111 -0.0216 0.0121  -0.0606 54  SER C CA    
4719 C  C     A SER C 54  ? 0.1784 0.3167 0.2142 -0.0385 0.0289  -0.0481 54  SER C C     
4720 C  C     B SER C 54  ? 0.1812 0.3149 0.2163 -0.0377 0.0178  -0.0684 54  SER C C     
4721 O  O     A SER C 54  ? 0.1939 0.3297 0.2259 -0.0314 0.0263  -0.0523 54  SER C O     
4722 O  O     B SER C 54  ? 0.2035 0.3318 0.2295 -0.0367 0.0235  -0.0885 54  SER C O     
4723 C  CB    A SER C 54  ? 0.1894 0.3329 0.2185 0.0025  0.0345  -0.0450 54  SER C CB    
4724 C  CB    B SER C 54  ? 0.2088 0.3193 0.2437 -0.0100 -0.0003 -0.0685 54  SER C CB    
4725 O  OG    A SER C 54  ? 0.1985 0.3458 0.2383 0.0105  0.0391  -0.0423 54  SER C OG    
4726 O  OG    B SER C 54  ? 0.2278 0.3267 0.2707 -0.0163 -0.0228 -0.0695 54  SER C OG    
4727 N  N     . GLY C 55  ? 0.1938 0.3082 0.2107 -0.0576 0.0014  -0.0525 55  GLY C N     
4728 C  CA    . GLY C 55  ? 0.2014 0.3119 0.2133 -0.0622 0.0034  -0.0430 55  GLY C CA    
4729 C  C     . GLY C 55  ? 0.2429 0.3153 0.2100 -0.0711 0.0078  -0.0358 55  GLY C C     
4730 O  O     . GLY C 55  ? 0.2442 0.2846 0.2122 -0.0713 0.0394  -0.0152 55  GLY C O     
4731 N  N     . ASP C 56  ? 0.2118 0.3225 0.1953 -0.0732 -0.0078 -0.0223 56  ASP C N     
4732 C  CA    . ASP C 56  ? 0.2108 0.3216 0.1749 -0.0545 0.0056  -0.0028 56  ASP C CA    
4733 C  C     . ASP C 56  ? 0.2229 0.3119 0.1864 -0.0456 -0.0052 0.0054  56  ASP C C     
4734 O  O     . ASP C 56  ? 0.2296 0.3174 0.2103 -0.0341 -0.0177 0.0004  56  ASP C O     
4735 C  CB    . ASP C 56  ? 0.2391 0.3121 0.1821 -0.0359 0.0295  -0.0187 56  ASP C CB    
4736 C  CG    . ASP C 56  ? 0.3207 0.3171 0.2308 -0.0412 -0.0012 -0.0095 56  ASP C CG    
4737 O  OD1   . ASP C 56  ? 0.3676 0.3205 0.2584 -0.0423 -0.0036 -0.0090 56  ASP C OD1   
4738 O  OD2   . ASP C 56  ? 0.3636 0.3169 0.2437 -0.0407 0.0088  0.0145  56  ASP C OD2   
4739 N  N     . THR C 57  ? 0.2185 0.2915 0.1779 -0.0469 0.0158  -0.0095 57  THR C N     
4740 C  CA    . THR C 57  ? 0.1913 0.2801 0.1920 -0.0393 0.0051  -0.0223 57  THR C CA    
4741 C  C     . THR C 57  ? 0.1822 0.2791 0.1749 -0.0521 -0.0063 -0.0024 57  THR C C     
4742 O  O     . THR C 57  ? 0.1963 0.2812 0.1876 -0.0334 0.0038  0.0053  57  THR C O     
4743 C  CB    . THR C 57  ? 0.2055 0.2764 0.2488 -0.0084 0.0036  -0.0282 57  THR C CB    
4744 O  OG1   . THR C 57  ? 0.2139 0.2829 0.2783 -0.0303 0.0025  -0.0255 57  THR C OG1   
4745 C  CG2   . THR C 57  ? 0.2166 0.2504 0.2469 0.0106  -0.0014 -0.0176 57  THR C CG2   
4746 N  N     . THR C 58  ? 0.1830 0.2867 0.1819 -0.0729 -0.0162 -0.0135 58  THR C N     
4747 C  CA    . THR C 58  ? 0.1773 0.2977 0.1749 -0.0453 -0.0265 0.0052  58  THR C CA    
4748 C  C     . THR C 58  ? 0.1775 0.2901 0.1928 -0.0360 -0.0348 0.0073  58  THR C C     
4749 O  O     . THR C 58  ? 0.2075 0.2810 0.2069 -0.0152 -0.0138 -0.0006 58  THR C O     
4750 C  CB    . THR C 58  ? 0.1955 0.3345 0.1890 -0.0436 -0.0346 0.0132  58  THR C CB    
4751 O  OG1   . THR C 58  ? 0.2269 0.3481 0.2228 -0.0323 -0.0279 0.0173  58  THR C OG1   
4752 C  CG2   . THR C 58  ? 0.2052 0.3496 0.1831 -0.0636 -0.0239 0.0004  58  THR C CG2   
4753 N  N     . THR C 59  ? 0.1764 0.3103 0.1722 -0.0531 -0.0022 0.0148  59  THR C N     
4754 C  CA    . THR C 59  ? 0.1737 0.3424 0.1711 -0.0856 0.0131  -0.0137 59  THR C CA    
4755 C  C     . THR C 59  ? 0.1634 0.3693 0.2098 -0.0599 -0.0017 -0.0174 59  THR C C     
4756 O  O     . THR C 59  ? 0.1851 0.3527 0.2023 -0.0474 -0.0146 -0.0261 59  THR C O     
4757 C  CB    . THR C 59  ? 0.2333 0.3514 0.1643 -0.0231 0.0165  -0.0103 59  THR C CB    
4758 O  OG1   . THR C 59  ? 0.2765 0.4068 0.2062 0.0057  0.02