data_5KZX
# 
_entry.id   5KZX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5KZX         
WWPDB D_1000222977 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '5KZR is human GAA in complex with DNJ'        5KZR unspecified 
PDB '5KZW is human GAA in complex with isomaltose' 5KZW unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5KZX 
_pdbx_database_status.recvd_initial_deposition_date   2016-07-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Deming, D.T.' 1 ? 
'Garman, S.C.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To be published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'The structure of human GAA: structural basis of Pompe disease' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Deming, D.T.' 1 ? 
primary 'Garman, S.C.' 2 ? 
# 
_cell.entry_id           5KZX 
_cell.length_a           97.110 
_cell.length_b           102.590 
_cell.length_c           128.550 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5KZX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Lysosomal alpha-glucosidase' 97141.812 1   3.2.1.20 ? 'UNP residues 79-952' ? 
2  branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-D-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   1 
?        ? ?                     ? 
3  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2   ? ? ? ? 
4  branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose'  586.542   1 
?        ? ?                     ? 
5  branched    man 'alpha-D-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1   ?        ? ? ? 
6  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?        ? ?                     ? 
7  non-polymer syn alpha-D-glucopyranose 180.156   2   ?        ? ?                     ? 
8  non-polymer syn beta-D-glucopyranose 180.156   2   ?        ? ?                     ? 
9  non-polymer syn 1,2-ETHANEDIOL 62.068    3   ?        ? ?                     ? 
10 non-polymer nat 'TRIETHYLENE GLYCOL' 150.173   1   ?        ? ?                     ? 
11 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   2   ?        ? ?                     ? 
12 non-polymer syn 'SULFATE ION' 96.063    3   ?        ? ?                     ? 
13 water       nat water 18.015    792 ?        ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acid maltase,Aglucosidase alfa' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPT
FFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVHRQLDGRVLLNTTVAP
LFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAM
DVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPL
DVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIG
KVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATIC
ASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLG
VPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHV
AGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPIEALGSLPPPPAAPREPAI
HSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIF
LARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPT
FFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVHRQLDGRVLLNTTVAP
LFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAM
DVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPL
DVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIG
KVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATIC
ASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLG
VPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHV
AGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPIEALGSLPPPPAAPREPAI
HSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIF
LARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         P10253 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   THR n 
1 3   GLN n 
1 4   CYS n 
1 5   ASP n 
1 6   VAL n 
1 7   PRO n 
1 8   PRO n 
1 9   ASN n 
1 10  SER n 
1 11  ARG n 
1 12  PHE n 
1 13  ASP n 
1 14  CYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ASP n 
1 18  LYS n 
1 19  ALA n 
1 20  ILE n 
1 21  THR n 
1 22  GLN n 
1 23  GLU n 
1 24  GLN n 
1 25  CYS n 
1 26  GLU n 
1 27  ALA n 
1 28  ARG n 
1 29  GLY n 
1 30  CYS n 
1 31  CYS n 
1 32  TYR n 
1 33  ILE n 
1 34  PRO n 
1 35  ALA n 
1 36  LYS n 
1 37  GLN n 
1 38  GLY n 
1 39  LEU n 
1 40  GLN n 
1 41  GLY n 
1 42  ALA n 
1 43  GLN n 
1 44  MET n 
1 45  GLY n 
1 46  GLN n 
1 47  PRO n 
1 48  TRP n 
1 49  CYS n 
1 50  PHE n 
1 51  PHE n 
1 52  PRO n 
1 53  PRO n 
1 54  SER n 
1 55  TYR n 
1 56  PRO n 
1 57  SER n 
1 58  TYR n 
1 59  LYS n 
1 60  LEU n 
1 61  GLU n 
1 62  ASN n 
1 63  LEU n 
1 64  SER n 
1 65  SER n 
1 66  SER n 
1 67  GLU n 
1 68  MET n 
1 69  GLY n 
1 70  TYR n 
1 71  THR n 
1 72  ALA n 
1 73  THR n 
1 74  LEU n 
1 75  THR n 
1 76  ARG n 
1 77  THR n 
1 78  THR n 
1 79  PRO n 
1 80  THR n 
1 81  PHE n 
1 82  PHE n 
1 83  PRO n 
1 84  LYS n 
1 85  ASP n 
1 86  ILE n 
1 87  LEU n 
1 88  THR n 
1 89  LEU n 
1 90  ARG n 
1 91  LEU n 
1 92  ASP n 
1 93  VAL n 
1 94  MET n 
1 95  MET n 
1 96  GLU n 
1 97  THR n 
1 98  GLU n 
1 99  ASN n 
1 100 ARG n 
1 101 LEU n 
1 102 HIS n 
1 103 PHE n 
1 104 THR n 
1 105 ILE n 
1 106 LYS n 
1 107 ASP n 
1 108 PRO n 
1 109 ALA n 
1 110 ASN n 
1 111 ARG n 
1 112 ARG n 
1 113 TYR n 
1 114 GLU n 
1 115 VAL n 
1 116 PRO n 
1 117 LEU n 
1 118 GLU n 
1 119 THR n 
1 120 PRO n 
1 121 HIS n 
1 122 VAL n 
1 123 HIS n 
1 124 SER n 
1 125 ARG n 
1 126 ALA n 
1 127 PRO n 
1 128 SER n 
1 129 PRO n 
1 130 LEU n 
1 131 TYR n 
1 132 SER n 
1 133 VAL n 
1 134 GLU n 
1 135 PHE n 
1 136 SER n 
1 137 GLU n 
1 138 GLU n 
1 139 PRO n 
1 140 PHE n 
1 141 GLY n 
1 142 VAL n 
1 143 ILE n 
1 144 VAL n 
1 145 HIS n 
1 146 ARG n 
1 147 GLN n 
1 148 LEU n 
1 149 ASP n 
1 150 GLY n 
1 151 ARG n 
1 152 VAL n 
1 153 LEU n 
1 154 LEU n 
1 155 ASN n 
1 156 THR n 
1 157 THR n 
1 158 VAL n 
1 159 ALA n 
1 160 PRO n 
1 161 LEU n 
1 162 PHE n 
1 163 PHE n 
1 164 ALA n 
1 165 ASP n 
1 166 GLN n 
1 167 PHE n 
1 168 LEU n 
1 169 GLN n 
1 170 LEU n 
1 171 SER n 
1 172 THR n 
1 173 SER n 
1 174 LEU n 
1 175 PRO n 
1 176 SER n 
1 177 GLN n 
1 178 TYR n 
1 179 ILE n 
1 180 THR n 
1 181 GLY n 
1 182 LEU n 
1 183 ALA n 
1 184 GLU n 
1 185 HIS n 
1 186 LEU n 
1 187 SER n 
1 188 PRO n 
1 189 LEU n 
1 190 MET n 
1 191 LEU n 
1 192 SER n 
1 193 THR n 
1 194 SER n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ILE n 
1 199 THR n 
1 200 LEU n 
1 201 TRP n 
1 202 ASN n 
1 203 ARG n 
1 204 ASP n 
1 205 LEU n 
1 206 ALA n 
1 207 PRO n 
1 208 THR n 
1 209 PRO n 
1 210 GLY n 
1 211 ALA n 
1 212 ASN n 
1 213 LEU n 
1 214 TYR n 
1 215 GLY n 
1 216 SER n 
1 217 HIS n 
1 218 PRO n 
1 219 PHE n 
1 220 TYR n 
1 221 LEU n 
1 222 ALA n 
1 223 LEU n 
1 224 GLU n 
1 225 ASP n 
1 226 GLY n 
1 227 GLY n 
1 228 SER n 
1 229 ALA n 
1 230 HIS n 
1 231 GLY n 
1 232 VAL n 
1 233 PHE n 
1 234 LEU n 
1 235 LEU n 
1 236 ASN n 
1 237 SER n 
1 238 ASN n 
1 239 ALA n 
1 240 MET n 
1 241 ASP n 
1 242 VAL n 
1 243 VAL n 
1 244 LEU n 
1 245 GLN n 
1 246 PRO n 
1 247 SER n 
1 248 PRO n 
1 249 ALA n 
1 250 LEU n 
1 251 SER n 
1 252 TRP n 
1 253 ARG n 
1 254 SER n 
1 255 THR n 
1 256 GLY n 
1 257 GLY n 
1 258 ILE n 
1 259 LEU n 
1 260 ASP n 
1 261 VAL n 
1 262 TYR n 
1 263 ILE n 
1 264 PHE n 
1 265 LEU n 
1 266 GLY n 
1 267 PRO n 
1 268 GLU n 
1 269 PRO n 
1 270 LYS n 
1 271 SER n 
1 272 VAL n 
1 273 VAL n 
1 274 GLN n 
1 275 GLN n 
1 276 TYR n 
1 277 LEU n 
1 278 ASP n 
1 279 VAL n 
1 280 VAL n 
1 281 GLY n 
1 282 TYR n 
1 283 PRO n 
1 284 PHE n 
1 285 MET n 
1 286 PRO n 
1 287 PRO n 
1 288 TYR n 
1 289 TRP n 
1 290 GLY n 
1 291 LEU n 
1 292 GLY n 
1 293 PHE n 
1 294 HIS n 
1 295 LEU n 
1 296 CYS n 
1 297 ARG n 
1 298 TRP n 
1 299 GLY n 
1 300 TYR n 
1 301 SER n 
1 302 SER n 
1 303 THR n 
1 304 ALA n 
1 305 ILE n 
1 306 THR n 
1 307 ARG n 
1 308 GLN n 
1 309 VAL n 
1 310 VAL n 
1 311 GLU n 
1 312 ASN n 
1 313 MET n 
1 314 THR n 
1 315 ARG n 
1 316 ALA n 
1 317 HIS n 
1 318 PHE n 
1 319 PRO n 
1 320 LEU n 
1 321 ASP n 
1 322 VAL n 
1 323 GLN n 
1 324 TRP n 
1 325 ASN n 
1 326 ASP n 
1 327 LEU n 
1 328 ASP n 
1 329 TYR n 
1 330 MET n 
1 331 ASP n 
1 332 SER n 
1 333 ARG n 
1 334 ARG n 
1 335 ASP n 
1 336 PHE n 
1 337 THR n 
1 338 PHE n 
1 339 ASN n 
1 340 LYS n 
1 341 ASP n 
1 342 GLY n 
1 343 PHE n 
1 344 ARG n 
1 345 ASP n 
1 346 PHE n 
1 347 PRO n 
1 348 ALA n 
1 349 MET n 
1 350 VAL n 
1 351 GLN n 
1 352 GLU n 
1 353 LEU n 
1 354 HIS n 
1 355 GLN n 
1 356 GLY n 
1 357 GLY n 
1 358 ARG n 
1 359 ARG n 
1 360 TYR n 
1 361 MET n 
1 362 MET n 
1 363 ILE n 
1 364 VAL n 
1 365 ASP n 
1 366 PRO n 
1 367 ALA n 
1 368 ILE n 
1 369 SER n 
1 370 SER n 
1 371 SER n 
1 372 GLY n 
1 373 PRO n 
1 374 ALA n 
1 375 GLY n 
1 376 SER n 
1 377 TYR n 
1 378 ARG n 
1 379 PRO n 
1 380 TYR n 
1 381 ASP n 
1 382 GLU n 
1 383 GLY n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 GLY n 
1 388 VAL n 
1 389 PHE n 
1 390 ILE n 
1 391 THR n 
1 392 ASN n 
1 393 GLU n 
1 394 THR n 
1 395 GLY n 
1 396 GLN n 
1 397 PRO n 
1 398 LEU n 
1 399 ILE n 
1 400 GLY n 
1 401 LYS n 
1 402 VAL n 
1 403 TRP n 
1 404 PRO n 
1 405 GLY n 
1 406 SER n 
1 407 THR n 
1 408 ALA n 
1 409 PHE n 
1 410 PRO n 
1 411 ASP n 
1 412 PHE n 
1 413 THR n 
1 414 ASN n 
1 415 PRO n 
1 416 THR n 
1 417 ALA n 
1 418 LEU n 
1 419 ALA n 
1 420 TRP n 
1 421 TRP n 
1 422 GLU n 
1 423 ASP n 
1 424 MET n 
1 425 VAL n 
1 426 ALA n 
1 427 GLU n 
1 428 PHE n 
1 429 HIS n 
1 430 ASP n 
1 431 GLN n 
1 432 VAL n 
1 433 PRO n 
1 434 PHE n 
1 435 ASP n 
1 436 GLY n 
1 437 MET n 
1 438 TRP n 
1 439 ILE n 
1 440 ASP n 
1 441 MET n 
1 442 ASN n 
1 443 GLU n 
1 444 PRO n 
1 445 SER n 
1 446 ASN n 
1 447 PHE n 
1 448 ILE n 
1 449 ARG n 
1 450 GLY n 
1 451 SER n 
1 452 GLU n 
1 453 ASP n 
1 454 GLY n 
1 455 CYS n 
1 456 PRO n 
1 457 ASN n 
1 458 ASN n 
1 459 GLU n 
1 460 LEU n 
1 461 GLU n 
1 462 ASN n 
1 463 PRO n 
1 464 PRO n 
1 465 TYR n 
1 466 VAL n 
1 467 PRO n 
1 468 GLY n 
1 469 VAL n 
1 470 VAL n 
1 471 GLY n 
1 472 GLY n 
1 473 THR n 
1 474 LEU n 
1 475 GLN n 
1 476 ALA n 
1 477 ALA n 
1 478 THR n 
1 479 ILE n 
1 480 CYS n 
1 481 ALA n 
1 482 SER n 
1 483 SER n 
1 484 HIS n 
1 485 GLN n 
1 486 PHE n 
1 487 LEU n 
1 488 SER n 
1 489 THR n 
1 490 HIS n 
1 491 TYR n 
1 492 ASN n 
1 493 LEU n 
1 494 HIS n 
1 495 ASN n 
1 496 LEU n 
1 497 TYR n 
1 498 GLY n 
1 499 LEU n 
1 500 THR n 
1 501 GLU n 
1 502 ALA n 
1 503 ILE n 
1 504 ALA n 
1 505 SER n 
1 506 HIS n 
1 507 ARG n 
1 508 ALA n 
1 509 LEU n 
1 510 VAL n 
1 511 LYS n 
1 512 ALA n 
1 513 ARG n 
1 514 GLY n 
1 515 THR n 
1 516 ARG n 
1 517 PRO n 
1 518 PHE n 
1 519 VAL n 
1 520 ILE n 
1 521 SER n 
1 522 ARG n 
1 523 SER n 
1 524 THR n 
1 525 PHE n 
1 526 ALA n 
1 527 GLY n 
1 528 HIS n 
1 529 GLY n 
1 530 ARG n 
1 531 TYR n 
1 532 ALA n 
1 533 GLY n 
1 534 HIS n 
1 535 TRP n 
1 536 THR n 
1 537 GLY n 
1 538 ASP n 
1 539 VAL n 
1 540 TRP n 
1 541 SER n 
1 542 SER n 
1 543 TRP n 
1 544 GLU n 
1 545 GLN n 
1 546 LEU n 
1 547 ALA n 
1 548 SER n 
1 549 SER n 
1 550 VAL n 
1 551 PRO n 
1 552 GLU n 
1 553 ILE n 
1 554 LEU n 
1 555 GLN n 
1 556 PHE n 
1 557 ASN n 
1 558 LEU n 
1 559 LEU n 
1 560 GLY n 
1 561 VAL n 
1 562 PRO n 
1 563 LEU n 
1 564 VAL n 
1 565 GLY n 
1 566 ALA n 
1 567 ASP n 
1 568 VAL n 
1 569 CYS n 
1 570 GLY n 
1 571 PHE n 
1 572 LEU n 
1 573 GLY n 
1 574 ASN n 
1 575 THR n 
1 576 SER n 
1 577 GLU n 
1 578 GLU n 
1 579 LEU n 
1 580 CYS n 
1 581 VAL n 
1 582 ARG n 
1 583 TRP n 
1 584 THR n 
1 585 GLN n 
1 586 LEU n 
1 587 GLY n 
1 588 ALA n 
1 589 PHE n 
1 590 TYR n 
1 591 PRO n 
1 592 PHE n 
1 593 MET n 
1 594 ARG n 
1 595 ASN n 
1 596 HIS n 
1 597 ASN n 
1 598 SER n 
1 599 LEU n 
1 600 LEU n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 GLN n 
1 605 GLU n 
1 606 PRO n 
1 607 TYR n 
1 608 SER n 
1 609 PHE n 
1 610 SER n 
1 611 GLU n 
1 612 PRO n 
1 613 ALA n 
1 614 GLN n 
1 615 GLN n 
1 616 ALA n 
1 617 MET n 
1 618 ARG n 
1 619 LYS n 
1 620 ALA n 
1 621 LEU n 
1 622 THR n 
1 623 LEU n 
1 624 ARG n 
1 625 TYR n 
1 626 ALA n 
1 627 LEU n 
1 628 LEU n 
1 629 PRO n 
1 630 HIS n 
1 631 LEU n 
1 632 TYR n 
1 633 THR n 
1 634 LEU n 
1 635 PHE n 
1 636 HIS n 
1 637 GLN n 
1 638 ALA n 
1 639 HIS n 
1 640 VAL n 
1 641 ALA n 
1 642 GLY n 
1 643 GLU n 
1 644 THR n 
1 645 VAL n 
1 646 ALA n 
1 647 ARG n 
1 648 PRO n 
1 649 LEU n 
1 650 PHE n 
1 651 LEU n 
1 652 GLU n 
1 653 PHE n 
1 654 PRO n 
1 655 LYS n 
1 656 ASP n 
1 657 SER n 
1 658 SER n 
1 659 THR n 
1 660 TRP n 
1 661 THR n 
1 662 VAL n 
1 663 ASP n 
1 664 HIS n 
1 665 GLN n 
1 666 LEU n 
1 667 LEU n 
1 668 TRP n 
1 669 GLY n 
1 670 GLU n 
1 671 ALA n 
1 672 LEU n 
1 673 LEU n 
1 674 ILE n 
1 675 THR n 
1 676 PRO n 
1 677 VAL n 
1 678 LEU n 
1 679 GLN n 
1 680 ALA n 
1 681 GLY n 
1 682 LYS n 
1 683 ALA n 
1 684 GLU n 
1 685 VAL n 
1 686 THR n 
1 687 GLY n 
1 688 TYR n 
1 689 PHE n 
1 690 PRO n 
1 691 LEU n 
1 692 GLY n 
1 693 THR n 
1 694 TRP n 
1 695 TYR n 
1 696 ASP n 
1 697 LEU n 
1 698 GLN n 
1 699 THR n 
1 700 VAL n 
1 701 PRO n 
1 702 ILE n 
1 703 GLU n 
1 704 ALA n 
1 705 LEU n 
1 706 GLY n 
1 707 SER n 
1 708 LEU n 
1 709 PRO n 
1 710 PRO n 
1 711 PRO n 
1 712 PRO n 
1 713 ALA n 
1 714 ALA n 
1 715 PRO n 
1 716 ARG n 
1 717 GLU n 
1 718 PRO n 
1 719 ALA n 
1 720 ILE n 
1 721 HIS n 
1 722 SER n 
1 723 GLU n 
1 724 GLY n 
1 725 GLN n 
1 726 TRP n 
1 727 VAL n 
1 728 THR n 
1 729 LEU n 
1 730 PRO n 
1 731 ALA n 
1 732 PRO n 
1 733 LEU n 
1 734 ASP n 
1 735 THR n 
1 736 ILE n 
1 737 ASN n 
1 738 VAL n 
1 739 HIS n 
1 740 LEU n 
1 741 ARG n 
1 742 ALA n 
1 743 GLY n 
1 744 TYR n 
1 745 ILE n 
1 746 ILE n 
1 747 PRO n 
1 748 LEU n 
1 749 GLN n 
1 750 GLY n 
1 751 PRO n 
1 752 GLY n 
1 753 LEU n 
1 754 THR n 
1 755 THR n 
1 756 THR n 
1 757 GLU n 
1 758 SER n 
1 759 ARG n 
1 760 GLN n 
1 761 GLN n 
1 762 PRO n 
1 763 MET n 
1 764 ALA n 
1 765 LEU n 
1 766 ALA n 
1 767 VAL n 
1 768 ALA n 
1 769 LEU n 
1 770 THR n 
1 771 LYS n 
1 772 GLY n 
1 773 GLY n 
1 774 GLU n 
1 775 ALA n 
1 776 ARG n 
1 777 GLY n 
1 778 GLU n 
1 779 LEU n 
1 780 PHE n 
1 781 TRP n 
1 782 ASP n 
1 783 ASP n 
1 784 GLY n 
1 785 GLU n 
1 786 SER n 
1 787 LEU n 
1 788 GLU n 
1 789 VAL n 
1 790 LEU n 
1 791 GLU n 
1 792 ARG n 
1 793 GLY n 
1 794 ALA n 
1 795 TYR n 
1 796 THR n 
1 797 GLN n 
1 798 VAL n 
1 799 ILE n 
1 800 PHE n 
1 801 LEU n 
1 802 ALA n 
1 803 ARG n 
1 804 ASN n 
1 805 ASN n 
1 806 THR n 
1 807 ILE n 
1 808 VAL n 
1 809 ASN n 
1 810 GLU n 
1 811 LEU n 
1 812 VAL n 
1 813 ARG n 
1 814 VAL n 
1 815 THR n 
1 816 SER n 
1 817 GLU n 
1 818 GLY n 
1 819 ALA n 
1 820 GLY n 
1 821 LEU n 
1 822 GLN n 
1 823 LEU n 
1 824 GLN n 
1 825 LYS n 
1 826 VAL n 
1 827 THR n 
1 828 VAL n 
1 829 LEU n 
1 830 GLY n 
1 831 VAL n 
1 832 ALA n 
1 833 THR n 
1 834 ALA n 
1 835 PRO n 
1 836 GLN n 
1 837 GLN n 
1 838 VAL n 
1 839 LEU n 
1 840 SER n 
1 841 ASN n 
1 842 GLY n 
1 843 VAL n 
1 844 PRO n 
1 845 VAL n 
1 846 SER n 
1 847 ASN n 
1 848 PHE n 
1 849 THR n 
1 850 TYR n 
1 851 SER n 
1 852 PRO n 
1 853 ASP n 
1 854 THR n 
1 855 LYS n 
1 856 VAL n 
1 857 LEU n 
1 858 ASP n 
1 859 ILE n 
1 860 CYS n 
1 861 VAL n 
1 862 SER n 
1 863 LEU n 
1 864 LEU n 
1 865 MET n 
1 866 GLY n 
1 867 GLU n 
1 868 GLN n 
1 869 PHE n 
1 870 LEU n 
1 871 VAL n 
1 872 SER n 
1 873 TRP n 
1 874 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   874 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GAA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'CHO cells' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LYAG_HUMAN 
_struct_ref.pdbx_db_accession          P10253 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPT
FFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAP
LFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAM
DVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPL
DVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIG
KVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATIC
ASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLG
VPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHV
AGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAI
HSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIF
LARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
;
_struct_ref.pdbx_align_begin           79 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5KZX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 874 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10253 
_struct_ref_seq.db_align_beg                  79 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  952 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       79 
_struct_ref_seq.pdbx_auth_seq_align_end       952 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5KZX HIS A 145 ? UNP P10253 ARG 223 conflict 223 1 
1 5KZX ILE A 702 ? UNP P10253 VAL 780 conflict 780 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                 'C4 H7 N O4'     133.103 
BGC 'D-saccharide, beta linking'  . beta-D-glucopyranose                     ?                 'C6 H12 O6'      180.156 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ?                 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer                   . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
FCA 'D-saccharide, alpha linking' . alpha-D-fucopyranose                     ?                 'C6 H12 O5'      164.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                    ?                 'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ?                 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ?                 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                 'C8 H15 N O6'    221.208 
PEG non-polymer                   . 'DI(HYDROXYETHYL)ETHER'                  ?                 'C4 H10 O3'      106.120 
PGE non-polymer                   . 'TRIETHYLENE GLYCOL'                     ?                 'C6 H14 O4'      150.173 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                            ?                 'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                                ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5KZX 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.38 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.57 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.690 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 sodium HEPES, 2% (v/v) PEG 400, 2M ammonium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      'Toroidal focusing mirror' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 325 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI(111) Double crystal' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.18076 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL14-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.18076 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL14-1 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5KZX 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             80.310 
_reflns.d_resolution_high            1.900 
_reflns.number_obs                   90718 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.2 
_reflns.pdbx_Rmerge_I_obs            0.09100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.9000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   47.8 
_reflns_shell.Rmerge_I_obs           0.36300 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        7.10 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5KZX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     69337 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             80.31 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    83.5 
_refine.ls_R_factor_obs                          0.156 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.154 
_refine.ls_R_factor_R_free                       0.185 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  3547 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.948 
_refine.B_iso_mean                               25.23 
_refine.aniso_B[1][1]                            0.09000 
_refine.aniso_B[2][2]                            -0.10000 
_refine.aniso_B[3][3]                            0.01000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING' 
_refine.pdbx_starting_model                      5KZR 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.151 
_refine.pdbx_overall_ESU_R_Free                  0.134 
_refine.overall_SU_ML                            0.081 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.697 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6690 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         269 
_refine_hist.number_atoms_solvent             792 
_refine_hist.number_atoms_total               7751 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        80.31 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.019  ? 7231  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 6608  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.469  1.989  ? 9897  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.916  3.000  ? 15259 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.914  5.000  ? 864   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.793 23.542 ? 319   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.501 15.000 ? 1051  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.200 15.000 ? 44    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.084  0.200  ? 1120  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 7999  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1671  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.730  6.878  ? 3414  'X-RAY DIFFRACTION' ? 
r_mcbond_other               2.729  6.877  ? 3413  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.577  10.226 ? 4265  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             5701 
_refine_ls_shell.R_factor_R_work                  0.2080 
_refine_ls_shell.percent_reflns_obs               92.77 
_refine_ls_shell.R_factor_R_free                  0.2490 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             269 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                     5KZX 
_struct.title                        'Crystal structure of human GAA' 
_struct.pdbx_descriptor              'Lysosomal alpha-glucosidase (E.C.3.2.1.20)' 
_struct.pdbx_model_details           'Complex with DNJ' 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5KZX 
_struct_keywords.text            
;Pompe disease, Glycogen storage disease 2, human acid alpha glucosidase, glycoprotein, N-linked glycosylation, lysosomal enzyme, HYDROLASE
;
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 7  ? 
K N N 8  ? 
L N N 9  ? 
M N N 9  ? 
N N N 10 ? 
O N N 11 ? 
P N N 12 ? 
Q N N 12 ? 
R N N 11 ? 
S N N 12 ? 
T N N 9  ? 
U N N 13 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 1   ? ASP A 5   ? PRO A 79  ASP A 83  5 ? 5  
HELX_P HELX_P2  AA2 PRO A 7   ? ARG A 11  ? PRO A 85  ARG A 89  5 ? 5  
HELX_P HELX_P3  AA3 THR A 21  ? ARG A 28  ? THR A 99  ARG A 106 1 ? 8  
HELX_P HELX_P4  AA4 THR A 157 ? ALA A 159 ? THR A 235 ALA A 237 5 ? 3  
HELX_P HELX_P5  AA5 GLU A 268 ? GLY A 281 ? GLU A 346 GLY A 359 1 ? 14 
HELX_P HELX_P6  AA6 PRO A 287 ? GLY A 292 ? PRO A 365 GLY A 370 5 ? 6  
HELX_P HELX_P7  AA7 SER A 302 ? ALA A 316 ? SER A 380 ALA A 394 1 ? 15 
HELX_P HELX_P8  AA8 ASP A 326 ? MET A 330 ? ASP A 404 MET A 408 5 ? 5  
HELX_P HELX_P9  AA9 ASP A 345 ? GLY A 356 ? ASP A 423 GLY A 434 1 ? 12 
HELX_P HELX_P10 AB1 TYR A 377 ? GLY A 387 ? TYR A 455 GLY A 465 1 ? 11 
HELX_P HELX_P11 AB2 ASN A 414 ? VAL A 432 ? ASN A 492 VAL A 510 1 ? 19 
HELX_P HELX_P12 AB3 THR A 489 ? HIS A 494 ? THR A 567 HIS A 572 1 ? 6  
HELX_P HELX_P13 AB4 LEU A 496 ? GLY A 514 ? LEU A 574 GLY A 592 1 ? 19 
HELX_P HELX_P14 AB5 GLY A 527 ? TYR A 531 ? GLY A 605 TYR A 609 5 ? 5  
HELX_P HELX_P15 AB6 SER A 542 ? LEU A 559 ? SER A 620 LEU A 637 1 ? 18 
HELX_P HELX_P16 AB7 SER A 576 ? ALA A 588 ? SER A 654 ALA A 666 1 ? 13 
HELX_P HELX_P17 AB8 GLU A 605 ? PHE A 609 ? GLU A 683 PHE A 687 5 ? 5  
HELX_P HELX_P18 AB9 SER A 610 ? GLY A 642 ? SER A 688 GLY A 720 1 ? 33 
HELX_P HELX_P19 AC1 PRO A 648 ? PHE A 653 ? PRO A 726 PHE A 731 1 ? 6  
HELX_P HELX_P20 AC2 ASP A 656 ? TRP A 660 ? ASP A 734 TRP A 738 5 ? 5  
HELX_P HELX_P21 AC3 GLN A 698 ? VAL A 700 ? GLN A 776 VAL A 778 5 ? 3  
HELX_P HELX_P22 AC4 THR A 754 ? ARG A 759 ? THR A 832 ARG A 837 1 ? 6  
HELX_P HELX_P23 AC5 GLU A 788 ? GLY A 793 ? GLU A 866 GLY A 871 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 4   SG  ? ? ? 1_555 A CYS 31  SG ? ? A CYS 82  A CYS 109  1_555 ? ? ? ? ? ? ? 2.080 ? ?               
disulf2  disulf ?    ? A CYS 14  SG  ? ? ? 1_555 A CYS 30  SG ? ? A CYS 92  A CYS 108  1_555 ? ? ? ? ? ? ? 1.994 ? ?               
disulf3  disulf ?    ? A CYS 25  SG  ? ? ? 1_555 A CYS 49  SG ? ? A CYS 103 A CYS 127  1_555 ? ? ? ? ? ? ? 2.121 ? ?               
disulf4  disulf ?    ? A CYS 455 SG  ? ? ? 1_555 A CYS 480 SG ? ? A CYS 533 A CYS 558  1_555 ? ? ? ? ? ? ? 2.119 ? ?               
disulf5  disulf ?    ? A CYS 569 SG  ? ? ? 1_555 A CYS 580 SG ? ? A CYS 647 A CYS 658  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
covale1  covale one  ? A ASN 62  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 140 B NAG 1    1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale2  covale one  ? A ASN 155 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 233 C NAG 1    1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale3  covale one  ? A ASN 312 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 390 D NAG 1    1_555 ? ? ? ? ? ? ? 1.430 ? N-Glycosylation 
covale4  covale one  ? A ASN 392 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 470 E NAG 1    1_555 ? ? ? ? ? ? ? 1.436 ? N-Glycosylation 
covale5  covale one  ? A ASN 574 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 652 F NAG 1    1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale6  covale one  ? A ASN 804 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 882 A NAG 1013 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale7  covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ?               
covale8  covale both ? B NAG .   O6  ? ? ? 1_555 B FCA .   C1 ? ? B NAG 1   B FCA 3    1_555 ? ? ? ? ? ? ? 1.442 ? ?               
covale9  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2    1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale10 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2    1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale11 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2    1_555 ? ? ? ? ? ? ? 1.429 ? ?               
covale12 covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? E NAG 2   E BMA 3    1_555 ? ? ? ? ? ? ? 1.443 ? ?               
covale13 covale both ? F NAG .   O6  ? ? ? 1_555 F FCA .   C1 ? ? F NAG 1   F FCA 2    1_555 ? ? ? ? ? ? ? 1.446 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 138 A . ? GLU 216 A PRO 139 A ? PRO 217 A 1 -1.11 
2 ALA 183 A . ? ALA 261 A GLU 184 A ? GLU 262 A 1 2.67  
3 SER 247 A . ? SER 325 A PRO 248 A ? PRO 326 A 1 1.91  
4 GLY 266 A . ? GLY 344 A PRO 267 A ? PRO 345 A 1 6.47  
5 GLU 443 A . ? GLU 521 A PRO 444 A ? PRO 522 A 1 -0.81 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2  ? 
AA2 ? 8  ? 
AA3 ? 3  ? 
AA4 ? 5  ? 
AA5 ? 8  ? 
AA6 ? 3  ? 
AA7 ? 6  ? 
AA8 ? 2  ? 
AA9 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? anti-parallel 
AA2 6  7  ? anti-parallel 
AA2 7  8  ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA4 4  5  ? anti-parallel 
AA5 1  2  ? parallel      
AA5 2  3  ? parallel      
AA5 3  4  ? parallel      
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? anti-parallel 
AA7 4  5  ? anti-parallel 
AA7 5  6  ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AA9 2  3  ? anti-parallel 
AA9 3  4  ? anti-parallel 
AA9 4  5  ? anti-parallel 
AA9 5  6  ? anti-parallel 
AA9 6  7  ? parallel      
AA9 7  8  ? anti-parallel 
AA9 8  9  ? parallel      
AA9 9  10 ? anti-parallel 
AA9 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  CYS A 31  ? TYR A 32  ? CYS A 109 TYR A 110 
AA1 2  CYS A 49  ? PHE A 50  ? CYS A 127 PHE A 128 
AA2 1  LYS A 59  ? SER A 65  ? LYS A 137 SER A 143 
AA2 2  GLY A 69  ? THR A 75  ? GLY A 147 THR A 153 
AA2 3  THR A 88  ? MET A 95  ? THR A 166 MET A 173 
AA2 4  ARG A 100 ? LYS A 106 ? ARG A 178 LYS A 184 
AA2 5  LEU A 259 ? PHE A 264 ? LEU A 337 PHE A 342 
AA2 6  ALA A 229 ? LEU A 234 ? ALA A 307 LEU A 312 
AA2 7  PHE A 219 ? LEU A 223 ? PHE A 297 LEU A 301 
AA2 8  ILE A 179 ? GLY A 181 ? ILE A 257 GLY A 259 
AA3 1  TYR A 131 ? SER A 136 ? TYR A 209 SER A 214 
AA3 2  GLY A 141 ? ARG A 146 ? GLY A 219 ARG A 224 
AA3 3  VAL A 152 ? ASN A 155 ? VAL A 230 ASN A 233 
AA4 1  PHE A 162 ? ALA A 164 ? PHE A 240 ALA A 242 
AA4 2  PHE A 167 ? SER A 173 ? PHE A 245 SER A 251 
AA4 3  ALA A 249 ? SER A 254 ? ALA A 327 SER A 332 
AA4 4  MET A 240 ? GLN A 245 ? MET A 318 GLN A 323 
AA4 5  THR A 196 ? LEU A 200 ? THR A 274 LEU A 278 
AA5 1  VAL A 564 ? GLY A 565 ? VAL A 642 GLY A 643 
AA5 2  GLY A 533 ? TRP A 535 ? GLY A 611 TRP A 613 
AA5 3  VAL A 519 ? SER A 521 ? VAL A 597 SER A 599 
AA5 4  MET A 437 ? ILE A 439 ? MET A 515 ILE A 517 
AA5 5  ARG A 359 ? VAL A 364 ? ARG A 437 VAL A 442 
AA5 6  VAL A 322 ? ASN A 325 ? VAL A 400 ASN A 403 
AA5 7  HIS A 294 ? LEU A 295 ? HIS A 372 LEU A 373 
AA5 8  ARG A 594 ? ASN A 595 ? ARG A 672 ASN A 673 
AA6 1  ILE A 368 ? SER A 369 ? ILE A 446 SER A 447 
AA6 2  GLY A 405 ? ALA A 408 ? GLY A 483 ALA A 486 
AA6 3  ILE A 399 ? VAL A 402 ? ILE A 477 VAL A 480 
AA7 1  ALA A 646 ? ARG A 647 ? ALA A 724 ARG A 725 
AA7 2  LEU A 666 ? TRP A 668 ? LEU A 744 TRP A 746 
AA7 3  LEU A 672 ? THR A 675 ? LEU A 750 THR A 753 
AA7 4  ASN A 737 ? ARG A 741 ? ASN A 815 ARG A 819 
AA7 5  GLY A 692 ? ASP A 696 ? GLY A 770 ASP A 774 
AA7 6  ALA A 719 ? SER A 722 ? ALA A 797 SER A 800 
AA8 1  GLU A 684 ? PHE A 689 ? GLU A 762 PHE A 767 
AA8 2  GLN A 725 ? PRO A 730 ? GLN A 803 PRO A 808 
AA9 1  VAL A 843 ? PRO A 844 ? VAL A 921 PRO A 922 
AA9 2  VAL A 838 ? SER A 840 ? VAL A 916 SER A 918 
AA9 3  LEU A 870 ? TRP A 873 ? LEU A 948 TRP A 951 
AA9 4  THR A 806 ? ARG A 813 ? THR A 884 ARG A 891 
AA9 5  THR A 796 ? ARG A 803 ? THR A 874 ARG A 881 
AA9 6  ALA A 775 ? TRP A 781 ? ALA A 853 TRP A 859 
AA9 7  TYR A 744 ? GLN A 749 ? TYR A 822 GLN A 827 
AA9 8  MET A 763 ? ALA A 768 ? MET A 841 ALA A 846 
AA9 9  GLN A 822 ? LEU A 829 ? GLN A 900 LEU A 907 
AA9 10 VAL A 856 ? LEU A 864 ? VAL A 934 LEU A 942 
AA9 11 ASN A 847 ? SER A 851 ? ASN A 925 SER A 929 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N CYS A 31  ? N CYS A 109 O PHE A 50  ? O PHE A 128 
AA2 1  2  N GLU A 61  ? N GLU A 139 O THR A 73  ? O THR A 151 
AA2 2  3  N LEU A 74  ? N LEU A 152 O LEU A 89  ? O LEU A 167 
AA2 3  4  N MET A 94  ? N MET A 172 O HIS A 102 ? O HIS A 180 
AA2 4  5  N PHE A 103 ? N PHE A 181 O VAL A 261 ? O VAL A 339 
AA2 5  6  O PHE A 264 ? O PHE A 342 N GLY A 231 ? N GLY A 309 
AA2 6  7  O HIS A 230 ? O HIS A 308 N ALA A 222 ? N ALA A 300 
AA2 7  8  O LEU A 221 ? O LEU A 299 N THR A 180 ? N THR A 258 
AA3 1  2  N GLU A 134 ? N GLU A 212 O ILE A 143 ? O ILE A 221 
AA3 2  3  N VAL A 144 ? N VAL A 222 O LEU A 153 ? O LEU A 231 
AA4 1  2  N ALA A 164 ? N ALA A 242 O PHE A 167 ? O PHE A 245 
AA4 2  3  N LEU A 170 ? N LEU A 248 O TRP A 252 ? O TRP A 330 
AA4 3  4  O ARG A 253 ? O ARG A 331 N ASP A 241 ? N ASP A 319 
AA4 4  5  O MET A 240 ? O MET A 318 N LEU A 200 ? N LEU A 278 
AA5 1  2  O GLY A 565 ? O GLY A 643 N HIS A 534 ? N HIS A 612 
AA5 2  3  O GLY A 533 ? O GLY A 611 N VAL A 519 ? N VAL A 597 
AA5 3  4  O ILE A 520 ? O ILE A 598 N ILE A 439 ? N ILE A 517 
AA5 4  5  O TRP A 438 ? O TRP A 516 N VAL A 364 ? N VAL A 442 
AA5 5  6  O ARG A 359 ? O ARG A 437 N GLN A 323 ? N GLN A 401 
AA5 6  7  O TRP A 324 ? O TRP A 402 N LEU A 295 ? N LEU A 373 
AA5 7  8  N HIS A 294 ? N HIS A 372 O ASN A 595 ? O ASN A 673 
AA6 1  2  N ILE A 368 ? N ILE A 446 O ALA A 408 ? O ALA A 486 
AA6 2  3  O THR A 407 ? O THR A 485 N GLY A 400 ? N GLY A 478 
AA7 1  2  N ARG A 647 ? N ARG A 725 O LEU A 667 ? O LEU A 745 
AA7 2  3  N LEU A 666 ? N LEU A 744 O ILE A 674 ? O ILE A 752 
AA7 3  4  N LEU A 673 ? N LEU A 751 O HIS A 739 ? O HIS A 817 
AA7 4  5  O LEU A 740 ? O LEU A 818 N TYR A 695 ? N TYR A 773 
AA7 5  6  N TRP A 694 ? N TRP A 772 O ILE A 720 ? O ILE A 798 
AA8 1  2  N VAL A 685 ? N VAL A 763 O LEU A 729 ? O LEU A 807 
AA9 1  2  O VAL A 843 ? O VAL A 921 N SER A 840 ? N SER A 918 
AA9 2  3  N LEU A 839 ? N LEU A 917 O SER A 872 ? O SER A 950 
AA9 3  4  O VAL A 871 ? O VAL A 949 N ILE A 807 ? N ILE A 885 
AA9 4  5  O GLU A 810 ? O GLU A 888 N ILE A 799 ? N ILE A 877 
AA9 5  6  O THR A 796 ? O THR A 874 N TRP A 781 ? N TRP A 859 
AA9 6  7  O ARG A 776 ? O ARG A 854 N ILE A 745 ? N ILE A 823 
AA9 7  8  N LEU A 748 ? N LEU A 826 O ALA A 764 ? O ALA A 842 
AA9 8  9  N MET A 763 ? N MET A 841 O GLN A 822 ? O GLN A 900 
AA9 9  10 N VAL A 828 ? N VAL A 906 O LEU A 857 ? O LEU A 935 
AA9 10 11 O ASP A 858 ? O ASP A 936 N THR A 849 ? N THR A 927 
# 
_atom_sites.entry_id                    5KZX 
_atom_sites.fract_transf_matrix[1][1]   0.010298 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009748 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007779 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1  1   ? 13.319  12.612  5.010   1.00 84.60  ? 79   PRO A N   1 
ATOM   2    C CA  . PRO A 1  1   ? 13.550  11.771  6.194   1.00 83.17  ? 79   PRO A CA  1 
ATOM   3    C C   . PRO A 1  1   ? 14.582  10.645  5.972   1.00 78.26  ? 79   PRO A C   1 
ATOM   4    O O   . PRO A 1  1   ? 14.718  10.154  4.844   1.00 69.86  ? 79   PRO A O   1 
ATOM   5    C CB  . PRO A 1  1   ? 12.157  11.192  6.480   1.00 77.53  ? 79   PRO A CB  1 
ATOM   6    C CG  . PRO A 1  1   ? 11.204  12.212  5.945   1.00 70.05  ? 79   PRO A CG  1 
ATOM   7    C CD  . PRO A 1  1   ? 11.887  12.888  4.786   1.00 70.37  ? 79   PRO A CD  1 
ATOM   8    N N   . THR A 1  2   ? 15.284  10.253  7.043   1.00 85.15  ? 80   THR A N   1 
ATOM   9    C CA  . THR A 1  2   ? 16.309  9.174   7.027   1.00 92.21  ? 80   THR A CA  1 
ATOM   10   C C   . THR A 1  2   ? 15.788  7.858   6.443   1.00 73.76  ? 80   THR A C   1 
ATOM   11   O O   . THR A 1  2   ? 16.386  7.276   5.523   1.00 55.15  ? 80   THR A O   1 
ATOM   12   C CB  . THR A 1  2   ? 16.822  8.856   8.462   1.00 107.22 ? 80   THR A CB  1 
ATOM   13   O OG1 . THR A 1  2   ? 17.285  10.056  9.094   1.00 139.84 ? 80   THR A OG1 1 
ATOM   14   C CG2 . THR A 1  2   ? 17.956  7.806   8.445   1.00 103.71 ? 80   THR A CG2 1 
ATOM   15   N N   . GLN A 1  3   ? 14.666  7.407   7.002   1.00 61.23  ? 81   GLN A N   1 
ATOM   16   C CA  . GLN A 1  3   ? 14.040  6.154   6.605   1.00 59.22  ? 81   GLN A CA  1 
ATOM   17   C C   . GLN A 1  3   ? 13.499  6.186   5.156   1.00 47.21  ? 81   GLN A C   1 
ATOM   18   O O   . GLN A 1  3   ? 13.347  5.134   4.550   1.00 47.27  ? 81   GLN A O   1 
ATOM   19   C CB  . GLN A 1  3   ? 12.967  5.711   7.630   1.00 63.90  ? 81   GLN A CB  1 
ATOM   20   C CG  . GLN A 1  3   ? 11.567  6.326   7.514   1.00 69.25  ? 81   GLN A CG  1 
ATOM   21   C CD  . GLN A 1  3   ? 11.440  7.723   8.093   1.00 83.82  ? 81   GLN A CD  1 
ATOM   22   O OE1 . GLN A 1  3   ? 12.415  8.471   8.184   1.00 105.62 ? 81   GLN A OE1 1 
ATOM   23   N NE2 . GLN A 1  3   ? 10.224  8.088   8.476   1.00 74.63  ? 81   GLN A NE2 1 
ATOM   24   N N   . CYS A 1  4   ? 13.256  7.376   4.597   1.00 35.21  ? 82   CYS A N   1 
ATOM   25   C CA  . CYS A 1  4   ? 12.789  7.511   3.200   1.00 33.14  ? 82   CYS A CA  1 
ATOM   26   C C   . CYS A 1  4   ? 13.873  7.508   2.133   1.00 35.18  ? 82   CYS A C   1 
ATOM   27   O O   . CYS A 1  4   ? 13.571  7.664   0.937   1.00 34.48  ? 82   CYS A O   1 
ATOM   28   C CB  . CYS A 1  4   ? 11.877  8.730   3.066   1.00 30.97  ? 82   CYS A CB  1 
ATOM   29   S SG  . CYS A 1  4   ? 10.369  8.538   4.048   1.00 33.85  ? 82   CYS A SG  1 
ATOM   30   N N   . ASP A 1  5   ? 15.118  7.301   2.556   1.00 36.68  ? 83   ASP A N   1 
ATOM   31   C CA  . ASP A 1  5   ? 16.265  7.216   1.660   1.00 41.05  ? 83   ASP A CA  1 
ATOM   32   C C   . ASP A 1  5   ? 16.365  5.799   1.085   1.00 43.09  ? 83   ASP A C   1 
ATOM   33   O O   . ASP A 1  5   ? 17.245  5.024   1.447   1.00 52.03  ? 83   ASP A O   1 
ATOM   34   C CB  . ASP A 1  5   ? 17.543  7.620   2.427   1.00 49.55  ? 83   ASP A CB  1 
ATOM   35   C CG  . ASP A 1  5   ? 18.783  7.685   1.547   1.00 61.98  ? 83   ASP A CG  1 
ATOM   36   O OD1 . ASP A 1  5   ? 18.671  7.864   0.308   1.00 67.62  ? 83   ASP A OD1 1 
ATOM   37   O OD2 . ASP A 1  5   ? 19.888  7.558   2.119   1.00 81.46  ? 83   ASP A OD2 1 
ATOM   38   N N   . VAL A 1  6   ? 15.447  5.478   0.179   1.00 38.82  ? 84   VAL A N   1 
ATOM   39   C CA  . VAL A 1  6   ? 15.359  4.155   -0.424  1.00 32.41  ? 84   VAL A CA  1 
ATOM   40   C C   . VAL A 1  6   ? 15.679  4.301   -1.913  1.00 29.52  ? 84   VAL A C   1 
ATOM   41   O O   . VAL A 1  6   ? 15.079  5.140   -2.597  1.00 27.82  ? 84   VAL A O   1 
ATOM   42   C CB  . VAL A 1  6   ? 13.951  3.569   -0.259  1.00 29.72  ? 84   VAL A CB  1 
ATOM   43   C CG1 . VAL A 1  6   ? 13.806  2.245   -1.024  1.00 26.81  ? 84   VAL A CG1 1 
ATOM   44   C CG2 . VAL A 1  6   ? 13.618  3.411   1.223   1.00 30.35  ? 84   VAL A CG2 1 
ATOM   45   N N   . PRO A 1  7   ? 16.612  3.488   -2.428  1.00 32.27  ? 85   PRO A N   1 
ATOM   46   C CA  . PRO A 1  7   ? 16.895  3.618   -3.862  1.00 31.30  ? 85   PRO A CA  1 
ATOM   47   C C   . PRO A 1  7   ? 15.633  3.466   -4.742  1.00 33.04  ? 85   PRO A C   1 
ATOM   48   O O   . PRO A 1  7   ? 14.820  2.546   -4.504  1.00 34.32  ? 85   PRO A O   1 
ATOM   49   C CB  . PRO A 1  7   ? 17.911  2.495   -4.136  1.00 31.26  ? 85   PRO A CB  1 
ATOM   50   C CG  . PRO A 1  7   ? 18.517  2.183   -2.814  1.00 35.70  ? 85   PRO A CG  1 
ATOM   51   C CD  . PRO A 1  7   ? 17.456  2.462   -1.783  1.00 35.62  ? 85   PRO A CD  1 
ATOM   52   N N   . PRO A 1  8   ? 15.469  4.349   -5.751  1.00 32.61  ? 86   PRO A N   1 
ATOM   53   C CA  . PRO A 1  8   ? 14.277  4.370   -6.602  1.00 29.20  ? 86   PRO A CA  1 
ATOM   54   C C   . PRO A 1  8   ? 13.792  3.003   -7.076  1.00 26.51  ? 86   PRO A C   1 
ATOM   55   O O   . PRO A 1  8   ? 12.596  2.693   -6.957  1.00 26.09  ? 86   PRO A O   1 
ATOM   56   C CB  . PRO A 1  8   ? 14.724  5.221   -7.783  1.00 32.27  ? 86   PRO A CB  1 
ATOM   57   C CG  . PRO A 1  8   ? 15.668  6.203   -7.168  1.00 32.68  ? 86   PRO A CG  1 
ATOM   58   C CD  . PRO A 1  8   ? 16.407  5.436   -6.122  1.00 35.43  ? 86   PRO A CD  1 
ATOM   59   N N   . ASN A 1  9   ? 14.709  2.186   -7.589  1.00 26.79  ? 87   ASN A N   1 
ATOM   60   C CA  . ASN A 1  9   ? 14.338  0.854   -8.096  1.00 27.46  ? 87   ASN A CA  1 
ATOM   61   C C   . ASN A 1  9   ? 13.856  -0.142  -7.042  1.00 22.67  ? 87   ASN A C   1 
ATOM   62   O O   . ASN A 1  9   ? 13.225  -1.143  -7.411  1.00 23.83  ? 87   ASN A O   1 
ATOM   63   C CB  . ASN A 1  9   ? 15.488  0.214   -8.870  1.00 26.57  ? 87   ASN A CB  1 
ATOM   64   C CG  . ASN A 1  9   ? 15.803  0.934   -10.150 1.00 29.58  ? 87   ASN A CG  1 
ATOM   65   O OD1 . ASN A 1  9   ? 14.975  1.651   -10.712 1.00 27.85  ? 87   ASN A OD1 1 
ATOM   66   N ND2 . ASN A 1  9   ? 16.990  0.698   -10.648 1.00 30.28  ? 87   ASN A ND2 1 
ATOM   67   N N   . SER A 1  10  ? 14.173  0.129   -5.772  1.00 23.73  ? 88   SER A N   1 
ATOM   68   C CA  . SER A 1  10  ? 13.814  -0.714  -4.627  1.00 28.69  ? 88   SER A CA  1 
ATOM   69   C C   . SER A 1  10  ? 12.618  -0.188  -3.817  1.00 26.87  ? 88   SER A C   1 
ATOM   70   O O   . SER A 1  10  ? 12.364  -0.648  -2.709  1.00 26.79  ? 88   SER A O   1 
ATOM   71   C CB  . SER A 1  10  ? 15.023  -0.834  -3.695  1.00 27.46  ? 88   SER A CB  1 
ATOM   72   O OG  . SER A 1  10  ? 16.137  -1.354  -4.403  1.00 39.13  ? 88   SER A OG  1 
ATOM   73   N N   . ARG A 1  11  ? 11.890  0.778   -4.364  1.00 27.23  ? 89   ARG A N   1 
ATOM   74   C CA  . ARG A 1  11  ? 10.698  1.307   -3.702  1.00 22.09  ? 89   ARG A CA  1 
ATOM   75   C C   . ARG A 1  11  ? 9.522   0.408   -4.040  1.00 21.48  ? 89   ARG A C   1 
ATOM   76   O O   . ARG A 1  11  ? 9.277   0.118   -5.221  1.00 21.55  ? 89   ARG A O   1 
ATOM   77   C CB  . ARG A 1  11  ? 10.460  2.746   -4.134  1.00 21.45  ? 89   ARG A CB  1 
ATOM   78   C CG  . ARG A 1  11  ? 11.558  3.658   -3.615  1.00 24.72  ? 89   ARG A CG  1 
ATOM   79   C CD  . ARG A 1  11  ? 11.497  5.056   -4.197  1.00 25.90  ? 89   ARG A CD  1 
ATOM   80   N NE  . ARG A 1  11  ? 12.686  5.811   -3.842  1.00 30.59  ? 89   ARG A NE  1 
ATOM   81   C CZ  . ARG A 1  11  ? 12.937  7.074   -4.195  1.00 32.13  ? 89   ARG A CZ  1 
ATOM   82   N NH1 . ARG A 1  11  ? 12.082  7.780   -4.939  1.00 29.99  ? 89   ARG A NH1 1 
ATOM   83   N NH2 . ARG A 1  11  ? 14.071  7.630   -3.794  1.00 28.30  ? 89   ARG A NH2 1 
ATOM   84   N N   . PHE A 1  12  ? 8.834   -0.082  -3.002  1.00 18.70  ? 90   PHE A N   1 
ATOM   85   C CA  . PHE A 1  12  ? 7.632   -0.880  -3.177  1.00 18.23  ? 90   PHE A CA  1 
ATOM   86   C C   . PHE A 1  12  ? 6.400   -0.030  -2.848  1.00 17.93  ? 90   PHE A C   1 
ATOM   87   O O   . PHE A 1  12  ? 6.391   0.737   -1.879  1.00 18.92  ? 90   PHE A O   1 
ATOM   88   C CB  . PHE A 1  12  ? 7.678   -2.138  -2.300  1.00 16.77  ? 90   PHE A CB  1 
ATOM   89   C CG  . PHE A 1  12  ? 8.735   -3.114  -2.700  1.00 16.73  ? 90   PHE A CG  1 
ATOM   90   C CD1 . PHE A 1  12  ? 10.059  -2.947  -2.279  1.00 19.44  ? 90   PHE A CD1 1 
ATOM   91   C CD2 . PHE A 1  12  ? 8.419   -4.224  -3.470  1.00 18.46  ? 90   PHE A CD2 1 
ATOM   92   C CE1 . PHE A 1  12  ? 11.043  -3.866  -2.650  1.00 19.15  ? 90   PHE A CE1 1 
ATOM   93   C CE2 . PHE A 1  12  ? 9.392   -5.159  -3.814  1.00 19.18  ? 90   PHE A CE2 1 
ATOM   94   C CZ  . PHE A 1  12  ? 10.705  -4.968  -3.411  1.00 19.04  ? 90   PHE A CZ  1 
ATOM   95   N N   . ASP A 1  13  ? 5.358   -0.197  -3.660  1.00 21.05  ? 91   ASP A N   1 
ATOM   96   C CA  . ASP A 1  13  ? 4.207   0.695   -3.672  1.00 18.80  ? 91   ASP A CA  1 
ATOM   97   C C   . ASP A 1  13  ? 3.358   0.557   -2.408  1.00 19.73  ? 91   ASP A C   1 
ATOM   98   O O   . ASP A 1  13  ? 2.847   -0.521  -2.115  1.00 16.67  ? 91   ASP A O   1 
ATOM   99   C CB  . ASP A 1  13  ? 3.357   0.402   -4.915  1.00 19.01  ? 91   ASP A CB  1 
ATOM   100  C CG  . ASP A 1  13  ? 2.267   1.430   -5.159  1.00 20.85  ? 91   ASP A CG  1 
ATOM   101  O OD1 . ASP A 1  13  ? 2.246   2.490   -4.495  1.00 18.43  ? 91   ASP A OD1 1 
ATOM   102  O OD2 . ASP A 1  13  ? 1.436   1.194   -6.072  1.00 27.41  ? 91   ASP A OD2 1 
ATOM   103  N N   . CYS A 1  14  ? 3.221   1.668   -1.688  1.00 19.92  ? 92   CYS A N   1 
ATOM   104  C CA  . CYS A 1  14  ? 2.365   1.763   -0.515  1.00 22.36  ? 92   CYS A CA  1 
ATOM   105  C C   . CYS A 1  14  ? 0.969   2.307   -0.856  1.00 25.80  ? 92   CYS A C   1 
ATOM   106  O O   . CYS A 1  14  ? 0.121   2.410   0.029   1.00 22.04  ? 92   CYS A O   1 
ATOM   107  C CB  . CYS A 1  14  ? 3.029   2.632   0.544   1.00 22.16  ? 92   CYS A CB  1 
ATOM   108  S SG  . CYS A 1  14  ? 2.059   2.937   2.049   1.00 21.65  ? 92   CYS A SG  1 
ATOM   109  N N   . ALA A 1  15  ? 0.728   2.646   -2.130  1.00 24.36  ? 93   ALA A N   1 
ATOM   110  C CA  . ALA A 1  15  ? -0.632  2.919   -2.603  1.00 22.58  ? 93   ALA A CA  1 
ATOM   111  C C   . ALA A 1  15  ? -0.976  2.115   -3.857  1.00 21.60  ? 93   ALA A C   1 
ATOM   112  O O   . ALA A 1  15  ? -1.291  2.695   -4.910  1.00 22.47  ? 93   ALA A O   1 
ATOM   113  C CB  . ALA A 1  15  ? -0.826  4.419   -2.806  1.00 25.52  ? 93   ALA A CB  1 
ATOM   114  N N   . PRO A 1  16  ? -0.963  0.762   -3.741  1.00 21.14  ? 94   PRO A N   1 
ATOM   115  C CA  . PRO A 1  16  ? -1.349  -0.086  -4.873  1.00 22.10  ? 94   PRO A CA  1 
ATOM   116  C C   . PRO A 1  16  ? -2.866  -0.149  -5.070  1.00 23.76  ? 94   PRO A C   1 
ATOM   117  O O   . PRO A 1  16  ? -3.339  -0.605  -6.121  1.00 21.09  ? 94   PRO A O   1 
ATOM   118  C CB  . PRO A 1  16  ? -0.813  -1.461  -4.465  1.00 22.26  ? 94   PRO A CB  1 
ATOM   119  C CG  . PRO A 1  16  ? -0.938  -1.463  -2.961  1.00 24.03  ? 94   PRO A CG  1 
ATOM   120  C CD  . PRO A 1  16  ? -0.609  -0.051  -2.554  1.00 23.63  ? 94   PRO A CD  1 
ATOM   121  N N   . ASP A 1  17  ? -3.609  0.299   -4.057  1.00 22.93  ? 95   ASP A N   1 
ATOM   122  C CA  . ASP A 1  17  ? -5.071  0.234   -4.048  1.00 26.91  ? 95   ASP A CA  1 
ATOM   123  C C   . ASP A 1  17  ? -5.776  1.443   -4.665  1.00 30.24  ? 95   ASP A C   1 
ATOM   124  O O   . ASP A 1  17  ? -6.927  1.324   -5.055  1.00 31.93  ? 95   ASP A O   1 
ATOM   125  C CB  . ASP A 1  17  ? -5.584  0.077   -2.616  1.00 26.49  ? 95   ASP A CB  1 
ATOM   126  C CG  . ASP A 1  17  ? -5.069  1.152   -1.693  1.00 31.37  ? 95   ASP A CG  1 
ATOM   127  O OD1 . ASP A 1  17  ? -3.850  1.459   -1.749  1.00 30.84  ? 95   ASP A OD1 1 
ATOM   128  O OD2 . ASP A 1  17  ? -5.866  1.675   -0.898  1.00 32.09  ? 95   ASP A OD2 1 
ATOM   129  N N   . LYS A 1  18  ? -5.120  2.606   -4.704  1.00 31.72  ? 96   LYS A N   1 
ATOM   130  C CA  . LYS A 1  18  ? -5.775  3.846   -5.157  1.00 34.36  ? 96   LYS A CA  1 
ATOM   131  C C   . LYS A 1  18  ? -4.787  4.986   -5.361  1.00 35.08  ? 96   LYS A C   1 
ATOM   132  O O   . LYS A 1  18  ? -3.636  4.941   -4.892  1.00 30.25  ? 96   LYS A O   1 
ATOM   133  C CB  . LYS A 1  18  ? -6.842  4.314   -4.147  1.00 34.40  ? 96   LYS A CB  1 
ATOM   134  C CG  . LYS A 1  18  ? -6.284  4.734   -2.795  1.00 37.25  ? 96   LYS A CG  1 
ATOM   135  C CD  . LYS A 1  18  ? -7.379  5.102   -1.806  1.00 42.87  ? 96   LYS A CD  1 
ATOM   136  C CE  . LYS A 1  18  ? -6.913  6.227   -0.906  1.00 52.59  ? 96   LYS A CE  1 
ATOM   137  N NZ  . LYS A 1  18  ? -7.795  6.384   0.275   1.00 70.90  ? 96   LYS A NZ  1 
ATOM   138  N N   . ALA A 1  19  ? -5.271  6.021   -6.038  1.00 34.86  ? 97   ALA A N   1 
ATOM   139  C CA  . ALA A 1  19  ? -4.548  7.279   -6.154  1.00 34.16  ? 97   ALA A CA  1 
ATOM   140  C C   . ALA A 1  19  ? -4.469  7.892   -4.763  1.00 31.20  ? 97   ALA A C   1 
ATOM   141  O O   . ALA A 1  19  ? -5.452  7.895   -4.027  1.00 27.60  ? 97   ALA A O   1 
ATOM   142  C CB  . ALA A 1  19  ? -5.271  8.225   -7.114  1.00 40.70  ? 97   ALA A CB  1 
ATOM   143  N N   . ILE A 1  20  ? -3.293  8.382   -4.402  1.00 28.63  ? 98   ILE A N   1 
ATOM   144  C CA  . ILE A 1  20  ? -3.045  8.892   -3.073  1.00 30.30  ? 98   ILE A CA  1 
ATOM   145  C C   . ILE A 1  20  ? -2.443  10.299  -3.158  1.00 29.37  ? 98   ILE A C   1 
ATOM   146  O O   . ILE A 1  20  ? -1.729  10.614  -4.112  1.00 32.79  ? 98   ILE A O   1 
ATOM   147  C CB  . ILE A 1  20  ? -2.124  7.896   -2.312  1.00 32.01  ? 98   ILE A CB  1 
ATOM   148  C CG1 . ILE A 1  20  ? -2.304  8.035   -0.808  1.00 32.87  ? 98   ILE A CG1 1 
ATOM   149  C CG2 . ILE A 1  20  ? -0.658  8.051   -2.714  1.00 32.12  ? 98   ILE A CG2 1 
ATOM   150  C CD1 . ILE A 1  20  ? -1.843  6.841   -0.014  1.00 35.40  ? 98   ILE A CD1 1 
ATOM   151  N N   . THR A 1  21  ? -2.760  11.141  -2.180  1.00 30.61  ? 99   THR A N   1 
ATOM   152  C CA  . THR A 1  21  ? -2.067  12.410  -1.984  1.00 30.22  ? 99   THR A CA  1 
ATOM   153  C C   . THR A 1  21  ? -0.855  12.219  -1.068  1.00 31.14  ? 99   THR A C   1 
ATOM   154  O O   . THR A 1  21  ? -0.709  11.184  -0.414  1.00 28.84  ? 99   THR A O   1 
ATOM   155  C CB  . THR A 1  21  ? -2.985  13.483  -1.361  1.00 33.58  ? 99   THR A CB  1 
ATOM   156  O OG1 . THR A 1  21  ? -3.314  13.136  -0.012  1.00 33.04  ? 99   THR A OG1 1 
ATOM   157  C CG2 . THR A 1  21  ? -4.251  13.646  -2.177  1.00 32.44  ? 99   THR A CG2 1 
ATOM   158  N N   . GLN A 1  22  ? 0.011   13.223  -1.017  1.00 28.68  ? 100  GLN A N   1 
ATOM   159  C CA  . GLN A 1  22  ? 1.176   13.178  -0.130  1.00 32.19  ? 100  GLN A CA  1 
ATOM   160  C C   . GLN A 1  22  ? 0.770   13.035  1.348   1.00 33.27  ? 100  GLN A C   1 
ATOM   161  O O   . GLN A 1  22  ? 1.397   12.287  2.091   1.00 34.81  ? 100  GLN A O   1 
ATOM   162  C CB  . GLN A 1  22  ? 2.053   14.416  -0.318  1.00 31.92  ? 100  GLN A CB  1 
ATOM   163  C CG  . GLN A 1  22  ? 3.183   14.532  0.710   1.00 34.75  ? 100  GLN A CG  1 
ATOM   164  C CD  . GLN A 1  22  ? 4.267   15.496  0.296   1.00 33.25  ? 100  GLN A CD  1 
ATOM   165  O OE1 . GLN A 1  22  ? 4.122   16.229  -0.679  1.00 40.31  ? 100  GLN A OE1 1 
ATOM   166  N NE2 . GLN A 1  22  ? 5.367   15.500  1.040   1.00 33.93  ? 100  GLN A NE2 1 
ATOM   167  N N   . GLU A 1  23  ? -0.282  13.748  1.754   1.00 33.27  ? 101  GLU A N   1 
ATOM   168  C CA  . GLU A 1  23  ? -0.718  13.740  3.137   1.00 32.09  ? 101  GLU A CA  1 
ATOM   169  C C   . GLU A 1  23  ? -1.217  12.352  3.518   1.00 31.21  ? 101  GLU A C   1 
ATOM   170  O O   . GLU A 1  23  ? -0.822  11.843  4.543   1.00 32.19  ? 101  GLU A O   1 
ATOM   171  C CB  . GLU A 1  23  ? -1.796  14.804  3.393   1.00 41.65  ? 101  GLU A CB  1 
ATOM   172  C CG  . GLU A 1  23  ? -2.099  14.989  4.873   1.00 52.54  ? 101  GLU A CG  1 
ATOM   173  C CD  . GLU A 1  23  ? -2.924  16.228  5.201   1.00 82.28  ? 101  GLU A CD  1 
ATOM   174  O OE1 . GLU A 1  23  ? -3.212  17.048  4.298   1.00 83.00  ? 101  GLU A OE1 1 
ATOM   175  O OE2 . GLU A 1  23  ? -3.282  16.384  6.392   1.00 72.98  ? 101  GLU A OE2 1 
ATOM   176  N N   . GLN A 1  24  ? -2.041  11.744  2.665   1.00 28.09  ? 102  GLN A N   1 
ATOM   177  C CA  . GLN A 1  24  ? -2.552  10.379  2.882   1.00 34.39  ? 102  GLN A CA  1 
ATOM   178  C C   . GLN A 1  24  ? -1.450  9.314   2.881   1.00 30.93  ? 102  GLN A C   1 
ATOM   179  O O   . GLN A 1  24  ? -1.483  8.367   3.673   1.00 29.68  ? 102  GLN A O   1 
ATOM   180  C CB  . GLN A 1  24  ? -3.556  10.000  1.796   1.00 36.58  ? 102  GLN A CB  1 
ATOM   181  C CG  . GLN A 1  24  ? -4.842  10.820  1.772   1.00 37.37  ? 102  GLN A CG  1 
ATOM   182  C CD  . GLN A 1  24  ? -5.626  10.599  0.487   1.00 38.67  ? 102  GLN A CD  1 
ATOM   183  O OE1 . GLN A 1  24  ? -5.058  10.296  -0.562  1.00 30.99  ? 102  GLN A OE1 1 
ATOM   184  N NE2 . GLN A 1  24  ? -6.936  10.755  0.565   1.00 43.16  ? 102  GLN A NE2 1 
ATOM   185  N N   . CYS A 1  25  ? -0.492  9.470   1.973   1.00 29.74  ? 103  CYS A N   1 
ATOM   186  C CA  . CYS A 1  25  ? 0.678   8.600   1.926   1.00 31.20  ? 103  CYS A CA  1 
ATOM   187  C C   . CYS A 1  25  ? 1.392   8.643   3.264   1.00 29.63  ? 103  CYS A C   1 
ATOM   188  O O   . CYS A 1  25  ? 1.592   7.619   3.905   1.00 24.94  ? 103  CYS A O   1 
ATOM   189  C CB  . CYS A 1  25  ? 1.609   9.047   0.812   1.00 32.64  ? 103  CYS A CB  1 
ATOM   190  S SG  . CYS A 1  25  ? 3.042   8.000   0.637   1.00 28.56  ? 103  CYS A SG  1 
ATOM   191  N N   . GLU A 1  26  ? 1.712   9.849   3.715   1.00 27.16  ? 104  GLU A N   1 
ATOM   192  C CA  . GLU A 1  26  ? 2.397   10.015  4.976   1.00 29.54  ? 104  GLU A CA  1 
ATOM   193  C C   . GLU A 1  26  ? 1.576   9.541   6.173   1.00 29.27  ? 104  GLU A C   1 
ATOM   194  O O   . GLU A 1  26  ? 2.147   9.018   7.112   1.00 28.74  ? 104  GLU A O   1 
ATOM   195  C CB  . GLU A 1  26  ? 2.867   11.467  5.143   1.00 31.75  ? 104  GLU A CB  1 
ATOM   196  C CG  . GLU A 1  26  ? 3.947   11.785  4.121   1.00 31.52  ? 104  GLU A CG  1 
ATOM   197  C CD  . GLU A 1  26  ? 4.396   13.232  4.107   1.00 31.84  ? 104  GLU A CD  1 
ATOM   198  O OE1 . GLU A 1  26  ? 5.376   13.528  3.396   1.00 29.24  ? 104  GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1  26  ? 3.781   14.066  4.781   1.00 37.08  ? 104  GLU A OE2 1 
ATOM   200  N N   . ALA A 1  27  ? 0.252   9.686   6.130   1.00 26.07  ? 105  ALA A N   1 
ATOM   201  C CA  . ALA A 1  27  ? -0.596  9.213   7.226   1.00 27.89  ? 105  ALA A CA  1 
ATOM   202  C C   . ALA A 1  27  ? -0.671  7.675   7.275   1.00 28.50  ? 105  ALA A C   1 
ATOM   203  O O   . ALA A 1  27  ? -0.889  7.111   8.336   1.00 32.17  ? 105  ALA A O   1 
ATOM   204  C CB  . ALA A 1  27  ? -1.985  9.820   7.126   1.00 28.54  ? 105  ALA A CB  1 
ATOM   205  N N   . ARG A 1  28  ? -0.446  6.995   6.143   1.00 28.03  ? 106  ARG A N   1 
ATOM   206  C CA  . ARG A 1  28  ? -0.233  5.539   6.150   1.00 25.81  ? 106  ARG A CA  1 
ATOM   207  C C   . ARG A 1  28  ? 1.085   5.097   6.779   1.00 26.62  ? 106  ARG A C   1 
ATOM   208  O O   . ARG A 1  28  ? 1.299   3.888   6.937   1.00 31.90  ? 106  ARG A O   1 
ATOM   209  C CB  . ARG A 1  28  ? -0.293  4.972   4.724   1.00 26.35  ? 106  ARG A CB  1 
ATOM   210  C CG  . ARG A 1  28  ? -1.678  5.014   4.155   1.00 26.12  ? 106  ARG A CG  1 
ATOM   211  C CD  . ARG A 1  28  ? -1.687  4.407   2.776   1.00 25.91  ? 106  ARG A CD  1 
ATOM   212  N NE  . ARG A 1  28  ? -3.058  4.247   2.327   1.00 23.53  ? 106  ARG A NE  1 
ATOM   213  C CZ  . ARG A 1  28  ? -3.434  3.601   1.243   1.00 22.53  ? 106  ARG A CZ  1 
ATOM   214  N NH1 . ARG A 1  28  ? -2.542  3.012   0.445   1.00 22.64  ? 106  ARG A NH1 1 
ATOM   215  N NH2 . ARG A 1  28  ? -4.726  3.536   0.962   1.00 28.46  ? 106  ARG A NH2 1 
ATOM   216  N N   . GLY A 1  29  ? 1.962   6.040   7.131   1.00 23.73  ? 107  GLY A N   1 
ATOM   217  C CA  . GLY A 1  29  ? 3.315   5.725   7.580   1.00 27.35  ? 107  GLY A CA  1 
ATOM   218  C C   . GLY A 1  29  ? 4.253   5.407   6.423   1.00 32.16  ? 107  GLY A C   1 
ATOM   219  O O   . GLY A 1  29  ? 5.252   4.671   6.592   1.00 29.57  ? 107  GLY A O   1 
ATOM   220  N N   . CYS A 1  30  ? 3.951   5.978   5.256   1.00 25.46  ? 108  CYS A N   1 
ATOM   221  C CA  . CYS A 1  30  ? 4.757   5.791   4.057   1.00 25.41  ? 108  CYS A CA  1 
ATOM   222  C C   . CYS A 1  30  ? 5.485   7.065   3.606   1.00 28.47  ? 108  CYS A C   1 
ATOM   223  O O   . CYS A 1  30  ? 5.199   8.166   4.079   1.00 25.24  ? 108  CYS A O   1 
ATOM   224  C CB  . CYS A 1  30  ? 3.869   5.214   2.953   1.00 26.00  ? 108  CYS A CB  1 
ATOM   225  S SG  . CYS A 1  30  ? 3.489   3.476   3.330   1.00 23.88  ? 108  CYS A SG  1 
ATOM   226  N N   . CYS A 1  31  ? 6.438   6.871   2.694   1.00 25.68  ? 109  CYS A N   1 
ATOM   227  C CA  . CYS A 1  31  ? 7.288   7.923   2.144   1.00 26.52  ? 109  CYS A CA  1 
ATOM   228  C C   . CYS A 1  31  ? 6.726   8.444   0.840   1.00 26.80  ? 109  CYS A C   1 
ATOM   229  O O   . CYS A 1  31  ? 6.355   7.645   -0.031  1.00 27.09  ? 109  CYS A O   1 
ATOM   230  C CB  . CYS A 1  31  ? 8.673   7.343   1.846   1.00 24.63  ? 109  CYS A CB  1 
ATOM   231  S SG  . CYS A 1  31  ? 9.536   6.777   3.319   1.00 29.69  ? 109  CYS A SG  1 
ATOM   232  N N   . TYR A 1  32  ? 6.724   9.765   0.664   1.00 24.89  ? 110  TYR A N   1 
ATOM   233  C CA  . TYR A 1  32  ? 6.201   10.361  -0.579  1.00 29.15  ? 110  TYR A CA  1 
ATOM   234  C C   . TYR A 1  32  ? 7.308   11.099  -1.327  1.00 28.36  ? 110  TYR A C   1 
ATOM   235  O O   . TYR A 1  32  ? 7.767   12.120  -0.856  1.00 25.69  ? 110  TYR A O   1 
ATOM   236  C CB  . TYR A 1  32  ? 5.060   11.323  -0.287  1.00 29.65  ? 110  TYR A CB  1 
ATOM   237  C CG  . TYR A 1  32  ? 4.467   11.950  -1.538  1.00 30.52  ? 110  TYR A CG  1 
ATOM   238  C CD1 . TYR A 1  32  ? 4.964   13.151  -2.035  1.00 29.81  ? 110  TYR A CD1 1 
ATOM   239  C CD2 . TYR A 1  32  ? 3.413   11.333  -2.231  1.00 33.04  ? 110  TYR A CD2 1 
ATOM   240  C CE1 . TYR A 1  32  ? 4.432   13.742  -3.172  1.00 32.12  ? 110  TYR A CE1 1 
ATOM   241  C CE2 . TYR A 1  32  ? 2.868   11.915  -3.370  1.00 29.61  ? 110  TYR A CE2 1 
ATOM   242  C CZ  . TYR A 1  32  ? 3.392   13.122  -3.830  1.00 31.75  ? 110  TYR A CZ  1 
ATOM   243  O OH  . TYR A 1  32  ? 2.895   13.726  -4.939  1.00 38.25  ? 110  TYR A OH  1 
ATOM   244  N N   . ILE A 1  33  ? 7.741   10.551  -2.462  1.00 24.60  ? 111  ILE A N   1 
ATOM   245  C CA  . ILE A 1  33  ? 8.753   11.157  -3.306  1.00 23.92  ? 111  ILE A CA  1 
ATOM   246  C C   . ILE A 1  33  ? 8.341   10.951  -4.746  1.00 23.34  ? 111  ILE A C   1 
ATOM   247  O O   . ILE A 1  33  ? 8.389   9.833   -5.239  1.00 23.55  ? 111  ILE A O   1 
ATOM   248  C CB  . ILE A 1  33  ? 10.158  10.555  -3.092  1.00 26.12  ? 111  ILE A CB  1 
ATOM   249  C CG1 . ILE A 1  33  ? 10.573  10.647  -1.615  1.00 28.84  ? 111  ILE A CG1 1 
ATOM   250  C CG2 . ILE A 1  33  ? 11.197  11.322  -3.924  1.00 33.02  ? 111  ILE A CG2 1 
ATOM   251  C CD1 . ILE A 1  33  ? 11.946  10.078  -1.335  1.00 30.23  ? 111  ILE A CD1 1 
ATOM   252  N N   . PRO A 1  34  ? 7.953   12.028  -5.449  1.00 25.13  ? 112  PRO A N   1 
ATOM   253  C CA  . PRO A 1  34  ? 7.584   11.809  -6.845  1.00 23.41  ? 112  PRO A CA  1 
ATOM   254  C C   . PRO A 1  34  ? 8.759   11.334  -7.712  1.00 23.59  ? 112  PRO A C   1 
ATOM   255  O O   . PRO A 1  34  ? 9.890   11.749  -7.496  1.00 25.37  ? 112  PRO A O   1 
ATOM   256  C CB  . PRO A 1  34  ? 7.075   13.182  -7.290  1.00 27.09  ? 112  PRO A CB  1 
ATOM   257  C CG  . PRO A 1  34  ? 6.636   13.846  -6.032  1.00 27.48  ? 112  PRO A CG  1 
ATOM   258  C CD  . PRO A 1  34  ? 7.650   13.405  -5.019  1.00 27.57  ? 112  PRO A CD  1 
ATOM   259  N N   . ALA A 1  35  ? 8.494   10.414  -8.638  1.00 26.01  ? 113  ALA A N   1 
ATOM   260  C CA  . ALA A 1  35  ? 9.466   10.065  -9.671  1.00 29.35  ? 113  ALA A CA  1 
ATOM   261  C C   . ALA A 1  35  ? 9.762   11.346  -10.428 1.00 32.71  ? 113  ALA A C   1 
ATOM   262  O O   . ALA A 1  35  ? 8.963   12.305  -10.401 1.00 30.67  ? 113  ALA A O   1 
ATOM   263  C CB  . ALA A 1  35  ? 8.906   9.013   -10.607 1.00 28.14  ? 113  ALA A CB  1 
ATOM   264  N N   . LYS A 1  36  ? 10.916  11.398  -11.069 1.00 28.57  ? 114  LYS A N   1 
ATOM   265  C CA  . LYS A 1  36  ? 11.318  12.627  -11.746 1.00 33.76  ? 114  LYS A CA  1 
ATOM   266  C C   . LYS A 1  36  ? 10.806  12.722  -13.201 1.00 32.91  ? 114  LYS A C   1 
ATOM   267  O O   . LYS A 1  36  ? 11.027  13.731  -13.881 1.00 29.44  ? 114  LYS A O   1 
ATOM   268  C CB  . LYS A 1  36  ? 12.834  12.807  -11.625 1.00 40.56  ? 114  LYS A CB  1 
ATOM   269  C CG  . LYS A 1  36  ? 13.212  13.129  -10.188 1.00 41.56  ? 114  LYS A CG  1 
ATOM   270  C CD  . LYS A 1  36  ? 14.700  13.243  -9.972  1.00 47.74  ? 114  LYS A CD  1 
ATOM   271  C CE  . LYS A 1  36  ? 14.968  13.556  -8.509  1.00 45.05  ? 114  LYS A CE  1 
ATOM   272  N NZ  . LYS A 1  36  ? 16.423  13.601  -8.237  1.00 55.02  ? 114  LYS A NZ  1 
ATOM   273  N N   . GLN A 1  37  ? 10.127  11.670  -13.659 1.00 30.61  ? 115  GLN A N   1 
ATOM   274  C CA  . GLN A 1  37  ? 9.477   11.652  -14.970 1.00 37.48  ? 115  GLN A CA  1 
ATOM   275  C C   . GLN A 1  37  ? 8.394   10.590  -14.943 1.00 40.00  ? 115  GLN A C   1 
ATOM   276  O O   . GLN A 1  37  ? 7.776   10.325  -15.982 1.00 34.20  ? 115  GLN A O   1 
ATOM   277  C CB  . GLN A 1  37  ? 10.489  11.365  -16.107 1.00 39.87  ? 115  GLN A CB  1 
ATOM   278  C CG  . GLN A 1  37  ? 11.177  10.006  -16.036 1.00 49.50  ? 115  GLN A CG  1 
ATOM   279  C CD  . GLN A 1  37  ? 12.464  10.040  -15.219 1.00 75.94  ? 115  GLN A CD  1 
ATOM   280  O OE1 . GLN A 1  37  ? 13.415  10.746  -15.573 1.00 117.38 ? 115  GLN A OE1 1 
ATOM   281  N NE2 . GLN A 1  37  ? 12.500  9.275   -14.123 1.00 75.41  ? 115  GLN A NE2 1 
ATOM   282  N N   . MET A 1  44  ? 1.837   1.329   -14.991 1.00 52.53  ? 122  MET A N   1 
ATOM   283  C CA  . MET A 1  44  ? 2.478   1.864   -13.748 1.00 48.83  ? 122  MET A CA  1 
ATOM   284  C C   . MET A 1  44  ? 3.963   2.170   -13.927 1.00 39.53  ? 122  MET A C   1 
ATOM   285  O O   . MET A 1  44  ? 4.588   1.774   -14.899 1.00 47.01  ? 122  MET A O   1 
ATOM   286  C CB  . MET A 1  44  ? 2.267   0.918   -12.543 1.00 56.16  ? 122  MET A CB  1 
ATOM   287  C CG  . MET A 1  44  ? 2.337   -0.576  -12.827 1.00 51.83  ? 122  MET A CG  1 
ATOM   288  S SD  . MET A 1  44  ? 2.690   -1.567  -11.339 1.00 40.66  ? 122  MET A SD  1 
ATOM   289  C CE  . MET A 1  44  ? 4.444   -1.267  -11.224 1.00 32.67  ? 122  MET A CE  1 
ATOM   290  N N   . GLY A 1  45  ? 4.500   2.935   -12.986 1.00 33.82  ? 123  GLY A N   1 
ATOM   291  C CA  . GLY A 1  45  ? 5.931   3.213   -12.909 1.00 30.27  ? 123  GLY A CA  1 
ATOM   292  C C   . GLY A 1  45  ? 6.405   3.054   -11.474 1.00 26.77  ? 123  GLY A C   1 
ATOM   293  O O   . GLY A 1  45  ? 5.740   2.449   -10.645 1.00 25.63  ? 123  GLY A O   1 
ATOM   294  N N   . GLN A 1  46  ? 7.576   3.596   -11.200 1.00 24.27  ? 124  GLN A N   1 
ATOM   295  C CA  . GLN A 1  46  ? 8.111   3.696   -9.860  1.00 26.13  ? 124  GLN A CA  1 
ATOM   296  C C   . GLN A 1  46  ? 7.110   4.347   -8.900  1.00 26.56  ? 124  GLN A C   1 
ATOM   297  O O   . GLN A 1  46  ? 6.580   5.408   -9.206  1.00 23.69  ? 124  GLN A O   1 
ATOM   298  C CB  . GLN A 1  46  ? 9.378   4.537   -9.942  1.00 29.17  ? 124  GLN A CB  1 
ATOM   299  C CG  . GLN A 1  46  ? 10.075  4.881   -8.644  1.00 31.92  ? 124  GLN A CG  1 
ATOM   300  C CD  . GLN A 1  46  ? 11.147  5.919   -8.885  1.00 37.20  ? 124  GLN A CD  1 
ATOM   301  O OE1 . GLN A 1  46  ? 11.200  6.973   -8.230  1.00 36.01  ? 124  GLN A OE1 1 
ATOM   302  N NE2 . GLN A 1  46  ? 12.002  5.635   -9.848  1.00 36.88  ? 124  GLN A NE2 1 
ATOM   303  N N   . PRO A 1  47  ? 6.856   3.716   -7.727  1.00 23.35  ? 125  PRO A N   1 
ATOM   304  C CA  . PRO A 1  47  ? 5.847   4.276   -6.853  1.00 23.28  ? 125  PRO A CA  1 
ATOM   305  C C   . PRO A 1  47  ? 6.318   5.567   -6.190  1.00 23.08  ? 125  PRO A C   1 
ATOM   306  O O   . PRO A 1  47  ? 7.409   5.630   -5.643  1.00 24.10  ? 125  PRO A O   1 
ATOM   307  C CB  . PRO A 1  47  ? 5.623   3.175   -5.815  1.00 22.23  ? 125  PRO A CB  1 
ATOM   308  C CG  . PRO A 1  47  ? 6.925   2.476   -5.742  1.00 23.77  ? 125  PRO A CG  1 
ATOM   309  C CD  . PRO A 1  47  ? 7.464   2.501   -7.150  1.00 20.31  ? 125  PRO A CD  1 
ATOM   310  N N   . TRP A 1  48  ? 5.473   6.582   -6.258  1.00 20.88  ? 126  TRP A N   1 
ATOM   311  C CA  . TRP A 1  48  ? 5.702   7.838   -5.578  1.00 22.08  ? 126  TRP A CA  1 
ATOM   312  C C   . TRP A 1  48  ? 5.479   7.675   -4.073  1.00 22.97  ? 126  TRP A C   1 
ATOM   313  O O   . TRP A 1  48  ? 6.077   8.413   -3.282  1.00 26.00  ? 126  TRP A O   1 
ATOM   314  C CB  . TRP A 1  48  ? 4.720   8.902   -6.080  1.00 23.63  ? 126  TRP A CB  1 
ATOM   315  C CG  . TRP A 1  48  ? 4.855   9.350   -7.518  1.00 24.86  ? 126  TRP A CG  1 
ATOM   316  C CD1 . TRP A 1  48  ? 5.358   8.650   -8.571  1.00 25.17  ? 126  TRP A CD1 1 
ATOM   317  C CD2 . TRP A 1  48  ? 4.423   10.609  -8.042  1.00 24.09  ? 126  TRP A CD2 1 
ATOM   318  N NE1 . TRP A 1  48  ? 5.284   9.408   -9.730  1.00 23.85  ? 126  TRP A NE1 1 
ATOM   319  C CE2 . TRP A 1  48  ? 4.707   10.612  -9.428  1.00 25.89  ? 126  TRP A CE2 1 
ATOM   320  C CE3 . TRP A 1  48  ? 3.813   11.732  -7.474  1.00 28.84  ? 126  TRP A CE3 1 
ATOM   321  C CZ2 . TRP A 1  48  ? 4.413   11.705  -10.255 1.00 26.90  ? 126  TRP A CZ2 1 
ATOM   322  C CZ3 . TRP A 1  48  ? 3.521   12.822  -8.293  1.00 32.09  ? 126  TRP A CZ3 1 
ATOM   323  C CH2 . TRP A 1  48  ? 3.825   12.795  -9.672  1.00 26.24  ? 126  TRP A CH2 1 
ATOM   324  N N   . CYS A 1  49  ? 4.606   6.735   -3.697  1.00 21.49  ? 127  CYS A N   1 
ATOM   325  C CA  . CYS A 1  49  ? 4.276   6.452   -2.293  1.00 23.20  ? 127  CYS A CA  1 
ATOM   326  C C   . CYS A 1  49  ? 4.798   5.066   -1.971  1.00 20.41  ? 127  CYS A C   1 
ATOM   327  O O   . CYS A 1  49  ? 4.341   4.095   -2.552  1.00 21.68  ? 127  CYS A O   1 
ATOM   328  C CB  . CYS A 1  49  ? 2.776   6.509   -2.052  1.00 24.25  ? 127  CYS A CB  1 
ATOM   329  S SG  . CYS A 1  49  ? 2.320   6.243   -0.307  1.00 28.32  ? 127  CYS A SG  1 
ATOM   330  N N   . PHE A 1  50  ? 5.770   4.976   -1.069  1.00 21.57  ? 128  PHE A N   1 
ATOM   331  C CA  . PHE A 1  50  ? 6.460   3.717   -0.833  1.00 23.52  ? 128  PHE A CA  1 
ATOM   332  C C   . PHE A 1  50  ? 6.785   3.450   0.635   1.00 21.72  ? 128  PHE A C   1 
ATOM   333  O O   . PHE A 1  50  ? 6.787   4.363   1.448   1.00 21.40  ? 128  PHE A O   1 
ATOM   334  C CB  . PHE A 1  50  ? 7.722   3.640   -1.693  1.00 22.94  ? 128  PHE A CB  1 
ATOM   335  C CG  . PHE A 1  50  ? 8.753   4.673   -1.357  1.00 25.71  ? 128  PHE A CG  1 
ATOM   336  C CD1 . PHE A 1  50  ? 8.694   5.946   -1.924  1.00 26.99  ? 128  PHE A CD1 1 
ATOM   337  C CD2 . PHE A 1  50  ? 9.794   4.380   -0.485  1.00 25.80  ? 128  PHE A CD2 1 
ATOM   338  C CE1 . PHE A 1  50  ? 9.651   6.901   -1.626  1.00 23.60  ? 128  PHE A CE1 1 
ATOM   339  C CE2 . PHE A 1  50  ? 10.758  5.335   -0.193  1.00 27.27  ? 128  PHE A CE2 1 
ATOM   340  C CZ  . PHE A 1  50  ? 10.676  6.598   -0.762  1.00 26.98  ? 128  PHE A CZ  1 
ATOM   341  N N   . PHE A 1  51  ? 7.039   2.181   0.952   1.00 20.90  ? 129  PHE A N   1 
ATOM   342  C CA  . PHE A 1  51  ? 7.256   1.745   2.344   1.00 20.36  ? 129  PHE A CA  1 
ATOM   343  C C   . PHE A 1  51  ? 8.665   2.121   2.788   1.00 21.64  ? 129  PHE A C   1 
ATOM   344  O O   . PHE A 1  51  ? 9.622   1.798   2.089   1.00 21.65  ? 129  PHE A O   1 
ATOM   345  C CB  . PHE A 1  51  ? 7.115   0.214   2.483   1.00 20.53  ? 129  PHE A CB  1 
ATOM   346  C CG  . PHE A 1  51  ? 5.790   -0.334  2.018   1.00 20.65  ? 129  PHE A CG  1 
ATOM   347  C CD1 . PHE A 1  51  ? 4.610   0.000   2.679   1.00 19.66  ? 129  PHE A CD1 1 
ATOM   348  C CD2 . PHE A 1  51  ? 5.720   -1.198  0.924   1.00 21.88  ? 129  PHE A CD2 1 
ATOM   349  C CE1 . PHE A 1  51  ? 3.381   -0.489  2.242   1.00 18.45  ? 129  PHE A CE1 1 
ATOM   350  C CE2 . PHE A 1  51  ? 4.493   -1.716  0.504   1.00 20.15  ? 129  PHE A CE2 1 
ATOM   351  C CZ  . PHE A 1  51  ? 3.326   -1.359  1.172   1.00 22.00  ? 129  PHE A CZ  1 
ATOM   352  N N   . PRO A 1  52  ? 8.816   2.781   3.955   1.00 21.87  ? 130  PRO A N   1 
ATOM   353  C CA  . PRO A 1  52  ? 10.167  2.807   4.539   1.00 23.67  ? 130  PRO A CA  1 
ATOM   354  C C   . PRO A 1  52  ? 10.530  1.403   5.044   1.00 24.72  ? 130  PRO A C   1 
ATOM   355  O O   . PRO A 1  52  ? 9.642   0.578   5.226   1.00 20.99  ? 130  PRO A O   1 
ATOM   356  C CB  . PRO A 1  52  ? 10.035  3.785   5.719   1.00 25.01  ? 130  PRO A CB  1 
ATOM   357  C CG  . PRO A 1  52  ? 8.581   3.743   6.094   1.00 25.84  ? 130  PRO A CG  1 
ATOM   358  C CD  . PRO A 1  52  ? 7.834   3.493   4.796   1.00 24.92  ? 130  PRO A CD  1 
ATOM   359  N N   . PRO A 1  53  ? 11.824  1.129   5.284   1.00 31.95  ? 131  PRO A N   1 
ATOM   360  C CA  . PRO A 1  53  ? 12.200  -0.199  5.819   1.00 35.31  ? 131  PRO A CA  1 
ATOM   361  C C   . PRO A 1  53  ? 11.533  -0.563  7.161   1.00 30.47  ? 131  PRO A C   1 
ATOM   362  O O   . PRO A 1  53  ? 11.393  -1.734  7.464   1.00 37.60  ? 131  PRO A O   1 
ATOM   363  C CB  . PRO A 1  53  ? 13.737  -0.123  5.956   1.00 37.52  ? 131  PRO A CB  1 
ATOM   364  C CG  . PRO A 1  53  ? 14.088  1.320   5.845   1.00 40.07  ? 131  PRO A CG  1 
ATOM   365  C CD  . PRO A 1  53  ? 12.987  2.009   5.092   1.00 32.58  ? 131  PRO A CD  1 
ATOM   366  N N   . SER A 1  54  ? 11.111  0.440   7.922   1.00 31.75  ? 132  SER A N   1 
ATOM   367  C CA  . SER A 1  54  ? 10.386  0.248   9.173   1.00 42.13  ? 132  SER A CA  1 
ATOM   368  C C   . SER A 1  54  ? 8.858   0.069   9.071   1.00 38.62  ? 132  SER A C   1 
ATOM   369  O O   . SER A 1  54  ? 8.214   -0.040  10.113  1.00 32.74  ? 132  SER A O   1 
ATOM   370  C CB  . SER A 1  54  ? 10.654  1.463   10.079  1.00 47.85  ? 132  SER A CB  1 
ATOM   371  O OG  . SER A 1  54  ? 10.034  2.632   9.547   1.00 48.12  ? 132  SER A OG  1 
ATOM   372  N N   . TYR A 1  55  ? 8.261   0.056   7.868   1.00 24.87  ? 133  TYR A N   1 
ATOM   373  C CA  . TYR A 1  55  ? 6.800   -0.031  7.778   1.00 24.98  ? 133  TYR A CA  1 
ATOM   374  C C   . TYR A 1  55  ? 6.330   -1.316  8.469   1.00 28.07  ? 133  TYR A C   1 
ATOM   375  O O   . TYR A 1  55  ? 6.979   -2.335  8.307   1.00 23.70  ? 133  TYR A O   1 
ATOM   376  C CB  . TYR A 1  55  ? 6.330   -0.038  6.321   1.00 26.22  ? 133  TYR A CB  1 
ATOM   377  C CG  . TYR A 1  55  ? 4.826   -0.113  6.171   1.00 22.40  ? 133  TYR A CG  1 
ATOM   378  C CD1 . TYR A 1  55  ? 4.046   1.034   6.109   1.00 23.35  ? 133  TYR A CD1 1 
ATOM   379  C CD2 . TYR A 1  55  ? 4.183   -1.341  6.081   1.00 24.98  ? 133  TYR A CD2 1 
ATOM   380  C CE1 . TYR A 1  55  ? 2.662   0.949   5.963   1.00 27.88  ? 133  TYR A CE1 1 
ATOM   381  C CE2 . TYR A 1  55  ? 2.808   -1.436  5.929   1.00 23.92  ? 133  TYR A CE2 1 
ATOM   382  C CZ  . TYR A 1  55  ? 2.046   -0.291  5.874   1.00 23.73  ? 133  TYR A CZ  1 
ATOM   383  O OH  . TYR A 1  55  ? 0.666   -0.403  5.735   1.00 27.19  ? 133  TYR A OH  1 
ATOM   384  N N   . PRO A 1  56  ? 5.204   -1.275  9.218   1.00 27.62  ? 134  PRO A N   1 
ATOM   385  C CA  . PRO A 1  56  ? 4.799   -2.500  9.953   1.00 27.08  ? 134  PRO A CA  1 
ATOM   386  C C   . PRO A 1  56  ? 4.518   -3.711  9.054   1.00 23.84  ? 134  PRO A C   1 
ATOM   387  O O   . PRO A 1  56  ? 3.793   -3.608  8.056   1.00 23.05  ? 134  PRO A O   1 
ATOM   388  C CB  . PRO A 1  56  ? 3.522   -2.070  10.706  1.00 25.29  ? 134  PRO A CB  1 
ATOM   389  C CG  . PRO A 1  56  ? 3.600   -0.573  10.788  1.00 27.53  ? 134  PRO A CG  1 
ATOM   390  C CD  . PRO A 1  56  ? 4.334   -0.123  9.548   1.00 27.36  ? 134  PRO A CD  1 
ATOM   391  N N   . SER A 1  57  ? 5.112   -4.844  9.405   1.00 21.61  ? 135  SER A N   1 
ATOM   392  C CA  . SER A 1  57  ? 4.892   -6.109  8.697   1.00 23.13  ? 135  SER A CA  1 
ATOM   393  C C   . SER A 1  57  ? 4.382   -7.097  9.741   1.00 21.53  ? 135  SER A C   1 
ATOM   394  O O   . SER A 1  57  ? 3.647   -6.703  10.663  1.00 24.42  ? 135  SER A O   1 
ATOM   395  C CB  . SER A 1  57  ? 6.189   -6.562  8.024   1.00 20.62  ? 135  SER A CB  1 
ATOM   396  O OG  . SER A 1  57  ? 6.016   -7.752  7.260   1.00 18.57  ? 135  SER A OG  1 
ATOM   397  N N   . TYR A 1  58  ? 4.726   -8.368  9.587   1.00 20.17  ? 136  TYR A N   1 
ATOM   398  C CA  . TYR A 1  58  ? 4.499   -9.373  10.619  1.00 18.92  ? 136  TYR A CA  1 
ATOM   399  C C   . TYR A 1  58  ? 5.835   -9.652  11.323  1.00 20.14  ? 136  TYR A C   1 
ATOM   400  O O   . TYR A 1  58  ? 6.919   -9.488  10.740  1.00 21.12  ? 136  TYR A O   1 
ATOM   401  C CB  . TYR A 1  58  ? 3.943   -10.651 10.001  1.00 20.16  ? 136  TYR A CB  1 
ATOM   402  C CG  . TYR A 1  58  ? 2.501   -10.569 9.553   1.00 19.49  ? 136  TYR A CG  1 
ATOM   403  C CD1 . TYR A 1  58  ? 2.140   -9.829  8.435   1.00 18.73  ? 136  TYR A CD1 1 
ATOM   404  C CD2 . TYR A 1  58  ? 1.491   -11.240 10.251  1.00 18.32  ? 136  TYR A CD2 1 
ATOM   405  C CE1 . TYR A 1  58  ? 0.824   -9.764  8.023   1.00 18.90  ? 136  TYR A CE1 1 
ATOM   406  C CE2 . TYR A 1  58  ? 0.172   -11.164 9.855   1.00 18.31  ? 136  TYR A CE2 1 
ATOM   407  C CZ  . TYR A 1  58  ? -0.163  -10.441 8.730   1.00 18.27  ? 136  TYR A CZ  1 
ATOM   408  O OH  . TYR A 1  58  ? -1.485  -10.331 8.313   1.00 16.03  ? 136  TYR A OH  1 
ATOM   409  N N   . LYS A 1  59  ? 5.745   -10.051 12.580  1.00 20.29  ? 137  LYS A N   1 
ATOM   410  C CA  . LYS A 1  59  ? 6.886   -10.497 13.359  1.00 20.79  ? 137  LYS A CA  1 
ATOM   411  C C   . LYS A 1  59  ? 6.878   -12.026 13.467  1.00 20.60  ? 137  LYS A C   1 
ATOM   412  O O   . LYS A 1  59  ? 5.852   -12.617 13.765  1.00 19.85  ? 137  LYS A O   1 
ATOM   413  C CB  . LYS A 1  59  ? 6.808   -9.917  14.770  1.00 24.63  ? 137  LYS A CB  1 
ATOM   414  C CG  . LYS A 1  59  ? 7.993   -10.306 15.639  1.00 30.47  ? 137  LYS A CG  1 
ATOM   415  C CD  . LYS A 1  59  ? 7.876   -9.743  17.045  1.00 35.57  ? 137  LYS A CD  1 
ATOM   416  C CE  . LYS A 1  59  ? 9.073   -10.155 17.876  1.00 37.66  ? 137  LYS A CE  1 
ATOM   417  N NZ  . LYS A 1  59  ? 9.015   -9.508  19.222  1.00 41.89  ? 137  LYS A NZ  1 
ATOM   418  N N   . LEU A 1  60  ? 8.026   -12.653 13.268  1.00 19.63  ? 138  LEU A N   1 
ATOM   419  C CA  . LEU A 1  60  ? 8.170   -14.102 13.487  1.00 22.57  ? 138  LEU A CA  1 
ATOM   420  C C   . LEU A 1  60  ? 8.238   -14.386 14.980  1.00 23.06  ? 138  LEU A C   1 
ATOM   421  O O   . LEU A 1  60  ? 9.024   -13.755 15.662  1.00 18.16  ? 138  LEU A O   1 
ATOM   422  C CB  . LEU A 1  60  ? 9.478   -14.596 12.881  1.00 24.30  ? 138  LEU A CB  1 
ATOM   423  C CG  . LEU A 1  60  ? 9.836   -16.091 12.993  1.00 23.59  ? 138  LEU A CG  1 
ATOM   424  C CD1 . LEU A 1  60  ? 9.240   -16.884 11.851  1.00 25.76  ? 138  LEU A CD1 1 
ATOM   425  C CD2 . LEU A 1  60  ? 11.346  -16.243 12.997  1.00 31.88  ? 138  LEU A CD2 1 
ATOM   426  N N   . GLU A 1  61  ? 7.451   -15.344 15.477  1.00 21.81  ? 139  GLU A N   1 
ATOM   427  C CA  . GLU A 1  61  ? 7.556   -15.774 16.884  1.00 22.47  ? 139  GLU A CA  1 
ATOM   428  C C   . GLU A 1  61  ? 7.405   -17.270 17.009  1.00 19.76  ? 139  GLU A C   1 
ATOM   429  O O   . GLU A 1  61  ? 6.703   -17.904 16.222  1.00 16.35  ? 139  GLU A O   1 
ATOM   430  C CB  . GLU A 1  61  ? 6.511   -15.095 17.772  1.00 26.66  ? 139  GLU A CB  1 
ATOM   431  C CG  . GLU A 1  61  ? 6.410   -13.598 17.566  1.00 35.27  ? 139  GLU A CG  1 
ATOM   432  C CD  . GLU A 1  61  ? 5.606   -12.917 18.643  1.00 42.38  ? 139  GLU A CD  1 
ATOM   433  O OE1 . GLU A 1  61  ? 4.478   -12.479 18.326  1.00 42.21  ? 139  GLU A OE1 1 
ATOM   434  O OE2 . GLU A 1  61  ? 6.103   -12.863 19.795  1.00 47.14  ? 139  GLU A OE2 1 
ATOM   435  N N   . ASN A 1  62  ? 8.079   -17.827 18.009  1.00 18.33  ? 140  ASN A N   1 
ATOM   436  C CA  . ASN A 1  62  ? 8.007   -19.243 18.324  1.00 20.04  ? 140  ASN A CA  1 
ATOM   437  C C   . ASN A 1  62  ? 8.421   -20.170 17.189  1.00 21.17  ? 140  ASN A C   1 
ATOM   438  O O   . ASN A 1  62  ? 7.788   -21.195 16.938  1.00 19.55  ? 140  ASN A O   1 
ATOM   439  C CB  . ASN A 1  62  ? 6.597   -19.550 18.873  1.00 23.72  ? 140  ASN A CB  1 
ATOM   440  C CG  . ASN A 1  62  ? 6.377   -18.925 20.243  1.00 28.10  ? 140  ASN A CG  1 
ATOM   441  O OD1 . ASN A 1  62  ? 7.340   -18.621 20.940  1.00 24.62  ? 140  ASN A OD1 1 
ATOM   442  N ND2 . ASN A 1  62  ? 5.128   -18.737 20.632  1.00 38.35  ? 140  ASN A ND2 1 
ATOM   443  N N   . LEU A 1  63  ? 9.503   -19.807 16.497  1.00 19.72  ? 141  LEU A N   1 
ATOM   444  C CA  . LEU A 1  63  ? 10.041  -20.674 15.468  1.00 20.81  ? 141  LEU A CA  1 
ATOM   445  C C   . LEU A 1  63  ? 10.459  -21.987 16.105  1.00 21.83  ? 141  LEU A C   1 
ATOM   446  O O   . LEU A 1  63  ? 11.122  -21.991 17.140  1.00 24.39  ? 141  LEU A O   1 
ATOM   447  C CB  . LEU A 1  63  ? 11.244  -20.033 14.791  1.00 23.01  ? 141  LEU A CB  1 
ATOM   448  C CG  . LEU A 1  63  ? 11.923  -20.898 13.716  1.00 22.18  ? 141  LEU A CG  1 
ATOM   449  C CD1 . LEU A 1  63  ? 11.063  -21.004 12.465  1.00 24.70  ? 141  LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1  63  ? 13.275  -20.312 13.350  1.00 25.45  ? 141  LEU A CD2 1 
ATOM   451  N N   . SER A 1  64  ? 10.065  -23.090 15.486  1.00 22.09  ? 142  SER A N   1 
ATOM   452  C CA  . SER A 1  64  ? 10.326  -24.426 16.028  1.00 24.95  ? 142  SER A CA  1 
ATOM   453  C C   . SER A 1  64  ? 10.736  -25.362 14.914  1.00 25.76  ? 142  SER A C   1 
ATOM   454  O O   . SER A 1  64  ? 10.256  -25.206 13.778  1.00 21.06  ? 142  SER A O   1 
ATOM   455  C CB  . SER A 1  64  ? 9.048   -24.964 16.686  1.00 27.14  ? 142  SER A CB  1 
ATOM   456  O OG  . SER A 1  64  ? 9.324   -26.173 17.314  1.00 36.72  ? 142  SER A OG  1 
ATOM   457  N N   . SER A 1  65  ? 11.586  -26.346 15.231  1.00 21.94  ? 143  SER A N   1 
ATOM   458  C CA  . SER A 1  65  ? 12.083  -27.291 14.229  1.00 30.02  ? 143  SER A CA  1 
ATOM   459  C C   . SER A 1  65  ? 11.414  -28.638 14.384  1.00 37.82  ? 143  SER A C   1 
ATOM   460  O O   . SER A 1  65  ? 11.565  -29.291 15.415  1.00 40.70  ? 143  SER A O   1 
ATOM   461  C CB  . SER A 1  65  ? 13.598  -27.454 14.311  1.00 34.44  ? 143  SER A CB  1 
ATOM   462  O OG  . SER A 1  65  ? 14.075  -28.274 13.256  1.00 40.50  ? 143  SER A OG  1 
ATOM   463  N N   . SER A 1  66  ? 10.685  -29.033 13.342  1.00 41.14  ? 144  SER A N   1 
ATOM   464  C CA  . SER A 1  66  ? 9.956   -30.302 13.274  1.00 54.46  ? 144  SER A CA  1 
ATOM   465  C C   . SER A 1  66  ? 10.739  -31.312 12.452  1.00 53.95  ? 144  SER A C   1 
ATOM   466  O O   . SER A 1  66  ? 11.773  -31.000 11.871  1.00 43.34  ? 144  SER A O   1 
ATOM   467  C CB  . SER A 1  66  ? 8.574   -30.093 12.615  1.00 64.66  ? 144  SER A CB  1 
ATOM   468  O OG  . SER A 1  66  ? 8.107   -28.751 12.743  1.00 55.35  ? 144  SER A OG  1 
ATOM   469  N N   . GLU A 1  67  ? 10.212  -32.523 12.389  1.00 65.07  ? 145  GLU A N   1 
ATOM   470  C CA  . GLU A 1  67  ? 10.767  -33.570 11.552  1.00 55.26  ? 145  GLU A CA  1 
ATOM   471  C C   . GLU A 1  67  ? 10.713  -33.202 10.059  1.00 60.65  ? 145  GLU A C   1 
ATOM   472  O O   . GLU A 1  67  ? 11.638  -33.528 9.324   1.00 67.22  ? 145  GLU A O   1 
ATOM   473  C CB  . GLU A 1  67  ? 10.007  -34.872 11.806  1.00 78.31  ? 145  GLU A CB  1 
ATOM   474  C CG  . GLU A 1  67  ? 10.487  -36.086 11.025  1.00 79.96  ? 145  GLU A CG  1 
ATOM   475  C CD  . GLU A 1  67  ? 9.555   -37.275 11.174  1.00 97.09  ? 145  GLU A CD  1 
ATOM   476  O OE1 . GLU A 1  67  ? 8.774   -37.314 12.153  1.00 92.38  ? 145  GLU A OE1 1 
ATOM   477  O OE2 . GLU A 1  67  ? 9.606   -38.176 10.308  1.00 96.51  ? 145  GLU A OE2 1 
ATOM   478  N N   . MET A 1  68  ? 9.664   -32.526 9.602   1.00 48.27  ? 146  MET A N   1 
ATOM   479  C CA  . MET A 1  68  ? 9.608   -32.129 8.180   1.00 67.96  ? 146  MET A CA  1 
ATOM   480  C C   . MET A 1  68  ? 10.349  -30.811 7.892   1.00 61.02  ? 146  MET A C   1 
ATOM   481  O O   . MET A 1  68  ? 10.834  -30.586 6.755   1.00 37.03  ? 146  MET A O   1 
ATOM   482  C CB  . MET A 1  68  ? 8.156   -32.072 7.682   1.00 74.38  ? 146  MET A CB  1 
ATOM   483  C CG  . MET A 1  68  ? 7.981   -31.974 6.154   1.00 93.02  ? 146  MET A CG  1 
ATOM   484  S SD  . MET A 1  68  ? 8.722   -33.206 5.037   1.00 95.91  ? 146  MET A SD  1 
ATOM   485  C CE  . MET A 1  68  ? 8.464   -34.732 5.948   1.00 78.19  ? 146  MET A CE  1 
ATOM   486  N N   . GLY A 1  69  ? 10.439  -29.943 8.903   1.00 33.87  ? 147  GLY A N   1 
ATOM   487  C CA  . GLY A 1  69  ? 11.081  -28.640 8.725   1.00 29.66  ? 147  GLY A CA  1 
ATOM   488  C C   . GLY A 1  69  ? 10.794  -27.683 9.873   1.00 28.08  ? 147  GLY A C   1 
ATOM   489  O O   . GLY A 1  69  ? 11.121  -27.971 11.004  1.00 29.91  ? 147  GLY A O   1 
ATOM   490  N N   . TYR A 1  70  ? 10.156  -26.556 9.587   1.00 24.79  ? 148  TYR A N   1 
ATOM   491  C CA  . TYR A 1  70  ? 9.974   -25.491 10.562  1.00 22.20  ? 148  TYR A CA  1 
ATOM   492  C C   . TYR A 1  70  ? 8.513   -25.117 10.678  1.00 22.19  ? 148  TYR A C   1 
ATOM   493  O O   . TYR A 1  70  ? 7.773   -25.218 9.704   1.00 18.38  ? 148  TYR A O   1 
ATOM   494  C CB  . TYR A 1  70  ? 10.759  -24.255 10.123  1.00 23.07  ? 148  TYR A CB  1 
ATOM   495  C CG  . TYR A 1  70  ? 12.232  -24.502 10.097  1.00 25.45  ? 148  TYR A CG  1 
ATOM   496  C CD1 . TYR A 1  70  ? 12.957  -24.486 11.280  1.00 28.35  ? 148  TYR A CD1 1 
ATOM   497  C CD2 . TYR A 1  70  ? 12.902  -24.791 8.913   1.00 29.28  ? 148  TYR A CD2 1 
ATOM   498  C CE1 . TYR A 1  70  ? 14.311  -24.738 11.300  1.00 31.46  ? 148  TYR A CE1 1 
ATOM   499  C CE2 . TYR A 1  70  ? 14.271  -25.054 8.922   1.00 31.60  ? 148  TYR A CE2 1 
ATOM   500  C CZ  . TYR A 1  70  ? 14.963  -25.020 10.126  1.00 34.69  ? 148  TYR A CZ  1 
ATOM   501  O OH  . TYR A 1  70  ? 16.301  -25.259 10.215  1.00 34.41  ? 148  TYR A OH  1 
ATOM   502  N N   . THR A 1  71  ? 8.114   -24.664 11.863  1.00 18.16  ? 149  THR A N   1 
ATOM   503  C CA  A THR A 1  71  ? 6.813   -24.029 12.067  0.50 20.36  ? 149  THR A CA  1 
ATOM   504  C CA  B THR A 1  71  ? 6.823   -24.016 12.031  0.50 20.53  ? 149  THR A CA  1 
ATOM   505  C C   . THR A 1  71  ? 6.990   -22.765 12.897  1.00 20.25  ? 149  THR A C   1 
ATOM   506  O O   . THR A 1  71  ? 7.907   -22.668 13.731  1.00 18.50  ? 149  THR A O   1 
ATOM   507  C CB  A THR A 1  71  ? 5.781   -24.958 12.764  0.50 22.10  ? 149  THR A CB  1 
ATOM   508  C CB  B THR A 1  71  ? 5.736   -24.992 12.570  0.50 22.91  ? 149  THR A CB  1 
ATOM   509  O OG1 A THR A 1  71  ? 6.129   -25.161 14.136  0.50 26.30  ? 149  THR A OG1 1 
ATOM   510  O OG1 B THR A 1  71  ? 4.450   -24.358 12.542  0.50 25.50  ? 149  THR A OG1 1 
ATOM   511  C CG2 A THR A 1  71  ? 5.705   -26.289 12.084  0.50 22.62  ? 149  THR A CG2 1 
ATOM   512  C CG2 B THR A 1  71  ? 6.030   -25.460 13.984  0.50 24.86  ? 149  THR A CG2 1 
ATOM   513  N N   . ALA A 1  72  ? 6.128   -21.784 12.677  1.00 19.07  ? 150  ALA A N   1 
ATOM   514  C CA  . ALA A 1  72  ? 6.191   -20.549 13.462  1.00 19.13  ? 150  ALA A CA  1 
ATOM   515  C C   . ALA A 1  72  ? 4.871   -19.809 13.426  1.00 19.96  ? 150  ALA A C   1 
ATOM   516  O O   . ALA A 1  72  ? 3.998   -20.079 12.590  1.00 17.78  ? 150  ALA A O   1 
ATOM   517  C CB  . ALA A 1  72  ? 7.305   -19.629 12.937  1.00 19.93  ? 150  ALA A CB  1 
ATOM   518  N N   . THR A 1  73  ? 4.745   -18.850 14.329  1.00 17.28  ? 151  THR A N   1 
ATOM   519  C CA  . THR A 1  73  ? 3.624   -17.930 14.300  1.00 18.94  ? 151  THR A CA  1 
ATOM   520  C C   . THR A 1  73  ? 4.110   -16.598 13.768  1.00 20.01  ? 151  THR A C   1 
ATOM   521  O O   . THR A 1  73  ? 5.243   -16.173 14.067  1.00 21.48  ? 151  THR A O   1 
ATOM   522  C CB  . THR A 1  73  ? 3.038   -17.762 15.705  1.00 17.86  ? 151  THR A CB  1 
ATOM   523  O OG1 . THR A 1  73  ? 2.554   -19.027 16.137  1.00 20.74  ? 151  THR A OG1 1 
ATOM   524  C CG2 . THR A 1  73  ? 1.883   -16.787 15.732  1.00 20.65  ? 151  THR A CG2 1 
ATOM   525  N N   . LEU A 1  74  ? 3.247   -15.942 12.988  1.00 18.74  ? 152  LEU A N   1 
ATOM   526  C CA  . LEU A 1  74  ? 3.508   -14.603 12.481  1.00 19.40  ? 152  LEU A CA  1 
ATOM   527  C C   . LEU A 1  74  ? 2.436   -13.676 13.000  1.00 20.90  ? 152  LEU A C   1 
ATOM   528  O O   . LEU A 1  74  ? 1.237   -13.974 12.872  1.00 21.68  ? 152  LEU A O   1 
ATOM   529  C CB  . LEU A 1  74  ? 3.498   -14.573 10.949  1.00 18.31  ? 152  LEU A CB  1 
ATOM   530  C CG  . LEU A 1  74  ? 4.354   -15.600 10.214  1.00 19.16  ? 152  LEU A CG  1 
ATOM   531  C CD1 . LEU A 1  74  ? 4.139   -15.468 8.714   1.00 16.67  ? 152  LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1  74  ? 5.832   -15.418 10.566  1.00 21.16  ? 152  LEU A CD2 1 
ATOM   533  N N   . THR A 1  75  ? 2.850   -12.535 13.538  1.00 17.09  ? 153  THR A N   1 
ATOM   534  C CA  . THR A 1  75  ? 1.925   -11.609 14.172  1.00 19.25  ? 153  THR A CA  1 
ATOM   535  C C   . THR A 1  75  ? 2.074   -10.198 13.616  1.00 19.65  ? 153  THR A C   1 
ATOM   536  O O   . THR A 1  75  ? 3.178   -9.670  13.573  1.00 22.45  ? 153  THR A O   1 
ATOM   537  C CB  . THR A 1  75  ? 2.139   -11.572 15.682  1.00 22.45  ? 153  THR A CB  1 
ATOM   538  O OG1 . THR A 1  75  ? 1.981   -12.894 16.199  1.00 23.07  ? 153  THR A OG1 1 
ATOM   539  C CG2 . THR A 1  75  ? 1.118   -10.598 16.365  1.00 26.70  ? 153  THR A CG2 1 
ATOM   540  N N   . ARG A 1  76  ? 0.957   -9.621  13.180  1.00 18.46  ? 154  ARG A N   1 
ATOM   541  C CA  . ARG A 1  76  ? 0.878   -8.223  12.787  1.00 20.09  ? 154  ARG A CA  1 
ATOM   542  C C   . ARG A 1  76  ? 0.202   -7.479  13.923  1.00 21.60  ? 154  ARG A C   1 
ATOM   543  O O   . ARG A 1  76  ? -0.874  -7.890  14.393  1.00 20.91  ? 154  ARG A O   1 
ATOM   544  C CB  . ARG A 1  76  ? 0.072   -8.057  11.480  1.00 19.42  ? 154  ARG A CB  1 
ATOM   545  C CG  . ARG A 1  76  ? -0.166  -6.605  11.104  1.00 20.71  ? 154  ARG A CG  1 
ATOM   546  C CD  . ARG A 1  76  ? -0.922  -6.415  9.790   1.00 20.72  ? 154  ARG A CD  1 
ATOM   547  N NE  . ARG A 1  76  ? -0.036  -6.519  8.655   1.00 18.00  ? 154  ARG A NE  1 
ATOM   548  C CZ  . ARG A 1  76  ? 0.877   -5.621  8.301   1.00 19.34  ? 154  ARG A CZ  1 
ATOM   549  N NH1 . ARG A 1  76  ? 1.639   -5.882  7.239   1.00 19.37  ? 154  ARG A NH1 1 
ATOM   550  N NH2 . ARG A 1  76  ? 1.062   -4.477  8.988   1.00 21.78  ? 154  ARG A NH2 1 
ATOM   551  N N   . THR A 1  77  ? 0.849   -6.393  14.350  1.00 23.54  ? 155  THR A N   1 
ATOM   552  C CA  A THR A 1  77  ? 0.392   -5.543  15.437  0.50 26.09  ? 155  THR A CA  1 
ATOM   553  C CA  B THR A 1  77  ? 0.322   -5.579  15.433  0.50 26.86  ? 155  THR A CA  1 
ATOM   554  C C   . THR A 1  77  ? -0.309  -4.279  14.933  1.00 25.22  ? 155  THR A C   1 
ATOM   555  O O   . THR A 1  77  ? -1.228  -3.792  15.564  1.00 34.26  ? 155  THR A O   1 
ATOM   556  C CB  A THR A 1  77  ? 1.582   -5.109  16.315  0.50 25.15  ? 155  THR A CB  1 
ATOM   557  C CB  B THR A 1  77  ? 1.369   -5.324  16.542  0.50 26.99  ? 155  THR A CB  1 
ATOM   558  O OG1 A THR A 1  77  ? 2.367   -6.256  16.657  0.50 24.29  ? 155  THR A OG1 1 
ATOM   559  O OG1 B THR A 1  77  ? 2.625   -4.953  15.967  0.50 24.67  ? 155  THR A OG1 1 
ATOM   560  C CG2 A THR A 1  77  ? 1.097   -4.407  17.581  0.50 26.42  ? 155  THR A CG2 1 
ATOM   561  C CG2 B THR A 1  77  ? 1.555   -6.582  17.386  0.50 31.18  ? 155  THR A CG2 1 
ATOM   562  N N   . THR A 1  78  ? 0.152   -3.729  13.808  1.00 23.92  ? 156  THR A N   1 
ATOM   563  C CA  . THR A 1  78  ? -0.462  -2.516  13.220  1.00 22.52  ? 156  THR A CA  1 
ATOM   564  C C   . THR A 1  78  ? -1.222  -2.868  11.924  1.00 24.26  ? 156  THR A C   1 
ATOM   565  O O   . THR A 1  78  ? -0.648  -3.490  11.021  1.00 23.46  ? 156  THR A O   1 
ATOM   566  C CB  . THR A 1  78  ? 0.600   -1.453  12.912  1.00 24.23  ? 156  THR A CB  1 
ATOM   567  O OG1 . THR A 1  78  ? 1.397   -1.228  14.082  1.00 25.99  ? 156  THR A OG1 1 
ATOM   568  C CG2 . THR A 1  78  ? -0.045  -0.136  12.458  1.00 28.19  ? 156  THR A CG2 1 
ATOM   569  N N   . PRO A 1  79  ? -2.514  -2.501  11.836  1.00 22.14  ? 157  PRO A N   1 
ATOM   570  C CA  . PRO A 1  79  ? -3.263  -2.822  10.620  1.00 23.67  ? 157  PRO A CA  1 
ATOM   571  C C   . PRO A 1  79  ? -2.681  -2.189  9.357   1.00 21.95  ? 157  PRO A C   1 
ATOM   572  O O   . PRO A 1  79  ? -2.016  -1.135  9.420   1.00 21.17  ? 157  PRO A O   1 
ATOM   573  C CB  . PRO A 1  79  ? -4.666  -2.246  10.887  1.00 29.01  ? 157  PRO A CB  1 
ATOM   574  C CG  . PRO A 1  79  ? -4.771  -2.132  12.374  1.00 30.88  ? 157  PRO A CG  1 
ATOM   575  C CD  . PRO A 1  79  ? -3.379  -1.942  12.899  1.00 25.13  ? 157  PRO A CD  1 
ATOM   576  N N   . THR A 1  80  ? -2.899  -2.853  8.225   1.00 21.02  ? 158  THR A N   1 
ATOM   577  C CA  . THR A 1  80  ? -2.638  -2.253  6.924   1.00 22.82  ? 158  THR A CA  1 
ATOM   578  C C   . THR A 1  80  ? -3.829  -1.345  6.545   1.00 23.57  ? 158  THR A C   1 
ATOM   579  O O   . THR A 1  80  ? -4.794  -1.209  7.279   1.00 20.18  ? 158  THR A O   1 
ATOM   580  C CB  . THR A 1  80  ? -2.427  -3.302  5.808   1.00 24.56  ? 158  THR A CB  1 
ATOM   581  O OG1 . THR A 1  80  ? -3.661  -3.965  5.496   1.00 21.12  ? 158  THR A OG1 1 
ATOM   582  C CG2 . THR A 1  80  ? -1.354  -4.325  6.208   1.00 30.07  ? 158  THR A CG2 1 
ATOM   583  N N   . PHE A 1  81  ? -3.746  -0.751  5.376   1.00 21.49  ? 159  PHE A N   1 
ATOM   584  C CA  . PHE A 1  81  ? -4.842  0.040   4.825   1.00 23.68  ? 159  PHE A CA  1 
ATOM   585  C C   . PHE A 1  81  ? -5.868  -0.838  4.103   1.00 22.15  ? 159  PHE A C   1 
ATOM   586  O O   . PHE A 1  81  ? -6.815  -0.310  3.573   1.00 23.76  ? 159  PHE A O   1 
ATOM   587  C CB  . PHE A 1  81  ? -4.293  1.141   3.906   1.00 22.76  ? 159  PHE A CB  1 
ATOM   588  C CG  . PHE A 1  81  ? -3.249  0.649   2.944   1.00 22.87  ? 159  PHE A CG  1 
ATOM   589  C CD1 . PHE A 1  81  ? -3.612  -0.016  1.783   1.00 23.71  ? 159  PHE A CD1 1 
ATOM   590  C CD2 . PHE A 1  81  ? -1.902  0.809   3.230   1.00 24.57  ? 159  PHE A CD2 1 
ATOM   591  C CE1 . PHE A 1  81  ? -2.645  -0.496  0.911   1.00 21.44  ? 159  PHE A CE1 1 
ATOM   592  C CE2 . PHE A 1  81  ? -0.931  0.338   2.361   1.00 22.93  ? 159  PHE A CE2 1 
ATOM   593  C CZ  . PHE A 1  81  ? -1.303  -0.316  1.203   1.00 21.77  ? 159  PHE A CZ  1 
ATOM   594  N N   . PHE A 1  82  ? -5.717  -2.172  4.081   1.00 20.68  ? 160  PHE A N   1 
ATOM   595  C CA  . PHE A 1  82  ? -6.769  -3.031  3.529   1.00 20.39  ? 160  PHE A CA  1 
ATOM   596  C C   . PHE A 1  82  ? -7.693  -3.490  4.635   1.00 24.37  ? 160  PHE A C   1 
ATOM   597  O O   . PHE A 1  82  ? -7.267  -3.589  5.778   1.00 24.14  ? 160  PHE A O   1 
ATOM   598  C CB  . PHE A 1  82  ? -6.189  -4.260  2.828   1.00 23.99  ? 160  PHE A CB  1 
ATOM   599  C CG  . PHE A 1  82  ? -5.619  -3.957  1.485   1.00 24.83  ? 160  PHE A CG  1 
ATOM   600  C CD1 . PHE A 1  82  ? -6.462  -3.757  0.399   1.00 24.11  ? 160  PHE A CD1 1 
ATOM   601  C CD2 . PHE A 1  82  ? -4.247  -3.862  1.296   1.00 23.78  ? 160  PHE A CD2 1 
ATOM   602  C CE1 . PHE A 1  82  ? -5.952  -3.472  -0.850  1.00 21.74  ? 160  PHE A CE1 1 
ATOM   603  C CE2 . PHE A 1  82  ? -3.734  -3.569  0.037   1.00 22.97  ? 160  PHE A CE2 1 
ATOM   604  C CZ  . PHE A 1  82  ? -4.583  -3.375  -1.031  1.00 23.39  ? 160  PHE A CZ  1 
ATOM   605  N N   . PRO A 1  83  ? -8.954  -3.805  4.300   1.00 23.68  ? 161  PRO A N   1 
ATOM   606  C CA  . PRO A 1  83  ? -9.800  -4.337  5.369   1.00 24.23  ? 161  PRO A CA  1 
ATOM   607  C C   . PRO A 1  83  ? -9.450  -5.796  5.683   1.00 22.06  ? 161  PRO A C   1 
ATOM   608  O O   . PRO A 1  83  ? -8.847  -6.505  4.863   1.00 21.34  ? 161  PRO A O   1 
ATOM   609  C CB  . PRO A 1  83  ? -11.229 -4.185  4.812   1.00 25.66  ? 161  PRO A CB  1 
ATOM   610  C CG  . PRO A 1  83  ? -11.088 -3.936  3.334   1.00 27.27  ? 161  PRO A CG  1 
ATOM   611  C CD  . PRO A 1  83  ? -9.636  -3.799  2.989   1.00 25.25  ? 161  PRO A CD  1 
ATOM   612  N N   . LYS A 1  84  ? -9.792  -6.211  6.888   1.00 21.45  ? 162  LYS A N   1 
ATOM   613  C CA  . LYS A 1  84  ? -9.736  -7.609  7.306   1.00 23.34  ? 162  LYS A CA  1 
ATOM   614  C C   . LYS A 1  84  ? -8.343  -8.245  7.255   1.00 18.90  ? 162  LYS A C   1 
ATOM   615  O O   . LYS A 1  84  ? -8.193  -9.384  6.806   1.00 17.17  ? 162  LYS A O   1 
ATOM   616  C CB  . LYS A 1  84  ? -10.747 -8.442  6.512   1.00 27.41  ? 162  LYS A CB  1 
ATOM   617  C CG  . LYS A 1  84  ? -12.180 -7.947  6.704   1.00 39.22  ? 162  LYS A CG  1 
ATOM   618  C CD  . LYS A 1  84  ? -13.188 -8.874  6.046   1.00 47.29  ? 162  LYS A CD  1 
ATOM   619  C CE  . LYS A 1  84  ? -14.534 -8.196  5.853   1.00 55.63  ? 162  LYS A CE  1 
ATOM   620  N NZ  . LYS A 1  84  ? -15.342 -8.895  4.824   1.00 54.95  ? 162  LYS A NZ  1 
ATOM   621  N N   . ASP A 1  85  ? -7.346  -7.529  7.759   1.00 17.63  ? 163  ASP A N   1 
ATOM   622  C CA  . ASP A 1  85  ? -6.041  -8.139  8.034   1.00 20.04  ? 163  ASP A CA  1 
ATOM   623  C C   . ASP A 1  85  ? -6.238  -9.381  8.889   1.00 19.45  ? 163  ASP A C   1 
ATOM   624  O O   . ASP A 1  85  ? -7.073  -9.376  9.788   1.00 21.47  ? 163  ASP A O   1 
ATOM   625  C CB  . ASP A 1  85  ? -5.130  -7.200  8.827   1.00 19.39  ? 163  ASP A CB  1 
ATOM   626  C CG  . ASP A 1  85  ? -4.565  -6.076  8.009   1.00 19.57  ? 163  ASP A CG  1 
ATOM   627  O OD1 . ASP A 1  85  ? -3.993  -6.285  6.896   1.00 20.62  ? 163  ASP A OD1 1 
ATOM   628  O OD2 . ASP A 1  85  ? -4.631  -4.945  8.527   1.00 21.77  ? 163  ASP A OD2 1 
ATOM   629  N N   . ILE A 1  86  ? -5.481  -10.439 8.610   1.00 17.79  ? 164  ILE A N   1 
ATOM   630  C CA  . ILE A 1  86  ? -5.450  -11.590 9.482   1.00 20.57  ? 164  ILE A CA  1 
ATOM   631  C C   . ILE A 1  86  ? -4.183  -11.409 10.341  1.00 24.69  ? 164  ILE A C   1 
ATOM   632  O O   . ILE A 1  86  ? -3.046  -11.555 9.861   1.00 19.92  ? 164  ILE A O   1 
ATOM   633  C CB  . ILE A 1  86  ? -5.495  -12.897 8.683   1.00 21.92  ? 164  ILE A CB  1 
ATOM   634  C CG1 . ILE A 1  86  ? -6.784  -12.896 7.826   1.00 22.53  ? 164  ILE A CG1 1 
ATOM   635  C CG2 . ILE A 1  86  ? -5.474  -14.093 9.628   1.00 25.86  ? 164  ILE A CG2 1 
ATOM   636  C CD1 . ILE A 1  86  ? -6.728  -13.818 6.667   1.00 28.06  ? 164  ILE A CD1 1 
ATOM   637  N N   . LEU A 1  87  ? -4.389  -11.065 11.603  1.00 19.93  ? 165  LEU A N   1 
ATOM   638  C CA  . LEU A 1  87  ? -3.296  -10.555 12.447  1.00 20.85  ? 165  LEU A CA  1 
ATOM   639  C C   . LEU A 1  87  ? -2.345  -11.658 12.923  1.00 20.57  ? 165  LEU A C   1 
ATOM   640  O O   . LEU A 1  87  ? -1.163  -11.392 13.161  1.00 21.50  ? 165  LEU A O   1 
ATOM   641  C CB  . LEU A 1  87  ? -3.856  -9.742  13.628  1.00 22.30  ? 165  LEU A CB  1 
ATOM   642  C CG  . LEU A 1  87  ? -4.664  -8.480  13.262  1.00 24.44  ? 165  LEU A CG  1 
ATOM   643  C CD1 . LEU A 1  87  ? -5.168  -7.734  14.506  1.00 26.62  ? 165  LEU A CD1 1 
ATOM   644  C CD2 . LEU A 1  87  ? -3.866  -7.521  12.394  1.00 25.25  ? 165  LEU A CD2 1 
ATOM   645  N N   . THR A 1  88  ? -2.850  -12.888 13.027  1.00 20.16  ? 166  THR A N   1 
ATOM   646  C CA  . THR A 1  88  ? -2.073  -14.042 13.458  1.00 19.28  ? 166  THR A CA  1 
ATOM   647  C C   . THR A 1  88  ? -2.096  -15.091 12.356  1.00 19.00  ? 166  THR A C   1 
ATOM   648  O O   . THR A 1  88  ? -3.163  -15.557 11.944  1.00 19.95  ? 166  THR A O   1 
ATOM   649  C CB  . THR A 1  88  ? -2.666  -14.628 14.758  1.00 18.91  ? 166  THR A CB  1 
ATOM   650  O OG1 . THR A 1  88  ? -2.618  -13.628 15.778  1.00 18.30  ? 166  THR A OG1 1 
ATOM   651  C CG2 . THR A 1  88  ? -1.921  -15.872 15.204  1.00 23.40  ? 166  THR A CG2 1 
ATOM   652  N N   . LEU A 1  89  ? -0.911  -15.439 11.866  1.00 18.92  ? 167  LEU A N   1 
ATOM   653  C CA  . LEU A 1  89  ? -0.742  -16.449 10.820  1.00 19.29  ? 167  LEU A CA  1 
ATOM   654  C C   . LEU A 1  89  ? 0.137   -17.584 11.328  1.00 18.88  ? 167  LEU A C   1 
ATOM   655  O O   . LEU A 1  89  ? 0.831   -17.442 12.332  1.00 17.91  ? 167  LEU A O   1 
ATOM   656  C CB  . LEU A 1  89  ? -0.081  -15.827 9.599   1.00 20.37  ? 167  LEU A CB  1 
ATOM   657  C CG  . LEU A 1  89  ? -0.753  -14.597 8.978   1.00 20.18  ? 167  LEU A CG  1 
ATOM   658  C CD1 . LEU A 1  89  ? 0.110   -14.017 7.871   1.00 19.14  ? 167  LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1  89  ? -2.125  -14.974 8.448   1.00 19.50  ? 167  LEU A CD2 1 
ATOM   660  N N   . ARG A 1  90  ? 0.098   -18.699 10.614  1.00 19.76  ? 168  ARG A N   1 
ATOM   661  C CA  . ARG A 1  90  ? 0.963   -19.834 10.857  1.00 21.23  ? 168  ARG A CA  1 
ATOM   662  C C   . ARG A 1  90  ? 1.855   -20.032 9.638   1.00 18.59  ? 168  ARG A C   1 
ATOM   663  O O   . ARG A 1  90  ? 1.357   -20.072 8.507   1.00 18.19  ? 168  ARG A O   1 
ATOM   664  C CB  . ARG A 1  90  ? 0.095   -21.073 11.044  1.00 23.08  ? 168  ARG A CB  1 
ATOM   665  C CG  . ARG A 1  90  ? 0.818   -22.344 11.396  1.00 29.91  ? 168  ARG A CG  1 
ATOM   666  C CD  . ARG A 1  90  ? -0.162  -23.505 11.326  1.00 33.28  ? 168  ARG A CD  1 
ATOM   667  N NE  . ARG A 1  90  ? 0.514   -24.779 11.184  1.00 38.33  ? 168  ARG A NE  1 
ATOM   668  C CZ  . ARG A 1  90  ? 0.887   -25.598 12.168  1.00 39.94  ? 168  ARG A CZ  1 
ATOM   669  N NH1 . ARG A 1  90  ? 0.674   -25.309 13.450  1.00 53.99  ? 168  ARG A NH1 1 
ATOM   670  N NH2 . ARG A 1  90  ? 1.504   -26.734 11.856  1.00 40.93  ? 168  ARG A NH2 1 
ATOM   671  N N   . LEU A 1  91  ? 3.154   -20.189 9.881   1.00 17.27  ? 169  LEU A N   1 
ATOM   672  C CA  . LEU A 1  91  ? 4.146   -20.466 8.841   1.00 17.39  ? 169  LEU A CA  1 
ATOM   673  C C   . LEU A 1  91  ? 4.530   -21.936 8.956   1.00 16.69  ? 169  LEU A C   1 
ATOM   674  O O   . LEU A 1  91  ? 4.847   -22.389 10.041  1.00 18.21  ? 169  LEU A O   1 
ATOM   675  C CB  . LEU A 1  91  ? 5.396   -19.596 9.051   1.00 17.13  ? 169  LEU A CB  1 
ATOM   676  C CG  . LEU A 1  91  ? 6.604   -19.953 8.195   1.00 17.83  ? 169  LEU A CG  1 
ATOM   677  C CD1 . LEU A 1  91  ? 6.318   -19.635 6.735   1.00 19.96  ? 169  LEU A CD1 1 
ATOM   678  C CD2 . LEU A 1  91  ? 7.852   -19.209 8.656   1.00 24.25  ? 169  LEU A CD2 1 
ATOM   679  N N   . ASP A 1  92  ? 4.521   -22.672 7.846   1.00 15.52  ? 170  ASP A N   1 
ATOM   680  C CA  . ASP A 1  92  ? 5.044   -24.031 7.819   1.00 16.69  ? 170  ASP A CA  1 
ATOM   681  C C   . ASP A 1  92  ? 6.038   -24.158 6.677   1.00 17.66  ? 170  ASP A C   1 
ATOM   682  O O   . ASP A 1  92  ? 5.732   -23.799 5.533   1.00 17.34  ? 170  ASP A O   1 
ATOM   683  C CB  . ASP A 1  92  ? 3.909   -25.046 7.715   1.00 18.42  ? 170  ASP A CB  1 
ATOM   684  C CG  . ASP A 1  92  ? 3.070   -25.077 8.965   1.00 21.15  ? 170  ASP A CG  1 
ATOM   685  O OD1 . ASP A 1  92  ? 2.057   -24.355 9.029   1.00 25.83  ? 170  ASP A OD1 1 
ATOM   686  O OD2 . ASP A 1  92  ? 3.470   -25.748 9.922   1.00 23.75  ? 170  ASP A OD2 1 
ATOM   687  N N   . VAL A 1  93  ? 7.249   -24.611 7.001   1.00 17.23  ? 171  VAL A N   1 
ATOM   688  C CA  . VAL A 1  93  ? 8.306   -24.783 5.995   1.00 19.18  ? 171  VAL A CA  1 
ATOM   689  C C   . VAL A 1  93  ? 8.635   -26.271 5.935   1.00 23.38  ? 171  VAL A C   1 
ATOM   690  O O   . VAL A 1  93  ? 9.012   -26.863 6.963   1.00 23.18  ? 171  VAL A O   1 
ATOM   691  C CB  . VAL A 1  93  ? 9.574   -23.997 6.372   1.00 19.24  ? 171  VAL A CB  1 
ATOM   692  C CG1 . VAL A 1  93  ? 10.685  -24.204 5.331   1.00 19.73  ? 171  VAL A CG1 1 
ATOM   693  C CG2 . VAL A 1  93  ? 9.234   -22.525 6.570   1.00 20.34  ? 171  VAL A CG2 1 
ATOM   694  N N   . MET A 1  94  ? 8.507   -26.865 4.746   1.00 20.28  ? 172  MET A N   1 
ATOM   695  C CA  . MET A 1  94  ? 8.824   -28.286 4.530   1.00 19.96  ? 172  MET A CA  1 
ATOM   696  C C   . MET A 1  94  ? 9.971   -28.477 3.531   1.00 20.03  ? 172  MET A C   1 
ATOM   697  O O   . MET A 1  94  ? 9.881   -28.066 2.373   1.00 17.59  ? 172  MET A O   1 
ATOM   698  C CB  . MET A 1  94  ? 7.600   -29.013 4.000   1.00 20.00  ? 172  MET A CB  1 
ATOM   699  C CG  . MET A 1  94  ? 6.467   -29.176 5.006   1.00 26.37  ? 172  MET A CG  1 
ATOM   700  S SD  . MET A 1  94  ? 5.535   -27.703 5.438   1.00 27.68  ? 172  MET A SD  1 
ATOM   701  C CE  . MET A 1  94  ? 4.848   -27.226 3.864   1.00 25.84  ? 172  MET A CE  1 
ATOM   702  N N   . MET A 1  95  ? 11.010  -29.166 3.969   1.00 19.28  ? 173  MET A N   1 
ATOM   703  C CA  . MET A 1  95  ? 12.188  -29.424 3.161   1.00 19.27  ? 173  MET A CA  1 
ATOM   704  C C   . MET A 1  95  ? 11.916  -30.760 2.494   1.00 18.31  ? 173  MET A C   1 
ATOM   705  O O   . MET A 1  95  ? 12.219  -31.822 3.011   1.00 18.49  ? 173  MET A O   1 
ATOM   706  C CB  . MET A 1  95  ? 13.421  -29.365 4.057   1.00 22.99  ? 173  MET A CB  1 
ATOM   707  C CG  . MET A 1  95  ? 13.490  -27.999 4.769   1.00 31.75  ? 173  MET A CG  1 
ATOM   708  S SD  . MET A 1  95  ? 14.793  -27.834 5.966   1.00 53.20  ? 173  MET A SD  1 
ATOM   709  C CE  . MET A 1  95  ? 16.131  -27.177 4.978   1.00 53.42  ? 173  MET A CE  1 
ATOM   710  N N   . GLU A 1  96  ? 11.248  -30.697 1.350   1.00 20.60  ? 174  GLU A N   1 
ATOM   711  C CA  . GLU A 1  96  ? 10.572  -31.884 0.829   1.00 20.27  ? 174  GLU A CA  1 
ATOM   712  C C   . GLU A 1  96  ? 11.490  -32.834 0.095   1.00 22.36  ? 174  GLU A C   1 
ATOM   713  O O   . GLU A 1  96  ? 11.357  -34.034 0.259   1.00 22.12  ? 174  GLU A O   1 
ATOM   714  C CB  . GLU A 1  96  ? 9.379   -31.484 -0.038  1.00 21.55  ? 174  GLU A CB  1 
ATOM   715  C CG  . GLU A 1  96  ? 8.264   -30.932 0.809   1.00 19.44  ? 174  GLU A CG  1 
ATOM   716  C CD  . GLU A 1  96  ? 6.991   -30.639 0.057   1.00 23.39  ? 174  GLU A CD  1 
ATOM   717  O OE1 . GLU A 1  96  ? 6.993   -30.695 -1.175  1.00 20.17  ? 174  GLU A OE1 1 
ATOM   718  O OE2 . GLU A 1  96  ? 5.971   -30.341 0.721   1.00 18.62  ? 174  GLU A OE2 1 
ATOM   719  N N   . THR A 1  97  ? 12.376  -32.305 -0.742  1.00 20.24  ? 175  THR A N   1 
ATOM   720  C CA  . THR A 1  97  ? 13.427  -33.096 -1.391  1.00 21.84  ? 175  THR A CA  1 
ATOM   721  C C   . THR A 1  97  ? 14.678  -32.250 -1.422  1.00 22.02  ? 175  THR A C   1 
ATOM   722  O O   . THR A 1  97  ? 14.641  -31.088 -1.029  1.00 20.01  ? 175  THR A O   1 
ATOM   723  C CB  . THR A 1  97  ? 13.083  -33.481 -2.859  1.00 20.74  ? 175  THR A CB  1 
ATOM   724  O OG1 . THR A 1  97  ? 13.158  -32.328 -3.703  1.00 20.28  ? 175  THR A OG1 1 
ATOM   725  C CG2 . THR A 1  97  ? 11.705  -34.072 -2.968  1.00 21.96  ? 175  THR A CG2 1 
ATOM   726  N N   . GLU A 1  98  ? 15.770  -32.791 -1.958  1.00 20.08  ? 176  GLU A N   1 
ATOM   727  C CA  . GLU A 1  98  ? 16.988  -31.991 -2.096  1.00 23.38  ? 176  GLU A CA  1 
ATOM   728  C C   . GLU A 1  98  ? 16.814  -30.814 -3.067  1.00 20.38  ? 176  GLU A C   1 
ATOM   729  O O   . GLU A 1  98  ? 17.552  -29.853 -2.970  1.00 20.61  ? 176  GLU A O   1 
ATOM   730  C CB  . GLU A 1  98  ? 18.194  -32.857 -2.488  1.00 29.47  ? 176  GLU A CB  1 
ATOM   731  C CG  . GLU A 1  98  ? 18.230  -33.307 -3.931  1.00 40.69  ? 176  GLU A CG  1 
ATOM   732  C CD  . GLU A 1  98  ? 19.323  -34.334 -4.180  1.00 59.25  ? 176  GLU A CD  1 
ATOM   733  O OE1 . GLU A 1  98  ? 20.492  -34.045 -3.832  1.00 53.88  ? 176  GLU A OE1 1 
ATOM   734  O OE2 . GLU A 1  98  ? 19.010  -35.425 -4.716  1.00 70.58  ? 176  GLU A OE2 1 
ATOM   735  N N   . ASN A 1  99  ? 15.827  -30.891 -3.966  1.00 17.50  ? 177  ASN A N   1 
ATOM   736  C CA  . ASN A 1  99  ? 15.561  -29.861 -4.956  1.00 18.18  ? 177  ASN A CA  1 
ATOM   737  C C   . ASN A 1  99  ? 14.366  -28.998 -4.678  1.00 18.43  ? 177  ASN A C   1 
ATOM   738  O O   . ASN A 1  99  ? 14.234  -27.955 -5.306  1.00 18.57  ? 177  ASN A O   1 
ATOM   739  C CB  . ASN A 1  99  ? 15.294  -30.505 -6.317  1.00 22.42  ? 177  ASN A CB  1 
ATOM   740  C CG  . ASN A 1  99  ? 16.393  -31.439 -6.734  1.00 30.34  ? 177  ASN A CG  1 
ATOM   741  O OD1 . ASN A 1  99  ? 17.577  -31.158 -6.537  1.00 41.22  ? 177  ASN A OD1 1 
ATOM   742  N ND2 . ASN A 1  99  ? 16.012  -32.567 -7.297  1.00 29.91  ? 177  ASN A ND2 1 
ATOM   743  N N   . ARG A 1  100 ? 13.469  -29.452 -3.799  1.00 18.04  ? 178  ARG A N   1 
ATOM   744  C CA  . ARG A 1  100 ? 12.193  -28.802 -3.610  1.00 17.40  ? 178  ARG A CA  1 
ATOM   745  C C   . ARG A 1  100 ? 11.987  -28.369 -2.166  1.00 22.09  ? 178  ARG A C   1 
ATOM   746  O O   . ARG A 1  100 ? 11.938  -29.219 -1.270  1.00 21.27  ? 178  ARG A O   1 
ATOM   747  C CB  . ARG A 1  100 ? 11.061  -29.735 -4.014  1.00 18.27  ? 178  ARG A CB  1 
ATOM   748  C CG  . ARG A 1  100 ? 9.701   -29.097 -3.822  1.00 19.14  ? 178  ARG A CG  1 
ATOM   749  C CD  . ARG A 1  100 ? 8.575   -29.878 -4.436  1.00 19.43  ? 178  ARG A CD  1 
ATOM   750  N NE  . ARG A 1  100 ? 8.226   -31.032 -3.637  1.00 20.64  ? 178  ARG A NE  1 
ATOM   751  C CZ  . ARG A 1  100 ? 8.260   -32.302 -4.030  1.00 20.77  ? 178  ARG A CZ  1 
ATOM   752  N NH1 . ARG A 1  100 ? 8.622   -32.664 -5.248  1.00 22.19  ? 178  ARG A NH1 1 
ATOM   753  N NH2 . ARG A 1  100 ? 7.903   -33.233 -3.177  1.00 25.48  ? 178  ARG A NH2 1 
ATOM   754  N N   . LEU A 1  101 ? 11.843  -27.052 -1.976  1.00 19.00  ? 179  LEU A N   1 
ATOM   755  C CA  . LEU A 1  101 ? 11.501  -26.430 -0.694  1.00 21.88  ? 179  LEU A CA  1 
ATOM   756  C C   . LEU A 1  101 ? 10.060  -25.906 -0.815  1.00 21.02  ? 179  LEU A C   1 
ATOM   757  O O   . LEU A 1  101 ? 9.678   -25.364 -1.851  1.00 20.92  ? 179  LEU A O   1 
ATOM   758  C CB  . LEU A 1  101 ? 12.469  -25.278 -0.370  1.00 18.45  ? 179  LEU A CB  1 
ATOM   759  C CG  . LEU A 1  101 ? 12.252  -24.398 0.859   1.00 22.26  ? 179  LEU A CG  1 
ATOM   760  C CD1 . LEU A 1  101 ? 12.398  -25.188 2.164   1.00 19.69  ? 179  LEU A CD1 1 
ATOM   761  C CD2 . LEU A 1  101 ? 13.257  -23.253 0.831   1.00 23.89  ? 179  LEU A CD2 1 
ATOM   762  N N   . HIS A 1  102 ? 9.271   -26.088 0.242   1.00 18.95  ? 180  HIS A N   1 
ATOM   763  C CA  . HIS A 1  102 ? 7.843   -25.807 0.221   1.00 17.82  ? 180  HIS A CA  1 
ATOM   764  C C   . HIS A 1  102 ? 7.505   -25.036 1.500   1.00 21.53  ? 180  HIS A C   1 
ATOM   765  O O   . HIS A 1  102 ? 7.913   -25.429 2.600   1.00 17.98  ? 180  HIS A O   1 
ATOM   766  C CB  . HIS A 1  102 ? 7.097   -27.142 0.151   1.00 20.05  ? 180  HIS A CB  1 
ATOM   767  C CG  . HIS A 1  102 ? 5.613   -27.028 -0.003  1.00 21.69  ? 180  HIS A CG  1 
ATOM   768  N ND1 . HIS A 1  102 ? 4.754   -28.050 0.335   1.00 23.44  ? 180  HIS A ND1 1 
ATOM   769  C CD2 . HIS A 1  102 ? 4.833   -26.027 -0.471  1.00 25.59  ? 180  HIS A CD2 1 
ATOM   770  C CE1 . HIS A 1  102 ? 3.509   -27.682 0.087   1.00 19.68  ? 180  HIS A CE1 1 
ATOM   771  N NE2 . HIS A 1  102 ? 3.531   -26.454 -0.388  1.00 21.79  ? 180  HIS A NE2 1 
ATOM   772  N N   . PHE A 1  103 ? 6.830   -23.906 1.366   1.00 19.24  ? 181  PHE A N   1 
ATOM   773  C CA  . PHE A 1  103 ? 6.292   -23.242 2.550   1.00 18.11  ? 181  PHE A CA  1 
ATOM   774  C C   . PHE A 1  103 ? 4.892   -22.689 2.357   1.00 16.65  ? 181  PHE A C   1 
ATOM   775  O O   . PHE A 1  103 ? 4.496   -22.315 1.246   1.00 18.91  ? 181  PHE A O   1 
ATOM   776  C CB  . PHE A 1  103 ? 7.258   -22.191 3.139   1.00 17.38  ? 181  PHE A CB  1 
ATOM   777  C CG  . PHE A 1  103 ? 7.353   -20.883 2.372   1.00 17.48  ? 181  PHE A CG  1 
ATOM   778  C CD1 . PHE A 1  103 ? 6.477   -19.839 2.629   1.00 17.37  ? 181  PHE A CD1 1 
ATOM   779  C CD2 . PHE A 1  103 ? 8.380   -20.665 1.467   1.00 19.27  ? 181  PHE A CD2 1 
ATOM   780  C CE1 . PHE A 1  103 ? 6.598   -18.607 1.970   1.00 17.39  ? 181  PHE A CE1 1 
ATOM   781  C CE2 . PHE A 1  103 ? 8.525   -19.432 0.829   1.00 19.24  ? 181  PHE A CE2 1 
ATOM   782  C CZ  . PHE A 1  103 ? 7.623   -18.410 1.067   1.00 17.47  ? 181  PHE A CZ  1 
ATOM   783  N N   . THR A 1  104 ? 4.152   -22.677 3.457   1.00 18.01  ? 182  THR A N   1 
ATOM   784  C CA  . THR A 1  104 ? 2.812   -22.137 3.484   1.00 17.77  ? 182  THR A CA  1 
ATOM   785  C C   . THR A 1  104 ? 2.626   -21.113 4.595   1.00 18.96  ? 182  THR A C   1 
ATOM   786  O O   . THR A 1  104 ? 3.236   -21.210 5.659   1.00 19.10  ? 182  THR A O   1 
ATOM   787  C CB  . THR A 1  104 ? 1.790   -23.267 3.660   1.00 19.50  ? 182  THR A CB  1 
ATOM   788  O OG1 . THR A 1  104 ? 2.019   -23.921 4.912   1.00 21.53  ? 182  THR A OG1 1 
ATOM   789  C CG2 . THR A 1  104 ? 1.912   -24.288 2.521   1.00 20.93  ? 182  THR A CG2 1 
ATOM   790  N N   . ILE A 1  105 ? 1.788   -20.115 4.314   1.00 18.78  ? 183  ILE A N   1 
ATOM   791  C CA  . ILE A 1  105 ? 1.331   -19.150 5.290   1.00 16.62  ? 183  ILE A CA  1 
ATOM   792  C C   . ILE A 1  105 ? -0.202  -19.192 5.280   1.00 18.77  ? 183  ILE A C   1 
ATOM   793  O O   . ILE A 1  105 ? -0.834  -18.976 4.244   1.00 15.80  ? 183  ILE A O   1 
ATOM   794  C CB  . ILE A 1  105 ? 1.875   -17.736 5.020   1.00 17.77  ? 183  ILE A CB  1 
ATOM   795  C CG1 . ILE A 1  105 ? 3.426   -17.750 5.067   1.00 21.24  ? 183  ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1  105 ? 1.307   -16.761 6.041   1.00 17.74  ? 183  ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1  105 ? 4.088   -16.453 4.630   1.00 22.39  ? 183  ILE A CD1 1 
ATOM   798  N N   . LYS A 1  106 ? -0.773  -19.524 6.433   1.00 16.24  ? 184  LYS A N   1 
ATOM   799  C CA  . LYS A 1  106 ? -2.203  -19.827 6.583   1.00 22.92  ? 184  LYS A CA  1 
ATOM   800  C C   . LYS A 1  106 ? -2.761  -19.121 7.799   1.00 19.08  ? 184  LYS A C   1 
ATOM   801  O O   . LYS A 1  106 ? -2.010  -18.700 8.699   1.00 18.62  ? 184  LYS A O   1 
ATOM   802  C CB  . LYS A 1  106 ? -2.425  -21.332 6.846   1.00 25.03  ? 184  LYS A CB  1 
ATOM   803  C CG  . LYS A 1  106 ? -1.979  -22.266 5.751   1.00 28.44  ? 184  LYS A CG  1 
ATOM   804  C CD  . LYS A 1  106 ? -2.219  -23.714 6.159   1.00 29.82  ? 184  LYS A CD  1 
ATOM   805  C CE  . LYS A 1  106 ? -1.868  -24.634 5.005   1.00 28.67  ? 184  LYS A CE  1 
ATOM   806  N NZ  . LYS A 1  106 ? -2.037  -26.076 5.341   1.00 32.51  ? 184  LYS A NZ  1 
ATOM   807  N N   . ASP A 1  107 ? -4.085  -19.056 7.842   1.00 17.73  ? 185  ASP A N   1 
ATOM   808  C CA  . ASP A 1  107 ? -4.810  -18.573 9.002   1.00 19.04  ? 185  ASP A CA  1 
ATOM   809  C C   . ASP A 1  107 ? -5.041  -19.795 9.890   1.00 22.50  ? 185  ASP A C   1 
ATOM   810  O O   . ASP A 1  107 ? -5.827  -20.662 9.522   1.00 21.19  ? 185  ASP A O   1 
ATOM   811  C CB  . ASP A 1  107 ? -6.146  -17.941 8.570   1.00 17.11  ? 185  ASP A CB  1 
ATOM   812  C CG  . ASP A 1  107 ? -6.954  -17.404 9.730   1.00 19.09  ? 185  ASP A CG  1 
ATOM   813  O OD1 . ASP A 1  107 ? -6.619  -17.659 10.897  1.00 16.44  ? 185  ASP A OD1 1 
ATOM   814  O OD2 . ASP A 1  107 ? -7.955  -16.717 9.456   1.00 20.27  ? 185  ASP A OD2 1 
ATOM   815  N N   . PRO A 1  108 ? -4.354  -19.878 11.047  1.00 21.05  ? 186  PRO A N   1 
ATOM   816  C CA  . PRO A 1  108 ? -4.555  -21.055 11.892  1.00 24.79  ? 186  PRO A CA  1 
ATOM   817  C C   . PRO A 1  108 ? -5.962  -21.167 12.491  1.00 24.50  ? 186  PRO A C   1 
ATOM   818  O O   . PRO A 1  108 ? -6.332  -22.236 12.922  1.00 26.49  ? 186  PRO A O   1 
ATOM   819  C CB  . PRO A 1  108 ? -3.537  -20.851 13.028  1.00 25.26  ? 186  PRO A CB  1 
ATOM   820  C CG  . PRO A 1  108 ? -3.374  -19.367 13.103  1.00 23.72  ? 186  PRO A CG  1 
ATOM   821  C CD  . PRO A 1  108 ? -3.373  -18.956 11.656  1.00 24.14  ? 186  PRO A CD  1 
ATOM   822  N N   . ALA A 1  109 ? -6.719  -20.077 12.531  1.00 23.96  ? 187  ALA A N   1 
ATOM   823  C CA  . ALA A 1  109 ? -8.070  -20.087 13.098  1.00 27.20  ? 187  ALA A CA  1 
ATOM   824  C C   . ALA A 1  109 ? -9.178  -20.401 12.085  1.00 29.47  ? 187  ALA A C   1 
ATOM   825  O O   . ALA A 1  109 ? -10.321 -20.529 12.477  1.00 26.29  ? 187  ALA A O   1 
ATOM   826  C CB  . ALA A 1  109 ? -8.348  -18.737 13.743  1.00 25.68  ? 187  ALA A CB  1 
ATOM   827  N N   . ASN A 1  110 ? -8.875  -20.440 10.785  1.00 26.81  ? 188  ASN A N   1 
ATOM   828  C CA  . ASN A 1  110 ? -9.915  -20.632 9.759   1.00 27.62  ? 188  ASN A CA  1 
ATOM   829  C C   . ASN A 1  110 ? -9.331  -21.303 8.536   1.00 28.44  ? 188  ASN A C   1 
ATOM   830  O O   . ASN A 1  110 ? -8.305  -20.867 8.011   1.00 24.05  ? 188  ASN A O   1 
ATOM   831  C CB  . ASN A 1  110 ? -10.545 -19.303 9.320   1.00 31.38  ? 188  ASN A CB  1 
ATOM   832  C CG  . ASN A 1  110 ? -11.014 -18.454 10.481  1.00 48.10  ? 188  ASN A CG  1 
ATOM   833  O OD1 . ASN A 1  110 ? -10.419 -17.422 10.803  1.00 49.06  ? 188  ASN A OD1 1 
ATOM   834  N ND2 . ASN A 1  110 ? -12.071 -18.901 11.142  1.00 53.65  ? 188  ASN A ND2 1 
ATOM   835  N N   . ARG A 1  111 ? -9.991  -22.366 8.094   1.00 30.00  ? 189  ARG A N   1 
ATOM   836  C CA  . ARG A 1  111 ? -9.698  -22.997 6.821   1.00 32.02  ? 189  ARG A CA  1 
ATOM   837  C C   . ARG A 1  111 ? -10.027 -21.951 5.749   1.00 27.59  ? 189  ARG A C   1 
ATOM   838  O O   . ARG A 1  111 ? -11.102 -21.381 5.772   1.00 38.11  ? 189  ARG A O   1 
ATOM   839  C CB  . ARG A 1  111 ? -10.556 -24.262 6.677   1.00 36.60  ? 189  ARG A CB  1 
ATOM   840  C CG  . ARG A 1  111 ? -10.404 -25.062 5.385   1.00 50.05  ? 189  ARG A CG  1 
ATOM   841  C CD  . ARG A 1  111 ? -8.947  -25.279 5.041   1.00 55.58  ? 189  ARG A CD  1 
ATOM   842  N NE  . ARG A 1  111 ? -8.716  -26.386 4.112   1.00 79.90  ? 189  ARG A NE  1 
ATOM   843  C CZ  . ARG A 1  111 ? -8.959  -26.367 2.796   1.00 66.70  ? 189  ARG A CZ  1 
ATOM   844  N NH1 . ARG A 1  111 ? -9.494  -25.297 2.185   1.00 53.65  ? 189  ARG A NH1 1 
ATOM   845  N NH2 . ARG A 1  111 ? -8.688  -27.455 2.081   1.00 65.07  ? 189  ARG A NH2 1 
ATOM   846  N N   . ARG A 1  112 ? -9.054  -21.617 4.910   1.00 22.12  ? 190  ARG A N   1 
ATOM   847  C CA  . ARG A 1  112 ? -9.246  -20.680 3.805   1.00 18.78  ? 190  ARG A CA  1 
ATOM   848  C C   . ARG A 1  112 ? -9.244  -21.516 2.533   1.00 18.67  ? 190  ARG A C   1 
ATOM   849  O O   . ARG A 1  112 ? -8.751  -22.658 2.529   1.00 17.53  ? 190  ARG A O   1 
ATOM   850  C CB  . ARG A 1  112 ? -8.136  -19.604 3.780   1.00 18.64  ? 190  ARG A CB  1 
ATOM   851  C CG  . ARG A 1  112 ? -8.189  -18.616 4.933   1.00 17.69  ? 190  ARG A CG  1 
ATOM   852  C CD  . ARG A 1  112 ? -7.000  -17.644 4.948   1.00 19.68  ? 190  ARG A CD  1 
ATOM   853  N NE  . ARG A 1  112 ? -6.976  -16.854 3.729   1.00 18.45  ? 190  ARG A NE  1 
ATOM   854  C CZ  . ARG A 1  112 ? -7.782  -15.834 3.480   1.00 19.36  ? 190  ARG A CZ  1 
ATOM   855  N NH1 . ARG A 1  112 ? -8.667  -15.405 4.395   1.00 20.48  ? 190  ARG A NH1 1 
ATOM   856  N NH2 . ARG A 1  112 ? -7.714  -15.248 2.303   1.00 18.55  ? 190  ARG A NH2 1 
ATOM   857  N N   . TYR A 1  113 ? -9.821  -20.976 1.462   1.00 19.24  ? 191  TYR A N   1 
ATOM   858  C CA  . TYR A 1  113 ? -9.813  -21.657 0.163   1.00 20.54  ? 191  TYR A CA  1 
ATOM   859  C C   . TYR A 1  113 ? -8.383  -22.069 -0.262  1.00 17.58  ? 191  TYR A C   1 
ATOM   860  O O   . TYR A 1  113 ? -7.449  -21.265 -0.174  1.00 16.84  ? 191  TYR A O   1 
ATOM   861  C CB  . TYR A 1  113 ? -10.436 -20.765 -0.931  1.00 18.37  ? 191  TYR A CB  1 
ATOM   862  C CG  . TYR A 1  113 ? -10.142 -21.312 -2.304  1.00 17.21  ? 191  TYR A CG  1 
ATOM   863  C CD1 . TYR A 1  113 ? -10.876 -22.385 -2.814  1.00 17.55  ? 191  TYR A CD1 1 
ATOM   864  C CD2 . TYR A 1  113 ? -9.087  -20.820 -3.056  1.00 19.20  ? 191  TYR A CD2 1 
ATOM   865  C CE1 . TYR A 1  113 ? -10.584 -22.924 -4.056  1.00 17.50  ? 191  TYR A CE1 1 
ATOM   866  C CE2 . TYR A 1  113 ? -8.787  -21.363 -4.299  1.00 18.72  ? 191  TYR A CE2 1 
ATOM   867  C CZ  . TYR A 1  113 ? -9.544  -22.420 -4.792  1.00 17.32  ? 191  TYR A CZ  1 
ATOM   868  O OH  . TYR A 1  113 ? -9.258  -22.953 -6.033  1.00 14.99  ? 191  TYR A OH  1 
ATOM   869  N N   . GLU A 1  114 ? -8.232  -23.312 -0.712  1.00 16.86  ? 192  GLU A N   1 
ATOM   870  C CA  . GLU A 1  114 ? -6.969  -23.831 -1.244  1.00 19.21  ? 192  GLU A CA  1 
ATOM   871  C C   . GLU A 1  114 ? -7.240  -24.530 -2.563  1.00 19.26  ? 192  GLU A C   1 
ATOM   872  O O   . GLU A 1  114 ? -8.284  -25.153 -2.725  1.00 15.43  ? 192  GLU A O   1 
ATOM   873  C CB  . GLU A 1  114 ? -6.305  -24.800 -0.260  1.00 22.67  ? 192  GLU A CB  1 
ATOM   874  C CG  . GLU A 1  114 ? -5.847  -24.100 1.017   1.00 22.36  ? 192  GLU A CG  1 
ATOM   875  C CD  . GLU A 1  114 ? -5.069  -24.995 1.963   1.00 25.53  ? 192  GLU A CD  1 
ATOM   876  O OE1 . GLU A 1  114 ? -4.217  -25.763 1.499   1.00 27.91  ? 192  GLU A OE1 1 
ATOM   877  O OE2 . GLU A 1  114 ? -5.281  -24.888 3.179   1.00 24.02  ? 192  GLU A OE2 1 
ATOM   878  N N   . VAL A 1  115 ? -6.277  -24.438 -3.477  1.00 17.74  ? 193  VAL A N   1 
ATOM   879  C CA  . VAL A 1  115 ? -6.418  -25.001 -4.806  1.00 18.31  ? 193  VAL A CA  1 
ATOM   880  C C   . VAL A 1  115 ? -6.377  -26.530 -4.681  1.00 24.09  ? 193  VAL A C   1 
ATOM   881  O O   . VAL A 1  115 ? -5.458  -27.080 -4.075  1.00 21.78  ? 193  VAL A O   1 
ATOM   882  C CB  . VAL A 1  115 ? -5.298  -24.563 -5.751  1.00 17.16  ? 193  VAL A CB  1 
ATOM   883  C CG1 . VAL A 1  115 ? -5.508  -25.150 -7.155  1.00 20.23  ? 193  VAL A CG1 1 
ATOM   884  C CG2 . VAL A 1  115 ? -5.219  -23.049 -5.821  1.00 19.26  ? 193  VAL A CG2 1 
ATOM   885  N N   . PRO A 1  116 ? -7.382  -27.219 -5.228  1.00 26.14  ? 194  PRO A N   1 
ATOM   886  C CA  . PRO A 1  116 ? -7.315  -28.693 -5.143  1.00 32.94  ? 194  PRO A CA  1 
ATOM   887  C C   . PRO A 1  116 ? -6.150  -29.268 -5.990  1.00 33.60  ? 194  PRO A C   1 
ATOM   888  O O   . PRO A 1  116 ? -6.053  -28.968 -7.181  1.00 30.07  ? 194  PRO A O   1 
ATOM   889  C CB  . PRO A 1  116 ? -8.698  -29.133 -5.638  1.00 36.81  ? 194  PRO A CB  1 
ATOM   890  C CG  . PRO A 1  116 ? -9.242  -27.975 -6.411  1.00 35.74  ? 194  PRO A CG  1 
ATOM   891  C CD  . PRO A 1  116 ? -8.660  -26.742 -5.788  1.00 27.23  ? 194  PRO A CD  1 
ATOM   892  N N   . LEU A 1  117 ? -5.250  -30.023 -5.350  1.00 32.90  ? 195  LEU A N   1 
ATOM   893  C CA  . LEU A 1  117 ? -4.049  -30.596 -6.001  1.00 43.86  ? 195  LEU A CA  1 
ATOM   894  C C   . LEU A 1  117 ? -3.603  -31.868 -5.276  1.00 52.83  ? 195  LEU A C   1 
ATOM   895  O O   . LEU A 1  117 ? -3.440  -31.849 -4.051  1.00 60.62  ? 195  LEU A O   1 
ATOM   896  C CB  . LEU A 1  117 ? -2.879  -29.587 -6.007  1.00 39.31  ? 195  LEU A CB  1 
ATOM   897  C CG  . LEU A 1  117 ? -1.450  -30.087 -6.400  1.00 41.17  ? 195  LEU A CG  1 
ATOM   898  C CD1 . LEU A 1  117 ? -0.908  -29.373 -7.633  1.00 38.31  ? 195  LEU A CD1 1 
ATOM   899  C CD2 . LEU A 1  117 ? -0.448  -30.015 -5.237  1.00 44.12  ? 195  LEU A CD2 1 
ATOM   900  N N   . GLU A 1  118 ? -3.391  -32.955 -6.025  1.00 53.04  ? 196  GLU A N   1 
ATOM   901  C CA  . GLU A 1  118 ? -2.767  -34.177 -5.470  1.00 72.69  ? 196  GLU A CA  1 
ATOM   902  C C   . GLU A 1  118 ? -1.297  -33.888 -5.174  1.00 55.40  ? 196  GLU A C   1 
ATOM   903  O O   . GLU A 1  118 ? -0.604  -33.344 -6.026  1.00 55.82  ? 196  GLU A O   1 
ATOM   904  C CB  . GLU A 1  118 ? -2.838  -35.350 -6.456  1.00 72.21  ? 196  GLU A CB  1 
ATOM   905  C CG  . GLU A 1  118 ? -4.225  -35.916 -6.722  1.00 76.70  ? 196  GLU A CG  1 
ATOM   906  C CD  . GLU A 1  118 ? -4.242  -36.903 -7.886  1.00 83.12  ? 196  GLU A CD  1 
ATOM   907  O OE1 . GLU A 1  118 ? -3.192  -37.513 -8.195  1.00 63.55  ? 196  GLU A OE1 1 
ATOM   908  O OE2 . GLU A 1  118 ? -5.313  -37.071 -8.501  1.00 83.99  ? 196  GLU A OE2 1 
ATOM   909  N N   . THR A 1  119 ? -0.824  -34.234 -3.978  1.00 73.95  ? 197  THR A N   1 
ATOM   910  C CA  . THR A 1  119 ? 0.596   -34.037 -3.627  1.00 91.12  ? 197  THR A CA  1 
ATOM   911  C C   . THR A 1  119 ? 1.467   -35.095 -4.352  1.00 82.51  ? 197  THR A C   1 
ATOM   912  O O   . THR A 1  119 ? 0.967   -36.178 -4.669  1.00 65.39  ? 197  THR A O   1 
ATOM   913  C CB  . THR A 1  119 ? 0.811   -34.019 -2.096  1.00 96.32  ? 197  THR A CB  1 
ATOM   914  O OG1 . THR A 1  119 ? 0.166   -35.151 -1.499  1.00 106.20 ? 197  THR A OG1 1 
ATOM   915  C CG2 . THR A 1  119 ? 0.243   -32.718 -1.493  1.00 75.37  ? 197  THR A CG2 1 
ATOM   916  N N   . PRO A 1  120 ? 2.759   -34.778 -4.629  1.00 89.69  ? 198  PRO A N   1 
ATOM   917  C CA  . PRO A 1  120 ? 3.556   -35.468 -5.676  1.00 94.31  ? 198  PRO A CA  1 
ATOM   918  C C   . PRO A 1  120 ? 3.570   -37.002 -5.655  1.00 87.33  ? 198  PRO A C   1 
ATOM   919  O O   . PRO A 1  120 ? 3.960   -37.607 -4.659  1.00 100.54 ? 198  PRO A O   1 
ATOM   920  C CB  . PRO A 1  120 ? 4.975   -34.915 -5.451  1.00 83.59  ? 198  PRO A CB  1 
ATOM   921  C CG  . PRO A 1  120 ? 4.753   -33.584 -4.814  1.00 74.32  ? 198  PRO A CG  1 
ATOM   922  C CD  . PRO A 1  120 ? 3.597   -33.814 -3.886  1.00 83.94  ? 198  PRO A CD  1 
ATOM   923  N N   . SER A 1  128 ? 22.692  -33.281 1.501   1.00 44.29  ? 206  SER A N   1 
ATOM   924  C CA  . SER A 1  128 ? 22.184  -31.952 1.859   1.00 37.75  ? 206  SER A CA  1 
ATOM   925  C C   . SER A 1  128 ? 21.348  -31.390 0.722   1.00 36.82  ? 206  SER A C   1 
ATOM   926  O O   . SER A 1  128 ? 21.674  -31.616 -0.440  1.00 33.89  ? 206  SER A O   1 
ATOM   927  C CB  . SER A 1  128 ? 23.333  -30.985 2.136   1.00 38.87  ? 206  SER A CB  1 
ATOM   928  O OG  . SER A 1  128 ? 22.863  -29.738 2.622   1.00 35.17  ? 206  SER A OG  1 
ATOM   929  N N   . PRO A 1  129 ? 20.281  -30.636 1.042   1.00 27.90  ? 207  PRO A N   1 
ATOM   930  C CA  . PRO A 1  129 ? 19.530  -30.048 -0.067  1.00 25.30  ? 207  PRO A CA  1 
ATOM   931  C C   . PRO A 1  129 ? 20.361  -29.017 -0.817  1.00 22.62  ? 207  PRO A C   1 
ATOM   932  O O   . PRO A 1  129 ? 21.430  -28.621 -0.350  1.00 25.04  ? 207  PRO A O   1 
ATOM   933  C CB  . PRO A 1  129 ? 18.317  -29.405 0.618   1.00 23.82  ? 207  PRO A CB  1 
ATOM   934  C CG  . PRO A 1  129 ? 18.225  -30.054 1.946   1.00 22.11  ? 207  PRO A CG  1 
ATOM   935  C CD  . PRO A 1  129 ? 19.623  -30.382 2.338   1.00 28.62  ? 207  PRO A CD  1 
ATOM   936  N N   . LEU A 1  130 ? 19.882  -28.612 -1.986  1.00 21.27  ? 208  LEU A N   1 
ATOM   937  C CA  . LEU A 1  130 ? 20.567  -27.612 -2.792  1.00 22.40  ? 208  LEU A CA  1 
ATOM   938  C C   . LEU A 1  130 ? 20.348  -26.196 -2.237  1.00 21.51  ? 208  LEU A C   1 
ATOM   939  O O   . LEU A 1  130 ? 21.053  -25.277 -2.625  1.00 17.19  ? 208  LEU A O   1 
ATOM   940  C CB  . LEU A 1  130 ? 20.095  -27.664 -4.240  1.00 22.70  ? 208  LEU A CB  1 
ATOM   941  C CG  . LEU A 1  130 ? 20.372  -28.952 -5.025  1.00 28.89  ? 208  LEU A CG  1 
ATOM   942  C CD1 . LEU A 1  130 ? 19.928  -28.784 -6.480  1.00 30.53  ? 208  LEU A CD1 1 
ATOM   943  C CD2 . LEU A 1  130 ? 21.822  -29.360 -4.968  1.00 28.66  ? 208  LEU A CD2 1 
ATOM   944  N N   . TYR A 1  131 ? 19.379  -26.061 -1.332  1.00 19.01  ? 209  TYR A N   1 
ATOM   945  C CA  . TYR A 1  131 ? 18.975  -24.802 -0.734  1.00 20.52  ? 209  TYR A CA  1 
ATOM   946  C C   . TYR A 1  131 ? 19.348  -24.819 0.747   1.00 24.15  ? 209  TYR A C   1 
ATOM   947  O O   . TYR A 1  131 ? 19.507  -25.890 1.363   1.00 21.10  ? 209  TYR A O   1 
ATOM   948  C CB  . TYR A 1  131 ? 17.448  -24.596 -0.856  1.00 20.76  ? 209  TYR A CB  1 
ATOM   949  C CG  . TYR A 1  131 ? 16.638  -25.789 -0.390  1.00 19.29  ? 209  TYR A CG  1 
ATOM   950  C CD1 . TYR A 1  131 ? 16.333  -25.973 0.954   1.00 22.41  ? 209  TYR A CD1 1 
ATOM   951  C CD2 . TYR A 1  131 ? 16.202  -26.759 -1.300  1.00 19.31  ? 209  TYR A CD2 1 
ATOM   952  C CE1 . TYR A 1  131 ? 15.616  -27.092 1.379   1.00 20.66  ? 209  TYR A CE1 1 
ATOM   953  C CE2 . TYR A 1  131 ? 15.471  -27.865 -0.893  1.00 19.14  ? 209  TYR A CE2 1 
ATOM   954  C CZ  . TYR A 1  131 ? 15.178  -28.030 0.450   1.00 21.85  ? 209  TYR A CZ  1 
ATOM   955  O OH  . TYR A 1  131 ? 14.483  -29.146 0.873   1.00 23.67  ? 209  TYR A OH  1 
ATOM   956  N N   . SER A 1  132 ? 19.473  -23.629 1.315   1.00 23.99  ? 210  SER A N   1 
ATOM   957  C CA  . SER A 1  132 ? 19.302  -23.456 2.765   1.00 25.16  ? 210  SER A CA  1 
ATOM   958  C C   . SER A 1  132 ? 18.238  -22.406 2.965   1.00 25.86  ? 210  SER A C   1 
ATOM   959  O O   . SER A 1  132 ? 17.890  -21.681 2.045   1.00 20.96  ? 210  SER A O   1 
ATOM   960  C CB  . SER A 1  132 ? 20.599  -23.045 3.461   1.00 27.32  ? 210  SER A CB  1 
ATOM   961  O OG  . SER A 1  132 ? 21.048  -21.788 3.010   1.00 30.10  ? 210  SER A OG  1 
ATOM   962  N N   . VAL A 1  133 ? 17.733  -22.323 4.183   1.00 22.43  ? 211  VAL A N   1 
ATOM   963  C CA  . VAL A 1  133 ? 16.644  -21.416 4.487   1.00 23.60  ? 211  VAL A CA  1 
ATOM   964  C C   . VAL A 1  133 ? 16.915  -20.788 5.827   1.00 21.40  ? 211  VAL A C   1 
ATOM   965  O O   . VAL A 1  133 ? 17.354  -21.462 6.750   1.00 23.86  ? 211  VAL A O   1 
ATOM   966  C CB  . VAL A 1  133 ? 15.278  -22.140 4.410   1.00 28.13  ? 211  VAL A CB  1 
ATOM   967  C CG1 . VAL A 1  133 ? 15.166  -23.261 5.433   1.00 36.84  ? 211  VAL A CG1 1 
ATOM   968  C CG2 . VAL A 1  133 ? 14.132  -21.140 4.525   1.00 30.14  ? 211  VAL A CG2 1 
ATOM   969  N N   . GLU A 1  134 ? 16.732  -19.481 5.912   1.00 21.39  ? 212  GLU A N   1 
ATOM   970  C CA  . GLU A 1  134 ? 16.802  -18.764 7.188   1.00 21.99  ? 212  GLU A CA  1 
ATOM   971  C C   . GLU A 1  134 ? 15.716  -17.693 7.198   1.00 18.62  ? 212  GLU A C   1 
ATOM   972  O O   . GLU A 1  134 ? 15.036  -17.462 6.184   1.00 18.45  ? 212  GLU A O   1 
ATOM   973  C CB  . GLU A 1  134 ? 18.206  -18.191 7.423   1.00 24.03  ? 212  GLU A CB  1 
ATOM   974  C CG  . GLU A 1  134 ? 18.903  -17.618 6.220   1.00 31.96  ? 212  GLU A CG  1 
ATOM   975  C CD  . GLU A 1  134 ? 20.232  -16.974 6.573   1.00 39.33  ? 212  GLU A CD  1 
ATOM   976  O OE1 . GLU A 1  134 ? 20.204  -15.877 7.159   1.00 42.49  ? 212  GLU A OE1 1 
ATOM   977  O OE2 . GLU A 1  134 ? 21.297  -17.567 6.286   1.00 39.49  ? 212  GLU A OE2 1 
ATOM   978  N N   . PHE A 1  135 ? 15.524  -17.067 8.339   1.00 17.74  ? 213  PHE A N   1 
ATOM   979  C CA  . PHE A 1  135 ? 14.370  -16.196 8.548   1.00 17.45  ? 213  PHE A CA  1 
ATOM   980  C C   . PHE A 1  135 ? 14.778  -14.869 9.143   1.00 20.94  ? 213  PHE A C   1 
ATOM   981  O O   . PHE A 1  135 ? 15.662  -14.792 10.020  1.00 21.11  ? 213  PHE A O   1 
ATOM   982  C CB  . PHE A 1  135 ? 13.351  -16.883 9.474   1.00 18.36  ? 213  PHE A CB  1 
ATOM   983  C CG  . PHE A 1  135 ? 12.957  -18.272 9.028   1.00 18.29  ? 213  PHE A CG  1 
ATOM   984  C CD1 . PHE A 1  135 ? 11.953  -18.461 8.085   1.00 20.87  ? 213  PHE A CD1 1 
ATOM   985  C CD2 . PHE A 1  135 ? 13.623  -19.377 9.509   1.00 21.10  ? 213  PHE A CD2 1 
ATOM   986  C CE1 . PHE A 1  135 ? 11.622  -19.729 7.659   1.00 21.47  ? 213  PHE A CE1 1 
ATOM   987  C CE2 . PHE A 1  135 ? 13.303  -20.653 9.084   1.00 20.94  ? 213  PHE A CE2 1 
ATOM   988  C CZ  . PHE A 1  135 ? 12.300  -20.836 8.164   1.00 21.25  ? 213  PHE A CZ  1 
ATOM   989  N N   . SER A 1  136 ? 14.118  -13.815 8.681   1.00 19.59  ? 214  SER A N   1 
ATOM   990  C CA  . SER A 1  136 ? 14.222  -12.514 9.324   1.00 18.69  ? 214  SER A CA  1 
ATOM   991  C C   . SER A 1  136 ? 13.070  -12.444 10.328  1.00 20.16  ? 214  SER A C   1 
ATOM   992  O O   . SER A 1  136 ? 11.965  -12.890 10.036  1.00 21.12  ? 214  SER A O   1 
ATOM   993  C CB  . SER A 1  136 ? 14.141  -11.392 8.276   1.00 20.29  ? 214  SER A CB  1 
ATOM   994  O OG  . SER A 1  136 ? 14.079  -10.147 8.945   1.00 35.35  ? 214  SER A OG  1 
ATOM   995  N N   . GLU A 1  137 ? 13.335  -11.875 11.503  1.00 20.10  ? 215  GLU A N   1 
ATOM   996  C CA  . GLU A 1  137 ? 12.392  -11.855 12.613  1.00 19.94  ? 215  GLU A CA  1 
ATOM   997  C C   . GLU A 1  137 ? 11.383  -10.714 12.521  1.00 20.99  ? 215  GLU A C   1 
ATOM   998  O O   . GLU A 1  137 ? 10.187  -10.904 12.699  1.00 19.26  ? 215  GLU A O   1 
ATOM   999  C CB  . GLU A 1  137 ? 13.175  -11.749 13.925  1.00 22.87  ? 215  GLU A CB  1 
ATOM   1000 C CG  . GLU A 1  137 ? 12.338  -12.005 15.163  1.00 29.01  ? 215  GLU A CG  1 
ATOM   1001 C CD  . GLU A 1  137 ? 13.194  -12.123 16.420  1.00 37.45  ? 215  GLU A CD  1 
ATOM   1002 O OE1 . GLU A 1  137 ? 14.298  -11.542 16.463  1.00 29.01  ? 215  GLU A OE1 1 
ATOM   1003 O OE2 . GLU A 1  137 ? 12.769  -12.812 17.355  1.00 34.01  ? 215  GLU A OE2 1 
ATOM   1004 N N   . GLU A 1  138 ? 11.865  -9.510  12.249  1.00 22.06  ? 216  GLU A N   1 
ATOM   1005 C CA  . GLU A 1  138 ? 11.007  -8.336  12.265  1.00 23.47  ? 216  GLU A CA  1 
ATOM   1006 C C   . GLU A 1  138 ? 11.707  -7.235  11.453  1.00 25.09  ? 216  GLU A C   1 
ATOM   1007 O O   . GLU A 1  138 ? 12.716  -6.721  11.935  1.00 27.26  ? 216  GLU A O   1 
ATOM   1008 C CB  . GLU A 1  138 ? 10.754  -7.883  13.717  1.00 25.20  ? 216  GLU A CB  1 
ATOM   1009 C CG  . GLU A 1  138 ? 9.719   -6.765  13.841  1.00 29.23  ? 216  GLU A CG  1 
ATOM   1010 C CD  . GLU A 1  138 ? 9.433   -6.367  15.277  1.00 29.28  ? 216  GLU A CD  1 
ATOM   1011 O OE1 . GLU A 1  138 ? 8.281   -6.058  15.581  1.00 36.67  ? 216  GLU A OE1 1 
ATOM   1012 O OE2 . GLU A 1  138 ? 10.349  -6.356  16.112  1.00 38.16  ? 216  GLU A OE2 1 
ATOM   1013 N N   . PRO A 1  139 ? 11.251  -6.897  10.235  1.00 21.30  ? 217  PRO A N   1 
ATOM   1014 C CA  . PRO A 1  139 ? 10.115  -7.523  9.575   1.00 24.01  ? 217  PRO A CA  1 
ATOM   1015 C C   . PRO A 1  139 ? 10.399  -8.950  9.140   1.00 22.99  ? 217  PRO A C   1 
ATOM   1016 O O   . PRO A 1  139 ? 11.528  -9.275  8.750   1.00 23.33  ? 217  PRO A O   1 
ATOM   1017 C CB  . PRO A 1  139 ? 9.909   -6.647  8.332   1.00 24.49  ? 217  PRO A CB  1 
ATOM   1018 C CG  . PRO A 1  139 ? 11.307  -6.220  7.961   1.00 25.94  ? 217  PRO A CG  1 
ATOM   1019 C CD  . PRO A 1  139 ? 12.011  -6.028  9.294   1.00 24.07  ? 217  PRO A CD  1 
ATOM   1020 N N   . PHE A 1  140 ? 9.357   -9.771  9.188   1.00 20.27  ? 218  PHE A N   1 
ATOM   1021 C CA  . PHE A 1  140 ? 9.445   -11.160 8.798   1.00 20.47  ? 218  PHE A CA  1 
ATOM   1022 C C   . PHE A 1  140 ? 9.848   -11.348 7.333   1.00 19.94  ? 218  PHE A C   1 
ATOM   1023 O O   . PHE A 1  140 ? 9.339   -10.674 6.442   1.00 19.48  ? 218  PHE A O   1 
ATOM   1024 C CB  . PHE A 1  140 ? 8.104   -11.866 9.044   1.00 22.13  ? 218  PHE A CB  1 
ATOM   1025 C CG  . PHE A 1  140 ? 8.015   -13.205 8.386   1.00 18.57  ? 218  PHE A CG  1 
ATOM   1026 C CD1 . PHE A 1  140 ? 8.755   -14.270 8.869   1.00 19.08  ? 218  PHE A CD1 1 
ATOM   1027 C CD2 . PHE A 1  140 ? 7.267   -13.372 7.234   1.00 19.52  ? 218  PHE A CD2 1 
ATOM   1028 C CE1 . PHE A 1  140 ? 8.717   -15.503 8.237   1.00 17.98  ? 218  PHE A CE1 1 
ATOM   1029 C CE2 . PHE A 1  140 ? 7.215   -14.608 6.599   1.00 19.56  ? 218  PHE A CE2 1 
ATOM   1030 C CZ  . PHE A 1  140 ? 7.949   -15.666 7.099   1.00 17.66  ? 218  PHE A CZ  1 
ATOM   1031 N N   . GLY A 1  141 ? 10.736  -12.297 7.082   1.00 19.69  ? 219  GLY A N   1 
ATOM   1032 C CA  . GLY A 1  141 ? 10.989  -12.737 5.709   1.00 19.95  ? 219  GLY A CA  1 
ATOM   1033 C C   . GLY A 1  141 ? 11.579  -14.122 5.687   1.00 22.62  ? 219  GLY A C   1 
ATOM   1034 O O   . GLY A 1  141 ? 12.171  -14.577 6.682   1.00 17.88  ? 219  GLY A O   1 
ATOM   1035 N N   . VAL A 1  142 ? 11.402  -14.791 4.559   1.00 18.89  ? 220  VAL A N   1 
ATOM   1036 C CA  . VAL A 1  142 ? 11.998  -16.090 4.320   1.00 18.80  ? 220  VAL A CA  1 
ATOM   1037 C C   . VAL A 1  142 ? 13.133  -15.819 3.361   1.00 20.27  ? 220  VAL A C   1 
ATOM   1038 O O   . VAL A 1  142 ? 12.924  -15.138 2.366   1.00 17.99  ? 220  VAL A O   1 
ATOM   1039 C CB  . VAL A 1  142 ? 11.004  -17.063 3.659   1.00 17.05  ? 220  VAL A CB  1 
ATOM   1040 C CG1 . VAL A 1  142 ? 11.680  -18.385 3.317   1.00 18.09  ? 220  VAL A CG1 1 
ATOM   1041 C CG2 . VAL A 1  142 ? 9.819   -17.282 4.586   1.00 18.76  ? 220  VAL A CG2 1 
ATOM   1042 N N   . ILE A 1  143 ? 14.325  -16.336 3.671   1.00 17.40  ? 221  ILE A N   1 
ATOM   1043 C CA  . ILE A 1  143 ? 15.502  -16.155 2.836   1.00 18.61  ? 221  ILE A CA  1 
ATOM   1044 C C   . ILE A 1  143 ? 15.948  -17.542 2.364   1.00 18.88  ? 221  ILE A C   1 
ATOM   1045 O O   . ILE A 1  143 ? 16.202  -18.413 3.188   1.00 21.29  ? 221  ILE A O   1 
ATOM   1046 C CB  . ILE A 1  143 ? 16.649  -15.423 3.573   1.00 20.31  ? 221  ILE A CB  1 
ATOM   1047 C CG1 . ILE A 1  143 ? 16.256  -13.990 3.963   1.00 21.92  ? 221  ILE A CG1 1 
ATOM   1048 C CG2 . ILE A 1  143 ? 17.921  -15.365 2.728   1.00 20.38  ? 221  ILE A CG2 1 
ATOM   1049 C CD1 . ILE A 1  143 ? 16.179  -13.782 5.458   1.00 27.40  ? 221  ILE A CD1 1 
ATOM   1050 N N   . VAL A 1  144 ? 16.052  -17.738 1.049   1.00 18.09  ? 222  VAL A N   1 
ATOM   1051 C CA  . VAL A 1  144 ? 16.493  -19.024 0.483   1.00 21.22  ? 222  VAL A CA  1 
ATOM   1052 C C   . VAL A 1  144 ? 17.794  -18.780 -0.276  1.00 20.48  ? 222  VAL A C   1 
ATOM   1053 O O   . VAL A 1  144 ? 17.837  -17.960 -1.209  1.00 18.23  ? 222  VAL A O   1 
ATOM   1054 C CB  . VAL A 1  144 ? 15.389  -19.637 -0.416  1.00 20.81  ? 222  VAL A CB  1 
ATOM   1055 C CG1 . VAL A 1  144 ? 15.835  -20.945 -1.064  1.00 20.43  ? 222  VAL A CG1 1 
ATOM   1056 C CG2 . VAL A 1  144 ? 14.131  -19.877 0.411   1.00 21.95  ? 222  VAL A CG2 1 
ATOM   1057 N N   . HIS A 1  145 ? 18.855  -19.458 0.158   1.00 19.56  ? 223  HIS A N   1 
ATOM   1058 C CA  . HIS A 1  145 ? 20.159  -19.436 -0.532  1.00 21.94  ? 223  HIS A CA  1 
ATOM   1059 C C   . HIS A 1  145 ? 20.350  -20.702 -1.371  1.00 19.02  ? 223  HIS A C   1 
ATOM   1060 O O   . HIS A 1  145 ? 19.929  -21.766 -0.978  1.00 20.02  ? 223  HIS A O   1 
ATOM   1061 C CB  . HIS A 1  145 ? 21.321  -19.378 0.485   1.00 24.02  ? 223  HIS A CB  1 
ATOM   1062 C CG  . HIS A 1  145 ? 21.521  -18.049 1.143   1.00 26.33  ? 223  HIS A CG  1 
ATOM   1063 N ND1 . HIS A 1  145 ? 21.017  -17.753 2.394   1.00 29.84  ? 223  HIS A ND1 1 
ATOM   1064 C CD2 . HIS A 1  145 ? 22.249  -16.970 0.768   1.00 25.08  ? 223  HIS A CD2 1 
ATOM   1065 C CE1 . HIS A 1  145 ? 21.393  -16.534 2.742   1.00 23.72  ? 223  HIS A CE1 1 
ATOM   1066 N NE2 . HIS A 1  145 ? 22.142  -16.038 1.772   1.00 27.42  ? 223  HIS A NE2 1 
ATOM   1067 N N   . ARG A 1  146 ? 21.001  -20.580 -2.521  1.00 19.67  ? 224  ARG A N   1 
ATOM   1068 C CA  . ARG A 1  146 ? 21.604  -21.734 -3.195  1.00 20.84  ? 224  ARG A CA  1 
ATOM   1069 C C   . ARG A 1  146 ? 22.876  -22.059 -2.413  1.00 23.03  ? 224  ARG A C   1 
ATOM   1070 O O   . ARG A 1  146 ? 23.753  -21.181 -2.311  1.00 20.23  ? 224  ARG A O   1 
ATOM   1071 C CB  . ARG A 1  146 ? 21.973  -21.381 -4.642  1.00 19.50  ? 224  ARG A CB  1 
ATOM   1072 C CG  . ARG A 1  146 ? 22.610  -22.519 -5.415  1.00 19.65  ? 224  ARG A CG  1 
ATOM   1073 C CD  . ARG A 1  146 ? 22.808  -22.188 -6.887  1.00 19.26  ? 224  ARG A CD  1 
ATOM   1074 N NE  . ARG A 1  146 ? 21.541  -21.901 -7.559  1.00 18.13  ? 224  ARG A NE  1 
ATOM   1075 C CZ  . ARG A 1  146 ? 20.624  -22.807 -7.865  1.00 17.65  ? 224  ARG A CZ  1 
ATOM   1076 N NH1 . ARG A 1  146 ? 20.831  -24.105 -7.606  1.00 17.62  ? 224  ARG A NH1 1 
ATOM   1077 N NH2 . ARG A 1  146 ? 19.497  -22.417 -8.473  1.00 19.32  ? 224  ARG A NH2 1 
ATOM   1078 N N   . GLN A 1  147 ? 22.967  -23.271 -1.838  1.00 20.47  ? 225  GLN A N   1 
ATOM   1079 C CA  . GLN A 1  147 ? 24.123  -23.648 -0.998  1.00 25.53  ? 225  GLN A CA  1 
ATOM   1080 C C   . GLN A 1  147 ? 25.454  -23.676 -1.748  1.00 24.03  ? 225  GLN A C   1 
ATOM   1081 O O   . GLN A 1  147 ? 26.498  -23.353 -1.165  1.00 24.11  ? 225  GLN A O   1 
ATOM   1082 C CB  . GLN A 1  147 ? 23.933  -25.027 -0.304  1.00 28.19  ? 225  GLN A CB  1 
ATOM   1083 C CG  . GLN A 1  147 ? 22.697  -25.111 0.588   1.00 40.14  ? 225  GLN A CG  1 
ATOM   1084 C CD  . GLN A 1  147 ? 22.907  -25.835 1.922   1.00 43.81  ? 225  GLN A CD  1 
ATOM   1085 O OE1 . GLN A 1  147 ? 23.087  -25.200 2.954   1.00 42.83  ? 225  GLN A OE1 1 
ATOM   1086 N NE2 . GLN A 1  147 ? 22.861  -27.164 1.901   1.00 38.52  ? 225  GLN A NE2 1 
ATOM   1087 N N   . LEU A 1  148 ? 25.434  -24.068 -3.021  1.00 23.27  ? 226  LEU A N   1 
ATOM   1088 C CA  . LEU A 1  148 ? 26.689  -24.250 -3.775  1.00 22.84  ? 226  LEU A CA  1 
ATOM   1089 C C   . LEU A 1  148 ? 27.501  -22.955 -3.884  1.00 23.63  ? 226  LEU A C   1 
ATOM   1090 O O   . LEU A 1  148 ? 28.710  -22.979 -3.717  1.00 22.29  ? 226  LEU A O   1 
ATOM   1091 C CB  . LEU A 1  148 ? 26.440  -24.832 -5.170  1.00 22.54  ? 226  LEU A CB  1 
ATOM   1092 C CG  . LEU A 1  148 ? 27.684  -25.268 -5.982  1.00 26.88  ? 226  LEU A CG  1 
ATOM   1093 C CD1 . LEU A 1  148 ? 28.538  -26.267 -5.200  1.00 29.59  ? 226  LEU A CD1 1 
ATOM   1094 C CD2 . LEU A 1  148 ? 27.285  -25.876 -7.318  1.00 26.16  ? 226  LEU A CD2 1 
ATOM   1095 N N   . ASP A 1  149 ? 26.838  -21.837 -4.162  1.00 21.32  ? 227  ASP A N   1 
ATOM   1096 C CA  . ASP A 1  149 ? 27.536  -20.544 -4.383  1.00 22.71  ? 227  ASP A CA  1 
ATOM   1097 C C   . ASP A 1  149 ? 27.088  -19.401 -3.454  1.00 24.16  ? 227  ASP A C   1 
ATOM   1098 O O   . ASP A 1  149 ? 27.614  -18.306 -3.548  1.00 24.96  ? 227  ASP A O   1 
ATOM   1099 C CB  . ASP A 1  149 ? 27.408  -20.105 -5.863  1.00 21.84  ? 227  ASP A CB  1 
ATOM   1100 C CG  . ASP A 1  149 ? 25.942  -20.018 -6.349  1.00 23.94  ? 227  ASP A CG  1 
ATOM   1101 O OD1 . ASP A 1  149 ? 25.017  -19.936 -5.508  1.00 20.36  ? 227  ASP A OD1 1 
ATOM   1102 O OD2 . ASP A 1  149 ? 25.710  -20.032 -7.585  1.00 24.53  ? 227  ASP A OD2 1 
ATOM   1103 N N   . GLY A 1  150 ? 26.130  -19.652 -2.564  1.00 23.58  ? 228  GLY A N   1 
ATOM   1104 C CA  . GLY A 1  150 ? 25.617  -18.612 -1.688  1.00 23.26  ? 228  GLY A CA  1 
ATOM   1105 C C   . GLY A 1  150 ? 24.747  -17.531 -2.330  1.00 21.69  ? 228  GLY A C   1 
ATOM   1106 O O   . GLY A 1  150 ? 24.514  -16.509 -1.700  1.00 25.98  ? 228  GLY A O   1 
ATOM   1107 N N   . ARG A 1  151 ? 24.260  -17.736 -3.554  1.00 22.15  ? 229  ARG A N   1 
ATOM   1108 C CA  . ARG A 1  151 ? 23.410  -16.732 -4.208  1.00 23.43  ? 229  ARG A CA  1 
ATOM   1109 C C   . ARG A 1  151 ? 22.055  -16.685 -3.486  1.00 20.24  ? 229  ARG A C   1 
ATOM   1110 O O   . ARG A 1  151 ? 21.489  -17.716 -3.175  1.00 16.83  ? 229  ARG A O   1 
ATOM   1111 C CB  . ARG A 1  151 ? 23.197  -17.046 -5.687  1.00 23.70  ? 229  ARG A CB  1 
ATOM   1112 C CG  . ARG A 1  151 ? 22.640  -15.850 -6.457  1.00 24.89  ? 229  ARG A CG  1 
ATOM   1113 C CD  . ARG A 1  151 ? 22.618  -16.090 -7.943  1.00 28.25  ? 229  ARG A CD  1 
ATOM   1114 N NE  . ARG A 1  151 ? 23.955  -16.370 -8.476  1.00 26.77  ? 229  ARG A NE  1 
ATOM   1115 C CZ  . ARG A 1  151 ? 24.895  -15.453 -8.739  1.00 31.42  ? 229  ARG A CZ  1 
ATOM   1116 N NH1 . ARG A 1  151 ? 24.690  -14.149 -8.511  1.00 31.43  ? 229  ARG A NH1 1 
ATOM   1117 N NH2 . ARG A 1  151 ? 26.068  -15.850 -9.237  1.00 31.46  ? 229  ARG A NH2 1 
ATOM   1118 N N   . VAL A 1  152 ? 21.568  -15.484 -3.214  1.00 21.14  ? 230  VAL A N   1 
ATOM   1119 C CA  . VAL A 1  152 ? 20.251  -15.289 -2.586  1.00 18.35  ? 230  VAL A CA  1 
ATOM   1120 C C   . VAL A 1  152 ? 19.200  -15.441 -3.690  1.00 17.74  ? 230  VAL A C   1 
ATOM   1121 O O   . VAL A 1  152 ? 19.162  -14.667 -4.636  1.00 21.45  ? 230  VAL A O   1 
ATOM   1122 C CB  . VAL A 1  152 ? 20.155  -13.903 -1.902  1.00 19.78  ? 230  VAL A CB  1 
ATOM   1123 C CG1 . VAL A 1  152 ? 18.813  -13.727 -1.206  1.00 18.57  ? 230  VAL A CG1 1 
ATOM   1124 C CG2 . VAL A 1  152 ? 21.281  -13.736 -0.894  1.00 20.33  ? 230  VAL A CG2 1 
ATOM   1125 N N   . LEU A 1  153 ? 18.372  -16.467 -3.581  1.00 16.43  ? 231  LEU A N   1 
ATOM   1126 C CA  . LEU A 1  153 ? 17.339  -16.754 -4.567  1.00 16.48  ? 231  LEU A CA  1 
ATOM   1127 C C   . LEU A 1  153 ? 16.012  -16.093 -4.191  1.00 16.45  ? 231  LEU A C   1 
ATOM   1128 O O   . LEU A 1  153 ? 15.379  -15.439 -5.012  1.00 17.00  ? 231  LEU A O   1 
ATOM   1129 C CB  . LEU A 1  153 ? 17.180  -18.268 -4.695  1.00 17.23  ? 231  LEU A CB  1 
ATOM   1130 C CG  . LEU A 1  153 ? 18.470  -19.036 -5.002  1.00 18.29  ? 231  LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1  153 ? 18.157  -20.491 -5.288  1.00 19.67  ? 231  LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1  153 ? 19.267  -18.434 -6.151  1.00 21.62  ? 231  LEU A CD2 1 
ATOM   1133 N N   . LEU A 1  154 ? 15.625  -16.273 -2.931  1.00 17.68  ? 232  LEU A N   1 
ATOM   1134 C CA  . LEU A 1  154 ? 14.429  -15.673 -2.354  1.00 21.43  ? 232  LEU A CA  1 
ATOM   1135 C C   . LEU A 1  154 ? 14.824  -14.830 -1.147  1.00 19.23  ? 232  LEU A C   1 
ATOM   1136 O O   . LEU A 1  154 ? 15.661  -15.231 -0.306  1.00 19.62  ? 232  LEU A O   1 
ATOM   1137 C CB  . LEU A 1  154 ? 13.456  -16.775 -1.913  1.00 24.37  ? 232  LEU A CB  1 
ATOM   1138 C CG  . LEU A 1  154 ? 11.943  -16.522 -1.910  1.00 36.02  ? 232  LEU A CG  1 
ATOM   1139 C CD1 . LEU A 1  154 ? 11.396  -16.464 -3.323  1.00 39.03  ? 232  LEU A CD1 1 
ATOM   1140 C CD2 . LEU A 1  154 ? 11.208  -17.606 -1.132  1.00 39.64  ? 232  LEU A CD2 1 
ATOM   1141 N N   . ASN A 1  155 ? 14.230  -13.650 -1.043  1.00 20.66  ? 233  ASN A N   1 
ATOM   1142 C CA  . ASN A 1  155 ? 14.332  -12.868 0.193   1.00 18.58  ? 233  ASN A CA  1 
ATOM   1143 C C   . ASN A 1  155 ? 13.070  -12.056 0.361   1.00 17.90  ? 233  ASN A C   1 
ATOM   1144 O O   . ASN A 1  155 ? 12.927  -10.985 -0.248  1.00 18.05  ? 233  ASN A O   1 
ATOM   1145 C CB  . ASN A 1  155 ? 15.579  -11.982 0.166   1.00 19.31  ? 233  ASN A CB  1 
ATOM   1146 C CG  . ASN A 1  155 ? 15.732  -11.140 1.429   1.00 19.64  ? 233  ASN A CG  1 
ATOM   1147 O OD1 . ASN A 1  155 ? 14.876  -11.154 2.323   1.00 19.21  ? 233  ASN A OD1 1 
ATOM   1148 N ND2 . ASN A 1  155 ? 16.820  -10.406 1.509   1.00 21.31  ? 233  ASN A ND2 1 
ATOM   1149 N N   . THR A 1  156 ? 12.130  -12.558 1.168   1.00 20.25  ? 234  THR A N   1 
ATOM   1150 C CA  . THR A 1  156 ? 10.835  -11.881 1.256   1.00 17.85  ? 234  THR A CA  1 
ATOM   1151 C C   . THR A 1  156 ? 10.827  -10.727 2.260   1.00 20.86  ? 234  THR A C   1 
ATOM   1152 O O   . THR A 1  156 ? 9.788   -10.087 2.463   1.00 18.02  ? 234  THR A O   1 
ATOM   1153 C CB  . THR A 1  156 ? 9.664   -12.846 1.506   1.00 18.97  ? 234  THR A CB  1 
ATOM   1154 O OG1 . THR A 1  156 ? 9.634   -13.259 2.875   1.00 18.64  ? 234  THR A OG1 1 
ATOM   1155 C CG2 . THR A 1  156 ? 9.735   -14.041 0.578   1.00 16.60  ? 234  THR A CG2 1 
ATOM   1156 N N   . THR A 1  157 ? 11.981  -10.479 2.890   1.00 20.88  ? 235  THR A N   1 
ATOM   1157 C CA  . THR A 1  157 ? 12.175  -9.365  3.816   1.00 22.31  ? 235  THR A CA  1 
ATOM   1158 C C   . THR A 1  157 ? 12.095  -8.010  3.104   1.00 23.63  ? 235  THR A C   1 
ATOM   1159 O O   . THR A 1  157 ? 11.872  -7.002  3.759   1.00 23.76  ? 235  THR A O   1 
ATOM   1160 C CB  . THR A 1  157 ? 13.543  -9.494  4.554   1.00 22.90  ? 235  THR A CB  1 
ATOM   1161 O OG1 . THR A 1  157 ? 13.725  -10.851 4.994   1.00 23.72  ? 235  THR A OG1 1 
ATOM   1162 C CG2 . THR A 1  157 ? 13.609  -8.628  5.777   1.00 24.25  ? 235  THR A CG2 1 
ATOM   1163 N N   . VAL A 1  158 ? 12.270  -7.995  1.775   1.00 21.73  ? 236  VAL A N   1 
ATOM   1164 C CA  . VAL A 1  158 ? 12.371  -6.747  0.991   1.00 20.74  ? 236  VAL A CA  1 
ATOM   1165 C C   . VAL A 1  158 ? 11.143  -5.839  1.030   1.00 21.55  ? 236  VAL A C   1 
ATOM   1166 O O   . VAL A 1  158 ? 11.261  -4.669  0.742   1.00 21.79  ? 236  VAL A O   1 
ATOM   1167 C CB  . VAL A 1  158 ? 12.722  -6.991  -0.504  1.00 20.46  ? 236  VAL A CB  1 
ATOM   1168 C CG1 . VAL A 1  158 ? 14.079  -7.678  -0.665  1.00 20.41  ? 236  VAL A CG1 1 
ATOM   1169 C CG2 . VAL A 1  158 ? 11.609  -7.740  -1.237  1.00 19.32  ? 236  VAL A CG2 1 
ATOM   1170 N N   . ALA A 1  159 ? 9.974   -6.379  1.370   1.00 21.27  ? 237  ALA A N   1 
ATOM   1171 C CA  . ALA A 1  159 ? 8.766   -5.584  1.516   1.00 20.73  ? 237  ALA A CA  1 
ATOM   1172 C C   . ALA A 1  159 ? 7.841   -6.214  2.559   1.00 20.80  ? 237  ALA A C   1 
ATOM   1173 O O   . ALA A 1  159 ? 8.049   -7.357  2.950   1.00 23.86  ? 237  ALA A O   1 
ATOM   1174 C CB  . ALA A 1  159 ? 8.064   -5.445  0.173   1.00 19.44  ? 237  ALA A CB  1 
ATOM   1175 N N   . PRO A 1  160 ? 6.831   -5.459  3.033   1.00 23.71  ? 238  PRO A N   1 
ATOM   1176 C CA  . PRO A 1  160 ? 5.939   -6.002  4.074   1.00 22.22  ? 238  PRO A CA  1 
ATOM   1177 C C   . PRO A 1  160 ? 5.107   -7.190  3.596   1.00 24.84  ? 238  PRO A C   1 
ATOM   1178 O O   . PRO A 1  160 ? 4.740   -7.248  2.435   1.00 23.16  ? 238  PRO A O   1 
ATOM   1179 C CB  . PRO A 1  160 ? 4.997   -4.832  4.380   1.00 22.08  ? 238  PRO A CB  1 
ATOM   1180 C CG  . PRO A 1  160 ? 5.674   -3.616  3.860   1.00 22.89  ? 238  PRO A CG  1 
ATOM   1181 C CD  . PRO A 1  160 ? 6.491   -4.061  2.691   1.00 18.58  ? 238  PRO A CD  1 
ATOM   1182 N N   . LEU A 1  161 ? 4.828   -8.130  4.489   1.00 21.41  ? 239  LEU A N   1 
ATOM   1183 C CA  . LEU A 1  161 ? 3.870   -9.185  4.192   1.00 20.82  ? 239  LEU A CA  1 
ATOM   1184 C C   . LEU A 1  161 ? 2.503   -8.601  4.458   1.00 18.11  ? 239  LEU A C   1 
ATOM   1185 O O   . LEU A 1  161 ? 2.248   -8.064  5.545   1.00 18.28  ? 239  LEU A O   1 
ATOM   1186 C CB  . LEU A 1  161 ? 4.100   -10.403 5.079   1.00 18.35  ? 239  LEU A CB  1 
ATOM   1187 C CG  . LEU A 1  161 ? 3.103   -11.542 5.052   1.00 16.41  ? 239  LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1  161 ? 3.066   -12.184 3.675   1.00 18.34  ? 239  LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1  161 ? 3.461   -12.558 6.122   1.00 16.26  ? 239  LEU A CD2 1 
ATOM   1190 N N   . PHE A 1  162 ? 1.646   -8.672  3.454   1.00 15.85  ? 240  PHE A N   1 
ATOM   1191 C CA  . PHE A 1  162 ? 0.218   -8.341  3.586   1.00 18.83  ? 240  PHE A CA  1 
ATOM   1192 C C   . PHE A 1  162 ? -0.519  -9.660  3.567   1.00 18.56  ? 240  PHE A C   1 
ATOM   1193 O O   . PHE A 1  162 ? -0.263  -10.503 2.684   1.00 15.53  ? 240  PHE A O   1 
ATOM   1194 C CB  . PHE A 1  162 ? -0.275  -7.503  2.401   1.00 20.23  ? 240  PHE A CB  1 
ATOM   1195 C CG  . PHE A 1  162 ? 0.072   -6.045  2.505   1.00 22.54  ? 240  PHE A CG  1 
ATOM   1196 C CD1 . PHE A 1  162 ? 1.396   -5.623  2.415   1.00 27.16  ? 240  PHE A CD1 1 
ATOM   1197 C CD2 . PHE A 1  162 ? -0.926  -5.087  2.674   1.00 24.75  ? 240  PHE A CD2 1 
ATOM   1198 C CE1 . PHE A 1  162 ? 1.718   -4.276  2.511   1.00 27.70  ? 240  PHE A CE1 1 
ATOM   1199 C CE2 . PHE A 1  162 ? -0.607  -3.738  2.771   1.00 23.96  ? 240  PHE A CE2 1 
ATOM   1200 C CZ  . PHE A 1  162 ? 0.717   -3.337  2.716   1.00 25.05  ? 240  PHE A CZ  1 
ATOM   1201 N N   . PHE A 1  163 ? -1.432  -9.839  4.525   1.00 17.69  ? 241  PHE A N   1 
ATOM   1202 C CA  . PHE A 1  163 ? -2.290  -11.018 4.550   1.00 17.08  ? 241  PHE A CA  1 
ATOM   1203 C C   . PHE A 1  163 ? -3.639  -10.620 5.116   1.00 19.36  ? 241  PHE A C   1 
ATOM   1204 O O   . PHE A 1  163 ? -3.893  -10.687 6.339   1.00 17.02  ? 241  PHE A O   1 
ATOM   1205 C CB  . PHE A 1  163 ? -1.652  -12.143 5.366   1.00 17.54  ? 241  PHE A CB  1 
ATOM   1206 C CG  . PHE A 1  163 ? -2.170  -13.510 5.017   1.00 18.85  ? 241  PHE A CG  1 
ATOM   1207 C CD1 . PHE A 1  163 ? -3.505  -13.852 5.243   1.00 19.34  ? 241  PHE A CD1 1 
ATOM   1208 C CD2 . PHE A 1  163 ? -1.325  -14.463 4.456   1.00 17.04  ? 241  PHE A CD2 1 
ATOM   1209 C CE1 . PHE A 1  163 ? -3.978  -15.118 4.912   1.00 19.96  ? 241  PHE A CE1 1 
ATOM   1210 C CE2 . PHE A 1  163 ? -1.802  -15.716 4.113   1.00 17.31  ? 241  PHE A CE2 1 
ATOM   1211 C CZ  . PHE A 1  163 ? -3.126  -16.047 4.342   1.00 18.50  ? 241  PHE A CZ  1 
ATOM   1212 N N   . ALA A 1  164 ? -4.496  -10.199 4.205   1.00 16.76  ? 242  ALA A N   1 
ATOM   1213 C CA  . ALA A 1  164 ? -5.852  -9.763  4.523   1.00 18.19  ? 242  ALA A CA  1 
ATOM   1214 C C   . ALA A 1  164 ? -6.803  -10.654 3.766   1.00 19.07  ? 242  ALA A C   1 
ATOM   1215 O O   . ALA A 1  164 ? -6.406  -11.305 2.788   1.00 17.29  ? 242  ALA A O   1 
ATOM   1216 C CB  . ALA A 1  164 ? -6.037  -8.315  4.120   1.00 18.65  ? 242  ALA A CB  1 
ATOM   1217 N N   . ASP A 1  165 ? -8.064  -10.665 4.185   1.00 17.02  ? 243  ASP A N   1 
ATOM   1218 C CA  . ASP A 1  165 ? -9.004  -11.636 3.660   1.00 18.85  ? 243  ASP A CA  1 
ATOM   1219 C C   . ASP A 1  165 ? -9.048  -11.678 2.130   1.00 17.79  ? 243  ASP A C   1 
ATOM   1220 O O   . ASP A 1  165 ? -9.125  -12.761 1.552   1.00 18.58  ? 243  ASP A O   1 
ATOM   1221 C CB  . ASP A 1  165 ? -10.414 -11.437 4.227   1.00 20.09  ? 243  ASP A CB  1 
ATOM   1222 C CG  . ASP A 1  165 ? -11.318 -12.617 3.921   1.00 23.66  ? 243  ASP A CG  1 
ATOM   1223 O OD1 . ASP A 1  165 ? -10.879 -13.782 4.097   1.00 22.37  ? 243  ASP A OD1 1 
ATOM   1224 O OD2 . ASP A 1  165 ? -12.443 -12.394 3.451   1.00 25.28  ? 243  ASP A OD2 1 
ATOM   1225 N N   . GLN A 1  166 ? -8.974  -10.510 1.490   1.00 15.89  ? 244  GLN A N   1 
ATOM   1226 C CA  . GLN A 1  166 ? -8.989  -10.422 0.024   1.00 17.08  ? 244  GLN A CA  1 
ATOM   1227 C C   . GLN A 1  166 ? -7.750  -9.736  -0.554  1.00 15.21  ? 244  GLN A C   1 
ATOM   1228 O O   . GLN A 1  166 ? -7.791  -9.189  -1.650  1.00 16.29  ? 244  GLN A O   1 
ATOM   1229 C CB  . GLN A 1  166 ? -10.277 -9.735  -0.437  1.00 17.24  ? 244  GLN A CB  1 
ATOM   1230 C CG  . GLN A 1  166 ? -11.491 -10.598 -0.195  1.00 20.38  ? 244  GLN A CG  1 
ATOM   1231 C CD  . GLN A 1  166 ? -12.770 -9.934  -0.634  1.00 21.99  ? 244  GLN A CD  1 
ATOM   1232 O OE1 . GLN A 1  166 ? -13.521 -9.445  0.188   1.00 27.16  ? 244  GLN A OE1 1 
ATOM   1233 N NE2 . GLN A 1  166 ? -13.018 -9.916  -1.935  1.00 19.36  ? 244  GLN A NE2 1 
ATOM   1234 N N   . PHE A 1  167 ? -6.643  -9.765  0.179   1.00 15.54  ? 245  PHE A N   1 
ATOM   1235 C CA  . PHE A 1  167 ? -5.389  -9.235  -0.339  1.00 17.10  ? 245  PHE A CA  1 
ATOM   1236 C C   . PHE A 1  167 ? -4.186  -9.876  0.370   1.00 17.37  ? 245  PHE A C   1 
ATOM   1237 O O   . PHE A 1  167 ? -3.964  -9.683  1.584   1.00 16.28  ? 245  PHE A O   1 
ATOM   1238 C CB  . PHE A 1  167 ? -5.344  -7.708  -0.258  1.00 15.71  ? 245  PHE A CB  1 
ATOM   1239 C CG  . PHE A 1  167 ? -4.134  -7.106  -0.919  1.00 16.20  ? 245  PHE A CG  1 
ATOM   1240 C CD1 . PHE A 1  167 ? -4.113  -6.877  -2.296  1.00 18.30  ? 245  PHE A CD1 1 
ATOM   1241 C CD2 . PHE A 1  167 ? -3.001  -6.782  -0.171  1.00 17.98  ? 245  PHE A CD2 1 
ATOM   1242 C CE1 . PHE A 1  167 ? -2.993  -6.335  -2.916  1.00 18.37  ? 245  PHE A CE1 1 
ATOM   1243 C CE2 . PHE A 1  167 ? -1.883  -6.223  -0.783  1.00 18.79  ? 245  PHE A CE2 1 
ATOM   1244 C CZ  . PHE A 1  167 ? -1.872  -6.007  -2.159  1.00 18.03  ? 245  PHE A CZ  1 
ATOM   1245 N N   . LEU A 1  168 ? -3.434  -10.648 -0.402  1.00 16.96  ? 246  LEU A N   1 
ATOM   1246 C CA  . LEU A 1  168 ? -2.182  -11.256 0.038   1.00 16.89  ? 246  LEU A CA  1 
ATOM   1247 C C   . LEU A 1  168 ? -1.096  -10.636 -0.808  1.00 19.99  ? 246  LEU A C   1 
ATOM   1248 O O   . LEU A 1  168 ? -1.253  -10.555 -2.025  1.00 18.80  ? 246  LEU A O   1 
ATOM   1249 C CB  . LEU A 1  168 ? -2.197  -12.761 -0.247  1.00 17.01  ? 246  LEU A CB  1 
ATOM   1250 C CG  . LEU A 1  168 ? -2.878  -13.758 0.673   1.00 21.09  ? 246  LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1  168 ? -4.117  -13.232 1.385   1.00 21.68  ? 246  LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1  168 ? -3.128  -15.080 -0.062  1.00 20.67  ? 246  LEU A CD2 1 
ATOM   1253 N N   . GLN A 1  169 ? -0.022  -10.165 -0.182  1.00 16.54  ? 247  GLN A N   1 
ATOM   1254 C CA  . GLN A 1  169 ? 1.142   -9.723  -0.938  1.00 18.85  ? 247  GLN A CA  1 
ATOM   1255 C C   . GLN A 1  169 ? 2.385   -10.286 -0.288  1.00 18.84  ? 247  GLN A C   1 
ATOM   1256 O O   . GLN A 1  169 ? 2.576   -10.143 0.928   1.00 16.29  ? 247  GLN A O   1 
ATOM   1257 C CB  . GLN A 1  169 ? 1.273   -8.187  -1.018  1.00 18.95  ? 247  GLN A CB  1 
ATOM   1258 C CG  . GLN A 1  169 ? 2.350   -7.739  -1.993  1.00 20.29  ? 247  GLN A CG  1 
ATOM   1259 C CD  . GLN A 1  169 ? 2.480   -6.217  -2.110  1.00 21.71  ? 247  GLN A CD  1 
ATOM   1260 O OE1 . GLN A 1  169 ? 2.003   -5.641  -3.035  1.00 26.52  ? 247  GLN A OE1 1 
ATOM   1261 N NE2 . GLN A 1  169 ? 3.164   -5.601  -1.184  1.00 29.97  ? 247  GLN A NE2 1 
ATOM   1262 N N   . LEU A 1  170 ? 3.204   -10.911 -1.118  1.00 16.59  ? 248  LEU A N   1 
ATOM   1263 C CA  . LEU A 1  170 ? 4.500   -11.449 -0.723  1.00 15.70  ? 248  LEU A CA  1 
ATOM   1264 C C   . LEU A 1  170 ? 5.462   -11.024 -1.796  1.00 15.80  ? 248  LEU A C   1 
ATOM   1265 O O   . LEU A 1  170 ? 5.173   -11.199 -2.990  1.00 15.48  ? 248  LEU A O   1 
ATOM   1266 C CB  . LEU A 1  170 ? 4.448   -12.975 -0.642  1.00 16.24  ? 248  LEU A CB  1 
ATOM   1267 C CG  . LEU A 1  170 ? 5.710   -13.694 -0.176  1.00 16.72  ? 248  LEU A CG  1 
ATOM   1268 C CD1 . LEU A 1  170 ? 5.936   -13.439 1.309   1.00 20.09  ? 248  LEU A CD1 1 
ATOM   1269 C CD2 . LEU A 1  170 ? 5.598   -15.185 -0.442  1.00 18.05  ? 248  LEU A CD2 1 
ATOM   1270 N N   . SER A 1  171 ? 6.584   -10.428 -1.394  1.00 17.59  ? 249  SER A N   1 
ATOM   1271 C CA  . SER A 1  171 ? 7.570   -9.931  -2.354  1.00 16.59  ? 249  SER A CA  1 
ATOM   1272 C C   . SER A 1  171 ? 8.889   -10.651 -2.198  1.00 15.73  ? 249  SER A C   1 
ATOM   1273 O O   . SER A 1  171 ? 9.158   -11.242 -1.156  1.00 15.40  ? 249  SER A O   1 
ATOM   1274 C CB  . SER A 1  171 ? 7.792   -8.402  -2.192  1.00 16.72  ? 249  SER A CB  1 
ATOM   1275 O OG  . SER A 1  171 ? 6.588   -7.650  -2.385  1.00 16.93  ? 249  SER A OG  1 
ATOM   1276 N N   . THR A 1  172 ? 9.734   -10.554 -3.220  1.00 15.05  ? 250  THR A N   1 
ATOM   1277 C CA  . THR A 1  172 ? 11.091  -11.057 -3.131  1.00 15.28  ? 250  THR A CA  1 
ATOM   1278 C C   . THR A 1  172 ? 12.013  -10.284 -4.029  1.00 15.74  ? 250  THR A C   1 
ATOM   1279 O O   . THR A 1  172 ? 11.606  -9.756  -5.074  1.00 17.85  ? 250  THR A O   1 
ATOM   1280 C CB  . THR A 1  172 ? 11.169  -12.572 -3.481  1.00 16.32  ? 250  THR A CB  1 
ATOM   1281 O OG1 . THR A 1  172 ? 12.514  -13.067 -3.312  1.00 16.04  ? 250  THR A OG1 1 
ATOM   1282 C CG2 . THR A 1  172 ? 10.702  -12.865 -4.935  1.00 13.80  ? 250  THR A CG2 1 
ATOM   1283 N N   . SER A 1  173 ? 13.273  -10.236 -3.641  1.00 16.59  ? 251  SER A N   1 
ATOM   1284 C CA  . SER A 1  173 ? 14.317  -9.900  -4.602  1.00 17.43  ? 251  SER A CA  1 
ATOM   1285 C C   . SER A 1  173 ? 14.397  -11.026 -5.642  1.00 18.35  ? 251  SER A C   1 
ATOM   1286 O O   . SER A 1  173 ? 14.030  -12.195 -5.357  1.00 17.47  ? 251  SER A O   1 
ATOM   1287 C CB  . SER A 1  173 ? 15.658  -9.715  -3.894  1.00 18.48  ? 251  SER A CB  1 
ATOM   1288 O OG  . SER A 1  173 ? 16.015  -10.869 -3.166  1.00 21.52  ? 251  SER A OG  1 
ATOM   1289 N N   . LEU A 1  174 ? 14.864  -10.664 -6.836  1.00 18.23  ? 252  LEU A N   1 
ATOM   1290 C CA  . LEU A 1  174 ? 15.197  -11.614 -7.885  1.00 18.27  ? 252  LEU A CA  1 
ATOM   1291 C C   . LEU A 1  174 ? 16.720  -11.643 -8.122  1.00 19.79  ? 252  LEU A C   1 
ATOM   1292 O O   . LEU A 1  174 ? 17.434  -10.668 -7.869  1.00 18.21  ? 252  LEU A O   1 
ATOM   1293 C CB  . LEU A 1  174 ? 14.476  -11.273 -9.189  1.00 17.95  ? 252  LEU A CB  1 
ATOM   1294 C CG  . LEU A 1  174 ? 12.942  -11.394 -9.165  1.00 17.30  ? 252  LEU A CG  1 
ATOM   1295 C CD1 . LEU A 1  174 ? 12.366  -10.686 -10.371 1.00 17.79  ? 252  LEU A CD1 1 
ATOM   1296 C CD2 . LEU A 1  174 ? 12.501  -12.860 -9.138  1.00 17.98  ? 252  LEU A CD2 1 
ATOM   1297 N N   . PRO A 1  175 ? 17.228  -12.776 -8.605  1.00 19.68  ? 253  PRO A N   1 
ATOM   1298 C CA  . PRO A 1  175 ? 18.688  -12.888 -8.661  1.00 20.89  ? 253  PRO A CA  1 
ATOM   1299 C C   . PRO A 1  175 ? 19.273  -12.251 -9.916  1.00 20.92  ? 253  PRO A C   1 
ATOM   1300 O O   . PRO A 1  175 ? 20.466  -12.076 -9.979  1.00 21.06  ? 253  PRO A O   1 
ATOM   1301 C CB  . PRO A 1  175 ? 18.906  -14.398 -8.679  1.00 20.71  ? 253  PRO A CB  1 
ATOM   1302 C CG  . PRO A 1  175 ? 17.700  -14.918 -9.379  1.00 18.71  ? 253  PRO A CG  1 
ATOM   1303 C CD  . PRO A 1  175 ? 16.566  -14.052 -8.928  1.00 18.36  ? 253  PRO A CD  1 
ATOM   1304 N N   . SER A 1  176 ? 18.440  -11.942 -10.904 1.00 18.95  ? 254  SER A N   1 
ATOM   1305 C CA  . SER A 1  176 ? 18.892  -11.303 -12.151 1.00 21.77  ? 254  SER A CA  1 
ATOM   1306 C C   . SER A 1  176 ? 17.728  -10.577 -12.771 1.00 20.67  ? 254  SER A C   1 
ATOM   1307 O O   . SER A 1  176 ? 16.612  -10.656 -12.262 1.00 17.62  ? 254  SER A O   1 
ATOM   1308 C CB  . SER A 1  176 ? 19.377  -12.350 -13.145 1.00 20.24  ? 254  SER A CB  1 
ATOM   1309 O OG  . SER A 1  176 ? 18.277  -12.994 -13.798 1.00 18.95  ? 254  SER A OG  1 
ATOM   1310 N N   . GLN A 1  177 ? 17.986  -9.923  -13.899 1.00 17.10  ? 255  GLN A N   1 
ATOM   1311 C CA  . GLN A 1  177 ? 16.951  -9.273  -14.657 1.00 19.02  ? 255  GLN A CA  1 
ATOM   1312 C C   . GLN A 1  177 ? 16.235  -10.233 -15.592 1.00 20.04  ? 255  GLN A C   1 
ATOM   1313 O O   . GLN A 1  177 ? 15.410  -9.786  -16.381 1.00 18.51  ? 255  GLN A O   1 
ATOM   1314 C CB  . GLN A 1  177 ? 17.540  -8.120  -15.494 1.00 21.20  ? 255  GLN A CB  1 
ATOM   1315 C CG  . GLN A 1  177 ? 18.184  -6.996  -14.711 1.00 20.04  ? 255  GLN A CG  1 
ATOM   1316 C CD  . GLN A 1  177 ? 17.193  -6.252  -13.835 1.00 23.18  ? 255  GLN A CD  1 
ATOM   1317 O OE1 . GLN A 1  177 ? 15.985  -6.322  -14.027 1.00 24.46  ? 255  GLN A OE1 1 
ATOM   1318 N NE2 . GLN A 1  177 ? 17.708  -5.543  -12.867 1.00 23.52  ? 255  GLN A NE2 1 
ATOM   1319 N N   . TYR A 1  178 ? 16.510  -11.535 -15.487 1.00 18.16  ? 256  TYR A N   1 
ATOM   1320 C CA  . TYR A 1  178 ? 16.025  -12.531 -16.430 1.00 16.95  ? 256  TYR A CA  1 
ATOM   1321 C C   . TYR A 1  178 ? 15.069  -13.477 -15.752 1.00 16.04  ? 256  TYR A C   1 
ATOM   1322 O O   . TYR A 1  178 ? 15.462  -14.305 -14.911 1.00 18.24  ? 256  TYR A O   1 
ATOM   1323 C CB  . TYR A 1  178 ? 17.192  -13.302 -17.053 1.00 19.98  ? 256  TYR A CB  1 
ATOM   1324 C CG  . TYR A 1  178 ? 18.049  -12.402 -17.882 1.00 25.81  ? 256  TYR A CG  1 
ATOM   1325 C CD1 . TYR A 1  178 ? 19.150  -11.743 -17.309 1.00 26.63  ? 256  TYR A CD1 1 
ATOM   1326 C CD2 . TYR A 1  178 ? 17.741  -12.152 -19.220 1.00 24.24  ? 256  TYR A CD2 1 
ATOM   1327 C CE1 . TYR A 1  178 ? 19.944  -10.893 -18.060 1.00 27.86  ? 256  TYR A CE1 1 
ATOM   1328 C CE2 . TYR A 1  178 ? 18.527  -11.300 -19.982 1.00 34.16  ? 256  TYR A CE2 1 
ATOM   1329 C CZ  . TYR A 1  178 ? 19.629  -10.675 -19.393 1.00 37.33  ? 256  TYR A CZ  1 
ATOM   1330 O OH  . TYR A 1  178 ? 20.413  -9.827  -20.117 1.00 37.97  ? 256  TYR A OH  1 
ATOM   1331 N N   . ILE A 1  179 ? 13.811  -13.358 -16.147 1.00 17.14  ? 257  ILE A N   1 
ATOM   1332 C CA  . ILE A 1  179 ? 12.714  -14.103 -15.550 1.00 17.63  ? 257  ILE A CA  1 
ATOM   1333 C C   . ILE A 1  179 ? 11.673  -14.434 -16.648 1.00 18.50  ? 257  ILE A C   1 
ATOM   1334 O O   . ILE A 1  179 ? 11.359  -13.589 -17.489 1.00 17.61  ? 257  ILE A O   1 
ATOM   1335 C CB  . ILE A 1  179 ? 12.107  -13.329 -14.368 1.00 15.54  ? 257  ILE A CB  1 
ATOM   1336 C CG1 . ILE A 1  179 ? 10.939  -14.112 -13.756 1.00 17.04  ? 257  ILE A CG1 1 
ATOM   1337 C CG2 . ILE A 1  179 ? 11.721  -11.910 -14.783 1.00 17.55  ? 257  ILE A CG2 1 
ATOM   1338 C CD1 . ILE A 1  179 ? 10.287  -13.473 -12.551 1.00 17.23  ? 257  ILE A CD1 1 
ATOM   1339 N N   . THR A 1  180 ? 11.178  -15.677 -16.630 1.00 17.22  ? 258  THR A N   1 
ATOM   1340 C CA  . THR A 1  180 ? 10.186  -16.151 -17.595 1.00 18.65  ? 258  THR A CA  1 
ATOM   1341 C C   . THR A 1  180 ? 9.092   -16.909 -16.876 1.00 17.65  ? 258  THR A C   1 
ATOM   1342 O O   . THR A 1  180 ? 9.321   -17.470 -15.807 1.00 19.86  ? 258  THR A O   1 
ATOM   1343 C CB  . THR A 1  180 ? 10.831  -17.050 -18.688 1.00 20.48  ? 258  THR A CB  1 
ATOM   1344 O OG1 . THR A 1  180 ? 9.863   -17.347 -19.707 1.00 20.28  ? 258  THR A OG1 1 
ATOM   1345 C CG2 . THR A 1  180 ? 11.364  -18.338 -18.106 1.00 18.72  ? 258  THR A CG2 1 
ATOM   1346 N N   . GLY A 1  181 ? 7.903   -16.921 -17.471 1.00 19.13  ? 259  GLY A N   1 
ATOM   1347 C CA  . GLY A 1  181 ? 6.753   -17.642 -16.936 1.00 16.06  ? 259  GLY A CA  1 
ATOM   1348 C C   . GLY A 1  181 ? 5.543   -16.744 -16.877 1.00 17.47  ? 259  GLY A C   1 
ATOM   1349 O O   . GLY A 1  181 ? 5.382   -15.848 -17.717 1.00 18.06  ? 259  GLY A O   1 
ATOM   1350 N N   . LEU A 1  182 ? 4.676   -17.003 -15.893 1.00 15.58  ? 260  LEU A N   1 
ATOM   1351 C CA  . LEU A 1  182 ? 3.536   -16.155 -15.613 1.00 14.19  ? 260  LEU A CA  1 
ATOM   1352 C C   . LEU A 1  182 ? 2.611   -15.952 -16.821 1.00 17.10  ? 260  LEU A C   1 
ATOM   1353 O O   . LEU A 1  182 ? 2.197   -14.832 -17.123 1.00 18.15  ? 260  LEU A O   1 
ATOM   1354 C CB  . LEU A 1  182 ? 3.988   -14.814 -15.029 1.00 13.78  ? 260  LEU A CB  1 
ATOM   1355 C CG  . LEU A 1  182 ? 4.884   -14.855 -13.775 1.00 14.57  ? 260  LEU A CG  1 
ATOM   1356 C CD1 . LEU A 1  182 ? 5.454   -13.470 -13.507 1.00 15.74  ? 260  LEU A CD1 1 
ATOM   1357 C CD2 . LEU A 1  182 ? 4.135   -15.396 -12.569 1.00 15.19  ? 260  LEU A CD2 1 
ATOM   1358 N N   . ALA A 1  183 ? 2.304   -17.054 -17.489 1.00 14.42  ? 261  ALA A N   1 
ATOM   1359 C CA  . ALA A 1  183 ? 1.336   -17.087 -18.565 1.00 14.38  ? 261  ALA A CA  1 
ATOM   1360 C C   . ALA A 1  183 ? -0.087  -16.774 -18.065 1.00 15.40  ? 261  ALA A C   1 
ATOM   1361 O O   . ALA A 1  183 ? -0.361  -16.877 -16.859 1.00 13.91  ? 261  ALA A O   1 
ATOM   1362 C CB  . ALA A 1  183 ? 1.381   -18.458 -19.242 1.00 15.37  ? 261  ALA A CB  1 
ATOM   1363 N N   . GLU A 1  184 ? -1.011  -16.400 -18.944 1.00 13.44  ? 262  GLU A N   1 
ATOM   1364 C CA  . GLU A 1  184 ? -0.829  -16.301 -20.396 1.00 15.32  ? 262  GLU A CA  1 
ATOM   1365 C C   . GLU A 1  184 ? -0.931  -14.847 -20.823 1.00 16.35  ? 262  GLU A C   1 
ATOM   1366 O O   . GLU A 1  184 ? -1.938  -14.187 -20.568 1.00 14.28  ? 262  GLU A O   1 
ATOM   1367 C CB  . GLU A 1  184 ? -1.893  -17.113 -21.101 1.00 16.55  ? 262  GLU A CB  1 
ATOM   1368 C CG  . GLU A 1  184 ? -1.718  -17.204 -22.615 1.00 19.84  ? 262  GLU A CG  1 
ATOM   1369 C CD  . GLU A 1  184 ? -2.688  -18.180 -23.254 1.00 18.59  ? 262  GLU A CD  1 
ATOM   1370 O OE1 . GLU A 1  184 ? -3.710  -18.512 -22.630 1.00 15.56  ? 262  GLU A OE1 1 
ATOM   1371 O OE2 . GLU A 1  184 ? -2.424  -18.620 -24.381 1.00 18.66  ? 262  GLU A OE2 1 
ATOM   1372 N N   . HIS A 1  185 ? 0.139   -14.366 -21.450 1.00 17.61  ? 263  HIS A N   1 
ATOM   1373 C CA  . HIS A 1  185 ? 0.268   -12.989 -21.920 1.00 22.05  ? 263  HIS A CA  1 
ATOM   1374 C C   . HIS A 1  185 ? 1.078   -12.961 -23.214 1.00 22.07  ? 263  HIS A C   1 
ATOM   1375 O O   . HIS A 1  185 ? 1.895   -13.848 -23.447 1.00 22.66  ? 263  HIS A O   1 
ATOM   1376 C CB  . HIS A 1  185 ? 0.963   -12.127 -20.866 1.00 20.32  ? 263  HIS A CB  1 
ATOM   1377 C CG  . HIS A 1  185 ? 0.303   -12.206 -19.548 1.00 18.20  ? 263  HIS A CG  1 
ATOM   1378 N ND1 . HIS A 1  185 ? 0.594   -13.195 -18.645 1.00 19.26  ? 263  HIS A ND1 1 
ATOM   1379 C CD2 . HIS A 1  185 ? -0.731  -11.503 -19.031 1.00 20.75  ? 263  HIS A CD2 1 
ATOM   1380 C CE1 . HIS A 1  185 ? -0.211  -13.078 -17.605 1.00 20.88  ? 263  HIS A CE1 1 
ATOM   1381 N NE2 . HIS A 1  185 ? -1.018  -12.054 -17.812 1.00 18.60  ? 263  HIS A NE2 1 
ATOM   1382 N N   . LEU A 1  186 ? 0.845   -11.929 -24.021 1.00 23.47  ? 264  LEU A N   1 
ATOM   1383 C CA  . LEU A 1  186 ? 1.532   -11.755 -25.307 1.00 27.31  ? 264  LEU A CA  1 
ATOM   1384 C C   . LEU A 1  186 ? 2.767   -10.940 -24.986 1.00 27.61  ? 264  LEU A C   1 
ATOM   1385 O O   . LEU A 1  186 ? 2.662   -9.754  -24.678 1.00 34.48  ? 264  LEU A O   1 
ATOM   1386 C CB  . LEU A 1  186 ? 0.613   -11.061 -26.326 1.00 36.22  ? 264  LEU A CB  1 
ATOM   1387 C CG  . LEU A 1  186 ? 0.866   -11.341 -27.813 1.00 48.13  ? 264  LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1  186 ? 0.727   -12.824 -28.167 1.00 69.03  ? 264  LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1  186 ? -0.106  -10.507 -28.624 1.00 51.19  ? 264  LEU A CD2 1 
ATOM   1390 N N   . SER A 1  187 ? 3.925   -11.607 -24.991 1.00 24.64  ? 265  SER A N   1 
ATOM   1391 C CA  . SER A 1  187 ? 5.158   -11.064 -24.422 1.00 26.78  ? 265  SER A CA  1 
ATOM   1392 C C   . SER A 1  187 ? 6.396   -11.795 -24.951 1.00 23.21  ? 265  SER A C   1 
ATOM   1393 O O   . SER A 1  187 ? 6.290   -12.947 -25.324 1.00 23.96  ? 265  SER A O   1 
ATOM   1394 C CB  . SER A 1  187 ? 5.089   -11.246 -22.893 1.00 30.61  ? 265  SER A CB  1 
ATOM   1395 O OG  . SER A 1  187 ? 6.360   -11.219 -22.288 1.00 28.92  ? 265  SER A OG  1 
ATOM   1396 N N   . PRO A 1  188 ? 7.576   -11.146 -24.941 1.00 21.36  ? 266  PRO A N   1 
ATOM   1397 C CA  . PRO A 1  188 ? 8.817   -11.921 -25.095 1.00 20.83  ? 266  PRO A CA  1 
ATOM   1398 C C   . PRO A 1  188 ? 8.910   -13.042 -24.049 1.00 20.72  ? 266  PRO A C   1 
ATOM   1399 O O   . PRO A 1  188 ? 8.204   -13.005 -23.048 1.00 18.95  ? 266  PRO A O   1 
ATOM   1400 C CB  . PRO A 1  188 ? 9.923   -10.866 -24.868 1.00 21.21  ? 266  PRO A CB  1 
ATOM   1401 C CG  . PRO A 1  188 ? 9.277   -9.554  -25.201 1.00 24.59  ? 266  PRO A CG  1 
ATOM   1402 C CD  . PRO A 1  188 ? 7.845   -9.701  -24.758 1.00 24.52  ? 266  PRO A CD  1 
ATOM   1403 N N   . LEU A 1  189 ? 9.776   -14.024 -24.274 1.00 21.31  ? 267  LEU A N   1 
ATOM   1404 C CA  . LEU A 1  189 ? 9.917   -15.135 -23.332 1.00 22.25  ? 267  LEU A CA  1 
ATOM   1405 C C   . LEU A 1  189 ? 10.450  -14.619 -21.999 1.00 22.31  ? 267  LEU A C   1 
ATOM   1406 O O   . LEU A 1  189 ? 9.967   -15.015 -20.928 1.00 22.82  ? 267  LEU A O   1 
ATOM   1407 C CB  . LEU A 1  189 ? 10.820  -16.224 -23.914 1.00 22.43  ? 267  LEU A CB  1 
ATOM   1408 C CG  . LEU A 1  189 ? 10.820  -17.582 -23.210 1.00 23.65  ? 267  LEU A CG  1 
ATOM   1409 C CD1 . LEU A 1  189 ? 9.424   -18.171 -23.018 1.00 21.53  ? 267  LEU A CD1 1 
ATOM   1410 C CD2 . LEU A 1  189 ? 11.691  -18.536 -24.007 1.00 22.07  ? 267  LEU A CD2 1 
ATOM   1411 N N   . MET A 1  190 ? 11.431  -13.715 -22.082 1.00 20.83  ? 268  MET A N   1 
ATOM   1412 C CA  . MET A 1  190 ? 11.948  -13.015 -20.914 1.00 23.52  ? 268  MET A CA  1 
ATOM   1413 C C   . MET A 1  190 ? 11.073  -11.804 -20.643 1.00 24.05  ? 268  MET A C   1 
ATOM   1414 O O   . MET A 1  190 ? 10.846  -10.992 -21.526 1.00 21.82  ? 268  MET A O   1 
ATOM   1415 C CB  . MET A 1  190 ? 13.409  -12.603 -21.131 1.00 22.69  ? 268  MET A CB  1 
ATOM   1416 C CG  . MET A 1  190 ? 14.370  -13.786 -21.176 1.00 20.37  ? 268  MET A CG  1 
ATOM   1417 S SD  . MET A 1  190 ? 14.474  -14.730 -19.635 1.00 22.36  ? 268  MET A SD  1 
ATOM   1418 C CE  . MET A 1  190 ? 14.978  -16.331 -20.265 1.00 24.78  ? 268  MET A CE  1 
ATOM   1419 N N   . LEU A 1  191 ? 10.568  -11.701 -19.421 1.00 19.74  ? 269  LEU A N   1 
ATOM   1420 C CA  . LEU A 1  191 ? 9.598   -10.668 -19.076 1.00 22.60  ? 269  LEU A CA  1 
ATOM   1421 C C   . LEU A 1  191 ? 10.331  -9.381  -18.758 1.00 21.50  ? 269  LEU A C   1 
ATOM   1422 O O   . LEU A 1  191 ? 11.448  -9.404  -18.217 1.00 27.42  ? 269  LEU A O   1 
ATOM   1423 C CB  . LEU A 1  191 ? 8.745   -11.105 -17.864 1.00 21.03  ? 269  LEU A CB  1 
ATOM   1424 C CG  . LEU A 1  191 ? 8.053   -12.474 -18.016 1.00 21.37  ? 269  LEU A CG  1 
ATOM   1425 C CD1 . LEU A 1  191 ? 7.452   -12.933 -16.703 1.00 18.54  ? 269  LEU A CD1 1 
ATOM   1426 C CD2 . LEU A 1  191 ? 6.987   -12.479 -19.121 1.00 25.80  ? 269  LEU A CD2 1 
ATOM   1427 N N   . SER A 1  192 ? 9.700   -8.255  -19.064 1.00 19.57  ? 270  SER A N   1 
ATOM   1428 C CA  . SER A 1  192 ? 10.220  -6.958  -18.632 1.00 20.79  ? 270  SER A CA  1 
ATOM   1429 C C   . SER A 1  192 ? 10.120  -6.719  -17.102 1.00 18.43  ? 270  SER A C   1 
ATOM   1430 O O   . SER A 1  192 ? 9.041   -6.780  -16.522 1.00 22.91  ? 270  SER A O   1 
ATOM   1431 C CB  . SER A 1  192 ? 9.499   -5.814  -19.350 1.00 22.29  ? 270  SER A CB  1 
ATOM   1432 O OG  . SER A 1  192 ? 9.981   -4.580  -18.829 1.00 21.98  ? 270  SER A OG  1 
ATOM   1433 N N   . THR A 1  193 ? 11.245  -6.402  -16.469 1.00 19.91  ? 271  THR A N   1 
ATOM   1434 C CA  . THR A 1  193 ? 11.248  -5.998  -15.060 1.00 23.73  ? 271  THR A CA  1 
ATOM   1435 C C   . THR A 1  193 ? 11.047  -4.493  -14.849 1.00 25.13  ? 271  THR A C   1 
ATOM   1436 O O   . THR A 1  193 ? 11.130  -4.046  -13.711 1.00 20.99  ? 271  THR A O   1 
ATOM   1437 C CB  . THR A 1  193 ? 12.545  -6.398  -14.341 1.00 25.76  ? 271  THR A CB  1 
ATOM   1438 O OG1 . THR A 1  193 ? 13.646  -5.775  -14.999 1.00 26.14  ? 271  THR A OG1 1 
ATOM   1439 C CG2 . THR A 1  193 ? 12.713  -7.922  -14.300 1.00 20.46  ? 271  THR A CG2 1 
ATOM   1440 N N   . SER A 1  194 ? 10.749  -3.724  -15.906 1.00 21.75  ? 272  SER A N   1 
ATOM   1441 C CA  . SER A 1  194 ? 10.564  -2.253  -15.778 1.00 26.35  ? 272  SER A CA  1 
ATOM   1442 C C   . SER A 1  194 ? 9.150   -1.849  -15.374 1.00 27.61  ? 272  SER A C   1 
ATOM   1443 O O   . SER A 1  194 ? 8.392   -1.291  -16.166 1.00 25.41  ? 272  SER A O   1 
ATOM   1444 C CB  . SER A 1  194 ? 10.954  -1.540  -17.070 1.00 33.42  ? 272  SER A CB  1 
ATOM   1445 O OG  . SER A 1  194 ? 12.303  -1.841  -17.382 1.00 44.51  ? 272  SER A OG  1 
ATOM   1446 N N   . TRP A 1  195 ? 8.812   -2.132  -14.122 1.00 22.45  ? 273  TRP A N   1 
ATOM   1447 C CA  . TRP A 1  195 ? 7.521   -1.749  -13.542 1.00 24.29  ? 273  TRP A CA  1 
ATOM   1448 C C   . TRP A 1  195 ? 6.355   -2.331  -14.318 1.00 25.35  ? 273  TRP A C   1 
ATOM   1449 O O   . TRP A 1  195 ? 5.496   -1.610  -14.818 1.00 26.37  ? 273  TRP A O   1 
ATOM   1450 C CB  . TRP A 1  195 ? 7.411   -0.215  -13.411 1.00 22.90  ? 273  TRP A CB  1 
ATOM   1451 C CG  . TRP A 1  195 ? 8.565   0.346   -12.644 1.00 22.88  ? 273  TRP A CG  1 
ATOM   1452 C CD1 . TRP A 1  195 ? 9.641   1.014   -13.158 1.00 25.14  ? 273  TRP A CD1 1 
ATOM   1453 C CD2 . TRP A 1  195 ? 8.789   0.254   -11.233 1.00 21.01  ? 273  TRP A CD2 1 
ATOM   1454 N NE1 . TRP A 1  195 ? 10.512  1.364   -12.149 1.00 28.41  ? 273  TRP A NE1 1 
ATOM   1455 C CE2 . TRP A 1  195 ? 10.016  0.911   -10.959 1.00 24.78  ? 273  TRP A CE2 1 
ATOM   1456 C CE3 . TRP A 1  195 ? 8.061   -0.286  -10.167 1.00 23.59  ? 273  TRP A CE3 1 
ATOM   1457 C CZ2 . TRP A 1  195 ? 10.527  1.039   -9.664  1.00 25.59  ? 273  TRP A CZ2 1 
ATOM   1458 C CZ3 . TRP A 1  195 ? 8.588   -0.186  -8.883  1.00 21.32  ? 273  TRP A CZ3 1 
ATOM   1459 C CH2 . TRP A 1  195 ? 9.798   0.473   -8.642  1.00 21.59  ? 273  TRP A CH2 1 
ATOM   1460 N N   . THR A 1  196 ? 6.320   -3.652  -14.354 1.00 23.81  ? 274  THR A N   1 
ATOM   1461 C CA  . THR A 1  196 ? 5.398   -4.391  -15.192 1.00 24.01  ? 274  THR A CA  1 
ATOM   1462 C C   . THR A 1  196 ? 4.367   -5.084  -14.292 1.00 19.85  ? 274  THR A C   1 
ATOM   1463 O O   . THR A 1  196 ? 4.750   -5.792  -13.369 1.00 19.52  ? 274  THR A O   1 
ATOM   1464 C CB  . THR A 1  196 ? 6.173   -5.453  -15.981 1.00 25.40  ? 274  THR A CB  1 
ATOM   1465 O OG1 . THR A 1  196 ? 7.263   -4.835  -16.671 1.00 29.66  ? 274  THR A OG1 1 
ATOM   1466 C CG2 . THR A 1  196 ? 5.265   -6.177  -16.970 1.00 27.95  ? 274  THR A CG2 1 
ATOM   1467 N N   . ARG A 1  197 ? 3.089   -4.865  -14.592 1.00 19.48  ? 275  ARG A N   1 
ATOM   1468 C CA  A ARG A 1  197 ? 1.965   -5.476  -13.859 0.50 19.68  ? 275  ARG A CA  1 
ATOM   1469 C CA  B ARG A 1  197 ? 1.951   -5.444  -13.868 0.50 21.28  ? 275  ARG A CA  1 
ATOM   1470 C C   . ARG A 1  197 ? 1.461   -6.627  -14.715 1.00 19.67  ? 275  ARG A C   1 
ATOM   1471 O O   . ARG A 1  197 ? 0.966   -6.409  -15.794 1.00 18.27  ? 275  ARG A O   1 
ATOM   1472 C CB  A ARG A 1  197 ? 0.854   -4.442  -13.637 0.50 19.85  ? 275  ARG A CB  1 
ATOM   1473 C CB  B ARG A 1  197 ? 0.865   -4.356  -13.738 0.50 23.52  ? 275  ARG A CB  1 
ATOM   1474 C CG  A ARG A 1  197 ? -0.386  -4.886  -12.857 0.50 18.05  ? 275  ARG A CG  1 
ATOM   1475 C CG  B ARG A 1  197 ? -0.148  -4.467  -12.604 0.50 25.77  ? 275  ARG A CG  1 
ATOM   1476 C CD  A ARG A 1  197 ? -1.503  -3.846  -13.059 0.50 20.39  ? 275  ARG A CD  1 
ATOM   1477 C CD  B ARG A 1  197 ? -0.956  -3.155  -12.504 0.50 29.87  ? 275  ARG A CD  1 
ATOM   1478 N NE  A ARG A 1  197 ? -2.138  -4.008  -14.369 0.50 32.04  ? 275  ARG A NE  1 
ATOM   1479 N NE  B ARG A 1  197 ? -1.874  -3.127  -11.358 0.50 40.25  ? 275  ARG A NE  1 
ATOM   1480 C CZ  A ARG A 1  197 ? -2.455  -3.018  -15.213 0.50 36.37  ? 275  ARG A CZ  1 
ATOM   1481 C CZ  B ARG A 1  197 ? -3.024  -2.460  -11.335 0.50 42.37  ? 275  ARG A CZ  1 
ATOM   1482 N NH1 A ARG A 1  197 ? -2.184  -1.753  -14.909 0.50 36.38  ? 275  ARG A NH1 1 
ATOM   1483 N NH1 B ARG A 1  197 ? -3.395  -1.749  -12.388 0.50 40.23  ? 275  ARG A NH1 1 
ATOM   1484 N NH2 A ARG A 1  197 ? -3.035  -3.311  -16.379 0.50 26.52  ? 275  ARG A NH2 1 
ATOM   1485 N NH2 B ARG A 1  197 ? -3.813  -2.509  -10.269 0.50 41.05  ? 275  ARG A NH2 1 
ATOM   1486 N N   . ILE A 1  198 ? 1.602   -7.858  -14.233 1.00 15.63  ? 276  ILE A N   1 
ATOM   1487 C CA  . ILE A 1  198 ? 1.191   -9.049  -14.997 1.00 18.48  ? 276  ILE A CA  1 
ATOM   1488 C C   . ILE A 1  198 ? -0.041  -9.622  -14.315 1.00 17.33  ? 276  ILE A C   1 
ATOM   1489 O O   . ILE A 1  198 ? 0.019   -10.000 -13.143 1.00 15.45  ? 276  ILE A O   1 
ATOM   1490 C CB  . ILE A 1  198 ? 2.323   -10.105 -15.081 1.00 17.24  ? 276  ILE A CB  1 
ATOM   1491 C CG1 . ILE A 1  198 ? 3.519   -9.507  -15.846 1.00 21.09  ? 276  ILE A CG1 1 
ATOM   1492 C CG2 . ILE A 1  198 ? 1.845   -11.347 -15.828 1.00 15.65  ? 276  ILE A CG2 1 
ATOM   1493 C CD1 . ILE A 1  198 ? 4.831   -10.222 -15.676 1.00 23.64  ? 276  ILE A CD1 1 
ATOM   1494 N N   . THR A 1  199 ? -1.164  -9.627  -15.031 1.00 16.40  ? 277  THR A N   1 
ATOM   1495 C CA  . THR A 1  199 ? -2.464  -9.964  -14.427 1.00 16.56  ? 277  THR A CA  1 
ATOM   1496 C C   . THR A 1  199 ? -2.927  -11.372 -14.842 1.00 14.28  ? 277  THR A C   1 
ATOM   1497 O O   . THR A 1  199 ? -3.015  -11.688 -16.045 1.00 14.51  ? 277  THR A O   1 
ATOM   1498 C CB  . THR A 1  199 ? -3.529  -8.914  -14.772 1.00 14.15  ? 277  THR A CB  1 
ATOM   1499 O OG1 . THR A 1  199 ? -3.124  -7.632  -14.269 1.00 14.16  ? 277  THR A OG1 1 
ATOM   1500 C CG2 . THR A 1  199 ? -4.861  -9.265  -14.149 1.00 15.51  ? 277  THR A CG2 1 
ATOM   1501 N N   . LEU A 1  200 ? -3.206  -12.198 -13.840 1.00 14.18  ? 278  LEU A N   1 
ATOM   1502 C CA  . LEU A 1  200 ? -3.712  -13.565 -14.008 1.00 14.35  ? 278  LEU A CA  1 
ATOM   1503 C C   . LEU A 1  200 ? -5.206  -13.630 -13.692 1.00 12.36  ? 278  LEU A C   1 
ATOM   1504 O O   . LEU A 1  200 ? -5.609  -13.706 -12.533 1.00 14.39  ? 278  LEU A O   1 
ATOM   1505 C CB  . LEU A 1  200 ? -2.918  -14.552 -13.135 1.00 15.43  ? 278  LEU A CB  1 
ATOM   1506 C CG  . LEU A 1  200 ? -1.607  -15.119 -13.730 1.00 18.16  ? 278  LEU A CG  1 
ATOM   1507 C CD1 . LEU A 1  200 ? -0.593  -14.049 -14.026 1.00 19.90  ? 278  LEU A CD1 1 
ATOM   1508 C CD2 . LEU A 1  200 ? -0.953  -16.130 -12.799 1.00 17.83  ? 278  LEU A CD2 1 
ATOM   1509 N N   . TRP A 1  201 ? -6.032  -13.576 -14.745 1.00 12.62  ? 279  TRP A N   1 
ATOM   1510 C CA  . TRP A 1  201 ? -7.478  -13.684 -14.616 1.00 12.91  ? 279  TRP A CA  1 
ATOM   1511 C C   . TRP A 1  201 ? -7.998  -14.106 -15.982 1.00 14.30  ? 279  TRP A C   1 
ATOM   1512 O O   . TRP A 1  201 ? -7.949  -13.330 -16.937 1.00 14.45  ? 279  TRP A O   1 
ATOM   1513 C CB  . TRP A 1  201 ? -8.089  -12.365 -14.196 1.00 15.44  ? 279  TRP A CB  1 
ATOM   1514 C CG  . TRP A 1  201 ? -9.593  -12.426 -14.021 1.00 16.56  ? 279  TRP A CG  1 
ATOM   1515 C CD1 . TRP A 1  201 ? -10.532 -11.851 -14.813 1.00 16.17  ? 279  TRP A CD1 1 
ATOM   1516 C CD2 . TRP A 1  201 ? -10.305 -13.143 -13.009 1.00 15.63  ? 279  TRP A CD2 1 
ATOM   1517 N NE1 . TRP A 1  201 ? -11.793 -12.135 -14.334 1.00 16.20  ? 279  TRP A NE1 1 
ATOM   1518 C CE2 . TRP A 1  201 ? -11.683 -12.927 -13.228 1.00 15.33  ? 279  TRP A CE2 1 
ATOM   1519 C CE3 . TRP A 1  201 ? -9.913  -13.954 -11.939 1.00 14.93  ? 279  TRP A CE3 1 
ATOM   1520 C CZ2 . TRP A 1  201 ? -12.681 -13.478 -12.393 1.00 15.01  ? 279  TRP A CZ2 1 
ATOM   1521 C CZ3 . TRP A 1  201 ? -10.900 -14.480 -11.099 1.00 14.62  ? 279  TRP A CZ3 1 
ATOM   1522 C CH2 . TRP A 1  201 ? -12.260 -14.246 -11.337 1.00 14.90  ? 279  TRP A CH2 1 
ATOM   1523 N N   . ASN A 1  202 ? -8.424  -15.364 -16.084 1.00 14.45  ? 280  ASN A N   1 
ATOM   1524 C CA  . ASN A 1  202 ? -8.705  -15.977 -17.378 1.00 14.75  ? 280  ASN A CA  1 
ATOM   1525 C C   . ASN A 1  202 ? -9.822  -15.211 -18.049 1.00 14.08  ? 280  ASN A C   1 
ATOM   1526 O O   . ASN A 1  202 ? -10.829 -14.905 -17.412 1.00 15.05  ? 280  ASN A O   1 
ATOM   1527 C CB  . ASN A 1  202 ? -9.042  -17.456 -17.220 1.00 13.98  ? 280  ASN A CB  1 
ATOM   1528 C CG  . ASN A 1  202 ? -7.852  -18.282 -16.685 1.00 15.29  ? 280  ASN A CG  1 
ATOM   1529 O OD1 . ASN A 1  202 ? -6.737  -17.797 -16.559 1.00 16.17  ? 280  ASN A OD1 1 
ATOM   1530 N ND2 . ASN A 1  202 ? -8.107  -19.524 -16.357 1.00 16.53  ? 280  ASN A ND2 1 
ATOM   1531 N N   . ARG A 1  203 ? -9.593  -14.862 -19.310 1.00 13.55  ? 281  ARG A N   1 
ATOM   1532 C CA  . ARG A 1  203 ? -10.359 -13.862 -20.028 1.00 12.42  ? 281  ARG A CA  1 
ATOM   1533 C C   . ARG A 1  203 ? -10.372 -14.174 -21.517 1.00 14.40  ? 281  ARG A C   1 
ATOM   1534 O O   . ARG A 1  203 ? -9.314  -14.413 -22.110 1.00 13.38  ? 281  ARG A O   1 
ATOM   1535 C CB  . ARG A 1  203 ? -9.729  -12.483 -19.821 1.00 13.31  ? 281  ARG A CB  1 
ATOM   1536 C CG  . ARG A 1  203 ? -10.221 -11.364 -20.725 1.00 15.82  ? 281  ARG A CG  1 
ATOM   1537 C CD  . ARG A 1  203 ? -11.720 -11.158 -20.606 1.00 15.19  ? 281  ARG A CD  1 
ATOM   1538 N NE  . ARG A 1  203 ? -12.235 -10.273 -21.653 1.00 16.47  ? 281  ARG A NE  1 
ATOM   1539 C CZ  . ARG A 1  203 ? -12.572 -8.990  -21.496 1.00 15.45  ? 281  ARG A CZ  1 
ATOM   1540 N NH1 . ARG A 1  203 ? -12.473 -8.367  -20.329 1.00 15.23  ? 281  ARG A NH1 1 
ATOM   1541 N NH2 . ARG A 1  203 ? -13.062 -8.334  -22.527 1.00 15.35  ? 281  ARG A NH2 1 
ATOM   1542 N N   . ASP A 1  204 ? -11.574 -14.172 -22.091 1.00 17.27  ? 282  ASP A N   1 
ATOM   1543 C CA  . ASP A 1  204 ? -11.778 -14.323 -23.543 1.00 19.58  ? 282  ASP A CA  1 
ATOM   1544 C C   . ASP A 1  204 ? -11.510 -12.948 -24.152 1.00 26.66  ? 282  ASP A C   1 
ATOM   1545 O O   . ASP A 1  204 ? -12.369 -12.067 -24.107 1.00 25.02  ? 282  ASP A O   1 
ATOM   1546 C CB  . ASP A 1  204 ? -13.203 -14.751 -23.853 1.00 20.48  ? 282  ASP A CB  1 
ATOM   1547 C CG  . ASP A 1  204 ? -13.475 -14.884 -25.357 1.00 26.73  ? 282  ASP A CG  1 
ATOM   1548 O OD1 . ASP A 1  204 ? -12.594 -14.492 -26.165 1.00 26.48  ? 282  ASP A OD1 1 
ATOM   1549 O OD2 . ASP A 1  204 ? -14.553 -15.432 -25.714 1.00 26.55  ? 282  ASP A OD2 1 
ATOM   1550 N N   . LEU A 1  205 ? -10.292 -12.771 -24.636 1.00 22.62  ? 283  LEU A N   1 
ATOM   1551 C CA  . LEU A 1  205 ? -9.902  -11.588 -25.404 1.00 26.45  ? 283  LEU A CA  1 
ATOM   1552 C C   . LEU A 1  205 ? -8.901  -12.022 -26.454 1.00 18.83  ? 283  LEU A C   1 
ATOM   1553 O O   . LEU A 1  205 ? -8.003  -12.787 -26.157 1.00 20.72  ? 283  LEU A O   1 
ATOM   1554 C CB  . LEU A 1  205 ? -9.260  -10.545 -24.493 1.00 27.03  ? 283  LEU A CB  1 
ATOM   1555 C CG  . LEU A 1  205 ? -8.840  -9.228  -25.169 1.00 31.78  ? 283  LEU A CG  1 
ATOM   1556 C CD1 . LEU A 1  205 ? -10.039 -8.352  -25.431 1.00 30.69  ? 283  LEU A CD1 1 
ATOM   1557 C CD2 . LEU A 1  205 ? -7.822  -8.489  -24.317 1.00 41.02  ? 283  LEU A CD2 1 
ATOM   1558 N N   . ALA A 1  206 ? -9.020  -11.519 -27.676 1.00 18.23  ? 284  ALA A N   1 
ATOM   1559 C CA  . ALA A 1  206 ? -8.005  -11.828 -28.690 1.00 22.99  ? 284  ALA A CA  1 
ATOM   1560 C C   . ALA A 1  206 ? -6.635  -11.350 -28.180 1.00 18.11  ? 284  ALA A C   1 
ATOM   1561 O O   . ALA A 1  206 ? -6.544  -10.223 -27.731 1.00 25.41  ? 284  ALA A O   1 
ATOM   1562 C CB  . ALA A 1  206 ? -8.343  -11.164 -30.032 1.00 21.18  ? 284  ALA A CB  1 
ATOM   1563 N N   . PRO A 1  207 ? -5.588  -12.199 -28.242 1.00 22.79  ? 285  PRO A N   1 
ATOM   1564 C CA  . PRO A 1  207 ? -4.315  -11.784 -27.653 1.00 29.44  ? 285  PRO A CA  1 
ATOM   1565 C C   . PRO A 1  207 ? -3.859  -10.377 -28.090 1.00 32.52  ? 285  PRO A C   1 
ATOM   1566 O O   . PRO A 1  207 ? -3.797  -10.076 -29.274 1.00 31.41  ? 285  PRO A O   1 
ATOM   1567 C CB  . PRO A 1  207 ? -3.349  -12.860 -28.126 1.00 26.77  ? 285  PRO A CB  1 
ATOM   1568 C CG  . PRO A 1  207 ? -4.194  -14.074 -28.207 1.00 28.41  ? 285  PRO A CG  1 
ATOM   1569 C CD  . PRO A 1  207 ? -5.493  -13.573 -28.770 1.00 23.98  ? 285  PRO A CD  1 
ATOM   1570 N N   . THR A 1  208 ? -3.644  -9.526  -27.098 1.00 34.20  ? 286  THR A N   1 
ATOM   1571 C CA  . THR A 1  208 ? -3.110  -8.188  -27.268 1.00 33.65  ? 286  THR A CA  1 
ATOM   1572 C C   . THR A 1  208 ? -2.121  -7.946  -26.104 1.00 38.32  ? 286  THR A C   1 
ATOM   1573 O O   . THR A 1  208 ? -2.285  -8.548  -25.033 1.00 31.82  ? 286  THR A O   1 
ATOM   1574 C CB  . THR A 1  208 ? -4.239  -7.139  -27.302 1.00 30.22  ? 286  THR A CB  1 
ATOM   1575 O OG1 . THR A 1  208 ? -3.694  -5.880  -27.682 1.00 51.56  ? 286  THR A OG1 1 
ATOM   1576 C CG2 . THR A 1  208 ? -4.942  -6.971  -25.971 1.00 36.47  ? 286  THR A CG2 1 
ATOM   1577 N N   . PRO A 1  209 ? -1.074  -7.117  -26.315 1.00 49.00  ? 287  PRO A N   1 
ATOM   1578 C CA  . PRO A 1  209 ? -0.102  -6.823  -25.231 1.00 35.79  ? 287  PRO A CA  1 
ATOM   1579 C C   . PRO A 1  209 ? -0.670  -6.193  -23.947 1.00 23.57  ? 287  PRO A C   1 
ATOM   1580 O O   . PRO A 1  209 ? -1.614  -5.416  -23.986 1.00 25.82  ? 287  PRO A O   1 
ATOM   1581 C CB  . PRO A 1  209 ? 0.884   -5.852  -25.906 1.00 44.21  ? 287  PRO A CB  1 
ATOM   1582 C CG  . PRO A 1  209 ? 0.840   -6.225  -27.350 1.00 51.31  ? 287  PRO A CG  1 
ATOM   1583 C CD  . PRO A 1  209 ? -0.589  -6.618  -27.623 1.00 52.81  ? 287  PRO A CD  1 
ATOM   1584 N N   . GLY A 1  210 ? -0.086  -6.535  -22.808 1.00 24.20  ? 288  GLY A N   1 
ATOM   1585 C CA  . GLY A 1  210 ? -0.515  -5.974  -21.530 1.00 27.41  ? 288  GLY A CA  1 
ATOM   1586 C C   . GLY A 1  210 ? -1.851  -6.490  -21.001 1.00 25.46  ? 288  GLY A C   1 
ATOM   1587 O O   . GLY A 1  210 ? -2.308  -5.991  -19.986 1.00 27.80  ? 288  GLY A O   1 
ATOM   1588 N N   . ALA A 1  211 ? -2.448  -7.508  -21.641 1.00 21.62  ? 289  ALA A N   1 
ATOM   1589 C CA  . ALA A 1  211 ? -3.772  -8.028  -21.228 1.00 20.38  ? 289  ALA A CA  1 
ATOM   1590 C C   . ALA A 1  211 ? -3.684  -9.375  -20.548 1.00 15.72  ? 289  ALA A C   1 
ATOM   1591 O O   . ALA A 1  211 ? -2.931  -10.219 -20.979 1.00 16.78  ? 289  ALA A O   1 
ATOM   1592 C CB  . ALA A 1  211 ? -4.678  -8.171  -22.440 1.00 22.63  ? 289  ALA A CB  1 
ATOM   1593 N N   . ASN A 1  212 ? -4.506  -9.589  -19.523 1.00 15.07  ? 290  ASN A N   1 
ATOM   1594 C CA  . ASN A 1  212 ? -4.818  -10.950 -19.071 1.00 15.16  ? 290  ASN A CA  1 
ATOM   1595 C C   . ASN A 1  212 ? -5.514  -11.767 -20.165 1.00 14.40  ? 290  ASN A C   1 
ATOM   1596 O O   . ASN A 1  212 ? -6.573  -11.382 -20.643 1.00 14.02  ? 290  ASN A O   1 
ATOM   1597 C CB  . ASN A 1  212 ? -5.687  -10.946 -17.803 1.00 13.81  ? 290  ASN A CB  1 
ATOM   1598 C CG  . ASN A 1  212 ? -6.929  -10.080 -17.932 1.00 15.52  ? 290  ASN A CG  1 
ATOM   1599 O OD1 . ASN A 1  212 ? -6.842  -8.922  -18.354 1.00 15.54  ? 290  ASN A OD1 1 
ATOM   1600 N ND2 . ASN A 1  212 ? -8.088  -10.626 -17.552 1.00 16.01  ? 290  ASN A ND2 1 
ATOM   1601 N N   . LEU A 1  213 ? -4.921  -12.888 -20.563 1.00 17.06  ? 291  LEU A N   1 
ATOM   1602 C CA  . LEU A 1  213 ? -5.503  -13.708 -21.636 1.00 16.95  ? 291  LEU A CA  1 
ATOM   1603 C C   . LEU A 1  213 ? -6.186  -14.952 -21.069 1.00 16.08  ? 291  LEU A C   1 
ATOM   1604 O O   . LEU A 1  213 ? -6.638  -14.956 -19.919 1.00 15.50  ? 291  LEU A O   1 
ATOM   1605 C CB  . LEU A 1  213 ? -4.462  -14.036 -22.710 1.00 17.05  ? 291  LEU A CB  1 
ATOM   1606 C CG  . LEU A 1  213 ? -3.629  -12.867 -23.227 1.00 17.93  ? 291  LEU A CG  1 
ATOM   1607 C CD1 . LEU A 1  213 ? -2.592  -13.375 -24.217 1.00 21.10  ? 291  LEU A CD1 1 
ATOM   1608 C CD2 . LEU A 1  213 ? -4.512  -11.795 -23.854 1.00 18.75  ? 291  LEU A CD2 1 
ATOM   1609 N N   . TYR A 1  214 ? -6.241  -16.012 -21.854 1.00 14.53  ? 292  TYR A N   1 
ATOM   1610 C CA  . TYR A 1  214 ? -7.137  -17.128 -21.566 1.00 17.80  ? 292  TYR A CA  1 
ATOM   1611 C C   . TYR A 1  214 ? -6.759  -17.974 -20.352 1.00 20.30  ? 292  TYR A C   1 
ATOM   1612 O O   . TYR A 1  214 ? -7.628  -18.653 -19.787 1.00 17.14  ? 292  TYR A O   1 
ATOM   1613 C CB  . TYR A 1  214 ? -7.203  -18.035 -22.773 1.00 17.58  ? 292  TYR A CB  1 
ATOM   1614 C CG  . TYR A 1  214 ? -7.445  -17.352 -24.105 1.00 16.54  ? 292  TYR A CG  1 
ATOM   1615 C CD1 . TYR A 1  214 ? -8.725  -16.890 -24.446 1.00 17.80  ? 292  TYR A CD1 1 
ATOM   1616 C CD2 . TYR A 1  214 ? -6.413  -17.213 -25.044 1.00 18.28  ? 292  TYR A CD2 1 
ATOM   1617 C CE1 . TYR A 1  214 ? -8.980  -16.306 -25.685 1.00 17.60  ? 292  TYR A CE1 1 
ATOM   1618 C CE2 . TYR A 1  214 ? -6.653  -16.615 -26.294 1.00 18.27  ? 292  TYR A CE2 1 
ATOM   1619 C CZ  . TYR A 1  214 ? -7.935  -16.173 -26.605 1.00 15.62  ? 292  TYR A CZ  1 
ATOM   1620 O OH  . TYR A 1  214 ? -8.197  -15.631 -27.837 1.00 18.17  ? 292  TYR A OH  1 
ATOM   1621 N N   . GLY A 1  215 ? -5.470  -17.947 -19.985 1.00 16.61  ? 293  GLY A N   1 
ATOM   1622 C CA  . GLY A 1  215 ? -4.916  -18.824 -18.964 1.00 15.09  ? 293  GLY A CA  1 
ATOM   1623 C C   . GLY A 1  215 ? -4.048  -18.103 -17.950 1.00 16.51  ? 293  GLY A C   1 
ATOM   1624 O O   . GLY A 1  215 ? -3.634  -16.946 -18.149 1.00 16.86  ? 293  GLY A O   1 
ATOM   1625 N N   . SER A 1  216 ? -3.774  -18.817 -16.867 1.00 13.97  ? 294  SER A N   1 
ATOM   1626 C CA  . SER A 1  216 ? -3.103  -18.272 -15.694 1.00 15.05  ? 294  SER A CA  1 
ATOM   1627 C C   . SER A 1  216 ? -2.191  -19.355 -15.124 1.00 15.19  ? 294  SER A C   1 
ATOM   1628 O O   . SER A 1  216 ? -2.659  -20.407 -14.730 1.00 15.97  ? 294  SER A O   1 
ATOM   1629 C CB  . SER A 1  216 ? -4.133  -17.844 -14.626 1.00 15.38  ? 294  SER A CB  1 
ATOM   1630 O OG  . SER A 1  216 ? -4.816  -16.671 -15.016 1.00 13.07  ? 294  SER A OG  1 
ATOM   1631 N N   . HIS A 1  217 ? -0.893  -19.089 -15.092 1.00 15.53  ? 295  HIS A N   1 
ATOM   1632 C CA  . HIS A 1  217 ? 0.083   -20.028 -14.591 1.00 15.72  ? 295  HIS A CA  1 
ATOM   1633 C C   . HIS A 1  217 ? 1.028   -19.294 -13.632 1.00 14.85  ? 295  HIS A C   1 
ATOM   1634 O O   . HIS A 1  217 ? 2.004   -18.681 -14.071 1.00 13.44  ? 295  HIS A O   1 
ATOM   1635 C CB  . HIS A 1  217 ? 0.880   -20.624 -15.765 1.00 14.54  ? 295  HIS A CB  1 
ATOM   1636 C CG  . HIS A 1  217 ? 0.069   -21.491 -16.672 1.00 15.12  ? 295  HIS A CG  1 
ATOM   1637 N ND1 . HIS A 1  217 ? 0.235   -22.859 -16.743 1.00 16.29  ? 295  HIS A ND1 1 
ATOM   1638 C CD2 . HIS A 1  217 ? -0.924  -21.186 -17.546 1.00 14.68  ? 295  HIS A CD2 1 
ATOM   1639 C CE1 . HIS A 1  217 ? -0.628  -23.359 -17.612 1.00 16.21  ? 295  HIS A CE1 1 
ATOM   1640 N NE2 . HIS A 1  217 ? -1.335  -22.361 -18.118 1.00 16.14  ? 295  HIS A NE2 1 
ATOM   1641 N N   . PRO A 1  218 ? 0.767   -19.370 -12.324 1.00 13.30  ? 296  PRO A N   1 
ATOM   1642 C CA  . PRO A 1  218 ? 1.601   -18.591 -11.379 1.00 15.88  ? 296  PRO A CA  1 
ATOM   1643 C C   . PRO A 1  218 ? 2.938   -19.257 -11.052 1.00 16.39  ? 296  PRO A C   1 
ATOM   1644 O O   . PRO A 1  218 ? 3.233   -19.645 -9.912  1.00 15.58  ? 296  PRO A O   1 
ATOM   1645 C CB  . PRO A 1  218 ? 0.691   -18.442 -10.155 1.00 14.17  ? 296  PRO A CB  1 
ATOM   1646 C CG  . PRO A 1  218 ? -0.170  -19.662 -10.216 1.00 12.71  ? 296  PRO A CG  1 
ATOM   1647 C CD  . PRO A 1  218 ? -0.455  -19.868 -11.676 1.00 12.40  ? 296  PRO A CD  1 
ATOM   1648 N N   . PHE A 1  219 ? 3.767   -19.352 -12.072 1.00 14.53  ? 297  PHE A N   1 
ATOM   1649 C CA  . PHE A 1  219 ? 5.076   -19.973 -11.956 1.00 16.87  ? 297  PHE A CA  1 
ATOM   1650 C C   . PHE A 1  219 ? 6.062   -19.096 -12.674 1.00 14.62  ? 297  PHE A C   1 
ATOM   1651 O O   . PHE A 1  219 ? 5.745   -18.584 -13.740 1.00 14.65  ? 297  PHE A O   1 
ATOM   1652 C CB  . PHE A 1  219 ? 5.070   -21.368 -12.596 1.00 16.23  ? 297  PHE A CB  1 
ATOM   1653 C CG  . PHE A 1  219 ? 6.439   -21.943 -12.794 1.00 14.85  ? 297  PHE A CG  1 
ATOM   1654 C CD1 . PHE A 1  219 ? 7.076   -22.623 -11.768 1.00 18.76  ? 297  PHE A CD1 1 
ATOM   1655 C CD2 . PHE A 1  219 ? 7.093   -21.807 -14.004 1.00 16.86  ? 297  PHE A CD2 1 
ATOM   1656 C CE1 . PHE A 1  219 ? 8.345   -23.136 -11.953 1.00 19.14  ? 297  PHE A CE1 1 
ATOM   1657 C CE2 . PHE A 1  219 ? 8.360   -22.323 -14.193 1.00 16.28  ? 297  PHE A CE2 1 
ATOM   1658 C CZ  . PHE A 1  219 ? 8.977   -23.000 -13.171 1.00 19.37  ? 297  PHE A CZ  1 
ATOM   1659 N N   . TYR A 1  220 ? 7.236   -18.887 -12.081 1.00 11.86  ? 298  TYR A N   1 
ATOM   1660 C CA  . TYR A 1  220 ? 8.329   -18.292 -12.799 1.00 12.96  ? 298  TYR A CA  1 
ATOM   1661 C C   . TYR A 1  220 ? 9.606   -19.089 -12.653 1.00 16.18  ? 298  TYR A C   1 
ATOM   1662 O O   . TYR A 1  220 ? 9.809   -19.762 -11.652 1.00 14.08  ? 298  TYR A O   1 
ATOM   1663 C CB  . TYR A 1  220 ? 8.556   -16.818 -12.405 1.00 13.60  ? 298  TYR A CB  1 
ATOM   1664 C CG  . TYR A 1  220 ? 9.132   -16.530 -11.011 1.00 12.59  ? 298  TYR A CG  1 
ATOM   1665 C CD1 . TYR A 1  220 ? 10.515  -16.571 -10.754 1.00 16.36  ? 298  TYR A CD1 1 
ATOM   1666 C CD2 . TYR A 1  220 ? 8.305   -16.129 -9.990  1.00 13.08  ? 298  TYR A CD2 1 
ATOM   1667 C CE1 . TYR A 1  220 ? 11.034  -16.259 -9.483  1.00 14.30  ? 298  TYR A CE1 1 
ATOM   1668 C CE2 . TYR A 1  220 ? 8.800   -15.823 -8.731  1.00 15.53  ? 298  TYR A CE2 1 
ATOM   1669 C CZ  . TYR A 1  220 ? 10.162  -15.874 -8.477  1.00 14.95  ? 298  TYR A CZ  1 
ATOM   1670 O OH  . TYR A 1  220 ? 10.584  -15.542 -7.204  1.00 14.14  ? 298  TYR A OH  1 
ATOM   1671 N N   . LEU A 1  221 ? 10.456  -18.969 -13.679 1.00 16.42  ? 299  LEU A N   1 
ATOM   1672 C CA  . LEU A 1  221 ? 11.804  -19.469 -13.676 1.00 15.66  ? 299  LEU A CA  1 
ATOM   1673 C C   . LEU A 1  221 ? 12.736  -18.274 -13.782 1.00 16.33  ? 299  LEU A C   1 
ATOM   1674 O O   . LEU A 1  221 ? 12.620  -17.464 -14.720 1.00 15.93  ? 299  LEU A O   1 
ATOM   1675 C CB  . LEU A 1  221 ? 12.005  -20.446 -14.849 1.00 17.72  ? 299  LEU A CB  1 
ATOM   1676 C CG  . LEU A 1  221 ? 13.376  -21.106 -15.000 1.00 17.35  ? 299  LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1  221 ? 13.255  -22.391 -15.798 1.00 19.72  ? 299  LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1  221 ? 14.401  -20.163 -15.628 1.00 23.20  ? 299  LEU A CD2 1 
ATOM   1679 N N   . ALA A 1  222 ? 13.674  -18.168 -12.828 1.00 16.19  ? 300  ALA A N   1 
ATOM   1680 C CA  . ALA A 1  222 ? 14.625  -17.052 -12.780 1.00 17.00  ? 300  ALA A CA  1 
ATOM   1681 C C   . ALA A 1  222 ? 16.010  -17.571 -13.092 1.00 16.90  ? 300  ALA A C   1 
ATOM   1682 O O   . ALA A 1  222 ? 16.431  -18.545 -12.473 1.00 18.75  ? 300  ALA A O   1 
ATOM   1683 C CB  . ALA A 1  222 ? 14.629  -16.449 -11.392 1.00 20.54  ? 300  ALA A CB  1 
ATOM   1684 N N   . LEU A 1  223 ? 16.717  -16.919 -14.017 1.00 15.76  ? 301  LEU A N   1 
ATOM   1685 C CA  . LEU A 1  223 ? 18.091  -17.281 -14.363 1.00 18.70  ? 301  LEU A CA  1 
ATOM   1686 C C   . LEU A 1  223 ? 19.057  -16.573 -13.445 1.00 20.71  ? 301  LEU A C   1 
ATOM   1687 O O   . LEU A 1  223 ? 18.807  -15.445 -13.017 1.00 24.98  ? 301  LEU A O   1 
ATOM   1688 C CB  . LEU A 1  223 ? 18.441  -16.910 -15.814 1.00 17.78  ? 301  LEU A CB  1 
ATOM   1689 C CG  . LEU A 1  223 ? 17.890  -17.801 -16.937 1.00 20.21  ? 301  LEU A CG  1 
ATOM   1690 C CD1 . LEU A 1  223 ? 18.113  -17.223 -18.322 1.00 20.45  ? 301  LEU A CD1 1 
ATOM   1691 C CD2 . LEU A 1  223 ? 18.495  -19.194 -16.887 1.00 24.29  ? 301  LEU A CD2 1 
ATOM   1692 N N   . GLU A 1  224 ? 20.184  -17.228 -13.186 1.00 18.89  ? 302  GLU A N   1 
ATOM   1693 C CA  . GLU A 1  224 ? 21.231  -16.696 -12.331 1.00 19.06  ? 302  GLU A CA  1 
ATOM   1694 C C   . GLU A 1  224 ? 22.510  -16.580 -13.155 1.00 19.05  ? 302  GLU A C   1 
ATOM   1695 O O   . GLU A 1  224 ? 22.766  -17.413 -14.024 1.00 18.42  ? 302  GLU A O   1 
ATOM   1696 C CB  . GLU A 1  224 ? 21.453  -17.630 -11.136 1.00 17.51  ? 302  GLU A CB  1 
ATOM   1697 C CG  . GLU A 1  224 ? 20.225  -17.798 -10.251 1.00 19.91  ? 302  GLU A CG  1 
ATOM   1698 C CD  . GLU A 1  224 ? 20.203  -19.088 -9.433  1.00 18.81  ? 302  GLU A CD  1 
ATOM   1699 O OE1 . GLU A 1  224 ? 21.265  -19.571 -8.994  1.00 18.68  ? 302  GLU A OE1 1 
ATOM   1700 O OE2 . GLU A 1  224 ? 19.092  -19.604 -9.174  1.00 19.59  ? 302  GLU A OE2 1 
ATOM   1701 N N   . ASP A 1  225 ? 23.328  -15.569 -12.862 1.00 21.82  ? 303  ASP A N   1 
ATOM   1702 C CA  . ASP A 1  225 ? 24.613  -15.359 -13.565 1.00 26.69  ? 303  ASP A CA  1 
ATOM   1703 C C   . ASP A 1  225 ? 25.455  -16.654 -13.556 1.00 22.15  ? 303  ASP A C   1 
ATOM   1704 O O   . ASP A 1  225 ? 25.577  -17.302 -12.537 1.00 25.56  ? 303  ASP A O   1 
ATOM   1705 C CB  . ASP A 1  225 ? 25.374  -14.185 -12.913 1.00 33.45  ? 303  ASP A CB  1 
ATOM   1706 C CG  . ASP A 1  225 ? 26.691  -13.861 -13.622 1.00 42.32  ? 303  ASP A CG  1 
ATOM   1707 O OD1 . ASP A 1  225 ? 26.713  -13.751 -14.865 1.00 47.52  ? 303  ASP A OD1 1 
ATOM   1708 O OD2 . ASP A 1  225 ? 27.714  -13.715 -12.930 1.00 57.39  ? 303  ASP A OD2 1 
ATOM   1709 N N   . GLY A 1  226 ? 25.964  -17.079 -14.699 1.00 25.68  ? 304  GLY A N   1 
ATOM   1710 C CA  . GLY A 1  226 ? 26.655  -18.375 -14.777 1.00 28.34  ? 304  GLY A CA  1 
ATOM   1711 C C   . GLY A 1  226 ? 25.798  -19.531 -15.299 1.00 26.90  ? 304  GLY A C   1 
ATOM   1712 O O   . GLY A 1  226 ? 26.341  -20.552 -15.677 1.00 30.92  ? 304  GLY A O   1 
ATOM   1713 N N   . GLY A 1  227 ? 24.471  -19.386 -15.333 1.00 24.18  ? 305  GLY A N   1 
ATOM   1714 C CA  . GLY A 1  227 ? 23.602  -20.359 -16.021 1.00 19.89  ? 305  GLY A CA  1 
ATOM   1715 C C   . GLY A 1  227 ? 22.783  -21.328 -15.173 1.00 20.66  ? 305  GLY A C   1 
ATOM   1716 O O   . GLY A 1  227 ? 22.070  -22.171 -15.716 1.00 21.84  ? 305  GLY A O   1 
ATOM   1717 N N   . SER A 1  228 ? 22.849  -21.203 -13.851 1.00 19.70  ? 306  SER A N   1 
ATOM   1718 C CA  . SER A 1  228 ? 21.906  -21.914 -12.986 1.00 19.77  ? 306  SER A CA  1 
ATOM   1719 C C   . SER A 1  228 ? 20.591  -21.154 -12.949 1.00 17.78  ? 306  SER A C   1 
ATOM   1720 O O   . SER A 1  228 ? 20.480  -19.996 -13.426 1.00 18.86  ? 306  SER A O   1 
ATOM   1721 C CB  . SER A 1  228 ? 22.458  -22.070 -11.561 1.00 21.05  ? 306  SER A CB  1 
ATOM   1722 O OG  . SER A 1  228 ? 23.517  -22.985 -11.569 1.00 23.07  ? 306  SER A OG  1 
ATOM   1723 N N   . ALA A 1  229 ? 19.591  -21.812 -12.372 1.00 16.67  ? 307  ALA A N   1 
ATOM   1724 C CA  . ALA A 1  229 ? 18.267  -21.237 -12.281 1.00 15.77  ? 307  ALA A CA  1 
ATOM   1725 C C   . ALA A 1  229 ? 17.471  -21.890 -11.180 1.00 15.32  ? 307  ALA A C   1 
ATOM   1726 O O   . ALA A 1  229 ? 17.761  -23.013 -10.711 1.00 16.08  ? 307  ALA A O   1 
ATOM   1727 C CB  . ALA A 1  229 ? 17.533  -21.386 -13.611 1.00 15.29  ? 307  ALA A CB  1 
ATOM   1728 N N   . HIS A 1  230 ? 16.451  -21.178 -10.765 1.00 14.14  ? 308  HIS A N   1 
ATOM   1729 C CA  . HIS A 1  230 ? 15.492  -21.729 -9.833  1.00 15.42  ? 308  HIS A CA  1 
ATOM   1730 C C   . HIS A 1  230 ? 14.107  -21.348 -10.331 1.00 14.92  ? 308  HIS A C   1 
ATOM   1731 O O   . HIS A 1  230 ? 13.974  -20.497 -11.191 1.00 15.37  ? 308  HIS A O   1 
ATOM   1732 C CB  . HIS A 1  230 ? 15.788  -21.253 -8.412  1.00 15.04  ? 308  HIS A CB  1 
ATOM   1733 C CG  . HIS A 1  230 ? 15.400  -19.843 -8.146  1.00 15.50  ? 308  HIS A CG  1 
ATOM   1734 N ND1 . HIS A 1  230 ? 16.235  -18.781 -8.392  1.00 18.03  ? 308  HIS A ND1 1 
ATOM   1735 C CD2 . HIS A 1  230 ? 14.262  -19.320 -7.631  1.00 18.17  ? 308  HIS A CD2 1 
ATOM   1736 C CE1 . HIS A 1  230 ? 15.615  -17.658 -8.068  1.00 19.30  ? 308  HIS A CE1 1 
ATOM   1737 N NE2 . HIS A 1  230 ? 14.420  -17.960 -7.594  1.00 19.79  ? 308  HIS A NE2 1 
ATOM   1738 N N   . GLY A 1  231 ? 13.096  -22.012 -9.792  1.00 16.88  ? 309  GLY A N   1 
ATOM   1739 C CA  . GLY A 1  231 ? 11.713  -21.702 -10.083 1.00 16.09  ? 309  GLY A CA  1 
ATOM   1740 C C   . GLY A 1  231 ? 10.904  -21.533 -8.820  1.00 16.99  ? 309  GLY A C   1 
ATOM   1741 O O   . GLY A 1  231 ? 11.264  -22.056 -7.760  1.00 14.51  ? 309  GLY A O   1 
ATOM   1742 N N   . VAL A 1  232 ? 9.804   -20.799 -8.953  1.00 14.53  ? 310  VAL A N   1 
ATOM   1743 C CA  . VAL A 1  232 ? 8.892   -20.543 -7.869  1.00 14.73  ? 310  VAL A CA  1 
ATOM   1744 C C   . VAL A 1  232 ? 7.478   -20.744 -8.387  1.00 14.22  ? 310  VAL A C   1 
ATOM   1745 O O   . VAL A 1  232 ? 7.129   -20.208 -9.426  1.00 15.70  ? 310  VAL A O   1 
ATOM   1746 C CB  . VAL A 1  232 ? 9.055   -19.104 -7.314  1.00 15.53  ? 310  VAL A CB  1 
ATOM   1747 C CG1 . VAL A 1  232 ? 8.058   -18.838 -6.174  1.00 15.04  ? 310  VAL A CG1 1 
ATOM   1748 C CG2 . VAL A 1  232 ? 10.485  -18.879 -6.838  1.00 19.33  ? 310  VAL A CG2 1 
ATOM   1749 N N   . PHE A 1  233 ? 6.689   -21.537 -7.667  1.00 15.03  ? 311  PHE A N   1 
ATOM   1750 C CA  . PHE A 1  233 ? 5.271   -21.757 -7.984  1.00 13.99  ? 311  PHE A CA  1 
ATOM   1751 C C   . PHE A 1  233 ? 4.482   -21.281 -6.794  1.00 12.61  ? 311  PHE A C   1 
ATOM   1752 O O   . PHE A 1  233 ? 4.763   -21.716 -5.692  1.00 13.41  ? 311  PHE A O   1 
ATOM   1753 C CB  . PHE A 1  233 ? 5.032   -23.251 -8.223  1.00 13.83  ? 311  PHE A CB  1 
ATOM   1754 C CG  . PHE A 1  233 ? 3.580   -23.652 -8.451  1.00 13.38  ? 311  PHE A CG  1 
ATOM   1755 C CD1 . PHE A 1  233 ? 2.736   -22.929 -9.293  1.00 17.35  ? 311  PHE A CD1 1 
ATOM   1756 C CD2 . PHE A 1  233 ? 3.084   -24.833 -7.885  1.00 13.65  ? 311  PHE A CD2 1 
ATOM   1757 C CE1 . PHE A 1  233 ? 1.409   -23.340 -9.517  1.00 13.92  ? 311  PHE A CE1 1 
ATOM   1758 C CE2 . PHE A 1  233 ? 1.779   -25.250 -8.123  1.00 14.61  ? 311  PHE A CE2 1 
ATOM   1759 C CZ  . PHE A 1  233 ? 0.944   -24.496 -8.945  1.00 14.16  ? 311  PHE A CZ  1 
ATOM   1760 N N   . LEU A 1  234 ? 3.565   -20.331 -7.003  1.00 12.75  ? 312  LEU A N   1 
ATOM   1761 C CA  . LEU A 1  234 ? 2.581   -19.946 -5.974  1.00 13.04  ? 312  LEU A CA  1 
ATOM   1762 C C   . LEU A 1  234 ? 1.298   -20.690 -6.295  1.00 13.84  ? 312  LEU A C   1 
ATOM   1763 O O   . LEU A 1  234 ? 0.636   -20.379 -7.295  1.00 14.77  ? 312  LEU A O   1 
ATOM   1764 C CB  . LEU A 1  234 ? 2.349   -18.423 -5.961  1.00 13.26  ? 312  LEU A CB  1 
ATOM   1765 C CG  . LEU A 1  234 ? 1.249   -17.904 -5.022  1.00 17.18  ? 312  LEU A CG  1 
ATOM   1766 C CD1 . LEU A 1  234 ? 1.619   -18.203 -3.574  1.00 17.21  ? 312  LEU A CD1 1 
ATOM   1767 C CD2 . LEU A 1  234 ? 0.961   -16.403 -5.226  1.00 16.62  ? 312  LEU A CD2 1 
ATOM   1768 N N   . LEU A 1  235 ? 0.955   -21.682 -5.477  1.00 15.14  ? 313  LEU A N   1 
ATOM   1769 C CA  . LEU A 1  235 ? -0.269  -22.462 -5.669  1.00 14.74  ? 313  LEU A CA  1 
ATOM   1770 C C   . LEU A 1  235 ? -1.501  -21.693 -5.171  1.00 15.00  ? 313  LEU A C   1 
ATOM   1771 O O   . LEU A 1  235 ? -1.957  -21.859 -4.038  1.00 15.23  ? 313  LEU A O   1 
ATOM   1772 C CB  . LEU A 1  235 ? -0.150  -23.825 -4.983  1.00 15.64  ? 313  LEU A CB  1 
ATOM   1773 C CG  . LEU A 1  235 ? -1.308  -24.801 -5.148  1.00 15.23  ? 313  LEU A CG  1 
ATOM   1774 C CD1 . LEU A 1  235 ? -1.631  -25.107 -6.607  1.00 16.40  ? 313  LEU A CD1 1 
ATOM   1775 C CD2 . LEU A 1  235 ? -0.959  -26.069 -4.394  1.00 17.97  ? 313  LEU A CD2 1 
ATOM   1776 N N   . ASN A 1  236 ? -2.010  -20.826 -6.040  1.00 13.68  ? 314  ASN A N   1 
ATOM   1777 C CA  . ASN A 1  236 ? -3.099  -19.899 -5.711  1.00 15.80  ? 314  ASN A CA  1 
ATOM   1778 C C   . ASN A 1  236 ? -3.860  -19.611 -7.022  1.00 13.64  ? 314  ASN A C   1 
ATOM   1779 O O   . ASN A 1  236 ? -3.249  -19.241 -8.014  1.00 13.22  ? 314  ASN A O   1 
ATOM   1780 C CB  . ASN A 1  236 ? -2.495  -18.626 -5.119  1.00 14.83  ? 314  ASN A CB  1 
ATOM   1781 C CG  . ASN A 1  236 ? -3.532  -17.603 -4.682  1.00 15.47  ? 314  ASN A CG  1 
ATOM   1782 O OD1 . ASN A 1  236 ? -4.262  -17.009 -5.504  1.00 16.85  ? 314  ASN A OD1 1 
ATOM   1783 N ND2 . ASN A 1  236 ? -3.585  -17.366 -3.388  1.00 16.32  ? 314  ASN A ND2 1 
ATOM   1784 N N   . SER A 1  237 ? -5.172  -19.802 -7.024  1.00 13.65  ? 315  SER A N   1 
ATOM   1785 C CA  . SER A 1  237 ? -5.989  -19.694 -8.251  1.00 12.98  ? 315  SER A CA  1 
ATOM   1786 C C   . SER A 1  237 ? -6.837  -18.439 -8.283  1.00 13.32  ? 315  SER A C   1 
ATOM   1787 O O   . SER A 1  237 ? -7.652  -18.268 -9.180  1.00 16.21  ? 315  SER A O   1 
ATOM   1788 C CB  . SER A 1  237 ? -6.880  -20.932 -8.411  1.00 12.38  ? 315  SER A CB  1 
ATOM   1789 O OG  . SER A 1  237 ? -7.791  -21.112 -7.338  1.00 13.97  ? 315  SER A OG  1 
ATOM   1790 N N   . ASN A 1  238 ? -6.639  -17.534 -7.328  1.00 15.52  ? 316  ASN A N   1 
ATOM   1791 C CA  . ASN A 1  238 ? -7.394  -16.287 -7.317  1.00 13.88  ? 316  ASN A CA  1 
ATOM   1792 C C   . ASN A 1  238 ? -6.893  -15.310 -8.353  1.00 14.03  ? 316  ASN A C   1 
ATOM   1793 O O   . ASN A 1  238 ? -5.773  -15.429 -8.841  1.00 15.81  ? 316  ASN A O   1 
ATOM   1794 C CB  . ASN A 1  238 ? -7.345  -15.628 -5.940  1.00 15.87  ? 316  ASN A CB  1 
ATOM   1795 C CG  . ASN A 1  238 ? -8.057  -16.446 -4.874  1.00 18.35  ? 316  ASN A CG  1 
ATOM   1796 O OD1 . ASN A 1  238 ? -7.463  -17.322 -4.226  1.00 18.74  ? 316  ASN A OD1 1 
ATOM   1797 N ND2 . ASN A 1  238 ? -9.329  -16.143 -4.670  1.00 16.58  ? 316  ASN A ND2 1 
ATOM   1798 N N   . ALA A 1  239 ? -7.728  -14.331 -8.681  1.00 14.41  ? 317  ALA A N   1 
ATOM   1799 C CA  . ALA A 1  239 ? -7.284  -13.198 -9.486  1.00 15.92  ? 317  ALA A CA  1 
ATOM   1800 C C   . ALA A 1  239 ? -6.042  -12.587 -8.827  1.00 15.66  ? 317  ALA A C   1 
ATOM   1801 O O   . ALA A 1  239 ? -6.043  -12.345 -7.599  1.00 14.35  ? 317  ALA A O   1 
ATOM   1802 C CB  . ALA A 1  239 ? -8.383  -12.156 -9.618  1.00 15.62  ? 317  ALA A CB  1 
ATOM   1803 N N   . MET A 1  240 ? -4.980  -12.373 -9.619  1.00 14.66  ? 318  MET A N   1 
ATOM   1804 C CA  . MET A 1  240 ? -3.753  -11.789 -9.085  1.00 16.54  ? 318  MET A CA  1 
ATOM   1805 C C   . MET A 1  240 ? -2.998  -10.898 -10.065 1.00 17.73  ? 318  MET A C   1 
ATOM   1806 O O   . MET A 1  240 ? -3.103  -11.060 -11.288 1.00 16.85  ? 318  MET A O   1 
ATOM   1807 C CB  . MET A 1  240 ? -2.831  -12.896 -8.539  1.00 19.78  ? 318  MET A CB  1 
ATOM   1808 C CG  . MET A 1  240 ? -2.081  -13.750 -9.532  1.00 23.98  ? 318  MET A CG  1 
ATOM   1809 S SD  . MET A 1  240 ? -0.780  -14.766 -8.744  1.00 22.27  ? 318  MET A SD  1 
ATOM   1810 C CE  . MET A 1  240 ? -1.750  -16.095 -8.077  1.00 21.12  ? 318  MET A CE  1 
ATOM   1811 N N   . ASP A 1  241 ? -2.285  -9.931  -9.500  1.00 14.55  ? 319  ASP A N   1 
ATOM   1812 C CA  . ASP A 1  241 ? -1.254  -9.179  -10.191 1.00 14.52  ? 319  ASP A CA  1 
ATOM   1813 C C   . ASP A 1  241 ? 0.094   -9.693  -9.709  1.00 16.23  ? 319  ASP A C   1 
ATOM   1814 O O   . ASP A 1  241 ? 0.277   -9.953  -8.499  1.00 14.90  ? 319  ASP A O   1 
ATOM   1815 C CB  . ASP A 1  241 ? -1.313  -7.684  -9.846  1.00 15.24  ? 319  ASP A CB  1 
ATOM   1816 C CG  . ASP A 1  241 ? -2.406  -6.912  -10.599 1.00 18.56  ? 319  ASP A CG  1 
ATOM   1817 O OD1 . ASP A 1  241 ? -2.828  -7.312  -11.711 1.00 15.96  ? 319  ASP A OD1 1 
ATOM   1818 O OD2 . ASP A 1  241 ? -2.814  -5.849  -10.090 1.00 18.00  ? 319  ASP A OD2 1 
ATOM   1819 N N   . VAL A 1  242 ? 1.040   -9.814  -10.636 1.00 14.51  ? 320  VAL A N   1 
ATOM   1820 C CA  . VAL A 1  242 ? 2.440   -10.031 -10.305 1.00 16.50  ? 320  VAL A CA  1 
ATOM   1821 C C   . VAL A 1  242 ? 3.235   -8.823  -10.830 1.00 18.48  ? 320  VAL A C   1 
ATOM   1822 O O   . VAL A 1  242 ? 3.170   -8.481  -12.023 1.00 21.48  ? 320  VAL A O   1 
ATOM   1823 C CB  . VAL A 1  242 ? 2.930   -11.379 -10.847 1.00 17.64  ? 320  VAL A CB  1 
ATOM   1824 C CG1 . VAL A 1  242 ? 4.359   -11.651 -10.410 1.00 21.62  ? 320  VAL A CG1 1 
ATOM   1825 C CG2 . VAL A 1  242 ? 2.008   -12.488 -10.357 1.00 18.14  ? 320  VAL A CG2 1 
ATOM   1826 N N   . VAL A 1  243 ? 3.921   -8.132  -9.920  1.00 15.39  ? 321  VAL A N   1 
ATOM   1827 C CA  . VAL A 1  243 ? 4.541   -6.855  -10.219 1.00 17.25  ? 321  VAL A CA  1 
ATOM   1828 C C   . VAL A 1  243 ? 6.051   -7.031  -10.222 1.00 17.70  ? 321  VAL A C   1 
ATOM   1829 O O   . VAL A 1  243 ? 6.642   -7.404  -9.207  1.00 19.90  ? 321  VAL A O   1 
ATOM   1830 C CB  . VAL A 1  243 ? 4.105   -5.761  -9.226  1.00 19.17  ? 321  VAL A CB  1 
ATOM   1831 C CG1 . VAL A 1  243 ? 4.861   -4.450  -9.463  1.00 19.86  ? 321  VAL A CG1 1 
ATOM   1832 C CG2 . VAL A 1  243 ? 2.600   -5.531  -9.343  1.00 21.63  ? 321  VAL A CG2 1 
ATOM   1833 N N   . LEU A 1  244 ? 6.665   -6.759  -11.363 1.00 19.03  ? 322  LEU A N   1 
ATOM   1834 C CA  . LEU A 1  244 ? 8.110   -6.876  -11.528 1.00 20.94  ? 322  LEU A CA  1 
ATOM   1835 C C   . LEU A 1  244 ? 8.687   -5.466  -11.542 1.00 21.28  ? 322  LEU A C   1 
ATOM   1836 O O   . LEU A 1  244 ? 8.139   -4.580  -12.198 1.00 20.92  ? 322  LEU A O   1 
ATOM   1837 C CB  . LEU A 1  244 ? 8.440   -7.611  -12.830 1.00 21.25  ? 322  LEU A CB  1 
ATOM   1838 C CG  . LEU A 1  244 ? 7.822   -8.990  -13.027 1.00 20.62  ? 322  LEU A CG  1 
ATOM   1839 C CD1 . LEU A 1  244 ? 8.302   -9.594  -14.356 1.00 23.51  ? 322  LEU A CD1 1 
ATOM   1840 C CD2 . LEU A 1  244 ? 8.148   -9.905  -11.878 1.00 22.35  ? 322  LEU A CD2 1 
ATOM   1841 N N   . GLN A 1  245 ? 9.746   -5.247  -10.769 1.00 19.61  ? 323  GLN A N   1 
ATOM   1842 C CA  . GLN A 1  245 ? 10.422  -3.963  -10.749 1.00 20.49  ? 323  GLN A CA  1 
ATOM   1843 C C   . GLN A 1  245 ? 11.932  -4.168  -10.940 1.00 19.50  ? 323  GLN A C   1 
ATOM   1844 O O   . GLN A 1  245 ? 12.432  -5.301  -10.811 1.00 16.48  ? 323  GLN A O   1 
ATOM   1845 C CB  . GLN A 1  245 ? 10.069  -3.196  -9.484  1.00 23.87  ? 323  GLN A CB  1 
ATOM   1846 C CG  . GLN A 1  245 ? 10.503  -3.812  -8.172  1.00 21.88  ? 323  GLN A CG  1 
ATOM   1847 C CD  . GLN A 1  245 ? 9.806   -3.112  -7.025  1.00 22.01  ? 323  GLN A CD  1 
ATOM   1848 O OE1 . GLN A 1  245 ? 8.611   -3.323  -6.800  1.00 21.06  ? 323  GLN A OE1 1 
ATOM   1849 N NE2 . GLN A 1  245 ? 10.531  -2.233  -6.324  1.00 20.21  ? 323  GLN A NE2 1 
ATOM   1850 N N   . PRO A 1  246 ? 12.654  -3.101  -11.322 1.00 19.25  ? 324  PRO A N   1 
ATOM   1851 C CA  . PRO A 1  246 ? 13.986  -3.362  -11.875 1.00 20.55  ? 324  PRO A CA  1 
ATOM   1852 C C   . PRO A 1  246 ? 15.126  -3.449  -10.850 1.00 20.13  ? 324  PRO A C   1 
ATOM   1853 O O   . PRO A 1  246 ? 16.272  -3.533  -11.256 1.00 20.72  ? 324  PRO A O   1 
ATOM   1854 C CB  . PRO A 1  246 ? 14.189  -2.206  -12.868 1.00 21.32  ? 324  PRO A CB  1 
ATOM   1855 C CG  . PRO A 1  246 ? 13.349  -1.110  -12.367 1.00 21.32  ? 324  PRO A CG  1 
ATOM   1856 C CD  . PRO A 1  246 ? 12.245  -1.703  -11.519 1.00 21.10  ? 324  PRO A CD  1 
ATOM   1857 N N   . SER A 1  247 ? 14.835  -3.481  -9.551  1.00 20.80  ? 325  SER A N   1 
ATOM   1858 C CA  . SER A 1  247 ? 15.906  -3.660  -8.546  1.00 22.96  ? 325  SER A CA  1 
ATOM   1859 C C   . SER A 1  247 ? 16.880  -4.839  -8.698  1.00 17.90  ? 325  SER A C   1 
ATOM   1860 O O   . SER A 1  247 ? 18.027  -4.621  -8.403  1.00 20.52  ? 325  SER A O   1 
ATOM   1861 C CB  . SER A 1  247 ? 15.371  -3.662  -7.110  1.00 27.30  ? 325  SER A CB  1 
ATOM   1862 O OG  . SER A 1  247 ? 14.264  -4.488  -7.009  1.00 22.87  ? 325  SER A OG  1 
ATOM   1863 N N   . PRO A 1  248 ? 16.519  -6.060  -9.117  1.00 16.77  ? 326  PRO A N   1 
ATOM   1864 C CA  . PRO A 1  248 ? 15.199  -6.519  -9.541  1.00 18.28  ? 326  PRO A CA  1 
ATOM   1865 C C   . PRO A 1  248 ? 14.456  -7.208  -8.427  1.00 18.95  ? 326  PRO A C   1 
ATOM   1866 O O   . PRO A 1  248 ? 15.079  -7.727  -7.509  1.00 18.23  ? 326  PRO A O   1 
ATOM   1867 C CB  . PRO A 1  248 ? 15.535  -7.523  -10.647 1.00 16.76  ? 326  PRO A CB  1 
ATOM   1868 C CG  . PRO A 1  248 ? 16.840  -8.116  -10.210 1.00 16.31  ? 326  PRO A CG  1 
ATOM   1869 C CD  . PRO A 1  248 ? 17.569  -7.056  -9.436  1.00 17.45  ? 326  PRO A CD  1 
ATOM   1870 N N   . ALA A 1  249 ? 13.128  -7.223  -8.530  1.00 16.66  ? 327  ALA A N   1 
ATOM   1871 C CA  . ALA A 1  249 ? 12.273  -7.780  -7.493  1.00 18.94  ? 327  ALA A CA  1 
ATOM   1872 C C   . ALA A 1  249 ? 10.892  -8.074  -8.060  1.00 17.58  ? 327  ALA A C   1 
ATOM   1873 O O   . ALA A 1  249 ? 10.537  -7.604  -9.141  1.00 17.06  ? 327  ALA A O   1 
ATOM   1874 C CB  . ALA A 1  249 ? 12.186  -6.818  -6.300  1.00 19.02  ? 327  ALA A CB  1 
ATOM   1875 N N   . LEU A 1  250 ? 10.140  -8.873  -7.317  1.00 16.15  ? 328  LEU A N   1 
ATOM   1876 C CA  . LEU A 1  250 ? 8.833   -9.341  -7.716  1.00 16.31  ? 328  LEU A CA  1 
ATOM   1877 C C   . LEU A 1  250 ? 7.877   -9.280  -6.515  1.00 17.77  ? 328  LEU A C   1 
ATOM   1878 O O   . LEU A 1  250 ? 8.291   -9.560  -5.388  1.00 16.63  ? 328  LEU A O   1 
ATOM   1879 C CB  . LEU A 1  250 ? 8.975   -10.771 -8.228  1.00 18.45  ? 328  LEU A CB  1 
ATOM   1880 C CG  . LEU A 1  250 ? 7.708   -11.539 -8.627  1.00 18.58  ? 328  LEU A CG  1 
ATOM   1881 C CD1 . LEU A 1  250 ? 8.056   -12.541 -9.714  1.00 19.83  ? 328  LEU A CD1 1 
ATOM   1882 C CD2 . LEU A 1  250 ? 7.047   -12.251 -7.446  1.00 17.83  ? 328  LEU A CD2 1 
ATOM   1883 N N   . SER A 1  251 ? 6.606   -8.944  -6.772  1.00 17.11  ? 329  SER A N   1 
ATOM   1884 C CA  . SER A 1  251 ? 5.545   -8.955  -5.753  1.00 14.69  ? 329  SER A CA  1 
ATOM   1885 C C   . SER A 1  251 ? 4.367   -9.776  -6.285  1.00 18.39  ? 329  SER A C   1 
ATOM   1886 O O   . SER A 1  251 ? 3.825   -9.467  -7.355  1.00 18.23  ? 329  SER A O   1 
ATOM   1887 C CB  . SER A 1  251 ? 5.069   -7.532  -5.434  1.00 16.36  ? 329  SER A CB  1 
ATOM   1888 O OG  . SER A 1  251 ? 6.074   -6.691  -4.863  1.00 15.09  ? 329  SER A OG  1 
ATOM   1889 N N   . TRP A 1  252 ? 4.004   -10.844 -5.574  1.00 16.08  ? 330  TRP A N   1 
ATOM   1890 C CA  . TRP A 1  252 ? 2.729   -11.523 -5.794  1.00 16.80  ? 330  TRP A CA  1 
ATOM   1891 C C   . TRP A 1  252 ? 1.618   -10.772 -5.036  1.00 15.76  ? 330  TRP A C   1 
ATOM   1892 O O   . TRP A 1  252 ? 1.760   -10.512 -3.839  1.00 14.49  ? 330  TRP A O   1 
ATOM   1893 C CB  . TRP A 1  252 ? 2.771   -12.950 -5.261  1.00 17.10  ? 330  TRP A CB  1 
ATOM   1894 C CG  . TRP A 1  252 ? 3.866   -13.864 -5.738  1.00 15.68  ? 330  TRP A CG  1 
ATOM   1895 C CD1 . TRP A 1  252 ? 5.051   -14.142 -5.091  1.00 15.76  ? 330  TRP A CD1 1 
ATOM   1896 C CD2 . TRP A 1  252 ? 3.815   -14.730 -6.875  1.00 16.20  ? 330  TRP A CD2 1 
ATOM   1897 N NE1 . TRP A 1  252 ? 5.759   -15.116 -5.798  1.00 18.86  ? 330  TRP A NE1 1 
ATOM   1898 C CE2 . TRP A 1  252 ? 5.023   -15.481 -6.898  1.00 16.49  ? 330  TRP A CE2 1 
ATOM   1899 C CE3 . TRP A 1  252 ? 2.880   -14.922 -7.904  1.00 20.08  ? 330  TRP A CE3 1 
ATOM   1900 C CZ2 . TRP A 1  252 ? 5.311   -16.411 -7.902  1.00 19.50  ? 330  TRP A CZ2 1 
ATOM   1901 C CZ3 . TRP A 1  252 ? 3.166   -15.851 -8.917  1.00 19.52  ? 330  TRP A CZ3 1 
ATOM   1902 C CH2 . TRP A 1  252 ? 4.376   -16.593 -8.900  1.00 20.80  ? 330  TRP A CH2 1 
ATOM   1903 N N   . ARG A 1  253 ? 0.528   -10.434 -5.721  1.00 13.30  ? 331  ARG A N   1 
ATOM   1904 C CA  . ARG A 1  253 ? -0.628  -9.776  -5.110  1.00 15.30  ? 331  ARG A CA  1 
ATOM   1905 C C   . ARG A 1  253 ? -1.858  -10.572 -5.452  1.00 19.51  ? 331  ARG A C   1 
ATOM   1906 O O   . ARG A 1  253 ? -2.359  -10.471 -6.561  1.00 20.34  ? 331  ARG A O   1 
ATOM   1907 C CB  . ARG A 1  253 ? -0.805  -8.364  -5.670  1.00 17.56  ? 331  ARG A CB  1 
ATOM   1908 C CG  . ARG A 1  253 ? 0.154   -7.343  -5.124  1.00 20.06  ? 331  ARG A CG  1 
ATOM   1909 C CD  . ARG A 1  253 ? -0.150  -5.975  -5.709  1.00 20.28  ? 331  ARG A CD  1 
ATOM   1910 N NE  . ARG A 1  253 ? 0.995   -5.102  -5.558  1.00 18.31  ? 331  ARG A NE  1 
ATOM   1911 C CZ  . ARG A 1  253 ? 1.163   -3.951  -6.206  1.00 21.63  ? 331  ARG A CZ  1 
ATOM   1912 N NH1 . ARG A 1  253 ? 0.259   -3.505  -7.083  1.00 19.15  ? 331  ARG A NH1 1 
ATOM   1913 N NH2 . ARG A 1  253 ? 2.262   -3.257  -6.001  1.00 21.32  ? 331  ARG A NH2 1 
ATOM   1914 N N   . SER A 1  254 ? -2.330  -11.397 -4.533  1.00 18.07  ? 332  SER A N   1 
ATOM   1915 C CA  . SER A 1  254 ? -3.503  -12.213 -4.829  1.00 16.19  ? 332  SER A CA  1 
ATOM   1916 C C   . SER A 1  254 ? -4.715  -11.712 -4.072  1.00 16.54  ? 332  SER A C   1 
ATOM   1917 O O   . SER A 1  254 ? -4.591  -11.126 -3.012  1.00 15.95  ? 332  SER A O   1 
ATOM   1918 C CB  . SER A 1  254 ? -3.237  -13.670 -4.494  1.00 17.51  ? 332  SER A CB  1 
ATOM   1919 O OG  . SER A 1  254 ? -4.381  -14.450 -4.777  1.00 17.35  ? 332  SER A OG  1 
ATOM   1920 N N   . THR A 1  255 ? -5.889  -11.969 -4.631  1.00 17.15  ? 333  THR A N   1 
ATOM   1921 C CA  . THR A 1  255 ? -7.150  -11.513 -4.054  1.00 16.20  ? 333  THR A CA  1 
ATOM   1922 C C   . THR A 1  255 ? -7.843  -12.511 -3.116  1.00 16.00  ? 333  THR A C   1 
ATOM   1923 O O   . THR A 1  255 ? -8.956  -12.269 -2.622  1.00 16.41  ? 333  THR A O   1 
ATOM   1924 C CB  . THR A 1  255 ? -8.100  -11.079 -5.169  1.00 16.25  ? 333  THR A CB  1 
ATOM   1925 O OG1 . THR A 1  255 ? -8.254  -12.123 -6.120  1.00 16.63  ? 333  THR A OG1 1 
ATOM   1926 C CG2 . THR A 1  255 ? -7.564  -9.843  -5.864  1.00 16.93  ? 333  THR A CG2 1 
ATOM   1927 N N   . GLY A 1  256 ? -7.214  -13.648 -2.862  1.00 14.79  ? 334  GLY A N   1 
ATOM   1928 C CA  . GLY A 1  256 ? -7.787  -14.608 -1.909  1.00 14.67  ? 334  GLY A CA  1 
ATOM   1929 C C   . GLY A 1  256 ? -6.849  -15.760 -1.632  1.00 17.63  ? 334  GLY A C   1 
ATOM   1930 O O   . GLY A 1  256 ? -5.656  -15.706 -1.974  1.00 14.16  ? 334  GLY A O   1 
ATOM   1931 N N   . GLY A 1  257 ? -7.389  -16.799 -1.002  1.00 14.98  ? 335  GLY A N   1 
ATOM   1932 C CA  . GLY A 1  257 ? -6.658  -18.016 -0.787  1.00 16.04  ? 335  GLY A CA  1 
ATOM   1933 C C   . GLY A 1  257 ? -5.593  -17.874 0.290   1.00 16.55  ? 335  GLY A C   1 
ATOM   1934 O O   . GLY A 1  257 ? -5.768  -17.112 1.243   1.00 13.67  ? 335  GLY A O   1 
ATOM   1935 N N   . ILE A 1  258 ? -4.507  -18.633 0.125   1.00 13.98  ? 336  ILE A N   1 
ATOM   1936 C CA  . ILE A 1  258 ? -3.377  -18.631 1.039   1.00 15.52  ? 336  ILE A CA  1 
ATOM   1937 C C   . ILE A 1  258 ? -2.092  -18.461 0.236   1.00 14.20  ? 336  ILE A C   1 
ATOM   1938 O O   . ILE A 1  258 ? -2.104  -18.493 -0.999  1.00 14.98  ? 336  ILE A O   1 
ATOM   1939 C CB  . ILE A 1  258 ? -3.314  -19.927 1.898   1.00 16.35  ? 336  ILE A CB  1 
ATOM   1940 C CG1 . ILE A 1  258 ? -3.037  -21.194 1.051   1.00 18.38  ? 336  ILE A CG1 1 
ATOM   1941 C CG2 . ILE A 1  258 ? -4.584  -20.117 2.724   1.00 17.80  ? 336  ILE A CG2 1 
ATOM   1942 C CD1 . ILE A 1  258 ? -2.407  -22.319 1.843   1.00 15.67  ? 336  ILE A CD1 1 
ATOM   1943 N N   . LEU A 1  259 ? -0.985  -18.298 0.942   1.00 14.67  ? 337  LEU A N   1 
ATOM   1944 C CA  . LEU A 1  259 ? 0.313   -18.346 0.311   1.00 15.09  ? 337  LEU A CA  1 
ATOM   1945 C C   . LEU A 1  259 ? 0.842   -19.769 0.473   1.00 17.25  ? 337  LEU A C   1 
ATOM   1946 O O   . LEU A 1  259 ? 1.098   -20.234 1.586   1.00 17.14  ? 337  LEU A O   1 
ATOM   1947 C CB  . LEU A 1  259 ? 1.253   -17.337 0.924   1.00 17.50  ? 337  LEU A CB  1 
ATOM   1948 C CG  . LEU A 1  259 ? 0.866   -15.861 0.804   1.00 15.47  ? 337  LEU A CG  1 
ATOM   1949 C CD1 . LEU A 1  259 ? 1.768   -15.022 1.711   1.00 17.14  ? 337  LEU A CD1 1 
ATOM   1950 C CD2 . LEU A 1  259 ? 0.952   -15.398 -0.643  1.00 17.55  ? 337  LEU A CD2 1 
ATOM   1951 N N   . ASP A 1  260 ? 0.939   -20.456 -0.656  1.00 15.80  ? 338  ASP A N   1 
ATOM   1952 C CA  . ASP A 1  260 ? 1.435   -21.820 -0.744  1.00 16.95  ? 338  ASP A CA  1 
ATOM   1953 C C   . ASP A 1  260 ? 2.531   -21.799 -1.838  1.00 15.59  ? 338  ASP A C   1 
ATOM   1954 O O   . ASP A 1  260 ? 2.243   -21.676 -3.059  1.00 14.16  ? 338  ASP A O   1 
ATOM   1955 C CB  . ASP A 1  260 ? 0.272   -22.731 -1.117  1.00 14.79  ? 338  ASP A CB  1 
ATOM   1956 C CG  . ASP A 1  260 ? 0.626   -24.215 -1.033  1.00 17.79  ? 338  ASP A CG  1 
ATOM   1957 O OD1 . ASP A 1  260 ? 1.827   -24.559 -1.035  1.00 18.51  ? 338  ASP A OD1 1 
ATOM   1958 O OD2 . ASP A 1  260 ? -0.298  -25.043 -0.969  1.00 18.31  ? 338  ASP A OD2 1 
ATOM   1959 N N   . VAL A 1  261 ? 3.782   -21.853 -1.385  1.00 14.33  ? 339  VAL A N   1 
ATOM   1960 C CA  . VAL A 1  261 ? 4.936   -21.542 -2.225  1.00 15.85  ? 339  VAL A CA  1 
ATOM   1961 C C   . VAL A 1  261 ? 5.889   -22.706 -2.350  1.00 17.21  ? 339  VAL A C   1 
ATOM   1962 O O   . VAL A 1  261 ? 6.294   -23.284 -1.344  1.00 18.52  ? 339  VAL A O   1 
ATOM   1963 C CB  . VAL A 1  261 ? 5.688   -20.290 -1.705  1.00 15.95  ? 339  VAL A CB  1 
ATOM   1964 C CG1 . VAL A 1  261 ? 6.831   -19.909 -2.643  1.00 17.66  ? 339  VAL A CG1 1 
ATOM   1965 C CG2 . VAL A 1  261 ? 4.710   -19.113 -1.568  1.00 17.44  ? 339  VAL A CG2 1 
ATOM   1966 N N   . TYR A 1  262 ? 6.266   -23.028 -3.593  1.00 15.52  ? 340  TYR A N   1 
ATOM   1967 C CA  . TYR A 1  262 ? 7.262   -24.059 -3.864  1.00 17.40  ? 340  TYR A CA  1 
ATOM   1968 C C   . TYR A 1  262 ? 8.437   -23.391 -4.516  1.00 19.30  ? 340  TYR A C   1 
ATOM   1969 O O   . TYR A 1  262 ? 8.254   -22.511 -5.389  1.00 15.39  ? 340  TYR A O   1 
ATOM   1970 C CB  . TYR A 1  262 ? 6.742   -25.127 -4.821  1.00 17.48  ? 340  TYR A CB  1 
ATOM   1971 C CG  . TYR A 1  262 ? 5.652   -26.011 -4.270  1.00 17.61  ? 340  TYR A CG  1 
ATOM   1972 C CD1 . TYR A 1  262 ? 4.322   -25.629 -4.358  1.00 20.56  ? 340  TYR A CD1 1 
ATOM   1973 C CD2 . TYR A 1  262 ? 5.942   -27.242 -3.699  1.00 17.28  ? 340  TYR A CD2 1 
ATOM   1974 C CE1 . TYR A 1  262 ? 3.312   -26.448 -3.887  1.00 22.42  ? 340  TYR A CE1 1 
ATOM   1975 C CE2 . TYR A 1  262 ? 4.938   -28.069 -3.228  1.00 21.20  ? 340  TYR A CE2 1 
ATOM   1976 C CZ  . TYR A 1  262 ? 3.618   -27.660 -3.334  1.00 22.54  ? 340  TYR A CZ  1 
ATOM   1977 O OH  . TYR A 1  262 ? 2.597   -28.440 -2.865  1.00 26.41  ? 340  TYR A OH  1 
ATOM   1978 N N   . ILE A 1  263 ? 9.638   -23.793 -4.081  1.00 18.99  ? 341  ILE A N   1 
ATOM   1979 C CA  . ILE A 1  263 ? 10.874  -23.330 -4.688  1.00 18.69  ? 341  ILE A CA  1 
ATOM   1980 C C   . ILE A 1  263 ? 11.638  -24.535 -5.243  1.00 17.19  ? 341  ILE A C   1 
ATOM   1981 O O   . ILE A 1  263 ? 11.865  -25.502 -4.535  1.00 19.89  ? 341  ILE A O   1 
ATOM   1982 C CB  . ILE A 1  263 ? 11.750  -22.507 -3.717  1.00 20.38  ? 341  ILE A CB  1 
ATOM   1983 C CG1 . ILE A 1  263 ? 10.970  -21.306 -3.133  1.00 23.17  ? 341  ILE A CG1 1 
ATOM   1984 C CG2 . ILE A 1  263 ? 12.974  -21.964 -4.457  1.00 20.18  ? 341  ILE A CG2 1 
ATOM   1985 C CD1 . ILE A 1  263 ? 10.256  -21.600 -1.827  1.00 31.43  ? 341  ILE A CD1 1 
ATOM   1986 N N   . PHE A 1  264 ? 12.028  -24.459 -6.520  1.00 16.69  ? 342  PHE A N   1 
ATOM   1987 C CA  . PHE A 1  264 ? 12.680  -25.556 -7.231  1.00 15.22  ? 342  PHE A CA  1 
ATOM   1988 C C   . PHE A 1  264 ? 14.094  -25.103 -7.568  1.00 17.75  ? 342  PHE A C   1 
ATOM   1989 O O   . PHE A 1  264 ? 14.272  -24.079 -8.219  1.00 16.43  ? 342  PHE A O   1 
ATOM   1990 C CB  . PHE A 1  264 ? 11.918  -25.913 -8.501  1.00 17.70  ? 342  PHE A CB  1 
ATOM   1991 C CG  . PHE A 1  264 ? 10.458  -26.146 -8.280  1.00 15.39  ? 342  PHE A CG  1 
ATOM   1992 C CD1 . PHE A 1  264 ? 10.021  -27.313 -7.679  1.00 17.83  ? 342  PHE A CD1 1 
ATOM   1993 C CD2 . PHE A 1  264 ? 9.521   -25.183 -8.624  1.00 16.95  ? 342  PHE A CD2 1 
ATOM   1994 C CE1 . PHE A 1  264 ? 8.662   -27.527 -7.443  1.00 16.82  ? 342  PHE A CE1 1 
ATOM   1995 C CE2 . PHE A 1  264 ? 8.172   -25.393 -8.406  1.00 15.93  ? 342  PHE A CE2 1 
ATOM   1996 C CZ  . PHE A 1  264 ? 7.743   -26.565 -7.808  1.00 14.98  ? 342  PHE A CZ  1 
ATOM   1997 N N   . LEU A 1  265 ? 15.087  -25.874 -7.130  1.00 16.71  ? 343  LEU A N   1 
ATOM   1998 C CA  . LEU A 1  265 ? 16.490  -25.427 -7.110  1.00 18.59  ? 343  LEU A CA  1 
ATOM   1999 C C   . LEU A 1  265 ? 17.339  -25.721 -8.352  1.00 19.54  ? 343  LEU A C   1 
ATOM   2000 O O   . LEU A 1  265 ? 18.466  -25.239 -8.455  1.00 19.10  ? 343  LEU A O   1 
ATOM   2001 C CB  . LEU A 1  265 ? 17.185  -25.985 -5.860  1.00 16.95  ? 343  LEU A CB  1 
ATOM   2002 C CG  . LEU A 1  265 ? 17.207  -25.078 -4.631  1.00 18.11  ? 343  LEU A CG  1 
ATOM   2003 C CD1 . LEU A 1  265 ? 18.203  -23.937 -4.816  1.00 19.86  ? 343  LEU A CD1 1 
ATOM   2004 C CD2 . LEU A 1  265 ? 15.810  -24.557 -4.314  1.00 17.41  ? 343  LEU A CD2 1 
ATOM   2005 N N   . GLY A 1  266 ? 16.824  -26.503 -9.287  1.00 20.73  ? 344  GLY A N   1 
ATOM   2006 C CA  . GLY A 1  266 ? 17.542  -26.786 -10.517 1.00 19.16  ? 344  GLY A CA  1 
ATOM   2007 C C   . GLY A 1  266 ? 18.712  -27.717 -10.255 1.00 19.09  ? 344  GLY A C   1 
ATOM   2008 O O   . GLY A 1  266 ? 18.482  -28.828 -9.764  1.00 19.78  ? 344  GLY A O   1 
ATOM   2009 N N   . PRO A 1  267 ? 19.961  -27.300 -10.516 1.00 19.20  ? 345  PRO A N   1 
ATOM   2010 C CA  . PRO A 1  267 ? 20.355  -25.944 -10.924 1.00 17.17  ? 345  PRO A CA  1 
ATOM   2011 C C   . PRO A 1  267 ? 20.162  -25.645 -12.408 1.00 18.70  ? 345  PRO A C   1 
ATOM   2012 O O   . PRO A 1  267 ? 20.139  -24.493 -12.783 1.00 15.89  ? 345  PRO A O   1 
ATOM   2013 C CB  . PRO A 1  267 ? 21.850  -25.917 -10.597 1.00 20.92  ? 345  PRO A CB  1 
ATOM   2014 C CG  . PRO A 1  267 ? 22.280  -27.330 -10.786 1.00 22.54  ? 345  PRO A CG  1 
ATOM   2015 C CD  . PRO A 1  267 ? 21.134  -28.169 -10.290 1.00 20.99  ? 345  PRO A CD  1 
ATOM   2016 N N   . GLU A 1  268 ? 19.994  -26.666 -13.239 1.00 16.71  ? 346  GLU A N   1 
ATOM   2017 C CA  . GLU A 1  268 ? 19.855  -26.441 -14.673 1.00 20.42  ? 346  GLU A CA  1 
ATOM   2018 C C   . GLU A 1  268 ? 18.412  -26.004 -14.956 1.00 18.81  ? 346  GLU A C   1 
ATOM   2019 O O   . GLU A 1  268 ? 17.495  -26.519 -14.328 1.00 20.96  ? 346  GLU A O   1 
ATOM   2020 C CB  . GLU A 1  268 ? 20.188  -27.727 -15.444 1.00 21.99  ? 346  GLU A CB  1 
ATOM   2021 C CG  . GLU A 1  268 ? 21.531  -28.348 -15.090 1.00 21.84  ? 346  GLU A CG  1 
ATOM   2022 C CD  . GLU A 1  268 ? 21.507  -29.267 -13.871 1.00 26.31  ? 346  GLU A CD  1 
ATOM   2023 O OE1 . GLU A 1  268 ? 20.436  -29.457 -13.216 1.00 25.06  ? 346  GLU A OE1 1 
ATOM   2024 O OE2 . GLU A 1  268 ? 22.577  -29.814 -13.562 1.00 24.45  ? 346  GLU A OE2 1 
ATOM   2025 N N   . PRO A 1  269 ? 18.196  -25.050 -15.882 1.00 20.39  ? 347  PRO A N   1 
ATOM   2026 C CA  . PRO A 1  269 ? 16.809  -24.728 -16.242 1.00 20.68  ? 347  PRO A CA  1 
ATOM   2027 C C   . PRO A 1  269 ? 15.907  -25.930 -16.636 1.00 17.28  ? 347  PRO A C   1 
ATOM   2028 O O   . PRO A 1  269 ? 14.738  -25.970 -16.257 1.00 15.70  ? 347  PRO A O   1 
ATOM   2029 C CB  . PRO A 1  269 ? 16.978  -23.733 -17.389 1.00 20.91  ? 347  PRO A CB  1 
ATOM   2030 C CG  . PRO A 1  269 ? 18.245  -23.007 -17.050 1.00 18.85  ? 347  PRO A CG  1 
ATOM   2031 C CD  . PRO A 1  269 ? 19.139  -24.045 -16.420 1.00 21.24  ? 347  PRO A CD  1 
ATOM   2032 N N   . LYS A 1  270 ? 16.421  -26.905 -17.368 1.00 18.22  ? 348  LYS A N   1 
ATOM   2033 C CA  . LYS A 1  270 ? 15.608  -28.113 -17.661 1.00 17.78  ? 348  LYS A CA  1 
ATOM   2034 C C   . LYS A 1  270 ? 15.185  -28.885 -16.395 1.00 17.84  ? 348  LYS A C   1 
ATOM   2035 O O   . LYS A 1  270 ? 14.062  -29.393 -16.309 1.00 15.03  ? 348  LYS A O   1 
ATOM   2036 C CB  . LYS A 1  270 ? 16.338  -29.040 -18.613 1.00 18.15  ? 348  LYS A CB  1 
ATOM   2037 C CG  . LYS A 1  270 ? 16.498  -28.434 -19.996 1.00 18.72  ? 348  LYS A CG  1 
ATOM   2038 C CD  . LYS A 1  270 ? 17.112  -29.398 -21.000 1.00 18.60  ? 348  LYS A CD  1 
ATOM   2039 C CE  . LYS A 1  270 ? 18.555  -29.730 -20.679 1.00 21.44  ? 348  LYS A CE  1 
ATOM   2040 N NZ  . LYS A 1  270 ? 19.234  -30.466 -21.763 1.00 22.68  ? 348  LYS A NZ  1 
ATOM   2041 N N   . SER A 1  271 ? 16.079  -28.940 -15.404 1.00 17.53  ? 349  SER A N   1 
ATOM   2042 C CA  . SER A 1  271 ? 15.767  -29.543 -14.113 1.00 16.90  ? 349  SER A CA  1 
ATOM   2043 C C   . SER A 1  271 ? 14.737  -28.741 -13.317 1.00 15.09  ? 349  SER A C   1 
ATOM   2044 O O   . SER A 1  271 ? 13.849  -29.315 -12.687 1.00 16.81  ? 349  SER A O   1 
ATOM   2045 C CB  . SER A 1  271 ? 17.042  -29.762 -13.283 1.00 18.06  ? 349  SER A CB  1 
ATOM   2046 O OG  . SER A 1  271 ? 17.938  -30.608 -13.973 1.00 20.65  ? 349  SER A OG  1 
ATOM   2047 N N   . VAL A 1  272 ? 14.826  -27.418 -13.372 1.00 15.18  ? 350  VAL A N   1 
ATOM   2048 C CA  . VAL A 1  272 ? 13.828  -26.594 -12.736 1.00 13.76  ? 350  VAL A CA  1 
ATOM   2049 C C   . VAL A 1  272 ? 12.441  -26.956 -13.286 1.00 15.56  ? 350  VAL A C   1 
ATOM   2050 O O   . VAL A 1  272 ? 11.494  -27.125 -12.524 1.00 15.73  ? 350  VAL A O   1 
ATOM   2051 C CB  . VAL A 1  272 ? 14.095  -25.089 -12.919 1.00 15.37  ? 350  VAL A CB  1 
ATOM   2052 C CG1 . VAL A 1  272 ? 12.905  -24.274 -12.418 1.00 15.38  ? 350  VAL A CG1 1 
ATOM   2053 C CG2 . VAL A 1  272 ? 15.381  -24.653 -12.211 1.00 14.94  ? 350  VAL A CG2 1 
ATOM   2054 N N   . VAL A 1  273 ? 12.315  -27.001 -14.608 1.00 14.70  ? 351  VAL A N   1 
ATOM   2055 C CA  . VAL A 1  273 ? 11.043  -27.325 -15.255 1.00 14.58  ? 351  VAL A CA  1 
ATOM   2056 C C   . VAL A 1  273 ? 10.577  -28.724 -14.827 1.00 16.58  ? 351  VAL A C   1 
ATOM   2057 O O   . VAL A 1  273 ? 9.433   -28.894 -14.423 1.00 15.05  ? 351  VAL A O   1 
ATOM   2058 C CB  . VAL A 1  273 ? 11.145  -27.198 -16.800 1.00 16.99  ? 351  VAL A CB  1 
ATOM   2059 C CG1 . VAL A 1  273 ? 9.952   -27.830 -17.505 1.00 19.03  ? 351  VAL A CG1 1 
ATOM   2060 C CG2 . VAL A 1  273 ? 11.253  -25.732 -17.200 1.00 17.50  ? 351  VAL A CG2 1 
ATOM   2061 N N   . GLN A 1  274 ? 11.469  -29.707 -14.847 1.00 15.42  ? 352  GLN A N   1 
ATOM   2062 C CA  . GLN A 1  274 ? 11.084  -31.072 -14.432 1.00 17.15  ? 352  GLN A CA  1 
ATOM   2063 C C   . GLN A 1  274 ? 10.628  -31.129 -12.952 1.00 16.69  ? 352  GLN A C   1 
ATOM   2064 O O   . GLN A 1  274 ? 9.665   -31.828 -12.613 1.00 16.60  ? 352  GLN A O   1 
ATOM   2065 C CB  . GLN A 1  274 ? 12.213  -32.069 -14.734 1.00 16.94  ? 352  GLN A CB  1 
ATOM   2066 C CG  . GLN A 1  274 ? 12.092  -33.425 -14.034 1.00 21.05  ? 352  GLN A CG  1 
ATOM   2067 C CD  . GLN A 1  274 ? 12.849  -33.504 -12.717 1.00 26.86  ? 352  GLN A CD  1 
ATOM   2068 O OE1 . GLN A 1  274 ? 14.056  -33.266 -12.669 1.00 32.02  ? 352  GLN A OE1 1 
ATOM   2069 N NE2 . GLN A 1  274 ? 12.152  -33.863 -11.649 1.00 31.69  ? 352  GLN A NE2 1 
ATOM   2070 N N   . GLN A 1  275 ? 11.298  -30.369 -12.099 1.00 16.05  ? 353  GLN A N   1 
ATOM   2071 C CA  . GLN A 1  275 ? 10.953  -30.294 -10.678 1.00 18.75  ? 353  GLN A CA  1 
ATOM   2072 C C   . GLN A 1  275 ? 9.568   -29.659 -10.421 1.00 16.51  ? 353  GLN A C   1 
ATOM   2073 O O   . GLN A 1  275 ? 8.794   -30.126 -9.566  1.00 16.17  ? 353  GLN A O   1 
ATOM   2074 C CB  . GLN A 1  275 ? 12.049  -29.525 -9.922  1.00 16.22  ? 353  GLN A CB  1 
ATOM   2075 C CG  . GLN A 1  275 ? 13.345  -30.327 -9.782  1.00 19.58  ? 353  GLN A CG  1 
ATOM   2076 C CD  . GLN A 1  275 ? 14.594  -29.469 -9.603  1.00 18.53  ? 353  GLN A CD  1 
ATOM   2077 O OE1 . GLN A 1  275 ? 14.511  -28.267 -9.356  1.00 19.71  ? 353  GLN A OE1 1 
ATOM   2078 N NE2 . GLN A 1  275 ? 15.765  -30.093 -9.725  1.00 17.63  ? 353  GLN A NE2 1 
ATOM   2079 N N   . TYR A 1  276 ? 9.288   -28.590 -11.150 1.00 14.68  ? 354  TYR A N   1 
ATOM   2080 C CA  . TYR A 1  276 ? 7.958   -27.995 -11.185 1.00 16.59  ? 354  TYR A CA  1 
ATOM   2081 C C   . TYR A 1  276 ? 6.905   -29.018 -11.639 1.00 17.14  ? 354  TYR A C   1 
ATOM   2082 O O   . TYR A 1  276 ? 5.860   -29.183 -10.977 1.00 16.18  ? 354  TYR A O   1 
ATOM   2083 C CB  . TYR A 1  276 ? 7.956   -26.764 -12.081 1.00 15.24  ? 354  TYR A CB  1 
ATOM   2084 C CG  . TYR A 1  276 ? 6.597   -26.184 -12.371 1.00 14.81  ? 354  TYR A CG  1 
ATOM   2085 C CD1 . TYR A 1  276 ? 5.729   -25.827 -11.343 1.00 14.48  ? 354  TYR A CD1 1 
ATOM   2086 C CD2 . TYR A 1  276 ? 6.178   -25.968 -13.671 1.00 16.19  ? 354  TYR A CD2 1 
ATOM   2087 C CE1 . TYR A 1  276 ? 4.495   -25.266 -11.611 1.00 12.22  ? 354  TYR A CE1 1 
ATOM   2088 C CE2 . TYR A 1  276 ? 4.937   -25.418 -13.935 1.00 13.39  ? 354  TYR A CE2 1 
ATOM   2089 C CZ  . TYR A 1  276 ? 4.104   -25.069 -12.913 1.00 14.54  ? 354  TYR A CZ  1 
ATOM   2090 O OH  . TYR A 1  276 ? 2.866   -24.523 -13.216 1.00 16.37  ? 354  TYR A OH  1 
ATOM   2091 N N   . LEU A 1  277 ? 7.197   -29.748 -12.710 1.00 15.86  ? 355  LEU A N   1 
ATOM   2092 C CA  . LEU A 1  277 ? 6.242   -30.747 -13.211 1.00 16.71  ? 355  LEU A CA  1 
ATOM   2093 C C   . LEU A 1  277 ? 6.076   -31.959 -12.294 1.00 18.15  ? 355  LEU A C   1 
ATOM   2094 O O   . LEU A 1  277 ? 5.046   -32.625 -12.328 1.00 16.72  ? 355  LEU A O   1 
ATOM   2095 C CB  . LEU A 1  277 ? 6.565   -31.117 -14.660 1.00 17.07  ? 355  LEU A CB  1 
ATOM   2096 C CG  . LEU A 1  277 ? 6.562   -29.915 -15.613 1.00 15.76  ? 355  LEU A CG  1 
ATOM   2097 C CD1 . LEU A 1  277 ? 6.906   -30.322 -17.052 1.00 17.23  ? 355  LEU A CD1 1 
ATOM   2098 C CD2 . LEU A 1  277 ? 5.252   -29.118 -15.603 1.00 19.12  ? 355  LEU A CD2 1 
ATOM   2099 N N   . ASP A 1  278 ? 7.074   -32.225 -11.452 1.00 19.78  ? 356  ASP A N   1 
ATOM   2100 C CA  . ASP A 1  278 ? 6.948   -33.189 -10.364 1.00 21.40  ? 356  ASP A CA  1 
ATOM   2101 C C   . ASP A 1  278 ? 5.844   -32.824 -9.351  1.00 19.46  ? 356  ASP A C   1 
ATOM   2102 O O   . ASP A 1  278 ? 5.330   -33.680 -8.682  1.00 19.73  ? 356  ASP A O   1 
ATOM   2103 C CB  . ASP A 1  278 ? 8.272   -33.302 -9.578  1.00 31.54  ? 356  ASP A CB  1 
ATOM   2104 C CG  . ASP A 1  278 ? 9.103   -34.480 -9.975  1.00 35.60  ? 356  ASP A CG  1 
ATOM   2105 O OD1 . ASP A 1  278 ? 9.289   -34.724 -11.178 1.00 37.01  ? 356  ASP A OD1 1 
ATOM   2106 O OD2 . ASP A 1  278 ? 9.584   -35.163 -9.060  1.00 48.26  ? 356  ASP A OD2 1 
ATOM   2107 N N   . VAL A 1  279 ? 5.518   -31.551 -9.210  1.00 17.07  ? 357  VAL A N   1 
ATOM   2108 C CA  . VAL A 1  279 ? 4.429   -31.109 -8.354  1.00 16.22  ? 357  VAL A CA  1 
ATOM   2109 C C   . VAL A 1  279 ? 3.096   -31.062 -9.139  1.00 19.13  ? 357  VAL A C   1 
ATOM   2110 O O   . VAL A 1  279 ? 2.087   -31.582 -8.670  1.00 19.24  ? 357  VAL A O   1 
ATOM   2111 C CB  . VAL A 1  279 ? 4.767   -29.724 -7.749  1.00 16.80  ? 357  VAL A CB  1 
ATOM   2112 C CG1 . VAL A 1  279 ? 3.571   -29.074 -7.040  1.00 17.68  ? 357  VAL A CG1 1 
ATOM   2113 C CG2 . VAL A 1  279 ? 5.974   -29.837 -6.822  1.00 17.45  ? 357  VAL A CG2 1 
ATOM   2114 N N   . VAL A 1  280 ? 3.082   -30.413 -10.307 1.00 17.52  ? 358  VAL A N   1 
ATOM   2115 C CA  . VAL A 1  280 ? 1.806   -30.154 -11.037 1.00 17.35  ? 358  VAL A CA  1 
ATOM   2116 C C   . VAL A 1  280 ? 1.378   -31.281 -11.980 1.00 21.45  ? 358  VAL A C   1 
ATOM   2117 O O   . VAL A 1  280 ? 0.205   -31.331 -12.358 1.00 24.62  ? 358  VAL A O   1 
ATOM   2118 C CB  . VAL A 1  280 ? 1.759   -28.800 -11.790 1.00 17.98  ? 358  VAL A CB  1 
ATOM   2119 C CG1 . VAL A 1  280 ? 1.890   -27.636 -10.824 1.00 19.52  ? 358  VAL A CG1 1 
ATOM   2120 C CG2 . VAL A 1  280 ? 2.805   -28.682 -12.897 1.00 16.83  ? 358  VAL A CG2 1 
ATOM   2121 N N   . GLY A 1  281 ? 2.310   -32.166 -12.350 1.00 19.49  ? 359  GLY A N   1 
ATOM   2122 C CA  . GLY A 1  281 ? 2.033   -33.291 -13.238 1.00 21.17  ? 359  GLY A CA  1 
ATOM   2123 C C   . GLY A 1  281 ? 2.873   -33.253 -14.505 1.00 18.08  ? 359  GLY A C   1 
ATOM   2124 O O   . GLY A 1  281 ? 3.075   -32.188 -15.100 1.00 18.44  ? 359  GLY A O   1 
ATOM   2125 N N   . TYR A 1  282 ? 3.384   -34.410 -14.910 1.00 16.72  ? 360  TYR A N   1 
ATOM   2126 C CA  . TYR A 1  282 ? 4.072   -34.521 -16.196 1.00 18.29  ? 360  TYR A CA  1 
ATOM   2127 C C   . TYR A 1  282 ? 3.032   -34.488 -17.315 1.00 18.31  ? 360  TYR A C   1 
ATOM   2128 O O   . TYR A 1  282 ? 1.893   -34.925 -17.117 1.00 17.23  ? 360  TYR A O   1 
ATOM   2129 C CB  . TYR A 1  282 ? 4.901   -35.808 -16.298 1.00 19.53  ? 360  TYR A CB  1 
ATOM   2130 C CG  . TYR A 1  282 ? 6.160   -35.881 -15.435 1.00 19.31  ? 360  TYR A CG  1 
ATOM   2131 C CD1 . TYR A 1  282 ? 6.609   -34.798 -14.683 1.00 20.07  ? 360  TYR A CD1 1 
ATOM   2132 C CD2 . TYR A 1  282 ? 6.907   -37.049 -15.396 1.00 20.30  ? 360  TYR A CD2 1 
ATOM   2133 C CE1 . TYR A 1  282 ? 7.765   -34.885 -13.909 1.00 19.34  ? 360  TYR A CE1 1 
ATOM   2134 C CE2 . TYR A 1  282 ? 8.057   -37.143 -14.640 1.00 21.38  ? 360  TYR A CE2 1 
ATOM   2135 C CZ  . TYR A 1  282 ? 8.489   -36.063 -13.914 1.00 24.67  ? 360  TYR A CZ  1 
ATOM   2136 O OH  . TYR A 1  282 ? 9.617   -36.194 -13.163 1.00 22.18  ? 360  TYR A OH  1 
ATOM   2137 N N   . PRO A 1  283 ? 3.412   -33.960 -18.487 1.00 16.84  ? 361  PRO A N   1 
ATOM   2138 C CA  . PRO A 1  283 ? 2.537   -33.912 -19.656 1.00 17.42  ? 361  PRO A CA  1 
ATOM   2139 C C   . PRO A 1  283 ? 1.937   -35.249 -20.021 1.00 15.95  ? 361  PRO A C   1 
ATOM   2140 O O   . PRO A 1  283 ? 2.621   -36.270 -19.911 1.00 14.20  ? 361  PRO A O   1 
ATOM   2141 C CB  . PRO A 1  283 ? 3.483   -33.467 -20.761 1.00 14.70  ? 361  PRO A CB  1 
ATOM   2142 C CG  . PRO A 1  283 ? 4.424   -32.595 -20.080 1.00 16.30  ? 361  PRO A CG  1 
ATOM   2143 C CD  . PRO A 1  283 ? 4.682   -33.277 -18.765 1.00 17.86  ? 361  PRO A CD  1 
ATOM   2144 N N   . PHE A 1  284 ? 0.675   -35.242 -20.455 1.00 17.21  ? 362  PHE A N   1 
ATOM   2145 C CA  . PHE A 1  284 ? 0.023   -36.469 -20.904 1.00 16.67  ? 362  PHE A CA  1 
ATOM   2146 C C   . PHE A 1  284 ? 0.648   -36.914 -22.204 1.00 18.21  ? 362  PHE A C   1 
ATOM   2147 O O   . PHE A 1  284 ? 1.209   -36.086 -22.926 1.00 17.71  ? 362  PHE A O   1 
ATOM   2148 C CB  . PHE A 1  284 ? -1.489  -36.295 -21.047 1.00 20.60  ? 362  PHE A CB  1 
ATOM   2149 C CG  . PHE A 1  284 ? -1.928  -35.703 -22.353 1.00 19.11  ? 362  PHE A CG  1 
ATOM   2150 C CD1 . PHE A 1  284 ? -1.774  -34.349 -22.608 1.00 17.55  ? 362  PHE A CD1 1 
ATOM   2151 C CD2 . PHE A 1  284 ? -2.527  -36.505 -23.313 1.00 17.45  ? 362  PHE A CD2 1 
ATOM   2152 C CE1 . PHE A 1  284 ? -2.174  -33.806 -23.801 1.00 17.00  ? 362  PHE A CE1 1 
ATOM   2153 C CE2 . PHE A 1  284 ? -2.947  -35.966 -24.510 1.00 18.77  ? 362  PHE A CE2 1 
ATOM   2154 C CZ  . PHE A 1  284 ? -2.783  -34.609 -24.750 1.00 18.42  ? 362  PHE A CZ  1 
ATOM   2155 N N   . MET A 1  285 ? 0.577   -38.217 -22.489 1.00 15.36  ? 363  MET A N   1 
ATOM   2156 C CA  . MET A 1  285 ? 1.126   -38.746 -23.721 1.00 19.04  ? 363  MET A CA  1 
ATOM   2157 C C   . MET A 1  285 ? 0.045   -38.671 -24.801 1.00 18.95  ? 363  MET A C   1 
ATOM   2158 O O   . MET A 1  285 ? -0.992  -39.300 -24.673 1.00 18.38  ? 363  MET A O   1 
ATOM   2159 C CB  . MET A 1  285 ? 1.611   -40.173 -23.522 1.00 18.64  ? 363  MET A CB  1 
ATOM   2160 C CG  . MET A 1  285 ? 2.403   -40.708 -24.700 1.00 19.77  ? 363  MET A CG  1 
ATOM   2161 S SD  . MET A 1  285 ? 3.941   -39.852 -25.030 1.00 18.61  ? 363  MET A SD  1 
ATOM   2162 C CE  . MET A 1  285 ? 4.367   -40.597 -26.607 1.00 21.49  ? 363  MET A CE  1 
ATOM   2163 N N   . PRO A 1  286 ? 0.260   -37.853 -25.843 1.00 17.59  ? 364  PRO A N   1 
ATOM   2164 C CA  . PRO A 1  286 ? -0.760  -37.824 -26.869 1.00 18.39  ? 364  PRO A CA  1 
ATOM   2165 C C   . PRO A 1  286 ? -0.789  -39.098 -27.727 1.00 18.23  ? 364  PRO A C   1 
ATOM   2166 O O   . PRO A 1  286 ? 0.216   -39.825 -27.814 1.00 17.62  ? 364  PRO A O   1 
ATOM   2167 C CB  . PRO A 1  286 ? -0.364  -36.610 -27.706 1.00 22.43  ? 364  PRO A CB  1 
ATOM   2168 C CG  . PRO A 1  286 ? 1.121   -36.554 -27.575 1.00 22.22  ? 364  PRO A CG  1 
ATOM   2169 C CD  . PRO A 1  286 ? 1.390   -36.966 -26.165 1.00 18.79  ? 364  PRO A CD  1 
ATOM   2170 N N   . PRO A 1  287 ? -1.925  -39.358 -28.382 1.00 18.86  ? 365  PRO A N   1 
ATOM   2171 C CA  . PRO A 1  287 ? -1.901  -40.344 -29.462 1.00 17.30  ? 365  PRO A CA  1 
ATOM   2172 C C   . PRO A 1  287 ? -0.991  -39.883 -30.618 1.00 17.40  ? 365  PRO A C   1 
ATOM   2173 O O   . PRO A 1  287 ? -0.851  -38.684 -30.873 1.00 15.59  ? 365  PRO A O   1 
ATOM   2174 C CB  . PRO A 1  287 ? -3.362  -40.417 -29.889 1.00 18.87  ? 365  PRO A CB  1 
ATOM   2175 C CG  . PRO A 1  287 ? -3.903  -39.077 -29.578 1.00 22.66  ? 365  PRO A CG  1 
ATOM   2176 C CD  . PRO A 1  287 ? -3.200  -38.623 -28.341 1.00 21.79  ? 365  PRO A CD  1 
ATOM   2177 N N   . TYR A 1  288 ? -0.337  -40.819 -31.276 1.00 15.80  ? 366  TYR A N   1 
ATOM   2178 C CA  . TYR A 1  288 ? 0.563   -40.487 -32.397 1.00 16.52  ? 366  TYR A CA  1 
ATOM   2179 C C   . TYR A 1  288 ? -0.135  -39.657 -33.481 1.00 17.51  ? 366  TYR A C   1 
ATOM   2180 O O   . TYR A 1  288 ? 0.415   -38.649 -33.971 1.00 17.59  ? 366  TYR A O   1 
ATOM   2181 C CB  . TYR A 1  288 ? 1.134   -41.776 -32.992 1.00 16.03  ? 366  TYR A CB  1 
ATOM   2182 C CG  . TYR A 1  288 ? 2.333   -41.646 -33.924 1.00 15.48  ? 366  TYR A CG  1 
ATOM   2183 C CD1 . TYR A 1  288 ? 2.171   -41.355 -35.280 1.00 15.34  ? 366  TYR A CD1 1 
ATOM   2184 C CD2 . TYR A 1  288 ? 3.624   -41.931 -33.464 1.00 16.50  ? 366  TYR A CD2 1 
ATOM   2185 C CE1 . TYR A 1  288 ? 3.278   -41.298 -36.143 1.00 17.94  ? 366  TYR A CE1 1 
ATOM   2186 C CE2 . TYR A 1  288 ? 4.740   -41.888 -34.313 1.00 15.18  ? 366  TYR A CE2 1 
ATOM   2187 C CZ  . TYR A 1  288 ? 4.570   -41.584 -35.650 1.00 16.50  ? 366  TYR A CZ  1 
ATOM   2188 O OH  . TYR A 1  288 ? 5.693   -41.536 -36.470 1.00 17.39  ? 366  TYR A OH  1 
ATOM   2189 N N   . TRP A 1  289 ? -1.368  -40.047 -33.812 1.00 15.32  ? 367  TRP A N   1 
ATOM   2190 C CA  . TRP A 1  289 ? -2.158  -39.323 -34.803 1.00 15.80  ? 367  TRP A CA  1 
ATOM   2191 C C   . TRP A 1  289 ? -2.357  -37.844 -34.481 1.00 17.41  ? 367  TRP A C   1 
ATOM   2192 O O   . TRP A 1  289 ? -2.489  -37.026 -35.392 1.00 18.02  ? 367  TRP A O   1 
ATOM   2193 C CB  . TRP A 1  289 ? -3.497  -40.032 -35.101 1.00 15.48  ? 367  TRP A CB  1 
ATOM   2194 C CG  . TRP A 1  289 ? -4.465  -40.153 -33.960 1.00 14.45  ? 367  TRP A CG  1 
ATOM   2195 C CD1 . TRP A 1  289 ? -4.700  -41.273 -33.208 1.00 16.13  ? 367  TRP A CD1 1 
ATOM   2196 C CD2 . TRP A 1  289 ? -5.369  -39.152 -33.472 1.00 14.70  ? 367  TRP A CD2 1 
ATOM   2197 N NE1 . TRP A 1  289 ? -5.680  -41.021 -32.254 1.00 16.38  ? 367  TRP A NE1 1 
ATOM   2198 C CE2 . TRP A 1  289 ? -6.096  -39.726 -32.389 1.00 16.16  ? 367  TRP A CE2 1 
ATOM   2199 C CE3 . TRP A 1  289 ? -5.613  -37.820 -33.809 1.00 17.20  ? 367  TRP A CE3 1 
ATOM   2200 C CZ2 . TRP A 1  289 ? -7.074  -39.026 -31.691 1.00 15.52  ? 367  TRP A CZ2 1 
ATOM   2201 C CZ3 . TRP A 1  289 ? -6.591  -37.117 -33.093 1.00 14.76  ? 367  TRP A CZ3 1 
ATOM   2202 C CH2 . TRP A 1  289 ? -7.299  -37.720 -32.058 1.00 14.10  ? 367  TRP A CH2 1 
ATOM   2203 N N   . GLY A 1  290 ? -2.354  -37.499 -33.190 1.00 17.07  ? 368  GLY A N   1 
ATOM   2204 C CA  . GLY A 1  290 ? -2.471  -36.117 -32.744 1.00 15.58  ? 368  GLY A CA  1 
ATOM   2205 C C   . GLY A 1  290 ? -1.359  -35.179 -33.147 1.00 16.72  ? 368  GLY A C   1 
ATOM   2206 O O   . GLY A 1  290 ? -1.558  -33.940 -33.120 1.00 16.38  ? 368  GLY A O   1 
ATOM   2207 N N   . LEU A 1  291 ? -0.216  -35.760 -33.555 1.00 14.97  ? 369  LEU A N   1 
ATOM   2208 C CA  . LEU A 1  291 ? 0.931   -35.026 -34.032 1.00 15.96  ? 369  LEU A CA  1 
ATOM   2209 C C   . LEU A 1  291 ? 0.936   -34.836 -35.548 1.00 15.73  ? 369  LEU A C   1 
ATOM   2210 O O   . LEU A 1  291 ? 1.781   -34.139 -36.073 1.00 14.55  ? 369  LEU A O   1 
ATOM   2211 C CB  . LEU A 1  291 ? 2.222   -35.729 -33.582 1.00 16.32  ? 369  LEU A CB  1 
ATOM   2212 C CG  . LEU A 1  291 ? 2.316   -36.062 -32.092 1.00 19.13  ? 369  LEU A CG  1 
ATOM   2213 C CD1 . LEU A 1  291 ? 3.642   -36.750 -31.833 1.00 22.55  ? 369  LEU A CD1 1 
ATOM   2214 C CD2 . LEU A 1  291 ? 2.177   -34.826 -31.218 1.00 23.19  ? 369  LEU A CD2 1 
ATOM   2215 N N   . GLY A 1  292 ? -0.035  -35.410 -36.247 1.00 19.07  ? 370  GLY A N   1 
ATOM   2216 C CA  . GLY A 1  292 ? -0.234  -35.119 -37.659 1.00 19.48  ? 370  GLY A CA  1 
ATOM   2217 C C   . GLY A 1  292 ? -0.836  -33.734 -37.840 1.00 19.50  ? 370  GLY A C   1 
ATOM   2218 O O   . GLY A 1  292 ? -1.077  -33.022 -36.873 1.00 17.64  ? 370  GLY A O   1 
ATOM   2219 N N   . PHE A 1  293 ? -1.103  -33.376 -39.088 1.00 16.71  ? 371  PHE A N   1 
ATOM   2220 C CA  . PHE A 1  293 ? -1.681  -32.097 -39.416 1.00 17.64  ? 371  PHE A CA  1 
ATOM   2221 C C   . PHE A 1  293 ? -3.183  -32.143 -39.142 1.00 17.75  ? 371  PHE A C   1 
ATOM   2222 O O   . PHE A 1  293 ? -3.845  -33.115 -39.492 1.00 16.11  ? 371  PHE A O   1 
ATOM   2223 C CB  . PHE A 1  293 ? -1.398  -31.758 -40.881 1.00 16.52  ? 371  PHE A CB  1 
ATOM   2224 C CG  . PHE A 1  293 ? -1.835  -30.358 -41.317 1.00 17.92  ? 371  PHE A CG  1 
ATOM   2225 C CD1 . PHE A 1  293 ? -1.506  -29.226 -40.578 1.00 18.02  ? 371  PHE A CD1 1 
ATOM   2226 C CD2 . PHE A 1  293 ? -2.519  -30.179 -42.524 1.00 17.09  ? 371  PHE A CD2 1 
ATOM   2227 C CE1 . PHE A 1  293 ? -1.907  -27.949 -40.999 1.00 17.29  ? 371  PHE A CE1 1 
ATOM   2228 C CE2 . PHE A 1  293 ? -2.903  -28.909 -42.956 1.00 17.14  ? 371  PHE A CE2 1 
ATOM   2229 C CZ  . PHE A 1  293 ? -2.580  -27.790 -42.196 1.00 15.57  ? 371  PHE A CZ  1 
ATOM   2230 N N   . HIS A 1  294 ? -3.690  -31.057 -38.551 1.00 16.34  ? 372  HIS A N   1 
ATOM   2231 C CA  . HIS A 1  294 ? -5.104  -30.824 -38.281 1.00 15.54  ? 372  HIS A CA  1 
ATOM   2232 C C   . HIS A 1  294 ? -5.577  -29.654 -39.139 1.00 16.23  ? 372  HIS A C   1 
ATOM   2233 O O   . HIS A 1  294 ? -4.866  -28.652 -39.273 1.00 15.79  ? 372  HIS A O   1 
ATOM   2234 C CB  . HIS A 1  294 ? -5.301  -30.439 -36.802 1.00 14.68  ? 372  HIS A CB  1 
ATOM   2235 C CG  . HIS A 1  294 ? -4.761  -31.441 -35.832 1.00 17.41  ? 372  HIS A CG  1 
ATOM   2236 N ND1 . HIS A 1  294 ? -5.553  -32.326 -35.138 1.00 17.02  ? 372  HIS A ND1 1 
ATOM   2237 C CD2 . HIS A 1  294 ? -3.492  -31.697 -35.441 1.00 16.62  ? 372  HIS A CD2 1 
ATOM   2238 C CE1 . HIS A 1  294 ? -4.799  -33.084 -34.367 1.00 18.89  ? 372  HIS A CE1 1 
ATOM   2239 N NE2 . HIS A 1  294 ? -3.542  -32.730 -34.544 1.00 16.48  ? 372  HIS A NE2 1 
ATOM   2240 N N   . LEU A 1  295 ? -6.788  -29.747 -39.684 1.00 15.85  ? 373  LEU A N   1 
ATOM   2241 C CA  . LEU A 1  295 ? -7.320  -28.665 -40.516 1.00 18.31  ? 373  LEU A CA  1 
ATOM   2242 C C   . LEU A 1  295 ? -8.777  -28.371 -40.162 1.00 18.99  ? 373  LEU A C   1 
ATOM   2243 O O   . LEU A 1  295 ? -9.625  -29.286 -40.073 1.00 16.42  ? 373  LEU A O   1 
ATOM   2244 C CB  . LEU A 1  295 ? -7.166  -29.010 -41.994 1.00 19.09  ? 373  LEU A CB  1 
ATOM   2245 C CG  . LEU A 1  295 ? -7.571  -27.943 -43.013 1.00 19.33  ? 373  LEU A CG  1 
ATOM   2246 C CD1 . LEU A 1  295 ? -6.749  -26.669 -42.868 1.00 22.29  ? 373  LEU A CD1 1 
ATOM   2247 C CD2 . LEU A 1  295 ? -7.446  -28.509 -44.421 1.00 18.09  ? 373  LEU A CD2 1 
ATOM   2248 N N   . CYS A 1  296 ? -9.043  -27.077 -39.963 1.00 17.00  ? 374  CYS A N   1 
ATOM   2249 C CA  . CYS A 1  296 ? -10.314 -26.576 -39.453 1.00 18.01  ? 374  CYS A CA  1 
ATOM   2250 C C   . CYS A 1  296 ? -10.630 -25.185 -40.016 1.00 17.48  ? 374  CYS A C   1 
ATOM   2251 O O   . CYS A 1  296 ? -9.747  -24.452 -40.432 1.00 17.57  ? 374  CYS A O   1 
ATOM   2252 C CB  . CYS A 1  296 ? -10.226 -26.447 -37.934 1.00 18.30  ? 374  CYS A CB  1 
ATOM   2253 S SG  . CYS A 1  296 ? -11.841 -26.264 -37.120 1.00 17.71  ? 374  CYS A SG  1 
ATOM   2254 N N   . ARG A 1  297 ? -11.906 -24.844 -40.047 1.00 15.59  ? 375  ARG A N   1 
ATOM   2255 C CA  . ARG A 1  297 ? -12.308 -23.443 -40.088 1.00 16.51  ? 375  ARG A CA  1 
ATOM   2256 C C   . ARG A 1  297 ? -13.712 -23.335 -39.565 1.00 18.00  ? 375  ARG A C   1 
ATOM   2257 O O   . ARG A 1  297 ? -14.473 -24.308 -39.556 1.00 16.60  ? 375  ARG A O   1 
ATOM   2258 C CB  . ARG A 1  297 ? -12.242 -22.841 -41.497 1.00 16.87  ? 375  ARG A CB  1 
ATOM   2259 C CG  . ARG A 1  297 ? -13.467 -23.080 -42.393 1.00 16.75  ? 375  ARG A CG  1 
ATOM   2260 C CD  . ARG A 1  297 ? -13.380 -22.281 -43.668 1.00 17.63  ? 375  ARG A CD  1 
ATOM   2261 N NE  . ARG A 1  297 ? -13.644 -20.860 -43.391 1.00 18.58  ? 375  ARG A NE  1 
ATOM   2262 C CZ  . ARG A 1  297 ? -13.409 -19.859 -44.233 1.00 19.72  ? 375  ARG A CZ  1 
ATOM   2263 N NH1 . ARG A 1  297 ? -12.868 -20.083 -45.429 1.00 22.44  ? 375  ARG A NH1 1 
ATOM   2264 N NH2 . ARG A 1  297 ? -13.686 -18.610 -43.866 1.00 20.82  ? 375  ARG A NH2 1 
ATOM   2265 N N   . TRP A 1  298 ? -14.046 -22.120 -39.178 1.00 17.73  ? 376  TRP A N   1 
ATOM   2266 C CA  . TRP A 1  298 ? -15.402 -21.732 -38.939 1.00 18.88  ? 376  TRP A CA  1 
ATOM   2267 C C   . TRP A 1  298 ? -15.922 -21.420 -40.325 1.00 18.35  ? 376  TRP A C   1 
ATOM   2268 O O   . TRP A 1  298 ? -15.362 -20.574 -41.019 1.00 17.81  ? 376  TRP A O   1 
ATOM   2269 C CB  . TRP A 1  298 ? -15.409 -20.497 -38.019 1.00 20.99  ? 376  TRP A CB  1 
ATOM   2270 C CG  . TRP A 1  298 ? -16.726 -20.103 -37.449 1.00 22.58  ? 376  TRP A CG  1 
ATOM   2271 C CD1 . TRP A 1  298 ? -17.922 -20.743 -37.582 1.00 23.69  ? 376  TRP A CD1 1 
ATOM   2272 C CD2 . TRP A 1  298 ? -16.964 -18.976 -36.615 1.00 24.34  ? 376  TRP A CD2 1 
ATOM   2273 N NE1 . TRP A 1  298 ? -18.899 -20.058 -36.905 1.00 27.25  ? 376  TRP A NE1 1 
ATOM   2274 C CE2 . TRP A 1  298 ? -18.336 -18.965 -36.309 1.00 25.99  ? 376  TRP A CE2 1 
ATOM   2275 C CE3 . TRP A 1  298 ? -16.148 -17.946 -36.121 1.00 30.07  ? 376  TRP A CE3 1 
ATOM   2276 C CZ2 . TRP A 1  298 ? -18.910 -17.987 -35.506 1.00 27.09  ? 376  TRP A CZ2 1 
ATOM   2277 C CZ3 . TRP A 1  298 ? -16.722 -16.959 -35.343 1.00 30.99  ? 376  TRP A CZ3 1 
ATOM   2278 C CH2 . TRP A 1  298 ? -18.085 -16.991 -35.039 1.00 32.89  ? 376  TRP A CH2 1 
ATOM   2279 N N   . GLY A 1  299 ? -16.927 -22.171 -40.758 1.00 20.19  ? 377  GLY A N   1 
ATOM   2280 C CA  . GLY A 1  299 ? -17.566 -21.976 -42.066 1.00 20.71  ? 377  GLY A CA  1 
ATOM   2281 C C   . GLY A 1  299 ? -17.599 -23.178 -42.988 1.00 20.76  ? 377  GLY A C   1 
ATOM   2282 O O   . GLY A 1  299 ? -18.132 -23.080 -44.093 1.00 20.50  ? 377  GLY A O   1 
ATOM   2283 N N   . TYR A 1  300 ? -17.029 -24.316 -42.582 1.00 22.24  ? 378  TYR A N   1 
ATOM   2284 C CA  . TYR A 1  300 ? -17.285 -25.566 -43.304 1.00 19.13  ? 378  TYR A CA  1 
ATOM   2285 C C   . TYR A 1  300 ? -18.707 -25.997 -42.933 1.00 21.20  ? 378  TYR A C   1 
ATOM   2286 O O   . TYR A 1  300 ? -18.906 -26.767 -42.001 1.00 21.60  ? 378  TYR A O   1 
ATOM   2287 C CB  . TYR A 1  300 ? -16.283 -26.663 -42.964 1.00 19.07  ? 378  TYR A CB  1 
ATOM   2288 C CG  . TYR A 1  300 ? -14.844 -26.416 -43.355 1.00 18.25  ? 378  TYR A CG  1 
ATOM   2289 C CD1 . TYR A 1  300 ? -14.496 -25.703 -44.519 1.00 17.35  ? 378  TYR A CD1 1 
ATOM   2290 C CD2 . TYR A 1  300 ? -13.811 -26.903 -42.548 1.00 16.77  ? 378  TYR A CD2 1 
ATOM   2291 C CE1 . TYR A 1  300 ? -13.168 -25.480 -44.845 1.00 19.35  ? 378  TYR A CE1 1 
ATOM   2292 C CE2 . TYR A 1  300 ? -12.489 -26.695 -42.872 1.00 17.74  ? 378  TYR A CE2 1 
ATOM   2293 C CZ  . TYR A 1  300 ? -12.161 -25.989 -44.016 1.00 21.09  ? 378  TYR A CZ  1 
ATOM   2294 O OH  . TYR A 1  300 ? -10.823 -25.787 -44.315 1.00 22.07  ? 378  TYR A OH  1 
ATOM   2295 N N   . SER A 1  301 ? -19.681 -25.484 -43.687 1.00 20.89  ? 379  SER A N   1 
ATOM   2296 C CA  . SER A 1  301 ? -21.084 -25.438 -43.256 1.00 22.57  ? 379  SER A CA  1 
ATOM   2297 C C   . SER A 1  301 ? -21.922 -26.654 -43.677 1.00 22.22  ? 379  SER A C   1 
ATOM   2298 O O   . SER A 1  301 ? -23.135 -26.666 -43.498 1.00 23.36  ? 379  SER A O   1 
ATOM   2299 C CB  . SER A 1  301 ? -21.731 -24.164 -43.804 1.00 22.23  ? 379  SER A CB  1 
ATOM   2300 O OG  . SER A 1  301 ? -21.601 -24.141 -45.217 1.00 23.55  ? 379  SER A OG  1 
ATOM   2301 N N   . SER A 1  302 ? -21.292 -27.668 -44.251 1.00 21.26  ? 380  SER A N   1 
ATOM   2302 C CA  . SER A 1  302 ? -21.980 -28.928 -44.495 1.00 19.63  ? 380  SER A CA  1 
ATOM   2303 C C   . SER A 1  302 ? -20.974 -30.060 -44.510 1.00 19.86  ? 380  SER A C   1 
ATOM   2304 O O   . SER A 1  302 ? -19.763 -29.818 -44.613 1.00 18.14  ? 380  SER A O   1 
ATOM   2305 C CB  . SER A 1  302 ? -22.772 -28.880 -45.819 1.00 17.72  ? 380  SER A CB  1 
ATOM   2306 O OG  . SER A 1  302 ? -21.901 -28.790 -46.931 1.00 20.85  ? 380  SER A OG  1 
ATOM   2307 N N   . THR A 1  303 ? -21.477 -31.296 -44.432 1.00 19.48  ? 381  THR A N   1 
ATOM   2308 C CA  . THR A 1  303 ? -20.630 -32.471 -44.620 1.00 17.66  ? 381  THR A CA  1 
ATOM   2309 C C   . THR A 1  303 ? -20.017 -32.509 -46.036 1.00 21.39  ? 381  THR A C   1 
ATOM   2310 O O   . THR A 1  303 ? -18.861 -32.881 -46.186 1.00 21.52  ? 381  THR A O   1 
ATOM   2311 C CB  . THR A 1  303 ? -21.384 -33.782 -44.370 1.00 18.03  ? 381  THR A CB  1 
ATOM   2312 O OG1 . THR A 1  303 ? -22.508 -33.852 -45.245 1.00 19.50  ? 381  THR A OG1 1 
ATOM   2313 C CG2 . THR A 1  303 ? -21.861 -33.886 -42.868 1.00 17.68  ? 381  THR A CG2 1 
ATOM   2314 N N   . ALA A 1  304 ? -20.787 -32.123 -47.054 1.00 21.83  ? 382  ALA A N   1 
ATOM   2315 C CA  . ALA A 1  304 ? -20.289 -32.069 -48.428 1.00 22.21  ? 382  ALA A CA  1 
ATOM   2316 C C   . ALA A 1  304 ? -19.069 -31.139 -48.557 1.00 21.78  ? 382  ALA A C   1 
ATOM   2317 O O   . ALA A 1  304 ? -18.056 -31.521 -49.118 1.00 22.12  ? 382  ALA A O   1 
ATOM   2318 C CB  . ALA A 1  304 ? -21.398 -31.625 -49.378 1.00 25.07  ? 382  ALA A CB  1 
ATOM   2319 N N   . ILE A 1  305 ? -19.168 -29.936 -48.002 1.00 21.72  ? 383  ILE A N   1 
ATOM   2320 C CA  . ILE A 1  305 ? -18.044 -29.004 -47.997 1.00 21.19  ? 383  ILE A CA  1 
ATOM   2321 C C   . ILE A 1  305 ? -16.864 -29.589 -47.216 1.00 22.10  ? 383  ILE A C   1 
ATOM   2322 O O   . ILE A 1  305 ? -15.719 -29.512 -47.662 1.00 17.69  ? 383  ILE A O   1 
ATOM   2323 C CB  . ILE A 1  305 ? -18.466 -27.636 -47.437 1.00 21.50  ? 383  ILE A CB  1 
ATOM   2324 C CG1 . ILE A 1  305 ? -19.348 -26.924 -48.486 1.00 24.16  ? 383  ILE A CG1 1 
ATOM   2325 C CG2 . ILE A 1  305 ? -17.246 -26.779 -47.059 1.00 24.71  ? 383  ILE A CG2 1 
ATOM   2326 C CD1 . ILE A 1  305 ? -20.136 -25.743 -47.958 1.00 27.96  ? 383  ILE A CD1 1 
ATOM   2327 N N   . THR A 1  306 ? -17.152 -30.182 -46.062 1.00 19.82  ? 384  THR A N   1 
ATOM   2328 C CA  . THR A 1  306 ? -16.108 -30.722 -45.199 1.00 20.50  ? 384  THR A CA  1 
ATOM   2329 C C   . THR A 1  306 ? -15.404 -31.872 -45.903 1.00 20.37  ? 384  THR A C   1 
ATOM   2330 O O   . THR A 1  306 ? -14.184 -31.961 -45.847 1.00 19.42  ? 384  THR A O   1 
ATOM   2331 C CB  . THR A 1  306 ? -16.681 -31.167 -43.843 1.00 20.24  ? 384  THR A CB  1 
ATOM   2332 O OG1 . THR A 1  306 ? -17.423 -30.078 -43.267 1.00 17.80  ? 384  THR A OG1 1 
ATOM   2333 C CG2 . THR A 1  306 ? -15.568 -31.629 -42.868 1.00 17.74  ? 384  THR A CG2 1 
ATOM   2334 N N   . ARG A 1  307 ? -16.170 -32.749 -46.559 1.00 21.46  ? 385  ARG A N   1 
ATOM   2335 C CA  . ARG A 1  307 ? -15.592 -33.822 -47.372 1.00 21.78  ? 385  ARG A CA  1 
ATOM   2336 C C   . ARG A 1  307 ? -14.669 -33.283 -48.486 1.00 22.44  ? 385  ARG A C   1 
ATOM   2337 O O   . ARG A 1  307 ? -13.634 -33.893 -48.793 1.00 22.17  ? 385  ARG A O   1 
ATOM   2338 C CB  . ARG A 1  307 ? -16.691 -34.668 -48.022 1.00 25.32  ? 385  ARG A CB  1 
ATOM   2339 C CG  . ARG A 1  307 ? -17.422 -35.625 -47.106 1.00 24.40  ? 385  ARG A CG  1 
ATOM   2340 C CD  . ARG A 1  307 ? -18.304 -36.531 -47.940 1.00 26.02  ? 385  ARG A CD  1 
ATOM   2341 N NE  . ARG A 1  307 ? -19.116 -37.399 -47.103 1.00 30.61  ? 385  ARG A NE  1 
ATOM   2342 C CZ  . ARG A 1  307 ? -20.344 -37.126 -46.642 1.00 31.90  ? 385  ARG A CZ  1 
ATOM   2343 N NH1 . ARG A 1  307 ? -20.973 -35.974 -46.921 1.00 37.19  ? 385  ARG A NH1 1 
ATOM   2344 N NH2 . ARG A 1  307 ? -20.954 -38.033 -45.879 1.00 31.61  ? 385  ARG A NH2 1 
ATOM   2345 N N   . GLN A 1  308 ? -15.055 -32.157 -49.091 1.00 22.29  ? 386  GLN A N   1 
ATOM   2346 C CA  . GLN A 1  308 ? -14.239 -31.496 -50.134 1.00 24.68  ? 386  GLN A CA  1 
ATOM   2347 C C   . GLN A 1  308 ? -12.863 -31.042 -49.671 1.00 22.50  ? 386  GLN A C   1 
ATOM   2348 O O   . GLN A 1  308 ? -11.940 -30.992 -50.477 1.00 20.77  ? 386  GLN A O   1 
ATOM   2349 C CB  . GLN A 1  308 ? -14.933 -30.265 -50.697 1.00 28.21  ? 386  GLN A CB  1 
ATOM   2350 C CG  . GLN A 1  308 ? -16.009 -30.536 -51.707 1.00 34.21  ? 386  GLN A CG  1 
ATOM   2351 C CD  . GLN A 1  308 ? -16.682 -29.253 -52.173 1.00 48.58  ? 386  GLN A CD  1 
ATOM   2352 O OE1 . GLN A 1  308 ? -16.108 -28.160 -52.101 1.00 38.70  ? 386  GLN A OE1 1 
ATOM   2353 N NE2 . GLN A 1  308 ? -17.917 -29.381 -52.635 1.00 52.01  ? 386  GLN A NE2 1 
ATOM   2354 N N   . VAL A 1  309 ? -12.734 -30.725 -48.379 1.00 20.69  ? 387  VAL A N   1 
ATOM   2355 C CA  . VAL A 1  309 ? -11.462 -30.313 -47.788 1.00 19.00  ? 387  VAL A CA  1 
ATOM   2356 C C   . VAL A 1  309 ? -10.491 -31.482 -47.876 1.00 20.89  ? 387  VAL A C   1 
ATOM   2357 O O   . VAL A 1  309 ? -9.390  -31.354 -48.430 1.00 18.83  ? 387  VAL A O   1 
ATOM   2358 C CB  . VAL A 1  309 ? -11.637 -29.847 -46.336 1.00 20.70  ? 387  VAL A CB  1 
ATOM   2359 C CG1 . VAL A 1  309 ? -10.295 -29.511 -45.696 1.00 20.18  ? 387  VAL A CG1 1 
ATOM   2360 C CG2 . VAL A 1  309 ? -12.584 -28.646 -46.273 1.00 20.09  ? 387  VAL A CG2 1 
ATOM   2361 N N   . VAL A 1  310 ? -10.937 -32.636 -47.387 1.00 19.01  ? 388  VAL A N   1 
ATOM   2362 C CA  . VAL A 1  310 ? -10.133 -33.850 -47.423 1.00 20.93  ? 388  VAL A CA  1 
ATOM   2363 C C   . VAL A 1  310 ? -9.778  -34.232 -48.873 1.00 20.87  ? 388  VAL A C   1 
ATOM   2364 O O   . VAL A 1  310 ? -8.619  -34.567 -49.163 1.00 17.35  ? 388  VAL A O   1 
ATOM   2365 C CB  . VAL A 1  310 ? -10.855 -35.007 -46.682 1.00 22.29  ? 388  VAL A CB  1 
ATOM   2366 C CG1 . VAL A 1  310 ? -10.078 -36.299 -46.810 1.00 21.74  ? 388  VAL A CG1 1 
ATOM   2367 C CG2 . VAL A 1  310 ? -11.079 -34.630 -45.214 1.00 25.35  ? 388  VAL A CG2 1 
ATOM   2368 N N   . GLU A 1  311 ? -10.783 -34.186 -49.758 1.00 19.25  ? 389  GLU A N   1 
ATOM   2369 C CA  . GLU A 1  311 ? -10.612 -34.466 -51.171 1.00 19.49  ? 389  GLU A CA  1 
ATOM   2370 C C   . GLU A 1  311 ? -9.575  -33.540 -51.794 1.00 20.82  ? 389  GLU A C   1 
ATOM   2371 O O   . GLU A 1  311 ? -8.694  -33.986 -52.531 1.00 21.32  ? 389  GLU A O   1 
ATOM   2372 C CB  . GLU A 1  311 ? -11.950 -34.325 -51.924 1.00 20.66  ? 389  GLU A CB  1 
ATOM   2373 C CG  . GLU A 1  311 ? -11.798 -34.431 -53.441 1.00 25.02  ? 389  GLU A CG  1 
ATOM   2374 C CD  . GLU A 1  311 ? -13.102 -34.304 -54.216 1.00 27.89  ? 389  GLU A CD  1 
ATOM   2375 O OE1 . GLU A 1  311 ? -13.052 -34.418 -55.457 1.00 36.95  ? 389  GLU A OE1 1 
ATOM   2376 O OE2 . GLU A 1  311 ? -14.173 -34.109 -53.603 1.00 29.11  ? 389  GLU A OE2 1 
ATOM   2377 N N   . ASN A 1  312 ? -9.710  -32.238 -51.528 1.00 20.01  ? 390  ASN A N   1 
ATOM   2378 C CA  . ASN A 1  312 ? -8.784  -31.255 -52.070 1.00 18.99  ? 390  ASN A CA  1 
ATOM   2379 C C   . ASN A 1  312 ? -7.364  -31.385 -51.519 1.00 18.01  ? 390  ASN A C   1 
ATOM   2380 O O   . ASN A 1  312 ? -6.404  -31.180 -52.247 1.00 19.08  ? 390  ASN A O   1 
ATOM   2381 C CB  . ASN A 1  312 ? -9.324  -29.820 -51.876 1.00 21.00  ? 390  ASN A CB  1 
ATOM   2382 C CG  . ASN A 1  312 ? -10.523 -29.533 -52.762 1.00 23.07  ? 390  ASN A CG  1 
ATOM   2383 O OD1 . ASN A 1  312 ? -10.971 -30.402 -53.524 1.00 23.37  ? 390  ASN A OD1 1 
ATOM   2384 N ND2 . ASN A 1  312 ? -11.056 -28.324 -52.661 1.00 25.97  ? 390  ASN A ND2 1 
ATOM   2385 N N   . MET A 1  313 ? -7.223  -31.694 -50.236 1.00 17.58  ? 391  MET A N   1 
ATOM   2386 C CA  . MET A 1  313 ? -5.887  -31.975 -49.660 1.00 17.91  ? 391  MET A CA  1 
ATOM   2387 C C   . MET A 1  313 ? -5.269  -33.203 -50.317 1.00 19.04  ? 391  MET A C   1 
ATOM   2388 O O   . MET A 1  313 ? -4.103  -33.200 -50.729 1.00 21.05  ? 391  MET A O   1 
ATOM   2389 C CB  . MET A 1  313 ? -5.983  -32.192 -48.135 1.00 14.88  ? 391  MET A CB  1 
ATOM   2390 C CG  . MET A 1  313 ? -6.312  -30.916 -47.402 1.00 17.52  ? 391  MET A CG  1 
ATOM   2391 S SD  . MET A 1  313 ? -4.883  -29.831 -47.244 1.00 17.83  ? 391  MET A SD  1 
ATOM   2392 C CE  . MET A 1  313 ? -3.956  -30.645 -45.943 1.00 15.50  ? 391  MET A CE  1 
ATOM   2393 N N   . THR A 1  314 ? -6.074  -34.245 -50.436 1.00 17.88  ? 392  THR A N   1 
ATOM   2394 C CA  . THR A 1  314 ? -5.592  -35.523 -50.954 1.00 18.35  ? 392  THR A CA  1 
ATOM   2395 C C   . THR A 1  314 ? -5.146  -35.392 -52.419 1.00 20.21  ? 392  THR A C   1 
ATOM   2396 O O   . THR A 1  314 ? -4.036  -35.801 -52.783 1.00 20.64  ? 392  THR A O   1 
ATOM   2397 C CB  . THR A 1  314 ? -6.666  -36.594 -50.755 1.00 17.49  ? 392  THR A CB  1 
ATOM   2398 O OG1 . THR A 1  314 ? -6.920  -36.745 -49.341 1.00 19.46  ? 392  THR A OG1 1 
ATOM   2399 C CG2 . THR A 1  314 ? -6.248  -37.913 -51.325 1.00 19.63  ? 392  THR A CG2 1 
ATOM   2400 N N   . ARG A 1  315 ? -5.985  -34.781 -53.241 1.00 20.56  ? 393  ARG A N   1 
ATOM   2401 C CA  . ARG A 1  315 ? -5.688  -34.619 -54.661 1.00 25.07  ? 393  ARG A CA  1 
ATOM   2402 C C   . ARG A 1  315 ? -4.383  -33.838 -54.884 1.00 25.91  ? 393  ARG A C   1 
ATOM   2403 O O   . ARG A 1  315 ? -3.688  -34.077 -55.869 1.00 23.14  ? 393  ARG A O   1 
ATOM   2404 C CB  . ARG A 1  315 ? -6.875  -33.932 -55.362 1.00 30.10  ? 393  ARG A CB  1 
ATOM   2405 C CG  . ARG A 1  315 ? -6.644  -33.472 -56.788 1.00 45.37  ? 393  ARG A CG  1 
ATOM   2406 C CD  . ARG A 1  315 ? -7.941  -32.951 -57.389 1.00 58.37  ? 393  ARG A CD  1 
ATOM   2407 N NE  . ARG A 1  315 ? -8.331  -31.665 -56.811 1.00 60.34  ? 393  ARG A NE  1 
ATOM   2408 C CZ  . ARG A 1  315 ? -9.564  -31.298 -56.435 1.00 69.88  ? 393  ARG A CZ  1 
ATOM   2409 N NH1 . ARG A 1  315 ? -10.612 -32.124 -56.515 1.00 69.14  ? 393  ARG A NH1 1 
ATOM   2410 N NH2 . ARG A 1  315 ? -9.750  -30.072 -55.941 1.00 65.27  ? 393  ARG A NH2 1 
ATOM   2411 N N   . ALA A 1  316 ? -4.080  -32.896 -53.987 1.00 22.98  ? 394  ALA A N   1 
ATOM   2412 C CA  . ALA A 1  316 ? -2.849  -32.075 -54.068 1.00 24.40  ? 394  ALA A CA  1 
ATOM   2413 C C   . ALA A 1  316 ? -1.713  -32.598 -53.162 1.00 21.89  ? 394  ALA A C   1 
ATOM   2414 O O   . ALA A 1  316 ? -0.739  -31.900 -52.932 1.00 19.08  ? 394  ALA A O   1 
ATOM   2415 C CB  . ALA A 1  316 ? -3.175  -30.621 -53.745 1.00 23.31  ? 394  ALA A CB  1 
ATOM   2416 N N   . HIS A 1  317 ? -1.837  -33.836 -52.685 1.00 20.86  ? 395  HIS A N   1 
ATOM   2417 C CA  . HIS A 1  317 ? -0.758  -34.530 -51.978 1.00 22.18  ? 395  HIS A CA  1 
ATOM   2418 C C   . HIS A 1  317 ? -0.338  -33.847 -50.679 1.00 19.89  ? 395  HIS A C   1 
ATOM   2419 O O   . HIS A 1  317 ? 0.841   -33.844 -50.334 1.00 20.70  ? 395  HIS A O   1 
ATOM   2420 C CB  . HIS A 1  317 ? 0.472   -34.706 -52.887 1.00 25.32  ? 395  HIS A CB  1 
ATOM   2421 C CG  . HIS A 1  317 ? 0.151   -35.176 -54.263 1.00 29.59  ? 395  HIS A CG  1 
ATOM   2422 N ND1 . HIS A 1  317 ? -0.184  -36.481 -54.548 1.00 31.63  ? 395  HIS A ND1 1 
ATOM   2423 C CD2 . HIS A 1  317 ? 0.087   -34.503 -55.439 1.00 36.84  ? 395  HIS A CD2 1 
ATOM   2424 C CE1 . HIS A 1  317 ? -0.420  -36.600 -55.843 1.00 30.56  ? 395  HIS A CE1 1 
ATOM   2425 N NE2 . HIS A 1  317 ? -0.267  -35.414 -56.404 1.00 35.90  ? 395  HIS A NE2 1 
ATOM   2426 N N   . PHE A 1  318 ? -1.306  -33.286 -49.960 1.00 17.18  ? 396  PHE A N   1 
ATOM   2427 C CA  . PHE A 1  318 ? -1.064  -32.666 -48.652 1.00 19.00  ? 396  PHE A CA  1 
ATOM   2428 C C   . PHE A 1  318 ? -1.502  -33.633 -47.566 1.00 19.02  ? 396  PHE A C   1 
ATOM   2429 O O   . PHE A 1  318 ? -2.685  -34.029 -47.532 1.00 17.17  ? 396  PHE A O   1 
ATOM   2430 C CB  . PHE A 1  318 ? -1.870  -31.388 -48.503 1.00 17.87  ? 396  PHE A CB  1 
ATOM   2431 C CG  . PHE A 1  318 ? -1.370  -30.246 -49.348 1.00 19.19  ? 396  PHE A CG  1 
ATOM   2432 C CD1 . PHE A 1  318 ? -0.136  -29.651 -49.074 1.00 20.35  ? 396  PHE A CD1 1 
ATOM   2433 C CD2 . PHE A 1  318 ? -2.130  -29.746 -50.388 1.00 22.50  ? 396  PHE A CD2 1 
ATOM   2434 C CE1 . PHE A 1  318 ? 0.327   -28.577 -49.826 1.00 24.18  ? 396  PHE A CE1 1 
ATOM   2435 C CE2 . PHE A 1  318 ? -1.677  -28.671 -51.135 1.00 21.51  ? 396  PHE A CE2 1 
ATOM   2436 C CZ  . PHE A 1  318 ? -0.442  -28.091 -50.864 1.00 20.20  ? 396  PHE A CZ  1 
ATOM   2437 N N   . PRO A 1  319 ? -0.570  -34.024 -46.673 1.00 17.06  ? 397  PRO A N   1 
ATOM   2438 C CA  . PRO A 1  319 ? -0.939  -34.838 -45.518 1.00 17.32  ? 397  PRO A CA  1 
ATOM   2439 C C   . PRO A 1  319 ? -2.012  -34.178 -44.660 1.00 17.64  ? 397  PRO A C   1 
ATOM   2440 O O   . PRO A 1  319 ? -2.004  -32.955 -44.485 1.00 18.07  ? 397  PRO A O   1 
ATOM   2441 C CB  . PRO A 1  319 ? 0.374   -34.948 -44.732 1.00 19.63  ? 397  PRO A CB  1 
ATOM   2442 C CG  . PRO A 1  319 ? 1.436   -34.817 -45.781 1.00 21.18  ? 397  PRO A CG  1 
ATOM   2443 C CD  . PRO A 1  319 ? 0.883   -33.807 -46.740 1.00 20.61  ? 397  PRO A CD  1 
ATOM   2444 N N   . LEU A 1  320 ? -2.922  -34.987 -44.147 1.00 15.97  ? 398  LEU A N   1 
ATOM   2445 C CA  . LEU A 1  320 ? -3.978  -34.520 -43.243 1.00 16.59  ? 398  LEU A CA  1 
ATOM   2446 C C   . LEU A 1  320 ? -4.403  -35.701 -42.402 1.00 17.49  ? 398  LEU A C   1 
ATOM   2447 O O   . LEU A 1  320 ? -4.942  -36.661 -42.945 1.00 18.42  ? 398  LEU A O   1 
ATOM   2448 C CB  . LEU A 1  320 ? -5.188  -33.990 -44.026 1.00 18.07  ? 398  LEU A CB  1 
ATOM   2449 C CG  . LEU A 1  320 ? -6.374  -33.522 -43.163 1.00 17.05  ? 398  LEU A CG  1 
ATOM   2450 C CD1 . LEU A 1  320 ? -5.985  -32.333 -42.307 1.00 20.69  ? 398  LEU A CD1 1 
ATOM   2451 C CD2 . LEU A 1  320 ? -7.526  -33.177 -44.059 1.00 20.62  ? 398  LEU A CD2 1 
ATOM   2452 N N   . ASP A 1  321 ? -4.139  -35.644 -41.094 1.00 17.27  ? 399  ASP A N   1 
ATOM   2453 C CA  . ASP A 1  321 ? -4.584  -36.690 -40.192 1.00 16.21  ? 399  ASP A CA  1 
ATOM   2454 C C   . ASP A 1  321 ? -5.978  -36.482 -39.625 1.00 17.29  ? 399  ASP A C   1 
ATOM   2455 O O   . ASP A 1  321 ? -6.697  -37.465 -39.419 1.00 15.80  ? 399  ASP A O   1 
ATOM   2456 C CB  . ASP A 1  321 ? -3.579  -36.899 -39.040 1.00 15.89  ? 399  ASP A CB  1 
ATOM   2457 C CG  . ASP A 1  321 ? -2.625  -38.007 -39.325 1.00 16.97  ? 399  ASP A CG  1 
ATOM   2458 O OD1 . ASP A 1  321 ? -1.672  -37.769 -40.089 1.00 18.32  ? 399  ASP A OD1 1 
ATOM   2459 O OD2 . ASP A 1  321 ? -2.842  -39.151 -38.852 1.00 16.44  ? 399  ASP A OD2 1 
ATOM   2460 N N   . VAL A 1  322 ? -6.370  -35.223 -39.383 1.00 13.00  ? 400  VAL A N   1 
ATOM   2461 C CA  . VAL A 1  322 ? -7.567  -34.935 -38.603 1.00 13.75  ? 400  VAL A CA  1 
ATOM   2462 C C   . VAL A 1  322 ? -8.339  -33.786 -39.219 1.00 14.67  ? 400  VAL A C   1 
ATOM   2463 O O   . VAL A 1  322 ? -7.823  -32.669 -39.305 1.00 15.41  ? 400  VAL A O   1 
ATOM   2464 C CB  . VAL A 1  322 ? -7.237  -34.579 -37.143 1.00 14.86  ? 400  VAL A CB  1 
ATOM   2465 C CG1 . VAL A 1  322 ? -8.471  -34.703 -36.266 1.00 16.63  ? 400  VAL A CG1 1 
ATOM   2466 C CG2 . VAL A 1  322 ? -6.113  -35.439 -36.567 1.00 15.22  ? 400  VAL A CG2 1 
ATOM   2467 N N   . GLN A 1  323 ? -9.557  -34.077 -39.671 1.00 15.00  ? 401  GLN A N   1 
ATOM   2468 C CA  . GLN A 1  323 ? -10.513 -33.066 -40.116 1.00 16.59  ? 401  GLN A CA  1 
ATOM   2469 C C   . GLN A 1  323 ? -11.310 -32.580 -38.922 1.00 17.06  ? 401  GLN A C   1 
ATOM   2470 O O   . GLN A 1  323 ? -11.772 -33.378 -38.110 1.00 15.49  ? 401  GLN A O   1 
ATOM   2471 C CB  . GLN A 1  323 ? -11.487 -33.658 -41.133 1.00 18.94  ? 401  GLN A CB  1 
ATOM   2472 C CG  . GLN A 1  323 ? -12.451 -32.665 -41.754 1.00 18.57  ? 401  GLN A CG  1 
ATOM   2473 C CD  . GLN A 1  323 ? -11.729 -31.507 -42.395 1.00 16.70  ? 401  GLN A CD  1 
ATOM   2474 O OE1 . GLN A 1  323 ? -10.834 -31.699 -43.226 1.00 22.37  ? 401  GLN A OE1 1 
ATOM   2475 N NE2 . GLN A 1  323 ? -12.080 -30.296 -41.989 1.00 20.22  ? 401  GLN A NE2 1 
ATOM   2476 N N   . TRP A 1  324 ? -11.467 -31.263 -38.824 1.00 15.57  ? 402  TRP A N   1 
ATOM   2477 C CA  . TRP A 1  324 ? -12.232 -30.639 -37.778 1.00 15.07  ? 402  TRP A CA  1 
ATOM   2478 C C   . TRP A 1  324 ? -13.468 -29.910 -38.307 1.00 16.05  ? 402  TRP A C   1 
ATOM   2479 O O   . TRP A 1  324 ? -13.501 -29.456 -39.458 1.00 15.44  ? 402  TRP A O   1 
ATOM   2480 C CB  . TRP A 1  324 ? -11.389 -29.593 -37.061 1.00 17.56  ? 402  TRP A CB  1 
ATOM   2481 C CG  . TRP A 1  324 ? -10.224 -30.091 -36.299 1.00 16.33  ? 402  TRP A CG  1 
ATOM   2482 C CD1 . TRP A 1  324 ? -9.352  -31.044 -36.690 1.00 16.19  ? 402  TRP A CD1 1 
ATOM   2483 C CD2 . TRP A 1  324 ? -9.753  -29.620 -35.029 1.00 16.41  ? 402  TRP A CD2 1 
ATOM   2484 N NE1 . TRP A 1  324 ? -8.407  -31.239 -35.743 1.00 17.24  ? 402  TRP A NE1 1 
ATOM   2485 C CE2 . TRP A 1  324 ? -8.597  -30.369 -34.715 1.00 17.80  ? 402  TRP A CE2 1 
ATOM   2486 C CE3 . TRP A 1  324 ? -10.204 -28.665 -34.117 1.00 15.45  ? 402  TRP A CE3 1 
ATOM   2487 C CZ2 . TRP A 1  324 ? -7.876  -30.189 -33.518 1.00 16.04  ? 402  TRP A CZ2 1 
ATOM   2488 C CZ3 . TRP A 1  324 ? -9.493  -28.480 -32.947 1.00 13.52  ? 402  TRP A CZ3 1 
ATOM   2489 C CH2 . TRP A 1  324 ? -8.342  -29.231 -32.656 1.00 14.75  ? 402  TRP A CH2 1 
ATOM   2490 N N   . ASN A 1  325 ? -14.486 -29.794 -37.447 1.00 15.81  ? 403  ASN A N   1 
ATOM   2491 C CA  . ASN A 1  325 ? -15.482 -28.728 -37.591 1.00 15.37  ? 403  ASN A CA  1 
ATOM   2492 C C   . ASN A 1  325 ? -15.575 -27.840 -36.358 1.00 17.08  ? 403  ASN A C   1 
ATOM   2493 O O   . ASN A 1  325 ? -15.340 -28.260 -35.215 1.00 17.33  ? 403  ASN A O   1 
ATOM   2494 C CB  . ASN A 1  325 ? -16.873 -29.245 -37.937 1.00 16.57  ? 403  ASN A CB  1 
ATOM   2495 C CG  . ASN A 1  325 ? -16.956 -29.801 -39.346 1.00 18.35  ? 403  ASN A CG  1 
ATOM   2496 O OD1 . ASN A 1  325 ? -16.983 -29.042 -40.345 1.00 21.25  ? 403  ASN A OD1 1 
ATOM   2497 N ND2 . ASN A 1  325 ? -17.013 -31.120 -39.448 1.00 15.45  ? 403  ASN A ND2 1 
ATOM   2498 N N   . ASP A 1  326 ? -15.936 -26.602 -36.649 1.00 15.69  ? 404  ASP A N   1 
ATOM   2499 C CA  . ASP A 1  326 ? -16.297 -25.590 -35.690 1.00 17.32  ? 404  ASP A CA  1 
ATOM   2500 C C   . ASP A 1  326 ? -17.828 -25.674 -35.455 1.00 17.84  ? 404  ASP A C   1 
ATOM   2501 O O   . ASP A 1  326 ? -18.440 -26.706 -35.706 1.00 17.17  ? 404  ASP A O   1 
ATOM   2502 C CB  . ASP A 1  326 ? -15.873 -24.232 -36.294 1.00 17.98  ? 404  ASP A CB  1 
ATOM   2503 C CG  . ASP A 1  326 ? -15.606 -23.157 -35.246 1.00 19.09  ? 404  ASP A CG  1 
ATOM   2504 O OD1 . ASP A 1  326 ? -16.384 -23.050 -34.277 1.00 17.39  ? 404  ASP A OD1 1 
ATOM   2505 O OD2 . ASP A 1  326 ? -14.640 -22.391 -35.422 1.00 18.65  ? 404  ASP A OD2 1 
ATOM   2506 N N   . LEU A 1  327 ? -18.441 -24.580 -35.008 1.00 17.99  ? 405  LEU A N   1 
ATOM   2507 C CA  . LEU A 1  327 ? -19.857 -24.535 -34.630 1.00 19.45  ? 405  LEU A CA  1 
ATOM   2508 C C   . LEU A 1  327 ? -20.828 -25.006 -35.715 1.00 17.52  ? 405  LEU A C   1 
ATOM   2509 O O   . LEU A 1  327 ? -21.970 -25.376 -35.410 1.00 17.54  ? 405  LEU A O   1 
ATOM   2510 C CB  . LEU A 1  327 ? -20.250 -23.093 -34.234 1.00 18.64  ? 405  LEU A CB  1 
ATOM   2511 C CG  . LEU A 1  327 ? -19.603 -22.494 -32.983 1.00 19.85  ? 405  LEU A CG  1 
ATOM   2512 C CD1 . LEU A 1  327 ? -19.911 -21.014 -32.888 1.00 20.54  ? 405  LEU A CD1 1 
ATOM   2513 C CD2 . LEU A 1  327 ? -20.033 -23.231 -31.719 1.00 21.26  ? 405  LEU A CD2 1 
ATOM   2514 N N   . ASP A 1  328 ? -20.374 -24.981 -36.966 1.00 16.64  ? 406  ASP A N   1 
ATOM   2515 C CA  . ASP A 1  328 ? -21.184 -25.359 -38.116 1.00 18.63  ? 406  ASP A CA  1 
ATOM   2516 C C   . ASP A 1  328 ? -21.979 -26.632 -37.933 1.00 18.57  ? 406  ASP A C   1 
ATOM   2517 O O   . ASP A 1  328 ? -23.112 -26.699 -38.401 1.00 19.58  ? 406  ASP A O   1 
ATOM   2518 C CB  . ASP A 1  328 ? -20.302 -25.538 -39.342 1.00 21.10  ? 406  ASP A CB  1 
ATOM   2519 C CG  . ASP A 1  328 ? -19.523 -24.291 -39.673 1.00 21.54  ? 406  ASP A CG  1 
ATOM   2520 O OD1 . ASP A 1  328 ? -20.009 -23.495 -40.490 1.00 24.27  ? 406  ASP A OD1 1 
ATOM   2521 O OD2 . ASP A 1  328 ? -18.430 -24.115 -39.095 1.00 17.24  ? 406  ASP A OD2 1 
ATOM   2522 N N   . TYR A 1  329 ? -21.394 -27.640 -37.269 1.00 17.97  ? 407  TYR A N   1 
ATOM   2523 C CA  . TYR A 1  329 ? -22.038 -28.972 -37.172 1.00 18.75  ? 407  TYR A CA  1 
ATOM   2524 C C   . TYR A 1  329 ? -23.301 -28.999 -36.325 1.00 19.25  ? 407  TYR A C   1 
ATOM   2525 O O   . TYR A 1  329 ? -24.180 -29.821 -36.558 1.00 19.30  ? 407  TYR A O   1 
ATOM   2526 C CB  . TYR A 1  329 ? -21.063 -30.057 -36.685 1.00 18.32  ? 407  TYR A CB  1 
ATOM   2527 C CG  . TYR A 1  329 ? -20.787 -30.089 -35.202 1.00 17.67  ? 407  TYR A CG  1 
ATOM   2528 C CD1 . TYR A 1  329 ? -21.634 -30.761 -34.318 1.00 21.56  ? 407  TYR A CD1 1 
ATOM   2529 C CD2 . TYR A 1  329 ? -19.668 -29.452 -34.679 1.00 18.01  ? 407  TYR A CD2 1 
ATOM   2530 C CE1 . TYR A 1  329 ? -21.377 -30.780 -32.957 1.00 16.61  ? 407  TYR A CE1 1 
ATOM   2531 C CE2 . TYR A 1  329 ? -19.401 -29.466 -33.328 1.00 17.94  ? 407  TYR A CE2 1 
ATOM   2532 C CZ  . TYR A 1  329 ? -20.251 -30.145 -32.474 1.00 17.51  ? 407  TYR A CZ  1 
ATOM   2533 O OH  . TYR A 1  329 ? -19.965 -30.157 -31.140 1.00 14.91  ? 407  TYR A OH  1 
ATOM   2534 N N   . MET A 1  330 ? -23.369 -28.108 -35.347 1.00 20.34  ? 408  MET A N   1 
ATOM   2535 C CA  . MET A 1  330 ? -24.402 -28.167 -34.304 1.00 23.15  ? 408  MET A CA  1 
ATOM   2536 C C   . MET A 1  330 ? -25.784 -27.796 -34.820 1.00 22.73  ? 408  MET A C   1 
ATOM   2537 O O   . MET A 1  330 ? -25.908 -27.179 -35.884 1.00 22.60  ? 408  MET A O   1 
ATOM   2538 C CB  . MET A 1  330 ? -24.046 -27.234 -33.168 1.00 19.59  ? 408  MET A CB  1 
ATOM   2539 C CG  . MET A 1  330 ? -22.802 -27.637 -32.387 1.00 20.75  ? 408  MET A CG  1 
ATOM   2540 S SD  . MET A 1  330 ? -22.300 -26.291 -31.305 1.00 20.35  ? 408  MET A SD  1 
ATOM   2541 C CE  . MET A 1  330 ? -20.849 -26.941 -30.469 1.00 17.69  ? 408  MET A CE  1 
ATOM   2542 N N   . ASP A 1  331 ? -26.811 -28.184 -34.060 1.00 20.37  ? 409  ASP A N   1 
ATOM   2543 C CA  . ASP A 1  331 ? -28.176 -27.710 -34.278 1.00 20.04  ? 409  ASP A CA  1 
ATOM   2544 C C   . ASP A 1  331 ? -28.348 -26.439 -33.446 1.00 21.07  ? 409  ASP A C   1 
ATOM   2545 O O   . ASP A 1  331 ? -28.374 -26.489 -32.193 1.00 19.16  ? 409  ASP A O   1 
ATOM   2546 C CB  . ASP A 1  331 ? -29.212 -28.772 -33.910 1.00 22.19  ? 409  ASP A CB  1 
ATOM   2547 C CG  . ASP A 1  331 ? -30.659 -28.297 -34.151 1.00 26.72  ? 409  ASP A CG  1 
ATOM   2548 O OD1 . ASP A 1  331 ? -31.445 -29.021 -34.768 1.00 50.95  ? 409  ASP A OD1 1 
ATOM   2549 O OD2 . ASP A 1  331 ? -31.035 -27.205 -33.712 1.00 32.28  ? 409  ASP A OD2 1 
ATOM   2550 N N   . SER A 1  332 ? -28.402 -25.304 -34.144 1.00 18.97  ? 410  SER A N   1 
ATOM   2551 C CA  . SER A 1  332 ? -28.533 -23.976 -33.523 1.00 22.22  ? 410  SER A CA  1 
ATOM   2552 C C   . SER A 1  332 ? -27.460 -23.673 -32.470 1.00 21.92  ? 410  SER A C   1 
ATOM   2553 O O   . SER A 1  332 ? -27.769 -23.156 -31.386 1.00 21.61  ? 410  SER A O   1 
ATOM   2554 C CB  . SER A 1  332 ? -29.939 -23.802 -32.913 1.00 28.44  ? 410  SER A CB  1 
ATOM   2555 O OG  . SER A 1  332 ? -30.946 -24.115 -33.864 1.00 32.98  ? 410  SER A OG  1 
ATOM   2556 N N   . ARG A 1  333 ? -26.213 -24.020 -32.814 1.00 19.49  ? 411  ARG A N   1 
ATOM   2557 C CA  A ARG A 1  333 ? -25.018 -23.758 -32.015 0.50 19.44  ? 411  ARG A CA  1 
ATOM   2558 C CA  B ARG A 1  333 ? -25.047 -23.705 -31.996 0.50 20.17  ? 411  ARG A CA  1 
ATOM   2559 C C   . ARG A 1  333 ? -25.054 -24.389 -30.613 1.00 20.04  ? 411  ARG A C   1 
ATOM   2560 O O   . ARG A 1  333 ? -24.459 -23.885 -29.677 1.00 17.99  ? 411  ARG A O   1 
ATOM   2561 C CB  A ARG A 1  333 ? -24.691 -22.244 -32.003 0.50 21.27  ? 411  ARG A CB  1 
ATOM   2562 C CB  B ARG A 1  333 ? -24.876 -22.164 -31.886 0.50 23.02  ? 411  ARG A CB  1 
ATOM   2563 C CG  A ARG A 1  333 ? -24.244 -21.732 -33.384 0.50 20.38  ? 411  ARG A CG  1 
ATOM   2564 C CG  B ARG A 1  333 ? -24.828 -21.462 -33.257 0.50 25.26  ? 411  ARG A CG  1 
ATOM   2565 C CD  A ARG A 1  333 ? -24.207 -20.206 -33.500 0.50 22.43  ? 411  ARG A CD  1 
ATOM   2566 C CD  B ARG A 1  333 ? -25.120 -19.962 -33.219 0.50 27.94  ? 411  ARG A CD  1 
ATOM   2567 N NE  A ARG A 1  333 ? -23.836 -19.753 -34.849 0.50 25.03  ? 411  ARG A NE  1 
ATOM   2568 N NE  B ARG A 1  333 ? -26.457 -19.637 -32.716 0.50 31.29  ? 411  ARG A NE  1 
ATOM   2569 C CZ  A ARG A 1  333 ? -23.855 -18.480 -35.245 0.50 28.26  ? 411  ARG A CZ  1 
ATOM   2570 C CZ  B ARG A 1  333 ? -27.581 -19.874 -33.375 0.50 32.92  ? 411  ARG A CZ  1 
ATOM   2571 N NH1 A ARG A 1  333 ? -24.227 -17.531 -34.403 0.50 31.68  ? 411  ARG A NH1 1 
ATOM   2572 N NH1 B ARG A 1  333 ? -27.536 -20.444 -34.568 0.50 37.96  ? 411  ARG A NH1 1 
ATOM   2573 N NH2 A ARG A 1  333 ? -23.504 -18.152 -36.480 0.50 27.63  ? 411  ARG A NH2 1 
ATOM   2574 N NH2 B ARG A 1  333 ? -28.747 -19.538 -32.844 0.50 34.82  ? 411  ARG A NH2 1 
ATOM   2575 N N   . ARG A 1  334 ? -25.702 -25.561 -30.506 1.00 20.57  ? 412  ARG A N   1 
ATOM   2576 C CA  . ARG A 1  334 ? -25.797 -26.315 -29.241 1.00 19.75  ? 412  ARG A CA  1 
ATOM   2577 C C   . ARG A 1  334 ? -24.937 -27.575 -29.205 1.00 18.58  ? 412  ARG A C   1 
ATOM   2578 O O   . ARG A 1  334 ? -24.979 -28.376 -30.138 1.00 15.73  ? 412  ARG A O   1 
ATOM   2579 C CB  . ARG A 1  334 ? -27.237 -26.714 -28.981 1.00 19.63  ? 412  ARG A CB  1 
ATOM   2580 C CG  . ARG A 1  334 ? -28.132 -25.513 -28.759 1.00 22.47  ? 412  ARG A CG  1 
ATOM   2581 C CD  . ARG A 1  334 ? -29.557 -25.952 -28.527 1.00 21.78  ? 412  ARG A CD  1 
ATOM   2582 N NE  . ARG A 1  334 ? -30.143 -26.601 -29.695 1.00 25.54  ? 412  ARG A NE  1 
ATOM   2583 C CZ  . ARG A 1  334 ? -31.298 -27.271 -29.677 1.00 26.64  ? 412  ARG A CZ  1 
ATOM   2584 N NH1 . ARG A 1  334 ? -32.023 -27.364 -28.559 1.00 27.25  ? 412  ARG A NH1 1 
ATOM   2585 N NH2 . ARG A 1  334 ? -31.757 -27.821 -30.787 1.00 29.66  ? 412  ARG A NH2 1 
ATOM   2586 N N   . ASP A 1  335 ? -24.189 -27.745 -28.103 1.00 17.65  ? 413  ASP A N   1 
ATOM   2587 C CA  . ASP A 1  335 ? -23.430 -28.960 -27.824 1.00 17.67  ? 413  ASP A CA  1 
ATOM   2588 C C   . ASP A 1  335 ? -24.287 -30.214 -27.959 1.00 16.97  ? 413  ASP A C   1 
ATOM   2589 O O   . ASP A 1  335 ? -25.473 -30.202 -27.624 1.00 16.52  ? 413  ASP A O   1 
ATOM   2590 C CB  . ASP A 1  335 ? -22.927 -28.978 -26.383 1.00 19.25  ? 413  ASP A CB  1 
ATOM   2591 C CG  . ASP A 1  335 ? -21.733 -28.097 -26.123 1.00 20.30  ? 413  ASP A CG  1 
ATOM   2592 O OD1 . ASP A 1  335 ? -21.018 -27.649 -27.047 1.00 18.92  ? 413  ASP A OD1 1 
ATOM   2593 O OD2 . ASP A 1  335 ? -21.522 -27.869 -24.915 1.00 17.36  ? 413  ASP A OD2 1 
ATOM   2594 N N   . PHE A 1  336 ? -23.643 -31.302 -28.384 1.00 16.90  ? 414  PHE A N   1 
ATOM   2595 C CA  . PHE A 1  336 ? -24.236 -32.647 -28.419 1.00 16.85  ? 414  PHE A CA  1 
ATOM   2596 C C   . PHE A 1  336 ? -25.470 -32.727 -29.323 1.00 17.71  ? 414  PHE A C   1 
ATOM   2597 O O   . PHE A 1  336 ? -26.387 -33.477 -29.034 1.00 16.12  ? 414  PHE A O   1 
ATOM   2598 C CB  . PHE A 1  336 ? -24.558 -33.166 -26.992 1.00 17.40  ? 414  PHE A CB  1 
ATOM   2599 C CG  . PHE A 1  336 ? -23.463 -32.900 -25.993 1.00 16.68  ? 414  PHE A CG  1 
ATOM   2600 C CD1 . PHE A 1  336 ? -22.208 -33.488 -26.148 1.00 17.22  ? 414  PHE A CD1 1 
ATOM   2601 C CD2 . PHE A 1  336 ? -23.662 -32.034 -24.931 1.00 18.20  ? 414  PHE A CD2 1 
ATOM   2602 C CE1 . PHE A 1  336 ? -21.184 -33.226 -25.246 1.00 18.30  ? 414  PHE A CE1 1 
ATOM   2603 C CE2 . PHE A 1  336 ? -22.640 -31.773 -24.010 1.00 16.73  ? 414  PHE A CE2 1 
ATOM   2604 C CZ  . PHE A 1  336 ? -21.395 -32.359 -24.179 1.00 17.52  ? 414  PHE A CZ  1 
ATOM   2605 N N   . THR A 1  337 ? -25.480 -31.926 -30.390 1.00 16.49  ? 415  THR A N   1 
ATOM   2606 C CA  . THR A 1  337 ? -26.477 -31.993 -31.452 1.00 17.89  ? 415  THR A CA  1 
ATOM   2607 C C   . THR A 1  337 ? -25.733 -31.917 -32.777 1.00 18.76  ? 415  THR A C   1 
ATOM   2608 O O   . THR A 1  337 ? -24.554 -31.571 -32.832 1.00 18.46  ? 415  THR A O   1 
ATOM   2609 C CB  . THR A 1  337 ? -27.507 -30.830 -31.406 1.00 18.77  ? 415  THR A CB  1 
ATOM   2610 O OG1 . THR A 1  337 ? -26.870 -29.551 -31.645 1.00 16.02  ? 415  THR A OG1 1 
ATOM   2611 C CG2 . THR A 1  337 ? -28.231 -30.789 -30.074 1.00 19.76  ? 415  THR A CG2 1 
ATOM   2612 N N   . PHE A 1  338 ? -26.438 -32.253 -33.843 1.00 18.73  ? 416  PHE A N   1 
ATOM   2613 C CA  . PHE A 1  338 ? -26.010 -31.882 -35.166 1.00 20.47  ? 416  PHE A CA  1 
ATOM   2614 C C   . PHE A 1  338 ? -27.219 -31.487 -36.022 1.00 21.69  ? 416  PHE A C   1 
ATOM   2615 O O   . PHE A 1  338 ? -28.256 -32.137 -35.945 1.00 19.17  ? 416  PHE A O   1 
ATOM   2616 C CB  . PHE A 1  338 ? -25.122 -32.972 -35.812 1.00 18.84  ? 416  PHE A CB  1 
ATOM   2617 C CG  . PHE A 1  338 ? -25.786 -34.316 -36.015 1.00 21.07  ? 416  PHE A CG  1 
ATOM   2618 C CD1 . PHE A 1  338 ? -25.715 -35.307 -35.041 1.00 22.04  ? 416  PHE A CD1 1 
ATOM   2619 C CD2 . PHE A 1  338 ? -26.399 -34.630 -37.229 1.00 20.22  ? 416  PHE A CD2 1 
ATOM   2620 C CE1 . PHE A 1  338 ? -26.289 -36.567 -35.240 1.00 21.74  ? 416  PHE A CE1 1 
ATOM   2621 C CE2 . PHE A 1  338 ? -26.975 -35.881 -37.443 1.00 21.89  ? 416  PHE A CE2 1 
ATOM   2622 C CZ  . PHE A 1  338 ? -26.916 -36.859 -36.449 1.00 21.67  ? 416  PHE A CZ  1 
ATOM   2623 N N   . ASN A 1  339 ? -27.091 -30.417 -36.818 1.00 20.79  ? 417  ASN A N   1 
ATOM   2624 C CA  . ASN A 1  339 ? -28.212 -29.960 -37.643 1.00 24.08  ? 417  ASN A CA  1 
ATOM   2625 C C   . ASN A 1  339 ? -28.573 -30.987 -38.718 1.00 26.76  ? 417  ASN A C   1 
ATOM   2626 O O   . ASN A 1  339 ? -27.720 -31.782 -39.139 1.00 25.90  ? 417  ASN A O   1 
ATOM   2627 C CB  . ASN A 1  339 ? -27.973 -28.561 -38.219 1.00 23.50  ? 417  ASN A CB  1 
ATOM   2628 C CG  . ASN A 1  339 ? -26.909 -28.528 -39.301 1.00 24.64  ? 417  ASN A CG  1 
ATOM   2629 O OD1 . ASN A 1  339 ? -27.132 -29.003 -40.413 1.00 28.34  ? 417  ASN A OD1 1 
ATOM   2630 N ND2 . ASN A 1  339 ? -25.744 -27.976 -38.978 1.00 22.92  ? 417  ASN A ND2 1 
ATOM   2631 N N   . LYS A 1  340 ? -29.837 -30.968 -39.144 1.00 31.95  ? 418  LYS A N   1 
ATOM   2632 C CA  . LYS A 1  340 ? -30.351 -31.967 -40.084 1.00 33.77  ? 418  LYS A CA  1 
ATOM   2633 C C   . LYS A 1  340 ? -30.490 -31.402 -41.502 1.00 40.45  ? 418  LYS A C   1 
ATOM   2634 O O   . LYS A 1  340 ? -31.279 -31.896 -42.305 1.00 35.76  ? 418  LYS A O   1 
ATOM   2635 C CB  . LYS A 1  340 ? -31.677 -32.541 -39.563 1.00 35.45  ? 418  LYS A CB  1 
ATOM   2636 C CG  . LYS A 1  340 ? -31.593 -33.145 -38.153 1.00 33.02  ? 418  LYS A CG  1 
ATOM   2637 C CD  . LYS A 1  340 ? -30.592 -34.299 -38.091 1.00 36.05  ? 418  LYS A CD  1 
ATOM   2638 C CE  . LYS A 1  340 ? -30.655 -35.093 -36.796 1.00 38.70  ? 418  LYS A CE  1 
ATOM   2639 N NZ  . LYS A 1  340 ? -29.846 -34.498 -35.697 1.00 31.25  ? 418  LYS A NZ  1 
ATOM   2640 N N   . ASP A 1  341 ? -29.693 -30.380 -41.799 1.00 37.22  ? 419  ASP A N   1 
ATOM   2641 C CA  . ASP A 1  341 ? -29.613 -29.790 -43.120 1.00 42.75  ? 419  ASP A CA  1 
ATOM   2642 C C   . ASP A 1  341 ? -28.231 -30.149 -43.660 1.00 37.25  ? 419  ASP A C   1 
ATOM   2643 O O   . ASP A 1  341 ? -28.022 -31.304 -44.071 1.00 31.01  ? 419  ASP A O   1 
ATOM   2644 C CB  . ASP A 1  341 ? -29.867 -28.284 -43.027 1.00 50.29  ? 419  ASP A CB  1 
ATOM   2645 C CG  . ASP A 1  341 ? -31.336 -27.963 -42.892 1.00 68.57  ? 419  ASP A CG  1 
ATOM   2646 O OD1 . ASP A 1  341 ? -32.031 -27.970 -43.933 1.00 94.39  ? 419  ASP A OD1 1 
ATOM   2647 O OD2 . ASP A 1  341 ? -31.794 -27.719 -41.752 1.00 81.08  ? 419  ASP A OD2 1 
ATOM   2648 N N   . GLY A 1  342 ? -27.270 -29.232 -43.584 1.00 29.39  ? 420  GLY A N   1 
ATOM   2649 C CA  . GLY A 1  342 ? -25.915 -29.516 -44.048 1.00 28.53  ? 420  GLY A CA  1 
ATOM   2650 C C   . GLY A 1  342 ? -25.240 -30.706 -43.392 1.00 24.01  ? 420  GLY A C   1 
ATOM   2651 O O   . GLY A 1  342 ? -24.386 -31.337 -44.017 1.00 19.82  ? 420  GLY A O   1 
ATOM   2652 N N   . PHE A 1  343 ? -25.614 -31.027 -42.150 1.00 22.89  ? 421  PHE A N   1 
ATOM   2653 C CA  . PHE A 1  343 ? -24.955 -32.117 -41.391 1.00 22.61  ? 421  PHE A CA  1 
ATOM   2654 C C   . PHE A 1  343 ? -25.834 -33.327 -41.119 1.00 24.39  ? 421  PHE A C   1 
ATOM   2655 O O   . PHE A 1  343 ? -25.546 -34.132 -40.222 1.00 20.44  ? 421  PHE A O   1 
ATOM   2656 C CB  . PHE A 1  343 ? -24.368 -31.564 -40.091 1.00 22.89  ? 421  PHE A CB  1 
ATOM   2657 C CG  . PHE A 1  343 ? -23.073 -30.870 -40.292 1.00 21.44  ? 421  PHE A CG  1 
ATOM   2658 C CD1 . PHE A 1  343 ? -23.046 -29.573 -40.810 1.00 22.64  ? 421  PHE A CD1 1 
ATOM   2659 C CD2 . PHE A 1  343 ? -21.874 -31.517 -40.012 1.00 20.39  ? 421  PHE A CD2 1 
ATOM   2660 C CE1 . PHE A 1  343 ? -21.840 -28.926 -41.013 1.00 20.19  ? 421  PHE A CE1 1 
ATOM   2661 C CE2 . PHE A 1  343 ? -20.667 -30.877 -40.213 1.00 20.30  ? 421  PHE A CE2 1 
ATOM   2662 C CZ  . PHE A 1  343 ? -20.648 -29.582 -40.726 1.00 21.36  ? 421  PHE A CZ  1 
ATOM   2663 N N   . ARG A 1  344 ? -26.881 -33.479 -41.923 1.00 24.56  ? 422  ARG A N   1 
ATOM   2664 C CA  . ARG A 1  344 ? -27.811 -34.608 -41.794 1.00 30.20  ? 422  ARG A CA  1 
ATOM   2665 C C   . ARG A 1  344 ? -27.097 -35.960 -41.747 1.00 26.29  ? 422  ARG A C   1 
ATOM   2666 O O   . ARG A 1  344 ? -27.481 -36.831 -40.982 1.00 24.96  ? 422  ARG A O   1 
ATOM   2667 C CB  . ARG A 1  344 ? -28.803 -34.600 -42.968 1.00 38.67  ? 422  ARG A CB  1 
ATOM   2668 C CG  . ARG A 1  344 ? -29.991 -35.547 -42.824 1.00 55.19  ? 422  ARG A CG  1 
ATOM   2669 C CD  . ARG A 1  344 ? -30.830 -35.603 -44.096 1.00 65.82  ? 422  ARG A CD  1 
ATOM   2670 N NE  . ARG A 1  344 ? -31.168 -34.270 -44.619 1.00 89.81  ? 422  ARG A NE  1 
ATOM   2671 C CZ  . ARG A 1  344 ? -30.525 -33.610 -45.594 1.00 92.48  ? 422  ARG A CZ  1 
ATOM   2672 N NH1 . ARG A 1  344 ? -29.463 -34.127 -46.217 1.00 103.23 ? 422  ARG A NH1 1 
ATOM   2673 N NH2 . ARG A 1  344 ? -30.955 -32.398 -45.952 1.00 86.72  ? 422  ARG A NH2 1 
ATOM   2674 N N   . ASP A 1  345 ? -26.052 -36.119 -42.566 1.00 25.46  ? 423  ASP A N   1 
ATOM   2675 C CA  . ASP A 1  345 ? -25.294 -37.368 -42.642 1.00 25.01  ? 423  ASP A CA  1 
ATOM   2676 C C   . ASP A 1  345 ? -23.937 -37.280 -41.918 1.00 23.03  ? 423  ASP A C   1 
ATOM   2677 O O   . ASP A 1  345 ? -22.945 -37.903 -42.338 1.00 22.13  ? 423  ASP A O   1 
ATOM   2678 C CB  . ASP A 1  345 ? -25.105 -37.761 -44.109 1.00 30.50  ? 423  ASP A CB  1 
ATOM   2679 C CG  . ASP A 1  345 ? -24.220 -36.798 -44.856 1.00 28.83  ? 423  ASP A CG  1 
ATOM   2680 O OD1 . ASP A 1  345 ? -24.237 -35.586 -44.522 1.00 31.09  ? 423  ASP A OD1 1 
ATOM   2681 O OD2 . ASP A 1  345 ? -23.496 -37.251 -45.756 1.00 41.15  ? 423  ASP A OD2 1 
ATOM   2682 N N   . PHE A 1  346 ? -23.911 -36.534 -40.815 1.00 21.79  ? 424  PHE A N   1 
ATOM   2683 C CA  . PHE A 1  346 ? -22.713 -36.381 -39.968 1.00 20.99  ? 424  PHE A CA  1 
ATOM   2684 C C   . PHE A 1  346 ? -22.106 -37.736 -39.522 1.00 21.76  ? 424  PHE A C   1 
ATOM   2685 O O   . PHE A 1  346 ? -20.905 -37.948 -39.686 1.00 23.74  ? 424  PHE A O   1 
ATOM   2686 C CB  . PHE A 1  346 ? -23.078 -35.496 -38.755 1.00 22.26  ? 424  PHE A CB  1 
ATOM   2687 C CG  . PHE A 1  346 ? -21.919 -34.941 -37.965 1.00 19.59  ? 424  PHE A CG  1 
ATOM   2688 C CD1 . PHE A 1  346 ? -20.666 -34.675 -38.527 1.00 19.80  ? 424  PHE A CD1 1 
ATOM   2689 C CD2 . PHE A 1  346 ? -22.134 -34.587 -36.636 1.00 19.66  ? 424  PHE A CD2 1 
ATOM   2690 C CE1 . PHE A 1  346 ? -19.648 -34.112 -37.766 1.00 20.19  ? 424  PHE A CE1 1 
ATOM   2691 C CE2 . PHE A 1  346 ? -21.125 -34.032 -35.873 1.00 18.43  ? 424  PHE A CE2 1 
ATOM   2692 C CZ  . PHE A 1  346 ? -19.882 -33.787 -36.436 1.00 19.92  ? 424  PHE A CZ  1 
ATOM   2693 N N   . PRO A 1  347 ? -22.925 -38.675 -38.989 1.00 23.88  ? 425  PRO A N   1 
ATOM   2694 C CA  . PRO A 1  347 ? -22.293 -39.940 -38.614 1.00 23.59  ? 425  PRO A CA  1 
ATOM   2695 C C   . PRO A 1  347 ? -21.518 -40.598 -39.762 1.00 22.84  ? 425  PRO A C   1 
ATOM   2696 O O   . PRO A 1  347 ? -20.366 -41.025 -39.569 1.00 19.54  ? 425  PRO A O   1 
ATOM   2697 C CB  . PRO A 1  347 ? -23.482 -40.810 -38.174 1.00 23.93  ? 425  PRO A CB  1 
ATOM   2698 C CG  . PRO A 1  347 ? -24.467 -39.830 -37.660 1.00 22.53  ? 425  PRO A CG  1 
ATOM   2699 C CD  . PRO A 1  347 ? -24.350 -38.659 -38.592 1.00 25.00  ? 425  PRO A CD  1 
ATOM   2700 N N   . ALA A 1  348 ? -22.145 -40.671 -40.933 1.00 18.84  ? 426  ALA A N   1 
ATOM   2701 C CA  . ALA A 1  348 ? -21.520 -41.282 -42.087 1.00 21.91  ? 426  ALA A CA  1 
ATOM   2702 C C   . ALA A 1  348 ? -20.228 -40.590 -42.512 1.00 19.53  ? 426  ALA A C   1 
ATOM   2703 O O   . ALA A 1  348 ? -19.276 -41.261 -42.893 1.00 24.07  ? 426  ALA A O   1 
ATOM   2704 C CB  . ALA A 1  348 ? -22.497 -41.347 -43.262 1.00 24.29  ? 426  ALA A CB  1 
ATOM   2705 N N   . MET A 1  349 ? -20.187 -39.260 -42.447 1.00 19.73  ? 427  MET A N   1 
ATOM   2706 C CA  . MET A 1  349 ? -18.955 -38.520 -42.746 1.00 19.96  ? 427  MET A CA  1 
ATOM   2707 C C   . MET A 1  349 ? -17.802 -38.944 -41.837 1.00 19.40  ? 427  MET A C   1 
ATOM   2708 O O   . MET A 1  349 ? -16.688 -39.113 -42.290 1.00 18.05  ? 427  MET A O   1 
ATOM   2709 C CB  . MET A 1  349 ? -19.156 -37.006 -42.574 1.00 20.60  ? 427  MET A CB  1 
ATOM   2710 C CG  . MET A 1  349 ? -17.950 -36.198 -43.037 1.00 20.42  ? 427  MET A CG  1 
ATOM   2711 S SD  . MET A 1  349 ? -18.029 -34.440 -42.690 1.00 24.11  ? 427  MET A SD  1 
ATOM   2712 C CE  . MET A 1  349 ? -17.491 -34.474 -41.009 1.00 23.60  ? 427  MET A CE  1 
ATOM   2713 N N   . VAL A 1  350 ? -18.057 -39.056 -40.545 1.00 18.34  ? 428  VAL A N   1 
ATOM   2714 C CA  . VAL A 1  350 ? -16.989 -39.394 -39.598 1.00 17.47  ? 428  VAL A CA  1 
ATOM   2715 C C   . VAL A 1  350 ? -16.555 -40.860 -39.760 1.00 19.56  ? 428  VAL A C   1 
ATOM   2716 O O   . VAL A 1  350 ? -15.364 -41.153 -39.732 1.00 21.72  ? 428  VAL A O   1 
ATOM   2717 C CB  . VAL A 1  350 ? -17.388 -39.053 -38.145 1.00 19.11  ? 428  VAL A CB  1 
ATOM   2718 C CG1 . VAL A 1  350 ? -16.260 -39.433 -37.185 1.00 20.52  ? 428  VAL A CG1 1 
ATOM   2719 C CG2 . VAL A 1  350 ? -17.704 -37.551 -38.025 1.00 17.55  ? 428  VAL A CG2 1 
ATOM   2720 N N   . GLN A 1  351 ? -17.521 -41.758 -39.955 1.00 21.90  ? 429  GLN A N   1 
ATOM   2721 C CA  . GLN A 1  351 ? -17.252 -43.166 -40.289 1.00 24.10  ? 429  GLN A CA  1 
ATOM   2722 C C   . GLN A 1  351 ? -16.380 -43.282 -41.534 1.00 23.77  ? 429  GLN A C   1 
ATOM   2723 O O   . GLN A 1  351 ? -15.427 -44.053 -41.538 1.00 20.55  ? 429  GLN A O   1 
ATOM   2724 C CB  . GLN A 1  351 ? -18.552 -43.965 -40.494 1.00 26.12  ? 429  GLN A CB  1 
ATOM   2725 C CG  . GLN A 1  351 ? -19.368 -44.138 -39.197 1.00 36.87  ? 429  GLN A CG  1 
ATOM   2726 C CD  . GLN A 1  351 ? -20.847 -44.477 -39.418 1.00 48.64  ? 429  GLN A CD  1 
ATOM   2727 O OE1 . GLN A 1  351 ? -21.311 -44.655 -40.547 1.00 51.52  ? 429  GLN A OE1 1 
ATOM   2728 N NE2 . GLN A 1  351 ? -21.592 -44.568 -38.322 1.00 63.96  ? 429  GLN A NE2 1 
ATOM   2729 N N   . GLU A 1  352 ? -16.723 -42.528 -42.580 1.00 22.58  ? 430  GLU A N   1 
ATOM   2730 C CA  . GLU A 1  352 ? -15.936 -42.504 -43.812 1.00 22.11  ? 430  GLU A CA  1 
ATOM   2731 C C   . GLU A 1  352 ? -14.523 -41.976 -43.537 1.00 21.85  ? 430  GLU A C   1 
ATOM   2732 O O   . GLU A 1  352 ? -13.565 -42.519 -44.052 1.00 19.59  ? 430  GLU A O   1 
ATOM   2733 C CB  . GLU A 1  352 ? -16.603 -41.645 -44.887 1.00 28.92  ? 430  GLU A CB  1 
ATOM   2734 C CG  . GLU A 1  352 ? -17.868 -42.230 -45.521 1.00 37.88  ? 430  GLU A CG  1 
ATOM   2735 C CD  . GLU A 1  352 ? -18.792 -41.155 -46.114 1.00 44.96  ? 430  GLU A CD  1 
ATOM   2736 O OE1 . GLU A 1  352 ? -20.023 -41.355 -46.093 1.00 56.42  ? 430  GLU A OE1 1 
ATOM   2737 O OE2 . GLU A 1  352 ? -18.300 -40.098 -46.585 1.00 47.03  ? 430  GLU A OE2 1 
ATOM   2738 N N   . LEU A 1  353 ? -14.385 -40.940 -42.709 1.00 23.01  ? 431  LEU A N   1 
ATOM   2739 C CA  . LEU A 1  353 ? -13.041 -40.437 -42.360 1.00 21.37  ? 431  LEU A CA  1 
ATOM   2740 C C   . LEU A 1  353 ? -12.209 -41.540 -41.753 1.00 18.39  ? 431  LEU A C   1 
ATOM   2741 O O   . LEU A 1  353 ? -11.039 -41.725 -42.111 1.00 19.82  ? 431  LEU A O   1 
ATOM   2742 C CB  . LEU A 1  353 ? -13.093 -39.233 -41.416 1.00 18.08  ? 431  LEU A CB  1 
ATOM   2743 C CG  . LEU A 1  353 ? -13.467 -37.902 -42.027 1.00 20.59  ? 431  LEU A CG  1 
ATOM   2744 C CD1 . LEU A 1  353 ? -13.794 -36.902 -40.933 1.00 21.39  ? 431  LEU A CD1 1 
ATOM   2745 C CD2 . LEU A 1  353 ? -12.373 -37.372 -42.944 1.00 22.08  ? 431  LEU A CD2 1 
ATOM   2746 N N   . HIS A 1  354 ? -12.817 -42.277 -40.839 1.00 19.34  ? 432  HIS A N   1 
ATOM   2747 C CA  . HIS A 1  354 ? -12.134 -43.379 -40.192 1.00 19.30  ? 432  HIS A CA  1 
ATOM   2748 C C   . HIS A 1  354 ? -11.752 -44.466 -41.174 1.00 20.44  ? 432  HIS A C   1 
ATOM   2749 O O   . HIS A 1  354 ? -10.642 -44.961 -41.123 1.00 18.23  ? 432  HIS A O   1 
ATOM   2750 C CB  . HIS A 1  354 ? -12.981 -43.999 -39.104 1.00 17.95  ? 432  HIS A CB  1 
ATOM   2751 C CG  . HIS A 1  354 ? -13.169 -43.125 -37.927 1.00 18.84  ? 432  HIS A CG  1 
ATOM   2752 N ND1 . HIS A 1  354 ? -14.184 -43.328 -37.022 1.00 21.34  ? 432  HIS A ND1 1 
ATOM   2753 C CD2 . HIS A 1  354 ? -12.486 -42.043 -37.497 1.00 17.94  ? 432  HIS A CD2 1 
ATOM   2754 C CE1 . HIS A 1  354 ? -14.102 -42.420 -36.073 1.00 19.31  ? 432  HIS A CE1 1 
ATOM   2755 N NE2 . HIS A 1  354 ? -13.083 -41.625 -36.340 1.00 19.43  ? 432  HIS A NE2 1 
ATOM   2756 N N   . GLN A 1  355 ? -12.640 -44.815 -42.085 1.00 23.48  ? 433  GLN A N   1 
ATOM   2757 C CA  . GLN A 1  355 ? -12.309 -45.820 -43.130 1.00 23.21  ? 433  GLN A CA  1 
ATOM   2758 C C   . GLN A 1  355 ? -11.047 -45.470 -43.925 1.00 23.25  ? 433  GLN A C   1 
ATOM   2759 O O   . GLN A 1  355 ? -10.285 -46.355 -44.257 1.00 22.21  ? 433  GLN A O   1 
ATOM   2760 C CB  . GLN A 1  355 ? -13.492 -46.018 -44.080 1.00 32.24  ? 433  GLN A CB  1 
ATOM   2761 C CG  . GLN A 1  355 ? -14.640 -46.773 -43.419 1.00 41.44  ? 433  GLN A CG  1 
ATOM   2762 C CD  . GLN A 1  355 ? -16.001 -46.478 -44.038 1.00 65.29  ? 433  GLN A CD  1 
ATOM   2763 O OE1 . GLN A 1  355 ? -16.114 -46.174 -45.235 1.00 66.34  ? 433  GLN A OE1 1 
ATOM   2764 N NE2 . GLN A 1  355 ? -17.048 -46.567 -43.216 1.00 67.21  ? 433  GLN A NE2 1 
ATOM   2765 N N   . GLY A 1  356 ? -10.819 -44.182 -44.177 1.00 19.12  ? 434  GLY A N   1 
ATOM   2766 C CA  . GLY A 1  356 ? -9.616  -43.706 -44.880 1.00 20.27  ? 434  GLY A CA  1 
ATOM   2767 C C   . GLY A 1  356 ? -8.374  -43.534 -44.018 1.00 17.50  ? 434  GLY A C   1 
ATOM   2768 O O   . GLY A 1  356 ? -7.363  -43.078 -44.502 1.00 17.45  ? 434  GLY A O   1 
ATOM   2769 N N   . GLY A 1  357 ? -8.463  -43.811 -42.723 1.00 19.34  ? 435  GLY A N   1 
ATOM   2770 C CA  . GLY A 1  357 ? -7.311  -43.716 -41.831 1.00 21.52  ? 435  GLY A CA  1 
ATOM   2771 C C   . GLY A 1  357 ? -7.083  -42.377 -41.168 1.00 19.20  ? 435  GLY A C   1 
ATOM   2772 O O   . GLY A 1  357 ? -5.976  -42.121 -40.680 1.00 21.66  ? 435  GLY A O   1 
ATOM   2773 N N   . ARG A 1  358 ? -8.122  -41.535 -41.144 1.00 20.47  ? 436  ARG A N   1 
ATOM   2774 C CA  . ARG A 1  358 ? -8.082  -40.217 -40.523 1.00 18.25  ? 436  ARG A CA  1 
ATOM   2775 C C   . ARG A 1  358 ? -8.955  -40.174 -39.260 1.00 19.36  ? 436  ARG A C   1 
ATOM   2776 O O   . ARG A 1  358 ? -9.766  -41.067 -39.004 1.00 18.36  ? 436  ARG A O   1 
ATOM   2777 C CB  . ARG A 1  358 ? -8.557  -39.146 -41.518 1.00 18.83  ? 436  ARG A CB  1 
ATOM   2778 C CG  . ARG A 1  358 ? -7.585  -38.965 -42.670 1.00 17.94  ? 436  ARG A CG  1 
ATOM   2779 C CD  . ARG A 1  358 ? -7.936  -37.832 -43.608 1.00 17.92  ? 436  ARG A CD  1 
ATOM   2780 N NE  . ARG A 1  358 ? -6.904  -37.706 -44.656 1.00 19.86  ? 436  ARG A NE  1 
ATOM   2781 C CZ  . ARG A 1  358 ? -6.781  -38.505 -45.719 1.00 16.70  ? 436  ARG A CZ  1 
ATOM   2782 N NH1 . ARG A 1  358 ? -7.642  -39.493 -45.929 1.00 17.31  ? 436  ARG A NH1 1 
ATOM   2783 N NH2 . ARG A 1  358 ? -5.794  -38.309 -46.596 1.00 18.30  ? 436  ARG A NH2 1 
ATOM   2784 N N   . ARG A 1  359 ? -8.763  -39.119 -38.474 1.00 17.89  ? 437  ARG A N   1 
ATOM   2785 C CA  . ARG A 1  359 ? -9.536  -38.878 -37.267 1.00 17.60  ? 437  ARG A CA  1 
ATOM   2786 C C   . ARG A 1  359 ? -10.361 -37.625 -37.457 1.00 16.87  ? 437  ARG A C   1 
ATOM   2787 O O   . ARG A 1  359 ? -10.181 -36.902 -38.436 1.00 15.01  ? 437  ARG A O   1 
ATOM   2788 C CB  . ARG A 1  359 ? -8.635  -38.746 -36.046 1.00 19.17  ? 437  ARG A CB  1 
ATOM   2789 C CG  . ARG A 1  359 ? -8.397  -40.055 -35.312 1.00 27.85  ? 437  ARG A CG  1 
ATOM   2790 C CD  . ARG A 1  359 ? -7.391  -40.905 -36.014 1.00 22.28  ? 437  ARG A CD  1 
ATOM   2791 N NE  . ARG A 1  359 ? -7.145  -42.126 -35.267 1.00 28.10  ? 437  ARG A NE  1 
ATOM   2792 C CZ  . ARG A 1  359 ? -6.180  -43.002 -35.553 1.00 29.75  ? 437  ARG A CZ  1 
ATOM   2793 N NH1 . ARG A 1  359 ? -5.362  -42.821 -36.598 1.00 26.61  ? 437  ARG A NH1 1 
ATOM   2794 N NH2 . ARG A 1  359 ? -6.032  -44.067 -34.782 1.00 31.63  ? 437  ARG A NH2 1 
ATOM   2795 N N   . TYR A 1  360 ? -11.247 -37.385 -36.490 1.00 16.68  ? 438  TYR A N   1 
ATOM   2796 C CA  . TYR A 1  360 ? -12.205 -36.294 -36.526 1.00 16.52  ? 438  TYR A CA  1 
ATOM   2797 C C   . TYR A 1  360 ? -12.266 -35.593 -35.157 1.00 15.00  ? 438  TYR A C   1 
ATOM   2798 O O   . TYR A 1  360 ? -12.339 -36.254 -34.136 1.00 18.16  ? 438  TYR A O   1 
ATOM   2799 C CB  . TYR A 1  360 ? -13.598 -36.820 -36.929 1.00 15.70  ? 438  TYR A CB  1 
ATOM   2800 C CG  . TYR A 1  360 ? -14.562 -35.684 -36.990 1.00 17.55  ? 438  TYR A CG  1 
ATOM   2801 C CD1 . TYR A 1  360 ? -14.515 -34.769 -38.048 1.00 15.47  ? 438  TYR A CD1 1 
ATOM   2802 C CD2 . TYR A 1  360 ? -15.469 -35.463 -35.954 1.00 17.66  ? 438  TYR A CD2 1 
ATOM   2803 C CE1 . TYR A 1  360 ? -15.359 -33.683 -38.084 1.00 16.16  ? 438  TYR A CE1 1 
ATOM   2804 C CE2 . TYR A 1  360 ? -16.304 -34.367 -35.969 1.00 18.38  ? 438  TYR A CE2 1 
ATOM   2805 C CZ  . TYR A 1  360 ? -16.249 -33.480 -37.025 1.00 17.52  ? 438  TYR A CZ  1 
ATOM   2806 O OH  . TYR A 1  360 ? -17.093 -32.406 -37.019 1.00 16.99  ? 438  TYR A OH  1 
ATOM   2807 N N   . MET A 1  361 ? -12.247 -34.258 -35.168 1.00 15.43  ? 439  MET A N   1 
ATOM   2808 C CA  . MET A 1  361 ? -12.344 -33.413 -33.988 1.00 17.59  ? 439  MET A CA  1 
ATOM   2809 C C   . MET A 1  361 ? -13.419 -32.361 -34.237 1.00 19.54  ? 439  MET A C   1 
ATOM   2810 O O   . MET A 1  361 ? -13.613 -31.893 -35.379 1.00 16.29  ? 439  MET A O   1 
ATOM   2811 C CB  . MET A 1  361 ? -11.031 -32.665 -33.733 1.00 17.94  ? 439  MET A CB  1 
ATOM   2812 C CG  . MET A 1  361 ? -9.872  -33.526 -33.256 1.00 20.48  ? 439  MET A CG  1 
ATOM   2813 S SD  . MET A 1  361 ? -10.013 -33.854 -31.531 1.00 27.82  ? 439  MET A SD  1 
ATOM   2814 C CE  . MET A 1  361 ? -9.508  -32.270 -30.817 1.00 18.87  ? 439  MET A CE  1 
ATOM   2815 N N   . MET A 1  362 ? -14.092 -31.955 -33.170 1.00 17.37  ? 440  MET A N   1 
ATOM   2816 C CA  . MET A 1  362 ? -15.031 -30.843 -33.281 1.00 17.88  ? 440  MET A CA  1 
ATOM   2817 C C   . MET A 1  362 ? -15.071 -29.997 -32.032 1.00 17.23  ? 440  MET A C   1 
ATOM   2818 O O   . MET A 1  362 ? -14.661 -30.437 -30.949 1.00 16.71  ? 440  MET A O   1 
ATOM   2819 C CB  . MET A 1  362 ? -16.438 -31.326 -33.647 1.00 16.50  ? 440  MET A CB  1 
ATOM   2820 C CG  . MET A 1  362 ? -17.233 -31.912 -32.490 1.00 19.85  ? 440  MET A CG  1 
ATOM   2821 S SD  . MET A 1  362 ? -16.585 -33.482 -31.912 1.00 21.72  ? 440  MET A SD  1 
ATOM   2822 C CE  . MET A 1  362 ? -17.449 -33.648 -30.350 1.00 21.91  ? 440  MET A CE  1 
ATOM   2823 N N   . ILE A 1  363 ? -15.578 -28.776 -32.207 1.00 16.25  ? 441  ILE A N   1 
ATOM   2824 C CA  . ILE A 1  363 ? -15.669 -27.842 -31.119 1.00 16.63  ? 441  ILE A CA  1 
ATOM   2825 C C   . ILE A 1  363 ? -16.758 -28.256 -30.119 1.00 15.94  ? 441  ILE A C   1 
ATOM   2826 O O   . ILE A 1  363 ? -17.831 -28.741 -30.506 1.00 17.88  ? 441  ILE A O   1 
ATOM   2827 C CB  . ILE A 1  363 ? -15.889 -26.403 -31.628 1.00 14.72  ? 441  ILE A CB  1 
ATOM   2828 C CG1 . ILE A 1  363 ? -15.476 -25.407 -30.549 1.00 15.45  ? 441  ILE A CG1 1 
ATOM   2829 C CG2 . ILE A 1  363 ? -17.329 -26.200 -32.099 1.00 15.44  ? 441  ILE A CG2 1 
ATOM   2830 C CD1 . ILE A 1  363 ? -15.390 -23.984 -31.020 1.00 16.80  ? 441  ILE A CD1 1 
ATOM   2831 N N   . VAL A 1  364 ? -16.445 -28.086 -28.838 1.00 15.12  ? 442  VAL A N   1 
ATOM   2832 C CA  . VAL A 1  364 ? -17.403 -28.196 -27.743 1.00 14.67  ? 442  VAL A CA  1 
ATOM   2833 C C   . VAL A 1  364 ? -17.268 -26.954 -26.866 1.00 16.05  ? 442  VAL A C   1 
ATOM   2834 O O   . VAL A 1  364 ? -16.157 -26.599 -26.454 1.00 17.19  ? 442  VAL A O   1 
ATOM   2835 C CB  . VAL A 1  364 ? -17.145 -29.464 -26.912 1.00 18.49  ? 442  VAL A CB  1 
ATOM   2836 C CG1 . VAL A 1  364 ? -18.141 -29.593 -25.749 1.00 17.38  ? 442  VAL A CG1 1 
ATOM   2837 C CG2 . VAL A 1  364 ? -17.190 -30.688 -27.817 1.00 15.64  ? 442  VAL A CG2 1 
ATOM   2838 N N   . ASP A 1  365 ? -18.383 -26.270 -26.616 1.00 14.42  ? 443  ASP A N   1 
ATOM   2839 C CA  . ASP A 1  365 ? -18.420 -25.116 -25.712 1.00 15.80  ? 443  ASP A CA  1 
ATOM   2840 C C   . ASP A 1  365 ? -18.851 -25.646 -24.330 1.00 15.71  ? 443  ASP A C   1 
ATOM   2841 O O   . ASP A 1  365 ? -19.453 -26.705 -24.262 1.00 18.74  ? 443  ASP A O   1 
ATOM   2842 C CB  . ASP A 1  365 ? -19.411 -24.070 -26.235 1.00 17.64  ? 443  ASP A CB  1 
ATOM   2843 C CG  . ASP A 1  365 ? -18.920 -23.349 -27.523 1.00 18.12  ? 443  ASP A CG  1 
ATOM   2844 O OD1 . ASP A 1  365 ? -17.697 -23.229 -27.765 1.00 18.87  ? 443  ASP A OD1 1 
ATOM   2845 O OD2 . ASP A 1  365 ? -19.770 -22.847 -28.271 1.00 22.03  ? 443  ASP A OD2 1 
ATOM   2846 N N   . PRO A 1  366 ? -18.540 -24.937 -23.227 1.00 15.06  ? 444  PRO A N   1 
ATOM   2847 C CA  . PRO A 1  366 ? -18.988 -25.453 -21.916 1.00 15.49  ? 444  PRO A CA  1 
ATOM   2848 C C   . PRO A 1  366 ? -20.463 -25.141 -21.582 1.00 15.97  ? 444  PRO A C   1 
ATOM   2849 O O   . PRO A 1  366 ? -21.143 -25.933 -20.931 1.00 16.32  ? 444  PRO A O   1 
ATOM   2850 C CB  . PRO A 1  366 ? -18.040 -24.767 -20.947 1.00 16.84  ? 444  PRO A CB  1 
ATOM   2851 C CG  . PRO A 1  366 ? -17.768 -23.445 -21.587 1.00 17.78  ? 444  PRO A CG  1 
ATOM   2852 C CD  . PRO A 1  366 ? -17.772 -23.694 -23.079 1.00 16.27  ? 444  PRO A CD  1 
ATOM   2853 N N   . ALA A 1  367 ? -20.954 -24.012 -22.052 1.00 15.34  ? 445  ALA A N   1 
ATOM   2854 C CA  . ALA A 1  367 ? -22.252 -23.505 -21.637 1.00 18.53  ? 445  ALA A CA  1 
ATOM   2855 C C   . ALA A 1  367 ? -23.349 -24.207 -22.397 1.00 16.10  ? 445  ALA A C   1 
ATOM   2856 O O   . ALA A 1  367 ? -23.166 -24.553 -23.558 1.00 15.08  ? 445  ALA A O   1 
ATOM   2857 C CB  . ALA A 1  367 ? -22.325 -21.987 -21.846 1.00 20.85  ? 445  ALA A CB  1 
ATOM   2858 N N   . ILE A 1  368 ? -24.485 -24.420 -21.728 1.00 16.53  ? 446  ILE A N   1 
ATOM   2859 C CA  . ILE A 1  368 ? -25.551 -25.304 -22.231 1.00 16.15  ? 446  ILE A CA  1 
ATOM   2860 C C   . ILE A 1  368 ? -26.820 -24.496 -22.422 1.00 16.44  ? 446  ILE A C   1 
ATOM   2861 O O   . ILE A 1  368 ? -27.295 -23.848 -21.481 1.00 17.12  ? 446  ILE A O   1 
ATOM   2862 C CB  . ILE A 1  368 ? -25.777 -26.471 -21.234 1.00 17.44  ? 446  ILE A CB  1 
ATOM   2863 C CG1 . ILE A 1  368 ? -24.483 -27.272 -20.995 1.00 15.28  ? 446  ILE A CG1 1 
ATOM   2864 C CG2 . ILE A 1  368 ? -26.899 -27.386 -21.658 1.00 16.83  ? 446  ILE A CG2 1 
ATOM   2865 C CD1 . ILE A 1  368 ? -23.920 -28.011 -22.202 1.00 17.01  ? 446  ILE A CD1 1 
ATOM   2866 N N   . SER A 1  369 ? -27.383 -24.542 -23.631 1.00 15.45  ? 447  SER A N   1 
ATOM   2867 C CA  . SER A 1  369 ? -28.583 -23.790 -23.941 1.00 16.18  ? 447  SER A CA  1 
ATOM   2868 C C   . SER A 1  369 ? -29.685 -24.076 -22.909 1.00 16.29  ? 447  SER A C   1 
ATOM   2869 O O   . SER A 1  369 ? -30.046 -25.213 -22.686 1.00 15.98  ? 447  SER A O   1 
ATOM   2870 C CB  . SER A 1  369 ? -29.100 -24.130 -25.333 1.00 17.08  ? 447  SER A CB  1 
ATOM   2871 O OG  . SER A 1  369 ? -30.312 -23.459 -25.613 1.00 19.64  ? 447  SER A OG  1 
ATOM   2872 N N   . SER A 1  370 ? -30.206 -23.017 -22.315 1.00 16.71  ? 448  SER A N   1 
ATOM   2873 C CA  . SER A 1  370 ? -31.185 -23.097 -21.255 1.00 19.50  ? 448  SER A CA  1 
ATOM   2874 C C   . SER A 1  370 ? -32.613 -22.668 -21.664 1.00 24.22  ? 448  SER A C   1 
ATOM   2875 O O   . SER A 1  370 ? -33.518 -22.665 -20.828 1.00 20.79  ? 448  SER A O   1 
ATOM   2876 C CB  . SER A 1  370 ? -30.712 -22.215 -20.114 1.00 20.33  ? 448  SER A CB  1 
ATOM   2877 O OG  . SER A 1  370 ? -30.575 -20.860 -20.551 1.00 20.47  ? 448  SER A OG  1 
ATOM   2878 N N   . SER A 1  371 ? -32.809 -22.332 -22.932 1.00 19.24  ? 449  SER A N   1 
ATOM   2879 C CA  . SER A 1  371 ? -34.015 -21.652 -23.382 1.00 27.42  ? 449  SER A CA  1 
ATOM   2880 C C   . SER A 1  371 ? -34.970 -22.574 -24.128 1.00 25.47  ? 449  SER A C   1 
ATOM   2881 O O   . SER A 1  371 ? -36.036 -22.145 -24.486 1.00 23.13  ? 449  SER A O   1 
ATOM   2882 C CB  . SER A 1  371 ? -33.635 -20.471 -24.299 1.00 28.28  ? 449  SER A CB  1 
ATOM   2883 O OG  . SER A 1  371 ? -32.959 -20.925 -25.466 1.00 34.20  ? 449  SER A OG  1 
ATOM   2884 N N   . GLY A 1  372 ? -34.608 -23.838 -24.344 1.00 26.91  ? 450  GLY A N   1 
ATOM   2885 C CA  . GLY A 1  372 ? -35.434 -24.720 -25.154 1.00 27.48  ? 450  GLY A CA  1 
ATOM   2886 C C   . GLY A 1  372 ? -36.667 -25.092 -24.359 1.00 32.36  ? 450  GLY A C   1 
ATOM   2887 O O   . GLY A 1  372 ? -36.656 -24.971 -23.131 1.00 29.07  ? 450  GLY A O   1 
ATOM   2888 N N   . PRO A 1  373 ? -37.741 -25.543 -25.041 1.00 30.87  ? 451  PRO A N   1 
ATOM   2889 C CA  . PRO A 1  373 ? -38.845 -26.102 -24.254 1.00 31.88  ? 451  PRO A CA  1 
ATOM   2890 C C   . PRO A 1  373 ? -38.352 -27.244 -23.351 1.00 27.80  ? 451  PRO A C   1 
ATOM   2891 O O   . PRO A 1  373 ? -37.433 -27.990 -23.723 1.00 26.63  ? 451  PRO A O   1 
ATOM   2892 C CB  . PRO A 1  373 ? -39.819 -26.629 -25.320 1.00 33.00  ? 451  PRO A CB  1 
ATOM   2893 C CG  . PRO A 1  373 ? -39.512 -25.829 -26.546 1.00 36.85  ? 451  PRO A CG  1 
ATOM   2894 C CD  . PRO A 1  373 ? -38.042 -25.504 -26.486 1.00 33.44  ? 451  PRO A CD  1 
ATOM   2895 N N   . ALA A 1  374 ? -38.930 -27.341 -22.161 1.00 24.20  ? 452  ALA A N   1 
ATOM   2896 C CA  . ALA A 1  374 ? -38.620 -28.413 -21.238 1.00 23.68  ? 452  ALA A CA  1 
ATOM   2897 C C   . ALA A 1  374 ? -38.801 -29.742 -21.941 1.00 23.22  ? 452  ALA A C   1 
ATOM   2898 O O   . ALA A 1  374 ? -39.742 -29.924 -22.712 1.00 24.40  ? 452  ALA A O   1 
ATOM   2899 C CB  . ALA A 1  374 ? -39.548 -28.339 -20.031 1.00 27.26  ? 452  ALA A CB  1 
ATOM   2900 N N   . GLY A 1  375 ? -37.885 -30.663 -21.713 1.00 24.94  ? 453  GLY A N   1 
ATOM   2901 C CA  . GLY A 1  375 ? -37.970 -31.995 -22.318 1.00 24.55  ? 453  GLY A CA  1 
ATOM   2902 C C   . GLY A 1  375 ? -37.442 -32.106 -23.741 1.00 25.01  ? 453  GLY A C   1 
ATOM   2903 O O   . GLY A 1  375 ? -37.379 -33.203 -24.259 1.00 23.96  ? 453  GLY A O   1 
ATOM   2904 N N   . SER A 1  376 ? -37.040 -30.992 -24.366 1.00 25.92  ? 454  SER A N   1 
ATOM   2905 C CA  . SER A 1  376 ? -36.618 -30.991 -25.781 1.00 24.57  ? 454  SER A CA  1 
ATOM   2906 C C   . SER A 1  376 ? -35.094 -30.985 -25.972 1.00 21.35  ? 454  SER A C   1 
ATOM   2907 O O   . SER A 1  376 ? -34.630 -31.078 -27.081 1.00 20.91  ? 454  SER A O   1 
ATOM   2908 C CB  . SER A 1  376 ? -37.222 -29.769 -26.508 1.00 27.42  ? 454  SER A CB  1 
ATOM   2909 O OG  . SER A 1  376 ? -36.625 -28.540 -26.090 1.00 25.59  ? 454  SER A OG  1 
ATOM   2910 N N   . TYR A 1  377 ? -34.307 -30.864 -24.915 1.00 20.75  ? 455  TYR A N   1 
ATOM   2911 C CA  . TYR A 1  377 ? -32.838 -30.766 -25.083 1.00 19.16  ? 455  TYR A CA  1 
ATOM   2912 C C   . TYR A 1  377 ? -32.150 -31.392 -23.883 1.00 16.64  ? 455  TYR A C   1 
ATOM   2913 O O   . TYR A 1  377 ? -31.937 -30.759 -22.846 1.00 17.93  ? 455  TYR A O   1 
ATOM   2914 C CB  . TYR A 1  377 ? -32.415 -29.304 -25.326 1.00 19.61  ? 455  TYR A CB  1 
ATOM   2915 C CG  . TYR A 1  377 ? -30.914 -29.120 -25.486 1.00 18.57  ? 455  TYR A CG  1 
ATOM   2916 C CD1 . TYR A 1  377 ? -30.203 -29.813 -26.478 1.00 18.80  ? 455  TYR A CD1 1 
ATOM   2917 C CD2 . TYR A 1  377 ? -30.205 -28.257 -24.658 1.00 16.63  ? 455  TYR A CD2 1 
ATOM   2918 C CE1 . TYR A 1  377 ? -28.829 -29.659 -26.614 1.00 19.33  ? 455  TYR A CE1 1 
ATOM   2919 C CE2 . TYR A 1  377 ? -28.829 -28.085 -24.806 1.00 17.21  ? 455  TYR A CE2 1 
ATOM   2920 C CZ  . TYR A 1  377 ? -28.144 -28.799 -25.774 1.00 18.06  ? 455  TYR A CZ  1 
ATOM   2921 O OH  . TYR A 1  377 ? -26.774 -28.642 -25.922 1.00 18.67  ? 455  TYR A OH  1 
ATOM   2922 N N   . ARG A 1  378 ? -31.816 -32.663 -24.050 1.00 17.66  ? 456  ARG A N   1 
ATOM   2923 C CA  . ARG A 1  378 ? -31.411 -33.520 -22.965 1.00 18.09  ? 456  ARG A CA  1 
ATOM   2924 C C   . ARG A 1  378 ? -30.229 -33.012 -22.134 1.00 16.76  ? 456  ARG A C   1 
ATOM   2925 O O   . ARG A 1  378 ? -30.281 -33.106 -20.912 1.00 18.48  ? 456  ARG A O   1 
ATOM   2926 C CB  . ARG A 1  378 ? -31.191 -34.967 -23.485 1.00 18.24  ? 456  ARG A CB  1 
ATOM   2927 C CG  . ARG A 1  378 ? -30.586 -35.936 -22.451 1.00 22.35  ? 456  ARG A CG  1 
ATOM   2928 C CD  . ARG A 1  378 ? -30.616 -37.391 -22.935 1.00 24.40  ? 456  ARG A CD  1 
ATOM   2929 N NE  . ARG A 1  378 ? -29.788 -38.250 -22.094 1.00 26.78  ? 456  ARG A NE  1 
ATOM   2930 C CZ  . ARG A 1  378 ? -30.160 -38.766 -20.919 1.00 32.35  ? 456  ARG A CZ  1 
ATOM   2931 N NH1 . ARG A 1  378 ? -31.359 -38.506 -20.392 1.00 29.52  ? 456  ARG A NH1 1 
ATOM   2932 N NH2 . ARG A 1  378 ? -29.308 -39.533 -20.247 1.00 32.65  ? 456  ARG A NH2 1 
ATOM   2933 N N   . PRO A 1  379 ? -29.171 -32.464 -22.774 1.00 17.59  ? 457  PRO A N   1 
ATOM   2934 C CA  . PRO A 1  379 ? -28.032 -31.953 -21.986 1.00 17.02  ? 457  PRO A CA  1 
ATOM   2935 C C   . PRO A 1  379 ? -28.441 -30.939 -20.907 1.00 20.10  ? 457  PRO A C   1 
ATOM   2936 O O   . PRO A 1  379 ? -27.979 -30.998 -19.744 1.00 18.04  ? 457  PRO A O   1 
ATOM   2937 C CB  . PRO A 1  379 ? -27.126 -31.308 -23.052 1.00 18.35  ? 457  PRO A CB  1 
ATOM   2938 C CG  . PRO A 1  379 ? -27.443 -32.050 -24.312 1.00 17.17  ? 457  PRO A CG  1 
ATOM   2939 C CD  . PRO A 1  379 ? -28.932 -32.325 -24.229 1.00 17.38  ? 457  PRO A CD  1 
ATOM   2940 N N   . TYR A 1  380 ? -29.333 -30.036 -21.275 1.00 18.62  ? 458  TYR A N   1 
ATOM   2941 C CA  . TYR A 1  380 ? -29.879 -29.107 -20.308 1.00 18.99  ? 458  TYR A CA  1 
ATOM   2942 C C   . TYR A 1  380 ? -30.836 -29.777 -19.340 1.00 17.84  ? 458  TYR A C   1 
ATOM   2943 O O   . TYR A 1  380 ? -30.714 -29.579 -18.147 1.00 19.46  ? 458  TYR A O   1 
ATOM   2944 C CB  . TYR A 1  380 ? -30.614 -27.962 -20.999 1.00 18.84  ? 458  TYR A CB  1 
ATOM   2945 C CG  . TYR A 1  380 ? -31.129 -26.938 -20.016 1.00 18.35  ? 458  TYR A CG  1 
ATOM   2946 C CD1 . TYR A 1  380 ? -30.245 -26.166 -19.247 1.00 19.55  ? 458  TYR A CD1 1 
ATOM   2947 C CD2 . TYR A 1  380 ? -32.483 -26.744 -19.842 1.00 20.28  ? 458  TYR A CD2 1 
ATOM   2948 C CE1 . TYR A 1  380 ? -30.715 -25.218 -18.345 1.00 19.82  ? 458  TYR A CE1 1 
ATOM   2949 C CE2 . TYR A 1  380 ? -32.966 -25.805 -18.944 1.00 21.96  ? 458  TYR A CE2 1 
ATOM   2950 C CZ  . TYR A 1  380 ? -32.090 -25.047 -18.191 1.00 22.42  ? 458  TYR A CZ  1 
ATOM   2951 O OH  . TYR A 1  380 ? -32.595 -24.112 -17.303 1.00 28.15  ? 458  TYR A OH  1 
ATOM   2952 N N   . ASP A 1  381 ? -31.800 -30.529 -19.865 1.00 18.40  ? 459  ASP A N   1 
ATOM   2953 C CA  . ASP A 1  381 ? -32.876 -31.123 -19.034 1.00 21.55  ? 459  ASP A CA  1 
ATOM   2954 C C   . ASP A 1  381 ? -32.281 -32.036 -17.967 1.00 20.85  ? 459  ASP A C   1 
ATOM   2955 O O   . ASP A 1  381 ? -32.651 -31.987 -16.778 1.00 17.76  ? 459  ASP A O   1 
ATOM   2956 C CB  . ASP A 1  381 ? -33.858 -31.930 -19.885 1.00 20.53  ? 459  ASP A CB  1 
ATOM   2957 C CG  . ASP A 1  381 ? -34.517 -31.103 -21.000 1.00 23.52  ? 459  ASP A CG  1 
ATOM   2958 O OD1 . ASP A 1  381 ? -34.666 -29.870 -20.870 1.00 23.19  ? 459  ASP A OD1 1 
ATOM   2959 O OD2 . ASP A 1  381 ? -34.858 -31.699 -22.031 1.00 21.65  ? 459  ASP A OD2 1 
ATOM   2960 N N   . GLU A 1  382 ? -31.330 -32.857 -18.401 1.00 19.92  ? 460  GLU A N   1 
ATOM   2961 C CA  . GLU A 1  382 ? -30.606 -33.731 -17.495 1.00 21.07  ? 460  GLU A CA  1 
ATOM   2962 C C   . GLU A 1  382 ? -29.688 -32.962 -16.538 1.00 19.09  ? 460  GLU A C   1 
ATOM   2963 O O   . GLU A 1  382 ? -29.589 -33.316 -15.347 1.00 18.28  ? 460  GLU A O   1 
ATOM   2964 C CB  . GLU A 1  382 ? -29.848 -34.761 -18.317 1.00 24.79  ? 460  GLU A CB  1 
ATOM   2965 C CG  . GLU A 1  382 ? -29.219 -35.871 -17.542 1.00 32.30  ? 460  GLU A CG  1 
ATOM   2966 C CD  . GLU A 1  382 ? -30.192 -36.881 -16.959 1.00 29.17  ? 460  GLU A CD  1 
ATOM   2967 O OE1 . GLU A 1  382 ? -31.463 -36.750 -16.934 1.00 22.93  ? 460  GLU A OE1 1 
ATOM   2968 O OE2 . GLU A 1  382 ? -29.612 -37.851 -16.496 1.00 31.24  ? 460  GLU A OE2 1 
ATOM   2969 N N   . GLY A 1  383 ? -29.023 -31.914 -17.029 1.00 18.20  ? 461  GLY A N   1 
ATOM   2970 C CA  . GLY A 1  383 ? -28.208 -31.052 -16.170 1.00 18.03  ? 461  GLY A CA  1 
ATOM   2971 C C   . GLY A 1  383 ? -28.971 -30.426 -15.007 1.00 17.58  ? 461  GLY A C   1 
ATOM   2972 O O   . GLY A 1  383 ? -28.474 -30.336 -13.865 1.00 14.40  ? 461  GLY A O   1 
ATOM   2973 N N   . LEU A 1  384 ? -30.175 -29.973 -15.328 1.00 17.37  ? 462  LEU A N   1 
ATOM   2974 C CA  . LEU A 1  384 ? -31.087 -29.383 -14.375 1.00 20.21  ? 462  LEU A CA  1 
ATOM   2975 C C   . LEU A 1  384 ? -31.460 -30.417 -13.299 1.00 20.68  ? 462  LEU A C   1 
ATOM   2976 O O   . LEU A 1  384 ? -31.301 -30.164 -12.111 1.00 21.19  ? 462  LEU A O   1 
ATOM   2977 C CB  . LEU A 1  384 ? -32.347 -28.913 -15.117 1.00 24.85  ? 462  LEU A CB  1 
ATOM   2978 C CG  . LEU A 1  384 ? -33.036 -27.641 -14.688 1.00 32.27  ? 462  LEU A CG  1 
ATOM   2979 C CD1 . LEU A 1  384 ? -32.048 -26.464 -14.664 1.00 29.49  ? 462  LEU A CD1 1 
ATOM   2980 C CD2 . LEU A 1  384 ? -34.212 -27.368 -15.626 1.00 25.31  ? 462  LEU A CD2 1 
ATOM   2981 N N   . ARG A 1  385 ? -31.900 -31.595 -13.744 1.00 18.16  ? 463  ARG A N   1 
ATOM   2982 C CA  . ARG A 1  385 ? -32.302 -32.679 -12.870 1.00 19.96  ? 463  ARG A CA  1 
ATOM   2983 C C   . ARG A 1  385 ? -31.214 -33.029 -11.863 1.00 19.55  ? 463  ARG A C   1 
ATOM   2984 O O   . ARG A 1  385 ? -31.501 -33.211 -10.689 1.00 22.37  ? 463  ARG A O   1 
ATOM   2985 C CB  . ARG A 1  385 ? -32.668 -33.913 -13.685 1.00 19.91  ? 463  ARG A CB  1 
ATOM   2986 C CG  . ARG A 1  385 ? -33.183 -35.054 -12.836 1.00 22.44  ? 463  ARG A CG  1 
ATOM   2987 C CD  . ARG A 1  385 ? -33.524 -36.293 -13.640 1.00 22.48  ? 463  ARG A CD  1 
ATOM   2988 N NE  . ARG A 1  385 ? -32.367 -37.040 -14.109 1.00 24.31  ? 463  ARG A NE  1 
ATOM   2989 C CZ  . ARG A 1  385 ? -31.587 -37.844 -13.378 1.00 25.32  ? 463  ARG A CZ  1 
ATOM   2990 N NH1 . ARG A 1  385 ? -31.764 -38.017 -12.067 1.00 21.78  ? 463  ARG A NH1 1 
ATOM   2991 N NH2 . ARG A 1  385 ? -30.582 -38.472 -13.964 1.00 20.61  ? 463  ARG A NH2 1 
ATOM   2992 N N   . ARG A 1  386 ? -29.974 -33.087 -12.338 1.00 18.22  ? 464  ARG A N   1 
ATOM   2993 C CA  . ARG A 1  386 ? -28.861 -33.570 -11.559 1.00 17.29  ? 464  ARG A CA  1 
ATOM   2994 C C   . ARG A 1  386 ? -28.125 -32.459 -10.817 1.00 18.50  ? 464  ARG A C   1 
ATOM   2995 O O   . ARG A 1  386 ? -27.208 -32.744 -10.059 1.00 22.55  ? 464  ARG A O   1 
ATOM   2996 C CB  . ARG A 1  386 ? -27.926 -34.359 -12.468 1.00 17.36  ? 464  ARG A CB  1 
ATOM   2997 C CG  . ARG A 1  386 ? -28.585 -35.597 -13.051 1.00 20.15  ? 464  ARG A CG  1 
ATOM   2998 C CD  . ARG A 1  386 ? -27.610 -36.419 -13.887 1.00 21.45  ? 464  ARG A CD  1 
ATOM   2999 N NE  . ARG A 1  386 ? -26.713 -37.240 -13.077 1.00 25.82  ? 464  ARG A NE  1 
ATOM   3000 C CZ  . ARG A 1  386 ? -25.748 -38.012 -13.585 1.00 27.78  ? 464  ARG A CZ  1 
ATOM   3001 N NH1 . ARG A 1  386 ? -25.554 -38.081 -14.898 1.00 30.41  ? 464  ARG A NH1 1 
ATOM   3002 N NH2 . ARG A 1  386 ? -24.985 -38.722 -12.780 1.00 32.37  ? 464  ARG A NH2 1 
ATOM   3003 N N   . GLY A 1  387 ? -28.531 -31.204 -11.015 1.00 16.88  ? 465  GLY A N   1 
ATOM   3004 C CA  . GLY A 1  387 ? -27.924 -30.065 -10.319 1.00 19.31  ? 465  GLY A CA  1 
ATOM   3005 C C   . GLY A 1  387 ? -26.481 -29.793 -10.715 1.00 17.83  ? 465  GLY A C   1 
ATOM   3006 O O   . GLY A 1  387 ? -25.645 -29.529 -9.863  1.00 21.01  ? 465  GLY A O   1 
ATOM   3007 N N   . VAL A 1  388 ? -26.191 -29.817 -12.010 1.00 17.29  ? 466  VAL A N   1 
ATOM   3008 C CA  . VAL A 1  388 ? -24.795 -29.717 -12.479 1.00 16.94  ? 466  VAL A CA  1 
ATOM   3009 C C   . VAL A 1  388 ? -24.309 -28.297 -12.729 1.00 16.63  ? 466  VAL A C   1 
ATOM   3010 O O   . VAL A 1  388 ? -23.118 -28.088 -13.018 1.00 15.84  ? 466  VAL A O   1 
ATOM   3011 C CB  . VAL A 1  388 ? -24.556 -30.538 -13.773 1.00 17.43  ? 466  VAL A CB  1 
ATOM   3012 C CG1 . VAL A 1  388 ? -25.071 -31.963 -13.590 1.00 18.99  ? 466  VAL A CG1 1 
ATOM   3013 C CG2 . VAL A 1  388 ? -25.204 -29.880 -15.002 1.00 16.84  ? 466  VAL A CG2 1 
ATOM   3014 N N   . PHE A 1  389 ? -25.195 -27.321 -12.629 1.00 15.69  ? 467  PHE A N   1 
ATOM   3015 C CA  . PHE A 1  389 ? -24.859 -25.978 -13.080 1.00 16.20  ? 467  PHE A CA  1 
ATOM   3016 C C   . PHE A 1  389 ? -24.443 -25.069 -11.944 1.00 18.73  ? 467  PHE A C   1 
ATOM   3017 O O   . PHE A 1  389 ? -24.919 -25.198 -10.836 1.00 18.84  ? 467  PHE A O   1 
ATOM   3018 C CB  . PHE A 1  389 ? -26.033 -25.334 -13.821 1.00 16.51  ? 467  PHE A CB  1 
ATOM   3019 C CG  . PHE A 1  389 ? -26.450 -26.072 -15.043 1.00 15.38  ? 467  PHE A CG  1 
ATOM   3020 C CD1 . PHE A 1  389 ? -25.570 -26.219 -16.117 1.00 16.16  ? 467  PHE A CD1 1 
ATOM   3021 C CD2 . PHE A 1  389 ? -27.722 -26.622 -15.136 1.00 17.27  ? 467  PHE A CD2 1 
ATOM   3022 C CE1 . PHE A 1  389 ? -25.951 -26.918 -17.249 1.00 17.46  ? 467  PHE A CE1 1 
ATOM   3023 C CE2 . PHE A 1  389 ? -28.116 -27.301 -16.273 1.00 17.22  ? 467  PHE A CE2 1 
ATOM   3024 C CZ  . PHE A 1  389 ? -27.238 -27.459 -17.330 1.00 16.00  ? 467  PHE A CZ  1 
ATOM   3025 N N   . ILE A 1  390 ? -23.603 -24.091 -12.276 1.00 18.92  ? 468  ILE A N   1 
ATOM   3026 C CA  . ILE A 1  390 ? -23.257 -23.010 -11.359 1.00 18.19  ? 468  ILE A CA  1 
ATOM   3027 C C   . ILE A 1  390 ? -24.537 -22.244 -11.021 1.00 19.43  ? 468  ILE A C   1 
ATOM   3028 O O   . ILE A 1  390 ? -25.342 -21.928 -11.909 1.00 16.24  ? 468  ILE A O   1 
ATOM   3029 C CB  . ILE A 1  390 ? -22.198 -22.102 -11.991 1.00 18.40  ? 468  ILE A CB  1 
ATOM   3030 C CG1 . ILE A 1  390 ? -20.895 -22.914 -12.174 1.00 17.54  ? 468  ILE A CG1 1 
ATOM   3031 C CG2 . ILE A 1  390 ? -22.008 -20.826 -11.173 1.00 19.00  ? 468  ILE A CG2 1 
ATOM   3032 C CD1 . ILE A 1  390 ? -19.741 -22.160 -12.823 1.00 14.30  ? 468  ILE A CD1 1 
ATOM   3033 N N   . THR A 1  391 ? -24.741 -21.988 -9.734  1.00 16.42  ? 469  THR A N   1 
ATOM   3034 C CA  . THR A 1  391 ? -25.960 -21.343 -9.277  1.00 17.74  ? 469  THR A CA  1 
ATOM   3035 C C   . THR A 1  391 ? -25.691 -19.962 -8.689  1.00 18.66  ? 469  THR A C   1 
ATOM   3036 O O   . THR A 1  391 ? -24.548 -19.602 -8.371  1.00 19.40  ? 469  THR A O   1 
ATOM   3037 C CB  . THR A 1  391 ? -26.700 -22.213 -8.250  1.00 17.59  ? 469  THR A CB  1 
ATOM   3038 O OG1 . THR A 1  391 ? -25.806 -22.525 -7.177  1.00 17.71  ? 469  THR A OG1 1 
ATOM   3039 C CG2 . THR A 1  391 ? -27.205 -23.510 -8.921  1.00 16.11  ? 469  THR A CG2 1 
ATOM   3040 N N   . ASN A 1  392 ? -26.757 -19.190 -8.578  1.00 18.53  ? 470  ASN A N   1 
ATOM   3041 C CA  . ASN A 1  392 ? -26.674 -17.810 -8.125  1.00 19.54  ? 470  ASN A CA  1 
ATOM   3042 C C   . ASN A 1  392 ? -27.232 -17.693 -6.704  1.00 22.14  ? 470  ASN A C   1 
ATOM   3043 O O   . ASN A 1  392 ? -27.461 -18.702 -6.040  1.00 20.46  ? 470  ASN A O   1 
ATOM   3044 C CB  . ASN A 1  392 ? -27.373 -16.877 -9.143  1.00 20.54  ? 470  ASN A CB  1 
ATOM   3045 C CG  . ASN A 1  392 ? -28.883 -17.051 -9.202  1.00 23.32  ? 470  ASN A CG  1 
ATOM   3046 O OD1 . ASN A 1  392 ? -29.502 -17.725 -8.364  1.00 20.48  ? 470  ASN A OD1 1 
ATOM   3047 N ND2 . ASN A 1  392 ? -29.488 -16.429 -10.217 1.00 26.31  ? 470  ASN A ND2 1 
ATOM   3048 N N   . GLU A 1  393 ? -27.438 -16.458 -6.263  1.00 23.51  ? 471  GLU A N   1 
ATOM   3049 C CA  . GLU A 1  393 ? -27.809 -16.138 -4.890  1.00 30.19  ? 471  GLU A CA  1 
ATOM   3050 C C   . GLU A 1  393 ? -29.078 -16.847 -4.425  1.00 30.14  ? 471  GLU A C   1 
ATOM   3051 O O   . GLU A 1  393 ? -29.154 -17.277 -3.284  1.00 32.91  ? 471  GLU A O   1 
ATOM   3052 C CB  . GLU A 1  393 ? -28.007 -14.630 -4.800  1.00 42.68  ? 471  GLU A CB  1 
ATOM   3053 C CG  . GLU A 1  393 ? -27.919 -14.024 -3.426  1.00 56.13  ? 471  GLU A CG  1 
ATOM   3054 C CD  . GLU A 1  393 ? -27.737 -12.521 -3.520  1.00 63.80  ? 471  GLU A CD  1 
ATOM   3055 O OE1 . GLU A 1  393 ? -28.361 -11.875 -4.401  1.00 57.25  ? 471  GLU A OE1 1 
ATOM   3056 O OE2 . GLU A 1  393 ? -26.950 -11.989 -2.729  1.00 56.16  ? 471  GLU A OE2 1 
ATOM   3057 N N   . THR A 1  394 ? -30.061 -16.990 -5.315  1.00 23.56  ? 472  THR A N   1 
ATOM   3058 C CA  . THR A 1  394 ? -31.326 -17.619 -4.947  1.00 27.90  ? 472  THR A CA  1 
ATOM   3059 C C   . THR A 1  394 ? -31.352 -19.127 -5.228  1.00 25.92  ? 472  THR A C   1 
ATOM   3060 O O   . THR A 1  394 ? -32.408 -19.740 -5.181  1.00 32.84  ? 472  THR A O   1 
ATOM   3061 C CB  . THR A 1  394 ? -32.501 -16.882 -5.629  1.00 32.46  ? 472  THR A CB  1 
ATOM   3062 O OG1 . THR A 1  394 ? -32.252 -16.805 -7.033  1.00 38.20  ? 472  THR A OG1 1 
ATOM   3063 C CG2 . THR A 1  394 ? -32.633 -15.441 -5.062  1.00 31.92  ? 472  THR A CG2 1 
ATOM   3064 N N   . GLY A 1  395 ? -30.193 -19.717 -5.520  1.00 23.87  ? 473  GLY A N   1 
ATOM   3065 C CA  . GLY A 1  395 ? -30.060 -21.160 -5.749  1.00 23.22  ? 473  GLY A CA  1 
ATOM   3066 C C   . GLY A 1  395 ? -30.379 -21.662 -7.143  1.00 24.03  ? 473  GLY A C   1 
ATOM   3067 O O   . GLY A 1  395 ? -30.344 -22.862 -7.372  1.00 24.33  ? 473  GLY A O   1 
ATOM   3068 N N   . GLN A 1  396 ? -30.622 -20.769 -8.096  1.00 19.56  ? 474  GLN A N   1 
ATOM   3069 C CA  . GLN A 1  396 ? -31.061 -21.181 -9.427  1.00 20.66  ? 474  GLN A CA  1 
ATOM   3070 C C   . GLN A 1  396 ? -29.890 -21.107 -10.391 1.00 19.33  ? 474  GLN A C   1 
ATOM   3071 O O   . GLN A 1  396 ? -28.882 -20.484 -10.079 1.00 18.88  ? 474  GLN A O   1 
ATOM   3072 C CB  . GLN A 1  396 ? -32.214 -20.309 -9.881  1.00 23.91  ? 474  GLN A CB  1 
ATOM   3073 C CG  . GLN A 1  396 ? -33.246 -20.131 -8.781  1.00 35.93  ? 474  GLN A CG  1 
ATOM   3074 C CD  . GLN A 1  396 ? -34.267 -19.107 -9.145  1.00 47.09  ? 474  GLN A CD  1 
ATOM   3075 O OE1 . GLN A 1  396 ? -34.147 -17.936 -8.784  1.00 51.19  ? 474  GLN A OE1 1 
ATOM   3076 N NE2 . GLN A 1  396 ? -35.256 -19.526 -9.917  1.00 62.56  ? 474  GLN A NE2 1 
ATOM   3077 N N   . PRO A 1  397 ? -29.982 -21.793 -11.542 1.00 18.12  ? 475  PRO A N   1 
ATOM   3078 C CA  . PRO A 1  397 ? -28.825 -21.725 -12.441 1.00 18.93  ? 475  PRO A CA  1 
ATOM   3079 C C   . PRO A 1  397 ? -28.532 -20.285 -12.858 1.00 17.03  ? 475  PRO A C   1 
ATOM   3080 O O   . PRO A 1  397 ? -29.461 -19.518 -13.139 1.00 16.97  ? 475  PRO A O   1 
ATOM   3081 C CB  . PRO A 1  397 ? -29.261 -22.558 -13.661 1.00 19.84  ? 475  PRO A CB  1 
ATOM   3082 C CG  . PRO A 1  397 ? -30.323 -23.462 -13.132 1.00 22.22  ? 475  PRO A CG  1 
ATOM   3083 C CD  . PRO A 1  397 ? -31.043 -22.669 -12.068 1.00 20.22  ? 475  PRO A CD  1 
ATOM   3084 N N   . LEU A 1  398 ? -27.255 -19.907 -12.828 1.00 16.41  ? 476  LEU A N   1 
ATOM   3085 C CA  . LEU A 1  398 ? -26.832 -18.630 -13.384 1.00 18.45  ? 476  LEU A CA  1 
ATOM   3086 C C   . LEU A 1  398 ? -26.952 -18.727 -14.898 1.00 17.23  ? 476  LEU A C   1 
ATOM   3087 O O   . LEU A 1  398 ? -26.400 -19.661 -15.506 1.00 17.71  ? 476  LEU A O   1 
ATOM   3088 C CB  . LEU A 1  398 ? -25.406 -18.300 -12.968 1.00 17.95  ? 476  LEU A CB  1 
ATOM   3089 C CG  . LEU A 1  398 ? -24.846 -16.947 -13.453 1.00 18.08  ? 476  LEU A CG  1 
ATOM   3090 C CD1 . LEU A 1  398 ? -23.836 -16.426 -12.435 1.00 19.76  ? 476  LEU A CD1 1 
ATOM   3091 C CD2 . LEU A 1  398 ? -24.211 -17.049 -14.854 1.00 16.76  ? 476  LEU A CD2 1 
ATOM   3092 N N   . ILE A 1  399 ? -27.689 -17.787 -15.496 1.00 15.31  ? 477  ILE A N   1 
ATOM   3093 C CA  . ILE A 1  399 ? -27.899 -17.765 -16.935 1.00 15.76  ? 477  ILE A CA  1 
ATOM   3094 C C   . ILE A 1  399 ? -27.142 -16.629 -17.576 1.00 17.63  ? 477  ILE A C   1 
ATOM   3095 O O   . ILE A 1  399 ? -27.336 -15.470 -17.200 1.00 17.51  ? 477  ILE A O   1 
ATOM   3096 C CB  . ILE A 1  399 ? -29.383 -17.636 -17.318 1.00 17.59  ? 477  ILE A CB  1 
ATOM   3097 C CG1 . ILE A 1  399 ? -30.209 -18.737 -16.636 1.00 17.02  ? 477  ILE A CG1 1 
ATOM   3098 C CG2 . ILE A 1  399 ? -29.553 -17.674 -18.849 1.00 16.46  ? 477  ILE A CG2 1 
ATOM   3099 C CD1 . ILE A 1  399 ? -29.724 -20.166 -16.884 1.00 17.28  ? 477  ILE A CD1 1 
ATOM   3100 N N   . GLY A 1  400 ? -26.306 -16.968 -18.560 1.00 17.43  ? 478  GLY A N   1 
ATOM   3101 C CA  . GLY A 1  400 ? -25.563 -15.985 -19.336 1.00 18.02  ? 478  GLY A CA  1 
ATOM   3102 C C   . GLY A 1  400 ? -25.995 -16.060 -20.777 1.00 18.61  ? 478  GLY A C   1 
ATOM   3103 O O   . GLY A 1  400 ? -27.044 -16.629 -21.090 1.00 18.75  ? 478  GLY A O   1 
ATOM   3104 N N   . LYS A 1  401 ? -25.183 -15.472 -21.650 1.00 20.40  ? 479  LYS A N   1 
ATOM   3105 C CA  . LYS A 1  401 ? -25.415 -15.491 -23.087 1.00 20.81  ? 479  LYS A CA  1 
ATOM   3106 C C   . LYS A 1  401 ? -24.153 -15.882 -23.846 1.00 19.96  ? 479  LYS A C   1 
ATOM   3107 O O   . LYS A 1  401 ? -23.140 -15.198 -23.747 1.00 18.89  ? 479  LYS A O   1 
ATOM   3108 C CB  . LYS A 1  401 ? -25.827 -14.111 -23.571 1.00 24.75  ? 479  LYS A CB  1 
ATOM   3109 C CG  . LYS A 1  401 ? -27.185 -13.635 -23.088 1.00 33.25  ? 479  LYS A CG  1 
ATOM   3110 C CD  . LYS A 1  401 ? -28.321 -14.293 -23.831 1.00 33.94  ? 479  LYS A CD  1 
ATOM   3111 C CE  . LYS A 1  401 ? -29.592 -13.470 -23.728 1.00 35.32  ? 479  LYS A CE  1 
ATOM   3112 N NZ  . LYS A 1  401 ? -30.683 -14.225 -24.391 1.00 37.12  ? 479  LYS A NZ  1 
ATOM   3113 N N   . VAL A 1  402 ? -24.217 -16.955 -24.630 1.00 17.32  ? 480  VAL A N   1 
ATOM   3114 C CA  . VAL A 1  402 ? -23.078 -17.325 -25.504 1.00 20.74  ? 480  VAL A CA  1 
ATOM   3115 C C   . VAL A 1  402 ? -23.662 -17.737 -26.848 1.00 17.83  ? 480  VAL A C   1 
ATOM   3116 O O   . VAL A 1  402 ? -24.744 -17.277 -27.175 1.00 17.27  ? 480  VAL A O   1 
ATOM   3117 C CB  . VAL A 1  402 ? -22.146 -18.402 -24.880 1.00 19.80  ? 480  VAL A CB  1 
ATOM   3118 C CG1 . VAL A 1  402 ? -20.716 -18.124 -25.274 1.00 28.57  ? 480  VAL A CG1 1 
ATOM   3119 C CG2 . VAL A 1  402 ? -22.185 -18.403 -23.366 1.00 28.22  ? 480  VAL A CG2 1 
ATOM   3120 N N   . TRP A 1  403 ? -22.996 -18.594 -27.621 1.00 17.72  ? 481  TRP A N   1 
ATOM   3121 C CA  . TRP A 1  403 ? -23.420 -18.839 -29.009 1.00 19.61  ? 481  TRP A CA  1 
ATOM   3122 C C   . TRP A 1  403 ? -24.871 -19.300 -29.217 1.00 21.49  ? 481  TRP A C   1 
ATOM   3123 O O   . TRP A 1  403 ? -25.515 -18.859 -30.167 1.00 21.77  ? 481  TRP A O   1 
ATOM   3124 C CB  . TRP A 1  403 ? -22.420 -19.742 -29.740 1.00 21.92  ? 481  TRP A CB  1 
ATOM   3125 C CG  . TRP A 1  403 ? -21.141 -19.008 -30.024 1.00 21.70  ? 481  TRP A CG  1 
ATOM   3126 C CD1 . TRP A 1  403 ? -19.931 -19.220 -29.445 1.00 21.22  ? 481  TRP A CD1 1 
ATOM   3127 C CD2 . TRP A 1  403 ? -20.973 -17.889 -30.915 1.00 23.23  ? 481  TRP A CD2 1 
ATOM   3128 N NE1 . TRP A 1  403 ? -19.010 -18.326 -29.938 1.00 25.89  ? 481  TRP A NE1 1 
ATOM   3129 C CE2 . TRP A 1  403 ? -19.621 -17.497 -30.841 1.00 26.98  ? 481  TRP A CE2 1 
ATOM   3130 C CE3 . TRP A 1  403 ? -21.832 -17.192 -31.768 1.00 31.89  ? 481  TRP A CE3 1 
ATOM   3131 C CZ2 . TRP A 1  403 ? -19.101 -16.437 -31.590 1.00 26.64  ? 481  TRP A CZ2 1 
ATOM   3132 C CZ3 . TRP A 1  403 ? -21.313 -16.139 -32.535 1.00 37.07  ? 481  TRP A CZ3 1 
ATOM   3133 C CH2 . TRP A 1  403 ? -19.961 -15.768 -32.425 1.00 31.27  ? 481  TRP A CH2 1 
ATOM   3134 N N   . PRO A 1  404 ? -25.398 -20.174 -28.340 1.00 21.64  ? 482  PRO A N   1 
ATOM   3135 C CA  . PRO A 1  404 ? -26.784 -20.564 -28.612 1.00 21.84  ? 482  PRO A CA  1 
ATOM   3136 C C   . PRO A 1  404 ? -27.838 -19.586 -28.126 1.00 21.19  ? 482  PRO A C   1 
ATOM   3137 O O   . PRO A 1  404 ? -28.995 -19.800 -28.435 1.00 24.31  ? 482  PRO A O   1 
ATOM   3138 C CB  . PRO A 1  404 ? -26.939 -21.913 -27.887 1.00 23.23  ? 482  PRO A CB  1 
ATOM   3139 C CG  . PRO A 1  404 ? -25.846 -21.995 -26.904 1.00 20.66  ? 482  PRO A CG  1 
ATOM   3140 C CD  . PRO A 1  404 ? -24.765 -21.018 -27.311 1.00 20.35  ? 482  PRO A CD  1 
ATOM   3141 N N   . GLY A 1  405 ? -27.453 -18.509 -27.432 1.00 19.69  ? 483  GLY A N   1 
ATOM   3142 C CA  . GLY A 1  405 ? -28.395 -17.643 -26.742 1.00 19.91  ? 483  GLY A CA  1 
ATOM   3143 C C   . GLY A 1  405 ? -28.212 -17.845 -25.242 1.00 19.01  ? 483  GLY A C   1 
ATOM   3144 O O   . GLY A 1  405 ? -27.076 -17.952 -24.773 1.00 16.92  ? 483  GLY A O   1 
ATOM   3145 N N   . SER A 1  406 ? -29.315 -17.878 -24.491 1.00 17.59  ? 484  SER A N   1 
ATOM   3146 C CA  . SER A 1  406 ? -29.265 -18.094 -23.039 1.00 16.47  ? 484  SER A CA  1 
ATOM   3147 C C   . SER A 1  406 ? -28.653 -19.435 -22.687 1.00 17.26  ? 484  SER A C   1 
ATOM   3148 O O   . SER A 1  406 ? -29.029 -20.436 -23.281 1.00 17.52  ? 484  SER A O   1 
ATOM   3149 C CB  . SER A 1  406 ? -30.680 -18.048 -22.446 1.00 17.43  ? 484  SER A CB  1 
ATOM   3150 O OG  . SER A 1  406 ? -31.249 -16.767 -22.603 1.00 18.24  ? 484  SER A OG  1 
ATOM   3151 N N   . THR A 1  407 ? -27.737 -19.457 -21.705 1.00 16.68  ? 485  THR A N   1 
ATOM   3152 C CA  . THR A 1  407 ? -27.068 -20.674 -21.305 1.00 16.05  ? 485  THR A CA  1 
ATOM   3153 C C   . THR A 1  407 ? -26.782 -20.735 -19.819 1.00 16.62  ? 485  THR A C   1 
ATOM   3154 O O   . THR A 1  407 ? -26.490 -19.705 -19.182 1.00 15.93  ? 485  THR A O   1 
ATOM   3155 C CB  . THR A 1  407 ? -25.675 -20.786 -21.949 1.00 18.90  ? 485  THR A CB  1 
ATOM   3156 O OG1 . THR A 1  407 ? -24.883 -19.646 -21.552 1.00 15.04  ? 485  THR A OG1 1 
ATOM   3157 C CG2 . THR A 1  407 ? -25.758 -20.894 -23.444 1.00 17.82  ? 485  THR A CG2 1 
ATOM   3158 N N   . ALA A 1  408 ? -26.778 -21.960 -19.295 1.00 16.04  ? 486  ALA A N   1 
ATOM   3159 C CA  . ALA A 1  408 ? -26.289 -22.229 -17.951 1.00 15.08  ? 486  ALA A CA  1 
ATOM   3160 C C   . ALA A 1  408 ? -24.867 -22.733 -18.083 1.00 16.22  ? 486  ALA A C   1 
ATOM   3161 O O   . ALA A 1  408 ? -24.443 -23.138 -19.177 1.00 15.73  ? 486  ALA A O   1 
ATOM   3162 C CB  . ALA A 1  408 ? -27.173 -23.257 -17.249 1.00 17.32  ? 486  ALA A CB  1 
ATOM   3163 N N   . PHE A 1  409 ? -24.120 -22.701 -16.979 1.00 15.27  ? 487  PHE A N   1 
ATOM   3164 C CA  . PHE A 1  409 ? -22.688 -23.019 -17.010 1.00 14.32  ? 487  PHE A CA  1 
ATOM   3165 C C   . PHE A 1  409 ? -22.415 -24.221 -16.131 1.00 14.85  ? 487  PHE A C   1 
ATOM   3166 O O   . PHE A 1  409 ? -22.701 -24.171 -14.927 1.00 13.66  ? 487  PHE A O   1 
ATOM   3167 C CB  . PHE A 1  409 ? -21.898 -21.813 -16.516 1.00 17.11  ? 487  PHE A CB  1 
ATOM   3168 C CG  . PHE A 1  409 ? -21.953 -20.656 -17.458 1.00 14.95  ? 487  PHE A CG  1 
ATOM   3169 C CD1 . PHE A 1  409 ? -23.015 -19.756 -17.405 1.00 16.84  ? 487  PHE A CD1 1 
ATOM   3170 C CD2 . PHE A 1  409 ? -20.979 -20.497 -18.419 1.00 15.38  ? 487  PHE A CD2 1 
ATOM   3171 C CE1 . PHE A 1  409 ? -23.093 -18.712 -18.294 1.00 16.90  ? 487  PHE A CE1 1 
ATOM   3172 C CE2 . PHE A 1  409 ? -21.041 -19.436 -19.310 1.00 18.72  ? 487  PHE A CE2 1 
ATOM   3173 C CZ  . PHE A 1  409 ? -22.105 -18.545 -19.249 1.00 16.34  ? 487  PHE A CZ  1 
ATOM   3174 N N   . PRO A 1  410 ? -21.909 -25.321 -16.714 1.00 14.76  ? 488  PRO A N   1 
ATOM   3175 C CA  . PRO A 1  410 ? -21.601 -26.475 -15.849 1.00 15.76  ? 488  PRO A CA  1 
ATOM   3176 C C   . PRO A 1  410 ? -20.530 -26.191 -14.809 1.00 17.13  ? 488  PRO A C   1 
ATOM   3177 O O   . PRO A 1  410 ? -19.585 -25.449 -15.072 1.00 17.71  ? 488  PRO A O   1 
ATOM   3178 C CB  . PRO A 1  410 ? -21.084 -27.534 -16.818 1.00 13.91  ? 488  PRO A CB  1 
ATOM   3179 C CG  . PRO A 1  410 ? -21.646 -27.165 -18.124 1.00 17.06  ? 488  PRO A CG  1 
ATOM   3180 C CD  . PRO A 1  410 ? -21.744 -25.655 -18.142 1.00 15.80  ? 488  PRO A CD  1 
ATOM   3181 N N   . ASP A 1  411 ? -20.696 -26.796 -13.646 1.00 15.71  ? 489  ASP A N   1 
ATOM   3182 C CA  . ASP A 1  411 ? -19.736 -26.710 -12.558 1.00 15.05  ? 489  ASP A CA  1 
ATOM   3183 C C   . ASP A 1  411 ? -18.870 -27.951 -12.559 1.00 13.93  ? 489  ASP A C   1 
ATOM   3184 O O   . ASP A 1  411 ? -19.237 -28.986 -11.990 1.00 16.54  ? 489  ASP A O   1 
ATOM   3185 C CB  . ASP A 1  411 ? -20.503 -26.576 -11.243 1.00 16.35  ? 489  ASP A CB  1 
ATOM   3186 C CG  . ASP A 1  411 ? -19.615 -26.697 -10.028 1.00 15.94  ? 489  ASP A CG  1 
ATOM   3187 O OD1 . ASP A 1  411 ? -18.359 -26.646 -10.146 1.00 15.42  ? 489  ASP A OD1 1 
ATOM   3188 O OD2 . ASP A 1  411 ? -20.201 -26.879 -8.949  1.00 17.28  ? 489  ASP A OD2 1 
ATOM   3189 N N   . PHE A 1  412 ? -17.705 -27.851 -13.167 1.00 14.31  ? 490  PHE A N   1 
ATOM   3190 C CA  . PHE A 1  412 ? -16.823 -29.010 -13.289 1.00 17.17  ? 490  PHE A CA  1 
ATOM   3191 C C   . PHE A 1  412 ? -16.042 -29.332 -11.987 1.00 18.81  ? 490  PHE A C   1 
ATOM   3192 O O   . PHE A 1  412 ? -15.190 -30.210 -11.996 1.00 17.43  ? 490  PHE A O   1 
ATOM   3193 C CB  . PHE A 1  412 ? -15.897 -28.855 -14.494 1.00 15.66  ? 490  PHE A CB  1 
ATOM   3194 C CG  . PHE A 1  412 ? -16.629 -28.838 -15.834 1.00 15.29  ? 490  PHE A CG  1 
ATOM   3195 C CD1 . PHE A 1  412 ? -17.158 -30.006 -16.361 1.00 17.86  ? 490  PHE A CD1 1 
ATOM   3196 C CD2 . PHE A 1  412 ? -16.756 -27.669 -16.567 1.00 16.41  ? 490  PHE A CD2 1 
ATOM   3197 C CE1 . PHE A 1  412 ? -17.808 -30.008 -17.590 1.00 18.13  ? 490  PHE A CE1 1 
ATOM   3198 C CE2 . PHE A 1  412 ? -17.431 -27.646 -17.785 1.00 15.95  ? 490  PHE A CE2 1 
ATOM   3199 C CZ  . PHE A 1  412 ? -17.950 -28.823 -18.306 1.00 16.97  ? 490  PHE A CZ  1 
ATOM   3200 N N   . THR A 1  413 ? -16.344 -28.643 -10.882 1.00 18.22  ? 491  THR A N   1 
ATOM   3201 C CA  . THR A 1  413 ? -15.942 -29.114 -9.539  1.00 17.43  ? 491  THR A CA  1 
ATOM   3202 C C   . THR A 1  413 ? -16.963 -30.009 -8.856  1.00 20.02  ? 491  THR A C   1 
ATOM   3203 O O   . THR A 1  413 ? -16.671 -30.566 -7.792  1.00 20.17  ? 491  THR A O   1 
ATOM   3204 C CB  . THR A 1  413 ? -15.586 -27.961 -8.595  1.00 18.21  ? 491  THR A CB  1 
ATOM   3205 O OG1 . THR A 1  413 ? -16.770 -27.274 -8.140  1.00 15.74  ? 491  THR A OG1 1 
ATOM   3206 C CG2 . THR A 1  413 ? -14.645 -27.001 -9.277  1.00 17.22  ? 491  THR A CG2 1 
ATOM   3207 N N   . ASN A 1  414 ? -18.158 -30.143 -9.440  1.00 17.64  ? 492  ASN A N   1 
ATOM   3208 C CA  . ASN A 1  414 ? -19.191 -30.993 -8.886  1.00 16.95  ? 492  ASN A CA  1 
ATOM   3209 C C   . ASN A 1  414 ? -19.024 -32.435 -9.433  1.00 17.01  ? 492  ASN A C   1 
ATOM   3210 O O   . ASN A 1  414 ? -19.106 -32.646 -10.633 1.00 18.26  ? 492  ASN A O   1 
ATOM   3211 C CB  . ASN A 1  414 ? -20.557 -30.439 -9.256  1.00 18.47  ? 492  ASN A CB  1 
ATOM   3212 C CG  . ASN A 1  414 ? -21.703 -31.200 -8.627  1.00 19.58  ? 492  ASN A CG  1 
ATOM   3213 O OD1 . ASN A 1  414 ? -21.573 -32.347 -8.203  1.00 20.54  ? 492  ASN A OD1 1 
ATOM   3214 N ND2 . ASN A 1  414 ? -22.865 -30.564 -8.610  1.00 23.81  ? 492  ASN A ND2 1 
ATOM   3215 N N   . PRO A 1  415 ? -18.807 -33.426 -8.556  1.00 17.98  ? 493  PRO A N   1 
ATOM   3216 C CA  . PRO A 1  415 ? -18.666 -34.803 -9.078  1.00 18.23  ? 493  PRO A CA  1 
ATOM   3217 C C   . PRO A 1  415 ? -19.853 -35.262 -9.912  1.00 17.65  ? 493  PRO A C   1 
ATOM   3218 O O   . PRO A 1  415 ? -19.653 -35.999 -10.871 1.00 19.63  ? 493  PRO A O   1 
ATOM   3219 C CB  . PRO A 1  415 ? -18.536 -35.670 -7.825  1.00 20.28  ? 493  PRO A CB  1 
ATOM   3220 C CG  . PRO A 1  415 ? -18.274 -34.744 -6.684  1.00 23.30  ? 493  PRO A CG  1 
ATOM   3221 C CD  . PRO A 1  415 ? -18.572 -33.333 -7.099  1.00 19.54  ? 493  PRO A CD  1 
ATOM   3222 N N   . THR A 1  416 ? -21.070 -34.814 -9.575  1.00 17.15  ? 494  THR A N   1 
ATOM   3223 C CA  . THR A 1  416 ? -22.251 -35.160 -10.389 1.00 18.11  ? 494  THR A CA  1 
ATOM   3224 C C   . THR A 1  416 ? -22.204 -34.557 -11.789 1.00 19.00  ? 494  THR A C   1 
ATOM   3225 O O   . THR A 1  416 ? -22.674 -35.177 -12.741 1.00 20.00  ? 494  THR A O   1 
ATOM   3226 C CB  . THR A 1  416 ? -23.548 -34.739 -9.698  1.00 17.86  ? 494  THR A CB  1 
ATOM   3227 O OG1 . THR A 1  416 ? -23.572 -35.358 -8.429  1.00 19.91  ? 494  THR A OG1 1 
ATOM   3228 C CG2 . THR A 1  416 ? -24.793 -35.167 -10.478 1.00 18.74  ? 494  THR A CG2 1 
ATOM   3229 N N   . ALA A 1  417 ? -21.680 -33.338 -11.904 1.00 18.75  ? 495  ALA A N   1 
ATOM   3230 C CA  . ALA A 1  417 ? -21.445 -32.723 -13.221 1.00 17.95  ? 495  ALA A CA  1 
ATOM   3231 C C   . ALA A 1  417 ? -20.432 -33.499 -14.038 1.00 18.36  ? 495  ALA A C   1 
ATOM   3232 O O   . ALA A 1  417 ? -20.555 -33.592 -15.268 1.00 15.98  ? 495  ALA A O   1 
ATOM   3233 C CB  . ALA A 1  417 ? -20.978 -31.286 -13.070 1.00 17.61  ? 495  ALA A CB  1 
ATOM   3234 N N   . LEU A 1  418 ? -19.400 -34.031 -13.383 1.00 16.22  ? 496  LEU A N   1 
ATOM   3235 C CA  . LEU A 1  418 ? -18.435 -34.892 -14.087 1.00 19.43  ? 496  LEU A CA  1 
ATOM   3236 C C   . LEU A 1  418 ? -19.123 -36.110 -14.709 1.00 17.25  ? 496  LEU A C   1 
ATOM   3237 O O   . LEU A 1  418 ? -18.865 -36.456 -15.872 1.00 15.64  ? 496  LEU A O   1 
ATOM   3238 C CB  . LEU A 1  418 ? -17.326 -35.371 -13.158 1.00 24.40  ? 496  LEU A CB  1 
ATOM   3239 C CG  . LEU A 1  418 ? -16.458 -34.288 -12.521 1.00 34.49  ? 496  LEU A CG  1 
ATOM   3240 C CD1 . LEU A 1  418 ? -15.466 -34.885 -11.516 1.00 32.05  ? 496  LEU A CD1 1 
ATOM   3241 C CD2 . LEU A 1  418 ? -15.757 -33.504 -13.614 1.00 28.24  ? 496  LEU A CD2 1 
ATOM   3242 N N   . ALA A 1  419 ? -20.013 -36.737 -13.934 1.00 16.13  ? 497  ALA A N   1 
ATOM   3243 C CA  . ALA A 1  419 ? -20.710 -37.938 -14.383 1.00 16.48  ? 497  ALA A CA  1 
ATOM   3244 C C   . ALA A 1  419 ? -21.660 -37.582 -15.539 1.00 18.42  ? 497  ALA A C   1 
ATOM   3245 O O   . ALA A 1  419 ? -21.749 -38.300 -16.534 1.00 17.66  ? 497  ALA A O   1 
ATOM   3246 C CB  . ALA A 1  419 ? -21.464 -38.573 -13.230 1.00 18.75  ? 497  ALA A CB  1 
ATOM   3247 N N   . TRP A 1  420 ? -22.333 -36.444 -15.395 1.00 16.87  ? 498  TRP A N   1 
ATOM   3248 C CA  . TRP A 1  420 ? -23.199 -35.917 -16.440 1.00 17.10  ? 498  TRP A CA  1 
ATOM   3249 C C   . TRP A 1  420 ? -22.424 -35.631 -17.711 1.00 16.73  ? 498  TRP A C   1 
ATOM   3250 O O   . TRP A 1  420 ? -22.909 -35.952 -18.802 1.00 15.87  ? 498  TRP A O   1 
ATOM   3251 C CB  . TRP A 1  420 ? -23.941 -34.676 -15.934 1.00 16.71  ? 498  TRP A CB  1 
ATOM   3252 C CG  . TRP A 1  420 ? -24.563 -33.819 -16.959 1.00 16.05  ? 498  TRP A CG  1 
ATOM   3253 C CD1 . TRP A 1  420 ? -25.780 -33.989 -17.551 1.00 17.47  ? 498  TRP A CD1 1 
ATOM   3254 C CD2 . TRP A 1  420 ? -24.002 -32.632 -17.514 1.00 16.13  ? 498  TRP A CD2 1 
ATOM   3255 N NE1 . TRP A 1  420 ? -26.015 -32.972 -18.445 1.00 15.85  ? 498  TRP A NE1 1 
ATOM   3256 C CE2 . TRP A 1  420 ? -24.933 -32.124 -18.442 1.00 16.38  ? 498  TRP A CE2 1 
ATOM   3257 C CE3 . TRP A 1  420 ? -22.793 -31.949 -17.321 1.00 16.75  ? 498  TRP A CE3 1 
ATOM   3258 C CZ2 . TRP A 1  420 ? -24.690 -30.960 -19.182 1.00 16.98  ? 498  TRP A CZ2 1 
ATOM   3259 C CZ3 . TRP A 1  420 ? -22.562 -30.774 -18.044 1.00 19.36  ? 498  TRP A CZ3 1 
ATOM   3260 C CH2 . TRP A 1  420 ? -23.494 -30.309 -18.975 1.00 17.17  ? 498  TRP A CH2 1 
ATOM   3261 N N   . TRP A 1  421 ? -21.234 -35.034 -17.584 1.00 16.18  ? 499  TRP A N   1 
ATOM   3262 C CA  . TRP A 1  421 ? -20.420 -34.712 -18.761 1.00 16.92  ? 499  TRP A CA  1 
ATOM   3263 C C   . TRP A 1  421 ? -19.963 -35.969 -19.468 1.00 18.06  ? 499  TRP A C   1 
ATOM   3264 O O   . TRP A 1  421 ? -20.048 -36.063 -20.701 1.00 18.74  ? 499  TRP A O   1 
ATOM   3265 C CB  . TRP A 1  421 ? -19.214 -33.888 -18.369 1.00 17.15  ? 499  TRP A CB  1 
ATOM   3266 C CG  . TRP A 1  421 ? -18.434 -33.212 -19.454 1.00 17.29  ? 499  TRP A CG  1 
ATOM   3267 C CD1 . TRP A 1  421 ? -17.147 -33.461 -19.781 1.00 16.65  ? 499  TRP A CD1 1 
ATOM   3268 C CD2 . TRP A 1  421 ? -18.856 -32.106 -20.280 1.00 15.27  ? 499  TRP A CD2 1 
ATOM   3269 N NE1 . TRP A 1  421 ? -16.725 -32.584 -20.765 1.00 17.74  ? 499  TRP A NE1 1 
ATOM   3270 C CE2 . TRP A 1  421 ? -17.752 -31.736 -21.077 1.00 17.70  ? 499  TRP A CE2 1 
ATOM   3271 C CE3 . TRP A 1  421 ? -20.046 -31.369 -20.394 1.00 15.16  ? 499  TRP A CE3 1 
ATOM   3272 C CZ2 . TRP A 1  421 ? -17.811 -30.673 -22.011 1.00 16.49  ? 499  TRP A CZ2 1 
ATOM   3273 C CZ3 . TRP A 1  421 ? -20.107 -30.314 -21.325 1.00 15.85  ? 499  TRP A CZ3 1 
ATOM   3274 C CH2 . TRP A 1  421 ? -18.989 -29.977 -22.113 1.00 15.46  ? 499  TRP A CH2 1 
ATOM   3275 N N   . GLU A 1  422 ? -19.463 -36.918 -18.693 1.00 19.43  ? 500  GLU A N   1 
ATOM   3276 C CA  . GLU A 1  422 ? -19.113 -38.248 -19.229 1.00 17.13  ? 500  GLU A CA  1 
ATOM   3277 C C   . GLU A 1  422 ? -20.279 -38.859 -19.990 1.00 18.22  ? 500  GLU A C   1 
ATOM   3278 O O   . GLU A 1  422 ? -20.077 -39.362 -21.092 1.00 15.31  ? 500  GLU A O   1 
ATOM   3279 C CB  . GLU A 1  422 ? -18.688 -39.189 -18.118 1.00 20.75  ? 500  GLU A CB  1 
ATOM   3280 C CG  . GLU A 1  422 ? -17.364 -38.805 -17.452 1.00 25.63  ? 500  GLU A CG  1 
ATOM   3281 C CD  . GLU A 1  422 ? -17.207 -39.394 -16.062 1.00 28.21  ? 500  GLU A CD  1 
ATOM   3282 O OE1 . GLU A 1  422 ? -18.052 -40.215 -15.652 1.00 25.11  ? 500  GLU A OE1 1 
ATOM   3283 O OE2 . GLU A 1  422 ? -16.232 -39.036 -15.391 1.00 27.93  ? 500  GLU A OE2 1 
ATOM   3284 N N   . ASP A 1  423 ? -21.481 -38.775 -19.415 1.00 16.09  ? 501  ASP A N   1 
ATOM   3285 C CA  . ASP A 1  423 ? -22.677 -39.315 -20.047 1.00 18.76  ? 501  ASP A CA  1 
ATOM   3286 C C   . ASP A 1  423 ? -23.032 -38.591 -21.346 1.00 19.34  ? 501  ASP A C   1 
ATOM   3287 O O   . ASP A 1  423 ? -23.385 -39.254 -22.318 1.00 21.22  ? 501  ASP A O   1 
ATOM   3288 C CB  . ASP A 1  423 ? -23.893 -39.259 -19.119 1.00 21.13  ? 501  ASP A CB  1 
ATOM   3289 C CG  . ASP A 1  423 ? -23.810 -40.222 -17.950 1.00 24.94  ? 501  ASP A CG  1 
ATOM   3290 O OD1 . ASP A 1  423 ? -22.877 -41.067 -17.874 1.00 22.91  ? 501  ASP A OD1 1 
ATOM   3291 O OD2 . ASP A 1  423 ? -24.702 -40.100 -17.078 1.00 22.43  ? 501  ASP A OD2 1 
ATOM   3292 N N   . MET A 1  424 ? -22.959 -37.251 -21.362 1.00 15.88  ? 502  MET A N   1 
ATOM   3293 C CA  . MET A 1  424 ? -23.310 -36.485 -22.566 1.00 17.23  ? 502  MET A CA  1 
ATOM   3294 C C   . MET A 1  424 ? -22.313 -36.764 -23.687 1.00 17.07  ? 502  MET A C   1 
ATOM   3295 O O   . MET A 1  424 ? -22.707 -36.916 -24.818 1.00 16.64  ? 502  MET A O   1 
ATOM   3296 C CB  . MET A 1  424 ? -23.359 -34.981 -22.292 1.00 16.57  ? 502  MET A CB  1 
ATOM   3297 C CG  . MET A 1  424 ? -24.423 -34.515 -21.309 1.00 18.54  ? 502  MET A CG  1 
ATOM   3298 S SD  . MET A 1  424 ? -26.074 -35.061 -21.741 1.00 21.18  ? 502  MET A SD  1 
ATOM   3299 C CE  . MET A 1  424 ? -26.298 -36.572 -20.816 1.00 21.58  ? 502  MET A CE  1 
ATOM   3300 N N   . VAL A 1  425 ? -21.028 -36.845 -23.337 1.00 16.64  ? 503  VAL A N   1 
ATOM   3301 C CA  . VAL A 1  425 ? -19.962 -37.190 -24.282 1.00 16.03  ? 503  VAL A CA  1 
ATOM   3302 C C   . VAL A 1  425 ? -20.146 -38.619 -24.829 1.00 17.96  ? 503  VAL A C   1 
ATOM   3303 O O   . VAL A 1  425 ? -20.003 -38.837 -26.043 1.00 17.96  ? 503  VAL A O   1 
ATOM   3304 C CB  . VAL A 1  425 ? -18.580 -36.992 -23.620 1.00 17.01  ? 503  VAL A CB  1 
ATOM   3305 C CG1 . VAL A 1  425 ? -17.443 -37.665 -24.393 1.00 20.54  ? 503  VAL A CG1 1 
ATOM   3306 C CG2 . VAL A 1  425 ? -18.303 -35.491 -23.439 1.00 19.28  ? 503  VAL A CG2 1 
ATOM   3307 N N   . ALA A 1  426 ? -20.449 -39.585 -23.961 1.00 15.09  ? 504  ALA A N   1 
ATOM   3308 C CA  . ALA A 1  426 ? -20.621 -40.969 -24.417 1.00 16.27  ? 504  ALA A CA  1 
ATOM   3309 C C   . ALA A 1  426 ? -21.851 -41.103 -25.316 1.00 18.93  ? 504  ALA A C   1 
ATOM   3310 O O   . ALA A 1  426 ? -21.815 -41.807 -26.342 1.00 17.91  ? 504  ALA A O   1 
ATOM   3311 C CB  . ALA A 1  426 ? -20.725 -41.921 -23.241 1.00 18.03  ? 504  ALA A CB  1 
ATOM   3312 N N   . GLU A 1  427 ? -22.935 -40.420 -24.954 1.00 18.92  ? 505  GLU A N   1 
ATOM   3313 C CA  . GLU A 1  427 ? -24.167 -40.509 -25.760 1.00 18.93  ? 505  GLU A CA  1 
ATOM   3314 C C   . GLU A 1  427 ? -23.985 -39.866 -27.121 1.00 19.92  ? 505  GLU A C   1 
ATOM   3315 O O   . GLU A 1  427 ? -24.416 -40.433 -28.131 1.00 18.70  ? 505  GLU A O   1 
ATOM   3316 C CB  . GLU A 1  427 ? -25.356 -39.874 -25.042 1.00 19.73  ? 505  GLU A CB  1 
ATOM   3317 C CG  . GLU A 1  427 ? -25.889 -40.726 -23.901 1.00 21.80  ? 505  GLU A CG  1 
ATOM   3318 C CD  . GLU A 1  427 ? -26.843 -39.959 -22.998 1.00 21.55  ? 505  GLU A CD  1 
ATOM   3319 O OE1 . GLU A 1  427 ? -27.408 -38.926 -23.404 1.00 22.07  ? 505  GLU A OE1 1 
ATOM   3320 O OE2 . GLU A 1  427 ? -27.008 -40.392 -21.866 1.00 26.19  ? 505  GLU A OE2 1 
ATOM   3321 N N   . PHE A 1  428 ? -23.326 -38.699 -27.163 1.00 16.88  ? 506  PHE A N   1 
ATOM   3322 C CA  . PHE A 1  428 ? -23.031 -38.084 -28.445 1.00 18.82  ? 506  PHE A CA  1 
ATOM   3323 C C   . PHE A 1  428 ? -22.067 -38.937 -29.273 1.00 18.92  ? 506  PHE A C   1 
ATOM   3324 O O   . PHE A 1  428 ? -22.287 -39.125 -30.485 1.00 17.11  ? 506  PHE A O   1 
ATOM   3325 C CB  . PHE A 1  428 ? -22.523 -36.632 -28.272 1.00 18.42  ? 506  PHE A CB  1 
ATOM   3326 C CG  . PHE A 1  428 ? -22.640 -35.791 -29.516 1.00 18.61  ? 506  PHE A CG  1 
ATOM   3327 C CD1 . PHE A 1  428 ? -23.838 -35.713 -30.213 1.00 21.23  ? 506  PHE A CD1 1 
ATOM   3328 C CD2 . PHE A 1  428 ? -21.554 -35.072 -29.999 1.00 19.03  ? 506  PHE A CD2 1 
ATOM   3329 C CE1 . PHE A 1  428 ? -23.944 -34.943 -31.372 1.00 23.69  ? 506  PHE A CE1 1 
ATOM   3330 C CE2 . PHE A 1  428 ? -21.657 -34.308 -31.157 1.00 18.38  ? 506  PHE A CE2 1 
ATOM   3331 C CZ  . PHE A 1  428 ? -22.854 -34.233 -31.829 1.00 20.61  ? 506  PHE A CZ  1 
ATOM   3332 N N   . HIS A 1  429 ? -21.026 -39.473 -28.633 1.00 19.36  ? 507  HIS A N   1 
ATOM   3333 C CA  . HIS A 1  429 ? -20.072 -40.397 -29.310 1.00 18.93  ? 507  HIS A CA  1 
ATOM   3334 C C   . HIS A 1  429 ? -20.736 -41.644 -29.906 1.00 21.41  ? 507  HIS A C   1 
ATOM   3335 O O   . HIS A 1  429 ? -20.293 -42.143 -30.941 1.00 18.58  ? 507  HIS A O   1 
ATOM   3336 C CB  . HIS A 1  429 ? -18.950 -40.851 -28.366 1.00 19.26  ? 507  HIS A CB  1 
ATOM   3337 C CG  . HIS A 1  429 ? -17.818 -41.545 -29.061 1.00 20.97  ? 507  HIS A CG  1 
ATOM   3338 N ND1 . HIS A 1  429 ? -17.733 -42.913 -29.178 1.00 24.28  ? 507  HIS A ND1 1 
ATOM   3339 C CD2 . HIS A 1  429 ? -16.733 -41.051 -29.690 1.00 21.10  ? 507  HIS A CD2 1 
ATOM   3340 C CE1 . HIS A 1  429 ? -16.639 -43.231 -29.848 1.00 22.60  ? 507  HIS A CE1 1 
ATOM   3341 N NE2 . HIS A 1  429 ? -16.019 -42.117 -30.176 1.00 24.29  ? 507  HIS A NE2 1 
ATOM   3342 N N   . ASP A 1  430 ? -21.766 -42.161 -29.237 1.00 23.04  ? 508  ASP A N   1 
ATOM   3343 C CA  . ASP A 1  430 ? -22.609 -43.239 -29.790 1.00 23.75  ? 508  ASP A CA  1 
ATOM   3344 C C   . ASP A 1  430 ? -23.275 -42.857 -31.120 1.00 24.55  ? 508  ASP A C   1 
ATOM   3345 O O   . ASP A 1  430 ? -23.452 -43.715 -31.962 1.00 21.87  ? 508  ASP A O   1 
ATOM   3346 C CB  . ASP A 1  430 ? -23.722 -43.640 -28.806 1.00 26.81  ? 508  ASP A CB  1 
ATOM   3347 C CG  . ASP A 1  430 ? -23.211 -44.407 -27.601 1.00 40.30  ? 508  ASP A CG  1 
ATOM   3348 O OD1 . ASP A 1  430 ? -22.109 -44.988 -27.660 1.00 41.46  ? 508  ASP A OD1 1 
ATOM   3349 O OD2 . ASP A 1  430 ? -23.934 -44.443 -26.580 1.00 53.31  ? 508  ASP A OD2 1 
ATOM   3350 N N   . GLN A 1  431 ? -23.634 -41.582 -31.303 1.00 22.54  ? 509  GLN A N   1 
ATOM   3351 C CA  . GLN A 1  431 ? -24.191 -41.089 -32.571 1.00 23.85  ? 509  GLN A CA  1 
ATOM   3352 C C   . GLN A 1  431 ? -23.129 -40.778 -33.636 1.00 22.55  ? 509  GLN A C   1 
ATOM   3353 O O   . GLN A 1  431 ? -23.315 -41.075 -34.827 1.00 21.15  ? 509  GLN A O   1 
ATOM   3354 C CB  . GLN A 1  431 ? -25.002 -39.814 -32.350 1.00 26.50  ? 509  GLN A CB  1 
ATOM   3355 C CG  . GLN A 1  431 ? -26.214 -39.920 -31.449 1.00 32.85  ? 509  GLN A CG  1 
ATOM   3356 C CD  . GLN A 1  431 ? -27.048 -38.641 -31.510 1.00 47.36  ? 509  GLN A CD  1 
ATOM   3357 O OE1 . GLN A 1  431 ? -27.030 -37.839 -30.586 1.00 50.86  ? 509  GLN A OE1 1 
ATOM   3358 N NE2 . GLN A 1  431 ? -27.749 -38.430 -32.631 1.00 46.33  ? 509  GLN A NE2 1 
ATOM   3359 N N   . VAL A 1  432 ? -22.046 -40.139 -33.204 1.00 19.30  ? 510  VAL A N   1 
ATOM   3360 C CA  . VAL A 1  432 ? -20.968 -39.661 -34.087 1.00 21.31  ? 510  VAL A CA  1 
ATOM   3361 C C   . VAL A 1  432 ? -19.631 -39.954 -33.406 1.00 21.94  ? 510  VAL A C   1 
ATOM   3362 O O   . VAL A 1  432 ? -19.364 -39.362 -32.371 1.00 19.03  ? 510  VAL A O   1 
ATOM   3363 C CB  . VAL A 1  432 ? -21.042 -38.127 -34.293 1.00 21.49  ? 510  VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1  432 ? -19.950 -37.658 -35.265 1.00 19.58  ? 510  VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1  432 ? -22.411 -37.729 -34.798 1.00 23.39  ? 510  VAL A CG2 1 
ATOM   3366 N N   . PRO A 1  433 ? -18.798 -40.867 -33.970 1.00 21.99  ? 511  PRO A N   1 
ATOM   3367 C CA  . PRO A 1  433 ? -17.634 -41.363 -33.242 1.00 19.48  ? 511  PRO A CA  1 
ATOM   3368 C C   . PRO A 1  433 ? -16.394 -40.456 -33.361 1.00 17.89  ? 511  PRO A C   1 
ATOM   3369 O O   . PRO A 1  433 ? -15.344 -40.835 -33.899 1.00 18.80  ? 511  PRO A O   1 
ATOM   3370 C CB  . PRO A 1  433 ? -17.455 -42.787 -33.807 1.00 21.42  ? 511  PRO A CB  1 
ATOM   3371 C CG  . PRO A 1  433 ? -17.961 -42.693 -35.216 1.00 22.05  ? 511  PRO A CG  1 
ATOM   3372 C CD  . PRO A 1  433 ? -19.025 -41.621 -35.216 1.00 22.55  ? 511  PRO A CD  1 
ATOM   3373 N N   . PHE A 1  434 ? -16.532 -39.250 -32.820 1.00 17.00  ? 512  PHE A N   1 
ATOM   3374 C CA  . PHE A 1  434 ? -15.446 -38.254 -32.823 1.00 16.62  ? 512  PHE A CA  1 
ATOM   3375 C C   . PHE A 1  434 ? -14.280 -38.779 -31.960 1.00 18.50  ? 512  PHE A C   1 
ATOM   3376 O O   . PHE A 1  434 ? -14.475 -39.645 -31.072 1.00 16.80  ? 512  PHE A O   1 
ATOM   3377 C CB  . PHE A 1  434 ? -15.946 -36.878 -32.318 1.00 16.82  ? 512  PHE A CB  1 
ATOM   3378 C CG  . PHE A 1  434 ? -16.610 -36.938 -30.953 1.00 16.49  ? 512  PHE A CG  1 
ATOM   3379 C CD1 . PHE A 1  434 ? -15.857 -36.933 -29.798 1.00 17.78  ? 512  PHE A CD1 1 
ATOM   3380 C CD2 . PHE A 1  434 ? -17.994 -37.070 -30.843 1.00 15.71  ? 512  PHE A CD2 1 
ATOM   3381 C CE1 . PHE A 1  434 ? -16.463 -37.058 -28.552 1.00 17.19  ? 512  PHE A CE1 1 
ATOM   3382 C CE2 . PHE A 1  434 ? -18.602 -37.202 -29.610 1.00 15.12  ? 512  PHE A CE2 1 
ATOM   3383 C CZ  . PHE A 1  434 ? -17.837 -37.176 -28.463 1.00 16.43  ? 512  PHE A CZ  1 
ATOM   3384 N N   . ASP A 1  435 ? -13.075 -38.279 -32.239 1.00 17.01  ? 513  ASP A N   1 
ATOM   3385 C CA  . ASP A 1  435 ? -11.826 -38.837 -31.676 1.00 16.11  ? 513  ASP A CA  1 
ATOM   3386 C C   . ASP A 1  435 ? -11.170 -37.986 -30.593 1.00 16.68  ? 513  ASP A C   1 
ATOM   3387 O O   . ASP A 1  435 ? -10.152 -38.370 -30.018 1.00 18.11  ? 513  ASP A O   1 
ATOM   3388 C CB  . ASP A 1  435 ? -10.876 -39.090 -32.838 1.00 17.40  ? 513  ASP A CB  1 
ATOM   3389 C CG  . ASP A 1  435 ? -11.461 -40.091 -33.814 1.00 16.40  ? 513  ASP A CG  1 
ATOM   3390 O OD1 . ASP A 1  435 ? -11.771 -41.178 -33.339 1.00 17.35  ? 513  ASP A OD1 1 
ATOM   3391 O OD2 . ASP A 1  435 ? -11.696 -39.789 -35.013 1.00 18.70  ? 513  ASP A OD2 1 
ATOM   3392 N N   . GLY A 1  436 ? -11.779 -36.840 -30.308 1.00 17.54  ? 514  GLY A N   1 
ATOM   3393 C CA  . GLY A 1  436 ? -11.345 -35.966 -29.229 1.00 15.49  ? 514  GLY A CA  1 
ATOM   3394 C C   . GLY A 1  436 ? -12.256 -34.754 -29.123 1.00 15.47  ? 514  GLY A C   1 
ATOM   3395 O O   . GLY A 1  436 ? -13.317 -34.709 -29.749 1.00 16.86  ? 514  GLY A O   1 
ATOM   3396 N N   . MET A 1  437 ? -11.834 -33.780 -28.334 1.00 14.21  ? 515  MET A N   1 
ATOM   3397 C CA  . MET A 1  437 ? -12.649 -32.607 -28.050 1.00 15.29  ? 515  MET A CA  1 
ATOM   3398 C C   . MET A 1  437 ? -11.800 -31.342 -28.077 1.00 14.49  ? 515  MET A C   1 
ATOM   3399 O O   . MET A 1  437 ? -10.728 -31.273 -27.459 1.00 16.64  ? 515  MET A O   1 
ATOM   3400 C CB  . MET A 1  437 ? -13.358 -32.768 -26.697 1.00 14.41  ? 515  MET A CB  1 
ATOM   3401 C CG  . MET A 1  437 ? -14.383 -33.885 -26.654 1.00 15.78  ? 515  MET A CG  1 
ATOM   3402 S SD  . MET A 1  437 ? -14.969 -34.232 -24.966 1.00 18.39  ? 515  MET A SD  1 
ATOM   3403 C CE  . MET A 1  437 ? -15.749 -32.672 -24.568 1.00 19.59  ? 515  MET A CE  1 
ATOM   3404 N N   . TRP A 1  438 ? -12.287 -30.364 -28.832 1.00 14.47  ? 516  TRP A N   1 
ATOM   3405 C CA  . TRP A 1  438 ? -11.754 -29.014 -28.866 1.00 15.16  ? 516  TRP A CA  1 
ATOM   3406 C C   . TRP A 1  438 ? -12.636 -28.205 -27.908 1.00 16.93  ? 516  TRP A C   1 
ATOM   3407 O O   . TRP A 1  438 ? -13.785 -27.892 -28.232 1.00 15.76  ? 516  TRP A O   1 
ATOM   3408 C CB  . TRP A 1  438 ? -11.830 -28.509 -30.304 1.00 14.87  ? 516  TRP A CB  1 
ATOM   3409 C CG  . TRP A 1  438 ? -11.544 -27.096 -30.512 1.00 15.47  ? 516  TRP A CG  1 
ATOM   3410 C CD1 . TRP A 1  438 ? -10.774 -26.291 -29.747 1.00 13.10  ? 516  TRP A CD1 1 
ATOM   3411 C CD2 . TRP A 1  438 ? -11.962 -26.311 -31.625 1.00 14.91  ? 516  TRP A CD2 1 
ATOM   3412 N NE1 . TRP A 1  438 ? -10.746 -25.042 -30.260 1.00 15.38  ? 516  TRP A NE1 1 
ATOM   3413 C CE2 . TRP A 1  438 ? -11.443 -25.022 -31.434 1.00 14.90  ? 516  TRP A CE2 1 
ATOM   3414 C CE3 . TRP A 1  438 ? -12.727 -26.571 -32.759 1.00 15.18  ? 516  TRP A CE3 1 
ATOM   3415 C CZ2 . TRP A 1  438 ? -11.673 -23.979 -32.322 1.00 14.67  ? 516  TRP A CZ2 1 
ATOM   3416 C CZ3 . TRP A 1  438 ? -12.947 -25.538 -33.656 1.00 14.62  ? 516  TRP A CZ3 1 
ATOM   3417 C CH2 . TRP A 1  438 ? -12.427 -24.252 -33.426 1.00 15.37  ? 516  TRP A CH2 1 
ATOM   3418 N N   . ILE A 1  439 ? -12.132 -27.945 -26.701 1.00 15.10  ? 517  ILE A N   1 
ATOM   3419 C CA  . ILE A 1  439 ? -12.944 -27.268 -25.692 1.00 15.16  ? 517  ILE A CA  1 
ATOM   3420 C C   . ILE A 1  439 ? -12.586 -25.790 -25.662 1.00 16.14  ? 517  ILE A C   1 
ATOM   3421 O O   . ILE A 1  439 ? -11.474 -25.407 -25.303 1.00 14.19  ? 517  ILE A O   1 
ATOM   3422 C CB  . ILE A 1  439 ? -12.904 -27.943 -24.309 1.00 14.06  ? 517  ILE A CB  1 
ATOM   3423 C CG1 . ILE A 1  439 ? -11.475 -28.053 -23.749 1.00 14.73  ? 517  ILE A CG1 1 
ATOM   3424 C CG2 . ILE A 1  439 ? -13.569 -29.324 -24.428 1.00 16.98  ? 517  ILE A CG2 1 
ATOM   3425 C CD1 . ILE A 1  439 ? -11.416 -28.677 -22.397 1.00 15.68  ? 517  ILE A CD1 1 
ATOM   3426 N N   . ASP A 1  440 ? -13.543 -24.980 -26.078 1.00 14.53  ? 518  ASP A N   1 
ATOM   3427 C CA  . ASP A 1  440 ? -13.378 -23.533 -26.245 1.00 16.08  ? 518  ASP A CA  1 
ATOM   3428 C C   . ASP A 1  440 ? -14.174 -22.802 -25.170 1.00 14.75  ? 518  ASP A C   1 
ATOM   3429 O O   . ASP A 1  440 ? -14.894 -23.449 -24.419 1.00 15.55  ? 518  ASP A O   1 
ATOM   3430 C CB  . ASP A 1  440 ? -13.916 -23.164 -27.630 1.00 17.52  ? 518  ASP A CB  1 
ATOM   3431 C CG  . ASP A 1  440 ? -13.643 -21.715 -28.008 1.00 19.03  ? 518  ASP A CG  1 
ATOM   3432 O OD1 . ASP A 1  440 ? -12.644 -21.128 -27.526 1.00 15.88  ? 518  ASP A OD1 1 
ATOM   3433 O OD2 . ASP A 1  440 ? -14.463 -21.172 -28.771 1.00 19.85  ? 518  ASP A OD2 1 
ATOM   3434 N N   . MET A 1  441 ? -14.019 -21.476 -25.071 1.00 16.38  ? 519  MET A N   1 
ATOM   3435 C CA  . MET A 1  441 ? -14.965 -20.593 -24.350 1.00 19.48  ? 519  MET A CA  1 
ATOM   3436 C C   . MET A 1  441 ? -14.975 -20.861 -22.832 1.00 14.63  ? 519  MET A C   1 
ATOM   3437 O O   . MET A 1  441 ? -15.911 -20.496 -22.161 1.00 17.11  ? 519  MET A O   1 
ATOM   3438 C CB  . MET A 1  441 ? -16.423 -20.728 -24.882 1.00 20.67  ? 519  MET A CB  1 
ATOM   3439 C CG  . MET A 1  441 ? -16.687 -20.437 -26.346 1.00 23.76  ? 519  MET A CG  1 
ATOM   3440 S SD  . MET A 1  441 ? -16.241 -18.763 -26.794 1.00 40.97  ? 519  MET A SD  1 
ATOM   3441 C CE  . MET A 1  441 ? -17.650 -17.876 -26.158 1.00 35.80  ? 519  MET A CE  1 
ATOM   3442 N N   . ASN A 1  442 ? -13.907 -21.456 -22.305 1.00 14.98  ? 520  ASN A N   1 
ATOM   3443 C CA  . ASN A 1  442 ? -13.907 -22.035 -20.968 1.00 14.66  ? 520  ASN A CA  1 
ATOM   3444 C C   . ASN A 1  442 ? -13.092 -21.247 -19.974 1.00 14.15  ? 520  ASN A C   1 
ATOM   3445 O O   . ASN A 1  442 ? -12.547 -21.787 -19.005 1.00 14.20  ? 520  ASN A O   1 
ATOM   3446 C CB  . ASN A 1  442 ? -13.507 -23.518 -21.018 1.00 16.86  ? 520  ASN A CB  1 
ATOM   3447 C CG  . ASN A 1  442 ? -12.155 -23.778 -21.669 1.00 15.60  ? 520  ASN A CG  1 
ATOM   3448 O OD1 . ASN A 1  442 ? -11.537 -22.894 -22.279 1.00 15.02  ? 520  ASN A OD1 1 
ATOM   3449 N ND2 . ASN A 1  442 ? -11.725 -25.029 -21.604 1.00 16.58  ? 520  ASN A ND2 1 
ATOM   3450 N N   . GLU A 1  443 ? -13.112 -19.926 -20.168 1.00 13.91  ? 521  GLU A N   1 
ATOM   3451 C CA  . GLU A 1  443 ? -12.589 -18.995 -19.189 1.00 14.47  ? 521  GLU A CA  1 
ATOM   3452 C C   . GLU A 1  443 ? -13.365 -18.909 -17.847 1.00 14.53  ? 521  GLU A C   1 
ATOM   3453 O O   . GLU A 1  443 ? -12.710 -18.772 -16.808 1.00 14.68  ? 521  GLU A O   1 
ATOM   3454 C CB  . GLU A 1  443 ? -12.379 -17.617 -19.823 1.00 15.95  ? 521  GLU A CB  1 
ATOM   3455 C CG  . GLU A 1  443 ? -11.290 -17.624 -20.925 1.00 16.78  ? 521  GLU A CG  1 
ATOM   3456 C CD  . GLU A 1  443 ? -11.708 -18.291 -22.238 1.00 17.92  ? 521  GLU A CD  1 
ATOM   3457 O OE1 . GLU A 1  443 ? -12.918 -18.278 -22.598 1.00 17.01  ? 521  GLU A OE1 1 
ATOM   3458 O OE2 . GLU A 1  443 ? -10.839 -18.877 -22.922 1.00 20.66  ? 521  GLU A OE2 1 
ATOM   3459 N N   . PRO A 1  444 ? -14.703 -18.982 -17.787 1.00 13.82  ? 522  PRO A N   1 
ATOM   3460 C CA  . PRO A 1  444 ? -15.666 -19.129 -18.870 1.00 15.32  ? 522  PRO A CA  1 
ATOM   3461 C C   . PRO A 1  444 ? -16.097 -17.826 -19.522 1.00 13.28  ? 522  PRO A C   1 
ATOM   3462 O O   . PRO A 1  444 ? -16.292 -16.821 -18.842 1.00 19.38  ? 522  PRO A O   1 
ATOM   3463 C CB  . PRO A 1  444 ? -16.867 -19.766 -18.157 1.00 14.63  ? 522  PRO A CB  1 
ATOM   3464 C CG  . PRO A 1  444 ? -16.804 -19.239 -16.777 1.00 15.46  ? 522  PRO A CG  1 
ATOM   3465 C CD  . PRO A 1  444 ? -15.342 -19.072 -16.461 1.00 15.24  ? 522  PRO A CD  1 
ATOM   3466 N N   . SER A 1  445 ? -16.281 -17.867 -20.833 1.00 15.37  ? 523  SER A N   1 
ATOM   3467 C CA  . SER A 1  445 ? -16.609 -16.681 -21.620 1.00 15.68  ? 523  SER A CA  1 
ATOM   3468 C C   . SER A 1  445 ? -18.109 -16.427 -21.558 1.00 17.34  ? 523  SER A C   1 
ATOM   3469 O O   . SER A 1  445 ? -18.915 -17.354 -21.637 1.00 15.70  ? 523  SER A O   1 
ATOM   3470 C CB  . SER A 1  445 ? -16.164 -16.866 -23.071 1.00 15.89  ? 523  SER A CB  1 
ATOM   3471 O OG  . SER A 1  445 ? -16.457 -15.722 -23.861 1.00 19.68  ? 523  SER A OG  1 
ATOM   3472 N N   . ASN A 1  446 ? -18.473 -15.155 -21.445 1.00 15.05  ? 524  ASN A N   1 
ATOM   3473 C CA  . ASN A 1  446 ? -19.861 -14.741 -21.395 1.00 15.86  ? 524  ASN A CA  1 
ATOM   3474 C C   . ASN A 1  446 ? -19.983 -13.495 -22.250 1.00 17.36  ? 524  ASN A C   1 
ATOM   3475 O O   . ASN A 1  446 ? -19.171 -12.584 -22.110 1.00 18.15  ? 524  ASN A O   1 
ATOM   3476 C CB  . ASN A 1  446 ? -20.248 -14.470 -19.923 1.00 16.20  ? 524  ASN A CB  1 
ATOM   3477 C CG  . ASN A 1  446 ? -21.755 -14.308 -19.703 1.00 17.91  ? 524  ASN A CG  1 
ATOM   3478 O OD1 . ASN A 1  446 ? -22.584 -14.471 -20.614 1.00 17.21  ? 524  ASN A OD1 1 
ATOM   3479 N ND2 . ASN A 1  446 ? -22.118 -14.014 -18.450 1.00 19.36  ? 524  ASN A ND2 1 
ATOM   3480 N N   . PHE A 1  447 ? -20.974 -13.444 -23.139 1.00 20.28  ? 525  PHE A N   1 
ATOM   3481 C CA  . PHE A 1  447 ? -21.155 -12.267 -24.009 1.00 20.69  ? 525  PHE A CA  1 
ATOM   3482 C C   . PHE A 1  447 ? -21.828 -11.091 -23.318 1.00 23.06  ? 525  PHE A C   1 
ATOM   3483 O O   . PHE A 1  447 ? -21.951 -10.028 -23.904 1.00 21.70  ? 525  PHE A O   1 
ATOM   3484 C CB  . PHE A 1  447 ? -21.956 -12.590 -25.283 1.00 20.59  ? 525  PHE A CB  1 
ATOM   3485 C CG  . PHE A 1  447 ? -21.335 -13.621 -26.179 1.00 19.59  ? 525  PHE A CG  1 
ATOM   3486 C CD1 . PHE A 1  447 ? -20.001 -13.987 -26.086 1.00 22.07  ? 525  PHE A CD1 1 
ATOM   3487 C CD2 . PHE A 1  447 ? -22.115 -14.211 -27.171 1.00 21.13  ? 525  PHE A CD2 1 
ATOM   3488 C CE1 . PHE A 1  447 ? -19.465 -14.932 -26.943 1.00 23.62  ? 525  PHE A CE1 1 
ATOM   3489 C CE2 . PHE A 1  447 ? -21.587 -15.157 -28.010 1.00 20.88  ? 525  PHE A CE2 1 
ATOM   3490 C CZ  . PHE A 1  447 ? -20.256 -15.519 -27.902 1.00 21.02  ? 525  PHE A CZ  1 
ATOM   3491 N N   . ILE A 1  448 ? -22.287 -11.277 -22.093 1.00 19.20  ? 526  ILE A N   1 
ATOM   3492 C CA  . ILE A 1  448 ? -22.822 -10.194 -21.301 1.00 20.23  ? 526  ILE A CA  1 
ATOM   3493 C C   . ILE A 1  448 ? -22.071 -10.235 -19.991 1.00 20.20  ? 526  ILE A C   1 
ATOM   3494 O O   . ILE A 1  448 ? -21.390 -11.230 -19.689 1.00 18.05  ? 526  ILE A O   1 
ATOM   3495 C CB  . ILE A 1  448 ? -24.357 -10.315 -21.105 1.00 23.47  ? 526  ILE A CB  1 
ATOM   3496 C CG1 . ILE A 1  448 ? -24.743 -11.646 -20.435 1.00 25.59  ? 526  ILE A CG1 1 
ATOM   3497 C CG2 . ILE A 1  448 ? -25.069 -10.172 -22.447 1.00 23.00  ? 526  ILE A CG2 1 
ATOM   3498 C CD1 . ILE A 1  448 ? -26.224 -11.798 -20.147 1.00 34.50  ? 526  ILE A CD1 1 
ATOM   3499 N N   . ARG A 1  449 ? -22.195 -9.157  -19.224 1.00 19.68  ? 527  ARG A N   1 
ATOM   3500 C CA  A ARG A 1  449 ? -21.485 -9.036  -17.949 0.50 20.11  ? 527  ARG A CA  1 
ATOM   3501 C CA  B ARG A 1  449 ? -21.495 -9.005  -17.940 0.50 20.00  ? 527  ARG A CA  1 
ATOM   3502 C C   . ARG A 1  449 ? -22.179 -9.816  -16.830 1.00 18.00  ? 527  ARG A C   1 
ATOM   3503 O O   . ARG A 1  449 ? -23.290 -9.479  -16.413 1.00 18.39  ? 527  ARG A O   1 
ATOM   3504 C CB  A ARG A 1  449 ? -21.352 -7.572  -17.547 0.50 21.97  ? 527  ARG A CB  1 
ATOM   3505 C CB  B ARG A 1  449 ? -21.452 -7.518  -17.553 0.50 21.70  ? 527  ARG A CB  1 
ATOM   3506 C CG  A ARG A 1  449 ? -20.424 -7.340  -16.359 0.50 24.48  ? 527  ARG A CG  1 
ATOM   3507 C CG  B ARG A 1  449 ? -20.573 -7.157  -16.352 0.50 24.06  ? 527  ARG A CG  1 
ATOM   3508 C CD  A ARG A 1  449 ? -20.372 -5.870  -16.007 0.50 26.20  ? 527  ARG A CD  1 
ATOM   3509 C CD  B ARG A 1  449 ? -20.755 -5.691  -15.970 0.50 24.57  ? 527  ARG A CD  1 
ATOM   3510 N NE  A ARG A 1  449 ? -19.886 -5.657  -14.654 0.50 25.29  ? 527  ARG A NE  1 
ATOM   3511 N NE  B ARG A 1  449 ? -22.166 -5.329  -15.966 0.50 24.72  ? 527  ARG A NE  1 
ATOM   3512 C CZ  A ARG A 1  449 ? -19.592 -4.463  -14.180 0.50 28.47  ? 527  ARG A CZ  1 
ATOM   3513 C CZ  B ARG A 1  449 ? -22.951 -5.356  -14.892 0.50 28.59  ? 527  ARG A CZ  1 
ATOM   3514 N NH1 A ARG A 1  449 ? -19.724 -3.390  -14.967 0.50 30.26  ? 527  ARG A NH1 1 
ATOM   3515 N NH1 B ARG A 1  449 ? -22.454 -5.704  -13.704 0.50 26.16  ? 527  ARG A NH1 1 
ATOM   3516 N NH2 A ARG A 1  449 ? -19.152 -4.347  -12.946 0.50 26.03  ? 527  ARG A NH2 1 
ATOM   3517 N NH2 B ARG A 1  449 ? -24.231 -5.015  -15.011 0.50 25.74  ? 527  ARG A NH2 1 
ATOM   3518 N N   . GLY A 1  450 ? -21.525 -10.870 -16.358 1.00 17.48  ? 528  GLY A N   1 
ATOM   3519 C CA  . GLY A 1  450 ? -21.970 -11.608 -15.171 1.00 18.02  ? 528  GLY A CA  1 
ATOM   3520 C C   . GLY A 1  450 ? -23.100 -12.603 -15.406 1.00 17.74  ? 528  GLY A C   1 
ATOM   3521 O O   . GLY A 1  450 ? -22.889 -13.818 -15.335 1.00 18.63  ? 528  GLY A O   1 
ATOM   3522 N N   . SER A 1  451 ? -24.300 -12.081 -15.641 1.00 18.65  ? 529  SER A N   1 
ATOM   3523 C CA  . SER A 1  451 ? -25.490 -12.897 -15.938 1.00 18.29  ? 529  SER A CA  1 
ATOM   3524 C C   . SER A 1  451 ? -26.545 -12.038 -16.553 1.00 19.00  ? 529  SER A C   1 
ATOM   3525 O O   . SER A 1  451 ? -26.463 -10.801 -16.477 1.00 19.11  ? 529  SER A O   1 
ATOM   3526 C CB  . SER A 1  451 ? -26.050 -13.556 -14.663 1.00 20.80  ? 529  SER A CB  1 
ATOM   3527 O OG  . SER A 1  451 ? -26.980 -12.726 -13.974 1.00 18.48  ? 529  SER A OG  1 
ATOM   3528 N N   . GLU A 1  452 ? -27.562 -12.676 -17.124 1.00 16.85  ? 530  GLU A N   1 
ATOM   3529 C CA  . GLU A 1  452 ? -28.747 -11.963 -17.632 1.00 21.61  ? 530  GLU A CA  1 
ATOM   3530 C C   . GLU A 1  452 ? -29.328 -11.084 -16.552 1.00 23.08  ? 530  GLU A C   1 
ATOM   3531 O O   . GLU A 1  452 ? -29.948 -10.100 -16.854 1.00 23.52  ? 530  GLU A O   1 
ATOM   3532 C CB  . GLU A 1  452 ? -29.873 -12.910 -18.103 1.00 20.62  ? 530  GLU A CB  1 
ATOM   3533 C CG  . GLU A 1  452 ? -29.556 -13.666 -19.354 1.00 21.64  ? 530  GLU A CG  1 
ATOM   3534 C CD  . GLU A 1  452 ? -30.712 -14.518 -19.855 1.00 24.70  ? 530  GLU A CD  1 
ATOM   3535 O OE1 . GLU A 1  452 ? -31.655 -14.836 -19.092 1.00 22.12  ? 530  GLU A OE1 1 
ATOM   3536 O OE2 . GLU A 1  452 ? -30.644 -14.904 -21.026 1.00 27.65  ? 530  GLU A OE2 1 
ATOM   3537 N N   . ASP A 1  453 ? -29.132 -11.441 -15.294 1.00 24.34  ? 531  ASP A N   1 
ATOM   3538 C CA  . ASP A 1  453 ? -29.710 -10.684 -14.186 1.00 24.84  ? 531  ASP A CA  1 
ATOM   3539 C C   . ASP A 1  453 ? -28.658 -9.850  -13.457 1.00 24.24  ? 531  ASP A C   1 
ATOM   3540 O O   . ASP A 1  453 ? -28.852 -9.494  -12.308 1.00 24.98  ? 531  ASP A O   1 
ATOM   3541 C CB  . ASP A 1  453 ? -30.379 -11.694 -13.254 1.00 24.93  ? 531  ASP A CB  1 
ATOM   3542 C CG  . ASP A 1  453 ? -31.362 -12.572 -14.001 1.00 25.89  ? 531  ASP A CG  1 
ATOM   3543 O OD1 . ASP A 1  453 ? -31.019 -13.723 -14.379 1.00 22.60  ? 531  ASP A OD1 1 
ATOM   3544 O OD2 . ASP A 1  453 ? -32.473 -12.078 -14.272 1.00 31.06  ? 531  ASP A OD2 1 
ATOM   3545 N N   . GLY A 1  454 ? -27.540 -9.543  -14.117 1.00 23.25  ? 532  GLY A N   1 
ATOM   3546 C CA  . GLY A 1  454 ? -26.422 -8.874  -13.470 1.00 24.62  ? 532  GLY A CA  1 
ATOM   3547 C C   . GLY A 1  454 ? -25.918 -9.686  -12.294 1.00 23.23  ? 532  GLY A C   1 
ATOM   3548 O O   . GLY A 1  454 ? -26.100 -10.921 -12.238 1.00 23.43  ? 532  GLY A O   1 
ATOM   3549 N N   . CYS A 1  455 ? -25.282 -9.000  -11.358 1.00 18.43  ? 533  CYS A N   1 
ATOM   3550 C CA  . CYS A 1  455 ? -24.711 -9.645  -10.178 1.00 20.78  ? 533  CYS A CA  1 
ATOM   3551 C C   . CYS A 1  455 ? -25.025 -8.812  -8.947  1.00 21.93  ? 533  CYS A C   1 
ATOM   3552 O O   . CYS A 1  455 ? -25.169 -7.600  -9.054  1.00 21.75  ? 533  CYS A O   1 
ATOM   3553 C CB  . CYS A 1  455 ? -23.196 -9.751  -10.292 1.00 20.74  ? 533  CYS A CB  1 
ATOM   3554 S SG  . CYS A 1  455 ? -22.605 -10.553 -11.811 1.00 24.58  ? 533  CYS A SG  1 
ATOM   3555 N N   . PRO A 1  456 ? -25.075 -9.452  -7.779  1.00 20.10  ? 534  PRO A N   1 
ATOM   3556 C CA  . PRO A 1  456 ? -25.288 -8.702  -6.542  1.00 25.33  ? 534  PRO A CA  1 
ATOM   3557 C C   . PRO A 1  456 ? -24.110 -7.789  -6.175  1.00 24.77  ? 534  PRO A C   1 
ATOM   3558 O O   . PRO A 1  456 ? -23.030 -7.898  -6.736  1.00 22.66  ? 534  PRO A O   1 
ATOM   3559 C CB  . PRO A 1  456 ? -25.489 -9.796  -5.485  1.00 22.86  ? 534  PRO A CB  1 
ATOM   3560 C CG  . PRO A 1  456 ? -24.923 -11.033 -6.062  1.00 26.66  ? 534  PRO A CG  1 
ATOM   3561 C CD  . PRO A 1  456 ? -24.893 -10.897 -7.551  1.00 21.65  ? 534  PRO A CD  1 
ATOM   3562 N N   . ASN A 1  457 ? -24.349 -6.868  -5.262  1.00 21.91  ? 535  ASN A N   1 
ATOM   3563 C CA  . ASN A 1  457 ? -23.314 -5.997  -4.754  1.00 32.17  ? 535  ASN A CA  1 
ATOM   3564 C C   . ASN A 1  457 ? -22.758 -6.599  -3.469  1.00 27.33  ? 535  ASN A C   1 
ATOM   3565 O O   . ASN A 1  457 ? -23.384 -6.531  -2.416  1.00 31.42  ? 535  ASN A O   1 
ATOM   3566 C CB  . ASN A 1  457 ? -23.875 -4.585  -4.504  1.00 39.29  ? 535  ASN A CB  1 
ATOM   3567 C CG  . ASN A 1  457 ? -22.819 -3.616  -3.979  1.00 56.52  ? 535  ASN A CG  1 
ATOM   3568 O OD1 . ASN A 1  457 ? -21.612 -3.794  -4.201  1.00 44.15  ? 535  ASN A OD1 1 
ATOM   3569 N ND2 . ASN A 1  457 ? -23.272 -2.583  -3.276  1.00 69.62  ? 535  ASN A ND2 1 
ATOM   3570 N N   . ASN A 1  458 ? -21.600 -7.233  -3.568  1.00 20.58  ? 536  ASN A N   1 
ATOM   3571 C CA  . ASN A 1  458 ? -20.924 -7.758  -2.394  1.00 18.70  ? 536  ASN A CA  1 
ATOM   3572 C C   . ASN A 1  458 ? -19.427 -7.666  -2.606  1.00 21.14  ? 536  ASN A C   1 
ATOM   3573 O O   . ASN A 1  458 ? -18.973 -7.210  -3.665  1.00 24.10  ? 536  ASN A O   1 
ATOM   3574 C CB  . ASN A 1  458 ? -21.429 -9.186  -2.046  1.00 21.61  ? 536  ASN A CB  1 
ATOM   3575 C CG  . ASN A 1  458 ? -21.192 -10.194 -3.172  1.00 21.74  ? 536  ASN A CG  1 
ATOM   3576 O OD1 . ASN A 1  458 ? -20.084 -10.312 -3.679  1.00 18.51  ? 536  ASN A OD1 1 
ATOM   3577 N ND2 . ASN A 1  458 ? -22.241 -10.915 -3.571  1.00 20.68  ? 536  ASN A ND2 1 
ATOM   3578 N N   . GLU A 1  459 ? -18.674 -8.095  -1.601  1.00 21.68  ? 537  GLU A N   1 
ATOM   3579 C CA  . GLU A 1  459 ? -17.227 -7.946  -1.572  1.00 21.29  ? 537  GLU A CA  1 
ATOM   3580 C C   . GLU A 1  459 ? -16.508 -8.873  -2.509  1.00 21.23  ? 537  GLU A C   1 
ATOM   3581 O O   . GLU A 1  459 ? -15.365 -8.607  -2.873  1.00 17.76  ? 537  GLU A O   1 
ATOM   3582 C CB  . GLU A 1  459 ? -16.697 -8.139  -0.149  1.00 27.21  ? 537  GLU A CB  1 
ATOM   3583 C CG  . GLU A 1  459 ? -16.709 -6.833  0.631   1.00 44.54  ? 537  GLU A CG  1 
ATOM   3584 C CD  . GLU A 1  459 ? -16.463 -7.023  2.113   1.00 62.16  ? 537  GLU A CD  1 
ATOM   3585 O OE1 . GLU A 1  459 ? -17.161 -7.871  2.714   1.00 57.82  ? 537  GLU A OE1 1 
ATOM   3586 O OE2 . GLU A 1  459 ? -15.582 -6.323  2.667   1.00 70.60  ? 537  GLU A OE2 1 
ATOM   3587 N N   . LEU A 1  460 ? -17.154 -9.956  -2.918  1.00 17.88  ? 538  LEU A N   1 
ATOM   3588 C CA  . LEU A 1  460 ? -16.573 -10.789 -3.964  1.00 17.48  ? 538  LEU A CA  1 
ATOM   3589 C C   . LEU A 1  460 ? -16.713 -10.152 -5.347  1.00 20.18  ? 538  LEU A C   1 
ATOM   3590 O O   . LEU A 1  460 ? -15.761 -10.172 -6.144  1.00 17.90  ? 538  LEU A O   1 
ATOM   3591 C CB  . LEU A 1  460 ? -17.175 -12.198 -3.960  1.00 16.47  ? 538  LEU A CB  1 
ATOM   3592 C CG  . LEU A 1  460 ? -17.105 -13.004 -2.670  1.00 20.79  ? 538  LEU A CG  1 
ATOM   3593 C CD1 . LEU A 1  460 ? -17.740 -14.374 -2.889  1.00 21.15  ? 538  LEU A CD1 1 
ATOM   3594 C CD2 . LEU A 1  460 ? -15.668 -13.121 -2.178  1.00 18.77  ? 538  LEU A CD2 1 
ATOM   3595 N N   . GLU A 1  461 ? -17.885 -9.599  -5.649  1.00 21.23  ? 539  GLU A N   1 
ATOM   3596 C CA  . GLU A 1  461 ? -18.072 -8.885  -6.928  1.00 17.42  ? 539  GLU A CA  1 
ATOM   3597 C C   . GLU A 1  461 ? -17.291 -7.552  -6.968  1.00 19.28  ? 539  GLU A C   1 
ATOM   3598 O O   . GLU A 1  461 ? -16.853 -7.115  -8.045  1.00 21.82  ? 539  GLU A O   1 
ATOM   3599 C CB  . GLU A 1  461 ? -19.563 -8.568  -7.192  1.00 20.52  ? 539  GLU A CB  1 
ATOM   3600 C CG  . GLU A 1  461 ? -20.542 -9.738  -7.097  1.00 21.34  ? 539  GLU A CG  1 
ATOM   3601 C CD  . GLU A 1  461 ? -20.357 -10.810 -8.150  1.00 18.31  ? 539  GLU A CD  1 
ATOM   3602 O OE1 . GLU A 1  461 ? -20.993 -11.874 -7.976  1.00 17.80  ? 539  GLU A OE1 1 
ATOM   3603 O OE2 . GLU A 1  461 ? -19.593 -10.625 -9.116  1.00 21.06  ? 539  GLU A OE2 1 
ATOM   3604 N N   . ASN A 1  462 ? -17.161 -6.902  -5.806  1.00 20.00  ? 540  ASN A N   1 
ATOM   3605 C CA  . ASN A 1  462 ? -16.483 -5.594  -5.670  1.00 22.89  ? 540  ASN A CA  1 
ATOM   3606 C C   . ASN A 1  462 ? -15.395 -5.653  -4.596  1.00 20.91  ? 540  ASN A C   1 
ATOM   3607 O O   . ASN A 1  462 ? -15.590 -5.151  -3.486  1.00 22.16  ? 540  ASN A O   1 
ATOM   3608 C CB  . ASN A 1  462 ? -17.523 -4.505  -5.337  1.00 25.54  ? 540  ASN A CB  1 
ATOM   3609 C CG  . ASN A 1  462 ? -18.614 -4.379  -6.410  1.00 33.04  ? 540  ASN A CG  1 
ATOM   3610 O OD1 . ASN A 1  462 ? -18.331 -4.123  -7.581  1.00 42.06  ? 540  ASN A OD1 1 
ATOM   3611 N ND2 . ASN A 1  462 ? -19.870 -4.569  -6.006  1.00 40.45  ? 540  ASN A ND2 1 
ATOM   3612 N N   . PRO A 1  463 ? -14.267 -6.318  -4.899  1.00 18.81  ? 541  PRO A N   1 
ATOM   3613 C CA  . PRO A 1  463 ? -13.270 -6.570  -3.867  1.00 19.75  ? 541  PRO A CA  1 
ATOM   3614 C C   . PRO A 1  463 ? -12.377 -5.354  -3.641  1.00 19.69  ? 541  PRO A C   1 
ATOM   3615 O O   . PRO A 1  463 ? -12.325 -4.473  -4.485  1.00 20.87  ? 541  PRO A O   1 
ATOM   3616 C CB  . PRO A 1  463 ? -12.489 -7.743  -4.433  1.00 19.31  ? 541  PRO A CB  1 
ATOM   3617 C CG  . PRO A 1  463 ? -12.531 -7.519  -5.897  1.00 20.83  ? 541  PRO A CG  1 
ATOM   3618 C CD  . PRO A 1  463 ? -13.863 -6.892  -6.194  1.00 19.27  ? 541  PRO A CD  1 
ATOM   3619 N N   . PRO A 1  464 ? -11.711 -5.279  -2.479  1.00 20.17  ? 542  PRO A N   1 
ATOM   3620 C CA  . PRO A 1  464 ? -10.954 -4.073  -2.146  1.00 18.35  ? 542  PRO A CA  1 
ATOM   3621 C C   . PRO A 1  464 ? -9.752  -3.872  -3.078  1.00 20.13  ? 542  PRO A C   1 
ATOM   3622 O O   . PRO A 1  464 ? -9.320  -2.740  -3.254  1.00 19.09  ? 542  PRO A O   1 
ATOM   3623 C CB  . PRO A 1  464 ? -10.500 -4.314  -0.705  1.00 20.67  ? 542  PRO A CB  1 
ATOM   3624 C CG  . PRO A 1  464 ? -10.540 -5.788  -0.542  1.00 21.99  ? 542  PRO A CG  1 
ATOM   3625 C CD  . PRO A 1  464 ? -11.624 -6.299  -1.429  1.00 19.90  ? 542  PRO A CD  1 
ATOM   3626 N N   . TYR A 1  465 ? -9.237  -4.942  -3.689  1.00 20.05  ? 543  TYR A N   1 
ATOM   3627 C CA  . TYR A 1  465 ? -8.166  -4.810  -4.676  1.00 18.58  ? 543  TYR A CA  1 
ATOM   3628 C C   . TYR A 1  465 ? -8.574  -5.530  -5.923  1.00 17.34  ? 543  TYR A C   1 
ATOM   3629 O O   . TYR A 1  465 ? -8.725  -6.748  -5.898  1.00 18.50  ? 543  TYR A O   1 
ATOM   3630 C CB  . TYR A 1  465 ? -6.860  -5.397  -4.157  1.00 17.63  ? 543  TYR A CB  1 
ATOM   3631 C CG  . TYR A 1  465 ? -5.701  -5.230  -5.109  1.00 18.30  ? 543  TYR A CG  1 
ATOM   3632 C CD1 . TYR A 1  465 ? -4.944  -4.063  -5.112  1.00 19.98  ? 543  TYR A CD1 1 
ATOM   3633 C CD2 . TYR A 1  465 ? -5.358  -6.228  -6.009  1.00 19.24  ? 543  TYR A CD2 1 
ATOM   3634 C CE1 . TYR A 1  465 ? -3.881  -3.896  -5.986  1.00 20.52  ? 543  TYR A CE1 1 
ATOM   3635 C CE2 . TYR A 1  465 ? -4.287  -6.069  -6.885  1.00 17.34  ? 543  TYR A CE2 1 
ATOM   3636 C CZ  . TYR A 1  465 ? -3.554  -4.897  -6.865  1.00 20.73  ? 543  TYR A CZ  1 
ATOM   3637 O OH  . TYR A 1  465 ? -2.487  -4.717  -7.720  1.00 19.03  ? 543  TYR A OH  1 
ATOM   3638 N N   . VAL A 1  466 ? -8.730  -4.783  -7.011  1.00 17.43  ? 544  VAL A N   1 
ATOM   3639 C CA  . VAL A 1  466 ? -9.052  -5.374  -8.311  1.00 17.63  ? 544  VAL A CA  1 
ATOM   3640 C C   . VAL A 1  466 ? -7.802  -5.390  -9.167  1.00 17.86  ? 544  VAL A C   1 
ATOM   3641 O O   . VAL A 1  466 ? -7.281  -4.319  -9.499  1.00 18.42  ? 544  VAL A O   1 
ATOM   3642 C CB  . VAL A 1  466 ? -10.158 -4.605  -9.065  1.00 18.38  ? 544  VAL A CB  1 
ATOM   3643 C CG1 . VAL A 1  466 ? -10.462 -5.318  -10.389 1.00 22.51  ? 544  VAL A CG1 1 
ATOM   3644 C CG2 . VAL A 1  466 ? -11.418 -4.552  -8.218  1.00 20.53  ? 544  VAL A CG2 1 
ATOM   3645 N N   . PRO A 1  467 ? -7.305  -6.592  -9.526  1.00 15.48  ? 545  PRO A N   1 
ATOM   3646 C CA  . PRO A 1  467 ? -6.135  -6.651  -10.395 1.00 16.77  ? 545  PRO A CA  1 
ATOM   3647 C C   . PRO A 1  467 ? -6.346  -5.978  -11.748 1.00 15.51  ? 545  PRO A C   1 
ATOM   3648 O O   . PRO A 1  467 ? -7.484  -5.668  -12.126 1.00 15.99  ? 545  PRO A O   1 
ATOM   3649 C CB  . PRO A 1  467 ? -5.919  -8.163  -10.574 1.00 16.24  ? 545  PRO A CB  1 
ATOM   3650 C CG  . PRO A 1  467 ? -6.434  -8.736  -9.326  1.00 17.88  ? 545  PRO A CG  1 
ATOM   3651 C CD  . PRO A 1  467 ? -7.645  -7.930  -9.007  1.00 16.68  ? 545  PRO A CD  1 
ATOM   3652 N N   . GLY A 1  468 ? -5.265  -5.809  -12.498 1.00 14.39  ? 546  GLY A N   1 
ATOM   3653 C CA  . GLY A 1  468 ? -5.290  -5.007  -13.707 1.00 14.94  ? 546  GLY A CA  1 
ATOM   3654 C C   . GLY A 1  468 ? -5.970  -5.703  -14.883 1.00 18.92  ? 546  GLY A C   1 
ATOM   3655 O O   . GLY A 1  468 ? -5.423  -5.734  -16.000 1.00 18.62  ? 546  GLY A O   1 
ATOM   3656 N N   . VAL A 1  469 ? -7.173  -6.226  -14.645 1.00 18.76  ? 547  VAL A N   1 
ATOM   3657 C CA  . VAL A 1  469 ? -7.901  -7.002  -15.670 1.00 17.34  ? 547  VAL A CA  1 
ATOM   3658 C C   . VAL A 1  469 ? -8.507  -6.098  -16.738 1.00 17.01  ? 547  VAL A C   1 
ATOM   3659 O O   . VAL A 1  469 ? -8.918  -4.987  -16.440 1.00 16.41  ? 547  VAL A O   1 
ATOM   3660 C CB  . VAL A 1  469 ? -9.028  -7.872  -15.052 1.00 18.93  ? 547  VAL A CB  1 
ATOM   3661 C CG1 . VAL A 1  469 ? -8.455  -8.813  -14.005 1.00 21.35  ? 547  VAL A CG1 1 
ATOM   3662 C CG2 . VAL A 1  469 ? -10.145 -7.029  -14.445 1.00 18.88  ? 547  VAL A CG2 1 
ATOM   3663 N N   . VAL A 1  470 ? -8.550  -6.575  -17.985 1.00 17.13  ? 548  VAL A N   1 
ATOM   3664 C CA  . VAL A 1  470 ? -9.276  -5.893  -19.024 1.00 17.24  ? 548  VAL A CA  1 
ATOM   3665 C C   . VAL A 1  470 ? -10.728 -5.687  -18.599 1.00 18.60  ? 548  VAL A C   1 
ATOM   3666 O O   . VAL A 1  470 ? -11.374 -6.601  -18.104 1.00 15.14  ? 548  VAL A O   1 
ATOM   3667 C CB  . VAL A 1  470 ? -9.193  -6.621  -20.382 1.00 20.42  ? 548  VAL A CB  1 
ATOM   3668 C CG1 . VAL A 1  470 ? -10.065 -5.918  -21.426 1.00 20.00  ? 548  VAL A CG1 1 
ATOM   3669 C CG2 . VAL A 1  470 ? -7.735  -6.718  -20.843 1.00 19.24  ? 548  VAL A CG2 1 
ATOM   3670 N N   . GLY A 1  471 ? -11.201 -4.449  -18.734 1.00 15.84  ? 549  GLY A N   1 
ATOM   3671 C CA  . GLY A 1  471 ? -12.540 -4.083  -18.324 1.00 17.31  ? 549  GLY A CA  1 
ATOM   3672 C C   . GLY A 1  471 ? -12.634 -3.590  -16.899 1.00 19.25  ? 549  GLY A C   1 
ATOM   3673 O O   . GLY A 1  471 ? -13.677 -3.097  -16.501 1.00 22.26  ? 549  GLY A O   1 
ATOM   3674 N N   . GLY A 1  472 ? -11.573 -3.732  -16.105 1.00 18.59  ? 550  GLY A N   1 
ATOM   3675 C CA  . GLY A 1  472 ? -11.585 -3.213  -14.738 1.00 22.02  ? 550  GLY A CA  1 
ATOM   3676 C C   . GLY A 1  472 ? -12.512 -3.857  -13.702 1.00 24.99  ? 550  GLY A C   1 
ATOM   3677 O O   . GLY A 1  472 ? -12.670 -3.308  -12.605 1.00 25.40  ? 550  GLY A O   1 
ATOM   3678 N N   . THR A 1  473 ? -13.100 -5.011  -14.025 1.00 19.55  ? 551  THR A N   1 
ATOM   3679 C CA  . THR A 1  473 ? -13.967 -5.755  -13.115 1.00 21.57  ? 551  THR A CA  1 
ATOM   3680 C C   . THR A 1  473 ? -13.732 -7.263  -13.317 1.00 24.19  ? 551  THR A C   1 
ATOM   3681 O O   . THR A 1  473 ? -13.439 -7.701  -14.428 1.00 21.94  ? 551  THR A O   1 
ATOM   3682 C CB  . THR A 1  473 ? -15.472 -5.438  -13.336 1.00 25.03  ? 551  THR A CB  1 
ATOM   3683 O OG1 . THR A 1  473 ? -16.273 -6.365  -12.596 1.00 38.56  ? 551  THR A OG1 1 
ATOM   3684 C CG2 . THR A 1  473 ? -15.876 -5.547  -14.775 1.00 29.41  ? 551  THR A CG2 1 
ATOM   3685 N N   . LEU A 1  474 ? -13.908 -8.044  -12.255 1.00 17.39  ? 552  LEU A N   1 
ATOM   3686 C CA  . LEU A 1  474 ? -13.837 -9.495  -12.358 1.00 18.26  ? 552  LEU A CA  1 
ATOM   3687 C C   . LEU A 1  474 ? -14.997 -10.115 -13.167 1.00 17.98  ? 552  LEU A C   1 
ATOM   3688 O O   . LEU A 1  474 ? -14.860 -11.239 -13.627 1.00 23.37  ? 552  LEU A O   1 
ATOM   3689 C CB  . LEU A 1  474 ? -13.748 -10.145 -10.962 1.00 18.07  ? 552  LEU A CB  1 
ATOM   3690 C CG  . LEU A 1  474 ? -12.521 -9.771  -10.108 1.00 18.68  ? 552  LEU A CG  1 
ATOM   3691 C CD1 . LEU A 1  474 ? -12.535 -10.495 -8.771  1.00 22.93  ? 552  LEU A CD1 1 
ATOM   3692 C CD2 . LEU A 1  474 ? -11.202 -10.066 -10.813 1.00 16.91  ? 552  LEU A CD2 1 
ATOM   3693 N N   . GLN A 1  475 ? -16.097 -9.383  -13.342 1.00 17.71  ? 553  GLN A N   1 
ATOM   3694 C CA  A GLN A 1  475 ? -17.260 -9.921  -14.059 0.50 20.46  ? 553  GLN A CA  1 
ATOM   3695 C CA  B GLN A 1  475 ? -17.312 -9.825  -14.053 0.50 19.88  ? 553  GLN A CA  1 
ATOM   3696 C C   . GLN A 1  475 ? -17.166 -9.700  -15.560 1.00 20.57  ? 553  GLN A C   1 
ATOM   3697 O O   . GLN A 1  475 ? -17.893 -10.344 -16.309 1.00 19.37  ? 553  GLN A O   1 
ATOM   3698 C CB  A GLN A 1  475 ? -18.573 -9.328  -13.540 0.50 22.05  ? 553  GLN A CB  1 
ATOM   3699 C CB  B GLN A 1  475 ? -18.529 -8.945  -13.675 0.50 20.61  ? 553  GLN A CB  1 
ATOM   3700 C CG  A GLN A 1  475 ? -18.787 -9.534  -12.056 0.50 25.96  ? 553  GLN A CG  1 
ATOM   3701 C CG  B GLN A 1  475 ? -18.927 -8.934  -12.209 0.50 23.41  ? 553  GLN A CG  1 
ATOM   3702 C CD  A GLN A 1  475 ? -18.230 -8.387  -11.242 0.50 25.50  ? 553  GLN A CD  1 
ATOM   3703 C CD  B GLN A 1  475 ? -19.877 -7.793  -11.856 0.50 22.02  ? 553  GLN A CD  1 
ATOM   3704 O OE1 A GLN A 1  475 ? -18.332 -7.229  -11.637 0.50 34.35  ? 553  GLN A OE1 1 
ATOM   3705 O OE1 B GLN A 1  475 ? -20.118 -6.886  -12.654 0.50 29.52  ? 553  GLN A OE1 1 
ATOM   3706 N NE2 A GLN A 1  475 ? -17.615 -8.704  -10.129 0.50 24.66  ? 553  GLN A NE2 1 
ATOM   3707 N NE2 B GLN A 1  475 ? -20.401 -7.828  -10.641 0.50 20.35  ? 553  GLN A NE2 1 
ATOM   3708 N N   . ALA A 1  476 ? -16.269 -8.817  -16.002 1.00 19.41  ? 554  ALA A N   1 
ATOM   3709 C CA  . ALA A 1  476 ? -16.192 -8.507  -17.427 1.00 20.12  ? 554  ALA A CA  1 
ATOM   3710 C C   . ALA A 1  476 ? -15.973 -9.763  -18.266 1.00 19.60  ? 554  ALA A C   1 
ATOM   3711 O O   . ALA A 1  476 ? -14.998 -10.492 -18.085 1.00 18.10  ? 554  ALA A O   1 
ATOM   3712 C CB  . ALA A 1  476 ? -15.120 -7.461  -17.724 1.00 19.23  ? 554  ALA A CB  1 
ATOM   3713 N N   . ALA A 1  477 ? -16.918 -9.990  -19.186 1.00 21.34  ? 555  ALA A N   1 
ATOM   3714 C CA  . ALA A 1  477 ? -16.865 -11.072 -20.179 1.00 19.27  ? 555  ALA A CA  1 
ATOM   3715 C C   . ALA A 1  477 ? -16.901 -12.453 -19.562 1.00 17.31  ? 555  ALA A C   1 
ATOM   3716 O O   . ALA A 1  477 ? -16.479 -13.451 -20.198 1.00 18.56  ? 555  ALA A O   1 
ATOM   3717 C CB  . ALA A 1  477 ? -15.662 -10.911 -21.098 1.00 17.58  ? 555  ALA A CB  1 
ATOM   3718 N N   . THR A 1  478 ? -17.407 -12.534 -18.331 1.00 15.25  ? 556  THR A N   1 
ATOM   3719 C CA  . THR A 1  478 ? -17.489 -13.826 -17.658 1.00 15.94  ? 556  THR A CA  1 
ATOM   3720 C C   . THR A 1  478 ? -18.717 -13.829 -16.737 1.00 15.81  ? 556  THR A C   1 
ATOM   3721 O O   . THR A 1  478 ? -19.654 -13.008 -16.903 1.00 14.61  ? 556  THR A O   1 
ATOM   3722 C CB  . THR A 1  478 ? -16.125 -14.181 -16.979 1.00 15.02  ? 556  THR A CB  1 
ATOM   3723 O OG1 . THR A 1  478 ? -16.136 -15.541 -16.512 1.00 16.29  ? 556  THR A OG1 1 
ATOM   3724 C CG2 . THR A 1  478 ? -15.774 -13.258 -15.816 1.00 17.04  ? 556  THR A CG2 1 
ATOM   3725 N N   . ILE A 1  479 ? -18.735 -14.746 -15.784 1.00 16.17  ? 557  ILE A N   1 
ATOM   3726 C CA  . ILE A 1  479 ? -19.871 -14.867 -14.879 1.00 14.33  ? 557  ILE A CA  1 
ATOM   3727 C C   . ILE A 1  479 ? -19.588 -14.209 -13.542 1.00 16.16  ? 557  ILE A C   1 
ATOM   3728 O O   . ILE A 1  479 ? -18.444 -13.880 -13.226 1.00 16.32  ? 557  ILE A O   1 
ATOM   3729 C CB  . ILE A 1  479 ? -20.316 -16.339 -14.700 1.00 15.41  ? 557  ILE A CB  1 
ATOM   3730 C CG1 . ILE A 1  479 ? -19.244 -17.194 -14.004 1.00 15.20  ? 557  ILE A CG1 1 
ATOM   3731 C CG2 . ILE A 1  479 ? -20.708 -16.948 -16.054 1.00 18.94  ? 557  ILE A CG2 1 
ATOM   3732 C CD1 . ILE A 1  479 ? -19.642 -18.642 -13.836 1.00 16.82  ? 557  ILE A CD1 1 
ATOM   3733 N N   . CYS A 1  480 ? -20.643 -14.045 -12.747 1.00 16.42  ? 558  CYS A N   1 
ATOM   3734 C CA  . CYS A 1  480 ? -20.546 -13.401 -11.449 1.00 16.06  ? 558  CYS A CA  1 
ATOM   3735 C C   . CYS A 1  480 ? -19.534 -14.120 -10.578 1.00 14.97  ? 558  CYS A C   1 
ATOM   3736 O O   . CYS A 1  480 ? -19.535 -15.361 -10.484 1.00 17.00  ? 558  CYS A O   1 
ATOM   3737 C CB  . CYS A 1  480 ? -21.901 -13.410 -10.751 1.00 17.94  ? 558  CYS A CB  1 
ATOM   3738 S SG  . CYS A 1  480 ? -23.212 -12.579 -11.674 1.00 17.00  ? 558  CYS A SG  1 
ATOM   3739 N N   . ALA A 1  481 ? -18.697 -13.330 -9.932  1.00 17.53  ? 559  ALA A N   1 
ATOM   3740 C CA  . ALA A 1  481 ? -17.678 -13.823 -9.001  1.00 15.85  ? 559  ALA A CA  1 
ATOM   3741 C C   . ALA A 1  481 ? -18.249 -14.479 -7.751  1.00 15.30  ? 559  ALA A C   1 
ATOM   3742 O O   . ALA A 1  481 ? -17.631 -15.401 -7.198  1.00 18.44  ? 559  ALA A O   1 
ATOM   3743 C CB  . ALA A 1  481 ? -16.737 -12.684 -8.620  1.00 15.61  ? 559  ALA A CB  1 
ATOM   3744 N N   . SER A 1  482 ? -19.439 -14.066 -7.313  1.00 14.40  ? 560  SER A N   1 
ATOM   3745 C CA  . SER A 1  482 ? -20.024 -14.647 -6.113  1.00 17.68  ? 560  SER A CA  1 
ATOM   3746 C C   . SER A 1  482 ? -20.945 -15.811 -6.434  1.00 19.28  ? 560  SER A C   1 
ATOM   3747 O O   . SER A 1  482 ? -21.570 -16.331 -5.520  1.00 20.25  ? 560  SER A O   1 
ATOM   3748 C CB  . SER A 1  482 ? -20.750 -13.598 -5.253  1.00 17.89  ? 560  SER A CB  1 
ATOM   3749 O OG  . SER A 1  482 ? -21.864 -13.048 -5.902  1.00 19.07  ? 560  SER A OG  1 
ATOM   3750 N N   . SER A 1  483 ? -21.007 -16.258 -7.696  1.00 14.86  ? 561  SER A N   1 
ATOM   3751 C CA  . SER A 1  483 ? -21.820 -17.438 -8.038  1.00 17.05  ? 561  SER A CA  1 
ATOM   3752 C C   . SER A 1  483 ? -21.249 -18.673 -7.362  1.00 16.18  ? 561  SER A C   1 
ATOM   3753 O O   . SER A 1  483 ? -20.056 -18.690 -7.003  1.00 14.94  ? 561  SER A O   1 
ATOM   3754 C CB  . SER A 1  483 ? -21.919 -17.630 -9.551  1.00 16.76  ? 561  SER A CB  1 
ATOM   3755 O OG  . SER A 1  483 ? -20.650 -17.818 -10.141 1.00 16.62  ? 561  SER A OG  1 
ATOM   3756 N N   . HIS A 1  484 ? -22.076 -19.709 -7.191  1.00 18.03  ? 562  HIS A N   1 
ATOM   3757 C CA  A HIS A 1  484 ? -21.645 -20.865 -6.390  0.50 19.85  ? 562  HIS A CA  1 
ATOM   3758 C CA  B HIS A 1  484 ? -21.746 -20.896 -6.368  0.50 17.48  ? 562  HIS A CA  1 
ATOM   3759 C C   . HIS A 1  484 ? -21.316 -22.129 -7.179  1.00 18.41  ? 562  HIS A C   1 
ATOM   3760 O O   . HIS A 1  484 ? -22.021 -22.531 -8.108  1.00 15.26  ? 562  HIS A O   1 
ATOM   3761 C CB  A HIS A 1  484 ? -22.624 -21.128 -5.247  0.50 23.23  ? 562  HIS A CB  1 
ATOM   3762 C CB  B HIS A 1  484 ? -22.962 -21.255 -5.489  0.50 17.68  ? 562  HIS A CB  1 
ATOM   3763 C CG  A HIS A 1  484 ? -22.538 -20.099 -4.162  0.50 27.33  ? 562  HIS A CG  1 
ATOM   3764 C CG  B HIS A 1  484 ? -22.868 -22.595 -4.821  0.50 16.50  ? 562  HIS A CG  1 
ATOM   3765 N ND1 A HIS A 1  484 ? -21.910 -20.323 -2.950  0.50 25.93  ? 562  HIS A ND1 1 
ATOM   3766 N ND1 B HIS A 1  484 ? -22.330 -22.763 -3.564  0.50 16.35  ? 562  HIS A ND1 1 
ATOM   3767 C CD2 A HIS A 1  484 ? -22.972 -18.820 -4.131  0.50 25.98  ? 562  HIS A CD2 1 
ATOM   3768 C CD2 B HIS A 1  484 ? -23.265 -23.825 -5.228  0.50 18.51  ? 562  HIS A CD2 1 
ATOM   3769 C CE1 A HIS A 1  484 ? -21.991 -19.228 -2.215  0.50 27.73  ? 562  HIS A CE1 1 
ATOM   3770 C CE1 B HIS A 1  484 ? -22.385 -24.039 -3.233  0.50 18.13  ? 562  HIS A CE1 1 
ATOM   3771 N NE2 A HIS A 1  484 ? -22.626 -18.301 -2.912  0.50 24.55  ? 562  HIS A NE2 1 
ATOM   3772 N NE2 B HIS A 1  484 ? -22.943 -24.704 -4.229  0.50 19.17  ? 562  HIS A NE2 1 
ATOM   3773 N N   . GLN A 1  485 ? -20.184 -22.733 -6.802  1.00 16.96  ? 563  GLN A N   1 
ATOM   3774 C CA  . GLN A 1  485 ? -19.735 -23.998 -7.325  1.00 15.93  ? 563  GLN A CA  1 
ATOM   3775 C C   . GLN A 1  485 ? -19.638 -24.957 -6.138  1.00 16.95  ? 563  GLN A C   1 
ATOM   3776 O O   . GLN A 1  485 ? -19.663 -24.545 -4.970  1.00 17.30  ? 563  GLN A O   1 
ATOM   3777 C CB  . GLN A 1  485 ? -18.378 -23.860 -8.044  1.00 15.99  ? 563  GLN A CB  1 
ATOM   3778 C CG  . GLN A 1  485 ? -18.365 -22.801 -9.140  1.00 17.47  ? 563  GLN A CG  1 
ATOM   3779 C CD  . GLN A 1  485 ? -17.203 -22.907 -10.112 1.00 14.51  ? 563  GLN A CD  1 
ATOM   3780 O OE1 . GLN A 1  485 ? -16.581 -21.904 -10.435 1.00 14.95  ? 563  GLN A OE1 1 
ATOM   3781 N NE2 . GLN A 1  485 ? -16.934 -24.112 -10.619 1.00 16.83  ? 563  GLN A NE2 1 
ATOM   3782 N N   . PHE A 1  486 ? -19.501 -26.237 -6.435  1.00 16.55  ? 564  PHE A N   1 
ATOM   3783 C CA  . PHE A 1  486 ? -19.476 -27.253 -5.400  1.00 16.89  ? 564  PHE A CA  1 
ATOM   3784 C C   . PHE A 1  486 ? -18.340 -27.013 -4.391  1.00 18.03  ? 564  PHE A C   1 
ATOM   3785 O O   . PHE A 1  486 ? -18.547 -27.137 -3.185  1.00 16.43  ? 564  PHE A O   1 
ATOM   3786 C CB  . PHE A 1  486 ? -19.345 -28.625 -6.083  1.00 18.83  ? 564  PHE A CB  1 
ATOM   3787 C CG  . PHE A 1  486 ? -19.356 -29.790 -5.138  1.00 20.45  ? 564  PHE A CG  1 
ATOM   3788 C CD1 . PHE A 1  486 ? -20.551 -30.311 -4.679  1.00 22.06  ? 564  PHE A CD1 1 
ATOM   3789 C CD2 . PHE A 1  486 ? -18.165 -30.379 -4.726  1.00 21.46  ? 564  PHE A CD2 1 
ATOM   3790 C CE1 . PHE A 1  486 ? -20.563 -31.396 -3.814  1.00 21.90  ? 564  PHE A CE1 1 
ATOM   3791 C CE2 . PHE A 1  486 ? -18.171 -31.467 -3.871  1.00 22.49  ? 564  PHE A CE2 1 
ATOM   3792 C CZ  . PHE A 1  486 ? -19.373 -31.966 -3.409  1.00 23.56  ? 564  PHE A CZ  1 
ATOM   3793 N N   . LEU A 1  487 ? -17.144 -26.674 -4.877  1.00 17.20  ? 565  LEU A N   1 
ATOM   3794 C CA  . LEU A 1  487 ? -15.969 -26.547 -3.994  1.00 20.13  ? 565  LEU A CA  1 
ATOM   3795 C C   . LEU A 1  487 ? -15.853 -25.189 -3.326  1.00 21.63  ? 565  LEU A C   1 
ATOM   3796 O O   . LEU A 1  487 ? -15.287 -25.087 -2.228  1.00 19.23  ? 565  LEU A O   1 
ATOM   3797 C CB  . LEU A 1  487 ? -14.659 -26.829 -4.741  1.00 20.73  ? 565  LEU A CB  1 
ATOM   3798 C CG  . LEU A 1  487 ? -14.413 -28.314 -5.009  1.00 32.11  ? 565  LEU A CG  1 
ATOM   3799 C CD1 . LEU A 1  487 ? -13.189 -28.509 -5.900  1.00 36.28  ? 565  LEU A CD1 1 
ATOM   3800 C CD2 . LEU A 1  487 ? -14.265 -29.089 -3.694  1.00 34.47  ? 565  LEU A CD2 1 
ATOM   3801 N N   . SER A 1  488 ? -16.333 -24.147 -3.994  1.00 18.52  ? 566  SER A N   1 
ATOM   3802 C CA  . SER A 1  488 ? -16.193 -22.787 -3.466  1.00 18.67  ? 566  SER A CA  1 
ATOM   3803 C C   . SER A 1  488 ? -16.950 -21.859 -4.378  1.00 18.02  ? 566  SER A C   1 
ATOM   3804 O O   . SER A 1  488 ? -17.660 -22.311 -5.285  1.00 15.75  ? 566  SER A O   1 
ATOM   3805 C CB  . SER A 1  488 ? -14.691 -22.387 -3.403  1.00 18.75  ? 566  SER A CB  1 
ATOM   3806 O OG  . SER A 1  488 ? -14.518 -21.169 -2.727  1.00 15.85  ? 566  SER A OG  1 
ATOM   3807 N N   . THR A 1  489 ? -16.814 -20.554 -4.139  1.00 16.99  ? 567  THR A N   1 
ATOM   3808 C CA  . THR A 1  489 ? -17.339 -19.555 -5.044  1.00 15.50  ? 567  THR A CA  1 
ATOM   3809 C C   . THR A 1  489 ? -16.491 -19.440 -6.318  1.00 16.28  ? 567  THR A C   1 
ATOM   3810 O O   . THR A 1  489 ? -15.298 -19.775 -6.365  1.00 15.37  ? 567  THR A O   1 
ATOM   3811 C CB  . THR A 1  489 ? -17.447 -18.180 -4.358  1.00 17.01  ? 567  THR A CB  1 
ATOM   3812 O OG1 . THR A 1  489 ? -16.173 -17.842 -3.809  1.00 17.49  ? 567  THR A OG1 1 
ATOM   3813 C CG2 . THR A 1  489 ? -18.492 -18.216 -3.223  1.00 18.40  ? 567  THR A CG2 1 
ATOM   3814 N N   . HIS A 1  490 ? -17.128 -18.952 -7.370  1.00 15.19  ? 568  HIS A N   1 
ATOM   3815 C CA  . HIS A 1  490 ? -16.419 -18.677 -8.611  1.00 14.83  ? 568  HIS A CA  1 
ATOM   3816 C C   . HIS A 1  490 ? -15.222 -17.729 -8.459  1.00 16.62  ? 568  HIS A C   1 
ATOM   3817 O O   . HIS A 1  490 ? -14.216 -17.831 -9.191  1.00 17.81  ? 568  HIS A O   1 
ATOM   3818 C CB  . HIS A 1  490 ? -17.381 -18.111 -9.643  1.00 15.52  ? 568  HIS A CB  1 
ATOM   3819 C CG  . HIS A 1  490 ? -16.841 -18.189 -11.021 1.00 14.49  ? 568  HIS A CG  1 
ATOM   3820 N ND1 . HIS A 1  490 ? -16.579 -19.390 -11.624 1.00 14.95  ? 568  HIS A ND1 1 
ATOM   3821 C CD2 . HIS A 1  490 ? -16.443 -17.231 -11.887 1.00 14.61  ? 568  HIS A CD2 1 
ATOM   3822 C CE1 . HIS A 1  490 ? -16.061 -19.177 -12.814 1.00 14.69  ? 568  HIS A CE1 1 
ATOM   3823 N NE2 . HIS A 1  490 ? -15.980 -17.875 -13.001 1.00 13.69  ? 568  HIS A NE2 1 
ATOM   3824 N N   . TYR A 1  491 ? -15.339 -16.798 -7.525  1.00 16.56  ? 569  TYR A N   1 
ATOM   3825 C CA  . TYR A 1  491 ? -14.226 -15.918 -7.165  1.00 16.12  ? 569  TYR A CA  1 
ATOM   3826 C C   . TYR A 1  491 ? -12.914 -16.679 -6.978  1.00 14.04  ? 569  TYR A C   1 
ATOM   3827 O O   . TYR A 1  491 ? -11.874 -16.288 -7.508  1.00 16.14  ? 569  TYR A O   1 
ATOM   3828 C CB  . TYR A 1  491 ? -14.590 -15.211 -5.891  1.00 15.55  ? 569  TYR A CB  1 
ATOM   3829 C CG  . TYR A 1  491 ? -13.622 -14.197 -5.346  1.00 16.04  ? 569  TYR A CG  1 
ATOM   3830 C CD1 . TYR A 1  491 ? -13.696 -12.865 -5.739  1.00 16.51  ? 569  TYR A CD1 1 
ATOM   3831 C CD2 . TYR A 1  491 ? -12.682 -14.549 -4.371  1.00 15.64  ? 569  TYR A CD2 1 
ATOM   3832 C CE1 . TYR A 1  491 ? -12.843 -11.908 -5.204  1.00 15.83  ? 569  TYR A CE1 1 
ATOM   3833 C CE2 . TYR A 1  491 ? -11.829 -13.591 -3.822  1.00 16.01  ? 569  TYR A CE2 1 
ATOM   3834 C CZ  . TYR A 1  491 ? -11.925 -12.273 -4.235  1.00 15.89  ? 569  TYR A CZ  1 
ATOM   3835 O OH  . TYR A 1  491 ? -11.100 -11.294 -3.696  1.00 16.06  ? 569  TYR A OH  1 
ATOM   3836 N N   . ASN A 1  492 ? -12.972 -17.770 -6.233  1.00 15.98  ? 570  ASN A N   1 
ATOM   3837 C CA  . ASN A 1  492 ? -11.787 -18.608 -5.981  1.00 16.51  ? 570  ASN A CA  1 
ATOM   3838 C C   . ASN A 1  492 ? -11.401 -19.564 -7.122  1.00 14.50  ? 570  ASN A C   1 
ATOM   3839 O O   . ASN A 1  492 ? -10.224 -19.896 -7.277  1.00 14.63  ? 570  ASN A O   1 
ATOM   3840 C CB  . ASN A 1  492 ? -11.990 -19.405 -4.697  1.00 15.13  ? 570  ASN A CB  1 
ATOM   3841 C CG  . ASN A 1  492 ? -12.055 -18.520 -3.462  1.00 15.14  ? 570  ASN A CG  1 
ATOM   3842 O OD1 . ASN A 1  492 ? -11.245 -17.621 -3.276  1.00 16.94  ? 570  ASN A OD1 1 
ATOM   3843 N ND2 . ASN A 1  492 ? -13.015 -18.794 -2.595  1.00 15.55  ? 570  ASN A ND2 1 
ATOM   3844 N N   . LEU A 1  493 ? -12.401 -20.007 -7.887  1.00 13.99  ? 571  LEU A N   1 
ATOM   3845 C CA  . LEU A 1  493 ? -12.281 -21.137 -8.820  1.00 15.57  ? 571  LEU A CA  1 
ATOM   3846 C C   . LEU A 1  493 ? -12.213 -20.737 -10.290 1.00 14.94  ? 571  LEU A C   1 
ATOM   3847 O O   . LEU A 1  493 ? -11.894 -21.575 -11.119 1.00 15.84  ? 571  LEU A O   1 
ATOM   3848 C CB  . LEU A 1  493 ? -13.470 -22.084 -8.623  1.00 17.30  ? 571  LEU A CB  1 
ATOM   3849 C CG  . LEU A 1  493 ? -13.509 -22.821 -7.289  1.00 17.33  ? 571  LEU A CG  1 
ATOM   3850 C CD1 . LEU A 1  493 ? -14.907 -23.403 -7.099  1.00 20.53  ? 571  LEU A CD1 1 
ATOM   3851 C CD2 . LEU A 1  493 ? -12.455 -23.925 -7.258  1.00 17.15  ? 571  LEU A CD2 1 
ATOM   3852 N N   . HIS A 1  494 ? -12.473 -19.465 -10.593 1.00 17.18  ? 572  HIS A N   1 
ATOM   3853 C CA  . HIS A 1  494 ? -12.534 -18.956 -11.964 1.00 13.22  ? 572  HIS A CA  1 
ATOM   3854 C C   . HIS A 1  494 ? -11.329 -19.375 -12.783 1.00 14.60  ? 572  HIS A C   1 
ATOM   3855 O O   . HIS A 1  494 ? -11.502 -19.916 -13.872 1.00 12.11  ? 572  HIS A O   1 
ATOM   3856 C CB  . HIS A 1  494 ? -12.719 -17.425 -11.977 1.00 13.99  ? 572  HIS A CB  1 
ATOM   3857 C CG  . HIS A 1  494 ? -12.562 -16.800 -13.329 1.00 16.32  ? 572  HIS A CG  1 
ATOM   3858 N ND1 . HIS A 1  494 ? -13.608 -16.607 -14.199 1.00 15.89  ? 572  HIS A ND1 1 
ATOM   3859 C CD2 . HIS A 1  494 ? -11.462 -16.344 -13.969 1.00 16.08  ? 572  HIS A CD2 1 
ATOM   3860 C CE1 . HIS A 1  494 ? -13.167 -16.046 -15.306 1.00 16.08  ? 572  HIS A CE1 1 
ATOM   3861 N NE2 . HIS A 1  494 ? -11.867 -15.878 -15.194 1.00 16.23  ? 572  HIS A NE2 1 
ATOM   3862 N N   . ASN A 1  495 ? -10.117 -19.185 -12.256 1.00 13.28  ? 573  ASN A N   1 
ATOM   3863 C CA  . ASN A 1  495 ? -8.913  -19.507 -13.031 1.00 14.77  ? 573  ASN A CA  1 
ATOM   3864 C C   . ASN A 1  495 ? -8.737  -21.005 -13.260 1.00 14.44  ? 573  ASN A C   1 
ATOM   3865 O O   . ASN A 1  495 ? -7.878  -21.398 -14.035 1.00 13.53  ? 573  ASN A O   1 
ATOM   3866 C CB  . ASN A 1  495 ? -7.647  -18.905 -12.411 1.00 13.35  ? 573  ASN A CB  1 
ATOM   3867 C CG  . ASN A 1  495 ? -7.493  -17.420 -12.721 1.00 16.45  ? 573  ASN A CG  1 
ATOM   3868 O OD1 . ASN A 1  495 ? -8.196  -16.873 -13.572 1.00 14.73  ? 573  ASN A OD1 1 
ATOM   3869 N ND2 . ASN A 1  495 ? -6.547  -16.770 -12.049 1.00 18.20  ? 573  ASN A ND2 1 
ATOM   3870 N N   . LEU A 1  496 ? -9.520  -21.824 -12.557 1.00 13.80  ? 574  LEU A N   1 
ATOM   3871 C CA  . LEU A 1  496 ? -9.533  -23.280 -12.787 1.00 15.42  ? 574  LEU A CA  1 
ATOM   3872 C C   . LEU A 1  496 ? -10.634 -23.752 -13.732 1.00 14.55  ? 574  LEU A C   1 
ATOM   3873 O O   . LEU A 1  496 ? -10.723 -24.935 -14.007 1.00 15.12  ? 574  LEU A O   1 
ATOM   3874 C CB  . LEU A 1  496 ? -9.720  -24.021 -11.466 1.00 16.03  ? 574  LEU A CB  1 
ATOM   3875 C CG  . LEU A 1  496 ? -8.827  -23.589 -10.305 1.00 16.99  ? 574  LEU A CG  1 
ATOM   3876 C CD1 . LEU A 1  496 ? -9.119  -24.465 -9.112  1.00 17.12  ? 574  LEU A CD1 1 
ATOM   3877 C CD2 . LEU A 1  496 ? -7.360  -23.637 -10.679 1.00 17.63  ? 574  LEU A CD2 1 
ATOM   3878 N N   . TYR A 1  497 ? -11.499 -22.866 -14.207 1.00 16.33  ? 575  TYR A N   1 
ATOM   3879 C CA  . TYR A 1  497 ? -12.655 -23.360 -14.948 1.00 15.44  ? 575  TYR A CA  1 
ATOM   3880 C C   . TYR A 1  497 ? -12.227 -24.279 -16.105 1.00 15.39  ? 575  TYR A C   1 
ATOM   3881 O O   . TYR A 1  497 ? -12.676 -25.456 -16.203 1.00 15.54  ? 575  TYR A O   1 
ATOM   3882 C CB  . TYR A 1  497 ? -13.561 -22.229 -15.433 1.00 15.77  ? 575  TYR A CB  1 
ATOM   3883 C CG  . TYR A 1  497 ? -14.897 -22.768 -15.930 1.00 17.18  ? 575  TYR A CG  1 
ATOM   3884 C CD1 . TYR A 1  497 ? -15.976 -22.891 -15.076 1.00 16.20  ? 575  TYR A CD1 1 
ATOM   3885 C CD2 . TYR A 1  497 ? -15.041 -23.236 -17.234 1.00 15.90  ? 575  TYR A CD2 1 
ATOM   3886 C CE1 . TYR A 1  497 ? -17.187 -23.398 -15.523 1.00 15.87  ? 575  TYR A CE1 1 
ATOM   3887 C CE2 . TYR A 1  497 ? -16.239 -23.740 -17.680 1.00 16.21  ? 575  TYR A CE2 1 
ATOM   3888 C CZ  . TYR A 1  497 ? -17.306 -23.824 -16.821 1.00 15.15  ? 575  TYR A CZ  1 
ATOM   3889 O OH  . TYR A 1  497 ? -18.484 -24.346 -17.268 1.00 16.13  ? 575  TYR A OH  1 
ATOM   3890 N N   . GLY A 1  498 ? -11.319 -23.767 -16.933 1.00 16.85  ? 576  GLY A N   1 
ATOM   3891 C CA  . GLY A 1  498 ? -10.835 -24.490 -18.102 1.00 15.02  ? 576  GLY A CA  1 
ATOM   3892 C C   . GLY A 1  498 ? -10.175 -25.794 -17.725 1.00 16.21  ? 576  GLY A C   1 
ATOM   3893 O O   . GLY A 1  498 ? -10.471 -26.845 -18.292 1.00 16.12  ? 576  GLY A O   1 
ATOM   3894 N N   . LEU A 1  499 ? -9.260  -25.711 -16.763 1.00 17.35  ? 577  LEU A N   1 
ATOM   3895 C CA  . LEU A 1  499 ? -8.587  -26.883 -16.252 1.00 16.42  ? 577  LEU A CA  1 
ATOM   3896 C C   . LEU A 1  499 ? -9.569  -27.957 -15.817 1.00 15.97  ? 577  LEU A C   1 
ATOM   3897 O O   . LEU A 1  499 ? -9.393  -29.119 -16.182 1.00 14.38  ? 577  LEU A O   1 
ATOM   3898 C CB  . LEU A 1  499 ? -7.687  -26.515 -15.077 1.00 20.50  ? 577  LEU A CB  1 
ATOM   3899 C CG  . LEU A 1  499 ? -7.008  -27.702 -14.380 1.00 22.08  ? 577  LEU A CG  1 
ATOM   3900 C CD1 . LEU A 1  499 ? -6.068  -28.374 -15.353 1.00 20.85  ? 577  LEU A CD1 1 
ATOM   3901 C CD2 . LEU A 1  499 ? -6.268  -27.239 -13.132 1.00 20.13  ? 577  LEU A CD2 1 
ATOM   3902 N N   . THR A 1  500 ? -10.582 -27.580 -15.025 1.00 13.97  ? 578  THR A N   1 
ATOM   3903 C CA  . THR A 1  500 ? -11.528 -28.566 -14.532 1.00 15.71  ? 578  THR A CA  1 
ATOM   3904 C C   . THR A 1  500 ? -12.331 -29.190 -15.681 1.00 16.14  ? 578  THR A C   1 
ATOM   3905 O O   . THR A 1  500 ? -12.630 -30.399 -15.640 1.00 14.92  ? 578  THR A O   1 
ATOM   3906 C CB  . THR A 1  500 ? -12.480 -28.014 -13.439 1.00 14.88  ? 578  THR A CB  1 
ATOM   3907 O OG1 . THR A 1  500 ? -13.188 -26.873 -13.921 1.00 14.75  ? 578  THR A OG1 1 
ATOM   3908 C CG2 . THR A 1  500 ? -11.694 -27.651 -12.199 1.00 15.33  ? 578  THR A CG2 1 
ATOM   3909 N N   . GLU A 1  501 ? -12.667 -28.396 -16.690 1.00 14.66  ? 579  GLU A N   1 
ATOM   3910 C CA  . GLU A 1  501 ? -13.319 -28.935 -17.889 1.00 16.04  ? 579  GLU A CA  1 
ATOM   3911 C C   . GLU A 1  501 ? -12.374 -29.904 -18.637 1.00 14.63  ? 579  GLU A C   1 
ATOM   3912 O O   . GLU A 1  501 ? -12.797 -30.971 -19.142 1.00 13.81  ? 579  GLU A O   1 
ATOM   3913 C CB  . GLU A 1  501 ? -13.818 -27.824 -18.827 1.00 16.74  ? 579  GLU A CB  1 
ATOM   3914 C CG  . GLU A 1  501 ? -14.659 -28.386 -19.974 1.00 16.82  ? 579  GLU A CG  1 
ATOM   3915 C CD  . GLU A 1  501 ? -14.967 -27.418 -21.085 1.00 15.56  ? 579  GLU A CD  1 
ATOM   3916 O OE1 . GLU A 1  501 ? -14.376 -26.332 -21.136 1.00 15.69  ? 579  GLU A OE1 1 
ATOM   3917 O OE2 . GLU A 1  501 ? -15.825 -27.751 -21.933 1.00 15.01  ? 579  GLU A OE2 1 
ATOM   3918 N N   . ALA A 1  502 ? -11.091 -29.567 -18.669 1.00 14.53  ? 580  ALA A N   1 
ATOM   3919 C CA  . ALA A 1  502 ? -10.127 -30.415 -19.376 1.00 13.77  ? 580  ALA A CA  1 
ATOM   3920 C C   . ALA A 1  502 ? -9.979  -31.772 -18.691 1.00 14.49  ? 580  ALA A C   1 
ATOM   3921 O O   . ALA A 1  502 ? -9.940  -32.808 -19.356 1.00 16.65  ? 580  ALA A O   1 
ATOM   3922 C CB  . ALA A 1  502 ? -8.797  -29.714 -19.503 1.00 14.48  ? 580  ALA A CB  1 
ATOM   3923 N N   . ILE A 1  503 ? -9.942  -31.763 -17.361 1.00 14.85  ? 581  ILE A N   1 
ATOM   3924 C CA  . ILE A 1  503 ? -9.965  -32.996 -16.586 1.00 15.39  ? 581  ILE A CA  1 
ATOM   3925 C C   . ILE A 1  503 ? -11.229 -33.819 -16.852 1.00 15.12  ? 581  ILE A C   1 
ATOM   3926 O O   . ILE A 1  503 ? -11.151 -35.045 -17.070 1.00 15.46  ? 581  ILE A O   1 
ATOM   3927 C CB  . ILE A 1  503 ? -9.798  -32.703 -15.071 1.00 15.00  ? 581  ILE A CB  1 
ATOM   3928 C CG1 . ILE A 1  503 ? -8.429  -32.076 -14.821 1.00 14.89  ? 581  ILE A CG1 1 
ATOM   3929 C CG2 . ILE A 1  503 ? -9.944  -33.985 -14.236 1.00 18.13  ? 581  ILE A CG2 1 
ATOM   3930 C CD1 . ILE A 1  503 ? -8.251  -31.489 -13.434 1.00 16.95  ? 581  ILE A CD1 1 
ATOM   3931 N N   . ALA A 1  504 ? -12.392 -33.164 -16.804 1.00 17.43  ? 582  ALA A N   1 
ATOM   3932 C CA  . ALA A 1  504 ? -13.686 -33.833 -17.073 1.00 16.35  ? 582  ALA A CA  1 
ATOM   3933 C C   . ALA A 1  504 ? -13.745 -34.464 -18.469 1.00 14.36  ? 582  ALA A C   1 
ATOM   3934 O O   . ALA A 1  504 ? -14.227 -35.582 -18.642 1.00 17.57  ? 582  ALA A O   1 
ATOM   3935 C CB  . ALA A 1  504 ? -14.839 -32.852 -16.913 1.00 17.07  ? 582  ALA A CB  1 
ATOM   3936 N N   . SER A 1  505 ? -13.228 -33.738 -19.443 1.00 14.10  ? 583  SER A N   1 
ATOM   3937 C CA  . SER A 1  505 ? -13.265 -34.145 -20.851 1.00 14.11  ? 583  SER A CA  1 
ATOM   3938 C C   . SER A 1  505 ? -12.290 -35.295 -21.120 1.00 15.98  ? 583  SER A C   1 
ATOM   3939 O O   . SER A 1  505 ? -12.601 -36.215 -21.866 1.00 13.80  ? 583  SER A O   1 
ATOM   3940 C CB  . SER A 1  505 ? -12.936 -32.957 -21.728 1.00 15.38  ? 583  SER A CB  1 
ATOM   3941 O OG  . SER A 1  505 ? -13.888 -31.899 -21.548 1.00 14.34  ? 583  SER A OG  1 
ATOM   3942 N N   . HIS A 1  506 ? -11.123 -35.228 -20.482 1.00 17.01  ? 584  HIS A N   1 
ATOM   3943 C CA  . HIS A 1  506 ? -10.102 -36.269 -20.521 1.00 15.28  ? 584  HIS A CA  1 
ATOM   3944 C C   . HIS A 1  506 ? -10.707 -37.591 -20.043 1.00 17.50  ? 584  HIS A C   1 
ATOM   3945 O O   . HIS A 1  506 ? -10.624 -38.598 -20.726 1.00 17.47  ? 584  HIS A O   1 
ATOM   3946 C CB  . HIS A 1  506 ? -8.921  -35.853 -19.600 1.00 17.12  ? 584  HIS A CB  1 
ATOM   3947 C CG  . HIS A 1  506 ? -7.784  -36.819 -19.584 1.00 17.10  ? 584  HIS A CG  1 
ATOM   3948 N ND1 . HIS A 1  506 ? -7.852  -38.053 -18.966 1.00 21.71  ? 584  HIS A ND1 1 
ATOM   3949 C CD2 . HIS A 1  506 ? -6.546  -36.739 -20.121 1.00 17.88  ? 584  HIS A CD2 1 
ATOM   3950 C CE1 . HIS A 1  506 ? -6.709  -38.695 -19.130 1.00 20.90  ? 584  HIS A CE1 1 
ATOM   3951 N NE2 . HIS A 1  506 ? -5.899  -37.921 -19.826 1.00 21.63  ? 584  HIS A NE2 1 
ATOM   3952 N N   . ARG A 1  507 ? -11.309 -37.563 -18.849 1.00 19.74  ? 585  ARG A N   1 
ATOM   3953 C CA  . ARG A 1  507 ? -11.995 -38.722 -18.254 1.00 22.81  ? 585  ARG A CA  1 
ATOM   3954 C C   . ARG A 1  507 ? -13.166 -39.233 -19.122 1.00 19.58  ? 585  ARG A C   1 
ATOM   3955 O O   . ARG A 1  507 ? -13.328 -40.433 -19.331 1.00 16.36  ? 585  ARG A O   1 
ATOM   3956 C CB  . ARG A 1  507 ? -12.498 -38.354 -16.841 1.00 27.35  ? 585  ARG A CB  1 
ATOM   3957 C CG  . ARG A 1  507 ? -12.775 -39.543 -15.928 1.00 52.05  ? 585  ARG A CG  1 
ATOM   3958 C CD  . ARG A 1  507 ? -11.657 -39.745 -14.907 1.00 77.05  ? 585  ARG A CD  1 
ATOM   3959 N NE  . ARG A 1  507 ? -11.605 -38.656 -13.909 1.00 88.26  ? 585  ARG A NE  1 
ATOM   3960 C CZ  . ARG A 1  507 ? -10.510 -37.997 -13.493 1.00 73.01  ? 585  ARG A CZ  1 
ATOM   3961 N NH1 . ARG A 1  507 ? -9.284  -38.281 -13.947 1.00 77.82  ? 585  ARG A NH1 1 
ATOM   3962 N NH2 . ARG A 1  507 ? -10.642 -37.041 -12.575 1.00 57.61  ? 585  ARG A NH2 1 
ATOM   3963 N N   . ALA A 1  508 ? -13.981 -38.309 -19.614 1.00 16.29  ? 586  ALA A N   1 
ATOM   3964 C CA  . ALA A 1  508 ? -15.092 -38.641 -20.508 1.00 20.04  ? 586  ALA A CA  1 
ATOM   3965 C C   . ALA A 1  508 ? -14.628 -39.383 -21.770 1.00 17.73  ? 586  ALA A C   1 
ATOM   3966 O O   . ALA A 1  508 ? -15.268 -40.336 -22.208 1.00 18.76  ? 586  ALA A O   1 
ATOM   3967 C CB  . ALA A 1  508 ? -15.862 -37.380 -20.866 1.00 18.57  ? 586  ALA A CB  1 
ATOM   3968 N N   . LEU A 1  509 ? -13.522 -38.930 -22.347 1.00 17.76  ? 587  LEU A N   1 
ATOM   3969 C CA  . LEU A 1  509 ? -12.996 -39.529 -23.586 1.00 18.39  ? 587  LEU A CA  1 
ATOM   3970 C C   . LEU A 1  509 ? -12.372 -40.883 -23.339 1.00 18.23  ? 587  LEU A C   1 
ATOM   3971 O O   . LEU A 1  509 ? -12.487 -41.780 -24.169 1.00 19.01  ? 587  LEU A O   1 
ATOM   3972 C CB  . LEU A 1  509 ? -12.003 -38.577 -24.289 1.00 17.32  ? 587  LEU A CB  1 
ATOM   3973 C CG  . LEU A 1  509 ? -12.701 -37.408 -24.985 1.00 17.45  ? 587  LEU A CG  1 
ATOM   3974 C CD1 . LEU A 1  509 ? -11.698 -36.304 -25.304 1.00 19.32  ? 587  LEU A CD1 1 
ATOM   3975 C CD2 . LEU A 1  509 ? -13.417 -37.832 -26.263 1.00 19.31  ? 587  LEU A CD2 1 
ATOM   3976 N N   . VAL A 1  510 ? -11.707 -41.032 -22.198 1.00 17.82  ? 588  VAL A N   1 
ATOM   3977 C CA  . VAL A 1  510 ? -11.173 -42.320 -21.789 1.00 19.08  ? 588  VAL A CA  1 
ATOM   3978 C C   . VAL A 1  510 ? -12.305 -43.341 -21.670 1.00 19.72  ? 588  VAL A C   1 
ATOM   3979 O O   . VAL A 1  510 ? -12.194 -44.461 -22.178 1.00 19.63  ? 588  VAL A O   1 
ATOM   3980 C CB  . VAL A 1  510 ? -10.385 -42.212 -20.457 1.00 20.06  ? 588  VAL A CB  1 
ATOM   3981 C CG1 . VAL A 1  510 ? -10.142 -43.607 -19.847 1.00 25.81  ? 588  VAL A CG1 1 
ATOM   3982 C CG2 . VAL A 1  510 ? -9.071  -41.479 -20.669 1.00 19.70  ? 588  VAL A CG2 1 
ATOM   3983 N N   . LYS A 1  511 ? -13.376 -42.966 -20.972 1.00 20.16  ? 589  LYS A N   1 
ATOM   3984 C CA  . LYS A 1  511 ? -14.514 -43.874 -20.777 1.00 21.63  ? 589  LYS A CA  1 
ATOM   3985 C C   . LYS A 1  511 ? -15.267 -44.146 -22.076 1.00 22.35  ? 589  LYS A C   1 
ATOM   3986 O O   . LYS A 1  511 ? -15.696 -45.266 -22.306 1.00 18.44  ? 589  LYS A O   1 
ATOM   3987 C CB  . LYS A 1  511 ? -15.478 -43.345 -19.728 1.00 21.50  ? 589  LYS A CB  1 
ATOM   3988 C CG  . LYS A 1  511 ? -14.906 -43.377 -18.320 1.00 29.17  ? 589  LYS A CG  1 
ATOM   3989 C CD  . LYS A 1  511 ? -15.850 -42.778 -17.290 1.00 33.93  ? 589  LYS A CD  1 
ATOM   3990 C CE  . LYS A 1  511 ? -15.248 -42.916 -15.888 1.00 40.18  ? 589  LYS A CE  1 
ATOM   3991 N NZ  . LYS A 1  511 ? -16.063 -42.288 -14.815 1.00 47.55  ? 589  LYS A NZ  1 
ATOM   3992 N N   . ALA A 1  512 ? -15.447 -43.133 -22.912 1.00 18.43  ? 590  ALA A N   1 
ATOM   3993 C CA  . ALA A 1  512 ? -16.195 -43.327 -24.163 1.00 18.79  ? 590  ALA A CA  1 
ATOM   3994 C C   . ALA A 1  512 ? -15.442 -44.164 -25.190 1.00 19.97  ? 590  ALA A C   1 
ATOM   3995 O O   . ALA A 1  512 ? -16.054 -44.948 -25.866 1.00 20.64  ? 590  ALA A O   1 
ATOM   3996 C CB  . ALA A 1  512 ? -16.549 -41.993 -24.777 1.00 21.63  ? 590  ALA A CB  1 
ATOM   3997 N N   . ARG A 1  513 ? -14.124 -43.993 -25.305 1.00 18.53  ? 591  ARG A N   1 
ATOM   3998 C CA  . ARG A 1  513 ? -13.352 -44.585 -26.398 1.00 19.09  ? 591  ARG A CA  1 
ATOM   3999 C C   . ARG A 1  513 ? -12.367 -45.676 -26.001 1.00 21.61  ? 591  ARG A C   1 
ATOM   4000 O O   . ARG A 1  513 ? -12.003 -46.475 -26.841 1.00 23.31  ? 591  ARG A O   1 
ATOM   4001 C CB  . ARG A 1  513 ? -12.600 -43.491 -27.145 1.00 19.99  ? 591  ARG A CB  1 
ATOM   4002 C CG  . ARG A 1  513 ? -13.523 -42.455 -27.755 1.00 18.36  ? 591  ARG A CG  1 
ATOM   4003 C CD  . ARG A 1  513 ? -12.733 -41.289 -28.336 1.00 20.38  ? 591  ARG A CD  1 
ATOM   4004 N NE  . ARG A 1  513 ? -12.011 -41.636 -29.567 1.00 17.55  ? 591  ARG A NE  1 
ATOM   4005 C CZ  . ARG A 1  513 ? -10.690 -41.797 -29.701 1.00 18.27  ? 591  ARG A CZ  1 
ATOM   4006 N NH1 . ARG A 1  513 ? -9.855  -41.677 -28.689 1.00 21.20  ? 591  ARG A NH1 1 
ATOM   4007 N NH2 . ARG A 1  513 ? -10.191 -42.073 -30.904 1.00 20.20  ? 591  ARG A NH2 1 
ATOM   4008 N N   . GLY A 1  514 ? -11.920 -45.703 -24.746 1.00 22.44  ? 592  GLY A N   1 
ATOM   4009 C CA  . GLY A 1  514 ? -11.012 -46.745 -24.278 1.00 20.57  ? 592  GLY A CA  1 
ATOM   4010 C C   . GLY A 1  514 ? -9.563  -46.607 -24.724 1.00 24.45  ? 592  GLY A C   1 
ATOM   4011 O O   . GLY A 1  514 ? -8.759  -47.510 -24.483 1.00 27.18  ? 592  GLY A O   1 
ATOM   4012 N N   . THR A 1  515 ? -9.218  -45.485 -25.353 1.00 21.78  ? 593  THR A N   1 
ATOM   4013 C CA  . THR A 1  515 ? -7.858  -45.199 -25.753 1.00 20.61  ? 593  THR A CA  1 
ATOM   4014 C C   . THR A 1  515 ? -7.468  -43.796 -25.279 1.00 23.18  ? 593  THR A C   1 
ATOM   4015 O O   . THR A 1  515 ? -8.285  -43.064 -24.746 1.00 21.66  ? 593  THR A O   1 
ATOM   4016 C CB  . THR A 1  515 ? -7.735  -45.300 -27.280 1.00 23.68  ? 593  THR A CB  1 
ATOM   4017 O OG1 . THR A 1  515 ? -8.700  -44.434 -27.893 1.00 23.41  ? 593  THR A OG1 1 
ATOM   4018 C CG2 . THR A 1  515 ? -7.977  -46.740 -27.737 1.00 24.58  ? 593  THR A CG2 1 
ATOM   4019 N N   . ARG A 1  516 ? -6.205  -43.436 -25.457 1.00 23.33  ? 594  ARG A N   1 
ATOM   4020 C CA  . ARG A 1  516 ? -5.695  -42.110 -25.079 1.00 29.71  ? 594  ARG A CA  1 
ATOM   4021 C C   . ARG A 1  516 ? -6.566  -40.926 -25.490 1.00 25.21  ? 594  ARG A C   1 
ATOM   4022 O O   . ARG A 1  516 ? -6.905  -40.830 -26.665 1.00 19.81  ? 594  ARG A O   1 
ATOM   4023 C CB  . ARG A 1  516 ? -4.379  -41.862 -25.788 1.00 29.56  ? 594  ARG A CB  1 
ATOM   4024 C CG  . ARG A 1  516 ? -3.232  -42.344 -24.991 1.00 33.34  ? 594  ARG A CG  1 
ATOM   4025 C CD  . ARG A 1  516 ? -1.972  -42.178 -25.806 1.00 27.93  ? 594  ARG A CD  1 
ATOM   4026 N NE  . ARG A 1  516 ? -1.266  -43.426 -25.766 1.00 27.60  ? 594  ARG A NE  1 
ATOM   4027 C CZ  . ARG A 1  516 ? -0.142  -43.667 -26.394 1.00 24.56  ? 594  ARG A CZ  1 
ATOM   4028 N NH1 . ARG A 1  516 ? 0.453   -42.724 -27.139 1.00 18.82  ? 594  ARG A NH1 1 
ATOM   4029 N NH2 . ARG A 1  516 ? 0.362   -44.879 -26.262 1.00 23.79  ? 594  ARG A NH2 1 
ATOM   4030 N N   . PRO A 1  517 ? -6.839  -39.991 -24.559 1.00 21.23  ? 595  PRO A N   1 
ATOM   4031 C CA  . PRO A 1  517 ? -7.650  -38.829 -24.937 1.00 19.61  ? 595  PRO A CA  1 
ATOM   4032 C C   . PRO A 1  517 ? -6.871  -37.756 -25.669 1.00 17.22  ? 595  PRO A C   1 
ATOM   4033 O O   . PRO A 1  517 ? -5.667  -37.614 -25.489 1.00 19.06  ? 595  PRO A O   1 
ATOM   4034 C CB  . PRO A 1  517 ? -8.150  -38.304 -23.600 1.00 21.75  ? 595  PRO A CB  1 
ATOM   4035 C CG  . PRO A 1  517 ? -7.163  -38.777 -22.610 1.00 23.64  ? 595  PRO A CG  1 
ATOM   4036 C CD  . PRO A 1  517 ? -6.622  -40.065 -23.103 1.00 18.88  ? 595  PRO A CD  1 
ATOM   4037 N N   . PHE A 1  518 ? -7.572  -36.970 -26.469 1.00 17.88  ? 596  PHE A N   1 
ATOM   4038 C CA  . PHE A 1  518 ? -6.976  -35.844 -27.172 1.00 17.95  ? 596  PHE A CA  1 
ATOM   4039 C C   . PHE A 1  518 ? -7.864  -34.611 -26.962 1.00 18.30  ? 596  PHE A C   1 
ATOM   4040 O O   . PHE A 1  518 ? -8.889  -34.454 -27.623 1.00 15.49  ? 596  PHE A O   1 
ATOM   4041 C CB  . PHE A 1  518 ? -6.778  -36.181 -28.646 1.00 16.58  ? 596  PHE A CB  1 
ATOM   4042 C CG  . PHE A 1  518 ? -5.931  -35.185 -29.380 1.00 16.64  ? 596  PHE A CG  1 
ATOM   4043 C CD1 . PHE A 1  518 ? -4.562  -35.181 -29.220 1.00 18.22  ? 596  PHE A CD1 1 
ATOM   4044 C CD2 . PHE A 1  518 ? -6.506  -34.239 -30.208 1.00 16.29  ? 596  PHE A CD2 1 
ATOM   4045 C CE1 . PHE A 1  518 ? -3.768  -34.252 -29.880 1.00 17.04  ? 596  PHE A CE1 1 
ATOM   4046 C CE2 . PHE A 1  518 ? -5.721  -33.309 -30.874 1.00 18.43  ? 596  PHE A CE2 1 
ATOM   4047 C CZ  . PHE A 1  518 ? -4.344  -33.316 -30.702 1.00 17.04  ? 596  PHE A CZ  1 
ATOM   4048 N N   . VAL A 1  519 ? -7.454  -33.754 -26.023 1.00 15.74  ? 597  VAL A N   1 
ATOM   4049 C CA  . VAL A 1  519 ? -8.214  -32.583 -25.643 1.00 15.12  ? 597  VAL A CA  1 
ATOM   4050 C C   . VAL A 1  519 ? -7.349  -31.365 -25.884 1.00 15.62  ? 597  VAL A C   1 
ATOM   4051 O O   . VAL A 1  519 ? -6.213  -31.328 -25.434 1.00 15.62  ? 597  VAL A O   1 
ATOM   4052 C CB  . VAL A 1  519 ? -8.654  -32.620 -24.158 1.00 16.88  ? 597  VAL A CB  1 
ATOM   4053 C CG1 . VAL A 1  519 ? -9.416  -31.348 -23.800 1.00 19.77  ? 597  VAL A CG1 1 
ATOM   4054 C CG2 . VAL A 1  519 ? -9.499  -33.860 -23.866 1.00 19.12  ? 597  VAL A CG2 1 
ATOM   4055 N N   . ILE A 1  520 ? -7.901  -30.381 -26.597 1.00 15.87  ? 598  ILE A N   1 
ATOM   4056 C CA  . ILE A 1  520 ? -7.228  -29.111 -26.881 1.00 15.33  ? 598  ILE A CA  1 
ATOM   4057 C C   . ILE A 1  520 ? -8.121  -28.005 -26.314 1.00 15.34  ? 598  ILE A C   1 
ATOM   4058 O O   . ILE A 1  520 ? -9.282  -27.864 -26.710 1.00 12.98  ? 598  ILE A O   1 
ATOM   4059 C CB  . ILE A 1  520 ? -7.040  -28.890 -28.406 1.00 15.70  ? 598  ILE A CB  1 
ATOM   4060 C CG1 . ILE A 1  520 ? -6.195  -30.002 -29.060 1.00 17.67  ? 598  ILE A CG1 1 
ATOM   4061 C CG2 . ILE A 1  520 ? -6.403  -27.543 -28.686 1.00 19.13  ? 598  ILE A CG2 1 
ATOM   4062 C CD1 . ILE A 1  520 ? -4.738  -30.052 -28.592 1.00 17.19  ? 598  ILE A CD1 1 
ATOM   4063 N N   . SER A 1  521 ? -7.572  -27.213 -25.396 1.00 13.47  ? 599  SER A N   1 
ATOM   4064 C CA  . SER A 1  521 ? -8.361  -26.302 -24.569 1.00 13.30  ? 599  SER A CA  1 
ATOM   4065 C C   . SER A 1  521 ? -7.891  -24.898 -24.765 1.00 14.76  ? 599  SER A C   1 
ATOM   4066 O O   . SER A 1  521 ? -6.688  -24.664 -24.896 1.00 16.01  ? 599  SER A O   1 
ATOM   4067 C CB  . SER A 1  521 ? -8.183  -26.661 -23.108 1.00 13.14  ? 599  SER A CB  1 
ATOM   4068 O OG  . SER A 1  521 ? -8.980  -25.846 -22.252 1.00 14.19  ? 599  SER A OG  1 
ATOM   4069 N N   . ARG A 1  522 ? -8.812  -23.946 -24.769 1.00 13.86  ? 600  ARG A N   1 
ATOM   4070 C CA  . ARG A 1  522 ? -8.395  -22.541 -24.787 1.00 15.40  ? 600  ARG A CA  1 
ATOM   4071 C C   . ARG A 1  522 ? -7.880  -22.087 -23.428 1.00 14.84  ? 600  ARG A C   1 
ATOM   4072 O O   . ARG A 1  522 ? -6.731  -21.691 -23.292 1.00 17.55  ? 600  ARG A O   1 
ATOM   4073 C CB  . ARG A 1  522 ? -9.521  -21.609 -25.248 1.00 17.02  ? 600  ARG A CB  1 
ATOM   4074 C CG  . ARG A 1  522 ? -8.949  -20.299 -25.768 1.00 22.25  ? 600  ARG A CG  1 
ATOM   4075 C CD  . ARG A 1  522 ? -9.944  -19.513 -26.575 1.00 23.16  ? 600  ARG A CD  1 
ATOM   4076 N NE  . ARG A 1  522 ? -11.012 -19.011 -25.728 1.00 20.07  ? 600  ARG A NE  1 
ATOM   4077 C CZ  . ARG A 1  522 ? -12.037 -18.293 -26.164 1.00 19.85  ? 600  ARG A CZ  1 
ATOM   4078 N NH1 . ARG A 1  522 ? -12.129 -17.956 -27.450 1.00 17.52  ? 600  ARG A NH1 1 
ATOM   4079 N NH2 . ARG A 1  522 ? -12.956 -17.879 -25.306 1.00 19.18  ? 600  ARG A NH2 1 
ATOM   4080 N N   . SER A 1  523 ? -8.741  -22.129 -22.415 1.00 14.88  ? 601  SER A N   1 
ATOM   4081 C CA  . SER A 1  523 ? -8.351  -21.738 -21.074 1.00 13.25  ? 601  SER A CA  1 
ATOM   4082 C C   . SER A 1  523 ? -7.549  -22.836 -20.365 1.00 14.32  ? 601  SER A C   1 
ATOM   4083 O O   . SER A 1  523 ? -7.808  -24.042 -20.554 1.00 14.86  ? 601  SER A O   1 
ATOM   4084 C CB  . SER A 1  523 ? -9.583  -21.325 -20.260 1.00 13.60  ? 601  SER A CB  1 
ATOM   4085 O OG  . SER A 1  523 ? -9.178  -20.834 -19.000 1.00 13.83  ? 601  SER A OG  1 
ATOM   4086 N N   . THR A 1  524 ? -6.545  -22.411 -19.596 1.00 13.50  ? 602  THR A N   1 
ATOM   4087 C CA  . THR A 1  524 ? -5.659  -23.305 -18.855 1.00 15.21  ? 602  THR A CA  1 
ATOM   4088 C C   . THR A 1  524 ? -5.274  -22.723 -17.498 1.00 11.90  ? 602  THR A C   1 
ATOM   4089 O O   . THR A 1  524 ? -5.377  -21.506 -17.261 1.00 15.20  ? 602  THR A O   1 
ATOM   4090 C CB  . THR A 1  524 ? -4.340  -23.610 -19.640 1.00 15.94  ? 602  THR A CB  1 
ATOM   4091 O OG1 . THR A 1  524 ? -3.575  -22.404 -19.817 1.00 15.50  ? 602  THR A OG1 1 
ATOM   4092 C CG2 . THR A 1  524 ? -4.630  -24.220 -21.010 1.00 16.83  ? 602  THR A CG2 1 
ATOM   4093 N N   . PHE A 1  525 ? -4.786  -23.602 -16.644 1.00 11.68  ? 603  PHE A N   1 
ATOM   4094 C CA  . PHE A 1  525 ? -4.115  -23.245 -15.383 1.00 12.35  ? 603  PHE A CA  1 
ATOM   4095 C C   . PHE A 1  525 ? -2.921  -24.166 -15.211 1.00 14.59  ? 603  PHE A C   1 
ATOM   4096 O O   . PHE A 1  525 ? -2.829  -25.209 -15.870 1.00 14.37  ? 603  PHE A O   1 
ATOM   4097 C CB  . PHE A 1  525 ? -5.070  -23.409 -14.205 1.00 12.52  ? 603  PHE A CB  1 
ATOM   4098 C CG  . PHE A 1  525 ? -4.554  -22.848 -12.881 1.00 12.71  ? 603  PHE A CG  1 
ATOM   4099 C CD1 . PHE A 1  525 ? -4.590  -21.493 -12.620 1.00 14.48  ? 603  PHE A CD1 1 
ATOM   4100 C CD2 . PHE A 1  525 ? -4.077  -23.689 -11.892 1.00 14.09  ? 603  PHE A CD2 1 
ATOM   4101 C CE1 . PHE A 1  525 ? -4.165  -20.978 -11.390 1.00 15.32  ? 603  PHE A CE1 1 
ATOM   4102 C CE2 . PHE A 1  525 ? -3.644  -23.199 -10.668 1.00 18.53  ? 603  PHE A CE2 1 
ATOM   4103 C CZ  . PHE A 1  525 ? -3.671  -21.826 -10.420 1.00 14.54  ? 603  PHE A CZ  1 
ATOM   4104 N N   . ALA A 1  526 ? -2.015  -23.801 -14.305 1.00 16.60  ? 604  ALA A N   1 
ATOM   4105 C CA  . ALA A 1  526 ? -0.911  -24.682 -13.912 1.00 19.20  ? 604  ALA A CA  1 
ATOM   4106 C C   . ALA A 1  526 ? -1.370  -26.122 -13.697 1.00 19.75  ? 604  ALA A C   1 
ATOM   4107 O O   . ALA A 1  526 ? -2.345  -26.381 -12.965 1.00 13.01  ? 604  ALA A O   1 
ATOM   4108 C CB  . ALA A 1  526 ? -0.227  -24.160 -12.656 1.00 21.40  ? 604  ALA A CB  1 
ATOM   4109 N N   . GLY A 1  527 ? -0.674  -27.043 -14.357 1.00 15.74  ? 605  GLY A N   1 
ATOM   4110 C CA  . GLY A 1  527 ? -1.003  -28.469 -14.287 1.00 16.69  ? 605  GLY A CA  1 
ATOM   4111 C C   . GLY A 1  527 ? -1.840  -28.967 -15.442 1.00 12.70  ? 605  GLY A C   1 
ATOM   4112 O O   . GLY A 1  527 ? -2.073  -30.158 -15.547 1.00 14.07  ? 605  GLY A O   1 
ATOM   4113 N N   . HIS A 1  528 ? -2.260  -28.062 -16.317 1.00 13.73  ? 606  HIS A N   1 
ATOM   4114 C CA  . HIS A 1  528 ? -3.114  -28.382 -17.472 1.00 14.03  ? 606  HIS A CA  1 
ATOM   4115 C C   . HIS A 1  528 ? -2.563  -29.473 -18.347 1.00 16.49  ? 606  HIS A C   1 
ATOM   4116 O O   . HIS A 1  528 ? -3.317  -30.338 -18.823 1.00 17.16  ? 606  HIS A O   1 
ATOM   4117 C CB  . HIS A 1  528 ? -3.321  -27.133 -18.326 1.00 14.93  ? 606  HIS A CB  1 
ATOM   4118 C CG  . HIS A 1  528 ? -4.251  -27.331 -19.468 1.00 14.52  ? 606  HIS A CG  1 
ATOM   4119 N ND1 . HIS A 1  528 ? -5.609  -27.136 -19.352 1.00 17.61  ? 606  HIS A ND1 1 
ATOM   4120 C CD2 . HIS A 1  528 ? -4.022  -27.662 -20.761 1.00 14.80  ? 606  HIS A CD2 1 
ATOM   4121 C CE1 . HIS A 1  528 ? -6.182  -27.364 -20.523 1.00 17.07  ? 606  HIS A CE1 1 
ATOM   4122 N NE2 . HIS A 1  528 ? -5.240  -27.700 -21.392 1.00 17.36  ? 606  HIS A NE2 1 
ATOM   4123 N N   . GLY A 1  529 ? -1.246  -29.444 -18.547 1.00 18.10  ? 607  GLY A N   1 
ATOM   4124 C CA  . GLY A 1  529 ? -0.582  -30.355 -19.449 1.00 17.39  ? 607  GLY A CA  1 
ATOM   4125 C C   . GLY A 1  529 ? -0.678  -31.822 -19.100 1.00 15.97  ? 607  GLY A C   1 
ATOM   4126 O O   . GLY A 1  529 ? -0.502  -32.662 -19.968 1.00 14.65  ? 607  GLY A O   1 
ATOM   4127 N N   . ARG A 1  530 ? -0.957  -32.125 -17.832 1.00 16.71  ? 608  ARG A N   1 
ATOM   4128 C CA  . ARG A 1  530 ? -1.261  -33.481 -17.387 1.00 16.77  ? 608  ARG A CA  1 
ATOM   4129 C C   . ARG A 1  530 ? -2.487  -34.093 -18.061 1.00 17.07  ? 608  ARG A C   1 
ATOM   4130 O O   . ARG A 1  530 ? -2.607  -35.330 -18.132 1.00 16.02  ? 608  ARG A O   1 
ATOM   4131 C CB  . ARG A 1  530 ? -1.434  -33.506 -15.852 1.00 22.11  ? 608  ARG A CB  1 
ATOM   4132 C CG  . ARG A 1  530 ? -1.524  -34.894 -15.220 1.00 24.08  ? 608  ARG A CG  1 
ATOM   4133 C CD  . ARG A 1  530 ? -1.757  -34.807 -13.715 1.00 31.21  ? 608  ARG A CD  1 
ATOM   4134 N NE  . ARG A 1  530 ? -1.984  -36.124 -13.114 1.00 42.79  ? 608  ARG A NE  1 
ATOM   4135 C CZ  . ARG A 1  530 ? -2.282  -36.350 -11.828 1.00 43.93  ? 608  ARG A CZ  1 
ATOM   4136 N NH1 . ARG A 1  530 ? -2.380  -35.355 -10.946 1.00 40.20  ? 608  ARG A NH1 1 
ATOM   4137 N NH2 . ARG A 1  530 ? -2.466  -37.596 -11.413 1.00 56.10  ? 608  ARG A NH2 1 
ATOM   4138 N N   . TYR A 1  531 ? -3.392  -33.247 -18.552 1.00 14.23  ? 609  TYR A N   1 
ATOM   4139 C CA  . TYR A 1  531 ? -4.652  -33.694 -19.149 1.00 15.21  ? 609  TYR A CA  1 
ATOM   4140 C C   . TYR A 1  531 ? -4.846  -33.324 -20.600 1.00 15.62  ? 609  TYR A C   1 
ATOM   4141 O O   . TYR A 1  531 ? -5.592  -33.989 -21.310 1.00 17.44  ? 609  TYR A O   1 
ATOM   4142 C CB  . TYR A 1  531 ? -5.814  -33.129 -18.332 1.00 16.08  ? 609  TYR A CB  1 
ATOM   4143 C CG  . TYR A 1  531 ? -5.697  -33.466 -16.877 1.00 21.04  ? 609  TYR A CG  1 
ATOM   4144 C CD1 . TYR A 1  531 ? -6.159  -34.677 -16.376 1.00 19.46  ? 609  TYR A CD1 1 
ATOM   4145 C CD2 . TYR A 1  531 ? -5.092  -32.577 -16.000 1.00 24.00  ? 609  TYR A CD2 1 
ATOM   4146 C CE1 . TYR A 1  531 ? -6.035  -34.989 -15.021 1.00 23.34  ? 609  TYR A CE1 1 
ATOM   4147 C CE2 . TYR A 1  531 ? -4.975  -32.860 -14.653 1.00 23.87  ? 609  TYR A CE2 1 
ATOM   4148 C CZ  . TYR A 1  531 ? -5.436  -34.062 -14.170 1.00 25.38  ? 609  TYR A CZ  1 
ATOM   4149 O OH  . TYR A 1  531 ? -5.284  -34.293 -12.843 1.00 31.01  ? 609  TYR A OH  1 
ATOM   4150 N N   . ALA A 1  532 ? -4.204  -32.259 -21.072 1.00 17.15  ? 610  ALA A N   1 
ATOM   4151 C CA  . ALA A 1  532 ? -4.631  -31.682 -22.338 1.00 17.21  ? 610  ALA A CA  1 
ATOM   4152 C C   . ALA A 1  532 ? -3.594  -30.766 -22.936 1.00 15.74  ? 610  ALA A C   1 
ATOM   4153 O O   . ALA A 1  532 ? -2.607  -30.410 -22.300 1.00 15.62  ? 610  ALA A O   1 
ATOM   4154 C CB  . ALA A 1  532 ? -5.946  -30.917 -22.112 1.00 15.92  ? 610  ALA A CB  1 
ATOM   4155 N N   . GLY A 1  533 ? -3.858  -30.367 -24.168 1.00 16.28  ? 611  GLY A N   1 
ATOM   4156 C CA  . GLY A 1  533 ? -3.032  -29.407 -24.869 1.00 14.79  ? 611  GLY A CA  1 
ATOM   4157 C C   . GLY A 1  533 ? -3.727  -28.070 -24.922 1.00 12.94  ? 611  GLY A C   1 
ATOM   4158 O O   . GLY A 1  533 ? -4.775  -27.867 -24.294 1.00 15.11  ? 611  GLY A O   1 
ATOM   4159 N N   . HIS A 1  534 ? -3.140  -27.159 -25.688 1.00 14.21  ? 612  HIS A N   1 
ATOM   4160 C CA  . HIS A 1  534 ? -3.608  -25.768 -25.781 1.00 15.21  ? 612  HIS A CA  1 
ATOM   4161 C C   . HIS A 1  534 ? -3.320  -25.202 -27.165 1.00 17.34  ? 612  HIS A C   1 
ATOM   4162 O O   . HIS A 1  534 ? -2.335  -25.567 -27.780 1.00 16.15  ? 612  HIS A O   1 
ATOM   4163 C CB  . HIS A 1  534 ? -2.888  -24.983 -24.692 1.00 15.89  ? 612  HIS A CB  1 
ATOM   4164 C CG  . HIS A 1  534 ? -3.073  -23.503 -24.734 1.00 15.54  ? 612  HIS A CG  1 
ATOM   4165 N ND1 . HIS A 1  534 ? -4.303  -22.885 -24.626 1.00 15.93  ? 612  HIS A ND1 1 
ATOM   4166 C CD2 . HIS A 1  534 ? -2.155  -22.509 -24.791 1.00 18.70  ? 612  HIS A CD2 1 
ATOM   4167 C CE1 . HIS A 1  534 ? -4.137  -21.572 -24.647 1.00 15.93  ? 612  HIS A CE1 1 
ATOM   4168 N NE2 . HIS A 1  534 ? -2.843  -21.316 -24.759 1.00 19.63  ? 612  HIS A NE2 1 
ATOM   4169 N N   . TRP A 1  535 ? -4.199  -24.318 -27.652 1.00 15.93  ? 613  TRP A N   1 
ATOM   4170 C CA  . TRP A 1  535 ? -3.863  -23.457 -28.771 1.00 15.37  ? 613  TRP A CA  1 
ATOM   4171 C C   . TRP A 1  535 ? -3.986  -22.018 -28.261 1.00 16.56  ? 613  TRP A C   1 
ATOM   4172 O O   . TRP A 1  535 ? -4.735  -21.754 -27.341 1.00 16.78  ? 613  TRP A O   1 
ATOM   4173 C CB  . TRP A 1  535 ? -4.699  -23.757 -30.033 1.00 16.05  ? 613  TRP A CB  1 
ATOM   4174 C CG  . TRP A 1  535 ? -5.905  -22.886 -30.253 1.00 17.64  ? 613  TRP A CG  1 
ATOM   4175 C CD1 . TRP A 1  535 ? -6.039  -21.892 -31.196 1.00 16.07  ? 613  TRP A CD1 1 
ATOM   4176 C CD2 . TRP A 1  535 ? -7.142  -22.931 -29.542 1.00 13.36  ? 613  TRP A CD2 1 
ATOM   4177 N NE1 . TRP A 1  535 ? -7.276  -21.308 -31.090 1.00 13.49  ? 613  TRP A NE1 1 
ATOM   4178 C CE2 . TRP A 1  535 ? -7.975  -21.923 -30.093 1.00 12.95  ? 613  TRP A CE2 1 
ATOM   4179 C CE3 . TRP A 1  535 ? -7.630  -23.709 -28.484 1.00 14.58  ? 613  TRP A CE3 1 
ATOM   4180 C CZ2 . TRP A 1  535 ? -9.261  -21.688 -29.630 1.00 14.92  ? 613  TRP A CZ2 1 
ATOM   4181 C CZ3 . TRP A 1  535 ? -8.921  -23.486 -28.037 1.00 15.31  ? 613  TRP A CZ3 1 
ATOM   4182 C CH2 . TRP A 1  535 ? -9.715  -22.475 -28.601 1.00 14.43  ? 613  TRP A CH2 1 
ATOM   4183 N N   . THR A 1  536 ? -3.252  -21.108 -28.873 1.00 13.13  ? 614  THR A N   1 
ATOM   4184 C CA  . THR A 1  536 ? -3.079  -19.749 -28.354 1.00 15.41  ? 614  THR A CA  1 
ATOM   4185 C C   . THR A 1  536 ? -4.218  -18.765 -28.685 1.00 15.87  ? 614  THR A C   1 
ATOM   4186 O O   . THR A 1  536 ? -4.116  -17.584 -28.394 1.00 17.56  ? 614  THR A O   1 
ATOM   4187 C CB  . THR A 1  536 ? -1.739  -19.165 -28.841 1.00 16.06  ? 614  THR A CB  1 
ATOM   4188 O OG1 . THR A 1  536 ? -1.693  -19.196 -30.274 1.00 14.38  ? 614  THR A OG1 1 
ATOM   4189 C CG2 . THR A 1  536 ? -0.564  -19.974 -28.257 1.00 16.21  ? 614  THR A CG2 1 
ATOM   4190 N N   . GLY A 1  537 ? -5.281  -19.253 -29.306 1.00 15.44  ? 615  GLY A N   1 
ATOM   4191 C CA  . GLY A 1  537 ? -6.518  -18.517 -29.445 1.00 15.90  ? 615  GLY A CA  1 
ATOM   4192 C C   . GLY A 1  537 ? -6.566  -17.637 -30.666 1.00 15.75  ? 615  GLY A C   1 
ATOM   4193 O O   . GLY A 1  537 ? -6.008  -17.956 -31.724 1.00 17.56  ? 615  GLY A O   1 
ATOM   4194 N N   . ASP A 1  538 ? -7.269  -16.528 -30.539 1.00 16.71  ? 616  ASP A N   1 
ATOM   4195 C CA  . ASP A 1  538 ? -7.650  -15.743 -31.712 1.00 15.60  ? 616  ASP A CA  1 
ATOM   4196 C C   . ASP A 1  538 ? -6.570  -14.784 -32.158 1.00 18.38  ? 616  ASP A C   1 
ATOM   4197 O O   . ASP A 1  538 ? -6.727  -13.561 -32.060 1.00 19.41  ? 616  ASP A O   1 
ATOM   4198 C CB  . ASP A 1  538 ? -8.958  -15.003 -31.440 1.00 17.75  ? 616  ASP A CB  1 
ATOM   4199 C CG  . ASP A 1  538 ? -10.146 -15.940 -31.276 1.00 17.02  ? 616  ASP A CG  1 
ATOM   4200 O OD1 . ASP A 1  538 ? -10.012 -17.154 -31.519 1.00 21.67  ? 616  ASP A OD1 1 
ATOM   4201 O OD2 . ASP A 1  538 ? -11.221 -15.454 -30.893 1.00 21.62  ? 616  ASP A OD2 1 
ATOM   4202 N N   . VAL A 1  539 ? -5.490  -15.344 -32.700 1.00 17.33  ? 617  VAL A N   1 
ATOM   4203 C CA  . VAL A 1  539 ? -4.377  -14.559 -33.213 1.00 16.92  ? 617  VAL A CA  1 
ATOM   4204 C C   . VAL A 1  539 ? -4.694  -14.027 -34.596 1.00 18.45  ? 617  VAL A C   1 
ATOM   4205 O O   . VAL A 1  539 ? -5.344  -14.708 -35.402 1.00 19.86  ? 617  VAL A O   1 
ATOM   4206 C CB  . VAL A 1  539 ? -3.039  -15.357 -33.177 1.00 18.35  ? 617  VAL A CB  1 
ATOM   4207 C CG1 . VAL A 1  539 ? -2.793  -15.858 -31.767 1.00 16.74  ? 617  VAL A CG1 1 
ATOM   4208 C CG2 . VAL A 1  539 ? -2.985  -16.494 -34.205 1.00 18.86  ? 617  VAL A CG2 1 
ATOM   4209 N N   . TRP A 1  540 ? -4.251  -12.799 -34.869 1.00 17.49  ? 618  TRP A N   1 
ATOM   4210 C CA  . TRP A 1  540 ? -4.373  -12.197 -36.195 1.00 17.91  ? 618  TRP A CA  1 
ATOM   4211 C C   . TRP A 1  540 ? -3.446  -12.828 -37.206 1.00 18.65  ? 618  TRP A C   1 
ATOM   4212 O O   . TRP A 1  540 ? -2.315  -13.206 -36.874 1.00 18.42  ? 618  TRP A O   1 
ATOM   4213 C CB  . TRP A 1  540 ? -4.050  -10.673 -36.152 1.00 20.15  ? 618  TRP A CB  1 
ATOM   4214 C CG  . TRP A 1  540 ? -5.146  -9.934  -35.535 1.00 26.34  ? 618  TRP A CG  1 
ATOM   4215 C CD1 . TRP A 1  540 ? -5.338  -9.686  -34.195 1.00 28.32  ? 618  TRP A CD1 1 
ATOM   4216 C CD2 . TRP A 1  540 ? -6.276  -9.403  -36.210 1.00 26.03  ? 618  TRP A CD2 1 
ATOM   4217 N NE1 . TRP A 1  540 ? -6.511  -9.017  -34.013 1.00 27.54  ? 618  TRP A NE1 1 
ATOM   4218 C CE2 . TRP A 1  540 ? -7.115  -8.837  -35.229 1.00 25.71  ? 618  TRP A CE2 1 
ATOM   4219 C CE3 . TRP A 1  540 ? -6.660  -9.344  -37.559 1.00 27.89  ? 618  TRP A CE3 1 
ATOM   4220 C CZ2 . TRP A 1  540 ? -8.319  -8.206  -35.553 1.00 28.59  ? 618  TRP A CZ2 1 
ATOM   4221 C CZ3 . TRP A 1  540 ? -7.859  -8.720  -37.885 1.00 32.21  ? 618  TRP A CZ3 1 
ATOM   4222 C CH2 . TRP A 1  540 ? -8.671  -8.157  -36.886 1.00 27.68  ? 618  TRP A CH2 1 
ATOM   4223 N N   . SER A 1  541 ? -3.893  -12.844 -38.464 1.00 17.04  ? 619  SER A N   1 
ATOM   4224 C CA  . SER A 1  541 ? -3.047  -13.215 -39.576 1.00 18.76  ? 619  SER A CA  1 
ATOM   4225 C C   . SER A 1  541 ? -2.118  -12.043 -39.870 1.00 20.96  ? 619  SER A C   1 
ATOM   4226 O O   . SER A 1  541 ? -2.325  -11.327 -40.840 1.00 18.25  ? 619  SER A O   1 
ATOM   4227 C CB  . SER A 1  541 ? -3.872  -13.616 -40.817 1.00 17.69  ? 619  SER A CB  1 
ATOM   4228 O OG  . SER A 1  541 ? -4.597  -14.815 -40.575 1.00 20.98  ? 619  SER A OG  1 
ATOM   4229 N N   . SER A 1  542 ? -1.076  -11.893 -39.041 1.00 17.71  ? 620  SER A N   1 
ATOM   4230 C CA  . SER A 1  542 ? -0.101  -10.793 -39.151 1.00 20.20  ? 620  SER A CA  1 
ATOM   4231 C C   . SER A 1  542 ? 1.300   -11.331 -38.933 1.00 19.28  ? 620  SER A C   1 
ATOM   4232 O O   . SER A 1  542 ? 1.478   -12.364 -38.296 1.00 16.72  ? 620  SER A O   1 
ATOM   4233 C CB  . SER A 1  542 ? -0.387  -9.701  -38.111 1.00 20.39  ? 620  SER A CB  1 
ATOM   4234 O OG  . SER A 1  542 ? -0.161  -10.178 -36.775 1.00 20.15  ? 620  SER A OG  1 
ATOM   4235 N N   . TRP A 1  543 ? 2.295   -10.627 -39.469 1.00 19.43  ? 621  TRP A N   1 
ATOM   4236 C CA  . TRP A 1  543 ? 3.703   -10.987 -39.239 1.00 21.24  ? 621  TRP A CA  1 
ATOM   4237 C C   . TRP A 1  543 ? 4.084   -10.861 -37.771 1.00 19.41  ? 621  TRP A C   1 
ATOM   4238 O O   . TRP A 1  543 ? 4.800   -11.710 -37.244 1.00 22.01  ? 621  TRP A O   1 
ATOM   4239 C CB  . TRP A 1  543 ? 4.653   -10.171 -40.133 1.00 21.70  ? 621  TRP A CB  1 
ATOM   4240 C CG  . TRP A 1  543 ? 4.466   -10.508 -41.577 1.00 18.79  ? 621  TRP A CG  1 
ATOM   4241 C CD1 . TRP A 1  543 ? 3.666   -9.860  -42.467 1.00 19.85  ? 621  TRP A CD1 1 
ATOM   4242 C CD2 . TRP A 1  543 ? 5.071   -11.586 -42.286 1.00 19.74  ? 621  TRP A CD2 1 
ATOM   4243 N NE1 . TRP A 1  543 ? 3.723   -10.481 -43.693 1.00 20.46  ? 621  TRP A NE1 1 
ATOM   4244 C CE2 . TRP A 1  543 ? 4.584   -11.541 -43.613 1.00 19.49  ? 621  TRP A CE2 1 
ATOM   4245 C CE3 . TRP A 1  543 ? 5.971   -12.599 -41.929 1.00 20.73  ? 621  TRP A CE3 1 
ATOM   4246 C CZ2 . TRP A 1  543 ? 4.994   -12.446 -44.594 1.00 20.00  ? 621  TRP A CZ2 1 
ATOM   4247 C CZ3 . TRP A 1  543 ? 6.381   -13.502 -42.905 1.00 22.74  ? 621  TRP A CZ3 1 
ATOM   4248 C CH2 . TRP A 1  543 ? 5.892   -13.422 -44.221 1.00 21.83  ? 621  TRP A CH2 1 
ATOM   4249 N N   . GLU A 1  544 ? 3.541   -9.855  -37.096 1.00 20.19  ? 622  GLU A N   1 
ATOM   4250 C CA  . GLU A 1  544 ? 3.691   -9.721  -35.645 1.00 23.98  ? 622  GLU A CA  1 
ATOM   4251 C C   . GLU A 1  544 ? 3.306   -10.970 -34.866 1.00 19.63  ? 622  GLU A C   1 
ATOM   4252 O O   . GLU A 1  544 ? 4.039   -11.431 -33.985 1.00 21.61  ? 622  GLU A O   1 
ATOM   4253 C CB  . GLU A 1  544 ? 2.848   -8.549  -35.109 1.00 27.40  ? 622  GLU A CB  1 
ATOM   4254 C CG  . GLU A 1  544 ? 3.473   -7.187  -35.297 1.00 46.90  ? 622  GLU A CG  1 
ATOM   4255 C CD  . GLU A 1  544 ? 2.548   -6.055  -34.862 1.00 61.36  ? 622  GLU A CD  1 
ATOM   4256 O OE1 . GLU A 1  544 ? 1.775   -6.241  -33.891 1.00 49.56  ? 622  GLU A OE1 1 
ATOM   4257 O OE2 . GLU A 1  544 ? 2.589   -4.976  -35.501 1.00 74.69  ? 622  GLU A OE2 1 
ATOM   4258 N N   . GLN A 1  545 ? 2.125   -11.490 -35.157 1.00 21.19  ? 623  GLN A N   1 
ATOM   4259 C CA  . GLN A 1  545 ? 1.612   -12.633 -34.413 1.00 21.37  ? 623  GLN A CA  1 
ATOM   4260 C C   . GLN A 1  545 ? 2.322   -13.933 -34.827 1.00 18.26  ? 623  GLN A C   1 
ATOM   4261 O O   . GLN A 1  545 ? 2.524   -14.815 -34.002 1.00 17.64  ? 623  GLN A O   1 
ATOM   4262 C CB  . GLN A 1  545 ? 0.093   -12.714 -34.539 1.00 22.86  ? 623  GLN A CB  1 
ATOM   4263 C CG  . GLN A 1  545 ? -0.627  -11.527 -33.885 1.00 30.06  ? 623  GLN A CG  1 
ATOM   4264 C CD  . GLN A 1  545 ? -1.280  -11.824 -32.536 1.00 27.81  ? 623  GLN A CD  1 
ATOM   4265 O OE1 . GLN A 1  545 ? -0.827  -12.664 -31.757 1.00 46.56  ? 623  GLN A OE1 1 
ATOM   4266 N NE2 . GLN A 1  545 ? -2.368  -11.148 -32.281 1.00 49.62  ? 623  GLN A NE2 1 
ATOM   4267 N N   . LEU A 1  546 ? 2.750   -14.043 -36.085 1.00 17.55  ? 624  LEU A N   1 
ATOM   4268 C CA  . LEU A 1  546 ? 3.631   -15.160 -36.451 1.00 17.17  ? 624  LEU A CA  1 
ATOM   4269 C C   . LEU A 1  546 ? 4.873   -15.167 -35.539 1.00 15.05  ? 624  LEU A C   1 
ATOM   4270 O O   . LEU A 1  546 ? 5.207   -16.194 -34.916 1.00 13.70  ? 624  LEU A O   1 
ATOM   4271 C CB  . LEU A 1  546 ? 4.024   -15.101 -37.919 1.00 15.51  ? 624  LEU A CB  1 
ATOM   4272 C CG  . LEU A 1  546 ? 5.169   -15.985 -38.413 1.00 18.49  ? 624  LEU A CG  1 
ATOM   4273 C CD1 . LEU A 1  546 ? 4.949   -17.478 -38.121 1.00 18.53  ? 624  LEU A CD1 1 
ATOM   4274 C CD2 . LEU A 1  546 ? 5.308   -15.780 -39.905 1.00 20.14  ? 624  LEU A CD2 1 
ATOM   4275 N N   . ALA A 1  547 ? 5.560   -14.031 -35.471 1.00 15.44  ? 625  ALA A N   1 
ATOM   4276 C CA  . ALA A 1  547 ? 6.759   -13.925 -34.634 1.00 19.34  ? 625  ALA A CA  1 
ATOM   4277 C C   . ALA A 1  547 ? 6.452   -14.183 -33.154 1.00 17.42  ? 625  ALA A C   1 
ATOM   4278 O O   . ALA A 1  547 ? 7.187   -14.904 -32.491 1.00 17.94  ? 625  ALA A O   1 
ATOM   4279 C CB  . ALA A 1  547 ? 7.424   -12.562 -34.798 1.00 22.02  ? 625  ALA A CB  1 
ATOM   4280 N N   . SER A 1  548 ? 5.369   -13.599 -32.653 1.00 17.67  ? 626  SER A N   1 
ATOM   4281 C CA  . SER A 1  548 ? 4.963   -13.782 -31.251 1.00 16.39  ? 626  SER A CA  1 
ATOM   4282 C C   . SER A 1  548 ? 4.580   -15.204 -30.902 1.00 16.52  ? 626  SER A C   1 
ATOM   4283 O O   . SER A 1  548 ? 4.630   -15.569 -29.747 1.00 16.82  ? 626  SER A O   1 
ATOM   4284 C CB  . SER A 1  548 ? 3.765   -12.909 -30.882 1.00 18.35  ? 626  SER A CB  1 
ATOM   4285 O OG  . SER A 1  548 ? 4.151   -11.581 -30.792 1.00 26.82  ? 626  SER A OG  1 
ATOM   4286 N N   . SER A 1  549 ? 4.185   -16.002 -31.882 1.00 16.29  ? 627  SER A N   1 
ATOM   4287 C CA  . SER A 1  549 ? 3.884   -17.410 -31.596 1.00 14.80  ? 627  SER A CA  1 
ATOM   4288 C C   . SER A 1  549 ? 5.101   -18.186 -31.119 1.00 15.66  ? 627  SER A C   1 
ATOM   4289 O O   . SER A 1  549 ? 4.935   -19.190 -30.436 1.00 16.97  ? 627  SER A O   1 
ATOM   4290 C CB  . SER A 1  549 ? 3.278   -18.104 -32.801 1.00 16.25  ? 627  SER A CB  1 
ATOM   4291 O OG  . SER A 1  549 ? 4.251   -18.324 -33.816 1.00 15.52  ? 627  SER A OG  1 
ATOM   4292 N N   . VAL A 1  550 ? 6.320   -17.767 -31.474 1.00 15.37  ? 628  VAL A N   1 
ATOM   4293 C CA  . VAL A 1  550 ? 7.500   -18.567 -31.076 1.00 15.86  ? 628  VAL A CA  1 
ATOM   4294 C C   . VAL A 1  550 ? 7.686   -18.507 -29.549 1.00 16.18  ? 628  VAL A C   1 
ATOM   4295 O O   . VAL A 1  550 ? 7.624   -19.557 -28.894 1.00 17.80  ? 628  VAL A O   1 
ATOM   4296 C CB  . VAL A 1  550 ? 8.781   -18.242 -31.880 1.00 16.80  ? 628  VAL A CB  1 
ATOM   4297 C CG1 . VAL A 1  550 ? 9.937   -19.156 -31.448 1.00 19.71  ? 628  VAL A CG1 1 
ATOM   4298 C CG2 . VAL A 1  550 ? 8.510   -18.411 -33.366 1.00 18.34  ? 628  VAL A CG2 1 
ATOM   4299 N N   . PRO A 1  551 ? 7.865   -17.305 -28.967 1.00 17.46  ? 629  PRO A N   1 
ATOM   4300 C CA  . PRO A 1  551 ? 7.964   -17.270 -27.493 1.00 17.43  ? 629  PRO A CA  1 
ATOM   4301 C C   . PRO A 1  551 ? 6.762   -17.892 -26.763 1.00 17.76  ? 629  PRO A C   1 
ATOM   4302 O O   . PRO A 1  551 ? 6.931   -18.514 -25.718 1.00 16.43  ? 629  PRO A O   1 
ATOM   4303 C CB  . PRO A 1  551 ? 8.068   -15.772 -27.161 1.00 15.26  ? 629  PRO A CB  1 
ATOM   4304 C CG  . PRO A 1  551 ? 7.870   -15.039 -28.435 1.00 16.67  ? 629  PRO A CG  1 
ATOM   4305 C CD  . PRO A 1  551 ? 8.093   -15.975 -29.562 1.00 16.89  ? 629  PRO A CD  1 
ATOM   4306 N N   . GLU A 1  552 ? 5.564   -17.739 -27.307 1.00 16.55  ? 630  GLU A N   1 
ATOM   4307 C CA  . GLU A 1  552 ? 4.398   -18.281 -26.643 1.00 16.44  ? 630  GLU A CA  1 
ATOM   4308 C C   . GLU A 1  552 ? 4.400   -19.831 -26.607 1.00 17.86  ? 630  GLU A C   1 
ATOM   4309 O O   . GLU A 1  552 ? 4.140   -20.447 -25.564 1.00 14.13  ? 630  GLU A O   1 
ATOM   4310 C CB  . GLU A 1  552 ? 3.126   -17.732 -27.274 1.00 22.97  ? 630  GLU A CB  1 
ATOM   4311 C CG  . GLU A 1  552 ? 1.907   -18.167 -26.486 1.00 32.43  ? 630  GLU A CG  1 
ATOM   4312 C CD  . GLU A 1  552 ? 0.700   -17.292 -26.664 1.00 47.04  ? 630  GLU A CD  1 
ATOM   4313 O OE1 . GLU A 1  552 ? 0.447   -16.793 -27.822 1.00 30.52  ? 630  GLU A OE1 1 
ATOM   4314 O OE2 . GLU A 1  552 ? 0.019   -17.163 -25.610 1.00 31.81  ? 630  GLU A OE2 1 
ATOM   4315 N N   . ILE A 1  553 ? 4.746   -20.458 -27.721 1.00 14.09  ? 631  ILE A N   1 
ATOM   4316 C CA  . ILE A 1  553 ? 4.865   -21.932 -27.755 1.00 15.70  ? 631  ILE A CA  1 
ATOM   4317 C C   . ILE A 1  553 ? 5.972   -22.423 -26.819 1.00 16.65  ? 631  ILE A C   1 
ATOM   4318 O O   . ILE A 1  553 ? 5.800   -23.412 -26.082 1.00 17.42  ? 631  ILE A O   1 
ATOM   4319 C CB  . ILE A 1  553 ? 5.016   -22.407 -29.203 1.00 15.94  ? 631  ILE A CB  1 
ATOM   4320 C CG1 . ILE A 1  553 ? 3.636   -22.670 -29.799 1.00 16.24  ? 631  ILE A CG1 1 
ATOM   4321 C CG2 . ILE A 1  553 ? 5.823   -23.691 -29.326 1.00 19.75  ? 631  ILE A CG2 1 
ATOM   4322 C CD1 . ILE A 1  553 ? 2.624   -21.569 -29.689 1.00 19.16  ? 631  ILE A CD1 1 
ATOM   4323 N N   . LEU A 1  554 ? 7.080   -21.703 -26.799 1.00 16.68  ? 632  LEU A N   1 
ATOM   4324 C CA  . LEU A 1  554 ? 8.179   -22.027 -25.870 1.00 13.30  ? 632  LEU A CA  1 
ATOM   4325 C C   . LEU A 1  554 ? 7.743   -21.872 -24.394 1.00 15.67  ? 632  LEU A C   1 
ATOM   4326 O O   . LEU A 1  554 ? 8.032   -22.714 -23.545 1.00 15.56  ? 632  LEU A O   1 
ATOM   4327 C CB  . LEU A 1  554 ? 9.377   -21.148 -26.198 1.00 14.65  ? 632  LEU A CB  1 
ATOM   4328 C CG  . LEU A 1  554 ? 9.955   -21.404 -27.594 1.00 15.38  ? 632  LEU A CG  1 
ATOM   4329 C CD1 . LEU A 1  554 ? 11.062  -20.420 -27.923 1.00 19.55  ? 632  LEU A CD1 1 
ATOM   4330 C CD2 . LEU A 1  554 ? 10.404  -22.847 -27.741 1.00 19.35  ? 632  LEU A CD2 1 
ATOM   4331 N N   . GLN A 1  555 ? 7.015   -20.810 -24.107 1.00 15.24  ? 633  GLN A N   1 
ATOM   4332 C CA  . GLN A 1  555 ? 6.522   -20.555 -22.754 1.00 19.78  ? 633  GLN A CA  1 
ATOM   4333 C C   . GLN A 1  555 ? 5.688   -21.711 -22.207 1.00 18.90  ? 633  GLN A C   1 
ATOM   4334 O O   . GLN A 1  555 ? 5.891   -22.132 -21.068 1.00 16.43  ? 633  GLN A O   1 
ATOM   4335 C CB  . GLN A 1  555 ? 5.715   -19.245 -22.725 1.00 19.76  ? 633  GLN A CB  1 
ATOM   4336 C CG  . GLN A 1  555 ? 5.288   -18.730 -21.356 1.00 22.76  ? 633  GLN A CG  1 
ATOM   4337 C CD  . GLN A 1  555 ? 6.453   -18.505 -20.413 1.00 26.39  ? 633  GLN A CD  1 
ATOM   4338 O OE1 . GLN A 1  555 ? 6.961   -17.396 -20.298 1.00 30.30  ? 633  GLN A OE1 1 
ATOM   4339 N NE2 . GLN A 1  555 ? 6.879   -19.570 -19.724 1.00 27.31  ? 633  GLN A NE2 1 
ATOM   4340 N N   . PHE A 1  556 ? 4.772   -22.216 -23.029 1.00 14.85  ? 634  PHE A N   1 
ATOM   4341 C CA  . PHE A 1  556 ? 3.870   -23.280 -22.633 1.00 14.80  ? 634  PHE A CA  1 
ATOM   4342 C C   . PHE A 1  556 ? 4.587   -24.604 -22.464 1.00 16.08  ? 634  PHE A C   1 
ATOM   4343 O O   . PHE A 1  556 ? 4.233   -25.375 -21.578 1.00 15.15  ? 634  PHE A O   1 
ATOM   4344 C CB  . PHE A 1  556 ? 2.652   -23.383 -23.575 1.00 16.49  ? 634  PHE A CB  1 
ATOM   4345 C CG  . PHE A 1  556 ? 1.527   -22.485 -23.169 1.00 15.37  ? 634  PHE A CG  1 
ATOM   4346 C CD1 . PHE A 1  556 ? 0.582   -22.928 -22.251 1.00 17.11  ? 634  PHE A CD1 1 
ATOM   4347 C CD2 . PHE A 1  556 ? 1.425   -21.180 -23.656 1.00 18.28  ? 634  PHE A CD2 1 
ATOM   4348 C CE1 . PHE A 1  556 ? -0.454  -22.112 -21.847 1.00 19.62  ? 634  PHE A CE1 1 
ATOM   4349 C CE2 . PHE A 1  556 ? 0.388   -20.350 -23.242 1.00 20.13  ? 634  PHE A CE2 1 
ATOM   4350 C CZ  . PHE A 1  556 ? -0.545  -20.814 -22.326 1.00 19.21  ? 634  PHE A CZ  1 
ATOM   4351 N N   . ASN A 1  557 ? 5.625   -24.841 -23.258 1.00 12.69  ? 635  ASN A N   1 
ATOM   4352 C CA  . ASN A 1  557 ? 6.521   -25.969 -22.998 1.00 13.39  ? 635  ASN A CA  1 
ATOM   4353 C C   . ASN A 1  557 ? 7.210   -25.918 -21.638 1.00 13.50  ? 635  ASN A C   1 
ATOM   4354 O O   . ASN A 1  557 ? 7.274   -26.949 -20.948 1.00 15.44  ? 635  ASN A O   1 
ATOM   4355 C CB  . ASN A 1  557 ? 7.558   -26.136 -24.111 1.00 13.04  ? 635  ASN A CB  1 
ATOM   4356 C CG  . ASN A 1  557 ? 7.019   -26.961 -25.262 1.00 13.47  ? 635  ASN A CG  1 
ATOM   4357 O OD1 . ASN A 1  557 ? 7.309   -28.160 -25.385 1.00 12.62  ? 635  ASN A OD1 1 
ATOM   4358 N ND2 . ASN A 1  557 ? 6.203   -26.346 -26.073 1.00 14.91  ? 635  ASN A ND2 1 
ATOM   4359 N N   . LEU A 1  558 ? 7.685   -24.740 -21.228 1.00 14.06  ? 636  LEU A N   1 
ATOM   4360 C CA  . LEU A 1  558 ? 8.318   -24.595 -19.910 1.00 15.45  ? 636  LEU A CA  1 
ATOM   4361 C C   . LEU A 1  558 ? 7.283   -24.782 -18.793 1.00 16.31  ? 636  LEU A C   1 
ATOM   4362 O O   . LEU A 1  558 ? 7.641   -25.111 -17.651 1.00 17.50  ? 636  LEU A O   1 
ATOM   4363 C CB  . LEU A 1  558 ? 8.969   -23.206 -19.739 1.00 18.37  ? 636  LEU A CB  1 
ATOM   4364 C CG  . LEU A 1  558 ? 10.004  -22.676 -20.721 1.00 23.91  ? 636  LEU A CG  1 
ATOM   4365 C CD1 . LEU A 1  558 ? 10.453  -21.280 -20.323 1.00 26.28  ? 636  LEU A CD1 1 
ATOM   4366 C CD2 . LEU A 1  558 ? 11.183  -23.610 -20.829 1.00 26.83  ? 636  LEU A CD2 1 
ATOM   4367 N N   . LEU A 1  559 ? 6.010   -24.541 -19.120 1.00 14.22  ? 637  LEU A N   1 
ATOM   4368 C CA  . LEU A 1  559 ? 4.900   -24.718 -18.176 1.00 16.52  ? 637  LEU A CA  1 
ATOM   4369 C C   . LEU A 1  559 ? 4.257   -26.088 -18.190 1.00 15.32  ? 637  LEU A C   1 
ATOM   4370 O O   . LEU A 1  559 ? 3.229   -26.297 -17.522 1.00 15.65  ? 637  LEU A O   1 
ATOM   4371 C CB  . LEU A 1  559 ? 3.844   -23.639 -18.437 1.00 15.46  ? 637  LEU A CB  1 
ATOM   4372 C CG  . LEU A 1  559 ? 4.357   -22.230 -18.117 1.00 17.02  ? 637  LEU A CG  1 
ATOM   4373 C CD1 . LEU A 1  559 ? 3.318   -21.223 -18.578 1.00 20.46  ? 637  LEU A CD1 1 
ATOM   4374 C CD2 . LEU A 1  559 ? 4.674   -22.053 -16.638 1.00 21.05  ? 637  LEU A CD2 1 
ATOM   4375 N N   . GLY A 1  560 ? 4.867   -27.010 -18.928 1.00 13.23  ? 638  GLY A N   1 
ATOM   4376 C CA  . GLY A 1  560 ? 4.458   -28.385 -18.947 1.00 15.33  ? 638  GLY A CA  1 
ATOM   4377 C C   . GLY A 1  560 ? 3.251   -28.646 -19.807 1.00 16.06  ? 638  GLY A C   1 
ATOM   4378 O O   . GLY A 1  560 ? 2.567   -29.636 -19.573 1.00 14.52  ? 638  GLY A O   1 
ATOM   4379 N N   . VAL A 1  561 ? 3.010   -27.782 -20.801 1.00 13.02  ? 639  VAL A N   1 
ATOM   4380 C CA  . VAL A 1  561 ? 1.924   -27.956 -21.775 1.00 13.95  ? 639  VAL A CA  1 
ATOM   4381 C C   . VAL A 1  561 ? 2.592   -28.009 -23.154 1.00 13.36  ? 639  VAL A C   1 
ATOM   4382 O O   . VAL A 1  561 ? 2.458   -27.085 -23.954 1.00 12.51  ? 639  VAL A O   1 
ATOM   4383 C CB  . VAL A 1  561 ? 0.850   -26.829 -21.722 1.00 13.67  ? 639  VAL A CB  1 
ATOM   4384 C CG1 . VAL A 1  561 ? -0.343  -27.168 -22.632 1.00 15.50  ? 639  VAL A CG1 1 
ATOM   4385 C CG2 . VAL A 1  561 ? 0.348   -26.616 -20.294 1.00 12.49  ? 639  VAL A CG2 1 
ATOM   4386 N N   . PRO A 1  562 ? 3.334   -29.100 -23.421 1.00 14.03  ? 640  PRO A N   1 
ATOM   4387 C CA  . PRO A 1  562 ? 4.099   -29.147 -24.648 1.00 15.48  ? 640  PRO A CA  1 
ATOM   4388 C C   . PRO A 1  562 ? 3.253   -29.324 -25.897 1.00 17.59  ? 640  PRO A C   1 
ATOM   4389 O O   . PRO A 1  562 ? 3.719   -28.954 -26.989 1.00 15.02  ? 640  PRO A O   1 
ATOM   4390 C CB  . PRO A 1  562 ? 5.012   -30.356 -24.432 1.00 15.69  ? 640  PRO A CB  1 
ATOM   4391 C CG  . PRO A 1  562 ? 4.198   -31.253 -23.559 1.00 17.23  ? 640  PRO A CG  1 
ATOM   4392 C CD  . PRO A 1  562 ? 3.612   -30.282 -22.584 1.00 15.51  ? 640  PRO A CD  1 
ATOM   4393 N N   . LEU A 1  563 ? 2.039   -29.881 -25.750 1.00 15.84  ? 641  LEU A N   1 
ATOM   4394 C CA  . LEU A 1  563 ? 1.121   -29.981 -26.881 1.00 14.37  ? 641  LEU A CA  1 
ATOM   4395 C C   . LEU A 1  563 ? 0.450   -28.621 -27.071 1.00 14.35  ? 641  LEU A C   1 
ATOM   4396 O O   . LEU A 1  563 ? -0.675  -28.383 -26.594 1.00 14.37  ? 641  LEU A O   1 
ATOM   4397 C CB  . LEU A 1  563 ? 0.086   -31.085 -26.658 1.00 14.73  ? 641  LEU A CB  1 
ATOM   4398 C CG  . LEU A 1  563 ? -0.877  -31.363 -27.822 1.00 16.04  ? 641  LEU A CG  1 
ATOM   4399 C CD1 . LEU A 1  563 ? -0.169  -31.989 -29.011 1.00 15.57  ? 641  LEU A CD1 1 
ATOM   4400 C CD2 . LEU A 1  563 ? -1.985  -32.303 -27.349 1.00 18.72  ? 641  LEU A CD2 1 
ATOM   4401 N N   . VAL A 1  564 ? 1.145   -27.746 -27.787 1.00 12.90  ? 642  VAL A N   1 
ATOM   4402 C CA  . VAL A 1  564 ? 0.730   -26.344 -27.943 1.00 13.52  ? 642  VAL A CA  1 
ATOM   4403 C C   . VAL A 1  564 ? 1.104   -25.866 -29.326 1.00 15.57  ? 642  VAL A C   1 
ATOM   4404 O O   . VAL A 1  564 ? 2.066   -26.349 -29.914 1.00 14.37  ? 642  VAL A O   1 
ATOM   4405 C CB  . VAL A 1  564 ? 1.352   -25.436 -26.844 1.00 15.31  ? 642  VAL A CB  1 
ATOM   4406 C CG1 . VAL A 1  564 ? 2.879   -25.404 -26.957 1.00 14.07  ? 642  VAL A CG1 1 
ATOM   4407 C CG2 . VAL A 1  564 ? 0.760   -24.017 -26.845 1.00 14.42  ? 642  VAL A CG2 1 
ATOM   4408 N N   . GLY A 1  565 ? 0.282   -24.972 -29.859 1.00 15.66  ? 643  GLY A N   1 
ATOM   4409 C CA  . GLY A 1  565 ? 0.555   -24.261 -31.096 1.00 15.41  ? 643  GLY A CA  1 
ATOM   4410 C C   . GLY A 1  565 ? -0.404  -23.099 -31.311 1.00 16.63  ? 643  GLY A C   1 
ATOM   4411 O O   . GLY A 1  565 ? -1.339  -22.882 -30.518 1.00 15.80  ? 643  GLY A O   1 
ATOM   4412 N N   . ALA A 1  566 ? -0.159  -22.342 -32.379 1.00 15.20  ? 644  ALA A N   1 
ATOM   4413 C CA  . ALA A 1  566 ? -1.055  -21.304 -32.815 1.00 14.98  ? 644  ALA A CA  1 
ATOM   4414 C C   . ALA A 1  566 ? -1.751  -21.755 -34.090 1.00 15.96  ? 644  ALA A C   1 
ATOM   4415 O O   . ALA A 1  566 ? -1.271  -22.653 -34.779 1.00 13.92  ? 644  ALA A O   1 
ATOM   4416 C CB  . ALA A 1  566 ? -0.291  -20.013 -33.063 1.00 16.92  ? 644  ALA A CB  1 
ATOM   4417 N N   . ASP A 1  567 ? -2.878  -21.108 -34.394 1.00 15.12  ? 645  ASP A N   1 
ATOM   4418 C CA  . ASP A 1  567 ? -3.592  -21.337 -35.659 1.00 14.25  ? 645  ASP A CA  1 
ATOM   4419 C C   . ASP A 1  567 ? -2.678  -20.971 -36.819 1.00 16.44  ? 645  ASP A C   1 
ATOM   4420 O O   . ASP A 1  567 ? -2.300  -19.786 -36.994 1.00 15.46  ? 645  ASP A O   1 
ATOM   4421 C CB  . ASP A 1  567 ? -4.872  -20.520 -35.731 1.00 14.03  ? 645  ASP A CB  1 
ATOM   4422 C CG  . ASP A 1  567 ? -5.919  -20.980 -34.720 1.00 14.96  ? 645  ASP A CG  1 
ATOM   4423 O OD1 . ASP A 1  567 ? -5.841  -22.135 -34.250 1.00 15.29  ? 645  ASP A OD1 1 
ATOM   4424 O OD2 . ASP A 1  567 ? -6.827  -20.189 -34.420 1.00 17.52  ? 645  ASP A OD2 1 
ATOM   4425 N N   . VAL A 1  568 ? -2.288  -21.991 -37.578 1.00 16.01  ? 646  VAL A N   1 
ATOM   4426 C CA  . VAL A 1  568 ? -1.329  -21.805 -38.672 1.00 16.12  ? 646  VAL A CA  1 
ATOM   4427 C C   . VAL A 1  568 ? -1.972  -20.927 -39.771 1.00 18.39  ? 646  VAL A C   1 
ATOM   4428 O O   . VAL A 1  568 ? -3.106  -21.161 -40.198 1.00 17.86  ? 646  VAL A O   1 
ATOM   4429 C CB  . VAL A 1  568 ? -0.781  -23.165 -39.187 1.00 15.91  ? 646  VAL A CB  1 
ATOM   4430 C CG1 . VAL A 1  568 ? 0.083   -23.002 -40.445 1.00 16.13  ? 646  VAL A CG1 1 
ATOM   4431 C CG2 . VAL A 1  568 ? 0.003   -23.858 -38.084 1.00 14.60  ? 646  VAL A CG2 1 
ATOM   4432 N N   . CYS A 1  569 ? -1.206  -19.910 -40.174 1.00 18.10  ? 647  CYS A N   1 
ATOM   4433 C CA  . CYS A 1  569 ? -1.580  -18.785 -41.028 1.00 15.27  ? 647  CYS A CA  1 
ATOM   4434 C C   . CYS A 1  569 ? -2.416  -17.713 -40.360 1.00 18.14  ? 647  CYS A C   1 
ATOM   4435 O O   . CYS A 1  569 ? -2.743  -16.697 -41.000 1.00 18.09  ? 647  CYS A O   1 
ATOM   4436 C CB  . CYS A 1  569 ? -2.173  -19.253 -42.369 1.00 18.67  ? 647  CYS A CB  1 
ATOM   4437 S SG  . CYS A 1  569 ? -1.046  -20.431 -43.147 1.00 20.42  ? 647  CYS A SG  1 
ATOM   4438 N N   . GLY A 1  570 ? -2.729  -17.908 -39.072 1.00 16.78  ? 648  GLY A N   1 
ATOM   4439 C CA  . GLY A 1  570 ? -3.465  -16.952 -38.282 1.00 17.04  ? 648  GLY A CA  1 
ATOM   4440 C C   . GLY A 1  570 ? -4.955  -17.162 -38.408 1.00 17.19  ? 648  GLY A C   1 
ATOM   4441 O O   . GLY A 1  570 ? -5.438  -17.638 -39.447 1.00 16.63  ? 648  GLY A O   1 
ATOM   4442 N N   . PHE A 1  571 ? -5.665  -16.804 -37.337 1.00 15.91  ? 649  PHE A N   1 
ATOM   4443 C CA  . PHE A 1  571 ? -7.110  -16.959 -37.235 1.00 15.83  ? 649  PHE A CA  1 
ATOM   4444 C C   . PHE A 1  571 ? -7.866  -15.752 -37.782 1.00 16.55  ? 649  PHE A C   1 
ATOM   4445 O O   . PHE A 1  571 ? -8.607  -15.868 -38.743 1.00 15.75  ? 649  PHE A O   1 
ATOM   4446 C CB  . PHE A 1  571 ? -7.524  -17.234 -35.776 1.00 16.82  ? 649  PHE A CB  1 
ATOM   4447 C CG  . PHE A 1  571 ? -8.999  -17.385 -35.589 1.00 15.49  ? 649  PHE A CG  1 
ATOM   4448 C CD1 . PHE A 1  571 ? -9.681  -18.454 -36.180 1.00 16.67  ? 649  PHE A CD1 1 
ATOM   4449 C CD2 . PHE A 1  571 ? -9.723  -16.450 -34.863 1.00 14.50  ? 649  PHE A CD2 1 
ATOM   4450 C CE1 . PHE A 1  571 ? -11.052 -18.586 -36.021 1.00 16.93  ? 649  PHE A CE1 1 
ATOM   4451 C CE2 . PHE A 1  571 ? -11.096 -16.582 -34.691 1.00 16.75  ? 649  PHE A CE2 1 
ATOM   4452 C CZ  . PHE A 1  571 ? -11.768 -17.647 -35.284 1.00 17.00  ? 649  PHE A CZ  1 
ATOM   4453 N N   . LEU A 1  572 ? -7.659  -14.598 -37.175 1.00 17.81  ? 650  LEU A N   1 
ATOM   4454 C CA  . LEU A 1  572 ? -8.430  -13.394 -37.511 1.00 18.85  ? 650  LEU A CA  1 
ATOM   4455 C C   . LEU A 1  572 ? -7.906  -12.707 -38.761 1.00 19.58  ? 650  LEU A C   1 
ATOM   4456 O O   . LEU A 1  572 ? -6.691  -12.694 -39.039 1.00 19.05  ? 650  LEU A O   1 
ATOM   4457 C CB  . LEU A 1  572 ? -8.432  -12.403 -36.345 1.00 19.58  ? 650  LEU A CB  1 
ATOM   4458 C CG  . LEU A 1  572 ? -9.153  -12.772 -35.049 1.00 21.96  ? 650  LEU A CG  1 
ATOM   4459 C CD1 . LEU A 1  572 ? -8.942  -11.705 -33.979 1.00 25.35  ? 650  LEU A CD1 1 
ATOM   4460 C CD2 . LEU A 1  572 ? -10.643 -12.988 -35.290 1.00 23.29  ? 650  LEU A CD2 1 
ATOM   4461 N N   . GLY A 1  573 ? -8.826  -12.120 -39.519 1.00 19.47  ? 651  GLY A N   1 
ATOM   4462 C CA  . GLY A 1  573 ? -8.455  -11.340 -40.694 1.00 20.64  ? 651  GLY A CA  1 
ATOM   4463 C C   . GLY A 1  573 ? -8.111  -12.257 -41.844 1.00 24.74  ? 651  GLY A C   1 
ATOM   4464 O O   . GLY A 1  573 ? -8.452  -13.439 -41.821 1.00 19.60  ? 651  GLY A O   1 
ATOM   4465 N N   . ASN A 1  574 ? -7.406  -11.712 -42.829 1.00 24.03  ? 652  ASN A N   1 
ATOM   4466 C CA  . ASN A 1  574 ? -7.056  -12.433 -44.042 1.00 21.92  ? 652  ASN A CA  1 
ATOM   4467 C C   . ASN A 1  574 ? -5.565  -12.614 -44.108 1.00 23.31  ? 652  ASN A C   1 
ATOM   4468 O O   . ASN A 1  574 ? -4.824  -11.647 -44.036 1.00 24.76  ? 652  ASN A O   1 
ATOM   4469 C CB  . ASN A 1  574 ? -7.513  -11.649 -45.267 1.00 21.74  ? 652  ASN A CB  1 
ATOM   4470 C CG  . ASN A 1  574 ? -9.019  -11.621 -45.397 1.00 25.82  ? 652  ASN A CG  1 
ATOM   4471 O OD1 . ASN A 1  574 ? -9.677  -12.632 -45.143 1.00 19.88  ? 652  ASN A OD1 1 
ATOM   4472 N ND2 . ASN A 1  574 ? -9.575  -10.474 -45.778 1.00 26.96  ? 652  ASN A ND2 1 
ATOM   4473 N N   . THR A 1  575 ? -5.131  -13.856 -44.283 1.00 21.14  ? 653  THR A N   1 
ATOM   4474 C CA  . THR A 1  575 ? -3.726  -14.147 -44.475 1.00 20.36  ? 653  THR A CA  1 
ATOM   4475 C C   . THR A 1  575 ? -3.330  -13.702 -45.887 1.00 21.83  ? 653  THR A C   1 
ATOM   4476 O O   . THR A 1  575 ? -4.184  -13.505 -46.735 1.00 24.22  ? 653  THR A O   1 
ATOM   4477 C CB  . THR A 1  575 ? -3.436  -15.657 -44.249 1.00 21.30  ? 653  THR A CB  1 
ATOM   4478 O OG1 . THR A 1  575 ? -2.059  -15.845 -43.921 1.00 22.45  ? 653  THR A OG1 1 
ATOM   4479 C CG2 . THR A 1  575 ? -3.791  -16.493 -45.447 1.00 20.83  ? 653  THR A CG2 1 
ATOM   4480 N N   . SER A 1  576 ? -2.036  -13.541 -46.115 1.00 18.97  ? 654  SER A N   1 
ATOM   4481 C CA  . SER A 1  576 ? -1.485  -13.395 -47.455 1.00 20.20  ? 654  SER A CA  1 
ATOM   4482 C C   . SER A 1  576 ? -0.739  -14.677 -47.781 1.00 20.01  ? 654  SER A C   1 
ATOM   4483 O O   . SER A 1  576 ? -0.398  -15.450 -46.876 1.00 19.91  ? 654  SER A O   1 
ATOM   4484 C CB  . SER A 1  576 ? -0.529  -12.217 -47.486 1.00 21.21  ? 654  SER A CB  1 
ATOM   4485 O OG  . SER A 1  576 ? 0.612   -12.522 -46.716 1.00 22.17  ? 654  SER A OG  1 
ATOM   4486 N N   . GLU A 1  577 ? -0.465  -14.899 -49.062 1.00 19.93  ? 655  GLU A N   1 
ATOM   4487 C CA  . GLU A 1  577 ? 0.222   -16.109 -49.490 1.00 19.39  ? 655  GLU A CA  1 
ATOM   4488 C C   . GLU A 1  577 ? 1.589   -16.239 -48.826 1.00 21.42  ? 655  GLU A C   1 
ATOM   4489 O O   . GLU A 1  577 ? 1.945   -17.308 -48.339 1.00 19.52  ? 655  GLU A O   1 
ATOM   4490 C CB  . GLU A 1  577 ? 0.374   -16.160 -51.015 1.00 23.93  ? 655  GLU A CB  1 
ATOM   4491 C CG  . GLU A 1  577 ? 0.957   -17.486 -51.484 1.00 23.94  ? 655  GLU A CG  1 
ATOM   4492 C CD  . GLU A 1  577 ? 0.726   -17.782 -52.947 1.00 21.50  ? 655  GLU A CD  1 
ATOM   4493 O OE1 . GLU A 1  577 ? 1.687   -17.654 -53.704 1.00 26.44  ? 655  GLU A OE1 1 
ATOM   4494 O OE2 . GLU A 1  577 ? -0.383  -18.185 -53.339 1.00 21.15  ? 655  GLU A OE2 1 
ATOM   4495 N N   . GLU A 1  578 ? 2.352   -15.151 -48.849 1.00 22.17  ? 656  GLU A N   1 
ATOM   4496 C CA  . GLU A 1  578 ? 3.699   -15.133 -48.313 1.00 20.59  ? 656  GLU A CA  1 
ATOM   4497 C C   . GLU A 1  578 ? 3.677   -15.450 -46.823 1.00 19.64  ? 656  GLU A C   1 
ATOM   4498 O O   . GLU A 1  578 ? 4.494   -16.231 -46.353 1.00 19.81  ? 656  GLU A O   1 
ATOM   4499 C CB  . GLU A 1  578 ? 4.367   -13.754 -48.525 1.00 22.63  ? 656  GLU A CB  1 
ATOM   4500 C CG  . GLU A 1  578 ? 5.892   -13.794 -48.435 1.00 23.03  ? 656  GLU A CG  1 
ATOM   4501 C CD  . GLU A 1  578 ? 6.551   -12.450 -48.160 1.00 26.43  ? 656  GLU A CD  1 
ATOM   4502 O OE1 . GLU A 1  578 ? 5.863   -11.405 -48.166 1.00 26.92  ? 656  GLU A OE1 1 
ATOM   4503 O OE2 . GLU A 1  578 ? 7.779   -12.447 -47.901 1.00 23.50  ? 656  GLU A OE2 1 
ATOM   4504 N N   . LEU A 1  579 ? 2.761   -14.823 -46.082 1.00 17.90  ? 657  LEU A N   1 
ATOM   4505 C CA  . LEU A 1  579 ? 2.635   -15.080 -44.654 1.00 16.68  ? 657  LEU A CA  1 
ATOM   4506 C C   . LEU A 1  579 ? 2.289   -16.537 -44.401 1.00 16.53  ? 657  LEU A C   1 
ATOM   4507 O O   . LEU A 1  579 ? 2.832   -17.162 -43.485 1.00 16.14  ? 657  LEU A O   1 
ATOM   4508 C CB  . LEU A 1  579 ? 1.574   -14.183 -44.013 1.00 17.33  ? 657  LEU A CB  1 
ATOM   4509 C CG  . LEU A 1  579 ? 1.265   -14.445 -42.538 1.00 16.72  ? 657  LEU A CG  1 
ATOM   4510 C CD1 . LEU A 1  579 ? 2.505   -14.180 -41.703 1.00 19.40  ? 657  LEU A CD1 1 
ATOM   4511 C CD2 . LEU A 1  579 ? 0.132   -13.584 -42.046 1.00 17.79  ? 657  LEU A CD2 1 
ATOM   4512 N N   . CYS A 1  580 ? 1.384   -17.079 -45.197 1.00 16.96  ? 658  CYS A N   1 
ATOM   4513 C CA  . CYS A 1  580 ? 0.927   -18.435 -44.955 1.00 17.52  ? 658  CYS A CA  1 
ATOM   4514 C C   . CYS A 1  580 ? 2.009   -19.468 -45.302 1.00 18.75  ? 658  CYS A C   1 
ATOM   4515 O O   . CYS A 1  580 ? 2.076   -20.512 -44.654 1.00 16.26  ? 658  CYS A O   1 
ATOM   4516 C CB  . CYS A 1  580 ? -0.426  -18.694 -45.646 1.00 20.29  ? 658  CYS A CB  1 
ATOM   4517 S SG  . CYS A 1  580 ? -1.246  -20.230 -45.156 1.00 23.00  ? 658  CYS A SG  1 
ATOM   4518 N N   . VAL A 1  581 ? 2.862   -19.181 -46.301 1.00 17.63  ? 659  VAL A N   1 
ATOM   4519 C CA  . VAL A 1  581 ? 4.063   -19.991 -46.521 1.00 16.93  ? 659  VAL A CA  1 
ATOM   4520 C C   . VAL A 1  581 ? 4.981   -19.981 -45.279 1.00 16.76  ? 659  VAL A C   1 
ATOM   4521 O O   . VAL A 1  581 ? 5.313   -21.040 -44.780 1.00 15.98  ? 659  VAL A O   1 
ATOM   4522 C CB  . VAL A 1  581 ? 4.876   -19.542 -47.747 1.00 16.49  ? 659  VAL A CB  1 
ATOM   4523 C CG1 . VAL A 1  581 ? 6.230   -20.227 -47.790 1.00 17.90  ? 659  VAL A CG1 1 
ATOM   4524 C CG2 . VAL A 1  581 ? 4.094   -19.828 -49.030 1.00 16.48  ? 659  VAL A CG2 1 
ATOM   4525 N N   . ARG A 1  582 ? 5.391   -18.806 -44.822 1.00 15.30  ? 660  ARG A N   1 
ATOM   4526 C CA  . ARG A 1  582 ? 6.279   -18.708 -43.649 1.00 17.14  ? 660  ARG A CA  1 
ATOM   4527 C C   . ARG A 1  582 ? 5.668   -19.246 -42.357 1.00 17.81  ? 660  ARG A C   1 
ATOM   4528 O O   . ARG A 1  582 ? 6.398   -19.792 -41.525 1.00 16.31  ? 660  ARG A O   1 
ATOM   4529 C CB  . ARG A 1  582 ? 6.706   -17.267 -43.394 1.00 17.32  ? 660  ARG A CB  1 
ATOM   4530 C CG  . ARG A 1  582 ? 7.530   -16.616 -44.509 1.00 19.40  ? 660  ARG A CG  1 
ATOM   4531 C CD  . ARG A 1  582 ? 8.761   -17.425 -44.867 1.00 19.20  ? 660  ARG A CD  1 
ATOM   4532 N NE  . ARG A 1  582 ? 9.766   -16.656 -45.600 1.00 20.86  ? 660  ARG A NE  1 
ATOM   4533 C CZ  . ARG A 1  582 ? 10.834  -17.187 -46.199 1.00 20.67  ? 660  ARG A CZ  1 
ATOM   4534 N NH1 . ARG A 1  582 ? 11.041  -18.487 -46.195 1.00 20.67  ? 660  ARG A NH1 1 
ATOM   4535 N NH2 . ARG A 1  582 ? 11.687  -16.411 -46.833 1.00 21.38  ? 660  ARG A NH2 1 
ATOM   4536 N N   . TRP A 1  583 ? 4.348   -19.073 -42.194 1.00 15.97  ? 661  TRP A N   1 
ATOM   4537 C CA  . TRP A 1  583 ? 3.632   -19.579 -41.025 1.00 13.73  ? 661  TRP A CA  1 
ATOM   4538 C C   . TRP A 1  583 ? 3.496   -21.100 -41.112 1.00 14.34  ? 661  TRP A C   1 
ATOM   4539 O O   . TRP A 1  583 ? 3.556   -21.781 -40.118 1.00 13.55  ? 661  TRP A O   1 
ATOM   4540 C CB  . TRP A 1  583 ? 2.247   -18.894 -40.893 1.00 14.28  ? 661  TRP A CB  1 
ATOM   4541 C CG  . TRP A 1  583 ? 1.757   -18.774 -39.449 1.00 14.33  ? 661  TRP A CG  1 
ATOM   4542 C CD1 . TRP A 1  583 ? 1.898   -19.693 -38.469 1.00 14.32  ? 661  TRP A CD1 1 
ATOM   4543 C CD2 . TRP A 1  583 ? 1.064   -17.672 -38.862 1.00 15.49  ? 661  TRP A CD2 1 
ATOM   4544 N NE1 . TRP A 1  583 ? 1.370   -19.239 -37.295 1.00 14.57  ? 661  TRP A NE1 1 
ATOM   4545 C CE2 . TRP A 1  583 ? 0.845   -17.995 -37.505 1.00 14.97  ? 661  TRP A CE2 1 
ATOM   4546 C CE3 . TRP A 1  583 ? 0.647   -16.424 -39.334 1.00 15.61  ? 661  TRP A CE3 1 
ATOM   4547 C CZ2 . TRP A 1  583 ? 0.192   -17.130 -36.619 1.00 15.54  ? 661  TRP A CZ2 1 
ATOM   4548 C CZ3 . TRP A 1  583 ? 0.004   -15.566 -38.457 1.00 14.53  ? 661  TRP A CZ3 1 
ATOM   4549 C CH2 . TRP A 1  583 ? -0.212  -15.919 -37.108 1.00 14.73  ? 661  TRP A CH2 1 
ATOM   4550 N N   . THR A 1  584 ? 3.319   -21.648 -42.309 1.00 14.67  ? 662  THR A N   1 
ATOM   4551 C CA  . THR A 1  584 ? 3.258   -23.088 -42.448 1.00 15.51  ? 662  THR A CA  1 
ATOM   4552 C C   . THR A 1  584 ? 4.635   -23.715 -42.172 1.00 15.56  ? 662  THR A C   1 
ATOM   4553 O O   . THR A 1  584 ? 4.721   -24.777 -41.539 1.00 16.19  ? 662  THR A O   1 
ATOM   4554 C CB  . THR A 1  584 ? 2.703   -23.517 -43.820 1.00 15.80  ? 662  THR A CB  1 
ATOM   4555 O OG1 . THR A 1  584 ? 1.382   -22.976 -43.977 1.00 16.38  ? 662  THR A OG1 1 
ATOM   4556 C CG2 . THR A 1  584 ? 2.625   -25.028 -43.902 1.00 16.31  ? 662  THR A CG2 1 
ATOM   4557 N N   . GLN A 1  585 ? 5.689   -23.069 -42.658 1.00 16.65  ? 663  GLN A N   1 
ATOM   4558 C CA  . GLN A 1  585 ? 7.064   -23.518 -42.405 1.00 16.61  ? 663  GLN A CA  1 
ATOM   4559 C C   . GLN A 1  585 ? 7.386   -23.563 -40.919 1.00 17.08  ? 663  GLN A C   1 
ATOM   4560 O O   . GLN A 1  585 ? 7.848   -24.576 -40.415 1.00 17.13  ? 663  GLN A O   1 
ATOM   4561 C CB  . GLN A 1  585 ? 8.057   -22.602 -43.098 1.00 16.80  ? 663  GLN A CB  1 
ATOM   4562 C CG  . GLN A 1  585 ? 8.114   -22.853 -44.591 1.00 18.16  ? 663  GLN A CG  1 
ATOM   4563 C CD  . GLN A 1  585 ? 8.873   -21.794 -45.366 1.00 17.09  ? 663  GLN A CD  1 
ATOM   4564 O OE1 . GLN A 1  585 ? 9.137   -20.707 -44.861 1.00 18.77  ? 663  GLN A OE1 1 
ATOM   4565 N NE2 . GLN A 1  585 ? 9.212   -22.110 -46.622 1.00 16.84  ? 663  GLN A NE2 1 
ATOM   4566 N N   . LEU A 1  586 ? 7.116   -22.471 -40.212 1.00 17.24  ? 664  LEU A N   1 
ATOM   4567 C CA  . LEU A 1  586 ? 7.394   -22.420 -38.768 1.00 18.40  ? 664  LEU A CA  1 
ATOM   4568 C C   . LEU A 1  586 ? 6.412   -23.305 -38.004 1.00 17.37  ? 664  LEU A C   1 
ATOM   4569 O O   . LEU A 1  586 ? 6.805   -24.058 -37.076 1.00 14.11  ? 664  LEU A O   1 
ATOM   4570 C CB  . LEU A 1  586 ? 7.345   -20.973 -38.276 1.00 21.63  ? 664  LEU A CB  1 
ATOM   4571 C CG  . LEU A 1  586 ? 7.549   -20.594 -36.796 1.00 22.46  ? 664  LEU A CG  1 
ATOM   4572 C CD1 . LEU A 1  586 ? 6.261   -20.647 -36.000 1.00 24.28  ? 664  LEU A CD1 1 
ATOM   4573 C CD2 . LEU A 1  586 ? 8.668   -21.395 -36.128 1.00 23.07  ? 664  LEU A CD2 1 
ATOM   4574 N N   . GLY A 1  587 ? 5.134   -23.233 -38.389 1.00 14.42  ? 665  GLY A N   1 
ATOM   4575 C CA  . GLY A 1  587 ? 4.083   -23.946 -37.679 1.00 17.51  ? 665  GLY A CA  1 
ATOM   4576 C C   . GLY A 1  587 ? 4.185   -25.455 -37.812 1.00 15.51  ? 665  GLY A C   1 
ATOM   4577 O O   . GLY A 1  587 ? 3.674   -26.175 -36.956 1.00 14.56  ? 665  GLY A O   1 
ATOM   4578 N N   . ALA A 1  588 ? 4.896   -25.938 -38.842 1.00 15.49  ? 666  ALA A N   1 
ATOM   4579 C CA  . ALA A 1  588 ? 5.236   -27.355 -38.938 1.00 16.08  ? 666  ALA A CA  1 
ATOM   4580 C C   . ALA A 1  588 ? 6.137   -27.803 -37.797 1.00 13.53  ? 666  ALA A C   1 
ATOM   4581 O O   . ALA A 1  588 ? 6.286   -29.002 -37.566 1.00 15.00  ? 666  ALA A O   1 
ATOM   4582 C CB  . ALA A 1  588 ? 5.887   -27.681 -40.273 1.00 17.00  ? 666  ALA A CB  1 
ATOM   4583 N N   . PHE A 1  589 ? 6.724   -26.841 -37.081 1.00 16.67  ? 667  PHE A N   1 
ATOM   4584 C CA  . PHE A 1  589 ? 7.458   -27.101 -35.865 1.00 14.91  ? 667  PHE A CA  1 
ATOM   4585 C C   . PHE A 1  589 ? 6.724   -26.759 -34.572 1.00 16.20  ? 667  PHE A C   1 
ATOM   4586 O O   . PHE A 1  589 ? 7.318   -26.856 -33.484 1.00 15.59  ? 667  PHE A O   1 
ATOM   4587 C CB  . PHE A 1  589 ? 8.845   -26.464 -35.959 1.00 17.70  ? 667  PHE A CB  1 
ATOM   4588 C CG  . PHE A 1  589 ? 9.730   -27.155 -36.945 1.00 17.63  ? 667  PHE A CG  1 
ATOM   4589 C CD1 . PHE A 1  589 ? 10.391  -28.336 -36.591 1.00 15.95  ? 667  PHE A CD1 1 
ATOM   4590 C CD2 . PHE A 1  589 ? 9.845   -26.683 -38.255 1.00 15.97  ? 667  PHE A CD2 1 
ATOM   4591 C CE1 . PHE A 1  589 ? 11.194  -29.002 -37.511 1.00 18.41  ? 667  PHE A CE1 1 
ATOM   4592 C CE2 . PHE A 1  589 ? 10.630  -27.361 -39.177 1.00 18.81  ? 667  PHE A CE2 1 
ATOM   4593 C CZ  . PHE A 1  589 ? 11.312  -28.521 -38.804 1.00 16.20  ? 667  PHE A CZ  1 
ATOM   4594 N N   . TYR A 1  590 ? 5.442   -26.392 -34.648 1.00 16.21  ? 668  TYR A N   1 
ATOM   4595 C CA  . TYR A 1  590 ? 4.625   -26.365 -33.419 1.00 14.72  ? 668  TYR A CA  1 
ATOM   4596 C C   . TYR A 1  590 ? 4.399   -27.836 -33.015 1.00 15.70  ? 668  TYR A C   1 
ATOM   4597 O O   . TYR A 1  590 ? 4.143   -28.675 -33.891 1.00 13.80  ? 668  TYR A O   1 
ATOM   4598 C CB  . TYR A 1  590 ? 3.249   -25.741 -33.661 1.00 15.64  ? 668  TYR A CB  1 
ATOM   4599 C CG  . TYR A 1  590 ? 3.162   -24.287 -34.011 1.00 14.29  ? 668  TYR A CG  1 
ATOM   4600 C CD1 . TYR A 1  590 ? 4.088   -23.358 -33.538 1.00 17.88  ? 668  TYR A CD1 1 
ATOM   4601 C CD2 . TYR A 1  590 ? 2.124   -23.822 -34.808 1.00 17.13  ? 668  TYR A CD2 1 
ATOM   4602 C CE1 . TYR A 1  590 ? 3.985   -22.021 -33.858 1.00 20.35  ? 668  TYR A CE1 1 
ATOM   4603 C CE2 . TYR A 1  590 ? 2.009   -22.469 -35.144 1.00 16.65  ? 668  TYR A CE2 1 
ATOM   4604 C CZ  . TYR A 1  590 ? 2.942   -21.571 -34.667 1.00 15.58  ? 668  TYR A CZ  1 
ATOM   4605 O OH  . TYR A 1  590 ? 2.846   -20.222 -34.959 1.00 16.47  ? 668  TYR A OH  1 
ATOM   4606 N N   . PRO A 1  591 ? 4.481   -28.166 -31.707 1.00 15.47  ? 669  PRO A N   1 
ATOM   4607 C CA  . PRO A 1  591 ? 4.182   -29.552 -31.368 1.00 15.95  ? 669  PRO A CA  1 
ATOM   4608 C C   . PRO A 1  591 ? 2.723   -29.961 -31.674 1.00 14.97  ? 669  PRO A C   1 
ATOM   4609 O O   . PRO A 1  591 ? 2.479   -31.102 -32.019 1.00 13.69  ? 669  PRO A O   1 
ATOM   4610 C CB  . PRO A 1  591 ? 4.485   -29.620 -29.868 1.00 17.46  ? 669  PRO A CB  1 
ATOM   4611 C CG  . PRO A 1  591 ? 5.526   -28.564 -29.668 1.00 15.74  ? 669  PRO A CG  1 
ATOM   4612 C CD  . PRO A 1  591 ? 5.069   -27.448 -30.560 1.00 14.68  ? 669  PRO A CD  1 
ATOM   4613 N N   . PHE A 1  592 ? 1.797   -29.013 -31.578 1.00 14.37  ? 670  PHE A N   1 
ATOM   4614 C CA  . PHE A 1  592 ? 0.426   -29.144 -32.079 1.00 16.34  ? 670  PHE A CA  1 
ATOM   4615 C C   . PHE A 1  592 ? 0.231   -28.255 -33.308 1.00 14.62  ? 670  PHE A C   1 
ATOM   4616 O O   . PHE A 1  592 ? 0.305   -27.004 -33.209 1.00 15.76  ? 670  PHE A O   1 
ATOM   4617 C CB  . PHE A 1  592 ? -0.586  -28.781 -30.977 1.00 15.40  ? 670  PHE A CB  1 
ATOM   4618 C CG  . PHE A 1  592 ? -2.010  -28.690 -31.466 1.00 13.74  ? 670  PHE A CG  1 
ATOM   4619 C CD1 . PHE A 1  592 ? -2.644  -29.801 -31.995 1.00 14.28  ? 670  PHE A CD1 1 
ATOM   4620 C CD2 . PHE A 1  592 ? -2.717  -27.491 -31.379 1.00 14.24  ? 670  PHE A CD2 1 
ATOM   4621 C CE1 . PHE A 1  592 ? -3.948  -29.726 -32.462 1.00 14.18  ? 670  PHE A CE1 1 
ATOM   4622 C CE2 . PHE A 1  592 ? -4.018  -27.410 -31.837 1.00 15.70  ? 670  PHE A CE2 1 
ATOM   4623 C CZ  . PHE A 1  592 ? -4.630  -28.528 -32.385 1.00 16.02  ? 670  PHE A CZ  1 
ATOM   4624 N N   . MET A 1  593 ? -0.011  -28.895 -34.459 1.00 13.27  ? 671  MET A N   1 
ATOM   4625 C CA  . MET A 1  593 ? -0.069  -28.207 -35.745 1.00 14.00  ? 671  MET A CA  1 
ATOM   4626 C C   . MET A 1  593 ? -1.481  -28.263 -36.368 1.00 15.41  ? 671  MET A C   1 
ATOM   4627 O O   . MET A 1  593 ? -1.911  -29.295 -36.903 1.00 15.16  ? 671  MET A O   1 
ATOM   4628 C CB  . MET A 1  593 ? 0.936   -28.786 -36.733 1.00 14.44  ? 671  MET A CB  1 
ATOM   4629 C CG  . MET A 1  593 ? 0.975   -27.970 -38.007 1.00 15.48  ? 671  MET A CG  1 
ATOM   4630 S SD  . MET A 1  593 ? 1.888   -28.721 -39.326 1.00 17.13  ? 671  MET A SD  1 
ATOM   4631 C CE  . MET A 1  593 ? 1.941   -27.325 -40.432 1.00 20.21  ? 671  MET A CE  1 
ATOM   4632 N N   . ARG A 1  594 ? -2.160  -27.129 -36.292 1.00 13.62  ? 672  ARG A N   1 
ATOM   4633 C CA  . ARG A 1  594 ? -3.491  -26.941 -36.822 1.00 15.00  ? 672  ARG A CA  1 
ATOM   4634 C C   . ARG A 1  594 ? -3.571  -25.604 -37.544 1.00 16.08  ? 672  ARG A C   1 
ATOM   4635 O O   . ARG A 1  594 ? -3.211  -24.569 -37.000 1.00 16.30  ? 672  ARG A O   1 
ATOM   4636 C CB  . ARG A 1  594 ? -4.551  -26.943 -35.718 1.00 14.34  ? 672  ARG A CB  1 
ATOM   4637 C CG  . ARG A 1  594 ? -5.967  -26.787 -36.262 1.00 14.40  ? 672  ARG A CG  1 
ATOM   4638 C CD  . ARG A 1  594 ? -6.984  -26.783 -35.127 1.00 18.59  ? 672  ARG A CD  1 
ATOM   4639 N NE  . ARG A 1  594 ? -6.959  -25.526 -34.379 1.00 16.97  ? 672  ARG A NE  1 
ATOM   4640 C CZ  . ARG A 1  594 ? -8.027  -24.893 -33.891 1.00 20.66  ? 672  ARG A CZ  1 
ATOM   4641 N NH1 . ARG A 1  594 ? -9.255  -25.370 -34.069 1.00 18.51  ? 672  ARG A NH1 1 
ATOM   4642 N NH2 . ARG A 1  594 ? -7.872  -23.729 -33.251 1.00 20.58  ? 672  ARG A NH2 1 
ATOM   4643 N N   . ASN A 1  595 ? -4.067  -25.652 -38.777 1.00 17.54  ? 673  ASN A N   1 
ATOM   4644 C CA  . ASN A 1  595 ? -4.452  -24.467 -39.514 1.00 17.41  ? 673  ASN A CA  1 
ATOM   4645 C C   . ASN A 1  595 ? -5.941  -24.300 -39.253 1.00 16.04  ? 673  ASN A C   1 
ATOM   4646 O O   . ASN A 1  595 ? -6.728  -25.213 -39.533 1.00 14.60  ? 673  ASN A O   1 
ATOM   4647 C CB  . ASN A 1  595 ? -4.180  -24.671 -41.003 1.00 16.67  ? 673  ASN A CB  1 
ATOM   4648 C CG  . ASN A 1  595 ? -4.572  -23.482 -41.852 1.00 18.81  ? 673  ASN A CG  1 
ATOM   4649 O OD1 . ASN A 1  595 ? -5.629  -22.892 -41.668 1.00 16.73  ? 673  ASN A OD1 1 
ATOM   4650 N ND2 . ASN A 1  595 ? -3.740  -23.162 -42.837 1.00 15.07  ? 673  ASN A ND2 1 
ATOM   4651 N N   . HIS A 1  596 ? -6.314  -23.133 -38.734 1.00 16.75  ? 674  HIS A N   1 
ATOM   4652 C CA  . HIS A 1  596 ? -7.712  -22.820 -38.375 1.00 16.54  ? 674  HIS A CA  1 
ATOM   4653 C C   . HIS A 1  596 ? -7.953  -21.380 -38.783 1.00 16.53  ? 674  HIS A C   1 
ATOM   4654 O O   . HIS A 1  596 ? -7.012  -20.588 -38.840 1.00 15.65  ? 674  HIS A O   1 
ATOM   4655 C CB  . HIS A 1  596 ? -7.966  -23.098 -36.882 1.00 14.25  ? 674  HIS A CB  1 
ATOM   4656 C CG  . HIS A 1  596 ? -9.300  -22.624 -36.384 1.00 14.51  ? 674  HIS A CG  1 
ATOM   4657 N ND1 . HIS A 1  596 ? -10.485 -22.953 -37.004 1.00 14.80  ? 674  HIS A ND1 1 
ATOM   4658 C CD2 . HIS A 1  596 ? -9.634  -21.832 -35.334 1.00 16.26  ? 674  HIS A CD2 1 
ATOM   4659 C CE1 . HIS A 1  596 ? -11.493 -22.379 -36.362 1.00 17.34  ? 674  HIS A CE1 1 
ATOM   4660 N NE2 . HIS A 1  596 ? -11.005 -21.699 -35.339 1.00 14.72  ? 674  HIS A NE2 1 
ATOM   4661 N N   . ASN A 1  597 ? -9.202  -21.048 -39.092 1.00 15.86  ? 675  ASN A N   1 
ATOM   4662 C CA  . ASN A 1  597 ? -9.531  -19.821 -39.802 1.00 16.04  ? 675  ASN A CA  1 
ATOM   4663 C C   . ASN A 1  597 ? -10.921 -19.307 -39.418 1.00 14.94  ? 675  ASN A C   1 
ATOM   4664 O O   . ASN A 1  597 ? -11.812 -20.117 -39.176 1.00 14.27  ? 675  ASN A O   1 
ATOM   4665 C CB  . ASN A 1  597 ? -9.463  -20.124 -41.302 1.00 16.00  ? 675  ASN A CB  1 
ATOM   4666 C CG  . ASN A 1  597 ? -9.446  -18.870 -42.167 1.00 17.46  ? 675  ASN A CG  1 
ATOM   4667 O OD1 . ASN A 1  597 ? -9.088  -17.784 -41.716 1.00 18.57  ? 675  ASN A OD1 1 
ATOM   4668 N ND2 . ASN A 1  597 ? -9.814  -19.031 -43.430 1.00 17.52  ? 675  ASN A ND2 1 
ATOM   4669 N N   . SER A 1  598 ? -11.108 -17.977 -39.365 1.00 16.39  ? 676  SER A N   1 
ATOM   4670 C CA  A SER A 1  598 ? -12.386 -17.396 -38.933 0.50 16.81  ? 676  SER A CA  1 
ATOM   4671 C CA  B SER A 1  598 ? -12.387 -17.394 -38.928 0.50 16.84  ? 676  SER A CA  1 
ATOM   4672 C C   . SER A 1  598 ? -13.440 -17.384 -40.038 1.00 17.82  ? 676  SER A C   1 
ATOM   4673 O O   . SER A 1  598 ? -13.139 -17.575 -41.222 1.00 18.31  ? 676  SER A O   1 
ATOM   4674 C CB  A SER A 1  598 ? -12.190 -15.984 -38.379 0.50 17.62  ? 676  SER A CB  1 
ATOM   4675 C CB  B SER A 1  598 ? -12.197 -15.987 -38.327 0.50 17.64  ? 676  SER A CB  1 
ATOM   4676 O OG  A SER A 1  598 ? -13.408 -15.488 -37.862 0.50 16.61  ? 676  SER A OG  1 
ATOM   4677 O OG  B SER A 1  598 ? -12.084 -14.980 -39.322 0.50 17.01  ? 676  SER A OG  1 
ATOM   4678 N N   . LEU A 1  599 ? -14.683 -17.170 -39.627 1.00 18.58  ? 677  LEU A N   1 
ATOM   4679 C CA  . LEU A 1  599 ? -15.849 -17.300 -40.494 1.00 20.13  ? 677  LEU A CA  1 
ATOM   4680 C C   . LEU A 1  599 ? -15.781 -16.441 -41.751 1.00 23.76  ? 677  LEU A C   1 
ATOM   4681 O O   . LEU A 1  599 ? -16.073 -16.937 -42.829 1.00 22.92  ? 677  LEU A O   1 
ATOM   4682 C CB  . LEU A 1  599 ? -17.132 -16.977 -39.713 1.00 21.55  ? 677  LEU A CB  1 
ATOM   4683 C CG  . LEU A 1  599 ? -18.458 -17.152 -40.470 1.00 23.44  ? 677  LEU A CG  1 
ATOM   4684 C CD1 . LEU A 1  599 ? -18.717 -18.613 -40.784 1.00 24.35  ? 677  LEU A CD1 1 
ATOM   4685 C CD2 . LEU A 1  599 ? -19.596 -16.592 -39.630 1.00 25.50  ? 677  LEU A CD2 1 
ATOM   4686 N N   . LEU A 1  600 ? -15.394 -15.174 -41.610 1.00 23.74  ? 678  LEU A N   1 
ATOM   4687 C CA  . LEU A 1  600 ? -15.438 -14.241 -42.737 1.00 31.30  ? 678  LEU A CA  1 
ATOM   4688 C C   . LEU A 1  600 ? -14.124 -14.124 -43.507 1.00 30.53  ? 678  LEU A C   1 
ATOM   4689 O O   . LEU A 1  600 ? -14.068 -13.415 -44.509 1.00 32.39  ? 678  LEU A O   1 
ATOM   4690 C CB  . LEU A 1  600 ? -15.913 -12.861 -42.258 1.00 36.03  ? 678  LEU A CB  1 
ATOM   4691 C CG  . LEU A 1  600 ? -17.277 -12.859 -41.551 1.00 39.68  ? 678  LEU A CG  1 
ATOM   4692 C CD1 . LEU A 1  600 ? -17.548 -11.490 -40.954 1.00 47.51  ? 678  LEU A CD1 1 
ATOM   4693 C CD2 . LEU A 1  600 ? -18.388 -13.277 -42.509 1.00 40.14  ? 678  LEU A CD2 1 
ATOM   4694 N N   . SER A 1  601 ? -13.084 -14.836 -43.070 1.00 29.04  ? 679  SER A N   1 
ATOM   4695 C CA  . SER A 1  601 ? -11.775 -14.749 -43.714 1.00 29.77  ? 679  SER A CA  1 
ATOM   4696 C C   . SER A 1  601 ? -11.708 -15.495 -45.077 1.00 26.73  ? 679  SER A C   1 
ATOM   4697 O O   . SER A 1  601 ? -12.438 -16.469 -45.332 1.00 22.76  ? 679  SER A O   1 
ATOM   4698 C CB  . SER A 1  601 ? -10.702 -15.316 -42.794 1.00 29.65  ? 679  SER A CB  1 
ATOM   4699 O OG  . SER A 1  601 ? -10.729 -14.727 -41.505 1.00 23.13  ? 679  SER A OG  1 
ATOM   4700 N N   . LEU A 1  602 ? -10.788 -15.040 -45.921 1.00 23.21  ? 680  LEU A N   1 
ATOM   4701 C CA  . LEU A 1  602 ? -10.439 -15.714 -47.159 1.00 23.25  ? 680  LEU A CA  1 
ATOM   4702 C C   . LEU A 1  602 ? -9.882  -17.124 -46.850 1.00 21.28  ? 680  LEU A C   1 
ATOM   4703 O O   . LEU A 1  602 ? -9.273  -17.333 -45.818 1.00 19.83  ? 680  LEU A O   1 
ATOM   4704 C CB  . LEU A 1  602 ? -9.391  -14.898 -47.928 1.00 28.14  ? 680  LEU A CB  1 
ATOM   4705 C CG  . LEU A 1  602 ? -9.839  -13.532 -48.445 1.00 40.09  ? 680  LEU A CG  1 
ATOM   4706 C CD1 . LEU A 1  602 ? -8.646  -12.781 -49.042 1.00 38.16  ? 680  LEU A CD1 1 
ATOM   4707 C CD2 . LEU A 1  602 ? -10.974 -13.663 -49.456 1.00 47.83  ? 680  LEU A CD2 1 
ATOM   4708 N N   . PRO A 1  603 ? -10.095 -18.093 -47.741 1.00 22.15  ? 681  PRO A N   1 
ATOM   4709 C CA  . PRO A 1  603 ? -9.614  -19.442 -47.412 1.00 24.74  ? 681  PRO A CA  1 
ATOM   4710 C C   . PRO A 1  603 ? -8.093  -19.519 -47.296 1.00 20.67  ? 681  PRO A C   1 
ATOM   4711 O O   . PRO A 1  603 ? -7.394  -18.779 -47.961 1.00 19.74  ? 681  PRO A O   1 
ATOM   4712 C CB  . PRO A 1  603 ? -10.115 -20.294 -48.580 1.00 26.09  ? 681  PRO A CB  1 
ATOM   4713 C CG  . PRO A 1  603 ? -11.212 -19.505 -49.200 1.00 27.54  ? 681  PRO A CG  1 
ATOM   4714 C CD  . PRO A 1  603 ? -10.851 -18.065 -49.004 1.00 26.77  ? 681  PRO A CD  1 
ATOM   4715 N N   . GLN A 1  604 ? -7.585  -20.408 -46.451 1.00 21.06  ? 682  GLN A N   1 
ATOM   4716 C CA  . GLN A 1  604 ? -6.130  -20.556 -46.280 1.00 18.81  ? 682  GLN A CA  1 
ATOM   4717 C C   . GLN A 1  604 ? -5.685  -22.009 -46.105 1.00 19.03  ? 682  GLN A C   1 
ATOM   4718 O O   . GLN A 1  604 ? -4.661  -22.278 -45.439 1.00 19.92  ? 682  GLN A O   1 
ATOM   4719 C CB  . GLN A 1  604 ? -5.657  -19.686 -45.102 1.00 18.18  ? 682  GLN A CB  1 
ATOM   4720 C CG  . GLN A 1  604 ? -6.241  -20.112 -43.744 1.00 18.18  ? 682  GLN A CG  1 
ATOM   4721 C CD  . GLN A 1  604 ? -5.892  -19.168 -42.631 1.00 18.39  ? 682  GLN A CD  1 
ATOM   4722 O OE1 . GLN A 1  604 ? -5.868  -17.929 -42.822 1.00 19.79  ? 682  GLN A OE1 1 
ATOM   4723 N NE2 . GLN A 1  604 ? -5.598  -19.735 -41.438 1.00 17.89  ? 682  GLN A NE2 1 
ATOM   4724 N N   . GLU A 1  605 ? -6.423  -22.940 -46.716 1.00 18.29  ? 683  GLU A N   1 
ATOM   4725 C CA  . GLU A 1  605 ? -6.004  -24.337 -46.762 1.00 19.69  ? 683  GLU A CA  1 
ATOM   4726 C C   . GLU A 1  605 ? -4.813  -24.392 -47.737 1.00 18.83  ? 683  GLU A C   1 
ATOM   4727 O O   . GLU A 1  605 ? -4.782  -23.606 -48.688 1.00 21.68  ? 683  GLU A O   1 
ATOM   4728 C CB  . GLU A 1  605 ? -7.118  -25.263 -47.260 1.00 18.07  ? 683  GLU A CB  1 
ATOM   4729 C CG  . GLU A 1  605 ? -8.413  -25.243 -46.436 1.00 19.40  ? 683  GLU A CG  1 
ATOM   4730 C CD  . GLU A 1  605 ? -9.397  -24.166 -46.869 1.00 19.56  ? 683  GLU A CD  1 
ATOM   4731 O OE1 . GLU A 1  605 ? -9.130  -23.459 -47.866 1.00 20.58  ? 683  GLU A OE1 1 
ATOM   4732 O OE2 . GLU A 1  605 ? -10.438 -24.023 -46.210 1.00 21.73  ? 683  GLU A OE2 1 
ATOM   4733 N N   . PRO A 1  606 ? -3.843  -25.302 -47.508 1.00 19.49  ? 684  PRO A N   1 
ATOM   4734 C CA  . PRO A 1  606 ? -2.660  -25.418 -48.367 1.00 20.82  ? 684  PRO A CA  1 
ATOM   4735 C C   . PRO A 1  606 ? -2.976  -25.467 -49.873 1.00 19.37  ? 684  PRO A C   1 
ATOM   4736 O O   . PRO A 1  606 ? -2.288  -24.812 -50.675 1.00 21.88  ? 684  PRO A O   1 
ATOM   4737 C CB  . PRO A 1  606 ? -2.007  -26.708 -47.872 1.00 22.42  ? 684  PRO A CB  1 
ATOM   4738 C CG  . PRO A 1  606 ? -2.354  -26.754 -46.417 1.00 22.70  ? 684  PRO A CG  1 
ATOM   4739 C CD  . PRO A 1  606 ? -3.706  -26.127 -46.284 1.00 20.39  ? 684  PRO A CD  1 
ATOM   4740 N N   . TYR A 1  607 ? -4.030  -26.189 -50.245 1.00 18.87  ? 685  TYR A N   1 
ATOM   4741 C CA  . TYR A 1  607 ? -4.434  -26.286 -51.674 1.00 20.86  ? 685  TYR A CA  1 
ATOM   4742 C C   . TYR A 1  607 ? -5.045  -25.018 -52.281 1.00 20.79  ? 685  TYR A C   1 
ATOM   4743 O O   . TYR A 1  607 ? -5.254  -24.973 -53.491 1.00 23.81  ? 685  TYR A O   1 
ATOM   4744 C CB  . TYR A 1  607 ? -5.390  -27.459 -51.909 1.00 21.65  ? 685  TYR A CB  1 
ATOM   4745 C CG  . TYR A 1  607 ? -6.651  -27.366 -51.088 1.00 19.38  ? 685  TYR A CG  1 
ATOM   4746 C CD1 . TYR A 1  607 ? -7.681  -26.502 -51.463 1.00 21.07  ? 685  TYR A CD1 1 
ATOM   4747 C CD2 . TYR A 1  607 ? -6.812  -28.117 -49.913 1.00 19.09  ? 685  TYR A CD2 1 
ATOM   4748 C CE1 . TYR A 1  607 ? -8.821  -26.370 -50.695 1.00 20.93  ? 685  TYR A CE1 1 
ATOM   4749 C CE2 . TYR A 1  607 ? -7.968  -27.999 -49.145 1.00 18.69  ? 685  TYR A CE2 1 
ATOM   4750 C CZ  . TYR A 1  607 ? -8.975  -27.126 -49.547 1.00 19.62  ? 685  TYR A CZ  1 
ATOM   4751 O OH  . TYR A 1  607 ? -10.142 -27.004 -48.828 1.00 18.21  ? 685  TYR A OH  1 
ATOM   4752 N N   . SER A 1  608 ? -5.339  -24.001 -51.478 1.00 19.96  ? 686  SER A N   1 
ATOM   4753 C CA  . SER A 1  608 ? -5.977  -22.776 -52.003 1.00 22.81  ? 686  SER A CA  1 
ATOM   4754 C C   . SER A 1  608 ? -5.001  -21.718 -52.539 1.00 24.93  ? 686  SER A C   1 
ATOM   4755 O O   . SER A 1  608 ? -5.447  -20.660 -52.986 1.00 23.99  ? 686  SER A O   1 
ATOM   4756 C CB  . SER A 1  608 ? -6.861  -22.149 -50.914 1.00 22.47  ? 686  SER A CB  1 
ATOM   4757 O OG  . SER A 1  608 ? -6.060  -21.585 -49.885 1.00 24.39  ? 686  SER A OG  1 
ATOM   4758 N N   . PHE A 1  609 ? -3.695  -22.003 -52.513 1.00 22.22  ? 687  PHE A N   1 
ATOM   4759 C CA  . PHE A 1  609 ? -2.653  -21.052 -52.917 1.00 22.66  ? 687  PHE A CA  1 
ATOM   4760 C C   . PHE A 1  609 ? -2.030  -21.391 -54.270 1.00 22.96  ? 687  PHE A C   1 
ATOM   4761 O O   . PHE A 1  609 ? -2.310  -22.431 -54.831 1.00 19.58  ? 687  PHE A O   1 
ATOM   4762 C CB  . PHE A 1  609 ? -1.585  -21.007 -51.826 1.00 20.89  ? 687  PHE A CB  1 
ATOM   4763 C CG  . PHE A 1  609 ? -2.096  -20.452 -50.542 1.00 20.55  ? 687  PHE A CG  1 
ATOM   4764 C CD1 . PHE A 1  609 ? -2.226  -19.072 -50.371 1.00 22.17  ? 687  PHE A CD1 1 
ATOM   4765 C CD2 . PHE A 1  609 ? -2.493  -21.296 -49.514 1.00 20.86  ? 687  PHE A CD2 1 
ATOM   4766 C CE1 . PHE A 1  609 ? -2.721  -18.554 -49.186 1.00 19.97  ? 687  PHE A CE1 1 
ATOM   4767 C CE2 . PHE A 1  609 ? -2.988  -20.780 -48.333 1.00 20.01  ? 687  PHE A CE2 1 
ATOM   4768 C CZ  . PHE A 1  609 ? -3.112  -19.412 -48.176 1.00 22.63  ? 687  PHE A CZ  1 
ATOM   4769 N N   . SER A 1  610 ? -1.173  -20.504 -54.777 1.00 22.46  ? 688  SER A N   1 
ATOM   4770 C CA  . SER A 1  610 ? -0.460  -20.734 -56.027 1.00 22.16  ? 688  SER A CA  1 
ATOM   4771 C C   . SER A 1  610 ? 0.439   -21.961 -55.891 1.00 23.87  ? 688  SER A C   1 
ATOM   4772 O O   . SER A 1  610 ? 0.760   -22.402 -54.783 1.00 23.65  ? 688  SER A O   1 
ATOM   4773 C CB  . SER A 1  610 ? 0.416   -19.534 -56.384 1.00 24.88  ? 688  SER A CB  1 
ATOM   4774 O OG  . SER A 1  610 ? 1.545   -19.483 -55.508 1.00 27.27  ? 688  SER A OG  1 
ATOM   4775 N N   . GLU A 1  611 ? 0.852   -22.484 -57.032 1.00 23.46  ? 689  GLU A N   1 
ATOM   4776 C CA  . GLU A 1  611 ? 1.668   -23.687 -57.112 1.00 27.42  ? 689  GLU A CA  1 
ATOM   4777 C C   . GLU A 1  611 ? 2.995   -23.598 -56.344 1.00 24.33  ? 689  GLU A C   1 
ATOM   4778 O O   . GLU A 1  611 ? 3.353   -24.539 -55.645 1.00 26.37  ? 689  GLU A O   1 
ATOM   4779 C CB  . GLU A 1  611 ? 1.903   -24.047 -58.599 1.00 31.80  ? 689  GLU A CB  1 
ATOM   4780 C CG  . GLU A 1  611 ? 2.719   -25.291 -58.856 1.00 37.03  ? 689  GLU A CG  1 
ATOM   4781 C CD  . GLU A 1  611 ? 2.028   -26.574 -58.431 1.00 44.19  ? 689  GLU A CD  1 
ATOM   4782 O OE1 . GLU A 1  611 ? 0.819   -26.563 -58.060 1.00 43.98  ? 689  GLU A OE1 1 
ATOM   4783 O OE2 . GLU A 1  611 ? 2.716   -27.614 -58.490 1.00 57.90  ? 689  GLU A OE2 1 
ATOM   4784 N N   . PRO A 1  612 ? 3.728   -22.487 -56.473 1.00 26.30  ? 690  PRO A N   1 
ATOM   4785 C CA  . PRO A 1  612 ? 4.964   -22.420 -55.722 1.00 24.84  ? 690  PRO A CA  1 
ATOM   4786 C C   . PRO A 1  612 ? 4.729   -22.418 -54.217 1.00 24.10  ? 690  PRO A C   1 
ATOM   4787 O O   . PRO A 1  612 ? 5.465   -23.059 -53.482 1.00 24.10  ? 690  PRO A O   1 
ATOM   4788 C CB  . PRO A 1  612 ? 5.565   -21.073 -56.153 1.00 28.14  ? 690  PRO A CB  1 
ATOM   4789 C CG  . PRO A 1  612 ? 4.978   -20.805 -57.493 1.00 31.86  ? 690  PRO A CG  1 
ATOM   4790 C CD  . PRO A 1  612 ? 3.600   -21.361 -57.423 1.00 26.96  ? 690  PRO A CD  1 
ATOM   4791 N N   . ALA A 1  613 ? 3.694   -21.719 -53.775 1.00 21.62  ? 691  ALA A N   1 
ATOM   4792 C CA  . ALA A 1  613 ? 3.324   -21.718 -52.350 1.00 20.49  ? 691  ALA A CA  1 
ATOM   4793 C C   . ALA A 1  613 ? 2.923   -23.113 -51.874 1.00 20.06  ? 691  ALA A C   1 
ATOM   4794 O O   . ALA A 1  613 ? 3.351   -23.564 -50.812 1.00 19.98  ? 691  ALA A O   1 
ATOM   4795 C CB  . ALA A 1  613 ? 2.212   -20.714 -52.103 1.00 21.99  ? 691  ALA A CB  1 
ATOM   4796 N N   . GLN A 1  614 ? 2.128   -23.805 -52.681 1.00 20.46  ? 692  GLN A N   1 
ATOM   4797 C CA  . GLN A 1  614 ? 1.728   -25.173 -52.380 1.00 19.97  ? 692  GLN A CA  1 
ATOM   4798 C C   . GLN A 1  614 ? 2.916   -26.103 -52.209 1.00 20.24  ? 692  GLN A C   1 
ATOM   4799 O O   . GLN A 1  614 ? 2.912   -26.965 -51.322 1.00 17.97  ? 692  GLN A O   1 
ATOM   4800 C CB  . GLN A 1  614 ? 0.846   -25.732 -53.482 1.00 20.17  ? 692  GLN A CB  1 
ATOM   4801 C CG  . GLN A 1  614 ? -0.566  -25.172 -53.507 1.00 21.17  ? 692  GLN A CG  1 
ATOM   4802 C CD  . GLN A 1  614 ? -1.515  -26.014 -54.355 1.00 25.23  ? 692  GLN A CD  1 
ATOM   4803 O OE1 . GLN A 1  614 ? -1.517  -27.243 -54.284 1.00 31.94  ? 692  GLN A OE1 1 
ATOM   4804 N NE2 . GLN A 1  614 ? -2.338  -25.358 -55.133 1.00 28.99  ? 692  GLN A NE2 1 
ATOM   4805 N N   . GLN A 1  615 ? 3.905   -25.968 -53.088 1.00 21.97  ? 693  GLN A N   1 
ATOM   4806 C CA  . GLN A 1  615 ? 5.125   -26.787 -53.011 1.00 22.18  ? 693  GLN A CA  1 
ATOM   4807 C C   . GLN A 1  615 ? 5.832   -26.572 -51.691 1.00 18.58  ? 693  GLN A C   1 
ATOM   4808 O O   . GLN A 1  615 ? 6.187   -27.538 -51.002 1.00 18.95  ? 693  GLN A O   1 
ATOM   4809 C CB  . GLN A 1  615 ? 6.102   -26.456 -54.154 1.00 25.77  ? 693  GLN A CB  1 
ATOM   4810 C CG  . GLN A 1  615 ? 5.642   -26.967 -55.501 1.00 39.67  ? 693  GLN A CG  1 
ATOM   4811 C CD  . GLN A 1  615 ? 6.574   -26.594 -56.639 1.00 47.49  ? 693  GLN A CD  1 
ATOM   4812 O OE1 . GLN A 1  615 ? 7.769   -26.367 -56.436 1.00 57.87  ? 693  GLN A OE1 1 
ATOM   4813 N NE2 . GLN A 1  615 ? 6.033   -26.565 -57.850 1.00 48.16  ? 693  GLN A NE2 1 
ATOM   4814 N N   . ALA A 1  616 ? 5.994   -25.305 -51.315 1.00 17.57  ? 694  ALA A N   1 
ATOM   4815 C CA  . ALA A 1  616 ? 6.654   -24.958 -50.049 1.00 19.14  ? 694  ALA A CA  1 
ATOM   4816 C C   . ALA A 1  616 ? 5.896   -25.464 -48.826 1.00 19.54  ? 694  ALA A C   1 
ATOM   4817 O O   . ALA A 1  616 ? 6.513   -25.952 -47.862 1.00 23.42  ? 694  ALA A O   1 
ATOM   4818 C CB  . ALA A 1  616 ? 6.857   -23.460 -49.965 1.00 21.57  ? 694  ALA A CB  1 
ATOM   4819 N N   . MET A 1  617 ? 4.569   -25.329 -48.852 1.00 17.47  ? 695  MET A N   1 
ATOM   4820 C CA  . MET A 1  617 ? 3.708   -25.850 -47.788 1.00 16.58  ? 695  MET A CA  1 
ATOM   4821 C C   . MET A 1  617 ? 3.759   -27.395 -47.697 1.00 18.55  ? 695  MET A C   1 
ATOM   4822 O O   . MET A 1  617 ? 3.860   -27.970 -46.587 1.00 17.15  ? 695  MET A O   1 
ATOM   4823 C CB  . MET A 1  617 ? 2.264   -25.360 -47.997 1.00 16.92  ? 695  MET A CB  1 
ATOM   4824 C CG  . MET A 1  617 ? 2.098   -23.861 -47.725 1.00 18.37  ? 695  MET A CG  1 
ATOM   4825 S SD  . MET A 1  617 ? 0.471   -23.248 -48.260 1.00 22.07  ? 695  MET A SD  1 
ATOM   4826 C CE  . MET A 1  617 ? 0.720   -21.489 -48.239 1.00 22.19  ? 695  MET A CE  1 
ATOM   4827 N N   . ARG A 1  618 ? 3.693   -28.052 -48.863 1.00 18.92  ? 696  ARG A N   1 
ATOM   4828 C CA  . ARG A 1  618 ? 3.801   -29.524 -48.949 1.00 18.83  ? 696  ARG A CA  1 
ATOM   4829 C C   . ARG A 1  618 ? 5.123   -30.014 -48.375 1.00 19.93  ? 696  ARG A C   1 
ATOM   4830 O O   . ARG A 1  618 ? 5.151   -31.018 -47.661 1.00 21.92  ? 696  ARG A O   1 
ATOM   4831 C CB  . ARG A 1  618 ? 3.667   -30.012 -50.393 1.00 19.93  ? 696  ARG A CB  1 
ATOM   4832 C CG  . ARG A 1  618 ? 3.440   -31.519 -50.514 1.00 20.97  ? 696  ARG A CG  1 
ATOM   4833 C CD  . ARG A 1  618 ? 3.246   -31.995 -51.945 1.00 24.66  ? 696  ARG A CD  1 
ATOM   4834 N NE  . ARG A 1  618 ? 2.082   -31.362 -52.557 1.00 24.79  ? 696  ARG A NE  1 
ATOM   4835 C CZ  . ARG A 1  618 ? 2.107   -30.423 -53.504 1.00 27.10  ? 696  ARG A CZ  1 
ATOM   4836 N NH1 . ARG A 1  618 ? 3.248   -29.983 -54.029 1.00 29.75  ? 696  ARG A NH1 1 
ATOM   4837 N NH2 . ARG A 1  618 ? 0.955   -29.935 -53.952 1.00 28.24  ? 696  ARG A NH2 1 
ATOM   4838 N N   . LYS A 1  619 ? 6.211   -29.317 -48.711 1.00 19.48  ? 697  LYS A N   1 
ATOM   4839 C CA  . LYS A 1  619 ? 7.553   -29.638 -48.189 1.00 22.33  ? 697  LYS A CA  1 
ATOM   4840 C C   . LYS A 1  619 ? 7.584   -29.556 -46.674 1.00 20.26  ? 697  LYS A C   1 
ATOM   4841 O O   . LYS A 1  619 ? 8.142   -30.429 -46.015 1.00 19.81  ? 697  LYS A O   1 
ATOM   4842 C CB  . LYS A 1  619 ? 8.640   -28.697 -48.761 1.00 24.39  ? 697  LYS A CB  1 
ATOM   4843 C CG  . LYS A 1  619 ? 10.038  -28.940 -48.164 1.00 37.38  ? 697  LYS A CG  1 
ATOM   4844 C CD  . LYS A 1  619 ? 11.127  -28.010 -48.697 1.00 51.73  ? 697  LYS A CD  1 
ATOM   4845 C CE  . LYS A 1  619 ? 12.514  -28.433 -48.224 1.00 61.57  ? 697  LYS A CE  1 
ATOM   4846 N NZ  . LYS A 1  619 ? 13.531  -27.351 -48.366 1.00 72.16  ? 697  LYS A NZ  1 
ATOM   4847 N N   . ALA A 1  620 ? 6.996   -28.492 -46.137 1.00 18.07  ? 698  ALA A N   1 
ATOM   4848 C CA  . ALA A 1  620 ? 6.901   -28.314 -44.687 1.00 19.01  ? 698  ALA A CA  1 
ATOM   4849 C C   . ALA A 1  620 ? 6.172   -29.469 -43.978 1.00 17.09  ? 698  ALA A C   1 
ATOM   4850 O O   . ALA A 1  620 ? 6.665   -30.012 -42.954 1.00 18.13  ? 698  ALA A O   1 
ATOM   4851 C CB  . ALA A 1  620 ? 6.236   -26.987 -44.365 1.00 17.25  ? 698  ALA A CB  1 
ATOM   4852 N N   . LEU A 1  621 ? 5.032   -29.856 -44.537 1.00 16.62  ? 699  LEU A N   1 
ATOM   4853 C CA  . LEU A 1  621 ? 4.239   -30.951 -44.011 1.00 18.28  ? 699  LEU A CA  1 
ATOM   4854 C C   . LEU A 1  621 ? 4.952   -32.288 -44.164 1.00 18.44  ? 699  LEU A C   1 
ATOM   4855 O O   . LEU A 1  621 ? 4.900   -33.082 -43.253 1.00 18.25  ? 699  LEU A O   1 
ATOM   4856 C CB  . LEU A 1  621 ? 2.867   -31.020 -44.681 1.00 18.13  ? 699  LEU A CB  1 
ATOM   4857 C CG  . LEU A 1  621 ? 1.919   -29.890 -44.295 1.00 18.38  ? 699  LEU A CG  1 
ATOM   4858 C CD1 . LEU A 1  621 ? 0.762   -29.838 -45.277 1.00 21.59  ? 699  LEU A CD1 1 
ATOM   4859 C CD2 . LEU A 1  621 ? 1.410   -30.068 -42.885 1.00 18.95  ? 699  LEU A CD2 1 
ATOM   4860 N N   . THR A 1  622 ? 5.617   -32.507 -45.300 1.00 15.98  ? 700  THR A N   1 
ATOM   4861 C CA  . THR A 1  622 ? 6.375   -33.740 -45.565 1.00 19.24  ? 700  THR A CA  1 
ATOM   4862 C C   . THR A 1  622 ? 7.531   -33.921 -44.569 1.00 18.29  ? 700  THR A C   1 
ATOM   4863 O O   . THR A 1  622 ? 7.781   -35.028 -44.079 1.00 15.03  ? 700  THR A O   1 
ATOM   4864 C CB  . THR A 1  622 ? 6.956   -33.702 -47.014 1.00 25.06  ? 700  THR A CB  1 
ATOM   4865 O OG1 . THR A 1  622 ? 5.872   -33.698 -47.929 1.00 26.93  ? 700  THR A OG1 1 
ATOM   4866 C CG2 . THR A 1  622 ? 7.855   -34.899 -47.304 1.00 36.00  ? 700  THR A CG2 1 
ATOM   4867 N N   . LEU A 1  623 ? 8.250   -32.841 -44.309 1.00 16.07  ? 701  LEU A N   1 
ATOM   4868 C CA  . LEU A 1  623 ? 9.355   -32.874 -43.345 1.00 18.03  ? 701  LEU A CA  1 
ATOM   4869 C C   . LEU A 1  623 ? 8.857   -33.163 -41.930 1.00 16.49  ? 701  LEU A C   1 
ATOM   4870 O O   . LEU A 1  623 ? 9.446   -33.989 -41.213 1.00 18.77  ? 701  LEU A O   1 
ATOM   4871 C CB  . LEU A 1  623 ? 10.152  -31.569 -43.391 1.00 17.58  ? 701  LEU A CB  1 
ATOM   4872 C CG  . LEU A 1  623 ? 11.252  -31.398 -42.338 1.00 20.63  ? 701  LEU A CG  1 
ATOM   4873 C CD1 . LEU A 1  623 ? 12.252  -32.559 -42.314 1.00 20.74  ? 701  LEU A CD1 1 
ATOM   4874 C CD2 . LEU A 1  623 ? 11.931  -30.050 -42.546 1.00 21.35  ? 701  LEU A CD2 1 
ATOM   4875 N N   . ARG A 1  624 ? 7.748   -32.532 -41.549 1.00 16.32  ? 702  ARG A N   1 
ATOM   4876 C CA  . ARG A 1  624 ? 7.100   -32.849 -40.258 1.00 15.54  ? 702  ARG A CA  1 
ATOM   4877 C C   . ARG A 1  624 ? 6.758   -34.347 -40.152 1.00 15.18  ? 702  ARG A C   1 
ATOM   4878 O O   . ARG A 1  624 ? 7.105   -34.986 -39.159 1.00 16.71  ? 702  ARG A O   1 
ATOM   4879 C CB  . ARG A 1  624 ? 5.857   -32.006 -40.016 1.00 15.85  ? 702  ARG A CB  1 
ATOM   4880 C CG  . ARG A 1  624 ? 5.213   -32.245 -38.650 1.00 15.16  ? 702  ARG A CG  1 
ATOM   4881 C CD  . ARG A 1  624 ? 3.835   -31.615 -38.521 1.00 16.15  ? 702  ARG A CD  1 
ATOM   4882 N NE  . ARG A 1  624 ? 3.236   -31.882 -37.204 1.00 17.28  ? 702  ARG A NE  1 
ATOM   4883 C CZ  . ARG A 1  624 ? 3.498   -31.231 -36.063 1.00 15.12  ? 702  ARG A CZ  1 
ATOM   4884 N NH1 . ARG A 1  624 ? 4.366   -30.226 -36.012 1.00 16.85  ? 702  ARG A NH1 1 
ATOM   4885 N NH2 . ARG A 1  624 ? 2.868   -31.591 -34.950 1.00 16.14  ? 702  ARG A NH2 1 
ATOM   4886 N N   . TYR A 1  625 ? 6.107   -34.898 -41.173 1.00 16.41  ? 703  TYR A N   1 
ATOM   4887 C CA  . TYR A 1  625 ? 5.732   -36.308 -41.161 1.00 15.26  ? 703  TYR A CA  1 
ATOM   4888 C C   . TYR A 1  625 ? 6.974   -37.201 -41.112 1.00 17.50  ? 703  TYR A C   1 
ATOM   4889 O O   . TYR A 1  625 ? 6.968   -38.188 -40.382 1.00 16.83  ? 703  TYR A O   1 
ATOM   4890 C CB  . TYR A 1  625 ? 4.759   -36.676 -42.311 1.00 15.37  ? 703  TYR A CB  1 
ATOM   4891 C CG  . TYR A 1  625 ? 3.312   -36.384 -41.965 1.00 16.77  ? 703  TYR A CG  1 
ATOM   4892 C CD1 . TYR A 1  625 ? 2.862   -35.076 -41.778 1.00 17.50  ? 703  TYR A CD1 1 
ATOM   4893 C CD2 . TYR A 1  625 ? 2.394   -37.414 -41.779 1.00 18.12  ? 703  TYR A CD2 1 
ATOM   4894 C CE1 . TYR A 1  625 ? 1.537   -34.817 -41.418 1.00 19.24  ? 703  TYR A CE1 1 
ATOM   4895 C CE2 . TYR A 1  625 ? 1.073   -37.159 -41.438 1.00 15.93  ? 703  TYR A CE2 1 
ATOM   4896 C CZ  . TYR A 1  625 ? 0.648   -35.858 -41.270 1.00 17.53  ? 703  TYR A CZ  1 
ATOM   4897 O OH  . TYR A 1  625 ? -0.658  -35.600 -40.935 1.00 17.14  ? 703  TYR A OH  1 
ATOM   4898 N N   . ALA A 1  626 ? 8.051   -36.841 -41.827 1.00 17.18  ? 704  ALA A N   1 
ATOM   4899 C CA  . ALA A 1  626 ? 9.313   -37.602 -41.728 1.00 16.95  ? 704  ALA A CA  1 
ATOM   4900 C C   . ALA A 1  626 ? 9.864   -37.651 -40.304 1.00 17.53  ? 704  ALA A C   1 
ATOM   4901 O O   . ALA A 1  626 ? 10.391  -38.688 -39.864 1.00 16.51  ? 704  ALA A O   1 
ATOM   4902 C CB  . ALA A 1  626 ? 10.369  -37.052 -42.674 1.00 18.72  ? 704  ALA A CB  1 
ATOM   4903 N N   . LEU A 1  627 ? 9.695   -36.544 -39.590 1.00 15.78  ? 705  LEU A N   1 
ATOM   4904 C CA  . LEU A 1  627 ? 10.215  -36.360 -38.238 1.00 16.51  ? 705  LEU A CA  1 
ATOM   4905 C C   . LEU A 1  627 ? 9.317   -36.919 -37.136 1.00 17.97  ? 705  LEU A C   1 
ATOM   4906 O O   . LEU A 1  627 ? 9.718   -36.891 -35.958 1.00 17.12  ? 705  LEU A O   1 
ATOM   4907 C CB  . LEU A 1  627 ? 10.446  -34.865 -37.984 1.00 17.89  ? 705  LEU A CB  1 
ATOM   4908 C CG  . LEU A 1  627 ? 11.642  -34.216 -38.683 1.00 20.12  ? 705  LEU A CG  1 
ATOM   4909 C CD1 . LEU A 1  627 ? 11.558  -32.703 -38.631 1.00 20.23  ? 705  LEU A CD1 1 
ATOM   4910 C CD2 . LEU A 1  627 ? 12.922  -34.683 -38.010 1.00 20.18  ? 705  LEU A CD2 1 
ATOM   4911 N N   . LEU A 1  628 ? 8.131   -37.444 -37.482 1.00 16.09  ? 706  LEU A N   1 
ATOM   4912 C CA  . LEU A 1  628 ? 7.180   -37.829 -36.448 1.00 16.93  ? 706  LEU A CA  1 
ATOM   4913 C C   . LEU A 1  628 ? 7.679   -38.853 -35.443 1.00 15.95  ? 706  LEU A C   1 
ATOM   4914 O O   . LEU A 1  628 ? 7.342   -38.725 -34.268 1.00 16.09  ? 706  LEU A O   1 
ATOM   4915 C CB  . LEU A 1  628 ? 5.831   -38.261 -37.018 1.00 16.94  ? 706  LEU A CB  1 
ATOM   4916 C CG  . LEU A 1  628 ? 5.004   -37.074 -37.521 1.00 18.22  ? 706  LEU A CG  1 
ATOM   4917 C CD1 . LEU A 1  628 ? 3.687   -37.556 -38.101 1.00 20.20  ? 706  LEU A CD1 1 
ATOM   4918 C CD2 . LEU A 1  628 ? 4.742   -36.037 -36.437 1.00 21.35  ? 706  LEU A CD2 1 
ATOM   4919 N N   . PRO A 1  629 ? 8.481   -39.848 -35.869 1.00 16.81  ? 707  PRO A N   1 
ATOM   4920 C CA  . PRO A 1  629 ? 8.999   -40.760 -34.825 1.00 19.62  ? 707  PRO A CA  1 
ATOM   4921 C C   . PRO A 1  629 ? 9.826   -40.061 -33.730 1.00 17.61  ? 707  PRO A C   1 
ATOM   4922 O O   . PRO A 1  629 ? 9.747   -40.426 -32.559 1.00 16.99  ? 707  PRO A O   1 
ATOM   4923 C CB  . PRO A 1  629 ? 9.882   -41.735 -35.624 1.00 20.48  ? 707  PRO A CB  1 
ATOM   4924 C CG  . PRO A 1  629 ? 9.252   -41.774 -36.963 1.00 20.13  ? 707  PRO A CG  1 
ATOM   4925 C CD  . PRO A 1  629 ? 8.747   -40.375 -37.216 1.00 18.51  ? 707  PRO A CD  1 
ATOM   4926 N N   . HIS A 1  630 ? 10.609  -39.077 -34.151 1.00 17.71  ? 708  HIS A N   1 
ATOM   4927 C CA  . HIS A 1  630 ? 11.399  -38.237 -33.282 1.00 18.13  ? 708  HIS A CA  1 
ATOM   4928 C C   . HIS A 1  630 ? 10.513  -37.364 -32.416 1.00 18.39  ? 708  HIS A C   1 
ATOM   4929 O O   . HIS A 1  630 ? 10.676  -37.369 -31.184 1.00 17.46  ? 708  HIS A O   1 
ATOM   4930 C CB  . HIS A 1  630 ? 12.413  -37.395 -34.106 1.00 18.02  ? 708  HIS A CB  1 
ATOM   4931 C CG  . HIS A 1  630 ? 13.332  -36.578 -33.263 1.00 20.61  ? 708  HIS A CG  1 
ATOM   4932 N ND1 . HIS A 1  630 ? 14.085  -37.120 -32.239 1.00 18.73  ? 708  HIS A ND1 1 
ATOM   4933 C CD2 . HIS A 1  630 ? 13.598  -35.250 -33.265 1.00 19.74  ? 708  HIS A CD2 1 
ATOM   4934 C CE1 . HIS A 1  630 ? 14.792  -36.165 -31.665 1.00 18.31  ? 708  HIS A CE1 1 
ATOM   4935 N NE2 . HIS A 1  630 ? 14.506  -35.019 -32.260 1.00 17.96  ? 708  HIS A NE2 1 
ATOM   4936 N N   . LEU A 1  631 ? 9.568   -36.634 -33.025 1.00 18.22  ? 709  LEU A N   1 
ATOM   4937 C CA  . LEU A 1  631 ? 8.619   -35.822 -32.237 1.00 17.08  ? 709  LEU A CA  1 
ATOM   4938 C C   . LEU A 1  631 ? 7.891   -36.664 -31.191 1.00 16.03  ? 709  LEU A C   1 
ATOM   4939 O O   . LEU A 1  631 ? 7.797   -36.268 -30.017 1.00 16.21  ? 709  LEU A O   1 
ATOM   4940 C CB  . LEU A 1  631 ? 7.588   -35.123 -33.115 1.00 16.50  ? 709  LEU A CB  1 
ATOM   4941 C CG  . LEU A 1  631 ? 6.648   -34.124 -32.420 1.00 18.03  ? 709  LEU A CG  1 
ATOM   4942 C CD1 . LEU A 1  631 ? 7.427   -33.007 -31.726 1.00 18.50  ? 709  LEU A CD1 1 
ATOM   4943 C CD2 . LEU A 1  631 ? 5.648   -33.518 -33.396 1.00 18.26  ? 709  LEU A CD2 1 
ATOM   4944 N N   . TYR A 1  632 ? 7.419   -37.838 -31.600 1.00 16.43  ? 710  TYR A N   1 
ATOM   4945 C CA  . TYR A 1  632 ? 6.760   -38.755 -30.665 1.00 15.55  ? 710  TYR A CA  1 
ATOM   4946 C C   . TYR A 1  632 ? 7.661   -39.157 -29.500 1.00 14.97  ? 710  TYR A C   1 
ATOM   4947 O O   . TYR A 1  632 ? 7.214   -39.216 -28.356 1.00 14.63  ? 710  TYR A O   1 
ATOM   4948 C CB  . TYR A 1  632 ? 6.303   -39.994 -31.384 1.00 15.94  ? 710  TYR A CB  1 
ATOM   4949 C CG  . TYR A 1  632 ? 5.271   -40.824 -30.662 1.00 15.51  ? 710  TYR A CG  1 
ATOM   4950 C CD1 . TYR A 1  632 ? 3.983   -40.330 -30.420 1.00 17.49  ? 710  TYR A CD1 1 
ATOM   4951 C CD2 . TYR A 1  632 ? 5.539   -42.151 -30.315 1.00 17.22  ? 710  TYR A CD2 1 
ATOM   4952 C CE1 . TYR A 1  632 ? 3.012   -41.119 -29.809 1.00 16.74  ? 710  TYR A CE1 1 
ATOM   4953 C CE2 . TYR A 1  632 ? 4.578   -42.946 -29.717 1.00 16.56  ? 710  TYR A CE2 1 
ATOM   4954 C CZ  . TYR A 1  632 ? 3.321   -42.438 -29.472 1.00 17.96  ? 710  TYR A CZ  1 
ATOM   4955 O OH  . TYR A 1  632 ? 2.401   -43.245 -28.864 1.00 16.80  ? 710  TYR A OH  1 
ATOM   4956 N N   . THR A 1  633 ? 8.927   -39.436 -29.798 1.00 16.34  ? 711  THR A N   1 
ATOM   4957 C CA  . THR A 1  633 ? 9.902   -39.769 -28.749 1.00 16.11  ? 711  THR A CA  1 
ATOM   4958 C C   . THR A 1  633 ? 10.159  -38.608 -27.821 1.00 14.72  ? 711  THR A C   1 
ATOM   4959 O O   . THR A 1  633 ? 10.336  -38.801 -26.587 1.00 15.75  ? 711  THR A O   1 
ATOM   4960 C CB  . THR A 1  633 ? 11.212  -40.287 -29.364 1.00 16.52  ? 711  THR A CB  1 
ATOM   4961 O OG1 . THR A 1  633 ? 10.910  -41.423 -30.171 1.00 16.06  ? 711  THR A OG1 1 
ATOM   4962 C CG2 . THR A 1  633 ? 12.229  -40.679 -28.284 1.00 18.03  ? 711  THR A CG2 1 
ATOM   4963 N N   . LEU A 1  634 ? 10.177  -37.393 -28.380 1.00 14.83  ? 712  LEU A N   1 
ATOM   4964 C CA  . LEU A 1  634 ? 10.265  -36.186 -27.530 1.00 15.91  ? 712  LEU A CA  1 
ATOM   4965 C C   . LEU A 1  634 ? 9.060   -36.074 -26.586 1.00 14.52  ? 712  LEU A C   1 
ATOM   4966 O O   . LEU A 1  634 ? 9.222   -35.737 -25.387 1.00 13.14  ? 712  LEU A O   1 
ATOM   4967 C CB  . LEU A 1  634 ? 10.462  -34.894 -28.352 1.00 13.98  ? 712  LEU A CB  1 
ATOM   4968 C CG  . LEU A 1  634 ? 11.746  -34.785 -29.195 1.00 16.36  ? 712  LEU A CG  1 
ATOM   4969 C CD1 . LEU A 1  634 ? 11.804  -33.505 -30.027 1.00 17.86  ? 712  LEU A CD1 1 
ATOM   4970 C CD2 . LEU A 1  634 ? 13.016  -34.912 -28.366 1.00 17.16  ? 712  LEU A CD2 1 
ATOM   4971 N N   . PHE A 1  635 ? 7.864   -36.404 -27.088 1.00 15.63  ? 713  PHE A N   1 
ATOM   4972 C CA  . PHE A 1  635 ? 6.650   -36.418 -26.223 1.00 15.22  ? 713  PHE A CA  1 
ATOM   4973 C C   . PHE A 1  635 ? 6.737   -37.476 -25.137 1.00 15.49  ? 713  PHE A C   1 
ATOM   4974 O O   . PHE A 1  635 ? 6.314   -37.248 -23.999 1.00 17.92  ? 713  PHE A O   1 
ATOM   4975 C CB  . PHE A 1  635 ? 5.344   -36.547 -27.048 1.00 16.88  ? 713  PHE A CB  1 
ATOM   4976 C CG  . PHE A 1  635 ? 4.758   -35.222 -27.455 1.00 17.64  ? 713  PHE A CG  1 
ATOM   4977 C CD1 . PHE A 1  635 ? 4.018   -34.473 -26.542 1.00 16.37  ? 713  PHE A CD1 1 
ATOM   4978 C CD2 . PHE A 1  635 ? 4.976   -34.696 -28.726 1.00 16.51  ? 713  PHE A CD2 1 
ATOM   4979 C CE1 . PHE A 1  635 ? 3.480   -33.244 -26.903 1.00 17.38  ? 713  PHE A CE1 1 
ATOM   4980 C CE2 . PHE A 1  635 ? 4.448   -33.468 -29.089 1.00 18.43  ? 713  PHE A CE2 1 
ATOM   4981 C CZ  . PHE A 1  635 ? 3.693   -32.741 -28.174 1.00 18.11  ? 713  PHE A CZ  1 
ATOM   4982 N N   . HIS A 1  636 ? 7.272   -38.641 -25.481 1.00 16.63  ? 714  HIS A N   1 
ATOM   4983 C CA  . HIS A 1  636 ? 7.525   -39.675 -24.495 1.00 18.08  ? 714  HIS A CA  1 
ATOM   4984 C C   . HIS A 1  636 ? 8.452   -39.157 -23.391 1.00 18.27  ? 714  HIS A C   1 
ATOM   4985 O O   . HIS A 1  636 ? 8.181   -39.376 -22.222 1.00 15.92  ? 714  HIS A O   1 
ATOM   4986 C CB  . HIS A 1  636 ? 8.112   -40.936 -25.148 1.00 16.74  ? 714  HIS A CB  1 
ATOM   4987 C CG  . HIS A 1  636 ? 8.710   -41.899 -24.171 1.00 18.66  ? 714  HIS A CG  1 
ATOM   4988 N ND1 . HIS A 1  636 ? 7.944   -42.687 -23.338 1.00 20.85  ? 714  HIS A ND1 1 
ATOM   4989 C CD2 . HIS A 1  636 ? 10.002  -42.193 -23.883 1.00 20.53  ? 714  HIS A CD2 1 
ATOM   4990 C CE1 . HIS A 1  636 ? 8.737   -43.420 -22.577 1.00 19.25  ? 714  HIS A CE1 1 
ATOM   4991 N NE2 . HIS A 1  636 ? 9.989   -43.145 -22.893 1.00 21.35  ? 714  HIS A NE2 1 
ATOM   4992 N N   . GLN A 1  637 ? 9.520   -38.454 -23.758 1.00 19.23  ? 715  GLN A N   1 
ATOM   4993 C CA  . GLN A 1  637 ? 10.433  -37.900 -22.743 1.00 22.46  ? 715  GLN A CA  1 
ATOM   4994 C C   . GLN A 1  637 ? 9.762   -36.849 -21.865 1.00 19.47  ? 715  GLN A C   1 
ATOM   4995 O O   . GLN A 1  637 ? 10.060  -36.761 -20.675 1.00 20.37  ? 715  GLN A O   1 
ATOM   4996 C CB  . GLN A 1  637 ? 11.722  -37.347 -23.370 1.00 22.71  ? 715  GLN A CB  1 
ATOM   4997 C CG  . GLN A 1  637 ? 12.606  -38.413 -24.042 1.00 28.70  ? 715  GLN A CG  1 
ATOM   4998 C CD  . GLN A 1  637 ? 13.049  -39.524 -23.079 1.00 36.09  ? 715  GLN A CD  1 
ATOM   4999 O OE1 . GLN A 1  637 ? 13.340  -39.275 -21.898 1.00 45.52  ? 715  GLN A OE1 1 
ATOM   5000 N NE2 . GLN A 1  637 ? 13.092  -40.749 -23.578 1.00 68.26  ? 715  GLN A NE2 1 
ATOM   5001 N N   . ALA A 1  638 ? 8.865   -36.056 -22.447 1.00 19.12  ? 716  ALA A N   1 
ATOM   5002 C CA  . ALA A 1  638 ? 8.095   -35.086 -21.682 1.00 21.81  ? 716  ALA A CA  1 
ATOM   5003 C C   . ALA A 1  638 ? 7.228   -35.822 -20.686 1.00 17.44  ? 716  ALA A C   1 
ATOM   5004 O O   . ALA A 1  638 ? 7.196   -35.485 -19.494 1.00 18.15  ? 716  ALA A O   1 
ATOM   5005 C CB  . ALA A 1  638 ? 7.241   -34.225 -22.591 1.00 19.07  ? 716  ALA A CB  1 
ATOM   5006 N N   . HIS A 1  639 ? 6.569   -36.863 -21.175 1.00 16.88  ? 717  HIS A N   1 
ATOM   5007 C CA  . HIS A 1  639 ? 5.624   -37.628 -20.375 1.00 18.27  ? 717  HIS A CA  1 
ATOM   5008 C C   . HIS A 1  639 ? 6.278   -38.407 -19.234 1.00 17.83  ? 717  HIS A C   1 
ATOM   5009 O O   . HIS A 1  639 ? 5.692   -38.511 -18.163 1.00 15.51  ? 717  HIS A O   1 
ATOM   5010 C CB  . HIS A 1  639 ? 4.772   -38.550 -21.275 1.00 18.69  ? 717  HIS A CB  1 
ATOM   5011 C CG  . HIS A 1  639 ? 3.857   -39.455 -20.515 1.00 17.27  ? 717  HIS A CG  1 
ATOM   5012 N ND1 . HIS A 1  639 ? 2.851   -38.985 -19.701 1.00 21.74  ? 717  HIS A ND1 1 
ATOM   5013 C CD2 . HIS A 1  639 ? 3.799   -40.804 -20.442 1.00 16.47  ? 717  HIS A CD2 1 
ATOM   5014 C CE1 . HIS A 1  639 ? 2.208   -40.011 -19.160 1.00 19.33  ? 717  HIS A CE1 1 
ATOM   5015 N NE2 . HIS A 1  639 ? 2.773   -41.125 -19.586 1.00 17.56  ? 717  HIS A NE2 1 
ATOM   5016 N N   . VAL A 1  640 ? 7.485   -38.929 -19.435 1.00 19.15  ? 718  VAL A N   1 
ATOM   5017 C CA  . VAL A 1  640 ? 8.129   -39.773 -18.391 1.00 19.77  ? 718  VAL A CA  1 
ATOM   5018 C C   . VAL A 1  640 ? 9.152   -39.074 -17.545 1.00 19.17  ? 718  VAL A C   1 
ATOM   5019 O O   . VAL A 1  640 ? 9.431   -39.527 -16.453 1.00 21.11  ? 718  VAL A O   1 
ATOM   5020 C CB  . VAL A 1  640 ? 8.750   -41.069 -18.955 1.00 23.16  ? 718  VAL A CB  1 
ATOM   5021 C CG1 . VAL A 1  640 ? 7.718   -41.753 -19.799 1.00 30.44  ? 718  VAL A CG1 1 
ATOM   5022 C CG2 . VAL A 1  640 ? 10.045  -40.815 -19.744 1.00 22.53  ? 718  VAL A CG2 1 
ATOM   5023 N N   . ALA A 1  641 ? 9.669   -37.947 -18.023 1.00 17.79  ? 719  ALA A N   1 
ATOM   5024 C CA  . ALA A 1  641 ? 10.734  -37.257 -17.321 1.00 19.24  ? 719  ALA A CA  1 
ATOM   5025 C C   . ALA A 1  641 ? 10.535  -35.758 -17.199 1.00 19.49  ? 719  ALA A C   1 
ATOM   5026 O O   . ALA A 1  641 ? 11.419  -35.087 -16.695 1.00 17.21  ? 719  ALA A O   1 
ATOM   5027 C CB  . ALA A 1  641 ? 12.074  -37.587 -17.984 1.00 21.25  ? 719  ALA A CB  1 
ATOM   5028 N N   . GLY A 1  642 ? 9.375   -35.226 -17.599 1.00 17.73  ? 720  GLY A N   1 
ATOM   5029 C CA  . GLY A 1  642 ? 9.114   -33.795 -17.438 1.00 18.90  ? 720  GLY A CA  1 
ATOM   5030 C C   . GLY A 1  642 ? 9.957   -32.867 -18.299 1.00 16.82  ? 720  GLY A C   1 
ATOM   5031 O O   . GLY A 1  642 ? 10.144  -31.687 -17.967 1.00 19.75  ? 720  GLY A O   1 
ATOM   5032 N N   . GLU A 1  643 ? 10.453  -33.401 -19.406 1.00 18.57  ? 721  GLU A N   1 
ATOM   5033 C CA  . GLU A 1  643 ? 11.207  -32.632 -20.386 1.00 19.03  ? 721  GLU A CA  1 
ATOM   5034 C C   . GLU A 1  643 ? 10.276  -31.747 -21.198 1.00 20.07  ? 721  GLU A C   1 
ATOM   5035 O O   . GLU A 1  643 ? 9.067   -31.983 -21.253 1.00 17.23  ? 721  GLU A O   1 
ATOM   5036 C CB  . GLU A 1  643 ? 11.930  -33.575 -21.351 1.00 24.34  ? 721  GLU A CB  1 
ATOM   5037 C CG  . GLU A 1  643 ? 13.097  -34.335 -20.755 1.00 26.57  ? 721  GLU A CG  1 
ATOM   5038 C CD  . GLU A 1  643 ? 14.271  -33.435 -20.418 1.00 34.40  ? 721  GLU A CD  1 
ATOM   5039 O OE1 . GLU A 1  643 ? 14.698  -32.573 -21.237 1.00 34.42  ? 721  GLU A OE1 1 
ATOM   5040 O OE2 . GLU A 1  643 ? 14.768  -33.574 -19.297 1.00 46.33  ? 721  GLU A OE2 1 
ATOM   5041 N N   . THR A 1  644 ? 10.867  -30.743 -21.844 1.00 16.82  ? 722  THR A N   1 
ATOM   5042 C CA  . THR A 1  644 ? 10.198  -29.943 -22.847 1.00 16.06  ? 722  THR A CA  1 
ATOM   5043 C C   . THR A 1  644 ? 10.325  -30.593 -24.219 1.00 14.76  ? 722  THR A C   1 
ATOM   5044 O O   . THR A 1  644 ? 11.264  -31.373 -24.483 1.00 16.98  ? 722  THR A O   1 
ATOM   5045 C CB  . THR A 1  644 ? 10.831  -28.540 -22.917 1.00 15.23  ? 722  THR A CB  1 
ATOM   5046 O OG1 . THR A 1  644 ? 12.231  -28.687 -23.158 1.00 16.38  ? 722  THR A OG1 1 
ATOM   5047 C CG2 . THR A 1  644 ? 10.624  -27.801 -21.622 1.00 17.30  ? 722  THR A CG2 1 
ATOM   5048 N N   . VAL A 1  645 ? 9.387   -30.270 -25.101 1.00 15.10  ? 723  VAL A N   1 
ATOM   5049 C CA  . VAL A 1  645 ? 9.411   -30.741 -26.502 1.00 15.03  ? 723  VAL A CA  1 
ATOM   5050 C C   . VAL A 1  645 ? 10.019  -29.663 -27.389 1.00 16.32  ? 723  VAL A C   1 
ATOM   5051 O O   . VAL A 1  645 ? 11.109  -29.853 -27.942 1.00 17.95  ? 723  VAL A O   1 
ATOM   5052 C CB  . VAL A 1  645 ? 8.018   -31.193 -26.959 1.00 16.38  ? 723  VAL A CB  1 
ATOM   5053 C CG1 . VAL A 1  645 ? 7.988   -31.497 -28.475 1.00 17.44  ? 723  VAL A CG1 1 
ATOM   5054 C CG2 . VAL A 1  645 ? 7.627   -32.420 -26.161 1.00 14.09  ? 723  VAL A CG2 1 
ATOM   5055 N N   . ALA A 1  646 ? 9.324   -28.539 -27.537 1.00 16.78  ? 724  ALA A N   1 
ATOM   5056 C CA  . ALA A 1  646 ? 9.934   -27.325 -28.089 1.00 16.05  ? 724  ALA A CA  1 
ATOM   5057 C C   . ALA A 1  646 ? 10.593  -26.562 -26.946 1.00 18.29  ? 724  ALA A C   1 
ATOM   5058 O O   . ALA A 1  646 ? 9.956   -26.326 -25.910 1.00 16.33  ? 724  ALA A O   1 
ATOM   5059 C CB  . ALA A 1  646 ? 8.901   -26.456 -28.766 1.00 17.02  ? 724  ALA A CB  1 
ATOM   5060 N N   . ARG A 1  647 ? 11.854  -26.171 -27.107 1.00 18.08  ? 725  ARG A N   1 
ATOM   5061 C CA  . ARG A 1  647 ? 12.552  -25.468 -26.025 1.00 19.24  ? 725  ARG A CA  1 
ATOM   5062 C C   . ARG A 1  647 ? 13.386  -24.300 -26.484 1.00 18.40  ? 725  ARG A C   1 
ATOM   5063 O O   . ARG A 1  647 ? 13.913  -24.303 -27.602 1.00 17.32  ? 725  ARG A O   1 
ATOM   5064 C CB  . ARG A 1  647 ? 13.372  -26.435 -25.165 1.00 23.53  ? 725  ARG A CB  1 
ATOM   5065 C CG  . ARG A 1  647 ? 14.634  -26.975 -25.781 1.00 18.28  ? 725  ARG A CG  1 
ATOM   5066 C CD  . ARG A 1  647 ? 15.353  -27.967 -24.898 1.00 17.04  ? 725  ARG A CD  1 
ATOM   5067 N NE  . ARG A 1  647 ? 14.551  -29.166 -24.655 1.00 17.86  ? 725  ARG A NE  1 
ATOM   5068 C CZ  . ARG A 1  647 ? 15.017  -30.376 -24.368 1.00 16.85  ? 725  ARG A CZ  1 
ATOM   5069 N NH1 . ARG A 1  647 ? 16.319  -30.632 -24.321 1.00 18.95  ? 725  ARG A NH1 1 
ATOM   5070 N NH2 . ARG A 1  647 ? 14.145  -31.372 -24.160 1.00 18.10  ? 725  ARG A NH2 1 
ATOM   5071 N N   . PRO A 1  648 ? 13.492  -23.267 -25.623 1.00 19.93  ? 726  PRO A N   1 
ATOM   5072 C CA  . PRO A 1  648 ? 14.326  -22.156 -26.018 1.00 18.19  ? 726  PRO A CA  1 
ATOM   5073 C C   . PRO A 1  648 ? 15.776  -22.578 -25.981 1.00 18.17  ? 726  PRO A C   1 
ATOM   5074 O O   . PRO A 1  648 ? 16.131  -23.566 -25.302 1.00 15.36  ? 726  PRO A O   1 
ATOM   5075 C CB  . PRO A 1  648 ? 14.016  -21.081 -24.972 1.00 20.13  ? 726  PRO A CB  1 
ATOM   5076 C CG  . PRO A 1  648 ? 13.597  -21.837 -23.784 1.00 22.28  ? 726  PRO A CG  1 
ATOM   5077 C CD  . PRO A 1  648 ? 12.925  -23.077 -24.274 1.00 19.40  ? 726  PRO A CD  1 
ATOM   5078 N N   . LEU A 1  649 ? 16.602  -21.846 -26.715 1.00 19.34  ? 727  LEU A N   1 
ATOM   5079 C CA  . LEU A 1  649 ? 18.036  -22.113 -26.720 1.00 19.47  ? 727  LEU A CA  1 
ATOM   5080 C C   . LEU A 1  649 ? 18.610  -22.061 -25.308 1.00 17.97  ? 727  LEU A C   1 
ATOM   5081 O O   . LEU A 1  649 ? 19.463  -22.866 -24.983 1.00 17.04  ? 727  LEU A O   1 
ATOM   5082 C CB  . LEU A 1  649 ? 18.801  -21.154 -27.630 1.00 22.83  ? 727  LEU A CB  1 
ATOM   5083 C CG  . LEU A 1  649 ? 18.874  -21.567 -29.105 1.00 25.06  ? 727  LEU A CG  1 
ATOM   5084 C CD1 . LEU A 1  649 ? 17.501  -21.609 -29.762 1.00 26.81  ? 727  LEU A CD1 1 
ATOM   5085 C CD2 . LEU A 1  649 ? 19.778  -20.597 -29.840 1.00 25.19  ? 727  LEU A CD2 1 
ATOM   5086 N N   . PHE A 1  650 ? 18.125  -21.151 -24.466 1.00 18.36  ? 728  PHE A N   1 
ATOM   5087 C CA  . PHE A 1  650 ? 18.694  -21.021 -23.131 1.00 19.95  ? 728  PHE A CA  1 
ATOM   5088 C C   . PHE A 1  650 ? 18.442  -22.247 -22.247 1.00 18.88  ? 728  PHE A C   1 
ATOM   5089 O O   . PHE A 1  650 ? 19.188  -22.477 -21.298 1.00 20.05  ? 728  PHE A O   1 
ATOM   5090 C CB  . PHE A 1  650 ? 18.259  -19.705 -22.442 1.00 21.28  ? 728  PHE A CB  1 
ATOM   5091 C CG  . PHE A 1  650 ? 16.963  -19.801 -21.686 1.00 21.58  ? 728  PHE A CG  1 
ATOM   5092 C CD1 . PHE A 1  650 ? 16.930  -20.317 -20.392 1.00 24.53  ? 728  PHE A CD1 1 
ATOM   5093 C CD2 . PHE A 1  650 ? 15.802  -19.330 -22.234 1.00 22.73  ? 728  PHE A CD2 1 
ATOM   5094 C CE1 . PHE A 1  650 ? 15.737  -20.412 -19.700 1.00 25.33  ? 728  PHE A CE1 1 
ATOM   5095 C CE2 . PHE A 1  650 ? 14.608  -19.410 -21.546 1.00 23.67  ? 728  PHE A CE2 1 
ATOM   5096 C CZ  . PHE A 1  650 ? 14.573  -19.958 -20.284 1.00 20.66  ? 728  PHE A CZ  1 
ATOM   5097 N N   . LEU A 1  651 ? 17.402  -23.033 -22.537 1.00 18.32  ? 729  LEU A N   1 
ATOM   5098 C CA  . LEU A 1  651 ? 17.167  -24.260 -21.765 1.00 19.36  ? 729  LEU A CA  1 
ATOM   5099 C C   . LEU A 1  651 ? 18.224  -25.262 -22.031 1.00 18.60  ? 729  LEU A C   1 
ATOM   5100 O O   . LEU A 1  651 ? 18.582  -26.010 -21.132 1.00 19.76  ? 729  LEU A O   1 
ATOM   5101 C CB  . LEU A 1  651 ? 15.802  -24.918 -22.027 1.00 22.15  ? 729  LEU A CB  1 
ATOM   5102 C CG  . LEU A 1  651 ? 15.031  -25.142 -20.731 1.00 20.73  ? 729  LEU A CG  1 
ATOM   5103 C CD1 . LEU A 1  651 ? 14.656  -23.793 -20.137 1.00 22.84  ? 729  LEU A CD1 1 
ATOM   5104 C CD2 . LEU A 1  651 ? 13.787  -25.975 -20.972 1.00 20.58  ? 729  LEU A CD2 1 
ATOM   5105 N N   . GLU A 1  652 ? 18.711  -25.292 -23.271 1.00 16.41  ? 730  GLU A N   1 
ATOM   5106 C CA  . GLU A 1  652 ? 19.686  -26.283 -23.679 1.00 18.78  ? 730  GLU A CA  1 
ATOM   5107 C C   . GLU A 1  652 ? 21.125  -25.798 -23.520 1.00 17.49  ? 730  GLU A C   1 
ATOM   5108 O O   . GLU A 1  652 ? 22.004  -26.612 -23.305 1.00 20.64  ? 730  GLU A O   1 
ATOM   5109 C CB  . GLU A 1  652 ? 19.386  -26.707 -25.134 1.00 21.59  ? 730  GLU A CB  1 
ATOM   5110 C CG  . GLU A 1  652 ? 20.121  -27.919 -25.642 1.00 21.13  ? 730  GLU A CG  1 
ATOM   5111 C CD  . GLU A 1  652 ? 19.941  -29.178 -24.814 1.00 21.97  ? 730  GLU A CD  1 
ATOM   5112 O OE1 . GLU A 1  652 ? 20.878  -29.995 -24.876 1.00 22.37  ? 730  GLU A OE1 1 
ATOM   5113 O OE2 . GLU A 1  652 ? 18.903  -29.379 -24.134 1.00 18.78  ? 730  GLU A OE2 1 
ATOM   5114 N N   . PHE A 1  653 ? 21.356  -24.485 -23.631 1.00 18.12  ? 731  PHE A N   1 
ATOM   5115 C CA  . PHE A 1  653 ? 22.700  -23.882 -23.496 1.00 17.56  ? 731  PHE A CA  1 
ATOM   5116 C C   . PHE A 1  653 ? 22.679  -22.733 -22.475 1.00 17.64  ? 731  PHE A C   1 
ATOM   5117 O O   . PHE A 1  653 ? 23.020  -21.599 -22.808 1.00 19.06  ? 731  PHE A O   1 
ATOM   5118 C CB  . PHE A 1  653 ? 23.186  -23.360 -24.853 1.00 18.18  ? 731  PHE A CB  1 
ATOM   5119 C CG  . PHE A 1  653 ? 23.249  -24.415 -25.912 1.00 18.14  ? 731  PHE A CG  1 
ATOM   5120 C CD1 . PHE A 1  653 ? 24.400  -25.197 -26.070 1.00 19.05  ? 731  PHE A CD1 1 
ATOM   5121 C CD2 . PHE A 1  653 ? 22.146  -24.663 -26.723 1.00 17.63  ? 731  PHE A CD2 1 
ATOM   5122 C CE1 . PHE A 1  653 ? 24.452  -26.179 -27.054 1.00 19.79  ? 731  PHE A CE1 1 
ATOM   5123 C CE2 . PHE A 1  653 ? 22.185  -25.664 -27.698 1.00 17.89  ? 731  PHE A CE2 1 
ATOM   5124 C CZ  . PHE A 1  653 ? 23.337  -26.421 -27.854 1.00 18.40  ? 731  PHE A CZ  1 
ATOM   5125 N N   . PRO A 1  654 ? 22.257  -23.024 -21.225 1.00 17.90  ? 732  PRO A N   1 
ATOM   5126 C CA  . PRO A 1  654 ? 22.102  -21.986 -20.214 1.00 19.35  ? 732  PRO A CA  1 
ATOM   5127 C C   . PRO A 1  654 ? 23.369  -21.207 -19.881 1.00 20.40  ? 732  PRO A C   1 
ATOM   5128 O O   . PRO A 1  654 ? 23.275  -20.036 -19.505 1.00 21.79  ? 732  PRO A O   1 
ATOM   5129 C CB  . PRO A 1  654 ? 21.607  -22.765 -18.979 1.00 18.56  ? 732  PRO A CB  1 
ATOM   5130 C CG  . PRO A 1  654 ? 22.075  -24.160 -19.191 1.00 18.00  ? 732  PRO A CG  1 
ATOM   5131 C CD  . PRO A 1  654 ? 21.927  -24.358 -20.678 1.00 17.82  ? 732  PRO A CD  1 
ATOM   5132 N N   . LYS A 1  655 ? 24.524  -21.852 -20.004 1.00 22.11  ? 733  LYS A N   1 
ATOM   5133 C CA  . LYS A 1  655 ? 25.814  -21.218 -19.686 1.00 23.55  ? 733  LYS A CA  1 
ATOM   5134 C C   . LYS A 1  655 ? 26.306  -20.263 -20.755 1.00 23.43  ? 733  LYS A C   1 
ATOM   5135 O O   . LYS A 1  655 ? 27.282  -19.563 -20.548 1.00 29.58  ? 733  LYS A O   1 
ATOM   5136 C CB  . LYS A 1  655 ? 26.876  -22.296 -19.416 1.00 25.88  ? 733  LYS A CB  1 
ATOM   5137 C CG  . LYS A 1  655 ? 26.549  -23.149 -18.195 1.00 30.72  ? 733  LYS A CG  1 
ATOM   5138 C CD  . LYS A 1  655 ? 27.640  -24.178 -17.924 1.00 36.30  ? 733  LYS A CD  1 
ATOM   5139 C CE  . LYS A 1  655 ? 27.406  -24.924 -16.622 1.00 44.81  ? 733  LYS A CE  1 
ATOM   5140 N NZ  . LYS A 1  655 ? 28.070  -26.257 -16.633 1.00 50.80  ? 733  LYS A NZ  1 
ATOM   5141 N N   . ASP A 1  656 ? 25.647  -20.229 -21.907 1.00 24.36  ? 734  ASP A N   1 
ATOM   5142 C CA  . ASP A 1  656 ? 25.949  -19.246 -22.933 1.00 23.90  ? 734  ASP A CA  1 
ATOM   5143 C C   . ASP A 1  656 ? 24.937  -18.104 -22.764 1.00 25.79  ? 734  ASP A C   1 
ATOM   5144 O O   . ASP A 1  656 ? 23.791  -18.201 -23.226 1.00 23.34  ? 734  ASP A O   1 
ATOM   5145 C CB  . ASP A 1  656 ? 25.863  -19.899 -24.320 1.00 21.20  ? 734  ASP A CB  1 
ATOM   5146 C CG  . ASP A 1  656 ? 26.226  -18.949 -25.442 1.00 25.00  ? 734  ASP A CG  1 
ATOM   5147 O OD1 . ASP A 1  656 ? 26.244  -17.718 -25.220 1.00 23.12  ? 734  ASP A OD1 1 
ATOM   5148 O OD2 . ASP A 1  656 ? 26.463  -19.425 -26.571 1.00 23.27  ? 734  ASP A OD2 1 
ATOM   5149 N N   . SER A 1  657 ? 25.366  -17.016 -22.127 1.00 21.23  ? 735  SER A N   1 
ATOM   5150 C CA  . SER A 1  657 ? 24.462  -15.917 -21.817 1.00 20.30  ? 735  SER A CA  1 
ATOM   5151 C C   . SER A 1  657 ? 23.875  -15.252 -23.080 1.00 23.35  ? 735  SER A C   1 
ATOM   5152 O O   . SER A 1  657 ? 22.828  -14.627 -22.996 1.00 23.04  ? 735  SER A O   1 
ATOM   5153 C CB  . SER A 1  657 ? 25.121  -14.887 -20.878 1.00 23.47  ? 735  SER A CB  1 
ATOM   5154 O OG  . SER A 1  657 ? 26.159  -14.150 -21.521 1.00 25.33  ? 735  SER A OG  1 
ATOM   5155 N N   . SER A 1  658 ? 24.525  -15.389 -24.244 1.00 23.28  ? 736  SER A N   1 
ATOM   5156 C CA  . SER A 1  658 ? 23.926  -14.906 -25.502 1.00 24.15  ? 736  SER A CA  1 
ATOM   5157 C C   . SER A 1  658 ? 22.590  -15.557 -25.847 1.00 23.03  ? 736  SER A C   1 
ATOM   5158 O O   . SER A 1  658 ? 21.804  -14.968 -26.589 1.00 25.00  ? 736  SER A O   1 
ATOM   5159 C CB  . SER A 1  658 ? 24.873  -15.102 -26.680 1.00 28.31  ? 736  SER A CB  1 
ATOM   5160 O OG  . SER A 1  658 ? 26.066  -14.364 -26.487 1.00 31.89  ? 736  SER A OG  1 
ATOM   5161 N N   . THR A 1  659 ? 22.337  -16.767 -25.336 1.00 18.88  ? 737  THR A N   1 
ATOM   5162 C CA  . THR A 1  659 ? 21.080  -17.443 -25.609 1.00 20.62  ? 737  THR A CA  1 
ATOM   5163 C C   . THR A 1  659 ? 19.925  -16.887 -24.798 1.00 23.04  ? 737  THR A C   1 
ATOM   5164 O O   . THR A 1  659 ? 18.760  -17.128 -25.157 1.00 20.39  ? 737  THR A O   1 
ATOM   5165 C CB  . THR A 1  659 ? 21.150  -18.972 -25.345 1.00 21.47  ? 737  THR A CB  1 
ATOM   5166 O OG1 . THR A 1  659 ? 21.302  -19.222 -23.958 1.00 19.28  ? 737  THR A OG1 1 
ATOM   5167 C CG2 . THR A 1  659 ? 22.289  -19.648 -26.131 1.00 21.68  ? 737  THR A CG2 1 
ATOM   5168 N N   . TRP A 1  660 ? 20.218  -16.149 -23.714 1.00 19.13  ? 738  TRP A N   1 
ATOM   5169 C CA  . TRP A 1  660 ? 19.183  -15.841 -22.733 1.00 19.89  ? 738  TRP A CA  1 
ATOM   5170 C C   . TRP A 1  660 ? 17.996  -15.060 -23.311 1.00 21.64  ? 738  TRP A C   1 
ATOM   5171 O O   . TRP A 1  660 ? 16.851  -15.343 -22.942 1.00 26.70  ? 738  TRP A O   1 
ATOM   5172 C CB  . TRP A 1  660 ? 19.775  -15.114 -21.526 1.00 19.10  ? 738  TRP A CB  1 
ATOM   5173 C CG  . TRP A 1  660 ? 20.593  -15.987 -20.654 1.00 20.08  ? 738  TRP A CG  1 
ATOM   5174 C CD1 . TRP A 1  660 ? 21.045  -17.243 -20.921 1.00 20.15  ? 738  TRP A CD1 1 
ATOM   5175 C CD2 . TRP A 1  660 ? 21.056  -15.666 -19.346 1.00 21.62  ? 738  TRP A CD2 1 
ATOM   5176 N NE1 . TRP A 1  660 ? 21.765  -17.722 -19.861 1.00 23.94  ? 738  TRP A NE1 1 
ATOM   5177 C CE2 . TRP A 1  660 ? 21.787  -16.773 -18.878 1.00 22.12  ? 738  TRP A CE2 1 
ATOM   5178 C CE3 . TRP A 1  660 ? 20.913  -14.551 -18.519 1.00 27.47  ? 738  TRP A CE3 1 
ATOM   5179 C CZ2 . TRP A 1  660 ? 22.383  -16.801 -17.609 1.00 22.14  ? 738  TRP A CZ2 1 
ATOM   5180 C CZ3 . TRP A 1  660 ? 21.499  -14.576 -17.258 1.00 28.63  ? 738  TRP A CZ3 1 
ATOM   5181 C CH2 . TRP A 1  660 ? 22.224  -15.702 -16.817 1.00 24.84  ? 738  TRP A CH2 1 
ATOM   5182 N N   . THR A 1  661 ? 18.250  -14.125 -24.229 1.00 22.98  ? 739  THR A N   1 
ATOM   5183 C CA  . THR A 1  661 ? 17.154  -13.331 -24.845 1.00 28.80  ? 739  THR A CA  1 
ATOM   5184 C C   . THR A 1  661 ? 16.690  -13.812 -26.229 1.00 27.36  ? 739  THR A C   1 
ATOM   5185 O O   . THR A 1  661 ? 15.856  -13.164 -26.856 1.00 33.64  ? 739  THR A O   1 
ATOM   5186 C CB  . THR A 1  661 ? 17.552  -11.860 -24.981 1.00 26.35  ? 739  THR A CB  1 
ATOM   5187 O OG1 . THR A 1  661 ? 18.764  -11.792 -25.735 1.00 30.96  ? 739  THR A OG1 1 
ATOM   5188 C CG2 . THR A 1  661 ? 17.746  -11.240 -23.598 1.00 35.42  ? 739  THR A CG2 1 
ATOM   5189 N N   . VAL A 1  662 ? 17.207  -14.939 -26.703 1.00 31.42  ? 740  VAL A N   1 
ATOM   5190 C CA  . VAL A 1  662 ? 16.776  -15.482 -27.982 1.00 25.43  ? 740  VAL A CA  1 
ATOM   5191 C C   . VAL A 1  662 ? 15.403  -16.127 -27.811 1.00 25.54  ? 740  VAL A C   1 
ATOM   5192 O O   . VAL A 1  662 ? 15.255  -17.093 -27.057 1.00 31.97  ? 740  VAL A O   1 
ATOM   5193 C CB  . VAL A 1  662 ? 17.771  -16.534 -28.517 1.00 26.13  ? 740  VAL A CB  1 
ATOM   5194 C CG1 . VAL A 1  662 ? 17.207  -17.277 -29.739 1.00 24.96  ? 740  VAL A CG1 1 
ATOM   5195 C CG2 . VAL A 1  662 ? 19.096  -15.871 -28.854 1.00 26.75  ? 740  VAL A CG2 1 
ATOM   5196 N N   . ASP A 1  663 ? 14.409  -15.609 -28.537 1.00 25.00  ? 741  ASP A N   1 
ATOM   5197 C CA  . ASP A 1  663 ? 13.135  -16.313 -28.653 1.00 24.42  ? 741  ASP A CA  1 
ATOM   5198 C C   . ASP A 1  663 ? 12.478  -16.286 -30.041 1.00 23.10  ? 741  ASP A C   1 
ATOM   5199 O O   . ASP A 1  663 ? 11.304  -16.590 -30.130 1.00 23.81  ? 741  ASP A O   1 
ATOM   5200 C CB  . ASP A 1  663 ? 12.168  -15.816 -27.580 1.00 30.43  ? 741  ASP A CB  1 
ATOM   5201 C CG  . ASP A 1  663 ? 11.899  -14.339 -27.687 1.00 31.05  ? 741  ASP A CG  1 
ATOM   5202 O OD1 . ASP A 1  663 ? 12.349  -13.706 -28.658 1.00 28.84  ? 741  ASP A OD1 1 
ATOM   5203 O OD2 . ASP A 1  663 ? 11.230  -13.822 -26.802 1.00 26.76  ? 741  ASP A OD2 1 
ATOM   5204 N N   . HIS A 1  664 ? 13.231  -15.968 -31.106 1.00 20.54  ? 742  HIS A N   1 
ATOM   5205 C CA  . HIS A 1  664 ? 12.770  -16.171 -32.477 1.00 21.40  ? 742  HIS A CA  1 
ATOM   5206 C C   . HIS A 1  664 ? 13.414  -17.398 -33.182 1.00 21.22  ? 742  HIS A C   1 
ATOM   5207 O O   . HIS A 1  664 ? 13.238  -17.625 -34.395 1.00 19.79  ? 742  HIS A O   1 
ATOM   5208 C CB  . HIS A 1  664 ? 12.904  -14.858 -33.235 1.00 25.11  ? 742  HIS A CB  1 
ATOM   5209 C CG  . HIS A 1  664 ? 11.921  -13.823 -32.761 1.00 33.62  ? 742  HIS A CG  1 
ATOM   5210 N ND1 . HIS A 1  664 ? 12.123  -12.472 -32.903 1.00 41.00  ? 742  HIS A ND1 1 
ATOM   5211 C CD2 . HIS A 1  664 ? 10.723  -13.958 -32.140 1.00 35.34  ? 742  HIS A CD2 1 
ATOM   5212 C CE1 . HIS A 1  664 ? 11.096  -11.817 -32.394 1.00 41.39  ? 742  HIS A CE1 1 
ATOM   5213 N NE2 . HIS A 1  664 ? 10.234  -12.695 -31.922 1.00 35.31  ? 742  HIS A NE2 1 
ATOM   5214 N N   . GLN A 1  665 ? 14.154  -18.177 -32.400 1.00 16.18  ? 743  GLN A N   1 
ATOM   5215 C CA  . GLN A 1  665 ? 14.530  -19.540 -32.762 1.00 17.33  ? 743  GLN A CA  1 
ATOM   5216 C C   . GLN A 1  665 ? 13.961  -20.494 -31.726 1.00 16.57  ? 743  GLN A C   1 
ATOM   5217 O O   . GLN A 1  665 ? 13.611  -20.088 -30.612 1.00 21.55  ? 743  GLN A O   1 
ATOM   5218 C CB  . GLN A 1  665 ? 16.039  -19.670 -32.800 1.00 16.46  ? 743  GLN A CB  1 
ATOM   5219 C CG  . GLN A 1  665 ? 16.704  -18.918 -33.937 1.00 17.92  ? 743  GLN A CG  1 
ATOM   5220 C CD  . GLN A 1  665 ? 18.178  -18.775 -33.700 1.00 17.42  ? 743  GLN A CD  1 
ATOM   5221 O OE1 . GLN A 1  665 ? 18.614  -17.882 -32.964 1.00 22.44  ? 743  GLN A OE1 1 
ATOM   5222 N NE2 . GLN A 1  665 ? 18.964  -19.672 -34.292 1.00 20.94  ? 743  GLN A NE2 1 
ATOM   5223 N N   . LEU A 1  666 ? 13.853  -21.761 -32.099 1.00 17.75  ? 744  LEU A N   1 
ATOM   5224 C CA  . LEU A 1  666 ? 13.454  -22.790 -31.158 1.00 18.27  ? 744  LEU A CA  1 
ATOM   5225 C C   . LEU A 1  666 ? 14.213  -24.072 -31.420 1.00 16.40  ? 744  LEU A C   1 
ATOM   5226 O O   . LEU A 1  666 ? 14.750  -24.296 -32.524 1.00 15.94  ? 744  LEU A O   1 
ATOM   5227 C CB  . LEU A 1  666 ? 11.948  -23.070 -31.224 1.00 20.17  ? 744  LEU A CB  1 
ATOM   5228 C CG  . LEU A 1  666 ? 11.348  -23.713 -32.480 1.00 22.11  ? 744  LEU A CG  1 
ATOM   5229 C CD1 . LEU A 1  666 ? 10.036  -24.403 -32.115 1.00 24.87  ? 744  LEU A CD1 1 
ATOM   5230 C CD2 . LEU A 1  666 ? 11.155  -22.677 -33.589 1.00 19.31  ? 744  LEU A CD2 1 
ATOM   5231 N N   . LEU A 1  667 ? 14.282  -24.894 -30.384 1.00 15.65  ? 745  LEU A N   1 
ATOM   5232 C CA  . LEU A 1  667 ? 14.779  -26.246 -30.531 1.00 16.06  ? 745  LEU A CA  1 
ATOM   5233 C C   . LEU A 1  667 ? 13.622  -27.217 -30.389 1.00 18.06  ? 745  LEU A C   1 
ATOM   5234 O O   . LEU A 1  667 ? 12.687  -26.972 -29.596 1.00 14.77  ? 745  LEU A O   1 
ATOM   5235 C CB  . LEU A 1  667 ? 15.822  -26.558 -29.475 1.00 19.42  ? 745  LEU A CB  1 
ATOM   5236 C CG  . LEU A 1  667 ? 17.177  -25.857 -29.564 1.00 17.20  ? 745  LEU A CG  1 
ATOM   5237 C CD1 . LEU A 1  667 ? 17.825  -25.790 -28.188 1.00 19.71  ? 745  LEU A CD1 1 
ATOM   5238 C CD2 . LEU A 1  667 ? 18.063  -26.600 -30.524 1.00 19.81  ? 745  LEU A CD2 1 
ATOM   5239 N N   . TRP A 1  668 ? 13.701  -28.308 -31.147 1.00 15.67  ? 746  TRP A N   1 
ATOM   5240 C CA  . TRP A 1  668 ? 13.033  -29.549 -30.785 1.00 15.41  ? 746  TRP A CA  1 
ATOM   5241 C C   . TRP A 1  668 ? 14.053  -30.400 -30.041 1.00 18.07  ? 746  TRP A C   1 
ATOM   5242 O O   . TRP A 1  668 ? 15.096  -30.750 -30.596 1.00 16.95  ? 746  TRP A O   1 
ATOM   5243 C CB  . TRP A 1  668 ? 12.530  -30.295 -32.027 1.00 18.73  ? 746  TRP A CB  1 
ATOM   5244 C CG  . TRP A 1  668 ? 11.162  -29.909 -32.481 1.00 16.28  ? 746  TRP A CG  1 
ATOM   5245 C CD1 . TRP A 1  668 ? 10.446  -28.818 -32.105 1.00 17.64  ? 746  TRP A CD1 1 
ATOM   5246 C CD2 . TRP A 1  668 ? 10.356  -30.616 -33.424 1.00 16.56  ? 746  TRP A CD2 1 
ATOM   5247 N NE1 . TRP A 1  668 ? 9.222   -28.823 -32.727 1.00 17.85  ? 746  TRP A NE1 1 
ATOM   5248 C CE2 . TRP A 1  668 ? 9.146   -29.910 -33.553 1.00 16.59  ? 746  TRP A CE2 1 
ATOM   5249 C CE3 . TRP A 1  668 ? 10.539  -31.792 -34.172 1.00 18.37  ? 746  TRP A CE3 1 
ATOM   5250 C CZ2 . TRP A 1  668 ? 8.110   -30.332 -34.411 1.00 15.01  ? 746  TRP A CZ2 1 
ATOM   5251 C CZ3 . TRP A 1  668 ? 9.518   -32.217 -35.012 1.00 18.72  ? 746  TRP A CZ3 1 
ATOM   5252 C CH2 . TRP A 1  668 ? 8.319   -31.474 -35.132 1.00 15.70  ? 746  TRP A CH2 1 
ATOM   5253 N N   . GLY A 1  669 ? 13.739  -30.735 -28.795 1.00 15.66  ? 747  GLY A N   1 
ATOM   5254 C CA  . GLY A 1  669 ? 14.648  -31.435 -27.910 1.00 18.14  ? 747  GLY A CA  1 
ATOM   5255 C C   . GLY A 1  669 ? 16.008  -30.781 -27.827 1.00 17.60  ? 747  GLY A C   1 
ATOM   5256 O O   . GLY A 1  669 ? 16.127  -29.547 -27.802 1.00 17.25  ? 747  GLY A O   1 
ATOM   5257 N N   . GLU A 1  670 ? 17.037  -31.617 -27.790 1.00 16.87  ? 748  GLU A N   1 
ATOM   5258 C CA  . GLU A 1  670 ? 18.398  -31.153 -27.611 1.00 19.66  ? 748  GLU A CA  1 
ATOM   5259 C C   . GLU A 1  670 ? 19.054  -30.737 -28.913 1.00 19.82  ? 748  GLU A C   1 
ATOM   5260 O O   . GLU A 1  670 ? 20.010  -29.970 -28.888 1.00 21.91  ? 748  GLU A O   1 
ATOM   5261 C CB  . GLU A 1  670 ? 19.236  -32.248 -26.982 1.00 21.16  ? 748  GLU A CB  1 
ATOM   5262 C CG  . GLU A 1  670 ? 18.775  -32.623 -25.582 1.00 26.65  ? 748  GLU A CG  1 
ATOM   5263 C CD  . GLU A 1  670 ? 19.329  -33.964 -25.126 1.00 31.61  ? 748  GLU A CD  1 
ATOM   5264 O OE1 . GLU A 1  670 ? 20.557  -34.114 -25.070 1.00 29.91  ? 748  GLU A OE1 1 
ATOM   5265 O OE2 . GLU A 1  670 ? 18.528  -34.872 -24.873 1.00 49.02  ? 748  GLU A OE2 1 
ATOM   5266 N N   . ALA A 1  671 ? 18.555  -31.251 -30.042 1.00 19.92  ? 749  ALA A N   1 
ATOM   5267 C CA  . ALA A 1  671 ? 19.392  -31.395 -31.243 1.00 19.78  ? 749  ALA A CA  1 
ATOM   5268 C C   . ALA A 1  671 ? 18.938  -30.707 -32.529 1.00 19.78  ? 749  ALA A C   1 
ATOM   5269 O O   . ALA A 1  671 ? 19.751  -30.596 -33.441 1.00 19.35  ? 749  ALA A O   1 
ATOM   5270 C CB  . ALA A 1  671 ? 19.591  -32.872 -31.513 1.00 21.80  ? 749  ALA A CB  1 
ATOM   5271 N N   . LEU A 1  672 ? 17.676  -30.283 -32.633 1.00 17.30  ? 750  LEU A N   1 
ATOM   5272 C CA  . LEU A 1  672 ? 17.164  -29.706 -33.883 1.00 19.31  ? 750  LEU A CA  1 
ATOM   5273 C C   . LEU A 1  672 ? 16.874  -28.224 -33.716 1.00 18.39  ? 750  LEU A C   1 
ATOM   5274 O O   . LEU A 1  672 ? 15.938  -27.849 -33.006 1.00 18.31  ? 750  LEU A O   1 
ATOM   5275 C CB  . LEU A 1  672 ? 15.895  -30.388 -34.349 1.00 19.96  ? 750  LEU A CB  1 
ATOM   5276 C CG  . LEU A 1  672 ? 15.966  -31.661 -35.152 1.00 25.71  ? 750  LEU A CG  1 
ATOM   5277 C CD1 . LEU A 1  672 ? 14.522  -32.124 -35.401 1.00 32.98  ? 750  LEU A CD1 1 
ATOM   5278 C CD2 . LEU A 1  672 ? 16.741  -31.498 -36.465 1.00 21.21  ? 750  LEU A CD2 1 
ATOM   5279 N N   . LEU A 1  673 ? 17.643  -27.390 -34.410 1.00 18.50  ? 751  LEU A N   1 
ATOM   5280 C CA  . LEU A 1  673 ? 17.530  -25.945 -34.291 1.00 15.79  ? 751  LEU A CA  1 
ATOM   5281 C C   . LEU A 1  673 ? 16.777  -25.413 -35.493 1.00 18.39  ? 751  LEU A C   1 
ATOM   5282 O O   . LEU A 1  673 ? 17.180  -25.644 -36.629 1.00 17.78  ? 751  LEU A O   1 
ATOM   5283 C CB  . LEU A 1  673 ? 18.900  -25.315 -34.208 1.00 16.61  ? 751  LEU A CB  1 
ATOM   5284 C CG  . LEU A 1  673 ? 18.952  -23.785 -34.088 1.00 16.62  ? 751  LEU A CG  1 
ATOM   5285 C CD1 . LEU A 1  673 ? 18.287  -23.268 -32.820 1.00 17.53  ? 751  LEU A CD1 1 
ATOM   5286 C CD2 . LEU A 1  673 ? 20.404  -23.361 -34.101 1.00 20.00  ? 751  LEU A CD2 1 
ATOM   5287 N N   . ILE A 1  674 ? 15.686  -24.701 -35.220 1.00 19.49  ? 752  ILE A N   1 
ATOM   5288 C CA  . ILE A 1  674 ? 14.839  -24.107 -36.243 1.00 17.03  ? 752  ILE A CA  1 
ATOM   5289 C C   . ILE A 1  674 ? 14.990  -22.581 -36.177 1.00 16.50  ? 752  ILE A C   1 
ATOM   5290 O O   . ILE A 1  674 ? 14.849  -21.974 -35.127 1.00 16.50  ? 752  ILE A O   1 
ATOM   5291 C CB  . ILE A 1  674 ? 13.375  -24.565 -36.063 1.00 16.46  ? 752  ILE A CB  1 
ATOM   5292 C CG1 . ILE A 1  674 ? 13.304  -26.117 -36.072 1.00 17.25  ? 752  ILE A CG1 1 
ATOM   5293 C CG2 . ILE A 1  674 ? 12.483  -23.979 -37.146 1.00 15.91  ? 752  ILE A CG2 1 
ATOM   5294 C CD1 . ILE A 1  674 ? 12.880  -26.725 -34.746 1.00 16.61  ? 752  ILE A CD1 1 
ATOM   5295 N N   . THR A 1  675 ? 15.307  -21.983 -37.318 1.00 15.23  ? 753  THR A N   1 
ATOM   5296 C CA  . THR A 1  675 ? 15.559  -20.564 -37.428 1.00 16.77  ? 753  THR A CA  1 
ATOM   5297 C C   . THR A 1  675 ? 14.643  -19.991 -38.513 1.00 18.43  ? 753  THR A C   1 
ATOM   5298 O O   . THR A 1  675 ? 15.067  -19.870 -39.663 1.00 19.62  ? 753  THR A O   1 
ATOM   5299 C CB  . THR A 1  675 ? 17.047  -20.334 -37.781 1.00 16.32  ? 753  THR A CB  1 
ATOM   5300 O OG1 . THR A 1  675 ? 17.872  -21.008 -36.820 1.00 18.37  ? 753  THR A OG1 1 
ATOM   5301 C CG2 . THR A 1  675 ? 17.382  -18.875 -37.749 1.00 17.64  ? 753  THR A CG2 1 
ATOM   5302 N N   . PRO A 1  676 ? 13.393  -19.630 -38.156 1.00 17.84  ? 754  PRO A N   1 
ATOM   5303 C CA  . PRO A 1  676 ? 12.399  -19.219 -39.162 1.00 18.60  ? 754  PRO A CA  1 
ATOM   5304 C C   . PRO A 1  676 ? 12.552  -17.802 -39.643 1.00 18.86  ? 754  PRO A C   1 
ATOM   5305 O O   . PRO A 1  676 ? 13.010  -16.937 -38.888 1.00 19.76  ? 754  PRO A O   1 
ATOM   5306 C CB  . PRO A 1  676 ? 11.075  -19.330 -38.402 1.00 17.14  ? 754  PRO A CB  1 
ATOM   5307 C CG  . PRO A 1  676 ? 11.464  -19.040 -36.976 1.00 17.29  ? 754  PRO A CG  1 
ATOM   5308 C CD  . PRO A 1  676 ? 12.803  -19.673 -36.805 1.00 18.00  ? 754  PRO A CD  1 
ATOM   5309 N N   . VAL A 1  677 ? 12.146  -17.561 -40.887 1.00 19.45  ? 755  VAL A N   1 
ATOM   5310 C CA  . VAL A 1  677 ? 11.857  -16.203 -41.342 1.00 18.66  ? 755  VAL A CA  1 
ATOM   5311 C C   . VAL A 1  677 ? 10.486  -15.790 -40.775 1.00 19.76  ? 755  VAL A C   1 
ATOM   5312 O O   . VAL A 1  677 ? 9.493   -16.524 -40.904 1.00 19.57  ? 755  VAL A O   1 
ATOM   5313 C CB  . VAL A 1  677 ? 11.893  -16.105 -42.870 1.00 20.70  ? 755  VAL A CB  1 
ATOM   5314 C CG1 . VAL A 1  677 ? 11.302  -14.779 -43.349 1.00 20.17  ? 755  VAL A CG1 1 
ATOM   5315 C CG2 . VAL A 1  677 ? 13.338  -16.235 -43.342 1.00 20.55  ? 755  VAL A CG2 1 
ATOM   5316 N N   . LEU A 1  678 ? 10.456  -14.619 -40.159 1.00 17.24  ? 756  LEU A N   1 
ATOM   5317 C CA  . LEU A 1  678 ? 9.304   -14.111 -39.434 1.00 18.89  ? 756  LEU A CA  1 
ATOM   5318 C C   . LEU A 1  678 ? 8.933   -12.716 -39.901 1.00 20.82  ? 756  LEU A C   1 
ATOM   5319 O O   . LEU A 1  678 ? 8.219   -12.023 -39.214 1.00 23.30  ? 756  LEU A O   1 
ATOM   5320 C CB  . LEU A 1  678 ? 9.593   -14.106 -37.933 1.00 19.25  ? 756  LEU A CB  1 
ATOM   5321 C CG  . LEU A 1  678 ? 10.027  -15.440 -37.306 1.00 21.31  ? 756  LEU A CG  1 
ATOM   5322 C CD1 . LEU A 1  678 ? 10.428  -15.283 -35.834 1.00 21.32  ? 756  LEU A CD1 1 
ATOM   5323 C CD2 . LEU A 1  678 ? 8.931   -16.485 -37.449 1.00 19.61  ? 756  LEU A CD2 1 
ATOM   5324 N N   . GLN A 1  679 ? 9.397   -12.328 -41.089 1.00 23.83  ? 757  GLN A N   1 
ATOM   5325 C CA  . GLN A 1  679 ? 9.142   -11.006 -41.638 1.00 25.88  ? 757  GLN A CA  1 
ATOM   5326 C C   . GLN A 1  679 ? 8.900   -11.120 -43.122 1.00 22.80  ? 757  GLN A C   1 
ATOM   5327 O O   . GLN A 1  679 ? 9.490   -11.972 -43.798 1.00 24.12  ? 757  GLN A O   1 
ATOM   5328 C CB  . GLN A 1  679 ? 10.339  -10.077 -41.404 1.00 30.92  ? 757  GLN A CB  1 
ATOM   5329 C CG  . GLN A 1  679 ? 10.760  -9.898  -39.956 1.00 29.18  ? 757  GLN A CG  1 
ATOM   5330 C CD  . GLN A 1  679 ? 12.045  -9.097  -39.850 1.00 40.94  ? 757  GLN A CD  1 
ATOM   5331 O OE1 . GLN A 1  679 ? 12.037  -7.880  -39.998 1.00 43.46  ? 757  GLN A OE1 1 
ATOM   5332 N NE2 . GLN A 1  679 ? 13.155  -9.778  -39.599 1.00 40.75  ? 757  GLN A NE2 1 
ATOM   5333 N N   . ALA A 1  680 ? 8.065   -10.232 -43.641 1.00 24.74  ? 758  ALA A N   1 
ATOM   5334 C CA  . ALA A 1  680 ? 7.771   -10.193 -45.071 1.00 22.73  ? 758  ALA A CA  1 
ATOM   5335 C C   . ALA A 1  680 ? 8.996   -9.721  -45.861 1.00 25.19  ? 758  ALA A C   1 
ATOM   5336 O O   . ALA A 1  680 ? 9.755   -8.885  -45.382 1.00 23.30  ? 758  ALA A O   1 
ATOM   5337 C CB  . ALA A 1  680 ? 6.588   -9.256  -45.347 1.00 23.24  ? 758  ALA A CB  1 
ATOM   5338 N N   . GLY A 1  681 ? 9.167   -10.258 -47.064 1.00 24.01  ? 759  GLY A N   1 
ATOM   5339 C CA  . GLY A 1  681 ? 10.163  -9.776  -48.010 1.00 28.47  ? 759  GLY A CA  1 
ATOM   5340 C C   . GLY A 1  681 ? 11.597  -10.201 -47.735 1.00 34.23  ? 759  GLY A C   1 
ATOM   5341 O O   . GLY A 1  681 ? 12.515  -9.722  -48.397 1.00 37.80  ? 759  GLY A O   1 
ATOM   5342 N N   . LYS A 1  682 ? 11.818  -11.099 -46.781 1.00 27.03  ? 760  LYS A N   1 
ATOM   5343 C CA  . LYS A 1  682 ? 13.172  -11.526 -46.484 1.00 26.52  ? 760  LYS A CA  1 
ATOM   5344 C C   . LYS A 1  682 ? 13.505  -12.789 -47.253 1.00 28.09  ? 760  LYS A C   1 
ATOM   5345 O O   . LYS A 1  682 ? 12.662  -13.690 -47.411 1.00 27.29  ? 760  LYS A O   1 
ATOM   5346 C CB  . LYS A 1  682 ? 13.344  -11.764 -44.991 1.00 30.84  ? 760  LYS A CB  1 
ATOM   5347 C CG  . LYS A 1  682 ? 13.096  -10.543 -44.125 1.00 33.94  ? 760  LYS A CG  1 
ATOM   5348 C CD  . LYS A 1  682 ? 14.204  -9.527  -44.278 1.00 39.60  ? 760  LYS A CD  1 
ATOM   5349 C CE  . LYS A 1  682 ? 14.122  -8.473  -43.201 1.00 49.72  ? 760  LYS A CE  1 
ATOM   5350 N NZ  . LYS A 1  682 ? 14.968  -7.315  -43.584 1.00 57.96  ? 760  LYS A NZ  1 
ATOM   5351 N N   . ALA A 1  683 ? 14.737  -12.843 -47.749 1.00 24.81  ? 761  ALA A N   1 
ATOM   5352 C CA  . ALA A 1  683 ? 15.297  -14.043 -48.345 1.00 25.15  ? 761  ALA A CA  1 
ATOM   5353 C C   . ALA A 1  683 ? 16.520  -14.520 -47.538 1.00 23.55  ? 761  ALA A C   1 
ATOM   5354 O O   . ALA A 1  683 ? 17.332  -15.293 -48.031 1.00 24.36  ? 761  ALA A O   1 
ATOM   5355 C CB  . ALA A 1  683 ? 15.681  -13.778 -49.804 1.00 27.10  ? 761  ALA A CB  1 
ATOM   5356 N N   . GLU A 1  684 ? 16.660  -14.025 -46.319 1.00 23.86  ? 762  GLU A N   1 
ATOM   5357 C CA  . GLU A 1  684 ? 17.710  -14.461 -45.410 1.00 25.41  ? 762  GLU A CA  1 
ATOM   5358 C C   . GLU A 1  684 ? 17.232  -14.272 -43.982 1.00 26.21  ? 762  GLU A C   1 
ATOM   5359 O O   . GLU A 1  684 ? 16.256  -13.567 -43.732 1.00 25.26  ? 762  GLU A O   1 
ATOM   5360 C CB  . GLU A 1  684 ? 19.032  -13.696 -45.641 1.00 26.69  ? 762  GLU A CB  1 
ATOM   5361 C CG  . GLU A 1  684 ? 18.991  -12.205 -45.332 1.00 30.53  ? 762  GLU A CG  1 
ATOM   5362 C CD  . GLU A 1  684 ? 20.309  -11.480 -45.608 1.00 36.79  ? 762  GLU A CD  1 
ATOM   5363 O OE1 . GLU A 1  684 ? 20.467  -10.380 -45.056 1.00 44.44  ? 762  GLU A OE1 1 
ATOM   5364 O OE2 . GLU A 1  684 ? 21.178  -12.002 -46.354 1.00 34.49  ? 762  GLU A OE2 1 
ATOM   5365 N N   . VAL A 1  685 ? 17.944  -14.895 -43.053 1.00 21.89  ? 763  VAL A N   1 
ATOM   5366 C CA  . VAL A 1  685 ? 17.649  -14.749 -41.632 1.00 22.63  ? 763  VAL A CA  1 
ATOM   5367 C C   . VAL A 1  685 ? 18.949  -14.863 -40.848 1.00 22.13  ? 763  VAL A C   1 
ATOM   5368 O O   . VAL A 1  685 ? 19.877  -15.572 -41.269 1.00 24.10  ? 763  VAL A O   1 
ATOM   5369 C CB  . VAL A 1  685 ? 16.622  -15.801 -41.176 1.00 20.27  ? 763  VAL A CB  1 
ATOM   5370 C CG1 . VAL A 1  685 ? 17.181  -17.214 -41.292 1.00 20.19  ? 763  VAL A CG1 1 
ATOM   5371 C CG2 . VAL A 1  685 ? 16.123  -15.502 -39.766 1.00 20.03  ? 763  VAL A CG2 1 
ATOM   5372 N N   . THR A 1  686 ? 19.027  -14.145 -39.737 1.00 22.25  ? 764  THR A N   1 
ATOM   5373 C CA  . THR A 1  686 ? 20.176  -14.218 -38.832 1.00 24.14  ? 764  THR A CA  1 
ATOM   5374 C C   . THR A 1  686 ? 19.764  -14.879 -37.513 1.00 23.99  ? 764  THR A C   1 
ATOM   5375 O O   . THR A 1  686 ? 18.812  -14.445 -36.859 1.00 22.49  ? 764  THR A O   1 
ATOM   5376 C CB  . THR A 1  686 ? 20.766  -12.822 -38.617 1.00 26.19  ? 764  THR A CB  1 
ATOM   5377 O OG1 . THR A 1  686 ? 21.241  -12.340 -39.879 1.00 29.04  ? 764  THR A OG1 1 
ATOM   5378 C CG2 . THR A 1  686 ? 21.945  -12.863 -37.616 1.00 26.65  ? 764  THR A CG2 1 
ATOM   5379 N N   . GLY A 1  687 ? 20.458  -15.951 -37.154 1.00 22.95  ? 765  GLY A N   1 
ATOM   5380 C CA  . GLY A 1  687 ? 20.114  -16.748 -35.964 1.00 24.59  ? 765  GLY A CA  1 
ATOM   5381 C C   . GLY A 1  687 ? 21.366  -16.972 -35.143 1.00 23.98  ? 765  GLY A C   1 
ATOM   5382 O O   . GLY A 1  687 ? 22.476  -16.890 -35.667 1.00 21.87  ? 765  GLY A O   1 
ATOM   5383 N N   . TYR A 1  688 ? 21.176  -17.216 -33.850 1.00 22.10  ? 766  TYR A N   1 
ATOM   5384 C CA  . TYR A 1  688 ? 22.264  -17.599 -32.971 1.00 22.12  ? 766  TYR A CA  1 
ATOM   5385 C C   . TYR A 1  688 ? 22.541  -19.101 -33.058 1.00 22.06  ? 766  TYR A C   1 
ATOM   5386 O O   . TYR A 1  688 ? 21.618  -19.912 -32.979 1.00 21.29  ? 766  TYR A O   1 
ATOM   5387 C CB  . TYR A 1  688 ? 21.957  -17.219 -31.523 1.00 21.34  ? 766  TYR A CB  1 
ATOM   5388 C CG  . TYR A 1  688 ? 23.189  -17.320 -30.669 1.00 21.37  ? 766  TYR A CG  1 
ATOM   5389 C CD1 . TYR A 1  688 ? 24.193  -16.359 -30.750 1.00 19.04  ? 766  TYR A CD1 1 
ATOM   5390 C CD2 . TYR A 1  688 ? 23.377  -18.398 -29.823 1.00 19.42  ? 766  TYR A CD2 1 
ATOM   5391 C CE1 . TYR A 1  688 ? 25.344  -16.466 -30.006 1.00 23.82  ? 766  TYR A CE1 1 
ATOM   5392 C CE2 . TYR A 1  688 ? 24.528  -18.513 -29.064 1.00 20.37  ? 766  TYR A CE2 1 
ATOM   5393 C CZ  . TYR A 1  688 ? 25.504  -17.557 -29.147 1.00 23.89  ? 766  TYR A CZ  1 
ATOM   5394 O OH  . TYR A 1  688 ? 26.639  -17.692 -28.377 1.00 22.30  ? 766  TYR A OH  1 
ATOM   5395 N N   . PHE A 1  689 ? 23.819  -19.444 -33.201 1.00 21.09  ? 767  PHE A N   1 
ATOM   5396 C CA  . PHE A 1  689 ? 24.299  -20.829 -33.207 1.00 21.24  ? 767  PHE A CA  1 
ATOM   5397 C C   . PHE A 1  689 ? 25.205  -21.026 -32.012 1.00 24.64  ? 767  PHE A C   1 
ATOM   5398 O O   . PHE A 1  689 ? 26.316  -20.495 -31.990 1.00 21.30  ? 767  PHE A O   1 
ATOM   5399 C CB  . PHE A 1  689 ? 25.020  -21.139 -34.518 1.00 22.48  ? 767  PHE A CB  1 
ATOM   5400 C CG  . PHE A 1  689 ? 24.067  -21.397 -35.642 1.00 22.14  ? 767  PHE A CG  1 
ATOM   5401 C CD1 . PHE A 1  689 ? 23.446  -20.345 -36.287 1.00 23.05  ? 767  PHE A CD1 1 
ATOM   5402 C CD2 . PHE A 1  689 ? 23.713  -22.696 -35.984 1.00 21.81  ? 767  PHE A CD2 1 
ATOM   5403 C CE1 . PHE A 1  689 ? 22.510  -20.574 -37.287 1.00 22.51  ? 767  PHE A CE1 1 
ATOM   5404 C CE2 . PHE A 1  689 ? 22.788  -22.937 -36.987 1.00 23.16  ? 767  PHE A CE2 1 
ATOM   5405 C CZ  . PHE A 1  689 ? 22.186  -21.871 -37.644 1.00 23.07  ? 767  PHE A CZ  1 
ATOM   5406 N N   . PRO A 1  690 ? 24.730  -21.781 -30.996 1.00 23.29  ? 768  PRO A N   1 
ATOM   5407 C CA  . PRO A 1  690 ? 25.596  -22.121 -29.873 1.00 24.79  ? 768  PRO A CA  1 
ATOM   5408 C C   . PRO A 1  690 ? 26.854  -22.874 -30.327 1.00 25.71  ? 768  PRO A C   1 
ATOM   5409 O O   . PRO A 1  690 ? 26.892  -23.427 -31.439 1.00 23.59  ? 768  PRO A O   1 
ATOM   5410 C CB  . PRO A 1  690 ? 24.698  -23.008 -28.997 1.00 24.55  ? 768  PRO A CB  1 
ATOM   5411 C CG  . PRO A 1  690 ? 23.314  -22.572 -29.323 1.00 23.24  ? 768  PRO A CG  1 
ATOM   5412 C CD  . PRO A 1  690 ? 23.373  -22.329 -30.812 1.00 22.22  ? 768  PRO A CD  1 
ATOM   5413 N N   . LEU A 1  691 ? 27.873  -22.870 -29.474 1.00 23.20  ? 769  LEU A N   1 
ATOM   5414 C CA  . LEU A 1  691 ? 29.114  -23.578 -29.736 1.00 29.28  ? 769  LEU A CA  1 
ATOM   5415 C C   . LEU A 1  691 ? 28.835  -25.020 -30.157 1.00 25.99  ? 769  LEU A C   1 
ATOM   5416 O O   . LEU A 1  691 ? 28.082  -25.745 -29.505 1.00 27.23  ? 769  LEU A O   1 
ATOM   5417 C CB  . LEU A 1  691 ? 30.028  -23.566 -28.502 1.00 34.10  ? 769  LEU A CB  1 
ATOM   5418 C CG  . LEU A 1  691 ? 31.316  -24.408 -28.567 1.00 46.20  ? 769  LEU A CG  1 
ATOM   5419 C CD1 . LEU A 1  691 ? 32.383  -23.701 -29.378 1.00 40.50  ? 769  LEU A CD1 1 
ATOM   5420 C CD2 . LEU A 1  691 ? 31.827  -24.724 -27.168 1.00 60.28  ? 769  LEU A CD2 1 
ATOM   5421 N N   . GLY A 1  692 ? 29.448  -25.411 -31.266 1.00 28.25  ? 770  GLY A N   1 
ATOM   5422 C CA  . GLY A 1  692 ? 29.191  -26.712 -31.868 1.00 27.68  ? 770  GLY A CA  1 
ATOM   5423 C C   . GLY A 1  692 ? 29.171  -26.666 -33.375 1.00 23.58  ? 770  GLY A C   1 
ATOM   5424 O O   . GLY A 1  692 ? 29.218  -25.596 -34.006 1.00 23.49  ? 770  GLY A O   1 
ATOM   5425 N N   . THR A 1  693 ? 29.082  -27.859 -33.947 1.00 25.06  ? 771  THR A N   1 
ATOM   5426 C CA  . THR A 1  693 ? 28.867  -28.039 -35.362 1.00 21.14  ? 771  THR A CA  1 
ATOM   5427 C C   . THR A 1  693 ? 27.379  -28.317 -35.562 1.00 20.93  ? 771  THR A C   1 
ATOM   5428 O O   . THR A 1  693 ? 26.793  -29.142 -34.855 1.00 22.16  ? 771  THR A O   1 
ATOM   5429 C CB  . THR A 1  693 ? 29.742  -29.189 -35.899 1.00 23.33  ? 771  THR A CB  1 
ATOM   5430 O OG1 . THR A 1  693 ? 31.106  -28.761 -35.871 1.00 24.20  ? 771  THR A OG1 1 
ATOM   5431 C CG2 . THR A 1  693 ? 29.370  -29.557 -37.327 1.00 25.25  ? 771  THR A CG2 1 
ATOM   5432 N N   . TRP A 1  694 ? 26.776  -27.601 -36.503 1.00 18.70  ? 772  TRP A N   1 
ATOM   5433 C CA  . TRP A 1  694 ? 25.362  -27.712 -36.817 1.00 21.43  ? 772  TRP A CA  1 
ATOM   5434 C C   . TRP A 1  694 ? 25.219  -28.031 -38.287 1.00 21.20  ? 772  TRP A C   1 
ATOM   5435 O O   . TRP A 1  694 ? 25.590  -27.220 -39.129 1.00 20.74  ? 772  TRP A O   1 
ATOM   5436 C CB  . TRP A 1  694 ? 24.680  -26.386 -36.492 1.00 24.04  ? 772  TRP A CB  1 
ATOM   5437 C CG  . TRP A 1  694 ? 24.709  -26.086 -35.025 1.00 21.96  ? 772  TRP A CG  1 
ATOM   5438 C CD1 . TRP A 1  694 ? 25.687  -25.441 -34.339 1.00 24.29  ? 772  TRP A CD1 1 
ATOM   5439 C CD2 . TRP A 1  694 ? 23.702  -26.422 -34.076 1.00 21.95  ? 772  TRP A CD2 1 
ATOM   5440 N NE1 . TRP A 1  694 ? 25.346  -25.350 -33.000 1.00 23.87  ? 772  TRP A NE1 1 
ATOM   5441 C CE2 . TRP A 1  694 ? 24.135  -25.949 -32.815 1.00 21.64  ? 772  TRP A CE2 1 
ATOM   5442 C CE3 . TRP A 1  694 ? 22.469  -27.093 -34.161 1.00 19.02  ? 772  TRP A CE3 1 
ATOM   5443 C CZ2 . TRP A 1  694 ? 23.377  -26.117 -31.648 1.00 21.89  ? 772  TRP A CZ2 1 
ATOM   5444 C CZ3 . TRP A 1  694 ? 21.715  -27.243 -33.001 1.00 18.02  ? 772  TRP A CZ3 1 
ATOM   5445 C CH2 . TRP A 1  694 ? 22.171  -26.763 -31.767 1.00 20.56  ? 772  TRP A CH2 1 
ATOM   5446 N N   . TYR A 1  695 ? 24.684  -29.207 -38.601 1.00 19.18  ? 773  TYR A N   1 
ATOM   5447 C CA  . TYR A 1  695 ? 24.561  -29.649 -39.981 1.00 20.24  ? 773  TYR A CA  1 
ATOM   5448 C C   . TYR A 1  695 ? 23.245  -29.180 -40.568 1.00 21.23  ? 773  TYR A C   1 
ATOM   5449 O O   . TYR A 1  695 ? 22.201  -29.244 -39.919 1.00 21.19  ? 773  TYR A O   1 
ATOM   5450 C CB  . TYR A 1  695 ? 24.614  -31.187 -40.077 1.00 19.77  ? 773  TYR A CB  1 
ATOM   5451 C CG  . TYR A 1  695 ? 25.913  -31.770 -39.615 1.00 19.98  ? 773  TYR A CG  1 
ATOM   5452 C CD1 . TYR A 1  695 ? 27.047  -31.705 -40.423 1.00 23.11  ? 773  TYR A CD1 1 
ATOM   5453 C CD2 . TYR A 1  695 ? 26.021  -32.377 -38.366 1.00 21.24  ? 773  TYR A CD2 1 
ATOM   5454 C CE1 . TYR A 1  695 ? 28.250  -32.238 -40.011 1.00 22.79  ? 773  TYR A CE1 1 
ATOM   5455 C CE2 . TYR A 1  695 ? 27.216  -32.905 -37.938 1.00 23.87  ? 773  TYR A CE2 1 
ATOM   5456 C CZ  . TYR A 1  695 ? 28.327  -32.841 -38.767 1.00 25.32  ? 773  TYR A CZ  1 
ATOM   5457 O OH  . TYR A 1  695 ? 29.518  -33.373 -38.356 1.00 23.41  ? 773  TYR A OH  1 
ATOM   5458 N N   . ASP A 1  696 ? 23.292  -28.752 -41.819 1.00 24.02  ? 774  ASP A N   1 
ATOM   5459 C CA  . ASP A 1  696 ? 22.094  -28.354 -42.521 1.00 26.59  ? 774  ASP A CA  1 
ATOM   5460 C C   . ASP A 1  696 ? 21.271  -29.608 -42.825 1.00 27.87  ? 774  ASP A C   1 
ATOM   5461 O O   . ASP A 1  696 ? 21.746  -30.529 -43.505 1.00 25.71  ? 774  ASP A O   1 
ATOM   5462 C CB  . ASP A 1  696 ? 22.463  -27.609 -43.794 1.00 31.67  ? 774  ASP A CB  1 
ATOM   5463 C CG  . ASP A 1  696 ? 21.304  -26.827 -44.360 1.00 35.49  ? 774  ASP A CG  1 
ATOM   5464 O OD1 . ASP A 1  696 ? 20.185  -27.363 -44.422 1.00 28.38  ? 774  ASP A OD1 1 
ATOM   5465 O OD2 . ASP A 1  696 ? 21.508  -25.652 -44.722 1.00 55.58  ? 774  ASP A OD2 1 
ATOM   5466 N N   . LEU A 1  697 ? 20.045  -29.642 -42.309 1.00 25.95  ? 775  LEU A N   1 
ATOM   5467 C CA  . LEU A 1  697 ? 19.151  -30.800 -42.481 1.00 27.28  ? 775  LEU A CA  1 
ATOM   5468 C C   . LEU A 1  697 ? 18.746  -31.049 -43.933 1.00 25.53  ? 775  LEU A C   1 
ATOM   5469 O O   . LEU A 1  697 ? 18.412  -32.180 -44.291 1.00 27.46  ? 775  LEU A O   1 
ATOM   5470 C CB  . LEU A 1  697 ? 17.907  -30.683 -41.593 1.00 23.87  ? 775  LEU A CB  1 
ATOM   5471 C CG  . LEU A 1  697 ? 17.134  -31.981 -41.323 1.00 24.21  ? 775  LEU A CG  1 
ATOM   5472 C CD1 . LEU A 1  697 ? 17.980  -32.973 -40.539 1.00 24.94  ? 775  LEU A CD1 1 
ATOM   5473 C CD2 . LEU A 1  697 ? 15.821  -31.691 -40.590 1.00 26.06  ? 775  LEU A CD2 1 
ATOM   5474 N N   . GLN A 1  698 ? 18.824  -30.029 -44.779 1.00 28.79  ? 776  GLN A N   1 
ATOM   5475 C CA  . GLN A 1  698 ? 18.607  -30.207 -46.224 1.00 37.16  ? 776  GLN A CA  1 
ATOM   5476 C C   . GLN A 1  698 ? 19.637  -31.115 -46.921 1.00 34.33  ? 776  GLN A C   1 
ATOM   5477 O O   . GLN A 1  698 ? 19.393  -31.536 -48.042 1.00 34.15  ? 776  GLN A O   1 
ATOM   5478 C CB  . GLN A 1  698 ? 18.544  -28.853 -46.942 1.00 41.24  ? 776  GLN A CB  1 
ATOM   5479 C CG  . GLN A 1  698 ? 17.268  -28.112 -46.596 1.00 52.42  ? 776  GLN A CG  1 
ATOM   5480 C CD  . GLN A 1  698 ? 17.207  -26.714 -47.170 1.00 64.31  ? 776  GLN A CD  1 
ATOM   5481 O OE1 . GLN A 1  698 ? 17.533  -26.494 -48.333 1.00 51.59  ? 776  GLN A OE1 1 
ATOM   5482 N NE2 . GLN A 1  698 ? 16.770  -25.758 -46.352 1.00 64.13  ? 776  GLN A NE2 1 
ATOM   5483 N N   . THR A 1  699 ? 20.765  -31.412 -46.270 1.00 30.59  ? 777  THR A N   1 
ATOM   5484 C CA  . THR A 1  699 ? 21.737  -32.391 -46.786 1.00 27.74  ? 777  THR A CA  1 
ATOM   5485 C C   . THR A 1  699 ? 21.370  -33.856 -46.489 1.00 29.41  ? 777  THR A C   1 
ATOM   5486 O O   . THR A 1  699 ? 22.036  -34.759 -46.965 1.00 32.50  ? 777  THR A O   1 
ATOM   5487 C CB  . THR A 1  699 ? 23.143  -32.114 -46.237 1.00 26.20  ? 777  THR A CB  1 
ATOM   5488 O OG1 . THR A 1  699 ? 23.157  -32.326 -44.821 1.00 21.15  ? 777  THR A OG1 1 
ATOM   5489 C CG2 . THR A 1  699 ? 23.578  -30.661 -46.559 1.00 27.51  ? 777  THR A CG2 1 
ATOM   5490 N N   . VAL A 1  700 ? 20.341  -34.089 -45.680 1.00 29.76  ? 778  VAL A N   1 
ATOM   5491 C CA  . VAL A 1  700 ? 19.815  -35.433 -45.448 1.00 34.58  ? 778  VAL A CA  1 
ATOM   5492 C C   . VAL A 1  700 ? 18.778  -35.691 -46.548 1.00 44.87  ? 778  VAL A C   1 
ATOM   5493 O O   . VAL A 1  700 ? 17.763  -34.989 -46.586 1.00 36.35  ? 778  VAL A O   1 
ATOM   5494 C CB  . VAL A 1  700 ? 19.105  -35.547 -44.077 1.00 27.55  ? 778  VAL A CB  1 
ATOM   5495 C CG1 . VAL A 1  700 ? 18.411  -36.906 -43.913 1.00 34.30  ? 778  VAL A CG1 1 
ATOM   5496 C CG2 . VAL A 1  700 ? 20.084  -35.306 -42.937 1.00 32.13  ? 778  VAL A CG2 1 
ATOM   5497 N N   . PRO A 1  701 ? 19.015  -36.686 -47.428 1.00 43.61  ? 779  PRO A N   1 
ATOM   5498 C CA  . PRO A 1  701 ? 17.998  -36.992 -48.452 1.00 61.37  ? 779  PRO A CA  1 
ATOM   5499 C C   . PRO A 1  701 ? 16.705  -37.633 -47.895 1.00 60.09  ? 779  PRO A C   1 
ATOM   5500 O O   . PRO A 1  701 ? 16.686  -38.823 -47.573 1.00 74.68  ? 779  PRO A O   1 
ATOM   5501 C CB  . PRO A 1  701 ? 18.732  -37.916 -49.435 1.00 60.16  ? 779  PRO A CB  1 
ATOM   5502 C CG  . PRO A 1  701 ? 19.919  -38.437 -48.706 1.00 59.84  ? 779  PRO A CG  1 
ATOM   5503 C CD  . PRO A 1  701 ? 20.248  -37.478 -47.603 1.00 48.62  ? 779  PRO A CD  1 
ATOM   5504 N N   . ILE A 1  702 ? 15.660  -36.804 -47.778 1.00 59.31  ? 780  ILE A N   1 
ATOM   5505 C CA  . ILE A 1  702 ? 14.289  -37.193 -47.381 1.00 71.11  ? 780  ILE A CA  1 
ATOM   5506 C C   . ILE A 1  702 ? 13.400  -37.320 -48.634 1.00 75.34  ? 780  ILE A C   1 
ATOM   5507 O O   . ILE A 1  702 ? 13.671  -36.687 -49.663 1.00 68.29  ? 780  ILE A O   1 
ATOM   5508 C CB  . ILE A 1  702 ? 13.714  -36.157 -46.355 1.00 64.20  ? 780  ILE A CB  1 
ATOM   5509 C CG1 . ILE A 1  702 ? 14.298  -36.439 -44.966 1.00 48.90  ? 780  ILE A CG1 1 
ATOM   5510 C CG2 . ILE A 1  702 ? 12.182  -36.152 -46.273 1.00 53.45  ? 780  ILE A CG2 1 
ATOM   5511 C CD1 . ILE A 1  702 ? 14.378  -35.224 -44.080 1.00 47.96  ? 780  ILE A CD1 1 
ATOM   5512 N N   . GLU A 1  703 ? 12.364  -38.160 -48.548 1.00 75.91  ? 781  GLU A N   1 
ATOM   5513 C CA  . GLU A 1  703 ? 11.327  -38.267 -49.587 1.00 77.47  ? 781  GLU A CA  1 
ATOM   5514 C C   . GLU A 1  703 ? 9.936   -38.211 -48.957 1.00 74.26  ? 781  GLU A C   1 
ATOM   5515 O O   . GLU A 1  703 ? 9.017   -37.605 -49.512 1.00 53.58  ? 781  GLU A O   1 
ATOM   5516 C CB  . GLU A 1  703 ? 11.476  -39.563 -50.394 1.00 87.71  ? 781  GLU A CB  1 
ATOM   5517 C CG  . GLU A 1  703 ? 12.601  -39.554 -51.425 1.00 91.69  ? 781  GLU A CG  1 
ATOM   5518 C CD  . GLU A 1  703 ? 13.936  -39.994 -50.853 1.00 89.33  ? 781  GLU A CD  1 
ATOM   5519 O OE1 . GLU A 1  703 ? 14.028  -41.158 -50.401 1.00 72.29  ? 781  GLU A OE1 1 
ATOM   5520 O OE2 . GLU A 1  703 ? 14.889  -39.180 -50.868 1.00 68.75  ? 781  GLU A OE2 1 
ATOM   5521 N N   . PRO A 1  715 ? 24.824  -19.536 -51.565 1.00 95.07  ? 793  PRO A N   1 
ATOM   5522 C CA  . PRO A 1  715 ? 25.784  -20.512 -51.079 1.00 85.05  ? 793  PRO A CA  1 
ATOM   5523 C C   . PRO A 1  715 ? 25.373  -21.045 -49.700 1.00 73.72  ? 793  PRO A C   1 
ATOM   5524 O O   . PRO A 1  715 ? 25.633  -20.406 -48.675 1.00 81.22  ? 793  PRO A O   1 
ATOM   5525 C CB  . PRO A 1  715 ? 27.090  -19.702 -51.018 1.00 83.58  ? 793  PRO A CB  1 
ATOM   5526 C CG  . PRO A 1  715 ? 26.654  -18.282 -50.790 1.00 84.27  ? 793  PRO A CG  1 
ATOM   5527 C CD  . PRO A 1  715 ? 25.187  -18.170 -51.145 1.00 97.28  ? 793  PRO A CD  1 
ATOM   5528 N N   . ARG A 1  716 ? 24.724  -22.206 -49.698 1.00 55.18  ? 794  ARG A N   1 
ATOM   5529 C CA  . ARG A 1  716 ? 24.265  -22.875 -48.474 1.00 55.49  ? 794  ARG A CA  1 
ATOM   5530 C C   . ARG A 1  716 ? 25.360  -23.788 -47.905 1.00 42.67  ? 794  ARG A C   1 
ATOM   5531 O O   . ARG A 1  716 ? 25.796  -24.718 -48.574 1.00 46.60  ? 794  ARG A O   1 
ATOM   5532 C CB  . ARG A 1  716 ? 23.002  -23.689 -48.783 1.00 46.58  ? 794  ARG A CB  1 
ATOM   5533 C CG  . ARG A 1  716 ? 22.440  -24.486 -47.622 1.00 50.22  ? 794  ARG A CG  1 
ATOM   5534 C CD  . ARG A 1  716 ? 20.991  -24.883 -47.870 1.00 58.93  ? 794  ARG A CD  1 
ATOM   5535 N NE  . ARG A 1  716 ? 20.105  -23.724 -47.764 1.00 61.52  ? 794  ARG A NE  1 
ATOM   5536 C CZ  . ARG A 1  716 ? 19.651  -23.191 -46.627 1.00 55.11  ? 794  ARG A CZ  1 
ATOM   5537 N NH1 . ARG A 1  716 ? 19.967  -23.694 -45.436 1.00 51.30  ? 794  ARG A NH1 1 
ATOM   5538 N NH2 . ARG A 1  716 ? 18.864  -22.125 -46.685 1.00 57.56  ? 794  ARG A NH2 1 
ATOM   5539 N N   . GLU A 1  717 ? 25.787  -23.534 -46.671 1.00 34.22  ? 795  GLU A N   1 
ATOM   5540 C CA  . GLU A 1  717 ? 26.841  -24.336 -46.044 1.00 35.10  ? 795  GLU A CA  1 
ATOM   5541 C C   . GLU A 1  717 ? 26.277  -25.675 -45.513 1.00 33.55  ? 795  GLU A C   1 
ATOM   5542 O O   . GLU A 1  717 ? 25.254  -25.683 -44.818 1.00 27.17  ? 795  GLU A O   1 
ATOM   5543 C CB  . GLU A 1  717 ? 27.527  -23.560 -44.907 1.00 43.42  ? 795  GLU A CB  1 
ATOM   5544 C CG  . GLU A 1  717 ? 28.395  -22.384 -45.367 1.00 62.57  ? 795  GLU A CG  1 
ATOM   5545 C CD  . GLU A 1  717 ? 29.632  -22.790 -46.178 1.00 72.88  ? 795  GLU A CD  1 
ATOM   5546 O OE1 . GLU A 1  717 ? 30.135  -23.923 -46.002 1.00 70.78  ? 795  GLU A OE1 1 
ATOM   5547 O OE2 . GLU A 1  717 ? 30.113  -21.968 -46.993 1.00 70.50  ? 795  GLU A OE2 1 
ATOM   5548 N N   . PRO A 1  718 ? 26.937  -26.806 -45.836 1.00 28.63  ? 796  PRO A N   1 
ATOM   5549 C CA  . PRO A 1  718 ? 26.484  -28.096 -45.278 1.00 31.37  ? 796  PRO A CA  1 
ATOM   5550 C C   . PRO A 1  718 ? 26.643  -28.231 -43.746 1.00 29.55  ? 796  PRO A C   1 
ATOM   5551 O O   . PRO A 1  718 ? 25.883  -28.965 -43.129 1.00 24.42  ? 796  PRO A O   1 
ATOM   5552 C CB  . PRO A 1  718 ? 27.349  -29.139 -46.011 1.00 32.69  ? 796  PRO A CB  1 
ATOM   5553 C CG  . PRO A 1  718 ? 28.491  -28.394 -46.602 1.00 33.49  ? 796  PRO A CG  1 
ATOM   5554 C CD  . PRO A 1  718 ? 28.032  -26.979 -46.818 1.00 33.54  ? 796  PRO A CD  1 
ATOM   5555 N N   . ALA A 1  719 ? 27.627  -27.555 -43.163 1.00 26.50  ? 797  ALA A N   1 
ATOM   5556 C CA  . ALA A 1  719 ? 27.840  -27.532 -41.707 1.00 29.76  ? 797  ALA A CA  1 
ATOM   5557 C C   . ALA A 1  719 ? 28.201  -26.123 -41.255 1.00 27.45  ? 797  ALA A C   1 
ATOM   5558 O O   . ALA A 1  719 ? 29.031  -25.468 -41.875 1.00 27.61  ? 797  ALA A O   1 
ATOM   5559 C CB  . ALA A 1  719 ? 28.959  -28.476 -41.315 1.00 28.26  ? 797  ALA A CB  1 
ATOM   5560 N N   . ILE A 1  720 ? 27.570  -25.665 -40.185 1.00 27.44  ? 798  ILE A N   1 
ATOM   5561 C CA  . ILE A 1  720 ? 27.948  -24.412 -39.540 1.00 29.51  ? 798  ILE A CA  1 
ATOM   5562 C C   . ILE A 1  720 ? 28.782  -24.796 -38.350 1.00 26.98  ? 798  ILE A C   1 
ATOM   5563 O O   . ILE A 1  720 ? 28.258  -25.406 -37.421 1.00 25.13  ? 798  ILE A O   1 
ATOM   5564 C CB  . ILE A 1  720 ? 26.712  -23.604 -39.103 1.00 30.69  ? 798  ILE A CB  1 
ATOM   5565 C CG1 . ILE A 1  720 ? 26.018  -23.061 -40.357 1.00 35.14  ? 798  ILE A CG1 1 
ATOM   5566 C CG2 . ILE A 1  720 ? 27.107  -22.451 -38.171 1.00 30.80  ? 798  ILE A CG2 1 
ATOM   5567 C CD1 . ILE A 1  720 ? 24.619  -22.553 -40.098 1.00 42.72  ? 798  ILE A CD1 1 
ATOM   5568 N N   . HIS A 1  721 ? 30.069  -24.445 -38.388 1.00 24.96  ? 799  HIS A N   1 
ATOM   5569 C CA  . HIS A 1  721 ? 31.000  -24.673 -37.268 1.00 28.21  ? 799  HIS A CA  1 
ATOM   5570 C C   . HIS A 1  721 ? 31.038  -23.418 -36.406 1.00 28.89  ? 799  HIS A C   1 
ATOM   5571 O O   . HIS A 1  721 ? 31.722  -22.461 -36.743 1.00 31.29  ? 799  HIS A O   1 
ATOM   5572 C CB  . HIS A 1  721 ? 32.400  -25.008 -37.790 1.00 28.49  ? 799  HIS A CB  1 
ATOM   5573 C CG  . HIS A 1  721 ? 32.427  -26.211 -38.673 1.00 29.30  ? 799  HIS A CG  1 
ATOM   5574 N ND1 . HIS A 1  721 ? 32.068  -27.463 -38.230 1.00 34.85  ? 799  HIS A ND1 1 
ATOM   5575 C CD2 . HIS A 1  721 ? 32.716  -26.345 -39.988 1.00 32.83  ? 799  HIS A CD2 1 
ATOM   5576 C CE1 . HIS A 1  721 ? 32.152  -28.325 -39.229 1.00 31.75  ? 799  HIS A CE1 1 
ATOM   5577 N NE2 . HIS A 1  721 ? 32.543  -27.671 -40.306 1.00 34.82  ? 799  HIS A NE2 1 
ATOM   5578 N N   . SER A 1  722 ? 30.281  -23.416 -35.314 1.00 26.84  ? 800  SER A N   1 
ATOM   5579 C CA  . SER A 1  722 ? 30.092  -22.211 -34.538 1.00 25.04  ? 800  SER A CA  1 
ATOM   5580 C C   . SER A 1  722 ? 30.904  -22.225 -33.261 1.00 31.00  ? 800  SER A C   1 
ATOM   5581 O O   . SER A 1  722 ? 31.046  -23.270 -32.623 1.00 26.87  ? 800  SER A O   1 
ATOM   5582 C CB  . SER A 1  722 ? 28.627  -22.052 -34.170 1.00 27.72  ? 800  SER A CB  1 
ATOM   5583 O OG  . SER A 1  722 ? 28.452  -20.940 -33.318 1.00 23.36  ? 800  SER A OG  1 
ATOM   5584 N N   . GLU A 1  723 ? 31.363  -21.028 -32.886 1.00 32.03  ? 801  GLU A N   1 
ATOM   5585 C CA  . GLU A 1  723 ? 32.013  -20.751 -31.607 1.00 34.98  ? 801  GLU A CA  1 
ATOM   5586 C C   . GLU A 1  723 ? 31.017  -20.226 -30.568 1.00 33.64  ? 801  GLU A C   1 
ATOM   5587 O O   . GLU A 1  723 ? 31.406  -19.916 -29.436 1.00 30.25  ? 801  GLU A O   1 
ATOM   5588 C CB  . GLU A 1  723 ? 33.091  -19.668 -31.796 1.00 42.31  ? 801  GLU A CB  1 
ATOM   5589 C CG  . GLU A 1  723 ? 34.114  -19.925 -32.902 1.00 57.25  ? 801  GLU A CG  1 
ATOM   5590 C CD  . GLU A 1  723 ? 35.399  -20.571 -32.403 1.00 72.57  ? 801  GLU A CD  1 
ATOM   5591 O OE1 . GLU A 1  723 ? 35.326  -21.604 -31.693 1.00 66.74  ? 801  GLU A OE1 1 
ATOM   5592 O OE2 . GLU A 1  723 ? 36.487  -20.043 -32.734 1.00 73.91  ? 801  GLU A OE2 1 
ATOM   5593 N N   . GLY A 1  724 ? 29.745  -20.104 -30.947 1.00 27.82  ? 802  GLY A N   1 
ATOM   5594 C CA  . GLY A 1  724 ? 28.774  -19.350 -30.171 1.00 24.92  ? 802  GLY A CA  1 
ATOM   5595 C C   . GLY A 1  724 ? 28.698  -17.979 -30.817 1.00 26.16  ? 802  GLY A C   1 
ATOM   5596 O O   . GLY A 1  724 ? 29.397  -17.035 -30.421 1.00 25.01  ? 802  GLY A O   1 
ATOM   5597 N N   . GLN A 1  725 ? 27.861  -17.863 -31.835 1.00 23.09  ? 803  GLN A N   1 
ATOM   5598 C CA  . GLN A 1  725 ? 27.849  -16.651 -32.639 1.00 26.42  ? 803  GLN A CA  1 
ATOM   5599 C C   . GLN A 1  725 ? 26.608  -16.564 -33.481 1.00 23.26  ? 803  GLN A C   1 
ATOM   5600 O O   . GLN A 1  725 ? 25.969  -17.569 -33.739 1.00 20.37  ? 803  GLN A O   1 
ATOM   5601 C CB  . GLN A 1  725 ? 29.081  -16.625 -33.558 1.00 26.69  ? 803  GLN A CB  1 
ATOM   5602 C CG  . GLN A 1  725 ? 29.121  -17.780 -34.535 1.00 26.29  ? 803  GLN A CG  1 
ATOM   5603 C CD  . GLN A 1  725 ? 30.497  -18.005 -35.119 1.00 30.10  ? 803  GLN A CD  1 
ATOM   5604 O OE1 . GLN A 1  725 ? 31.275  -18.839 -34.639 1.00 31.68  ? 803  GLN A OE1 1 
ATOM   5605 N NE2 . GLN A 1  725 ? 30.810  -17.255 -36.150 1.00 32.16  ? 803  GLN A NE2 1 
ATOM   5606 N N   . TRP A 1  726 ? 26.317  -15.351 -33.928 1.00 22.39  ? 804  TRP A N   1 
ATOM   5607 C CA  . TRP A 1  726 ? 25.227  -15.068 -34.844 1.00 25.15  ? 804  TRP A CA  1 
ATOM   5608 C C   . TRP A 1  726 ? 25.692  -15.363 -36.259 1.00 27.05  ? 804  TRP A C   1 
ATOM   5609 O O   . TRP A 1  726 ? 26.848  -15.106 -36.595 1.00 26.20  ? 804  TRP A O   1 
ATOM   5610 C CB  . TRP A 1  726 ? 24.790  -13.605 -34.714 1.00 25.19  ? 804  TRP A CB  1 
ATOM   5611 C CG  . TRP A 1  726 ? 24.148  -13.353 -33.407 1.00 25.61  ? 804  TRP A CG  1 
ATOM   5612 C CD1 . TRP A 1  726 ? 24.764  -12.950 -32.261 1.00 26.50  ? 804  TRP A CD1 1 
ATOM   5613 C CD2 . TRP A 1  726 ? 22.761  -13.533 -33.083 1.00 24.99  ? 804  TRP A CD2 1 
ATOM   5614 N NE1 . TRP A 1  726 ? 23.846  -12.869 -31.244 1.00 30.69  ? 804  TRP A NE1 1 
ATOM   5615 C CE2 . TRP A 1  726 ? 22.607  -13.209 -31.724 1.00 27.32  ? 804  TRP A CE2 1 
ATOM   5616 C CE3 . TRP A 1  726 ? 21.637  -13.922 -33.815 1.00 25.14  ? 804  TRP A CE3 1 
ATOM   5617 C CZ2 . TRP A 1  726 ? 21.368  -13.260 -31.078 1.00 29.94  ? 804  TRP A CZ2 1 
ATOM   5618 C CZ3 . TRP A 1  726 ? 20.411  -13.998 -33.175 1.00 29.41  ? 804  TRP A CZ3 1 
ATOM   5619 C CH2 . TRP A 1  726 ? 20.282  -13.657 -31.821 1.00 27.96  ? 804  TRP A CH2 1 
ATOM   5620 N N   . VAL A 1  727 ? 24.796  -15.949 -37.057 1.00 24.01  ? 805  VAL A N   1 
ATOM   5621 C CA  . VAL A 1  727 ? 25.094  -16.385 -38.407 1.00 22.61  ? 805  VAL A CA  1 
ATOM   5622 C C   . VAL A 1  727 ? 23.909  -16.042 -39.283 1.00 27.90  ? 805  VAL A C   1 
ATOM   5623 O O   . VAL A 1  727 ? 22.754  -16.339 -38.933 1.00 26.85  ? 805  VAL A O   1 
ATOM   5624 C CB  . VAL A 1  727 ? 25.329  -17.920 -38.504 1.00 26.44  ? 805  VAL A CB  1 
ATOM   5625 C CG1 . VAL A 1  727 ? 25.676  -18.330 -39.944 1.00 27.09  ? 805  VAL A CG1 1 
ATOM   5626 C CG2 . VAL A 1  727 ? 26.438  -18.363 -37.544 1.00 24.82  ? 805  VAL A CG2 1 
ATOM   5627 N N   . THR A 1  728 ? 24.209  -15.425 -40.423 1.00 24.69  ? 806  THR A N   1 
ATOM   5628 C CA  . THR A 1  728 ? 23.211  -15.071 -41.418 1.00 26.63  ? 806  THR A CA  1 
ATOM   5629 C C   . THR A 1  728 ? 23.134  -16.208 -42.398 1.00 25.33  ? 806  THR A C   1 
ATOM   5630 O O   . THR A 1  728 ? 24.161  -16.668 -42.913 1.00 26.52  ? 806  THR A O   1 
ATOM   5631 C CB  . THR A 1  728 ? 23.567  -13.751 -42.117 1.00 29.47  ? 806  THR A CB  1 
ATOM   5632 O OG1 . THR A 1  728 ? 23.485  -12.717 -41.144 1.00 27.00  ? 806  THR A OG1 1 
ATOM   5633 C CG2 . THR A 1  728 ? 22.609  -13.427 -43.241 1.00 28.02  ? 806  THR A CG2 1 
ATOM   5634 N N   . LEU A 1  729 ? 21.909  -16.688 -42.614 1.00 24.70  ? 807  LEU A N   1 
ATOM   5635 C CA  . LEU A 1  729 ? 21.640  -17.865 -43.428 1.00 25.23  ? 807  LEU A CA  1 
ATOM   5636 C C   . LEU A 1  729 ? 20.787  -17.462 -44.614 1.00 26.01  ? 807  LEU A C   1 
ATOM   5637 O O   . LEU A 1  729 ? 19.891  -16.635 -44.448 1.00 25.47  ? 807  LEU A O   1 
ATOM   5638 C CB  . LEU A 1  729 ? 20.858  -18.877 -42.617 1.00 27.21  ? 807  LEU A CB  1 
ATOM   5639 C CG  . LEU A 1  729 ? 21.500  -19.303 -41.292 1.00 28.90  ? 807  LEU A CG  1 
ATOM   5640 C CD1 . LEU A 1  729 ? 20.443  -19.857 -40.364 1.00 26.94  ? 807  LEU A CD1 1 
ATOM   5641 C CD2 . LEU A 1  729 ? 22.606  -20.314 -41.567 1.00 33.32  ? 807  LEU A CD2 1 
ATOM   5642 N N   . PRO A 1  730 ? 21.026  -18.071 -45.795 1.00 27.26  ? 808  PRO A N   1 
ATOM   5643 C CA  . PRO A 1  730 ? 20.064  -17.891 -46.880 1.00 27.91  ? 808  PRO A CA  1 
ATOM   5644 C C   . PRO A 1  730 ? 18.730  -18.538 -46.508 1.00 26.76  ? 808  PRO A C   1 
ATOM   5645 O O   . PRO A 1  730 ? 18.703  -19.615 -45.935 1.00 22.67  ? 808  PRO A O   1 
ATOM   5646 C CB  . PRO A 1  730 ? 20.709  -18.604 -48.082 1.00 30.67  ? 808  PRO A CB  1 
ATOM   5647 C CG  . PRO A 1  730 ? 21.890  -19.331 -47.574 1.00 32.82  ? 808  PRO A CG  1 
ATOM   5648 C CD  . PRO A 1  730 ? 22.024  -19.115 -46.096 1.00 31.24  ? 808  PRO A CD  1 
ATOM   5649 N N   . ALA A 1  731 ? 17.642  -17.863 -46.840 1.00 26.37  ? 809  ALA A N   1 
ATOM   5650 C CA  . ALA A 1  731 ? 16.311  -18.309 -46.481 1.00 26.83  ? 809  ALA A CA  1 
ATOM   5651 C C   . ALA A 1  731 ? 15.314  -17.754 -47.474 1.00 28.03  ? 809  ALA A C   1 
ATOM   5652 O O   . ALA A 1  731 ? 14.472  -16.913 -47.116 1.00 29.48  ? 809  ALA A O   1 
ATOM   5653 C CB  . ALA A 1  731 ? 15.968  -17.856 -45.076 1.00 23.21  ? 809  ALA A CB  1 
ATOM   5654 N N   . PRO A 1  732 ? 15.403  -18.212 -48.731 1.00 29.91  ? 810  PRO A N   1 
ATOM   5655 C CA  . PRO A 1  732 ? 14.387  -17.786 -49.691 1.00 32.41  ? 810  PRO A CA  1 
ATOM   5656 C C   . PRO A 1  732 ? 13.017  -18.381 -49.339 1.00 30.52  ? 810  PRO A C   1 
ATOM   5657 O O   . PRO A 1  732 ? 12.913  -19.202 -48.404 1.00 24.73  ? 810  PRO A O   1 
ATOM   5658 C CB  . PRO A 1  732 ? 14.929  -18.302 -51.029 1.00 33.00  ? 810  PRO A CB  1 
ATOM   5659 C CG  . PRO A 1  732 ? 15.739  -19.497 -50.659 1.00 35.92  ? 810  PRO A CG  1 
ATOM   5660 C CD  . PRO A 1  732 ? 16.375  -19.142 -49.339 1.00 34.18  ? 810  PRO A CD  1 
ATOM   5661 N N   . LEU A 1  733 ? 11.992  -17.965 -50.087 1.00 28.24  ? 811  LEU A N   1 
ATOM   5662 C CA  . LEU A 1  733 ? 10.601  -18.254 -49.767 1.00 29.72  ? 811  LEU A CA  1 
ATOM   5663 C C   . LEU A 1  733 ? 10.324  -19.749 -49.600 1.00 25.63  ? 811  LEU A C   1 
ATOM   5664 O O   . LEU A 1  733 ? 9.525   -20.117 -48.750 1.00 24.04  ? 811  LEU A O   1 
ATOM   5665 C CB  . LEU A 1  733 ? 9.619   -17.635 -50.791 1.00 31.82  ? 811  LEU A CB  1 
ATOM   5666 C CG  . LEU A 1  733 ? 8.123   -17.701 -50.421 1.00 34.94  ? 811  LEU A CG  1 
ATOM   5667 C CD1 . LEU A 1  733 ? 7.850   -17.163 -49.026 1.00 33.45  ? 811  LEU A CD1 1 
ATOM   5668 C CD2 . LEU A 1  733 ? 7.278   -16.936 -51.434 1.00 44.91  ? 811  LEU A CD2 1 
ATOM   5669 N N   . ASP A 1  734 ? 11.011  -20.593 -50.361 1.00 24.78  ? 812  ASP A N   1 
ATOM   5670 C CA  . ASP A 1  734 ? 10.814  -22.055 -50.279 1.00 26.91  ? 812  ASP A CA  1 
ATOM   5671 C C   . ASP A 1  734 ? 11.518  -22.755 -49.091 1.00 26.56  ? 812  ASP A C   1 
ATOM   5672 O O   . ASP A 1  734 ? 11.358  -23.957 -48.909 1.00 28.42  ? 812  ASP A O   1 
ATOM   5673 C CB  . ASP A 1  734 ? 11.155  -22.746 -51.623 1.00 33.73  ? 812  ASP A CB  1 
ATOM   5674 C CG  . ASP A 1  734 ? 12.619  -22.605 -52.045 1.00 36.96  ? 812  ASP A CG  1 
ATOM   5675 O OD1 . ASP A 1  734 ? 13.428  -21.921 -51.394 1.00 39.01  ? 812  ASP A OD1 1 
ATOM   5676 O OD2 . ASP A 1  734 ? 12.962  -23.193 -53.079 1.00 59.89  ? 812  ASP A OD2 1 
ATOM   5677 N N   . THR A 1  735 ? 12.227  -21.989 -48.258 1.00 25.58  ? 813  THR A N   1 
ATOM   5678 C CA  . THR A 1  735 ? 13.149  -22.530 -47.275 1.00 28.12  ? 813  THR A CA  1 
ATOM   5679 C C   . THR A 1  735 ? 12.826  -22.106 -45.853 1.00 24.44  ? 813  THR A C   1 
ATOM   5680 O O   . THR A 1  735 ? 12.526  -20.936 -45.584 1.00 25.34  ? 813  THR A O   1 
ATOM   5681 C CB  . THR A 1  735 ? 14.581  -22.029 -47.593 1.00 28.90  ? 813  THR A CB  1 
ATOM   5682 O OG1 . THR A 1  735 ? 14.912  -22.413 -48.923 1.00 39.57  ? 813  THR A OG1 1 
ATOM   5683 C CG2 . THR A 1  735 ? 15.629  -22.598 -46.625 1.00 30.80  ? 813  THR A CG2 1 
ATOM   5684 N N   . ILE A 1  736 ? 12.926  -23.066 -44.940 1.00 21.89  ? 814  ILE A N   1 
ATOM   5685 C CA  . ILE A 1  736 ? 13.137  -22.762 -43.537 1.00 20.82  ? 814  ILE A CA  1 
ATOM   5686 C C   . ILE A 1  736 ? 14.426  -23.447 -43.118 1.00 20.85  ? 814  ILE A C   1 
ATOM   5687 O O   . ILE A 1  736 ? 14.651  -24.629 -43.431 1.00 22.54  ? 814  ILE A O   1 
ATOM   5688 C CB  . ILE A 1  736 ? 11.941  -23.138 -42.625 1.00 21.94  ? 814  ILE A CB  1 
ATOM   5689 C CG1 . ILE A 1  736 ? 12.281  -22.828 -41.155 1.00 19.54  ? 814  ILE A CG1 1 
ATOM   5690 C CG2 . ILE A 1  736 ? 11.544  -24.610 -42.780 1.00 22.22  ? 814  ILE A CG2 1 
ATOM   5691 C CD1 . ILE A 1  736 ? 11.062  -22.659 -40.257 1.00 20.86  ? 814  ILE A CD1 1 
ATOM   5692 N N   . ASN A 1  737 ? 15.280  -22.706 -42.423 1.00 18.53  ? 815  ASN A N   1 
ATOM   5693 C CA  . ASN A 1  737 ? 16.527  -23.265 -41.903 1.00 17.90  ? 815  ASN A CA  1 
ATOM   5694 C C   . ASN A 1  737 ? 16.321  -24.185 -40.736 1.00 19.37  ? 815  ASN A C   1 
ATOM   5695 O O   . ASN A 1  737 ? 15.723  -23.806 -39.702 1.00 17.92  ? 815  ASN A O   1 
ATOM   5696 C CB  . ASN A 1  737 ? 17.508  -22.170 -41.528 1.00 19.94  ? 815  ASN A CB  1 
ATOM   5697 C CG  . ASN A 1  737 ? 18.181  -21.595 -42.742 1.00 21.72  ? 815  ASN A CG  1 
ATOM   5698 O OD1 . ASN A 1  737 ? 19.218  -22.103 -43.149 1.00 22.13  ? 815  ASN A OD1 1 
ATOM   5699 N ND2 . ASN A 1  737 ? 17.565  -20.574 -43.367 1.00 21.92  ? 815  ASN A ND2 1 
ATOM   5700 N N   . VAL A 1  738 ? 16.801  -25.411 -40.900 1.00 17.83  ? 816  VAL A N   1 
ATOM   5701 C CA  . VAL A 1  738 ? 16.716  -26.407 -39.842 1.00 19.18  ? 816  VAL A CA  1 
ATOM   5702 C C   . VAL A 1  738 ? 18.078  -27.054 -39.767 1.00 19.02  ? 816  VAL A C   1 
ATOM   5703 O O   . VAL A 1  738 ? 18.536  -27.577 -40.765 1.00 19.57  ? 816  VAL A O   1 
ATOM   5704 C CB  . VAL A 1  738 ? 15.644  -27.489 -40.119 1.00 20.99  ? 816  VAL A CB  1 
ATOM   5705 C CG1 . VAL A 1  738 ? 15.545  -28.448 -38.924 1.00 24.43  ? 816  VAL A CG1 1 
ATOM   5706 C CG2 . VAL A 1  738 ? 14.286  -26.850 -40.389 1.00 21.66  ? 816  VAL A CG2 1 
ATOM   5707 N N   . HIS A 1  739 ? 18.699  -27.028 -38.587 1.00 18.03  ? 817  HIS A N   1 
ATOM   5708 C CA  . HIS A 1  739 ? 20.019  -27.626 -38.376 1.00 19.43  ? 817  HIS A CA  1 
ATOM   5709 C C   . HIS A 1  739 ? 20.036  -28.696 -37.304 1.00 18.38  ? 817  HIS A C   1 
ATOM   5710 O O   . HIS A 1  739 ? 19.330  -28.596 -36.282 1.00 19.31  ? 817  HIS A O   1 
ATOM   5711 C CB  . HIS A 1  739 ? 21.058  -26.551 -38.051 1.00 20.23  ? 817  HIS A CB  1 
ATOM   5712 C CG  . HIS A 1  739 ? 21.344  -25.657 -39.205 1.00 23.44  ? 817  HIS A CG  1 
ATOM   5713 N ND1 . HIS A 1  739 ? 20.492  -24.646 -39.584 1.00 21.89  ? 817  HIS A ND1 1 
ATOM   5714 C CD2 . HIS A 1  739 ? 22.344  -25.679 -40.123 1.00 24.89  ? 817  HIS A CD2 1 
ATOM   5715 C CE1 . HIS A 1  739 ? 20.966  -24.065 -40.673 1.00 24.95  ? 817  HIS A CE1 1 
ATOM   5716 N NE2 . HIS A 1  739 ? 22.090  -24.673 -41.018 1.00 20.70  ? 817  HIS A NE2 1 
ATOM   5717 N N   . LEU A 1  740 ? 20.866  -29.710 -37.539 1.00 17.34  ? 818  LEU A N   1 
ATOM   5718 C CA  . LEU A 1  740 ? 20.984  -30.848 -36.657 1.00 18.90  ? 818  LEU A CA  1 
ATOM   5719 C C   . LEU A 1  740 ? 22.331  -30.779 -35.918 1.00 19.94  ? 818  LEU A C   1 
ATOM   5720 O O   . LEU A 1  740 ? 23.398  -30.742 -36.531 1.00 19.29  ? 818  LEU A O   1 
ATOM   5721 C CB  . LEU A 1  740 ? 20.844  -32.162 -37.443 1.00 18.82  ? 818  LEU A CB  1 
ATOM   5722 C CG  . LEU A 1  740 ? 20.994  -33.447 -36.620 1.00 20.89  ? 818  LEU A CG  1 
ATOM   5723 C CD1 . LEU A 1  740 ? 20.031  -33.433 -35.439 1.00 23.55  ? 818  LEU A CD1 1 
ATOM   5724 C CD2 . LEU A 1  740 ? 20.779  -34.690 -37.480 1.00 21.17  ? 818  LEU A CD2 1 
ATOM   5725 N N   . ARG A 1  741 ? 22.251  -30.761 -34.594 1.00 18.65  ? 819  ARG A N   1 
ATOM   5726 C CA  . ARG A 1  741 ? 23.412  -30.683 -33.704 1.00 19.06  ? 819  ARG A CA  1 
ATOM   5727 C C   . ARG A 1  741 ? 24.315  -31.932 -33.795 1.00 23.54  ? 819  ARG A C   1 
ATOM   5728 O O   . ARG A 1  741 ? 23.844  -33.050 -33.631 1.00 20.07  ? 819  ARG A O   1 
ATOM   5729 C CB  . ARG A 1  741 ? 22.902  -30.552 -32.278 1.00 18.12  ? 819  ARG A CB  1 
ATOM   5730 C CG  . ARG A 1  741 ? 23.943  -30.261 -31.212 1.00 21.12  ? 819  ARG A CG  1 
ATOM   5731 C CD  . ARG A 1  741 ? 23.202  -30.048 -29.895 1.00 21.41  ? 819  ARG A CD  1 
ATOM   5732 N NE  . ARG A 1  741 ? 24.112  -29.886 -28.771 1.00 18.37  ? 819  ARG A NE  1 
ATOM   5733 C CZ  . ARG A 1  741 ? 23.751  -29.810 -27.493 1.00 18.79  ? 819  ARG A CZ  1 
ATOM   5734 N NH1 . ARG A 1  741 ? 22.473  -29.849 -27.117 1.00 22.17  ? 819  ARG A NH1 1 
ATOM   5735 N NH2 . ARG A 1  741 ? 24.688  -29.685 -26.570 1.00 22.39  ? 819  ARG A NH2 1 
ATOM   5736 N N   . ALA A 1  742 ? 25.611  -31.720 -34.025 1.00 21.55  ? 820  ALA A N   1 
ATOM   5737 C CA  . ALA A 1  742 ? 26.596  -32.807 -34.017 1.00 23.75  ? 820  ALA A CA  1 
ATOM   5738 C C   . ALA A 1  742 ? 26.597  -33.530 -32.663 1.00 22.09  ? 820  ALA A C   1 
ATOM   5739 O O   . ALA A 1  742 ? 26.510  -32.899 -31.610 1.00 18.81  ? 820  ALA A O   1 
ATOM   5740 C CB  . ALA A 1  742 ? 27.988  -32.265 -34.341 1.00 24.33  ? 820  ALA A CB  1 
ATOM   5741 N N   . GLY A 1  743 ? 26.665  -34.855 -32.710 1.00 20.85  ? 821  GLY A N   1 
ATOM   5742 C CA  . GLY A 1  743 ? 26.561  -35.696 -31.530 1.00 21.92  ? 821  GLY A CA  1 
ATOM   5743 C C   . GLY A 1  743 ? 25.205  -36.356 -31.368 1.00 20.09  ? 821  GLY A C   1 
ATOM   5744 O O   . GLY A 1  743 ? 25.022  -37.086 -30.417 1.00 18.84  ? 821  GLY A O   1 
ATOM   5745 N N   . TYR A 1  744 ? 24.266  -36.133 -32.298 1.00 19.15  ? 822  TYR A N   1 
ATOM   5746 C CA  . TYR A 1  744 ? 22.901  -36.645 -32.154 1.00 18.37  ? 822  TYR A CA  1 
ATOM   5747 C C   . TYR A 1  744 ? 22.467  -37.461 -33.345 1.00 19.19  ? 822  TYR A C   1 
ATOM   5748 O O   . TYR A 1  744 ? 22.856  -37.182 -34.497 1.00 19.90  ? 822  TYR A O   1 
ATOM   5749 C CB  . TYR A 1  744 ? 21.922  -35.493 -31.919 1.00 19.95  ? 822  TYR A CB  1 
ATOM   5750 C CG  . TYR A 1  744 ? 22.108  -34.906 -30.557 1.00 19.78  ? 822  TYR A CG  1 
ATOM   5751 C CD1 . TYR A 1  744 ? 23.079  -33.948 -30.335 1.00 21.74  ? 822  TYR A CD1 1 
ATOM   5752 C CD2 . TYR A 1  744 ? 21.346  -35.342 -29.471 1.00 21.22  ? 822  TYR A CD2 1 
ATOM   5753 C CE1 . TYR A 1  744 ? 23.298  -33.435 -29.088 1.00 23.87  ? 822  TYR A CE1 1 
ATOM   5754 C CE2 . TYR A 1  744 ? 21.555  -34.831 -28.213 1.00 18.79  ? 822  TYR A CE2 1 
ATOM   5755 C CZ  . TYR A 1  744 ? 22.540  -33.865 -28.041 1.00 22.29  ? 822  TYR A CZ  1 
ATOM   5756 O OH  . TYR A 1  744 ? 22.807  -33.299 -26.833 1.00 23.26  ? 822  TYR A OH  1 
ATOM   5757 N N   . ILE A 1  745 ? 21.639  -38.462 -33.055 1.00 19.89  ? 823  ILE A N   1 
ATOM   5758 C CA  . ILE A 1  745 ? 21.006  -39.303 -34.048 1.00 17.56  ? 823  ILE A CA  1 
ATOM   5759 C C   . ILE A 1  745 ? 19.471  -39.158 -33.939 1.00 19.05  ? 823  ILE A C   1 
ATOM   5760 O O   . ILE A 1  745 ? 18.905  -39.237 -32.845 1.00 18.26  ? 823  ILE A O   1 
ATOM   5761 C CB  . ILE A 1  745 ? 21.387  -40.785 -33.848 1.00 19.74  ? 823  ILE A CB  1 
ATOM   5762 C CG1 . ILE A 1  745 ? 22.901  -40.976 -34.018 1.00 22.00  ? 823  ILE A CG1 1 
ATOM   5763 C CG2 . ILE A 1  745 ? 20.610  -41.665 -34.832 1.00 20.36  ? 823  ILE A CG2 1 
ATOM   5764 C CD1 . ILE A 1  745 ? 23.417  -42.334 -33.571 1.00 21.23  ? 823  ILE A CD1 1 
ATOM   5765 N N   . ILE A 1  746 ? 18.830  -38.983 -35.085 1.00 18.05  ? 824  ILE A N   1 
ATOM   5766 C CA  . ILE A 1  746 ? 17.407  -38.701 -35.210 1.00 24.35  ? 824  ILE A CA  1 
ATOM   5767 C C   . ILE A 1  746 ? 16.742  -39.840 -36.009 1.00 22.33  ? 824  ILE A C   1 
ATOM   5768 O O   . ILE A 1  746 ? 17.169  -40.109 -37.134 1.00 19.00  ? 824  ILE A O   1 
ATOM   5769 C CB  . ILE A 1  746 ? 17.213  -37.380 -36.021 1.00 25.49  ? 824  ILE A CB  1 
ATOM   5770 C CG1 . ILE A 1  746 ? 17.879  -36.218 -35.296 1.00 31.13  ? 824  ILE A CG1 1 
ATOM   5771 C CG2 . ILE A 1  746 ? 15.745  -37.063 -36.268 1.00 29.00  ? 824  ILE A CG2 1 
ATOM   5772 C CD1 . ILE A 1  746 ? 17.434  -36.042 -33.859 1.00 24.55  ? 824  ILE A CD1 1 
ATOM   5773 N N   . PRO A 1  747 ? 15.702  -40.495 -35.447 1.00 17.05  ? 825  PRO A N   1 
ATOM   5774 C CA  . PRO A 1  747 ? 14.929  -41.468 -36.233 1.00 19.86  ? 825  PRO A CA  1 
ATOM   5775 C C   . PRO A 1  747 ? 13.918  -40.754 -37.115 1.00 18.69  ? 825  PRO A C   1 
ATOM   5776 O O   . PRO A 1  747 ? 13.297  -39.781 -36.670 1.00 19.77  ? 825  PRO A O   1 
ATOM   5777 C CB  . PRO A 1  747 ? 14.184  -42.265 -35.167 1.00 16.93  ? 825  PRO A CB  1 
ATOM   5778 C CG  . PRO A 1  747 ? 13.940  -41.271 -34.080 1.00 16.83  ? 825  PRO A CG  1 
ATOM   5779 C CD  . PRO A 1  747 ? 15.098  -40.297 -34.113 1.00 19.50  ? 825  PRO A CD  1 
ATOM   5780 N N   . LEU A 1  748 ? 13.746  -41.263 -38.327 1.00 20.24  ? 826  LEU A N   1 
ATOM   5781 C CA  . LEU A 1  748 ? 12.818  -40.712 -39.327 1.00 19.17  ? 826  LEU A CA  1 
ATOM   5782 C C   . LEU A 1  748 ? 11.987  -41.855 -39.871 1.00 21.03  ? 826  LEU A C   1 
ATOM   5783 O O   . LEU A 1  748 ? 12.371  -43.021 -39.723 1.00 18.07  ? 826  LEU A O   1 
ATOM   5784 C CB  . LEU A 1  748 ? 13.602  -40.086 -40.491 1.00 22.99  ? 826  LEU A CB  1 
ATOM   5785 C CG  . LEU A 1  748 ? 14.683  -39.040 -40.135 1.00 23.32  ? 826  LEU A CG  1 
ATOM   5786 C CD1 . LEU A 1  748 ? 15.616  -38.802 -41.310 1.00 28.85  ? 826  LEU A CD1 1 
ATOM   5787 C CD2 . LEU A 1  748 ? 14.026  -37.749 -39.707 1.00 25.44  ? 826  LEU A CD2 1 
ATOM   5788 N N   . GLN A 1  749 ? 10.880  -41.532 -40.541 1.00 19.10  ? 827  GLN A N   1 
ATOM   5789 C CA  . GLN A 1  749 ? 10.051  -42.537 -41.179 1.00 18.65  ? 827  GLN A CA  1 
ATOM   5790 C C   . GLN A 1  749 ? 9.535   -42.040 -42.525 1.00 20.03  ? 827  GLN A C   1 
ATOM   5791 O O   . GLN A 1  749 ? 9.408   -40.841 -42.759 1.00 17.32  ? 827  GLN A O   1 
ATOM   5792 C CB  . GLN A 1  749 ? 8.924   -42.995 -40.234 1.00 18.48  ? 827  GLN A CB  1 
ATOM   5793 C CG  . GLN A 1  749 ? 8.099   -44.177 -40.747 1.00 18.76  ? 827  GLN A CG  1 
ATOM   5794 C CD  . GLN A 1  749 ? 7.311   -44.855 -39.641 1.00 20.39  ? 827  GLN A CD  1 
ATOM   5795 O OE1 . GLN A 1  749 ? 6.780   -44.194 -38.759 1.00 20.25  ? 827  GLN A OE1 1 
ATOM   5796 N NE2 . GLN A 1  749 ? 7.239   -46.173 -39.681 1.00 18.49  ? 827  GLN A NE2 1 
ATOM   5797 N N   . GLY A 1  750 ? 9.252   -42.984 -43.414 1.00 20.55  ? 828  GLY A N   1 
ATOM   5798 C CA  . GLY A 1  750 ? 8.786   -42.689 -44.762 1.00 24.06  ? 828  GLY A CA  1 
ATOM   5799 C C   . GLY A 1  750 ? 7.425   -42.010 -44.808 1.00 27.97  ? 828  GLY A C   1 
ATOM   5800 O O   . GLY A 1  750 ? 6.750   -41.876 -43.763 1.00 22.57  ? 828  GLY A O   1 
ATOM   5801 N N   . PRO A 1  751 ? 7.021   -41.565 -46.018 1.00 26.57  ? 829  PRO A N   1 
ATOM   5802 C CA  . PRO A 1  751 ? 5.906   -40.627 -46.155 1.00 24.91  ? 829  PRO A CA  1 
ATOM   5803 C C   . PRO A 1  751 ? 4.542   -41.265 -46.093 1.00 22.98  ? 829  PRO A C   1 
ATOM   5804 O O   . PRO A 1  751 ? 4.408   -42.473 -46.206 1.00 23.70  ? 829  PRO A O   1 
ATOM   5805 C CB  . PRO A 1  751 ? 6.136   -40.005 -47.541 1.00 27.88  ? 829  PRO A CB  1 
ATOM   5806 C CG  . PRO A 1  751 ? 6.841   -41.081 -48.320 1.00 27.79  ? 829  PRO A CG  1 
ATOM   5807 C CD  . PRO A 1  751 ? 7.669   -41.854 -47.319 1.00 26.63  ? 829  PRO A CD  1 
ATOM   5808 N N   . GLY A 1  752 ? 3.538   -40.427 -45.873 1.00 21.43  ? 830  GLY A N   1 
ATOM   5809 C CA  . GLY A 1  752 ? 2.150   -40.827 -45.917 1.00 18.47  ? 830  GLY A CA  1 
ATOM   5810 C C   . GLY A 1  752 ? 1.247   -39.607 -45.869 1.00 20.73  ? 830  GLY A C   1 
ATOM   5811 O O   . GLY A 1  752 ? 1.630   -38.583 -45.333 1.00 23.47  ? 830  GLY A O   1 
ATOM   5812 N N   . LEU A 1  753 ? 0.030   -39.727 -46.393 1.00 19.54  ? 831  LEU A N   1 
ATOM   5813 C CA  . LEU A 1  753 ? -0.951  -38.665 -46.229 1.00 20.53  ? 831  LEU A CA  1 
ATOM   5814 C C   . LEU A 1  753 ? -1.612  -38.692 -44.846 1.00 19.18  ? 831  LEU A C   1 
ATOM   5815 O O   . LEU A 1  753 ? -2.266  -37.734 -44.466 1.00 17.51  ? 831  LEU A O   1 
ATOM   5816 C CB  . LEU A 1  753 ? -1.987  -38.690 -47.337 1.00 22.66  ? 831  LEU A CB  1 
ATOM   5817 C CG  . LEU A 1  753 ? -1.458  -38.421 -48.756 1.00 26.99  ? 831  LEU A CG  1 
ATOM   5818 C CD1 . LEU A 1  753 ? -2.636  -38.382 -49.718 1.00 35.88  ? 831  LEU A CD1 1 
ATOM   5819 C CD2 . LEU A 1  753 ? -0.669  -37.107 -48.835 1.00 24.26  ? 831  LEU A CD2 1 
ATOM   5820 N N   . THR A 1  754 ? -1.430  -39.788 -44.109 1.00 18.35  ? 832  THR A N   1 
ATOM   5821 C CA  . THR A 1  754 ? -1.865  -39.906 -42.733 1.00 16.99  ? 832  THR A CA  1 
ATOM   5822 C C   . THR A 1  754 ? -0.818  -40.692 -41.961 1.00 17.88  ? 832  THR A C   1 
ATOM   5823 O O   . THR A 1  754 ? 0.000   -41.391 -42.575 1.00 17.78  ? 832  THR A O   1 
ATOM   5824 C CB  . THR A 1  754 ? -3.212  -40.648 -42.595 1.00 16.31  ? 832  THR A CB  1 
ATOM   5825 O OG1 . THR A 1  754 ? -3.014  -42.057 -42.773 1.00 18.32  ? 832  THR A OG1 1 
ATOM   5826 C CG2 . THR A 1  754 ? -4.234  -40.146 -43.590 1.00 18.32  ? 832  THR A CG2 1 
ATOM   5827 N N   . THR A 1  755 ? -0.878  -40.619 -40.628 1.00 16.99  ? 833  THR A N   1 
ATOM   5828 C CA  . THR A 1  755 ? -0.019  -41.455 -39.765 1.00 17.94  ? 833  THR A CA  1 
ATOM   5829 C C   . THR A 1  755 ? -0.396  -42.938 -39.803 1.00 17.20  ? 833  THR A C   1 
ATOM   5830 O O   . THR A 1  755 ? 0.443   -43.794 -39.520 1.00 19.71  ? 833  THR A O   1 
ATOM   5831 C CB  . THR A 1  755 ? 0.044   -40.961 -38.301 1.00 19.31  ? 833  THR A CB  1 
ATOM   5832 O OG1 . THR A 1  755 ? -1.256  -41.023 -37.690 1.00 17.11  ? 833  THR A OG1 1 
ATOM   5833 C CG2 . THR A 1  755 ? 0.576   -39.512 -38.257 1.00 19.24  ? 833  THR A CG2 1 
ATOM   5834 N N   . THR A 1  756 ? -1.640  -43.240 -40.171 1.00 18.16  ? 834  THR A N   1 
ATOM   5835 C CA  . THR A 1  756 ? -2.067  -44.621 -40.394 1.00 19.54  ? 834  THR A CA  1 
ATOM   5836 C C   . THR A 1  756 ? -1.200  -45.231 -41.507 1.00 19.85  ? 834  THR A C   1 
ATOM   5837 O O   . THR A 1  756 ? -0.691  -46.353 -41.378 1.00 23.63  ? 834  THR A O   1 
ATOM   5838 C CB  . THR A 1  756 ? -3.562  -44.686 -40.765 1.00 19.59  ? 834  THR A CB  1 
ATOM   5839 O OG1 . THR A 1  756 ? -4.325  -44.072 -39.725 1.00 18.83  ? 834  THR A OG1 1 
ATOM   5840 C CG2 . THR A 1  756 ? -4.026  -46.122 -40.956 1.00 19.68  ? 834  THR A CG2 1 
ATOM   5841 N N   . GLU A 1  757 ? -1.016  -44.465 -42.580 1.00 19.09  ? 835  GLU A N   1 
ATOM   5842 C CA  . GLU A 1  757 ? -0.112  -44.832 -43.655 1.00 23.82  ? 835  GLU A CA  1 
ATOM   5843 C C   . GLU A 1  757 ? 1.393   -44.712 -43.258 1.00 20.87  ? 835  GLU A C   1 
ATOM   5844 O O   . GLU A 1  757 ? 2.177   -45.646 -43.430 1.00 20.60  ? 835  GLU A O   1 
ATOM   5845 C CB  . GLU A 1  757 ? -0.425  -43.971 -44.868 1.00 23.52  ? 835  GLU A CB  1 
ATOM   5846 C CG  . GLU A 1  757 ? 0.164   -44.457 -46.161 1.00 32.29  ? 835  GLU A CG  1 
ATOM   5847 C CD  . GLU A 1  757 ? -0.193  -43.586 -47.362 1.00 40.23  ? 835  GLU A CD  1 
ATOM   5848 O OE1 . GLU A 1  757 ? -0.526  -42.389 -47.203 1.00 28.90  ? 835  GLU A OE1 1 
ATOM   5849 O OE2 . GLU A 1  757 ? -0.114  -44.114 -48.485 1.00 57.46  ? 835  GLU A OE2 1 
ATOM   5850 N N   . SER A 1  758 ? 1.779   -43.570 -42.723 1.00 18.53  ? 836  SER A N   1 
ATOM   5851 C CA  . SER A 1  758 ? 3.199   -43.281 -42.454 1.00 22.69  ? 836  SER A CA  1 
ATOM   5852 C C   . SER A 1  758 ? 3.840   -44.278 -41.452 1.00 20.93  ? 836  SER A C   1 
ATOM   5853 O O   . SER A 1  758 ? 4.953   -44.750 -41.669 1.00 18.58  ? 836  SER A O   1 
ATOM   5854 C CB  . SER A 1  758 ? 3.391   -41.813 -42.021 1.00 18.26  ? 836  SER A CB  1 
ATOM   5855 O OG  . SER A 1  758 ? 3.060   -41.619 -40.640 1.00 17.03  ? 836  SER A OG  1 
ATOM   5856 N N   . ARG A 1  759 ? 3.098   -44.660 -40.421 1.00 19.77  ? 837  ARG A N   1 
ATOM   5857 C CA  . ARG A 1  759 ? 3.601   -45.604 -39.410 1.00 20.06  ? 837  ARG A CA  1 
ATOM   5858 C C   . ARG A 1  759 ? 3.967   -46.996 -39.958 1.00 24.42  ? 837  ARG A C   1 
ATOM   5859 O O   . ARG A 1  759 ? 4.707   -47.717 -39.291 1.00 20.31  ? 837  ARG A O   1 
ATOM   5860 C CB  . ARG A 1  759 ? 2.596   -45.783 -38.278 1.00 17.77  ? 837  ARG A CB  1 
ATOM   5861 C CG  . ARG A 1  759 ? 2.450   -44.579 -37.359 1.00 20.60  ? 837  ARG A CG  1 
ATOM   5862 C CD  . ARG A 1  759 ? 1.275   -44.799 -36.408 1.00 21.19  ? 837  ARG A CD  1 
ATOM   5863 N NE  . ARG A 1  759 ? 1.445   -46.012 -35.598 1.00 21.34  ? 837  ARG A NE  1 
ATOM   5864 C CZ  . ARG A 1  759 ? 2.162   -46.094 -34.473 1.00 21.69  ? 837  ARG A CZ  1 
ATOM   5865 N NH1 . ARG A 1  759 ? 2.789   -45.029 -33.971 1.00 22.39  ? 837  ARG A NH1 1 
ATOM   5866 N NH2 . ARG A 1  759 ? 2.244   -47.250 -33.829 1.00 23.26  ? 837  ARG A NH2 1 
ATOM   5867 N N   . GLN A 1  760 ? 3.440   -47.357 -41.134 1.00 20.05  ? 838  GLN A N   1 
ATOM   5868 C CA  . GLN A 1  760 ? 3.762   -48.618 -41.797 1.00 22.24  ? 838  GLN A CA  1 
ATOM   5869 C C   . GLN A 1  760 ? 4.993   -48.546 -42.698 1.00 23.26  ? 838  GLN A C   1 
ATOM   5870 O O   . GLN A 1  760 ? 5.394   -49.548 -43.243 1.00 22.33  ? 838  GLN A O   1 
ATOM   5871 C CB  . GLN A 1  760 ? 2.567   -49.080 -42.630 1.00 22.26  ? 838  GLN A CB  1 
ATOM   5872 C CG  . GLN A 1  760 ? 1.317   -49.314 -41.806 1.00 25.36  ? 838  GLN A CG  1 
ATOM   5873 C CD  . GLN A 1  760 ? 0.118   -49.698 -42.666 1.00 34.54  ? 838  GLN A CD  1 
ATOM   5874 O OE1 . GLN A 1  760 ? 0.074   -50.783 -43.251 1.00 40.49  ? 838  GLN A OE1 1 
ATOM   5875 N NE2 . GLN A 1  760 ? -0.865  -48.810 -42.740 1.00 37.10  ? 838  GLN A NE2 1 
ATOM   5876 N N   . GLN A 1  761 ? 5.601   -47.374 -42.860 1.00 20.60  ? 839  GLN A N   1 
ATOM   5877 C CA  . GLN A 1  761 ? 6.702   -47.221 -43.792 1.00 20.60  ? 839  GLN A CA  1 
ATOM   5878 C C   . GLN A 1  761 ? 8.040   -47.599 -43.178 1.00 19.17  ? 839  GLN A C   1 
ATOM   5879 O O   . GLN A 1  761 ? 8.180   -47.633 -41.954 1.00 19.40  ? 839  GLN A O   1 
ATOM   5880 C CB  . GLN A 1  761 ? 6.791   -45.776 -44.283 1.00 21.78  ? 839  GLN A CB  1 
ATOM   5881 C CG  . GLN A 1  761 ? 5.538   -45.255 -44.958 1.00 25.32  ? 839  GLN A CG  1 
ATOM   5882 C CD  . GLN A 1  761 ? 5.116   -46.103 -46.141 1.00 36.17  ? 839  GLN A CD  1 
ATOM   5883 O OE1 . GLN A 1  761 ? 5.907   -46.341 -47.048 1.00 28.09  ? 839  GLN A OE1 1 
ATOM   5884 N NE2 . GLN A 1  761 ? 3.871   -46.608 -46.107 1.00 37.89  ? 839  GLN A NE2 1 
ATOM   5885 N N   . PRO A 1  762 ? 9.046   -47.832 -44.034 1.00 20.90  ? 840  PRO A N   1 
ATOM   5886 C CA  . PRO A 1  762 ? 10.415  -47.966 -43.536 1.00 21.82  ? 840  PRO A CA  1 
ATOM   5887 C C   . PRO A 1  762 ? 10.931  -46.721 -42.829 1.00 21.72  ? 840  PRO A C   1 
ATOM   5888 O O   . PRO A 1  762 ? 10.547  -45.591 -43.173 1.00 23.62  ? 840  PRO A O   1 
ATOM   5889 C CB  . PRO A 1  762 ? 11.245  -48.203 -44.813 1.00 21.65  ? 840  PRO A CB  1 
ATOM   5890 C CG  . PRO A 1  762 ? 10.269  -48.723 -45.822 1.00 26.94  ? 840  PRO A CG  1 
ATOM   5891 C CD  . PRO A 1  762 ? 8.964   -48.058 -45.494 1.00 22.91  ? 840  PRO A CD  1 
ATOM   5892 N N   . MET A 1  763 ? 11.823  -46.945 -41.873 1.00 19.52  ? 841  MET A N   1 
ATOM   5893 C CA  . MET A 1  763 ? 12.474  -45.890 -41.134 1.00 19.25  ? 841  MET A CA  1 
ATOM   5894 C C   . MET A 1  763 ? 13.887  -45.645 -41.644 1.00 21.04  ? 841  MET A C   1 
ATOM   5895 O O   . MET A 1  763 ? 14.442  -46.436 -42.430 1.00 21.94  ? 841  MET A O   1 
ATOM   5896 C CB  . MET A 1  763 ? 12.497  -46.228 -39.643 1.00 18.10  ? 841  MET A CB  1 
ATOM   5897 C CG  . MET A 1  763 ? 11.106  -46.340 -39.039 1.00 22.97  ? 841  MET A CG  1 
ATOM   5898 S SD  . MET A 1  763 ? 11.181  -46.532 -37.261 1.00 26.81  ? 841  MET A SD  1 
ATOM   5899 C CE  . MET A 1  763 ? 9.792   -45.532 -36.750 1.00 30.19  ? 841  MET A CE  1 
ATOM   5900 N N   . ALA A 1  764 ? 14.438  -44.527 -41.184 1.00 19.50  ? 842  ALA A N   1 
ATOM   5901 C CA  . ALA A 1  764 ? 15.808  -44.120 -41.449 1.00 19.39  ? 842  ALA A CA  1 
ATOM   5902 C C   . ALA A 1  764 ? 16.407  -43.491 -40.196 1.00 19.31  ? 842  ALA A C   1 
ATOM   5903 O O   . ALA A 1  764 ? 15.686  -43.103 -39.271 1.00 18.86  ? 842  ALA A O   1 
ATOM   5904 C CB  . ALA A 1  764 ? 15.841  -43.114 -42.606 1.00 19.98  ? 842  ALA A CB  1 
ATOM   5905 N N   . LEU A 1  765 ? 17.733  -43.410 -40.175 1.00 18.97  ? 843  LEU A N   1 
ATOM   5906 C CA  . LEU A 1  765 ? 18.464  -42.637 -39.193 1.00 19.51  ? 843  LEU A CA  1 
ATOM   5907 C C   . LEU A 1  765 ? 19.231  -41.517 -39.903 1.00 20.18  ? 843  LEU A C   1 
ATOM   5908 O O   . LEU A 1  765 ? 19.786  -41.732 -40.993 1.00 19.21  ? 843  LEU A O   1 
ATOM   5909 C CB  . LEU A 1  765 ? 19.450  -43.525 -38.456 1.00 21.92  ? 843  LEU A CB  1 
ATOM   5910 C CG  . LEU A 1  765 ? 18.882  -44.698 -37.671 1.00 20.85  ? 843  LEU A CG  1 
ATOM   5911 C CD1 . LEU A 1  765 ? 20.009  -45.569 -37.134 1.00 24.00  ? 843  LEU A CD1 1 
ATOM   5912 C CD2 . LEU A 1  765 ? 18.002  -44.216 -36.531 1.00 21.94  ? 843  LEU A CD2 1 
ATOM   5913 N N   . ALA A 1  766 ? 19.225  -40.335 -39.285 1.00 17.32  ? 844  ALA A N   1 
ATOM   5914 C CA  . ALA A 1  766 ? 20.137  -39.254 -39.597 1.00 18.91  ? 844  ALA A CA  1 
ATOM   5915 C C   . ALA A 1  766 ? 21.123  -39.160 -38.432 1.00 18.36  ? 844  ALA A C   1 
ATOM   5916 O O   . ALA A 1  766 ? 20.711  -38.933 -37.281 1.00 19.62  ? 844  ALA A O   1 
ATOM   5917 C CB  . ALA A 1  766 ? 19.368  -37.956 -39.749 1.00 21.77  ? 844  ALA A CB  1 
ATOM   5918 N N   . VAL A 1  767 ? 22.401  -39.389 -38.736 1.00 18.79  ? 845  VAL A N   1 
ATOM   5919 C CA  . VAL A 1  767 ? 23.487  -39.514 -37.770 1.00 19.81  ? 845  VAL A CA  1 
ATOM   5920 C C   . VAL A 1  767 ? 24.453  -38.332 -37.931 1.00 18.81  ? 845  VAL A C   1 
ATOM   5921 O O   . VAL A 1  767 ? 25.188  -38.239 -38.907 1.00 20.16  ? 845  VAL A O   1 
ATOM   5922 C CB  . VAL A 1  767 ? 24.251  -40.852 -37.939 1.00 20.96  ? 845  VAL A CB  1 
ATOM   5923 C CG1 . VAL A 1  767 ? 25.369  -41.001 -36.899 1.00 22.47  ? 845  VAL A CG1 1 
ATOM   5924 C CG2 . VAL A 1  767 ? 23.290  -42.050 -37.905 1.00 22.64  ? 845  VAL A CG2 1 
ATOM   5925 N N   . ALA A 1  768 ? 24.422  -37.412 -36.975 1.00 18.66  ? 846  ALA A N   1 
ATOM   5926 C CA  . ALA A 1  768 ? 25.253  -36.211 -37.015 1.00 17.87  ? 846  ALA A CA  1 
ATOM   5927 C C   . ALA A 1  768 ? 26.502  -36.431 -36.176 1.00 19.29  ? 846  ALA A C   1 
ATOM   5928 O O   . ALA A 1  768 ? 26.457  -36.366 -34.952 1.00 19.80  ? 846  ALA A O   1 
ATOM   5929 C CB  . ALA A 1  768 ? 24.462  -35.011 -36.507 1.00 16.35  ? 846  ALA A CB  1 
ATOM   5930 N N   . LEU A 1  769 ? 27.623  -36.715 -36.832 1.00 21.78  ? 847  LEU A N   1 
ATOM   5931 C CA  . LEU A 1  769 ? 28.852  -37.036 -36.114 1.00 21.33  ? 847  LEU A CA  1 
ATOM   5932 C C   . LEU A 1  769 ? 29.495  -35.783 -35.519 1.00 23.45  ? 847  LEU A C   1 
ATOM   5933 O O   . LEU A 1  769 ? 29.515  -34.710 -36.167 1.00 22.78  ? 847  LEU A O   1 
ATOM   5934 C CB  . LEU A 1  769 ? 29.858  -37.690 -37.047 1.00 24.23  ? 847  LEU A CB  1 
ATOM   5935 C CG  . LEU A 1  769 ? 29.487  -39.025 -37.686 1.00 22.05  ? 847  LEU A CG  1 
ATOM   5936 C CD1 . LEU A 1  769 ? 30.621  -39.417 -38.585 1.00 22.78  ? 847  LEU A CD1 1 
ATOM   5937 C CD2 . LEU A 1  769 ? 29.218  -40.100 -36.641 1.00 22.76  ? 847  LEU A CD2 1 
ATOM   5938 N N   . THR A 1  770 ? 30.030  -35.927 -34.307 1.00 19.60  ? 848  THR A N   1 
ATOM   5939 C CA  . THR A 1  770 ? 30.995  -34.975 -33.798 1.00 22.91  ? 848  THR A CA  1 
ATOM   5940 C C   . THR A 1  770 ? 32.238  -35.124 -34.622 1.00 24.95  ? 848  THR A C   1 
ATOM   5941 O O   . THR A 1  770 ? 32.380  -36.095 -35.363 1.00 25.70  ? 848  THR A O   1 
ATOM   5942 C CB  . THR A 1  770 ? 31.411  -35.240 -32.329 1.00 23.71  ? 848  THR A CB  1 
ATOM   5943 O OG1 . THR A 1  770 ? 31.993  -36.554 -32.196 1.00 23.40  ? 848  THR A OG1 1 
ATOM   5944 C CG2 . THR A 1  770 ? 30.231  -35.052 -31.408 1.00 24.45  ? 848  THR A CG2 1 
ATOM   5945 N N   . LYS A 1  771 ? 33.147  -34.172 -34.464 1.00 28.76  ? 849  LYS A N   1 
ATOM   5946 C CA  . LYS A 1  771 ? 34.481  -34.231 -35.065 1.00 33.08  ? 849  LYS A CA  1 
ATOM   5947 C C   . LYS A 1  771 ? 35.202  -35.537 -34.722 1.00 30.58  ? 849  LYS A C   1 
ATOM   5948 O O   . LYS A 1  771 ? 35.813  -36.147 -35.594 1.00 28.81  ? 849  LYS A O   1 
ATOM   5949 C CB  . LYS A 1  771 ? 35.320  -33.035 -34.607 1.00 37.47  ? 849  LYS A CB  1 
ATOM   5950 C CG  . LYS A 1  771 ? 36.630  -32.859 -35.361 1.00 45.57  ? 849  LYS A CG  1 
ATOM   5951 C CD  . LYS A 1  771 ? 37.077  -31.405 -35.282 1.00 56.24  ? 849  LYS A CD  1 
ATOM   5952 C CE  . LYS A 1  771 ? 38.360  -31.159 -36.057 1.00 72.22  ? 849  LYS A CE  1 
ATOM   5953 N NZ  . LYS A 1  771 ? 39.507  -31.914 -35.482 1.00 79.51  ? 849  LYS A NZ  1 
ATOM   5954 N N   . GLY A 1  772 ? 35.085  -35.980 -33.470 1.00 28.31  ? 850  GLY A N   1 
ATOM   5955 C CA  . GLY A 1  772 ? 35.616  -37.279 -33.042 1.00 27.72  ? 850  GLY A CA  1 
ATOM   5956 C C   . GLY A 1  772 ? 34.790  -38.512 -33.408 1.00 27.67  ? 850  GLY A C   1 
ATOM   5957 O O   . GLY A 1  772 ? 35.079  -39.591 -32.915 1.00 37.32  ? 850  GLY A O   1 
ATOM   5958 N N   . GLY A 1  773 ? 33.770  -38.376 -34.260 1.00 24.19  ? 851  GLY A N   1 
ATOM   5959 C CA  . GLY A 1  773 ? 32.977  -39.526 -34.732 1.00 26.50  ? 851  GLY A CA  1 
ATOM   5960 C C   . GLY A 1  773 ? 31.912  -40.101 -33.804 1.00 24.60  ? 851  GLY A C   1 
ATOM   5961 O O   . GLY A 1  773 ? 31.550  -41.272 -33.931 1.00 22.94  ? 851  GLY A O   1 
ATOM   5962 N N   . GLU A 1  774 ? 31.404  -39.290 -32.882 1.00 27.00  ? 852  GLU A N   1 
ATOM   5963 C CA  . GLU A 1  774 ? 30.452  -39.754 -31.871 1.00 29.49  ? 852  GLU A CA  1 
ATOM   5964 C C   . GLU A 1  774 ? 29.063  -39.221 -32.186 1.00 23.92  ? 852  GLU A C   1 
ATOM   5965 O O   . GLU A 1  774 ? 28.917  -38.101 -32.677 1.00 21.55  ? 852  GLU A O   1 
ATOM   5966 C CB  . GLU A 1  774 ? 30.856  -39.267 -30.480 1.00 32.52  ? 852  GLU A CB  1 
ATOM   5967 C CG  . GLU A 1  774 ? 32.217  -39.738 -29.982 1.00 42.94  ? 852  GLU A CG  1 
ATOM   5968 C CD  . GLU A 1  774 ? 32.185  -41.110 -29.345 1.00 49.19  ? 852  GLU A CD  1 
ATOM   5969 O OE1 . GLU A 1  774 ? 31.501  -41.289 -28.318 1.00 54.41  ? 852  GLU A OE1 1 
ATOM   5970 O OE2 . GLU A 1  774 ? 32.856  -42.014 -29.868 1.00 60.96  ? 852  GLU A OE2 1 
ATOM   5971 N N   . ALA A 1  775 ? 28.054  -40.029 -31.883 1.00 21.91  ? 853  ALA A N   1 
ATOM   5972 C CA  . ALA A 1  775 ? 26.668  -39.564 -31.815 1.00 21.24  ? 853  ALA A CA  1 
ATOM   5973 C C   . ALA A 1  775 ? 25.779  -40.545 -31.027 1.00 21.68  ? 853  ALA A C   1 
ATOM   5974 O O   . ALA A 1  775 ? 26.082  -41.744 -30.908 1.00 21.14  ? 853  ALA A O   1 
ATOM   5975 C CB  . ALA A 1  775 ? 26.087  -39.339 -33.218 1.00 21.44  ? 853  ALA A CB  1 
ATOM   5976 N N   . ARG A 1  776 ? 24.667  -40.025 -30.528 1.00 21.70  ? 854  ARG A N   1 
ATOM   5977 C CA  . ARG A 1  776 ? 23.726  -40.815 -29.741 1.00 22.62  ? 854  ARG A CA  1 
ATOM   5978 C C   . ARG A 1  776 ? 22.308  -40.352 -30.034 1.00 19.48  ? 854  ARG A C   1 
ATOM   5979 O O   . ARG A 1  776 ? 22.050  -39.165 -30.170 1.00 15.60  ? 854  ARG A O   1 
ATOM   5980 C CB  . ARG A 1  776 ? 24.026  -40.700 -28.241 1.00 27.52  ? 854  ARG A CB  1 
ATOM   5981 C CG  . ARG A 1  776 ? 23.092  -41.545 -27.365 1.00 36.28  ? 854  ARG A CG  1 
ATOM   5982 C CD  . ARG A 1  776 ? 23.159  -41.206 -25.884 1.00 39.99  ? 854  ARG A CD  1 
ATOM   5983 N NE  . ARG A 1  776 ? 22.149  -41.939 -25.107 1.00 43.53  ? 854  ARG A NE  1 
ATOM   5984 C CZ  . ARG A 1  776 ? 20.833  -41.686 -25.096 1.00 41.82  ? 854  ARG A CZ  1 
ATOM   5985 N NH1 . ARG A 1  776 ? 20.288  -40.708 -25.831 1.00 40.75  ? 854  ARG A NH1 1 
ATOM   5986 N NH2 . ARG A 1  776 ? 20.037  -42.422 -24.330 1.00 40.04  ? 854  ARG A NH2 1 
ATOM   5987 N N   . GLY A 1  777 ? 21.388  -41.295 -30.128 1.00 17.57  ? 855  GLY A N   1 
ATOM   5988 C CA  . GLY A 1  777 ? 19.987  -40.961 -30.161 1.00 18.39  ? 855  GLY A CA  1 
ATOM   5989 C C   . GLY A 1  777 ? 19.110  -42.086 -29.714 1.00 18.23  ? 855  GLY A C   1 
ATOM   5990 O O   . GLY A 1  777 ? 19.593  -43.119 -29.243 1.00 19.52  ? 855  GLY A O   1 
ATOM   5991 N N   . GLU A 1  778 ? 17.811  -41.897 -29.871 1.00 20.45  ? 856  GLU A N   1 
ATOM   5992 C CA  . GLU A 1  778 ? 16.861  -42.861 -29.357 1.00 20.67  ? 856  GLU A CA  1 
ATOM   5993 C C   . GLU A 1  778 ? 15.547  -42.881 -30.123 1.00 18.70  ? 856  GLU A C   1 
ATOM   5994 O O   . GLU A 1  778 ? 15.196  -41.925 -30.792 1.00 19.34  ? 856  GLU A O   1 
ATOM   5995 C CB  . GLU A 1  778 ? 16.602  -42.589 -27.861 1.00 26.94  ? 856  GLU A CB  1 
ATOM   5996 C CG  . GLU A 1  778 ? 16.018  -41.221 -27.545 1.00 35.40  ? 856  GLU A CG  1 
ATOM   5997 C CD  . GLU A 1  778 ? 15.712  -41.032 -26.056 1.00 49.01  ? 856  GLU A CD  1 
ATOM   5998 O OE1 . GLU A 1  778 ? 15.894  -41.982 -25.277 1.00 39.23  ? 856  GLU A OE1 1 
ATOM   5999 O OE2 . GLU A 1  778 ? 15.272  -39.930 -25.663 1.00 59.18  ? 856  GLU A OE2 1 
ATOM   6000 N N   . LEU A 1  779 ? 14.836  -43.994 -29.990 1.00 18.58  ? 857  LEU A N   1 
ATOM   6001 C CA  . LEU A 1  779 ? 13.487  -44.166 -30.506 1.00 18.49  ? 857  LEU A CA  1 
ATOM   6002 C C   . LEU A 1  779 ? 12.609  -44.809 -29.446 1.00 18.69  ? 857  LEU A C   1 
ATOM   6003 O O   . LEU A 1  779 ? 12.995  -45.827 -28.881 1.00 18.67  ? 857  LEU A O   1 
ATOM   6004 C CB  . LEU A 1  779 ? 13.520  -45.078 -31.713 1.00 18.03  ? 857  LEU A CB  1 
ATOM   6005 C CG  . LEU A 1  779 ? 12.184  -45.456 -32.362 1.00 19.09  ? 857  LEU A CG  1 
ATOM   6006 C CD1 . LEU A 1  779 ? 11.413  -44.240 -32.823 1.00 20.03  ? 857  LEU A CD1 1 
ATOM   6007 C CD2 . LEU A 1  779 ? 12.439  -46.396 -33.535 1.00 22.82  ? 857  LEU A CD2 1 
ATOM   6008 N N   . PHE A 1  780 ? 11.426  -44.228 -29.232 1.00 17.53  ? 858  PHE A N   1 
ATOM   6009 C CA  . PHE A 1  780 ? 10.348  -44.830 -28.459 1.00 17.29  ? 858  PHE A CA  1 
ATOM   6010 C C   . PHE A 1  780 ? 9.193   -45.196 -29.393 1.00 15.86  ? 858  PHE A C   1 
ATOM   6011 O O   . PHE A 1  780 ? 8.753   -44.376 -30.187 1.00 16.88  ? 858  PHE A O   1 
ATOM   6012 C CB  . PHE A 1  780 ? 9.845   -43.866 -27.380 1.00 16.64  ? 858  PHE A CB  1 
ATOM   6013 C CG  . PHE A 1  780 ? 8.621   -44.363 -26.651 1.00 18.89  ? 858  PHE A CG  1 
ATOM   6014 C CD1 . PHE A 1  780 ? 8.745   -45.192 -25.532 1.00 19.54  ? 858  PHE A CD1 1 
ATOM   6015 C CD2 . PHE A 1  780 ? 7.335   -44.007 -27.084 1.00 17.22  ? 858  PHE A CD2 1 
ATOM   6016 C CE1 . PHE A 1  780 ? 7.613   -45.662 -24.864 1.00 19.34  ? 858  PHE A CE1 1 
ATOM   6017 C CE2 . PHE A 1  780 ? 6.209   -44.473 -26.423 1.00 18.03  ? 858  PHE A CE2 1 
ATOM   6018 C CZ  . PHE A 1  780 ? 6.346   -45.317 -25.318 1.00 18.76  ? 858  PHE A CZ  1 
ATOM   6019 N N   . TRP A 1  781 ? 8.693   -46.423 -29.295 1.00 15.22  ? 859  TRP A N   1 
ATOM   6020 C CA  . TRP A 1  781 ? 7.619   -46.865 -30.178 1.00 17.79  ? 859  TRP A CA  1 
ATOM   6021 C C   . TRP A 1  781 ? 6.629   -47.727 -29.437 1.00 18.52  ? 859  TRP A C   1 
ATOM   6022 O O   . TRP A 1  781 ? 7.006   -48.694 -28.801 1.00 21.76  ? 859  TRP A O   1 
ATOM   6023 C CB  . TRP A 1  781 ? 8.188   -47.634 -31.357 1.00 18.56  ? 859  TRP A CB  1 
ATOM   6024 C CG  . TRP A 1  781 ? 7.241   -47.768 -32.524 1.00 19.91  ? 859  TRP A CG  1 
ATOM   6025 C CD1 . TRP A 1  781 ? 6.462   -48.843 -32.818 1.00 21.67  ? 859  TRP A CD1 1 
ATOM   6026 C CD2 . TRP A 1  781 ? 7.018   -46.812 -33.573 1.00 22.17  ? 859  TRP A CD2 1 
ATOM   6027 N NE1 . TRP A 1  781 ? 5.757   -48.612 -33.974 1.00 21.59  ? 859  TRP A NE1 1 
ATOM   6028 C CE2 . TRP A 1  781 ? 6.075   -47.374 -34.454 1.00 21.87  ? 859  TRP A CE2 1 
ATOM   6029 C CE3 . TRP A 1  781 ? 7.511   -45.524 -33.837 1.00 25.70  ? 859  TRP A CE3 1 
ATOM   6030 C CZ2 . TRP A 1  781 ? 5.618   -46.707 -35.605 1.00 26.29  ? 859  TRP A CZ2 1 
ATOM   6031 C CZ3 . TRP A 1  781 ? 7.056   -44.850 -34.970 1.00 27.47  ? 859  TRP A CZ3 1 
ATOM   6032 C CH2 . TRP A 1  781 ? 6.110   -45.457 -35.847 1.00 24.02  ? 859  TRP A CH2 1 
ATOM   6033 N N   . ASP A 1  782 ? 5.359   -47.374 -29.548 1.00 18.11  ? 860  ASP A N   1 
ATOM   6034 C CA  . ASP A 1  782 ? 4.262   -48.180 -29.044 1.00 19.46  ? 860  ASP A CA  1 
ATOM   6035 C C   . ASP A 1  782 ? 3.170   -48.265 -30.119 1.00 18.77  ? 860  ASP A C   1 
ATOM   6036 O O   . ASP A 1  782 ? 3.441   -47.919 -31.256 1.00 17.83  ? 860  ASP A O   1 
ATOM   6037 C CB  . ASP A 1  782 ? 3.781   -47.624 -27.702 1.00 17.88  ? 860  ASP A CB  1 
ATOM   6038 C CG  . ASP A 1  782 ? 3.186   -46.242 -27.795 1.00 20.40  ? 860  ASP A CG  1 
ATOM   6039 O OD1 . ASP A 1  782 ? 2.958   -45.707 -28.908 1.00 14.66  ? 860  ASP A OD1 1 
ATOM   6040 O OD2 . ASP A 1  782 ? 2.889   -45.698 -26.698 1.00 18.68  ? 860  ASP A OD2 1 
ATOM   6041 N N   . ASP A 1  783 ? 1.951   -48.685 -29.772 1.00 18.24  ? 861  ASP A N   1 
ATOM   6042 C CA  . ASP A 1  783 ? 0.888   -48.814 -30.776 1.00 19.71  ? 861  ASP A CA  1 
ATOM   6043 C C   . ASP A 1  783 ? 0.242   -47.477 -31.179 1.00 18.22  ? 861  ASP A C   1 
ATOM   6044 O O   . ASP A 1  783 ? -0.678  -47.442 -32.007 1.00 19.81  ? 861  ASP A O   1 
ATOM   6045 C CB  . ASP A 1  783 ? -0.165  -49.846 -30.329 1.00 21.44  ? 861  ASP A CB  1 
ATOM   6046 C CG  . ASP A 1  783 ? -1.070  -49.347 -29.203 1.00 22.89  ? 861  ASP A CG  1 
ATOM   6047 O OD1 . ASP A 1  783 ? -1.813  -50.190 -28.701 1.00 24.75  ? 861  ASP A OD1 1 
ATOM   6048 O OD2 . ASP A 1  783 ? -1.076  -48.135 -28.840 1.00 20.01  ? 861  ASP A OD2 1 
ATOM   6049 N N   . GLY A 1  784 ? 0.692   -46.384 -30.574 1.00 17.69  ? 862  GLY A N   1 
ATOM   6050 C CA  . GLY A 1  784 ? 0.234   -45.064 -30.944 1.00 17.96  ? 862  GLY A CA  1 
ATOM   6051 C C   . GLY A 1  784 ? -0.997  -44.539 -30.247 1.00 18.22  ? 862  GLY A C   1 
ATOM   6052 O O   . GLY A 1  784 ? -1.263  -43.353 -30.356 1.00 17.37  ? 862  GLY A O   1 
ATOM   6053 N N   . GLU A 1  785 ? -1.772  -45.378 -29.545 1.00 18.56  ? 863  GLU A N   1 
ATOM   6054 C CA  . GLU A 1  785 ? -2.995  -44.870 -28.883 1.00 21.06  ? 863  GLU A CA  1 
ATOM   6055 C C   . GLU A 1  785 ? -3.519  -45.555 -27.623 1.00 20.92  ? 863  GLU A C   1 
ATOM   6056 O O   . GLU A 1  785 ? -4.422  -45.004 -26.989 1.00 19.72  ? 863  GLU A O   1 
ATOM   6057 C CB  . GLU A 1  785 ? -4.144  -44.754 -29.909 1.00 25.42  ? 863  GLU A CB  1 
ATOM   6058 C CG  . GLU A 1  785 ? -4.668  -46.074 -30.408 1.00 30.73  ? 863  GLU A CG  1 
ATOM   6059 C CD  . GLU A 1  785 ? -5.368  -45.984 -31.763 1.00 48.94  ? 863  GLU A CD  1 
ATOM   6060 O OE1 . GLU A 1  785 ? -5.053  -46.797 -32.665 1.00 53.09  ? 863  GLU A OE1 1 
ATOM   6061 O OE2 . GLU A 1  785 ? -6.236  -45.117 -31.938 1.00 34.37  ? 863  GLU A OE2 1 
ATOM   6062 N N   . SER A 1  786 ? -2.982  -46.711 -27.228 1.00 18.80  ? 864  SER A N   1 
ATOM   6063 C CA  . SER A 1  786 ? -3.505  -47.401 -26.053 1.00 18.81  ? 864  SER A CA  1 
ATOM   6064 C C   . SER A 1  786 ? -3.181  -46.710 -24.761 1.00 20.63  ? 864  SER A C   1 
ATOM   6065 O O   . SER A 1  786 ? -2.180  -45.981 -24.657 1.00 19.04  ? 864  SER A O   1 
ATOM   6066 C CB  . SER A 1  786 ? -2.984  -48.842 -25.952 1.00 19.89  ? 864  SER A CB  1 
ATOM   6067 O OG  . SER A 1  786 ? -3.521  -49.600 -26.993 1.00 22.41  ? 864  SER A OG  1 
ATOM   6068 N N   . LEU A 1  787 ? -4.036  -46.987 -23.769 1.00 22.22  ? 865  LEU A N   1 
ATOM   6069 C CA  . LEU A 1  787 ? -3.847  -46.527 -22.402 1.00 24.69  ? 865  LEU A CA  1 
ATOM   6070 C C   . LEU A 1  787 ? -2.849  -47.431 -21.701 1.00 28.78  ? 865  LEU A C   1 
ATOM   6071 O O   . LEU A 1  787 ? -2.679  -48.576 -22.105 1.00 22.59  ? 865  LEU A O   1 
ATOM   6072 C CB  . LEU A 1  787 ? -5.180  -46.568 -21.635 1.00 34.84  ? 865  LEU A CB  1 
ATOM   6073 C CG  . LEU A 1  787 ? -6.306  -45.697 -22.221 1.00 33.87  ? 865  LEU A CG  1 
ATOM   6074 C CD1 . LEU A 1  787 ? -7.651  -46.036 -21.603 1.00 46.23  ? 865  LEU A CD1 1 
ATOM   6075 C CD2 . LEU A 1  787 ? -5.955  -44.245 -22.015 1.00 32.59  ? 865  LEU A CD2 1 
ATOM   6076 N N   . GLU A 1  788 ? -2.197  -46.884 -20.670 1.00 29.53  ? 866  GLU A N   1 
ATOM   6077 C CA  . GLU A 1  788 ? -1.314  -47.618 -19.736 1.00 32.43  ? 866  GLU A CA  1 
ATOM   6078 C C   . GLU A 1  788 ? -0.164  -48.393 -20.403 1.00 35.56  ? 866  GLU A C   1 
ATOM   6079 O O   . GLU A 1  788 ? 0.271   -49.429 -19.914 1.00 35.27  ? 866  GLU A O   1 
ATOM   6080 C CB  . GLU A 1  788 ? -2.171  -48.516 -18.824 1.00 35.44  ? 866  GLU A CB  1 
ATOM   6081 C CG  . GLU A 1  788 ? -3.154  -47.693 -17.980 1.00 40.72  ? 866  GLU A CG  1 
ATOM   6082 C CD  . GLU A 1  788 ? -4.117  -48.516 -17.141 1.00 45.31  ? 866  GLU A CD  1 
ATOM   6083 O OE1 . GLU A 1  788 ? -4.484  -49.644 -17.531 1.00 43.28  ? 866  GLU A OE1 1 
ATOM   6084 O OE2 . GLU A 1  788 ? -4.531  -48.003 -16.083 1.00 56.63  ? 866  GLU A OE2 1 
ATOM   6085 N N   . VAL A 1  789 ? 0.341   -47.861 -21.511 1.00 30.35  ? 867  VAL A N   1 
ATOM   6086 C CA  . VAL A 1  789 ? 1.418   -48.494 -22.252 1.00 27.94  ? 867  VAL A CA  1 
ATOM   6087 C C   . VAL A 1  789 ? 2.649   -48.722 -21.368 1.00 27.06  ? 867  VAL A C   1 
ATOM   6088 O O   . VAL A 1  789 ? 3.202   -49.818 -21.373 1.00 26.05  ? 867  VAL A O   1 
ATOM   6089 C CB  . VAL A 1  789 ? 1.798   -47.677 -23.518 1.00 24.10  ? 867  VAL A CB  1 
ATOM   6090 C CG1 . VAL A 1  789 ? 3.156   -48.099 -24.079 1.00 24.25  ? 867  VAL A CG1 1 
ATOM   6091 C CG2 . VAL A 1  789 ? 0.719   -47.851 -24.575 1.00 21.41  ? 867  VAL A CG2 1 
ATOM   6092 N N   . LEU A 1  790 ? 3.089   -47.690 -20.654 1.00 24.58  ? 868  LEU A N   1 
ATOM   6093 C CA  . LEU A 1  790 ? 4.327   -47.785 -19.879 1.00 30.56  ? 868  LEU A CA  1 
ATOM   6094 C C   . LEU A 1  790 ? 4.163   -48.740 -18.701 1.00 33.20  ? 868  LEU A C   1 
ATOM   6095 O O   . LEU A 1  790 ? 5.021   -49.605 -18.457 1.00 32.96  ? 868  LEU A O   1 
ATOM   6096 C CB  . LEU A 1  790 ? 4.809   -46.411 -19.407 1.00 30.50  ? 868  LEU A CB  1 
ATOM   6097 C CG  . LEU A 1  790 ? 5.041   -45.390 -20.519 1.00 26.06  ? 868  LEU A CG  1 
ATOM   6098 C CD1 . LEU A 1  790 ? 5.504   -44.083 -19.901 1.00 32.45  ? 868  LEU A CD1 1 
ATOM   6099 C CD2 . LEU A 1  790 ? 6.061   -45.893 -21.520 1.00 28.34  ? 868  LEU A CD2 1 
ATOM   6100 N N   . GLU A 1  791 ? 3.026   -48.628 -18.033 1.00 33.73  ? 869  GLU A N   1 
ATOM   6101 C CA  . GLU A 1  791 ? 2.689   -49.504 -16.922 1.00 37.68  ? 869  GLU A CA  1 
ATOM   6102 C C   . GLU A 1  791 ? 2.694   -50.957 -17.366 1.00 36.63  ? 869  GLU A C   1 
ATOM   6103 O O   . GLU A 1  791 ? 3.187   -51.818 -16.648 1.00 41.51  ? 869  GLU A O   1 
ATOM   6104 C CB  . GLU A 1  791 ? 1.326   -49.106 -16.348 1.00 52.79  ? 869  GLU A CB  1 
ATOM   6105 C CG  . GLU A 1  791 ? 1.074   -49.572 -14.926 1.00 72.24  ? 869  GLU A CG  1 
ATOM   6106 C CD  . GLU A 1  791 ? -0.318  -49.210 -14.434 1.00 87.72  ? 869  GLU A CD  1 
ATOM   6107 O OE1 . GLU A 1  791 ? -0.931  -48.258 -14.973 1.00 65.84  ? 869  GLU A OE1 1 
ATOM   6108 O OE2 . GLU A 1  791 ? -0.803  -49.888 -13.501 1.00 122.48 ? 869  GLU A OE2 1 
ATOM   6109 N N   . ARG A 1  792 ? 2.188   -51.222 -18.568 1.00 34.21  ? 870  ARG A N   1 
ATOM   6110 C CA  . ARG A 1  792 ? 2.108   -52.588 -19.095 1.00 29.00  ? 870  ARG A CA  1 
ATOM   6111 C C   . ARG A 1  792 ? 3.342   -53.063 -19.879 1.00 27.34  ? 870  ARG A C   1 
ATOM   6112 O O   . ARG A 1  792 ? 3.412   -54.227 -20.238 1.00 27.65  ? 870  ARG A O   1 
ATOM   6113 C CB  . ARG A 1  792 ? 0.860   -52.742 -19.962 1.00 35.54  ? 870  ARG A CB  1 
ATOM   6114 C CG  . ARG A 1  792 ? -0.438  -52.546 -19.188 1.00 40.11  ? 870  ARG A CG  1 
ATOM   6115 C CD  . ARG A 1  792 ? -1.682  -52.635 -20.063 1.00 40.66  ? 870  ARG A CD  1 
ATOM   6116 N NE  . ARG A 1  792 ? -1.638  -51.640 -21.139 1.00 46.95  ? 870  ARG A NE  1 
ATOM   6117 C CZ  . ARG A 1  792 ? -1.383  -51.886 -22.429 1.00 50.72  ? 870  ARG A CZ  1 
ATOM   6118 N NH1 . ARG A 1  792 ? -1.148  -53.125 -22.874 1.00 42.96  ? 870  ARG A NH1 1 
ATOM   6119 N NH2 . ARG A 1  792 ? -1.364  -50.866 -23.293 1.00 33.23  ? 870  ARG A NH2 1 
ATOM   6120 N N   . GLY A 1  793 ? 4.298   -52.179 -20.143 1.00 27.78  ? 871  GLY A N   1 
ATOM   6121 C CA  . GLY A 1  793 ? 5.488   -52.529 -20.905 1.00 28.85  ? 871  GLY A CA  1 
ATOM   6122 C C   . GLY A 1  793 ? 5.230   -52.809 -22.379 1.00 24.62  ? 871  GLY A C   1 
ATOM   6123 O O   . GLY A 1  793 ? 6.013   -53.509 -23.020 1.00 25.64  ? 871  GLY A O   1 
ATOM   6124 N N   . ALA A 1  794 ? 4.160   -52.237 -22.932 1.00 22.77  ? 872  ALA A N   1 
ATOM   6125 C CA  . ALA A 1  794 ? 3.780   -52.481 -24.333 1.00 21.96  ? 872  ALA A CA  1 
ATOM   6126 C C   . ALA A 1  794 ? 4.440   -51.449 -25.256 1.00 24.73  ? 872  ALA A C   1 
ATOM   6127 O O   . ALA A 1  794 ? 3.768   -50.751 -26.023 1.00 22.82  ? 872  ALA A O   1 
ATOM   6128 C CB  . ALA A 1  794 ? 2.270   -52.442 -24.472 1.00 22.45  ? 872  ALA A CB  1 
ATOM   6129 N N   . TYR A 1  795 ? 5.763   -51.376 -25.194 1.00 21.29  ? 873  TYR A N   1 
ATOM   6130 C CA  . TYR A 1  795 ? 6.522   -50.437 -26.003 1.00 21.94  ? 873  TYR A CA  1 
ATOM   6131 C C   . TYR A 1  795 ? 7.922   -50.949 -26.290 1.00 25.62  ? 873  TYR A C   1 
ATOM   6132 O O   . TYR A 1  795 ? 8.479   -51.774 -25.556 1.00 26.14  ? 873  TYR A O   1 
ATOM   6133 C CB  . TYR A 1  795 ? 6.608   -49.090 -25.304 1.00 22.69  ? 873  TYR A CB  1 
ATOM   6134 C CG  . TYR A 1  795 ? 7.424   -49.112 -24.044 1.00 24.53  ? 873  TYR A CG  1 
ATOM   6135 C CD1 . TYR A 1  795 ? 6.842   -49.414 -22.818 1.00 22.41  ? 873  TYR A CD1 1 
ATOM   6136 C CD2 . TYR A 1  795 ? 8.785   -48.841 -24.082 1.00 25.37  ? 873  TYR A CD2 1 
ATOM   6137 C CE1 . TYR A 1  795 ? 7.599   -49.431 -21.653 1.00 26.68  ? 873  TYR A CE1 1 
ATOM   6138 C CE2 . TYR A 1  795 ? 9.547   -48.851 -22.934 1.00 30.25  ? 873  TYR A CE2 1 
ATOM   6139 C CZ  . TYR A 1  795 ? 8.953   -49.135 -21.725 1.00 32.21  ? 873  TYR A CZ  1 
ATOM   6140 O OH  . TYR A 1  795 ? 9.738   -49.127 -20.605 1.00 35.78  ? 873  TYR A OH  1 
ATOM   6141 N N   . THR A 1  796 ? 8.489   -50.420 -27.358 1.00 20.33  ? 874  THR A N   1 
ATOM   6142 C CA  . THR A 1  796 ? 9.848   -50.692 -27.755 1.00 19.66  ? 874  THR A CA  1 
ATOM   6143 C C   . THR A 1  796 ? 10.647  -49.411 -27.557 1.00 19.75  ? 874  THR A C   1 
ATOM   6144 O O   . THR A 1  796 ? 10.141  -48.299 -27.772 1.00 20.42  ? 874  THR A O   1 
ATOM   6145 C CB  . THR A 1  796 ? 9.841   -51.178 -29.206 1.00 19.95  ? 874  THR A CB  1 
ATOM   6146 O OG1 . THR A 1  796 ? 9.225   -52.478 -29.232 1.00 17.18  ? 874  THR A OG1 1 
ATOM   6147 C CG2 . THR A 1  796 ? 11.239  -51.242 -29.801 1.00 21.36  ? 874  THR A CG2 1 
ATOM   6148 N N   . GLN A 1  797 ? 11.880  -49.575 -27.105 1.00 20.11  ? 875  GLN A N   1 
ATOM   6149 C CA  . GLN A 1  797 ? 12.790  -48.460 -26.843 1.00 23.02  ? 875  GLN A CA  1 
ATOM   6150 C C   . GLN A 1  797 ? 14.187  -48.869 -27.283 1.00 22.02  ? 875  GLN A C   1 
ATOM   6151 O O   . GLN A 1  797 ? 14.709  -49.896 -26.851 1.00 23.22  ? 875  GLN A O   1 
ATOM   6152 C CB  . GLN A 1  797 ? 12.805  -48.102 -25.369 1.00 23.29  ? 875  GLN A CB  1 
ATOM   6153 C CG  . GLN A 1  797 ? 13.620  -46.859 -25.083 1.00 30.50  ? 875  GLN A CG  1 
ATOM   6154 C CD  . GLN A 1  797 ? 13.219  -46.212 -23.778 1.00 43.20  ? 875  GLN A CD  1 
ATOM   6155 O OE1 . GLN A 1  797 ? 13.049  -45.000 -23.700 1.00 48.86  ? 875  GLN A OE1 1 
ATOM   6156 N NE2 . GLN A 1  797 ? 13.033  -47.027 -22.753 1.00 41.54  ? 875  GLN A NE2 1 
ATOM   6157 N N   . VAL A 1  798 ? 14.775  -48.068 -28.159 1.00 22.67  ? 876  VAL A N   1 
ATOM   6158 C CA  . VAL A 1  798 ? 16.048  -48.393 -28.764 1.00 21.58  ? 876  VAL A CA  1 
ATOM   6159 C C   . VAL A 1  798 ? 16.956  -47.174 -28.687 1.00 19.95  ? 876  VAL A C   1 
ATOM   6160 O O   . VAL A 1  798 ? 16.514  -46.052 -28.902 1.00 20.23  ? 876  VAL A O   1 
ATOM   6161 C CB  . VAL A 1  798 ? 15.866  -48.848 -30.233 1.00 23.16  ? 876  VAL A CB  1 
ATOM   6162 C CG1 . VAL A 1  798 ? 17.219  -49.153 -30.871 1.00 25.46  ? 876  VAL A CG1 1 
ATOM   6163 C CG2 . VAL A 1  798 ? 14.988  -50.090 -30.300 1.00 25.26  ? 876  VAL A CG2 1 
ATOM   6164 N N   . ILE A 1  799 ? 18.221  -47.412 -28.359 1.00 20.99  ? 877  ILE A N   1 
ATOM   6165 C CA  . ILE A 1  799 ? 19.246  -46.387 -28.383 1.00 20.55  ? 877  ILE A CA  1 
ATOM   6166 C C   . ILE A 1  799 ? 20.128  -46.646 -29.602 1.00 20.59  ? 877  ILE A C   1 
ATOM   6167 O O   . ILE A 1  799 ? 20.377  -47.787 -29.947 1.00 21.17  ? 877  ILE A O   1 
ATOM   6168 C CB  . ILE A 1  799 ? 20.049  -46.390 -27.062 1.00 24.77  ? 877  ILE A CB  1 
ATOM   6169 C CG1 . ILE A 1  799 ? 19.161  -45.870 -25.923 1.00 27.52  ? 877  ILE A CG1 1 
ATOM   6170 C CG2 . ILE A 1  799 ? 21.288  -45.508 -27.165 1.00 26.60  ? 877  ILE A CG2 1 
ATOM   6171 C CD1 . ILE A 1  799 ? 19.753  -46.077 -24.536 1.00 36.95  ? 877  ILE A CD1 1 
ATOM   6172 N N   . PHE A 1  800 ? 20.556  -45.580 -30.264 1.00 18.79  ? 878  PHE A N   1 
ATOM   6173 C CA  . PHE A 1  800 ? 21.506  -45.637 -31.380 1.00 20.35  ? 878  PHE A CA  1 
ATOM   6174 C C   . PHE A 1  800 ? 22.815  -44.983 -30.955 1.00 20.37  ? 878  PHE A C   1 
ATOM   6175 O O   . PHE A 1  800 ? 22.805  -43.935 -30.326 1.00 20.06  ? 878  PHE A O   1 
ATOM   6176 C CB  . PHE A 1  800 ? 20.929  -44.935 -32.618 1.00 20.20  ? 878  PHE A CB  1 
ATOM   6177 C CG  . PHE A 1  800 ? 19.538  -45.393 -32.967 1.00 20.70  ? 878  PHE A CG  1 
ATOM   6178 C CD1 . PHE A 1  800 ? 19.330  -46.649 -33.545 1.00 18.50  ? 878  PHE A CD1 1 
ATOM   6179 C CD2 . PHE A 1  800 ? 18.433  -44.610 -32.644 1.00 21.74  ? 878  PHE A CD2 1 
ATOM   6180 C CE1 . PHE A 1  800 ? 18.048  -47.085 -33.841 1.00 21.78  ? 878  PHE A CE1 1 
ATOM   6181 C CE2 . PHE A 1  800 ? 17.141  -45.045 -32.934 1.00 21.31  ? 878  PHE A CE2 1 
ATOM   6182 C CZ  . PHE A 1  800 ? 16.949  -46.287 -33.529 1.00 22.71  ? 878  PHE A CZ  1 
ATOM   6183 N N   . LEU A 1  801 ? 23.940  -45.585 -31.326 1.00 23.31  ? 879  LEU A N   1 
ATOM   6184 C CA  . LEU A 1  801 ? 25.258  -45.047 -30.973 1.00 24.63  ? 879  LEU A CA  1 
ATOM   6185 C C   . LEU A 1  801 ? 26.184  -45.092 -32.173 1.00 20.85  ? 879  LEU A C   1 
ATOM   6186 O O   . LEU A 1  801 ? 26.332  -46.136 -32.776 1.00 19.59  ? 879  LEU A O   1 
ATOM   6187 C CB  . LEU A 1  801 ? 25.861  -45.877 -29.848 1.00 25.93  ? 879  LEU A CB  1 
ATOM   6188 C CG  . LEU A 1  801 ? 25.125  -45.839 -28.509 1.00 28.82  ? 879  LEU A CG  1 
ATOM   6189 C CD1 . LEU A 1  801 ? 25.600  -46.994 -27.628 1.00 32.41  ? 879  LEU A CD1 1 
ATOM   6190 C CD2 . LEU A 1  801 ? 25.330  -44.492 -27.817 1.00 30.14  ? 879  LEU A CD2 1 
ATOM   6191 N N   . ALA A 1  802 ? 26.758  -43.956 -32.548 1.00 19.61  ? 880  ALA A N   1 
ATOM   6192 C CA  . ALA A 1  802 ? 27.848  -43.942 -33.507 1.00 19.55  ? 880  ALA A CA  1 
ATOM   6193 C C   . ALA A 1  802 ? 29.169  -43.734 -32.761 1.00 23.21  ? 880  ALA A C   1 
ATOM   6194 O O   . ALA A 1  802 ? 29.264  -42.907 -31.834 1.00 24.11  ? 880  ALA A O   1 
ATOM   6195 C CB  . ALA A 1  802 ? 27.644  -42.872 -34.573 1.00 17.74  ? 880  ALA A CB  1 
ATOM   6196 N N   . ARG A 1  803 ? 30.186  -44.488 -33.172 1.00 22.63  ? 881  ARG A N   1 
ATOM   6197 C CA  . ARG A 1  803 ? 31.517  -44.425 -32.549 1.00 29.91  ? 881  ARG A CA  1 
ATOM   6198 C C   . ARG A 1  803 ? 32.507  -45.100 -33.476 1.00 27.84  ? 881  ARG A C   1 
ATOM   6199 O O   . ARG A 1  803 ? 32.216  -46.177 -33.995 1.00 26.76  ? 881  ARG A O   1 
ATOM   6200 C CB  . ARG A 1  803 ? 31.515  -45.148 -31.187 1.00 34.38  ? 881  ARG A CB  1 
ATOM   6201 C CG  . ARG A 1  803 ? 32.891  -45.327 -30.560 1.00 42.89  ? 881  ARG A CG  1 
ATOM   6202 C CD  . ARG A 1  803 ? 32.849  -46.102 -29.254 1.00 50.34  ? 881  ARG A CD  1 
ATOM   6203 N NE  . ARG A 1  803 ? 32.037  -45.451 -28.221 1.00 66.91  ? 881  ARG A NE  1 
ATOM   6204 C CZ  . ARG A 1  803 ? 32.407  -44.407 -27.474 1.00 63.86  ? 881  ARG A CZ  1 
ATOM   6205 N NH1 . ARG A 1  803 ? 31.566  -43.927 -26.561 1.00 58.44  ? 881  ARG A NH1 1 
ATOM   6206 N NH2 . ARG A 1  803 ? 33.598  -43.828 -27.623 1.00 73.68  ? 881  ARG A NH2 1 
ATOM   6207 N N   . ASN A 1  804 ? 33.661  -44.485 -33.698 1.00 26.54  ? 882  ASN A N   1 
ATOM   6208 C CA  . ASN A 1  804 ? 34.747  -45.160 -34.417 1.00 31.06  ? 882  ASN A CA  1 
ATOM   6209 C C   . ASN A 1  804 ? 34.291  -45.804 -35.745 1.00 30.04  ? 882  ASN A C   1 
ATOM   6210 O O   . ASN A 1  804 ? 34.532  -46.987 -36.021 1.00 29.76  ? 882  ASN A O   1 
ATOM   6211 C CB  . ASN A 1  804 ? 35.377  -46.214 -33.490 1.00 37.88  ? 882  ASN A CB  1 
ATOM   6212 C CG  . ASN A 1  804 ? 36.740  -46.694 -33.976 1.00 50.28  ? 882  ASN A CG  1 
ATOM   6213 O OD1 . ASN A 1  804 ? 37.432  -45.979 -34.704 1.00 58.19  ? 882  ASN A OD1 1 
ATOM   6214 N ND2 . ASN A 1  804 ? 37.129  -47.911 -33.576 1.00 67.42  ? 882  ASN A ND2 1 
ATOM   6215 N N   . ASN A 1  805 ? 33.593  -45.018 -36.556 1.00 27.90  ? 883  ASN A N   1 
ATOM   6216 C CA  . ASN A 1  805 ? 33.093  -45.467 -37.855 1.00 26.79  ? 883  ASN A CA  1 
ATOM   6217 C C   . ASN A 1  805 ? 32.153  -46.679 -37.800 1.00 27.00  ? 883  ASN A C   1 
ATOM   6218 O O   . ASN A 1  805 ? 32.111  -47.455 -38.743 1.00 29.24  ? 883  ASN A O   1 
ATOM   6219 C CB  . ASN A 1  805 ? 34.261  -45.761 -38.818 1.00 29.06  ? 883  ASN A CB  1 
ATOM   6220 C CG  . ASN A 1  805 ? 35.083  -44.529 -39.126 1.00 30.17  ? 883  ASN A CG  1 
ATOM   6221 O OD1 . ASN A 1  805 ? 35.118  -43.592 -38.351 1.00 35.60  ? 883  ASN A OD1 1 
ATOM   6222 N ND2 . ASN A 1  805 ? 35.726  -44.523 -40.262 1.00 33.86  ? 883  ASN A ND2 1 
ATOM   6223 N N   . THR A 1  806 ? 31.427  -46.841 -36.694 1.00 24.48  ? 884  THR A N   1 
ATOM   6224 C CA  . THR A 1  806 ? 30.363  -47.822 -36.607 1.00 26.95  ? 884  THR A CA  1 
ATOM   6225 C C   . THR A 1  806 ? 29.103  -47.148 -36.090 1.00 25.93  ? 884  THR A C   1 
ATOM   6226 O O   . THR A 1  806 ? 29.182  -46.152 -35.390 1.00 24.45  ? 884  THR A O   1 
ATOM   6227 C CB  . THR A 1  806 ? 30.701  -48.993 -35.664 1.00 25.13  ? 884  THR A CB  1 
ATOM   6228 O OG1 . THR A 1  806 ? 30.653  -48.546 -34.297 1.00 22.95  ? 884  THR A OG1 1 
ATOM   6229 C CG2 . THR A 1  806 ? 32.078  -49.560 -35.984 1.00 25.20  ? 884  THR A CG2 1 
ATOM   6230 N N   . ILE A 1  807 ? 27.951  -47.694 -36.470 1.00 24.19  ? 885  ILE A N   1 
ATOM   6231 C CA  . ILE A 1  807 ? 26.651  -47.317 -35.922 1.00 23.77  ? 885  ILE A CA  1 
ATOM   6232 C C   . ILE A 1  807 ? 25.996  -48.613 -35.438 1.00 25.39  ? 885  ILE A C   1 
ATOM   6233 O O   . ILE A 1  807 ? 25.982  -49.618 -36.167 1.00 23.87  ? 885  ILE A O   1 
ATOM   6234 C CB  . ILE A 1  807 ? 25.771  -46.607 -36.984 1.00 24.76  ? 885  ILE A CB  1 
ATOM   6235 C CG1 . ILE A 1  807 ? 26.418  -45.280 -37.397 1.00 23.66  ? 885  ILE A CG1 1 
ATOM   6236 C CG2 . ILE A 1  807 ? 24.371  -46.334 -36.434 1.00 22.96  ? 885  ILE A CG2 1 
ATOM   6237 C CD1 . ILE A 1  807 ? 26.039  -44.842 -38.786 1.00 27.26  ? 885  ILE A CD1 1 
ATOM   6238 N N   . VAL A 1  808 ? 25.503  -48.606 -34.198 1.00 22.41  ? 886  VAL A N   1 
ATOM   6239 C CA  . VAL A 1  808 ? 24.844  -49.768 -33.608 1.00 22.47  ? 886  VAL A CA  1 
ATOM   6240 C C   . VAL A 1  808 ? 23.570  -49.315 -32.927 1.00 23.78  ? 886  VAL A C   1 
ATOM   6241 O O   . VAL A 1  808 ? 23.444  -48.154 -32.525 1.00 25.51  ? 886  VAL A O   1 
ATOM   6242 C CB  . VAL A 1  808 ? 25.699  -50.516 -32.550 1.00 24.40  ? 886  VAL A CB  1 
ATOM   6243 C CG1 . VAL A 1  808 ? 26.960  -51.126 -33.165 1.00 24.49  ? 886  VAL A CG1 1 
ATOM   6244 C CG2 . VAL A 1  808 ? 26.050  -49.612 -31.364 1.00 24.72  ? 886  VAL A CG2 1 
ATOM   6245 N N   . ASN A 1  809 ? 22.641  -50.251 -32.765 1.00 21.75  ? 887  ASN A N   1 
ATOM   6246 C CA  . ASN A 1  809 ? 21.515  -50.060 -31.856 1.00 21.56  ? 887  ASN A CA  1 
ATOM   6247 C C   . ASN A 1  809 ? 21.760  -50.810 -30.533 1.00 23.50  ? 887  ASN A C   1 
ATOM   6248 O O   . ASN A 1  809 ? 22.495  -51.795 -30.476 1.00 26.97  ? 887  ASN A O   1 
ATOM   6249 C CB  . ASN A 1  809 ? 20.162  -50.446 -32.485 1.00 20.88  ? 887  ASN A CB  1 
ATOM   6250 C CG  . ASN A 1  809 ? 20.134  -51.862 -33.014 1.00 23.11  ? 887  ASN A CG  1 
ATOM   6251 O OD1 . ASN A 1  809 ? 21.178  -52.475 -33.217 1.00 23.43  ? 887  ASN A OD1 1 
ATOM   6252 N ND2 . ASN A 1  809 ? 18.933  -52.381 -33.274 1.00 25.87  ? 887  ASN A ND2 1 
ATOM   6253 N N   . GLU A 1  810 ? 21.113  -50.335 -29.492 1.00 19.65  ? 888  GLU A N   1 
ATOM   6254 C CA  . GLU A 1  810 ? 21.142  -50.964 -28.190 1.00 27.81  ? 888  GLU A CA  1 
ATOM   6255 C C   . GLU A 1  810 ? 19.683  -51.147 -27.785 1.00 23.69  ? 888  GLU A C   1 
ATOM   6256 O O   . GLU A 1  810 ? 18.904  -50.199 -27.802 1.00 22.39  ? 888  GLU A O   1 
ATOM   6257 C CB  . GLU A 1  810 ? 21.908  -50.063 -27.227 1.00 27.57  ? 888  GLU A CB  1 
ATOM   6258 C CG  . GLU A 1  810 ? 22.115  -50.611 -25.843 1.00 38.68  ? 888  GLU A CG  1 
ATOM   6259 C CD  . GLU A 1  810 ? 22.525  -49.522 -24.869 1.00 50.76  ? 888  GLU A CD  1 
ATOM   6260 O OE1 . GLU A 1  810 ? 21.908  -49.430 -23.782 1.00 59.09  ? 888  GLU A OE1 1 
ATOM   6261 O OE2 . GLU A 1  810 ? 23.446  -48.745 -25.210 1.00 47.77  ? 888  GLU A OE2 1 
ATOM   6262 N N   . LEU A 1  811 ? 19.309  -52.381 -27.472 1.00 22.31  ? 889  LEU A N   1 
ATOM   6263 C CA  . LEU A 1  811 ? 17.911  -52.737 -27.311 1.00 23.71  ? 889  LEU A CA  1 
ATOM   6264 C C   . LEU A 1  811 ? 17.547  -52.610 -25.836 1.00 28.31  ? 889  LEU A C   1 
ATOM   6265 O O   . LEU A 1  811 ? 17.893  -53.464 -25.032 1.00 26.29  ? 889  LEU A O   1 
ATOM   6266 C CB  . LEU A 1  811 ? 17.679  -54.160 -27.821 1.00 24.96  ? 889  LEU A CB  1 
ATOM   6267 C CG  . LEU A 1  811 ? 18.153  -54.460 -29.255 1.00 26.14  ? 889  LEU A CG  1 
ATOM   6268 C CD1 . LEU A 1  811 ? 18.024  -55.944 -29.569 1.00 28.48  ? 889  LEU A CD1 1 
ATOM   6269 C CD2 . LEU A 1  811 ? 17.391  -53.624 -30.260 1.00 26.30  ? 889  LEU A CD2 1 
ATOM   6270 N N   . VAL A 1  812 ? 16.861  -51.536 -25.477 1.00 26.56  ? 890  VAL A N   1 
ATOM   6271 C CA  . VAL A 1  812 ? 16.458  -51.322 -24.085 1.00 28.06  ? 890  VAL A CA  1 
ATOM   6272 C C   . VAL A 1  812 ? 15.211  -52.156 -23.795 1.00 28.62  ? 890  VAL A C   1 
ATOM   6273 O O   . VAL A 1  812 ? 15.135  -52.829 -22.782 1.00 24.85  ? 890  VAL A O   1 
ATOM   6274 C CB  . VAL A 1  812 ? 16.253  -49.835 -23.782 1.00 29.62  ? 890  VAL A CB  1 
ATOM   6275 C CG1 . VAL A 1  812 ? 15.827  -49.632 -22.332 1.00 32.17  ? 890  VAL A CG1 1 
ATOM   6276 C CG2 . VAL A 1  812 ? 17.542  -49.074 -24.112 1.00 27.76  ? 890  VAL A CG2 1 
ATOM   6277 N N   . ARG A 1  813 ? 14.245  -52.121 -24.701 1.00 24.68  ? 891  ARG A N   1 
ATOM   6278 C CA  . ARG A 1  813 ? 13.095  -52.978 -24.605 1.00 25.33  ? 891  ARG A CA  1 
ATOM   6279 C C   . ARG A 1  813 ? 12.602  -53.216 -26.006 1.00 25.66  ? 891  ARG A C   1 
ATOM   6280 O O   . ARG A 1  813 ? 12.609  -52.305 -26.836 1.00 23.75  ? 891  ARG A O   1 
ATOM   6281 C CB  . ARG A 1  813 ? 12.001  -52.355 -23.735 1.00 27.77  ? 891  ARG A CB  1 
ATOM   6282 C CG  . ARG A 1  813 ? 10.849  -53.303 -23.444 1.00 32.34  ? 891  ARG A CG  1 
ATOM   6283 C CD  . ARG A 1  813 ? 9.852   -52.692 -22.471 1.00 30.53  ? 891  ARG A CD  1 
ATOM   6284 N NE  . ARG A 1  813 ? 8.797   -53.657 -22.177 1.00 34.15  ? 891  ARG A NE  1 
ATOM   6285 C CZ  . ARG A 1  813 ? 8.916   -54.697 -21.345 1.00 42.86  ? 891  ARG A CZ  1 
ATOM   6286 N NH1 . ARG A 1  813 ? 10.049  -54.932 -20.669 1.00 42.13  ? 891  ARG A NH1 1 
ATOM   6287 N NH2 . ARG A 1  813 ? 7.882   -55.516 -21.183 1.00 45.43  ? 891  ARG A NH2 1 
ATOM   6288 N N   . VAL A 1  814 ? 12.214  -54.451 -26.276 1.00 22.33  ? 892  VAL A N   1 
ATOM   6289 C CA  . VAL A 1  814 ? 11.677  -54.815 -27.567 1.00 26.64  ? 892  VAL A CA  1 
ATOM   6290 C C   . VAL A 1  814 ? 10.419  -55.651 -27.343 1.00 26.72  ? 892  VAL A C   1 
ATOM   6291 O O   . VAL A 1  814 ? 10.457  -56.647 -26.629 1.00 30.99  ? 892  VAL A O   1 
ATOM   6292 C CB  . VAL A 1  814 ? 12.708  -55.594 -28.419 1.00 28.78  ? 892  VAL A CB  1 
ATOM   6293 C CG1 . VAL A 1  814 ? 12.082  -56.032 -29.743 1.00 29.91  ? 892  VAL A CG1 1 
ATOM   6294 C CG2 . VAL A 1  814 ? 13.924  -54.716 -28.703 1.00 31.25  ? 892  VAL A CG2 1 
ATOM   6295 N N   . THR A 1  815 ? 9.321   -55.234 -27.970 1.00 26.68  ? 893  THR A N   1 
ATOM   6296 C CA  . THR A 1  815 ? 8.027   -55.899 -27.857 1.00 25.77  ? 893  THR A CA  1 
ATOM   6297 C C   . THR A 1  815 ? 7.399   -56.040 -29.228 1.00 28.01  ? 893  THR A C   1 
ATOM   6298 O O   . THR A 1  815 ? 7.969   -55.587 -30.237 1.00 24.34  ? 893  THR A O   1 
ATOM   6299 C CB  . THR A 1  815 ? 7.063   -55.125 -26.918 1.00 26.20  ? 893  THR A CB  1 
ATOM   6300 O OG1 . THR A 1  815 ? 6.871   -53.795 -27.405 1.00 23.72  ? 893  THR A OG1 1 
ATOM   6301 C CG2 . THR A 1  815 ? 7.609   -55.107 -25.497 1.00 28.50  ? 893  THR A CG2 1 
ATOM   6302 N N   . SER A 1  816 ? 6.240   -56.704 -29.269 1.00 31.18  ? 894  SER A N   1 
ATOM   6303 C CA  . SER A 1  816 ? 5.464   -56.875 -30.511 1.00 35.89  ? 894  SER A CA  1 
ATOM   6304 C C   . SER A 1  816 ? 5.227   -55.553 -31.264 1.00 35.06  ? 894  SER A C   1 
ATOM   6305 O O   . SER A 1  816 ? 5.402   -55.478 -32.467 1.00 28.39  ? 894  SER A O   1 
ATOM   6306 C CB  . SER A 1  816 ? 4.114   -57.533 -30.213 1.00 33.70  ? 894  SER A CB  1 
ATOM   6307 O OG  . SER A 1  816 ? 3.340   -56.727 -29.331 1.00 40.90  ? 894  SER A OG  1 
ATOM   6308 N N   . GLU A 1  817 ? 4.844   -54.509 -30.547 1.00 35.26  ? 895  GLU A N   1 
ATOM   6309 C CA  . GLU A 1  817 ? 4.700   -53.184 -31.184 1.00 45.26  ? 895  GLU A CA  1 
ATOM   6310 C C   . GLU A 1  817 ? 6.102   -52.596 -31.233 1.00 44.88  ? 895  GLU A C   1 
ATOM   6311 O O   . GLU A 1  817 ? 6.598   -52.073 -30.235 1.00 70.98  ? 895  GLU A O   1 
ATOM   6312 C CB  . GLU A 1  817 ? 3.675   -52.271 -30.483 1.00 38.08  ? 895  GLU A CB  1 
ATOM   6313 C CG  . GLU A 1  817 ? 3.819   -52.035 -28.997 1.00 42.17  ? 895  GLU A CG  1 
ATOM   6314 C CD  . GLU A 1  817 ? 3.349   -53.192 -28.125 1.00 46.64  ? 895  GLU A CD  1 
ATOM   6315 O OE1 . GLU A 1  817 ? 4.201   -53.787 -27.419 1.00 43.00  ? 895  GLU A OE1 1 
ATOM   6316 O OE2 . GLU A 1  817 ? 2.138   -53.502 -28.138 1.00 55.32  ? 895  GLU A OE2 1 
ATOM   6317 N N   . GLY A 1  818 ? 6.762   -52.753 -32.375 1.00 35.03  ? 896  GLY A N   1 
ATOM   6318 C CA  . GLY A 1  818 ? 8.170   -52.357 -32.529 1.00 35.55  ? 896  GLY A CA  1 
ATOM   6319 C C   . GLY A 1  818 ? 9.038   -53.358 -33.257 1.00 36.54  ? 896  GLY A C   1 
ATOM   6320 O O   . GLY A 1  818 ? 10.053  -52.992 -33.854 1.00 36.28  ? 896  GLY A O   1 
ATOM   6321 N N   . ALA A 1  819 ? 8.640   -54.624 -33.223 1.00 39.51  ? 897  ALA A N   1 
ATOM   6322 C CA  . ALA A 1  819 ? 9.425   -55.684 -33.835 1.00 45.46  ? 897  ALA A CA  1 
ATOM   6323 C C   . ALA A 1  819 ? 9.300   -55.757 -35.368 1.00 39.71  ? 897  ALA A C   1 
ATOM   6324 O O   . ALA A 1  819 ? 10.083  -56.462 -36.012 1.00 52.14  ? 897  ALA A O   1 
ATOM   6325 C CB  . ALA A 1  819 ? 9.077   -57.025 -33.193 1.00 44.33  ? 897  ALA A CB  1 
ATOM   6326 N N   . GLY A 1  820 ? 8.336   -55.050 -35.958 1.00 36.90  ? 898  GLY A N   1 
ATOM   6327 C CA  . GLY A 1  820 ? 8.201   -55.013 -37.416 1.00 39.41  ? 898  GLY A CA  1 
ATOM   6328 C C   . GLY A 1  820 ? 8.914   -53.850 -38.088 1.00 35.11  ? 898  GLY A C   1 
ATOM   6329 O O   . GLY A 1  820 ? 8.871   -53.743 -39.324 1.00 30.43  ? 898  GLY A O   1 
ATOM   6330 N N   . LEU A 1  821 ? 9.554   -52.976 -37.297 1.00 30.09  ? 899  LEU A N   1 
ATOM   6331 C CA  . LEU A 1  821 ? 10.097  -51.724 -37.819 1.00 25.11  ? 899  LEU A CA  1 
ATOM   6332 C C   . LEU A 1  821 ? 11.355  -51.945 -38.634 1.00 25.18  ? 899  LEU A C   1 
ATOM   6333 O O   . LEU A 1  821 ? 12.391  -52.356 -38.098 1.00 26.51  ? 899  LEU A O   1 
ATOM   6334 C CB  . LEU A 1  821 ? 10.408  -50.729 -36.708 1.00 22.82  ? 899  LEU A CB  1 
ATOM   6335 C CG  . LEU A 1  821 ? 9.225   -50.264 -35.853 1.00 25.90  ? 899  LEU A CG  1 
ATOM   6336 C CD1 . LEU A 1  821 ? 9.722   -49.405 -34.701 1.00 25.86  ? 899  LEU A CD1 1 
ATOM   6337 C CD2 . LEU A 1  821 ? 8.196   -49.513 -36.693 1.00 28.27  ? 899  LEU A CD2 1 
ATOM   6338 N N   . GLN A 1  822 ? 11.248  -51.583 -39.908 1.00 20.86  ? 900  GLN A N   1 
ATOM   6339 C CA  . GLN A 1  822 ? 12.267  -51.792 -40.927 1.00 22.14  ? 900  GLN A CA  1 
ATOM   6340 C C   . GLN A 1  822 ? 13.150  -50.546 -41.012 1.00 25.92  ? 900  GLN A C   1 
ATOM   6341 O O   . GLN A 1  822 ? 12.651  -49.427 -41.147 1.00 25.30  ? 900  GLN A O   1 
ATOM   6342 C CB  . GLN A 1  822 ? 11.574  -52.071 -42.276 1.00 22.59  ? 900  GLN A CB  1 
ATOM   6343 C CG  . GLN A 1  822 ? 10.775  -53.385 -42.273 1.00 26.29  ? 900  GLN A CG  1 
ATOM   6344 C CD  . GLN A 1  822 ? 9.722   -53.525 -43.397 1.00 34.51  ? 900  GLN A CD  1 
ATOM   6345 O OE1 . GLN A 1  822 ? 10.022  -53.397 -44.587 1.00 37.23  ? 900  GLN A OE1 1 
ATOM   6346 N NE2 . GLN A 1  822 ? 8.487   -53.835 -43.009 1.00 38.12  ? 900  GLN A NE2 1 
ATOM   6347 N N   . LEU A 1  823 ? 14.459  -50.732 -40.886 1.00 24.26  ? 901  LEU A N   1 
ATOM   6348 C CA  . LEU A 1  823 ? 15.409  -49.638 -41.087 1.00 20.88  ? 901  LEU A CA  1 
ATOM   6349 C C   . LEU A 1  823 ? 15.990  -49.826 -42.472 1.00 19.14  ? 901  LEU A C   1 
ATOM   6350 O O   . LEU A 1  823 ? 16.644  -50.842 -42.742 1.00 21.61  ? 901  LEU A O   1 
ATOM   6351 C CB  . LEU A 1  823 ? 16.505  -49.673 -40.021 1.00 20.59  ? 901  LEU A CB  1 
ATOM   6352 C CG  . LEU A 1  823 ? 17.702  -48.748 -40.161 1.00 18.74  ? 901  LEU A CG  1 
ATOM   6353 C CD1 . LEU A 1  823 ? 17.275  -47.298 -40.130 1.00 18.43  ? 901  LEU A CD1 1 
ATOM   6354 C CD2 . LEU A 1  823 ? 18.716  -49.008 -39.055 1.00 20.44  ? 901  LEU A CD2 1 
ATOM   6355 N N   . GLN A 1  824 ? 15.756  -48.859 -43.352 1.00 20.88  ? 902  GLN A N   1 
ATOM   6356 C CA  . GLN A 1  824 ? 16.190  -48.979 -44.746 1.00 26.15  ? 902  GLN A CA  1 
ATOM   6357 C C   . GLN A 1  824 ? 17.205  -47.950 -45.222 1.00 24.74  ? 902  GLN A C   1 
ATOM   6358 O O   . GLN A 1  824 ? 17.823  -48.156 -46.275 1.00 20.84  ? 902  GLN A O   1 
ATOM   6359 C CB  . GLN A 1  824 ? 14.969  -49.091 -45.679 1.00 28.37  ? 902  GLN A CB  1 
ATOM   6360 C CG  . GLN A 1  824 ? 14.336  -50.507 -45.565 1.00 47.05  ? 902  GLN A CG  1 
ATOM   6361 C CD  . GLN A 1  824 ? 13.165  -50.802 -46.502 1.00 45.91  ? 902  GLN A CD  1 
ATOM   6362 O OE1 . GLN A 1  824 ? 13.006  -50.168 -47.553 1.00 56.59  ? 902  GLN A OE1 1 
ATOM   6363 N NE2 . GLN A 1  824 ? 12.342  -51.792 -46.128 1.00 45.13  ? 902  GLN A NE2 1 
ATOM   6364 N N   . LYS A 1  825 ? 17.417  -46.886 -44.442 1.00 23.51  ? 903  LYS A N   1 
ATOM   6365 C CA  . LYS A 1  825 ? 18.373  -45.846 -44.813 1.00 25.29  ? 903  LYS A CA  1 
ATOM   6366 C C   . LYS A 1  825 ? 19.162  -45.309 -43.613 1.00 21.31  ? 903  LYS A C   1 
ATOM   6367 O O   . LYS A 1  825 ? 18.591  -45.056 -42.561 1.00 19.04  ? 903  LYS A O   1 
ATOM   6368 C CB  . LYS A 1  825 ? 17.630  -44.716 -45.546 1.00 32.57  ? 903  LYS A CB  1 
ATOM   6369 C CG  . LYS A 1  825 ? 18.550  -43.661 -46.141 1.00 47.91  ? 903  LYS A CG  1 
ATOM   6370 C CD  . LYS A 1  825 ? 18.155  -43.221 -47.557 1.00 71.30  ? 903  LYS A CD  1 
ATOM   6371 C CE  . LYS A 1  825 ? 17.254  -41.983 -47.552 1.00 81.30  ? 903  LYS A CE  1 
ATOM   6372 N NZ  . LYS A 1  825 ? 16.945  -41.566 -48.960 1.00 105.40 ? 903  LYS A NZ  1 
ATOM   6373 N N   . VAL A 1  826 ? 20.477  -45.160 -43.771 1.00 19.85  ? 904  VAL A N   1 
ATOM   6374 C CA  . VAL A 1  826 ? 21.328  -44.546 -42.752 1.00 18.02  ? 904  VAL A CA  1 
ATOM   6375 C C   . VAL A 1  826 ? 22.130  -43.439 -43.419 1.00 18.29  ? 904  VAL A C   1 
ATOM   6376 O O   . VAL A 1  826 ? 22.963  -43.704 -44.308 1.00 22.65  ? 904  VAL A O   1 
ATOM   6377 C CB  . VAL A 1  826 ? 22.271  -45.550 -42.064 1.00 19.84  ? 904  VAL A CB  1 
ATOM   6378 C CG1 . VAL A 1  826 ? 23.158  -44.870 -41.033 1.00 21.68  ? 904  VAL A CG1 1 
ATOM   6379 C CG2 . VAL A 1  826 ? 21.462  -46.682 -41.402 1.00 21.60  ? 904  VAL A CG2 1 
ATOM   6380 N N   . THR A 1  827 ? 21.881  -42.203 -42.979 1.00 17.82  ? 905  THR A N   1 
ATOM   6381 C CA  . THR A 1  827 ? 22.541  -41.034 -43.515 1.00 19.92  ? 905  THR A CA  1 
ATOM   6382 C C   . THR A 1  827 ? 23.476  -40.492 -42.445 1.00 19.14  ? 905  THR A C   1 
ATOM   6383 O O   . THR A 1  827 ? 23.040  -40.158 -41.337 1.00 19.08  ? 905  THR A O   1 
ATOM   6384 C CB  . THR A 1  827 ? 21.522  -39.958 -43.955 1.00 20.98  ? 905  THR A CB  1 
ATOM   6385 O OG1 . THR A 1  827 ? 20.550  -40.532 -44.833 1.00 23.24  ? 905  THR A OG1 1 
ATOM   6386 C CG2 . THR A 1  827 ? 22.213  -38.846 -44.718 1.00 23.81  ? 905  THR A CG2 1 
ATOM   6387 N N   . VAL A 1  828 ? 24.764  -40.409 -42.780 1.00 18.92  ? 906  VAL A N   1 
ATOM   6388 C CA  . VAL A 1  828 ? 25.803  -40.004 -41.828 1.00 19.28  ? 906  VAL A CA  1 
ATOM   6389 C C   . VAL A 1  828 ? 26.383  -38.649 -42.269 1.00 20.52  ? 906  VAL A C   1 
ATOM   6390 O O   . VAL A 1  828 ? 26.879  -38.515 -43.408 1.00 20.31  ? 906  VAL A O   1 
ATOM   6391 C CB  . VAL A 1  828 ? 26.926  -41.076 -41.751 1.00 20.45  ? 906  VAL A CB  1 
ATOM   6392 C CG1 . VAL A 1  828 ? 27.850  -40.823 -40.564 1.00 21.19  ? 906  VAL A CG1 1 
ATOM   6393 C CG2 . VAL A 1  828 ? 26.333  -42.482 -41.642 1.00 20.11  ? 906  VAL A CG2 1 
ATOM   6394 N N   . LEU A 1  829 ? 26.335  -37.674 -41.355 1.00 21.37  ? 907  LEU A N   1 
ATOM   6395 C CA  . LEU A 1  829 ? 26.802  -36.309 -41.589 1.00 20.73  ? 907  LEU A CA  1 
ATOM   6396 C C   . LEU A 1  829 ? 28.131  -36.074 -40.893 1.00 23.94  ? 907  LEU A C   1 
ATOM   6397 O O   . LEU A 1  829 ? 28.333  -36.504 -39.737 1.00 23.19  ? 907  LEU A O   1 
ATOM   6398 C CB  . LEU A 1  829 ? 25.773  -35.300 -41.076 1.00 21.70  ? 907  LEU A CB  1 
ATOM   6399 C CG  . LEU A 1  829 ? 24.302  -35.579 -41.416 1.00 23.64  ? 907  LEU A CG  1 
ATOM   6400 C CD1 . LEU A 1  829 ? 23.391  -34.515 -40.824 1.00 29.19  ? 907  LEU A CD1 1 
ATOM   6401 C CD2 . LEU A 1  829 ? 24.115  -35.638 -42.916 1.00 25.44  ? 907  LEU A CD2 1 
ATOM   6402 N N   . GLY A 1  830 ? 29.022  -35.368 -41.589 1.00 23.40  ? 908  GLY A N   1 
ATOM   6403 C CA  . GLY A 1  830 ? 30.378  -35.091 -41.096 1.00 24.60  ? 908  GLY A CA  1 
ATOM   6404 C C   . GLY A 1  830 ? 31.360  -36.228 -41.344 1.00 26.69  ? 908  GLY A C   1 
ATOM   6405 O O   . GLY A 1  830 ? 32.241  -36.470 -40.529 1.00 24.97  ? 908  GLY A O   1 
ATOM   6406 N N   . VAL A 1  831 ? 31.209  -36.932 -42.465 1.00 27.48  ? 909  VAL A N   1 
ATOM   6407 C CA  . VAL A 1  831 ? 32.153  -37.990 -42.843 1.00 29.59  ? 909  VAL A CA  1 
ATOM   6408 C C   . VAL A 1  831 ? 33.195  -37.330 -43.751 1.00 29.56  ? 909  VAL A C   1 
ATOM   6409 O O   . VAL A 1  831 ? 32.897  -36.945 -44.888 1.00 28.09  ? 909  VAL A O   1 
ATOM   6410 C CB  . VAL A 1  831 ? 31.459  -39.185 -43.553 1.00 29.44  ? 909  VAL A CB  1 
ATOM   6411 C CG1 . VAL A 1  831 ? 32.491  -40.160 -44.115 1.00 31.53  ? 909  VAL A CG1 1 
ATOM   6412 C CG2 . VAL A 1  831 ? 30.511  -39.902 -42.590 1.00 28.02  ? 909  VAL A CG2 1 
ATOM   6413 N N   . ALA A 1  832 ? 34.404  -37.194 -43.232 1.00 31.98  ? 910  ALA A N   1 
ATOM   6414 C CA  . ALA A 1  832 ? 35.431  -36.367 -43.861 1.00 38.96  ? 910  ALA A CA  1 
ATOM   6415 C C   . ALA A 1  832 ? 36.022  -36.998 -45.128 1.00 41.00  ? 910  ALA A C   1 
ATOM   6416 O O   . ALA A 1  832 ? 36.293  -36.303 -46.124 1.00 40.82  ? 910  ALA A O   1 
ATOM   6417 C CB  . ALA A 1  832 ? 36.532  -36.072 -42.845 1.00 40.77  ? 910  ALA A CB  1 
ATOM   6418 N N   . THR A 1  833 ? 36.199  -38.317 -45.097 1.00 40.85  ? 911  THR A N   1 
ATOM   6419 C CA  . THR A 1  833 ? 36.818  -39.031 -46.205 1.00 44.11  ? 911  THR A CA  1 
ATOM   6420 C C   . THR A 1  833 ? 35.844  -40.043 -46.808 1.00 44.13  ? 911  THR A C   1 
ATOM   6421 O O   . THR A 1  833 ? 35.098  -40.726 -46.087 1.00 36.29  ? 911  THR A O   1 
ATOM   6422 C CB  . THR A 1  833 ? 38.079  -39.759 -45.720 1.00 48.22  ? 911  THR A CB  1 
ATOM   6423 O OG1 . THR A 1  833 ? 38.854  -38.876 -44.898 1.00 56.97  ? 911  THR A OG1 1 
ATOM   6424 C CG2 . THR A 1  833 ? 38.921  -40.239 -46.898 1.00 54.38  ? 911  THR A CG2 1 
ATOM   6425 N N   . ALA A 1  834 ? 35.870  -40.145 -48.134 1.00 44.77  ? 912  ALA A N   1 
ATOM   6426 C CA  . ALA A 1  834 ? 35.018  -41.078 -48.845 1.00 44.36  ? 912  ALA A CA  1 
ATOM   6427 C C   . ALA A 1  834 ? 35.398  -42.496 -48.406 1.00 39.84  ? 912  ALA A C   1 
ATOM   6428 O O   . ALA A 1  834 ? 36.578  -42.827 -48.409 1.00 34.91  ? 912  ALA A O   1 
ATOM   6429 C CB  . ALA A 1  834 ? 35.187  -40.921 -50.345 1.00 44.45  ? 912  ALA A CB  1 
ATOM   6430 N N   . PRO A 1  835 ? 34.411  -43.312 -47.977 1.00 33.38  ? 913  PRO A N   1 
ATOM   6431 C CA  . PRO A 1  835 ? 34.755  -44.687 -47.613 1.00 31.61  ? 913  PRO A CA  1 
ATOM   6432 C C   . PRO A 1  835 ? 35.151  -45.532 -48.814 1.00 32.18  ? 913  PRO A C   1 
ATOM   6433 O O   . PRO A 1  835 ? 34.603  -45.365 -49.896 1.00 35.09  ? 913  PRO A O   1 
ATOM   6434 C CB  . PRO A 1  835 ? 33.479  -45.227 -46.946 1.00 32.21  ? 913  PRO A CB  1 
ATOM   6435 C CG  . PRO A 1  835 ? 32.396  -44.292 -47.312 1.00 34.90  ? 913  PRO A CG  1 
ATOM   6436 C CD  . PRO A 1  835 ? 33.022  -42.968 -47.632 1.00 33.14  ? 913  PRO A CD  1 
ATOM   6437 N N   . GLN A 1  836 ? 36.132  -46.401 -48.627 1.00 35.61  ? 914  GLN A N   1 
ATOM   6438 C CA  . GLN A 1  836 ? 36.409  -47.470 -49.605 1.00 41.35  ? 914  GLN A CA  1 
ATOM   6439 C C   . GLN A 1  836 ? 35.404  -48.618 -49.502 1.00 39.47  ? 914  GLN A C   1 
ATOM   6440 O O   . GLN A 1  836 ? 35.156  -49.290 -50.491 1.00 34.10  ? 914  GLN A O   1 
ATOM   6441 C CB  . GLN A 1  836 ? 37.823  -48.018 -49.440 1.00 47.53  ? 914  GLN A CB  1 
ATOM   6442 C CG  . GLN A 1  836 ? 38.915  -47.052 -49.885 1.00 65.13  ? 914  GLN A CG  1 
ATOM   6443 C CD  . GLN A 1  836 ? 40.271  -47.728 -50.043 1.00 87.23  ? 914  GLN A CD  1 
ATOM   6444 O OE1 . GLN A 1  836 ? 40.573  -48.721 -49.371 1.00 91.16  ? 914  GLN A OE1 1 
ATOM   6445 N NE2 . GLN A 1  836 ? 41.097  -47.189 -50.936 1.00 94.36  ? 914  GLN A NE2 1 
ATOM   6446 N N   . GLN A 1  837 ? 34.841  -48.851 -48.314 1.00 35.75  ? 915  GLN A N   1 
ATOM   6447 C CA  . GLN A 1  837 ? 33.808  -49.876 -48.134 1.00 36.18  ? 915  GLN A CA  1 
ATOM   6448 C C   . GLN A 1  837 ? 32.850  -49.548 -46.992 1.00 31.08  ? 915  GLN A C   1 
ATOM   6449 O O   . GLN A 1  837 ? 33.254  -48.953 -45.993 1.00 29.66  ? 915  GLN A O   1 
ATOM   6450 C CB  . GLN A 1  837 ? 34.433  -51.249 -47.867 1.00 40.76  ? 915  GLN A CB  1 
ATOM   6451 C CG  . GLN A 1  837 ? 35.477  -51.244 -46.768 1.00 45.94  ? 915  GLN A CG  1 
ATOM   6452 C CD  . GLN A 1  837 ? 35.446  -52.499 -45.917 1.00 63.57  ? 915  GLN A CD  1 
ATOM   6453 O OE1 . GLN A 1  837 ? 35.528  -53.616 -46.432 1.00 60.30  ? 915  GLN A OE1 1 
ATOM   6454 N NE2 . GLN A 1  837 ? 35.337  -52.316 -44.596 1.00 66.80  ? 915  GLN A NE2 1 
ATOM   6455 N N   . VAL A 1  838 ? 31.601  -49.972 -47.167 1.00 27.42  ? 916  VAL A N   1 
ATOM   6456 C CA  . VAL A 1  838 ? 30.545  -49.829 -46.187 1.00 29.11  ? 916  VAL A CA  1 
ATOM   6457 C C   . VAL A 1  838 ? 29.919  -51.212 -45.946 1.00 28.72  ? 916  VAL A C   1 
ATOM   6458 O O   . VAL A 1  838 ? 29.553  -51.900 -46.902 1.00 29.35  ? 916  VAL A O   1 
ATOM   6459 C CB  . VAL A 1  838 ? 29.462  -48.845 -46.676 1.00 29.23  ? 916  VAL A CB  1 
ATOM   6460 C CG1 . VAL A 1  838 ? 28.359  -48.713 -45.628 1.00 27.95  ? 916  VAL A CG1 1 
ATOM   6461 C CG2 . VAL A 1  838 ? 30.089  -47.488 -47.002 1.00 29.56  ? 916  VAL A CG2 1 
ATOM   6462 N N   . LEU A 1  839 ? 29.811  -51.602 -44.677 1.00 28.37  ? 917  LEU A N   1 
ATOM   6463 C CA  . LEU A 1  839 ? 29.339  -52.944 -44.286 1.00 28.26  ? 917  LEU A CA  1 
ATOM   6464 C C   . LEU A 1  839 ? 28.097  -52.814 -43.435 1.00 27.98  ? 917  LEU A C   1 
ATOM   6465 O O   . LEU A 1  839 ? 28.003  -51.897 -42.608 1.00 25.45  ? 917  LEU A O   1 
ATOM   6466 C CB  . LEU A 1  839 ? 30.397  -53.695 -43.466 1.00 29.70  ? 917  LEU A CB  1 
ATOM   6467 C CG  . LEU A 1  839 ? 31.805  -53.847 -44.062 1.00 31.78  ? 917  LEU A CG  1 
ATOM   6468 C CD1 . LEU A 1  839 ? 32.708  -54.528 -43.049 1.00 32.86  ? 917  LEU A CD1 1 
ATOM   6469 C CD2 . LEU A 1  839 ? 31.800  -54.611 -45.381 1.00 32.57  ? 917  LEU A CD2 1 
ATOM   6470 N N   . SER A 1  840 ? 27.160  -53.744 -43.635 1.00 26.51  ? 918  SER A N   1 
ATOM   6471 C CA  . SER A 1  840 ? 25.986  -53.899 -42.779 1.00 26.33  ? 918  SER A CA  1 
ATOM   6472 C C   . SER A 1  840 ? 25.994  -55.332 -42.289 1.00 25.96  ? 918  SER A C   1 
ATOM   6473 O O   . SER A 1  840 ? 25.899  -56.271 -43.092 1.00 21.62  ? 918  SER A O   1 
ATOM   6474 C CB  . SER A 1  840 ? 24.694  -53.613 -43.546 1.00 29.22  ? 918  SER A CB  1 
ATOM   6475 O OG  . SER A 1  840 ? 23.568  -53.765 -42.694 1.00 30.53  ? 918  SER A OG  1 
ATOM   6476 N N   . ASN A 1  841 ? 26.138  -55.499 -40.974 1.00 25.18  ? 919  ASN A N   1 
ATOM   6477 C CA  . ASN A 1  841 ? 26.273  -56.821 -40.351 1.00 26.41  ? 919  ASN A CA  1 
ATOM   6478 C C   . ASN A 1  841 ? 27.356  -57.670 -41.005 1.00 26.00  ? 919  ASN A C   1 
ATOM   6479 O O   . ASN A 1  841 ? 27.222  -58.879 -41.172 1.00 26.62  ? 919  ASN A O   1 
ATOM   6480 C CB  . ASN A 1  841 ? 24.898  -57.534 -40.284 1.00 26.61  ? 919  ASN A CB  1 
ATOM   6481 C CG  . ASN A 1  841 ? 24.000  -56.978 -39.177 1.00 25.79  ? 919  ASN A CG  1 
ATOM   6482 O OD1 . ASN A 1  841 ? 24.464  -56.290 -38.283 1.00 28.58  ? 919  ASN A OD1 1 
ATOM   6483 N ND2 . ASN A 1  841 ? 22.717  -57.301 -39.226 1.00 26.54  ? 919  ASN A ND2 1 
ATOM   6484 N N   . GLY A 1  842 ? 28.453  -57.005 -41.365 1.00 28.59  ? 920  GLY A N   1 
ATOM   6485 C CA  . GLY A 1  842 ? 29.625  -57.665 -41.927 1.00 26.27  ? 920  GLY A CA  1 
ATOM   6486 C C   . GLY A 1  842 ? 29.642  -57.836 -43.438 1.00 29.70  ? 920  GLY A C   1 
ATOM   6487 O O   . GLY A 1  842 ? 30.652  -58.275 -43.979 1.00 30.26  ? 920  GLY A O   1 
ATOM   6488 N N   . VAL A 1  843 ? 28.550  -57.460 -44.110 1.00 27.95  ? 921  VAL A N   1 
ATOM   6489 C CA  . VAL A 1  843 ? 28.343  -57.712 -45.529 1.00 27.03  ? 921  VAL A CA  1 
ATOM   6490 C C   . VAL A 1  843 ? 28.366  -56.380 -46.265 1.00 27.98  ? 921  VAL A C   1 
ATOM   6491 O O   . VAL A 1  843 ? 27.665  -55.455 -45.851 1.00 26.60  ? 921  VAL A O   1 
ATOM   6492 C CB  . VAL A 1  843 ? 26.979  -58.394 -45.772 1.00 26.49  ? 921  VAL A CB  1 
ATOM   6493 C CG1 . VAL A 1  843 ? 26.647  -58.497 -47.272 1.00 28.49  ? 921  VAL A CG1 1 
ATOM   6494 C CG2 . VAL A 1  843 ? 26.993  -59.773 -45.135 1.00 29.52  ? 921  VAL A CG2 1 
ATOM   6495 N N   . PRO A 1  844 ? 29.142  -56.283 -47.369 1.00 30.32  ? 922  PRO A N   1 
ATOM   6496 C CA  . PRO A 1  844 ? 29.112  -55.032 -48.157 1.00 32.20  ? 922  PRO A CA  1 
ATOM   6497 C C   . PRO A 1  844 ? 27.678  -54.638 -48.550 1.00 33.77  ? 922  PRO A C   1 
ATOM   6498 O O   . PRO A 1  844 ? 26.881  -55.507 -48.938 1.00 31.63  ? 922  PRO A O   1 
ATOM   6499 C CB  . PRO A 1  844 ? 29.968  -55.357 -49.389 1.00 32.29  ? 922  PRO A CB  1 
ATOM   6500 C CG  . PRO A 1  844 ? 30.812  -56.524 -48.989 1.00 34.92  ? 922  PRO A CG  1 
ATOM   6501 C CD  . PRO A 1  844 ? 30.004  -57.308 -47.991 1.00 30.07  ? 922  PRO A CD  1 
ATOM   6502 N N   . VAL A 1  845 ? 27.325  -53.364 -48.382 1.00 35.27  ? 923  VAL A N   1 
ATOM   6503 C CA  . VAL A 1  845 ? 25.925  -52.961 -48.575 1.00 35.76  ? 923  VAL A CA  1 
ATOM   6504 C C   . VAL A 1  845 ? 25.576  -52.927 -50.061 1.00 38.22  ? 923  VAL A C   1 
ATOM   6505 O O   . VAL A 1  845 ? 26.463  -52.742 -50.901 1.00 34.87  ? 923  VAL A O   1 
ATOM   6506 C CB  . VAL A 1  845 ? 25.587  -51.597 -47.939 1.00 37.63  ? 923  VAL A CB  1 
ATOM   6507 C CG1 . VAL A 1  845 ? 25.885  -51.612 -46.440 1.00 39.54  ? 923  VAL A CG1 1 
ATOM   6508 C CG2 . VAL A 1  845 ? 26.306  -50.455 -48.640 1.00 31.45  ? 923  VAL A CG2 1 
ATOM   6509 N N   . SER A 1  846 ? 24.282  -53.077 -50.360 1.00 41.76  ? 924  SER A N   1 
ATOM   6510 C CA  . SER A 1  846 ? 23.760  -53.064 -51.735 1.00 40.86  ? 924  SER A CA  1 
ATOM   6511 C C   . SER A 1  846 ? 24.148  -51.766 -52.465 1.00 47.05  ? 924  SER A C   1 
ATOM   6512 O O   . SER A 1  846 ? 24.605  -51.813 -53.608 1.00 48.04  ? 924  SER A O   1 
ATOM   6513 C CB  . SER A 1  846 ? 22.220  -53.260 -51.744 1.00 51.46  ? 924  SER A CB  1 
ATOM   6514 O OG  . SER A 1  846 ? 21.520  -52.259 -50.973 1.00 46.16  ? 924  SER A OG  1 
ATOM   6515 N N   . ASN A 1  847 ? 23.999  -50.626 -51.783 1.00 40.49  ? 925  ASN A N   1 
ATOM   6516 C CA  . ASN A 1  847 ? 24.290  -49.323 -52.353 1.00 40.43  ? 925  ASN A CA  1 
ATOM   6517 C C   . ASN A 1  847 ? 24.547  -48.224 -51.302 1.00 38.62  ? 925  ASN A C   1 
ATOM   6518 O O   . ASN A 1  847 ? 23.824  -48.121 -50.303 1.00 30.68  ? 925  ASN A O   1 
ATOM   6519 C CB  . ASN A 1  847 ? 23.115  -48.885 -53.219 1.00 46.11  ? 925  ASN A CB  1 
ATOM   6520 C CG  . ASN A 1  847 ? 23.459  -47.707 -54.105 1.00 64.99  ? 925  ASN A CG  1 
ATOM   6521 O OD1 . ASN A 1  847 ? 24.496  -47.696 -54.769 1.00 64.53  ? 925  ASN A OD1 1 
ATOM   6522 N ND2 . ASN A 1  847 ? 22.589  -46.704 -54.119 1.00 93.90  ? 925  ASN A ND2 1 
ATOM   6523 N N   . PHE A 1  848 ? 25.571  -47.410 -51.542 1.00 30.95  ? 926  PHE A N   1 
ATOM   6524 C CA  . PHE A 1  848 ? 25.809  -46.202 -50.772 1.00 29.88  ? 926  PHE A CA  1 
ATOM   6525 C C   . PHE A 1  848 ? 26.305  -45.105 -51.689 1.00 32.11  ? 926  PHE A C   1 
ATOM   6526 O O   . PHE A 1  848 ? 26.878  -45.401 -52.715 1.00 29.66  ? 926  PHE A O   1 
ATOM   6527 C CB  . PHE A 1  848 ? 26.810  -46.456 -49.633 1.00 30.08  ? 926  PHE A CB  1 
ATOM   6528 C CG  . PHE A 1  848 ? 28.247  -46.604 -50.071 1.00 31.28  ? 926  PHE A CG  1 
ATOM   6529 C CD1 . PHE A 1  848 ? 29.078  -45.491 -50.176 1.00 32.76  ? 926  PHE A CD1 1 
ATOM   6530 C CD2 . PHE A 1  848 ? 28.790  -47.864 -50.328 1.00 30.13  ? 926  PHE A CD2 1 
ATOM   6531 C CE1 . PHE A 1  848 ? 30.408  -45.624 -50.555 1.00 31.09  ? 926  PHE A CE1 1 
ATOM   6532 C CE2 . PHE A 1  848 ? 30.116  -48.000 -50.701 1.00 33.28  ? 926  PHE A CE2 1 
ATOM   6533 C CZ  . PHE A 1  848 ? 30.929  -46.879 -50.821 1.00 31.33  ? 926  PHE A CZ  1 
ATOM   6534 N N   . THR A 1  849 ? 26.095  -43.847 -51.309 1.00 31.74  ? 927  THR A N   1 
ATOM   6535 C CA  . THR A 1  849 ? 26.697  -42.709 -52.014 1.00 33.13  ? 927  THR A CA  1 
ATOM   6536 C C   . THR A 1  849 ? 27.443  -41.856 -51.001 1.00 33.13  ? 927  THR A C   1 
ATOM   6537 O O   . THR A 1  849 ? 27.032  -41.751 -49.842 1.00 28.46  ? 927  THR A O   1 
ATOM   6538 C CB  . THR A 1  849 ? 25.647  -41.820 -52.720 1.00 33.17  ? 927  THR A CB  1 
ATOM   6539 O OG1 . THR A 1  849 ? 24.864  -41.125 -51.745 1.00 35.66  ? 927  THR A OG1 1 
ATOM   6540 C CG2 . THR A 1  849 ? 24.728  -42.646 -53.572 1.00 34.91  ? 927  THR A CG2 1 
ATOM   6541 N N   . TYR A 1  850 ? 28.539  -41.257 -51.441 1.00 33.35  ? 928  TYR A N   1 
ATOM   6542 C CA  . TYR A 1  850 ? 29.250  -40.263 -50.663 1.00 31.98  ? 928  TYR A CA  1 
ATOM   6543 C C   . TYR A 1  850 ? 29.327  -38.998 -51.517 1.00 35.59  ? 928  TYR A C   1 
ATOM   6544 O O   . TYR A 1  850 ? 29.592  -39.070 -52.717 1.00 32.22  ? 928  TYR A O   1 
ATOM   6545 C CB  . TYR A 1  850 ? 30.642  -40.769 -50.279 1.00 34.86  ? 928  TYR A CB  1 
ATOM   6546 C CG  . TYR A 1  850 ? 31.439  -39.757 -49.492 1.00 34.11  ? 928  TYR A CG  1 
ATOM   6547 C CD1 . TYR A 1  850 ? 31.156  -39.506 -48.138 1.00 30.66  ? 928  TYR A CD1 1 
ATOM   6548 C CD2 . TYR A 1  850 ? 32.452  -39.004 -50.112 1.00 32.33  ? 928  TYR A CD2 1 
ATOM   6549 C CE1 . TYR A 1  850 ? 31.879  -38.555 -47.421 1.00 27.61  ? 928  TYR A CE1 1 
ATOM   6550 C CE2 . TYR A 1  850 ? 33.181  -38.057 -49.404 1.00 30.57  ? 928  TYR A CE2 1 
ATOM   6551 C CZ  . TYR A 1  850 ? 32.896  -37.819 -48.061 1.00 30.11  ? 928  TYR A CZ  1 
ATOM   6552 O OH  . TYR A 1  850 ? 33.646  -36.859 -47.366 1.00 28.09  ? 928  TYR A OH  1 
ATOM   6553 N N   . SER A 1  851 ? 29.054  -37.857 -50.897 1.00 32.02  ? 929  SER A N   1 
ATOM   6554 C CA  . SER A 1  851 ? 29.243  -36.553 -51.515 1.00 34.06  ? 929  SER A CA  1 
ATOM   6555 C C   . SER A 1  851 ? 30.451  -35.852 -50.867 1.00 32.72  ? 929  SER A C   1 
ATOM   6556 O O   . SER A 1  851 ? 30.382  -35.462 -49.693 1.00 30.95  ? 929  SER A O   1 
ATOM   6557 C CB  . SER A 1  851 ? 27.985  -35.704 -51.343 1.00 32.92  ? 929  SER A CB  1 
ATOM   6558 O OG  . SER A 1  851 ? 28.291  -34.313 -51.424 1.00 36.75  ? 929  SER A OG  1 
ATOM   6559 N N   . PRO A 1  852 ? 31.562  -35.691 -51.611 1.00 37.22  ? 930  PRO A N   1 
ATOM   6560 C CA  . PRO A 1  852 ? 32.697  -34.944 -51.031 1.00 38.59  ? 930  PRO A CA  1 
ATOM   6561 C C   . PRO A 1  852 ? 32.420  -33.463 -50.696 1.00 32.85  ? 930  PRO A C   1 
ATOM   6562 O O   . PRO A 1  852 ? 33.111  -32.903 -49.849 1.00 35.81  ? 930  PRO A O   1 
ATOM   6563 C CB  . PRO A 1  852 ? 33.793  -35.075 -52.096 1.00 41.43  ? 930  PRO A CB  1 
ATOM   6564 C CG  . PRO A 1  852 ? 33.085  -35.435 -53.348 1.00 41.83  ? 930  PRO A CG  1 
ATOM   6565 C CD  . PRO A 1  852 ? 31.895  -36.240 -52.940 1.00 39.02  ? 930  PRO A CD  1 
ATOM   6566 N N   . ASP A 1  853 ? 31.416  -32.850 -51.322 1.00 37.77  ? 931  ASP A N   1 
ATOM   6567 C CA  . ASP A 1  853 ? 31.081  -31.440 -51.061 1.00 39.34  ? 931  ASP A CA  1 
ATOM   6568 C C   . ASP A 1  853 ? 30.272  -31.234 -49.774 1.00 37.86  ? 931  ASP A C   1 
ATOM   6569 O O   . ASP A 1  853 ? 30.465  -30.236 -49.103 1.00 35.83  ? 931  ASP A O   1 
ATOM   6570 C CB  . ASP A 1  853 ? 30.290  -30.841 -52.229 1.00 41.75  ? 931  ASP A CB  1 
ATOM   6571 C CG  . ASP A 1  853 ? 31.085  -30.795 -53.526 1.00 53.41  ? 931  ASP A CG  1 
ATOM   6572 O OD1 . ASP A 1  853 ? 32.337  -30.845 -53.502 1.00 56.57  ? 931  ASP A OD1 1 
ATOM   6573 O OD2 . ASP A 1  853 ? 30.436  -30.698 -54.586 1.00 55.50  ? 931  ASP A OD2 1 
ATOM   6574 N N   . THR A 1  854 ? 29.345  -32.141 -49.457 1.00 31.33  ? 932  THR A N   1 
ATOM   6575 C CA  . THR A 1  854 ? 28.531  -32.011 -48.238 1.00 31.92  ? 932  THR A CA  1 
ATOM   6576 C C   . THR A 1  854 ? 29.043  -32.829 -47.071 1.00 28.20  ? 932  THR A C   1 
ATOM   6577 O O   . THR A 1  854 ? 28.586  -32.625 -45.943 1.00 31.87  ? 932  THR A O   1 
ATOM   6578 C CB  . THR A 1  854 ? 27.042  -32.350 -48.494 1.00 31.93  ? 932  THR A CB  1 
ATOM   6579 O OG1 . THR A 1  854 ? 26.913  -33.677 -49.037 1.00 31.18  ? 932  THR A OG1 1 
ATOM   6580 C CG2 . THR A 1  854 ? 26.442  -31.345 -49.457 1.00 28.36  ? 932  THR A CG2 1 
ATOM   6581 N N   . LYS A 1  855 ? 29.985  -33.733 -47.340 1.00 30.20  ? 933  LYS A N   1 
ATOM   6582 C CA  . LYS A 1  855 ? 30.485  -34.714 -46.359 1.00 30.83  ? 933  LYS A CA  1 
ATOM   6583 C C   . LYS A 1  855 ? 29.380  -35.679 -45.865 1.00 27.00  ? 933  LYS A C   1 
ATOM   6584 O O   . LYS A 1  855 ? 29.381  -36.092 -44.718 1.00 27.83  ? 933  LYS A O   1 
ATOM   6585 C CB  . LYS A 1  855 ? 31.191  -34.001 -45.178 1.00 33.75  ? 933  LYS A CB  1 
ATOM   6586 C CG  . LYS A 1  855 ? 32.222  -32.948 -45.578 1.00 39.38  ? 933  LYS A CG  1 
ATOM   6587 C CD  . LYS A 1  855 ? 33.330  -33.554 -46.423 1.00 46.97  ? 933  LYS A CD  1 
ATOM   6588 C CE  . LYS A 1  855 ? 34.442  -32.562 -46.726 1.00 59.70  ? 933  LYS A CE  1 
ATOM   6589 N NZ  . LYS A 1  855 ? 34.078  -31.626 -47.821 1.00 58.35  ? 933  LYS A NZ  1 
ATOM   6590 N N   . VAL A 1  856 ? 28.459  -36.051 -46.746 1.00 26.92  ? 934  VAL A N   1 
ATOM   6591 C CA  . VAL A 1  856 ? 27.343  -36.909 -46.381 1.00 24.83  ? 934  VAL A CA  1 
ATOM   6592 C C   . VAL A 1  856 ? 27.551  -38.280 -46.988 1.00 27.93  ? 934  VAL A C   1 
ATOM   6593 O O   . VAL A 1  856 ? 27.784  -38.402 -48.209 1.00 27.55  ? 934  VAL A O   1 
ATOM   6594 C CB  . VAL A 1  856 ? 26.006  -36.300 -46.860 1.00 27.93  ? 934  VAL A CB  1 
ATOM   6595 C CG1 . VAL A 1  856 ? 24.838  -37.268 -46.647 1.00 27.02  ? 934  VAL A CG1 1 
ATOM   6596 C CG2 . VAL A 1  856 ? 25.771  -34.975 -46.137 1.00 28.02  ? 934  VAL A CG2 1 
ATOM   6597 N N   . LEU A 1  857 ? 27.467  -39.296 -46.129 1.00 24.62  ? 935  LEU A N   1 
ATOM   6598 C CA  . LEU A 1  857 ? 27.503  -40.709 -46.521 1.00 23.05  ? 935  LEU A CA  1 
ATOM   6599 C C   . LEU A 1  857 ? 26.085  -41.230 -46.364 1.00 25.20  ? 935  LEU A C   1 
ATOM   6600 O O   . LEU A 1  857 ? 25.526  -41.172 -45.269 1.00 25.33  ? 935  LEU A O   1 
ATOM   6601 C CB  . LEU A 1  857 ? 28.444  -41.486 -45.618 1.00 23.03  ? 935  LEU A CB  1 
ATOM   6602 C CG  . LEU A 1  857 ? 28.483  -43.012 -45.784 1.00 23.20  ? 935  LEU A CG  1 
ATOM   6603 C CD1 . LEU A 1  857 ? 28.944  -43.413 -47.187 1.00 24.76  ? 935  LEU A CD1 1 
ATOM   6604 C CD2 . LEU A 1  857 ? 29.342  -43.632 -44.707 1.00 25.05  ? 935  LEU A CD2 1 
ATOM   6605 N N   . ASP A 1  858 ? 25.502  -41.725 -47.452 1.00 23.64  ? 936  ASP A N   1 
ATOM   6606 C CA  . ASP A 1  858 ? 24.121  -42.173 -47.453 1.00 25.21  ? 936  ASP A CA  1 
ATOM   6607 C C   . ASP A 1  858 ? 24.132  -43.658 -47.797 1.00 24.47  ? 936  ASP A C   1 
ATOM   6608 O O   . ASP A 1  858 ? 24.732  -44.048 -48.780 1.00 25.58  ? 936  ASP A O   1 
ATOM   6609 C CB  . ASP A 1  858 ? 23.322  -41.341 -48.467 1.00 27.13  ? 936  ASP A CB  1 
ATOM   6610 C CG  . ASP A 1  858 ? 21.827  -41.450 -48.287 1.00 25.26  ? 936  ASP A CG  1 
ATOM   6611 O OD1 . ASP A 1  858 ? 21.327  -41.566 -47.148 1.00 28.63  ? 936  ASP A OD1 1 
ATOM   6612 O OD2 . ASP A 1  858 ? 21.121  -41.395 -49.303 1.00 31.41  ? 936  ASP A OD2 1 
ATOM   6613 N N   . ILE A 1  859 ? 23.478  -44.476 -46.969 1.00 24.98  ? 937  ILE A N   1 
ATOM   6614 C CA  . ILE A 1  859 ? 23.632  -45.930 -47.001 1.00 22.22  ? 937  ILE A CA  1 
ATOM   6615 C C   . ILE A 1  859 ? 22.250  -46.592 -47.073 1.00 23.93  ? 937  ILE A C   1 
ATOM   6616 O O   . ILE A 1  859 ? 21.439  -46.376 -46.188 1.00 21.41  ? 937  ILE A O   1 
ATOM   6617 C CB  . ILE A 1  859 ? 24.352  -46.448 -45.731 1.00 22.24  ? 937  ILE A CB  1 
ATOM   6618 C CG1 . ILE A 1  859 ? 25.596  -45.632 -45.406 1.00 23.30  ? 937  ILE A CG1 1 
ATOM   6619 C CG2 . ILE A 1  859 ? 24.756  -47.924 -45.889 1.00 25.71  ? 937  ILE A CG2 1 
ATOM   6620 C CD1 . ILE A 1  859 ? 26.171  -45.918 -44.037 1.00 25.34  ? 937  ILE A CD1 1 
ATOM   6621 N N   . CYS A 1  860 ? 22.010  -47.417 -48.100 1.00 22.21  ? 938  CYS A N   1 
ATOM   6622 C CA  . CYS A 1  860 ? 20.844  -48.310 -48.132 1.00 24.66  ? 938  CYS A CA  1 
ATOM   6623 C C   . CYS A 1  860 ? 21.150  -49.588 -47.355 1.00 25.54  ? 938  CYS A C   1 
ATOM   6624 O O   . CYS A 1  860 ? 22.219  -50.186 -47.508 1.00 22.67  ? 938  CYS A O   1 
ATOM   6625 C CB  . CYS A 1  860 ? 20.443  -48.680 -49.567 1.00 28.41  ? 938  CYS A CB  1 
ATOM   6626 S SG  . CYS A 1  860 ? 20.094  -47.213 -50.542 1.00 38.03  ? 938  CYS A SG  1 
ATOM   6627 N N   . VAL A 1  861 ? 20.217  -49.957 -46.481 1.00 23.97  ? 939  VAL A N   1 
ATOM   6628 C CA  . VAL A 1  861 ? 20.338  -51.132 -45.633 1.00 25.85  ? 939  VAL A CA  1 
ATOM   6629 C C   . VAL A 1  861 ? 18.986  -51.829 -45.574 1.00 26.30  ? 939  VAL A C   1 
ATOM   6630 O O   . VAL A 1  861 ? 17.972  -51.257 -45.978 1.00 26.25  ? 939  VAL A O   1 
ATOM   6631 C CB  . VAL A 1  861 ? 20.819  -50.773 -44.191 1.00 25.63  ? 939  VAL A CB  1 
ATOM   6632 C CG1 . VAL A 1  861 ? 22.209  -50.163 -44.211 1.00 22.04  ? 939  VAL A CG1 1 
ATOM   6633 C CG2 . VAL A 1  861 ? 19.839  -49.867 -43.443 1.00 22.32  ? 939  VAL A CG2 1 
ATOM   6634 N N   . SER A 1  862 ? 18.994  -53.078 -45.113 1.00 26.12  ? 940  SER A N   1 
ATOM   6635 C CA  A SER A 1  862 ? 17.781  -53.835 -44.862 0.50 27.23  ? 940  SER A CA  1 
ATOM   6636 C CA  B SER A 1  862 ? 17.757  -53.798 -44.836 0.50 27.00  ? 940  SER A CA  1 
ATOM   6637 C C   . SER A 1  862 ? 17.906  -54.412 -43.449 1.00 26.96  ? 940  SER A C   1 
ATOM   6638 O O   . SER A 1  862 ? 18.330  -55.556 -43.286 1.00 27.12  ? 940  SER A O   1 
ATOM   6639 C CB  A SER A 1  862 ? 17.611  -54.940 -45.911 0.50 27.21  ? 940  SER A CB  1 
ATOM   6640 C CB  B SER A 1  862 ? 17.446  -54.846 -45.900 0.50 26.73  ? 940  SER A CB  1 
ATOM   6641 O OG  A SER A 1  862 ? 18.076  -54.514 -47.182 0.50 27.84  ? 940  SER A OG  1 
ATOM   6642 O OG  B SER A 1  862 ? 18.348  -55.928 -45.833 0.50 27.14  ? 940  SER A OG  1 
ATOM   6643 N N   . LEU A 1  863 ? 17.563  -53.594 -42.454 1.00 27.47  ? 941  LEU A N   1 
ATOM   6644 C CA  . LEU A 1  863 ? 17.744  -53.906 -41.030 1.00 24.80  ? 941  LEU A CA  1 
ATOM   6645 C C   . LEU A 1  863 ? 16.445  -53.747 -40.271 1.00 21.97  ? 941  LEU A C   1 
ATOM   6646 O O   . LEU A 1  863 ? 15.413  -53.385 -40.836 1.00 20.10  ? 941  LEU A O   1 
ATOM   6647 C CB  . LEU A 1  863 ? 18.848  -53.024 -40.452 1.00 22.84  ? 941  LEU A CB  1 
ATOM   6648 C CG  . LEU A 1  863 ? 20.218  -53.264 -41.093 1.00 23.35  ? 941  LEU A CG  1 
ATOM   6649 C CD1 . LEU A 1  863 ? 21.201  -52.217 -40.613 1.00 23.22  ? 941  LEU A CD1 1 
ATOM   6650 C CD2 . LEU A 1  863 ? 20.746  -54.679 -40.819 1.00 27.32  ? 941  LEU A CD2 1 
ATOM   6651 N N   . LEU A 1  864 ? 16.477  -54.085 -38.991 1.00 24.19  ? 942  LEU A N   1 
ATOM   6652 C CA  . LEU A 1  864 ? 15.292  -54.056 -38.159 1.00 22.09  ? 942  LEU A CA  1 
ATOM   6653 C C   . LEU A 1  864 ? 15.646  -53.276 -36.908 1.00 24.04  ? 942  LEU A C   1 
ATOM   6654 O O   . LEU A 1  864 ? 16.659  -53.577 -36.280 1.00 25.92  ? 942  LEU A O   1 
ATOM   6655 C CB  . LEU A 1  864 ? 14.870  -55.479 -37.808 1.00 25.14  ? 942  LEU A CB  1 
ATOM   6656 C CG  . LEU A 1  864 ? 14.330  -56.331 -38.963 1.00 25.71  ? 942  LEU A CG  1 
ATOM   6657 C CD1 . LEU A 1  864 ? 14.265  -57.801 -38.584 1.00 30.45  ? 942  LEU A CD1 1 
ATOM   6658 C CD2 . LEU A 1  864 ? 12.965  -55.826 -39.382 1.00 29.76  ? 942  LEU A CD2 1 
ATOM   6659 N N   . MET A 1  865 ? 14.839  -52.275 -36.552 1.00 24.13  ? 943  MET A N   1 
ATOM   6660 C CA  . MET A 1  865 ? 15.088  -51.485 -35.337 1.00 26.14  ? 943  MET A CA  1 
ATOM   6661 C C   . MET A 1  865 ? 15.231  -52.316 -34.073 1.00 22.46  ? 943  MET A C   1 
ATOM   6662 O O   . MET A 1  865 ? 16.017  -51.965 -33.181 1.00 24.64  ? 943  MET A O   1 
ATOM   6663 C CB  . MET A 1  865 ? 13.975  -50.458 -35.089 1.00 23.59  ? 943  MET A CB  1 
ATOM   6664 C CG  . MET A 1  865 ? 13.975  -49.301 -36.044 1.00 22.54  ? 943  MET A CG  1 
ATOM   6665 S SD  . MET A 1  865 ? 15.516  -48.400 -36.050 1.00 25.09  ? 943  MET A SD  1 
ATOM   6666 C CE  . MET A 1  865 ? 15.019  -46.924 -36.923 1.00 26.04  ? 943  MET A CE  1 
ATOM   6667 N N   . GLY A 1  866 ? 14.464  -53.393 -33.996 1.00 25.81  ? 944  GLY A N   1 
ATOM   6668 C CA  . GLY A 1  866 ? 14.442  -54.257 -32.822 1.00 29.14  ? 944  GLY A CA  1 
ATOM   6669 C C   . GLY A 1  866 ? 15.392  -55.433 -32.802 1.00 29.64  ? 944  GLY A C   1 
ATOM   6670 O O   . GLY A 1  866 ? 15.327  -56.209 -31.870 1.00 26.91  ? 944  GLY A O   1 
ATOM   6671 N N   . GLU A 1  867 ? 16.256  -55.575 -33.811 1.00 28.12  ? 945  GLU A N   1 
ATOM   6672 C CA  . GLU A 1  867 ? 17.316  -56.585 -33.800 1.00 31.97  ? 945  GLU A CA  1 
ATOM   6673 C C   . GLU A 1  867 ? 18.670  -55.915 -33.910 1.00 28.33  ? 945  GLU A C   1 
ATOM   6674 O O   . GLU A 1  867 ? 18.832  -54.969 -34.669 1.00 26.19  ? 945  GLU A O   1 
ATOM   6675 C CB  . GLU A 1  867 ? 17.138  -57.604 -34.933 1.00 33.44  ? 945  GLU A CB  1 
ATOM   6676 C CG  . GLU A 1  867 ? 16.606  -58.926 -34.429 1.00 54.79  ? 945  GLU A CG  1 
ATOM   6677 C CD  . GLU A 1  867 ? 15.801  -59.677 -35.458 1.00 61.68  ? 945  GLU A CD  1 
ATOM   6678 O OE1 . GLU A 1  867 ? 16.274  -59.839 -36.603 1.00 67.37  ? 945  GLU A OE1 1 
ATOM   6679 O OE2 . GLU A 1  867 ? 14.692  -60.113 -35.097 1.00 60.71  ? 945  GLU A OE2 1 
ATOM   6680 N N   . GLN A 1  868 ? 19.635  -56.425 -33.154 1.00 25.60  ? 946  GLN A N   1 
ATOM   6681 C CA  . GLN A 1  868 ? 20.948  -55.814 -33.074 1.00 32.28  ? 946  GLN A CA  1 
ATOM   6682 C C   . GLN A 1  868 ? 21.614  -55.799 -34.427 1.00 30.78  ? 946  GLN A C   1 
ATOM   6683 O O   . GLN A 1  868 ? 21.624  -56.811 -35.125 1.00 29.19  ? 946  GLN A O   1 
ATOM   6684 C CB  . GLN A 1  868 ? 21.850  -56.528 -32.063 1.00 38.70  ? 946  GLN A CB  1 
ATOM   6685 C CG  . GLN A 1  868 ? 21.664  -56.021 -30.649 1.00 46.27  ? 946  GLN A CG  1 
ATOM   6686 C CD  . GLN A 1  868 ? 22.518  -56.777 -29.660 1.00 64.15  ? 946  GLN A CD  1 
ATOM   6687 O OE1 . GLN A 1  868 ? 23.544  -56.282 -29.205 1.00 85.02  ? 946  GLN A OE1 1 
ATOM   6688 N NE2 . GLN A 1  868 ? 22.110  -57.995 -29.342 1.00 56.18  ? 946  GLN A NE2 1 
ATOM   6689 N N   . PHE A 1  869 ? 22.121  -54.630 -34.805 1.00 24.35  ? 947  PHE A N   1 
ATOM   6690 C CA  . PHE A 1  869 ? 22.861  -54.468 -36.046 1.00 23.45  ? 947  PHE A CA  1 
ATOM   6691 C C   . PHE A 1  869 ? 24.169  -53.713 -35.785 1.00 24.16  ? 947  PHE A C   1 
ATOM   6692 O O   . PHE A 1  869 ? 24.316  -53.055 -34.752 1.00 23.26  ? 947  PHE A O   1 
ATOM   6693 C CB  . PHE A 1  869 ? 22.003  -53.745 -37.110 1.00 22.98  ? 947  PHE A CB  1 
ATOM   6694 C CG  . PHE A 1  869 ? 21.589  -52.319 -36.748 1.00 22.29  ? 947  PHE A CG  1 
ATOM   6695 C CD1 . PHE A 1  869 ? 22.496  -51.260 -36.827 1.00 24.61  ? 947  PHE A CD1 1 
ATOM   6696 C CD2 . PHE A 1  869 ? 20.269  -52.020 -36.419 1.00 22.78  ? 947  PHE A CD2 1 
ATOM   6697 C CE1 . PHE A 1  869 ? 22.111  -49.954 -36.529 1.00 23.52  ? 947  PHE A CE1 1 
ATOM   6698 C CE2 . PHE A 1  869 ? 19.874  -50.711 -36.123 1.00 21.60  ? 947  PHE A CE2 1 
ATOM   6699 C CZ  . PHE A 1  869 ? 20.798  -49.676 -36.180 1.00 21.53  ? 947  PHE A CZ  1 
ATOM   6700 N N   . LEU A 1  870 ? 25.107  -53.834 -36.727 1.00 23.90  ? 948  LEU A N   1 
ATOM   6701 C CA  . LEU A 1  870 ? 26.317  -53.017 -36.754 1.00 26.48  ? 948  LEU A CA  1 
ATOM   6702 C C   . LEU A 1  870 ? 26.576  -52.579 -38.178 1.00 24.48  ? 948  LEU A C   1 
ATOM   6703 O O   . LEU A 1  870 ? 26.780  -53.404 -39.051 1.00 23.29  ? 948  LEU A O   1 
ATOM   6704 C CB  . LEU A 1  870 ? 27.533  -53.773 -36.218 1.00 29.76  ? 948  LEU A CB  1 
ATOM   6705 C CG  . LEU A 1  870 ? 28.746  -52.852 -35.948 1.00 36.55  ? 948  LEU A CG  1 
ATOM   6706 C CD1 . LEU A 1  870 ? 29.637  -53.424 -34.851 1.00 48.13  ? 948  LEU A CD1 1 
ATOM   6707 C CD2 . LEU A 1  870 ? 29.571  -52.577 -37.196 1.00 40.05  ? 948  LEU A CD2 1 
ATOM   6708 N N   . VAL A 1  871 ? 26.531  -51.279 -38.411 1.00 25.07  ? 949  VAL A N   1 
ATOM   6709 C CA  . VAL A 1  871 ? 26.876  -50.697 -39.712 1.00 25.14  ? 949  VAL A CA  1 
ATOM   6710 C C   . VAL A 1  871 ? 28.248  -50.054 -39.546 1.00 27.63  ? 949  VAL A C   1 
ATOM   6711 O O   . VAL A 1  871 ? 28.486  -49.393 -38.528 1.00 26.55  ? 949  VAL A O   1 
ATOM   6712 C CB  . VAL A 1  871 ? 25.837  -49.633 -40.110 1.00 25.81  ? 949  VAL A CB  1 
ATOM   6713 C CG1 . VAL A 1  871 ? 26.290  -48.835 -41.338 1.00 27.12  ? 949  VAL A CG1 1 
ATOM   6714 C CG2 . VAL A 1  871 ? 24.471  -50.290 -40.351 1.00 27.86  ? 949  VAL A CG2 1 
ATOM   6715 N N   . SER A 1  872 ? 29.147  -50.253 -40.514 1.00 26.11  ? 950  SER A N   1 
ATOM   6716 C CA  . SER A 1  872 ? 30.506  -49.677 -40.434 1.00 27.74  ? 950  SER A CA  1 
ATOM   6717 C C   . SER A 1  872 ? 31.007  -49.204 -41.783 1.00 27.98  ? 950  SER A C   1 
ATOM   6718 O O   . SER A 1  872 ? 30.474  -49.585 -42.819 1.00 28.50  ? 950  SER A O   1 
ATOM   6719 C CB  . SER A 1  872 ? 31.506  -50.677 -39.845 1.00 27.54  ? 950  SER A CB  1 
ATOM   6720 O OG  . SER A 1  872 ? 31.667  -51.806 -40.681 1.00 32.78  ? 950  SER A OG  1 
ATOM   6721 N N   . TRP A 1  873 ? 32.022  -48.346 -41.749 1.00 32.29  ? 951  TRP A N   1 
ATOM   6722 C CA  . TRP A 1  873 ? 32.694  -47.889 -42.964 1.00 33.36  ? 951  TRP A CA  1 
ATOM   6723 C C   . TRP A 1  873 ? 34.173  -47.559 -42.709 1.00 36.08  ? 951  TRP A C   1 
ATOM   6724 O O   . TRP A 1  873 ? 34.578  -47.291 -41.579 1.00 38.41  ? 951  TRP A O   1 
ATOM   6725 C CB  . TRP A 1  873 ? 31.952  -46.689 -43.565 1.00 31.61  ? 951  TRP A CB  1 
ATOM   6726 C CG  . TRP A 1  873 ? 31.965  -45.461 -42.686 1.00 33.22  ? 951  TRP A CG  1 
ATOM   6727 C CD1 . TRP A 1  873 ? 32.832  -44.409 -42.764 1.00 31.15  ? 951  TRP A CD1 1 
ATOM   6728 C CD2 . TRP A 1  873 ? 31.084  -45.171 -41.597 1.00 29.67  ? 951  TRP A CD2 1 
ATOM   6729 N NE1 . TRP A 1  873 ? 32.553  -43.489 -41.789 1.00 28.26  ? 951  TRP A NE1 1 
ATOM   6730 C CE2 . TRP A 1  873 ? 31.485  -43.924 -41.058 1.00 28.84  ? 951  TRP A CE2 1 
ATOM   6731 C CE3 . TRP A 1  873 ? 30.004  -45.847 -41.014 1.00 29.68  ? 951  TRP A CE3 1 
ATOM   6732 C CZ2 . TRP A 1  873 ? 30.849  -43.341 -39.964 1.00 29.50  ? 951  TRP A CZ2 1 
ATOM   6733 C CZ3 . TRP A 1  873 ? 29.359  -45.259 -39.928 1.00 31.54  ? 951  TRP A CZ3 1 
ATOM   6734 C CH2 . TRP A 1  873 ? 29.789  -44.016 -39.414 1.00 29.87  ? 951  TRP A CH2 1 
ATOM   6735 N N   . CYS A 1  874 ? 34.971  -47.597 -43.769 1.00 38.09  ? 952  CYS A N   1 
ATOM   6736 C CA  . CYS A 1  874 ? 36.360  -47.149 -43.720 1.00 43.39  ? 952  CYS A CA  1 
ATOM   6737 C C   . CYS A 1  874 ? 36.840  -46.834 -45.121 1.00 40.37  ? 952  CYS A C   1 
ATOM   6738 O O   . CYS A 1  874 ? 37.720  -46.009 -45.276 1.00 43.30  ? 952  CYS A O   1 
ATOM   6739 C CB  . CYS A 1  874 ? 37.251  -48.222 -43.109 1.00 45.67  ? 952  CYS A CB  1 
ATOM   6740 S SG  . CYS A 1  874 ? 37.072  -49.791 -43.965 1.00 61.66  ? 952  CYS A SG  1 
ATOM   6741 O OXT . CYS A 1  874 ? 36.367  -47.396 -46.113 1.00 40.12  ? 952  CYS A OXT 1 
HETATM 6742 C C1  . NAG B 2  .   ? 4.851   -18.194 21.942  1.00 32.35  ? 1    NAG B C1  1 
HETATM 6743 C C2  . NAG B 2  .   ? 3.501   -17.512 21.999  1.00 31.49  ? 1    NAG B C2  1 
HETATM 6744 C C3  . NAG B 2  .   ? 3.194   -17.025 23.413  1.00 47.77  ? 1    NAG B C3  1 
HETATM 6745 C C4  . NAG B 2  .   ? 3.312   -18.160 24.424  1.00 51.68  ? 1    NAG B C4  1 
HETATM 6746 C C5  . NAG B 2  .   ? 4.624   -18.926 24.229  1.00 49.96  ? 1    NAG B C5  1 
HETATM 6747 C C6  . NAG B 2  .   ? 4.671   -20.183 25.091  1.00 49.14  ? 1    NAG B C6  1 
HETATM 6748 C C7  . NAG B 2  .   ? 2.624   -16.232 20.118  1.00 31.09  ? 1    NAG B C7  1 
HETATM 6749 C C8  . NAG B 2  .   ? 2.761   -14.979 19.307  1.00 32.40  ? 1    NAG B C8  1 
HETATM 6750 N N2  . NAG B 2  .   ? 3.494   -16.368 21.116  1.00 30.35  ? 1    NAG B N2  1 
HETATM 6751 O O3  . NAG B 2  .   ? 1.872   -16.474 23.442  1.00 37.75  ? 1    NAG B O3  1 
HETATM 6752 O O4  . NAG B 2  .   ? 3.276   -17.599 25.746  1.00 64.70  ? 1    NAG B O4  1 
HETATM 6753 O O5  . NAG B 2  .   ? 4.792   -19.295 22.853  1.00 33.74  ? 1    NAG B O5  1 
HETATM 6754 O O6  . NAG B 2  .   ? 3.609   -21.051 24.674  1.00 56.72  ? 1    NAG B O6  1 
HETATM 6755 O O7  . NAG B 2  .   ? 1.777   -17.075 19.870  1.00 36.64  ? 1    NAG B O7  1 
HETATM 6756 C C1  . NAG B 2  .   ? 2.289   -18.227 26.585  1.00 67.53  ? 2    NAG B C1  1 
HETATM 6757 C C2  . NAG B 2  .   ? 2.630   -17.874 28.029  1.00 77.92  ? 2    NAG B C2  1 
HETATM 6758 C C3  . NAG B 2  .   ? 1.507   -18.226 29.007  1.00 84.27  ? 2    NAG B C3  1 
HETATM 6759 C C4  . NAG B 2  .   ? 0.144   -17.779 28.487  1.00 90.59  ? 2    NAG B C4  1 
HETATM 6760 C C5  . NAG B 2  .   ? -0.062  -18.326 27.074  1.00 103.48 ? 2    NAG B C5  1 
HETATM 6761 C C6  . NAG B 2  .   ? -1.412  -17.945 26.472  1.00 90.42  ? 2    NAG B C6  1 
HETATM 6762 C C7  . NAG B 2  .   ? 5.064   -18.006 28.439  1.00 51.41  ? 2    NAG B C7  1 
HETATM 6763 C C8  . NAG B 2  .   ? 6.196   -18.902 28.850  1.00 49.03  ? 2    NAG B C8  1 
HETATM 6764 N N2  . NAG B 2  .   ? 3.853   -18.576 28.398  1.00 58.32  ? 2    NAG B N2  1 
HETATM 6765 O O3  . NAG B 2  .   ? 1.754   -17.602 30.273  1.00 93.15  ? 2    NAG B O3  1 
HETATM 6766 O O4  . NAG B 2  .   ? -0.879  -18.232 29.385  1.00 88.21  ? 2    NAG B O4  1 
HETATM 6767 O O5  . NAG B 2  .   ? 0.971   -17.812 26.230  1.00 85.44  ? 2    NAG B O5  1 
HETATM 6768 O O6  . NAG B 2  .   ? -1.456  -16.532 26.244  1.00 78.58  ? 2    NAG B O6  1 
HETATM 6769 O O7  . NAG B 2  .   ? 5.271   -16.837 28.168  1.00 55.46  ? 2    NAG B O7  1 
HETATM 6770 C C1  . FCA B 2  .   ? 3.189   -22.000 25.675  1.00 79.00  ? 3    FCA B C1  1 
HETATM 6771 C C2  . FCA B 2  .   ? 3.432   -23.398 25.116  1.00 70.80  ? 3    FCA B C2  1 
HETATM 6772 C C3  . FCA B 2  .   ? 2.453   -23.716 23.991  1.00 76.12  ? 3    FCA B C3  1 
HETATM 6773 C C4  . FCA B 2  .   ? 1.012   -23.428 24.411  1.00 92.63  ? 3    FCA B C4  1 
HETATM 6774 C C5  . FCA B 2  .   ? 0.876   -22.014 24.980  1.00 89.52  ? 3    FCA B C5  1 
HETATM 6775 C C6  . FCA B 2  .   ? -0.539  -21.727 25.479  1.00 87.78  ? 3    FCA B C6  1 
HETATM 6776 O O2  . FCA B 2  .   ? 4.778   -23.485 24.627  1.00 75.23  ? 3    FCA B O2  1 
HETATM 6777 O O3  . FCA B 2  .   ? 2.592   -25.092 23.621  1.00 78.77  ? 3    FCA B O3  1 
HETATM 6778 O O4  . FCA B 2  .   ? 0.597   -24.388 25.392  1.00 125.91 ? 3    FCA B O4  1 
HETATM 6779 O O5  . FCA B 2  .   ? 1.813   -21.837 26.051  1.00 81.57  ? 3    FCA B O5  1 
HETATM 6780 C C1  . NAG C 3  .   ? 17.071  -9.560  2.648   1.00 19.89  ? 1    NAG C C1  1 
HETATM 6781 C C2  . NAG C 3  .   ? 18.572  -9.365  2.814   1.00 25.20  ? 1    NAG C C2  1 
HETATM 6782 C C3  . NAG C 3  .   ? 18.883  -8.411  3.954   1.00 34.13  ? 1    NAG C C3  1 
HETATM 6783 C C4  . NAG C 3  .   ? 18.076  -7.120  3.889   1.00 33.84  ? 1    NAG C C4  1 
HETATM 6784 C C5  . NAG C 3  .   ? 16.605  -7.373  3.522   1.00 27.91  ? 1    NAG C C5  1 
HETATM 6785 C C6  . NAG C 3  .   ? 15.910  -6.059  3.160   1.00 21.12  ? 1    NAG C C6  1 
HETATM 6786 C C7  . NAG C 3  .   ? 20.063  -11.234 2.327   1.00 24.76  ? 1    NAG C C7  1 
HETATM 6787 C C8  . NAG C 3  .   ? 20.685  -12.481 2.883   1.00 29.25  ? 1    NAG C C8  1 
HETATM 6788 N N2  . NAG C 3  .   ? 19.254  -10.596 3.156   1.00 23.20  ? 1    NAG C N2  1 
HETATM 6789 O O3  . NAG C 3  .   ? 20.291  -8.145  3.913   1.00 32.05  ? 1    NAG C O3  1 
HETATM 6790 O O4  . NAG C 3  .   ? 18.140  -6.540  5.207   1.00 52.39  ? 1    NAG C O4  1 
HETATM 6791 O O5  . NAG C 3  .   ? 16.474  -8.283  2.419   1.00 26.27  ? 1    NAG C O5  1 
HETATM 6792 O O6  . NAG C 3  .   ? 16.316  -5.627  1.857   1.00 30.12  ? 1    NAG C O6  1 
HETATM 6793 O O7  . NAG C 3  .   ? 20.261  -10.861 1.186   1.00 25.03  ? 1    NAG C O7  1 
HETATM 6794 C C1  . NAG C 3  .   ? 18.793  -5.263  5.269   1.00 62.74  ? 2    NAG C C1  1 
HETATM 6795 C C2  . NAG C 3  .   ? 18.302  -4.590  6.547   1.00 67.12  ? 2    NAG C C2  1 
HETATM 6796 C C3  . NAG C 3  .   ? 19.074  -3.307  6.856   1.00 73.77  ? 2    NAG C C3  1 
HETATM 6797 C C4  . NAG C 3  .   ? 20.581  -3.500  6.716   1.00 83.42  ? 2    NAG C C4  1 
HETATM 6798 C C5  . NAG C 3  .   ? 20.905  -4.136  5.366   1.00 84.20  ? 2    NAG C C5  1 
HETATM 6799 C C6  . NAG C 3  .   ? 22.405  -4.365  5.204   1.00 87.16  ? 2    NAG C C6  1 
HETATM 6800 C C7  . NAG C 3  .   ? 15.904  -4.902  7.079   1.00 56.58  ? 2    NAG C C7  1 
HETATM 6801 C C8  . NAG C 3  .   ? 14.513  -4.417  6.782   1.00 47.84  ? 2    NAG C C8  1 
HETATM 6802 N N2  . NAG C 3  .   ? 16.883  -4.282  6.408   1.00 60.18  ? 2    NAG C N2  1 
HETATM 6803 O O3  . NAG C 3  .   ? 18.779  -2.885  8.192   1.00 70.01  ? 2    NAG C O3  1 
HETATM 6804 O O4  . NAG C 3  .   ? 21.243  -2.235  6.866   1.00 99.78  ? 2    NAG C O4  1 
HETATM 6805 O O5  . NAG C 3  .   ? 20.216  -5.386  5.259   1.00 60.29  ? 2    NAG C O5  1 
HETATM 6806 O O6  . NAG C 3  .   ? 22.664  -5.058  3.981   1.00 86.13  ? 2    NAG C O6  1 
HETATM 6807 O O7  . NAG C 3  .   ? 16.100  -5.799  7.886   1.00 48.59  ? 2    NAG C O7  1 
HETATM 6808 C C1  . NAG D 3  .   ? -12.162 -27.900 -53.462 1.00 27.08  ? 1    NAG D C1  1 
HETATM 6809 C C2  . NAG D 3  .   ? -12.867 -26.632 -52.994 1.00 25.38  ? 1    NAG D C2  1 
HETATM 6810 C C3  . NAG D 3  .   ? -13.890 -26.145 -54.016 1.00 29.57  ? 1    NAG D C3  1 
HETATM 6811 C C4  . NAG D 3  .   ? -13.303 -26.060 -55.419 1.00 39.71  ? 1    NAG D C4  1 
HETATM 6812 C C5  . NAG D 3  .   ? -12.557 -27.353 -55.760 1.00 45.35  ? 1    NAG D C5  1 
HETATM 6813 C C6  . NAG D 3  .   ? -11.819 -27.287 -57.096 1.00 37.37  ? 1    NAG D C6  1 
HETATM 6814 C C7  . NAG D 3  .   ? -13.062 -26.538 -50.552 1.00 20.82  ? 1    NAG D C7  1 
HETATM 6815 C C8  . NAG D 3  .   ? -13.961 -26.857 -49.402 1.00 23.14  ? 1    NAG D C8  1 
HETATM 6816 N N2  . NAG D 3  .   ? -13.560 -26.862 -51.745 1.00 21.91  ? 1    NAG D N2  1 
HETATM 6817 O O3  . NAG D 3  .   ? -14.354 -24.856 -53.620 1.00 33.33  ? 1    NAG D O3  1 
HETATM 6818 O O4  . NAG D 3  .   ? -14.380 -25.877 -56.353 1.00 54.36  ? 1    NAG D O4  1 
HETATM 6819 O O5  . NAG D 3  .   ? -11.594 -27.634 -54.744 1.00 31.55  ? 1    NAG D O5  1 
HETATM 6820 O O6  . NAG D 3  .   ? -10.783 -26.303 -57.019 1.00 41.61  ? 1    NAG D O6  1 
HETATM 6821 O O7  . NAG D 3  .   ? -11.960 -26.036 -50.385 1.00 23.04  ? 1    NAG D O7  1 
HETATM 6822 C C1  . NAG D 3  .   ? -14.342 -24.597 -57.023 1.00 56.21  ? 2    NAG D C1  1 
HETATM 6823 C C2  . NAG D 3  .   ? -15.130 -24.686 -58.324 1.00 53.37  ? 2    NAG D C2  1 
HETATM 6824 C C3  . NAG D 3  .   ? -15.078 -23.339 -59.032 1.00 62.87  ? 2    NAG D C3  1 
HETATM 6825 C C4  . NAG D 3  .   ? -15.591 -22.232 -58.121 1.00 68.04  ? 2    NAG D C4  1 
HETATM 6826 C C5  . NAG D 3  .   ? -14.881 -22.249 -56.767 1.00 68.47  ? 2    NAG D C5  1 
HETATM 6827 C C6  . NAG D 3  .   ? -15.561 -21.303 -55.777 1.00 68.42  ? 2    NAG D C6  1 
HETATM 6828 C C7  . NAG D 3  .   ? -15.075 -26.991 -59.206 1.00 53.25  ? 2    NAG D C7  1 
HETATM 6829 C C8  . NAG D 3  .   ? -14.402 -27.929 -60.169 1.00 52.47  ? 2    NAG D C8  1 
HETATM 6830 N N2  . NAG D 3  .   ? -14.609 -25.734 -59.192 1.00 50.80  ? 2    NAG D N2  1 
HETATM 6831 O O3  . NAG D 3  .   ? -15.888 -23.376 -60.207 1.00 72.89  ? 2    NAG D O3  1 
HETATM 6832 O O4  . NAG D 3  .   ? -15.386 -20.973 -58.771 1.00 89.01  ? 2    NAG D O4  1 
HETATM 6833 O O5  . NAG D 3  .   ? -14.882 -23.564 -56.198 1.00 62.90  ? 2    NAG D O5  1 
HETATM 6834 O O6  . NAG D 3  .   ? -14.574 -20.656 -54.969 1.00 75.60  ? 2    NAG D O6  1 
HETATM 6835 O O7  . NAG D 3  .   ? -15.977 -27.380 -58.481 1.00 63.25  ? 2    NAG D O7  1 
HETATM 6836 C C1  . NAG E 4  .   ? -30.899 -16.465 -10.482 1.00 21.42  ? 1    NAG E C1  1 
HETATM 6837 C C2  . NAG E 4  .   ? -31.402 -15.029 -10.557 1.00 25.48  ? 1    NAG E C2  1 
HETATM 6838 C C3  . NAG E 4  .   ? -32.858 -14.986 -11.010 1.00 22.35  ? 1    NAG E C3  1 
HETATM 6839 C C4  . NAG E 4  .   ? -32.993 -15.740 -12.326 1.00 22.07  ? 1    NAG E C4  1 
HETATM 6840 C C5  . NAG E 4  .   ? -32.454 -17.157 -12.161 1.00 20.82  ? 1    NAG E C5  1 
HETATM 6841 C C6  . NAG E 4  .   ? -32.537 -17.948 -13.458 1.00 18.38  ? 1    NAG E C6  1 
HETATM 6842 C C7  . NAG E 4  .   ? -30.451 -13.365 -9.013  1.00 23.55  ? 1    NAG E C7  1 
HETATM 6843 C C8  . NAG E 4  .   ? -30.465 -12.831 -7.607  1.00 24.92  ? 1    NAG E C8  1 
HETATM 6844 N N2  . NAG E 4  .   ? -31.273 -14.385 -9.260  1.00 24.11  ? 1    NAG E N2  1 
HETATM 6845 O O3  . NAG E 4  .   ? -33.277 -13.625 -11.147 1.00 22.51  ? 1    NAG E O3  1 
HETATM 6846 O O4  . NAG E 4  .   ? -34.355 -15.832 -12.764 1.00 21.94  ? 1    NAG E O4  1 
HETATM 6847 O O5  . NAG E 4  .   ? -31.087 -17.071 -11.749 1.00 21.51  ? 1    NAG E O5  1 
HETATM 6848 O O6  . NAG E 4  .   ? -31.977 -19.250 -13.259 1.00 19.04  ? 1    NAG E O6  1 
HETATM 6849 O O7  . NAG E 4  .   ? -29.718 -12.881 -9.858  1.00 24.38  ? 1    NAG E O7  1 
HETATM 6850 C C1  . NAG E 4  .   ? -34.746 -14.742 -13.602 1.00 26.05  ? 2    NAG E C1  1 
HETATM 6851 C C2  . NAG E 4  .   ? -35.694 -15.288 -14.651 1.00 30.22  ? 2    NAG E C2  1 
HETATM 6852 C C3  . NAG E 4  .   ? -36.333 -14.164 -15.452 1.00 32.91  ? 2    NAG E C3  1 
HETATM 6853 C C4  . NAG E 4  .   ? -36.936 -13.133 -14.523 1.00 33.46  ? 2    NAG E C4  1 
HETATM 6854 C C5  . NAG E 4  .   ? -35.885 -12.646 -13.537 1.00 35.08  ? 2    NAG E C5  1 
HETATM 6855 C C6  . NAG E 4  .   ? -36.460 -11.630 -12.562 1.00 30.39  ? 2    NAG E C6  1 
HETATM 6856 C C7  . NAG E 4  .   ? -35.406 -17.403 -15.856 1.00 28.26  ? 2    NAG E C7  1 
HETATM 6857 C C8  . NAG E 4  .   ? -34.568 -18.172 -16.838 1.00 24.17  ? 2    NAG E C8  1 
HETATM 6858 N N2  . NAG E 4  .   ? -34.997 -16.161 -15.578 1.00 29.25  ? 2    NAG E N2  1 
HETATM 6859 O O3  . NAG E 4  .   ? -37.339 -14.700 -16.307 1.00 29.97  ? 2    NAG E O3  1 
HETATM 6860 O O4  . NAG E 4  .   ? -37.366 -12.023 -15.307 1.00 39.51  ? 2    NAG E O4  1 
HETATM 6861 O O5  . NAG E 4  .   ? -35.376 -13.754 -12.799 1.00 26.69  ? 2    NAG E O5  1 
HETATM 6862 O O6  . NAG E 4  .   ? -35.517 -11.430 -11.506 1.00 43.06  ? 2    NAG E O6  1 
HETATM 6863 O O7  . NAG E 4  .   ? -36.393 -17.906 -15.338 1.00 32.87  ? 2    NAG E O7  1 
HETATM 6864 C C1  . BMA E 4  .   ? -38.795 -11.955 -15.495 1.00 54.64  ? 3    BMA E C1  1 
HETATM 6865 C C2  . BMA E 4  .   ? -39.157 -10.482 -15.536 1.00 56.13  ? 3    BMA E C2  1 
HETATM 6866 C C3  . BMA E 4  .   ? -40.668 -10.313 -15.686 1.00 70.98  ? 3    BMA E C3  1 
HETATM 6867 C C4  . BMA E 4  .   ? -41.194 -11.119 -16.876 1.00 71.10  ? 3    BMA E C4  1 
HETATM 6868 C C5  . BMA E 4  .   ? -40.664 -12.557 -16.882 1.00 74.95  ? 3    BMA E C5  1 
HETATM 6869 C C6  . BMA E 4  .   ? -41.053 -13.250 -18.189 1.00 68.24  ? 3    BMA E C6  1 
HETATM 6870 O O2  . BMA E 4  .   ? -38.440 -9.886  -16.626 1.00 45.05  ? 3    BMA E O2  1 
HETATM 6871 O O3  . BMA E 4  .   ? -41.003 -8.921  -15.823 1.00 64.64  ? 3    BMA E O3  1 
HETATM 6872 O O4  . BMA E 4  .   ? -42.625 -11.158 -16.831 1.00 88.18  ? 3    BMA E O4  1 
HETATM 6873 O O5  . BMA E 4  .   ? -39.237 -12.580 -16.704 1.00 61.07  ? 3    BMA E O5  1 
HETATM 6874 O O6  . BMA E 4  .   ? -40.483 -14.562 -18.262 1.00 81.20  ? 3    BMA E O6  1 
HETATM 6875 C C1  . NAG F 5  .   ? -11.010 -10.299 -45.942 1.00 36.02  ? 1    NAG F C1  1 
HETATM 6876 C C2  . NAG F 5  .   ? -11.363 -8.891  -45.470 1.00 50.80  ? 1    NAG F C2  1 
HETATM 6877 C C3  . NAG F 5  .   ? -12.862 -8.647  -45.627 1.00 57.92  ? 1    NAG F C3  1 
HETATM 6878 C C4  . NAG F 5  .   ? -13.246 -8.812  -47.089 1.00 54.86  ? 1    NAG F C4  1 
HETATM 6879 C C5  . NAG F 5  .   ? -12.794 -10.185 -47.591 1.00 61.68  ? 1    NAG F C5  1 
HETATM 6880 C C6  . NAG F 5  .   ? -13.030 -10.303 -49.094 1.00 65.97  ? 1    NAG F C6  1 
HETATM 6881 C C7  . NAG F 5  .   ? -10.210 -7.665  -43.664 1.00 56.25  ? 1    NAG F C7  1 
HETATM 6882 C C8  . NAG F 5  .   ? -9.899  -7.652  -42.194 1.00 42.28  ? 1    NAG F C8  1 
HETATM 6883 N N2  . NAG F 5  .   ? -10.955 -8.696  -44.086 1.00 43.07  ? 1    NAG F N2  1 
HETATM 6884 O O3  . NAG F 5  .   ? -13.205 -7.331  -45.183 1.00 66.68  ? 1    NAG F O3  1 
HETATM 6885 O O4  . NAG F 5  .   ? -14.664 -8.646  -47.244 1.00 66.12  ? 1    NAG F O4  1 
HETATM 6886 O O5  . NAG F 5  .   ? -11.398 -10.417 -47.314 1.00 39.73  ? 1    NAG F O5  1 
HETATM 6887 O O6  . NAG F 5  .   ? -12.080 -9.455  -49.755 1.00 65.80  ? 1    NAG F O6  1 
HETATM 6888 O O7  . NAG F 5  .   ? -9.799  -6.783  -44.406 1.00 47.86  ? 1    NAG F O7  1 
HETATM 6889 C C1  . FCA F 5  .   ? -12.383 -9.114  -51.127 1.00 89.56  ? 2    FCA F C1  1 
HETATM 6890 C C2  . FCA F 5  .   ? -11.738 -10.097 -52.099 1.00 86.81  ? 2    FCA F C2  1 
HETATM 6891 C C3  . FCA F 5  .   ? -10.224 -10.091 -51.913 1.00 95.45  ? 2    FCA F C3  1 
HETATM 6892 C C4  . FCA F 5  .   ? -9.663  -8.672  -52.075 1.00 98.52  ? 2    FCA F C4  1 
HETATM 6893 C C5  . FCA F 5  .   ? -10.473 -7.625  -51.289 1.00 93.10  ? 2    FCA F C5  1 
HETATM 6894 C C6  . FCA F 5  .   ? -10.100 -6.199  -51.694 1.00 70.88  ? 2    FCA F C6  1 
HETATM 6895 O O2  . FCA F 5  .   ? -12.245 -11.423 -51.920 1.00 73.29  ? 2    FCA F O2  1 
HETATM 6896 O O3  . FCA F 5  .   ? -9.638  -10.998 -52.854 1.00 77.80  ? 2    FCA F O3  1 
HETATM 6897 O O4  . FCA F 5  .   ? -9.629  -8.326  -53.465 1.00 96.84  ? 2    FCA F O4  1 
HETATM 6898 O O5  . FCA F 5  .   ? -11.894 -7.806  -51.457 1.00 103.48 ? 2    FCA F O5  1 
HETATM 6899 C C1  . NAG G 6  .   ? 38.394  -48.520 -33.944 1.00 84.09  ? 1013 NAG A C1  1 
HETATM 6900 C C2  . NAG G 6  .   ? 39.316  -48.566 -32.727 1.00 102.97 ? 1013 NAG A C2  1 
HETATM 6901 C C3  . NAG G 6  .   ? 40.701  -48.988 -33.204 1.00 114.85 ? 1013 NAG A C3  1 
HETATM 6902 C C4  . NAG G 6  .   ? 40.630  -50.351 -33.897 1.00 119.35 ? 1013 NAG A C4  1 
HETATM 6903 C C5  . NAG G 6  .   ? 39.457  -50.484 -34.881 1.00 105.95 ? 1013 NAG A C5  1 
HETATM 6904 C C6  . NAG G 6  .   ? 39.194  -51.966 -35.150 1.00 86.61  ? 1013 NAG A C6  1 
HETATM 6905 C C7  . NAG G 6  .   ? 39.044  -47.140 -30.719 1.00 76.83  ? 1013 NAG A C7  1 
HETATM 6906 C C8  . NAG G 6  .   ? 39.161  -45.742 -30.185 1.00 58.89  ? 1013 NAG A C8  1 
HETATM 6907 N N2  . NAG G 6  .   ? 39.365  -47.292 -32.013 1.00 94.40  ? 1013 NAG A N2  1 
HETATM 6908 O O3  . NAG G 6  .   ? 41.603  -49.051 -32.092 1.00 112.03 ? 1013 NAG A O3  1 
HETATM 6909 O O4  . NAG G 6  .   ? 41.855  -50.577 -34.605 1.00 128.89 ? 1013 NAG A O4  1 
HETATM 6910 O O5  . NAG G 6  .   ? 38.248  -49.872 -34.397 1.00 98.34  ? 1013 NAG A O5  1 
HETATM 6911 O O6  . NAG G 6  .   ? 38.268  -52.123 -36.230 1.00 93.48  ? 1013 NAG A O6  1 
HETATM 6912 O O7  . NAG G 6  .   ? 38.677  -48.055 -29.996 1.00 75.25  ? 1013 NAG A O7  1 
HETATM 6913 C C1  A GLC H 7  .   ? -13.758 -18.739 -30.484 0.50 28.33  ? 1014 GLC A C1  1 
HETATM 6914 C C2  A GLC H 7  .   ? -12.549 -19.586 -30.856 0.50 27.14  ? 1014 GLC A C2  1 
HETATM 6915 C C3  A GLC H 7  .   ? -12.424 -19.662 -32.371 0.50 26.49  ? 1014 GLC A C3  1 
HETATM 6916 C C4  A GLC H 7  .   ? -13.733 -20.167 -32.959 0.50 25.87  ? 1014 GLC A C4  1 
HETATM 6917 C C5  A GLC H 7  .   ? -14.919 -19.338 -32.477 0.50 25.79  ? 1014 GLC A C5  1 
HETATM 6918 C C6  A GLC H 7  .   ? -16.236 -19.934 -32.964 0.50 25.86  ? 1014 GLC A C6  1 
HETATM 6919 O O1  A GLC H 7  .   ? -13.566 -17.408 -30.970 0.50 37.35  ? 1014 GLC A O1  1 
HETATM 6920 O O2  A GLC H 7  .   ? -11.386 -18.995 -30.272 0.50 24.37  ? 1014 GLC A O2  1 
HETATM 6921 O O3  A GLC H 7  .   ? -11.364 -20.545 -32.759 0.50 24.95  ? 1014 GLC A O3  1 
HETATM 6922 O O4  A GLC H 7  .   ? -13.657 -20.126 -34.387 0.50 23.41  ? 1014 GLC A O4  1 
HETATM 6923 O O5  A GLC H 7  .   ? -14.935 -19.304 -31.055 0.50 27.77  ? 1014 GLC A O5  1 
HETATM 6924 O O6  A GLC H 7  .   ? -16.454 -21.206 -32.340 0.50 23.95  ? 1014 GLC A O6  1 
HETATM 6925 C C2  B BGC I 8  .   ? -12.608 -19.562 -30.853 0.50 12.66  ? 1015 BGC A C2  1 
HETATM 6926 C C3  B BGC I 8  .   ? -12.384 -19.716 -32.350 0.50 12.92  ? 1015 BGC A C3  1 
HETATM 6927 C C4  B BGC I 8  .   ? -13.656 -20.274 -32.959 0.50 12.46  ? 1015 BGC A C4  1 
HETATM 6928 C C5  B BGC I 8  .   ? -14.847 -19.365 -32.662 0.50 13.14  ? 1015 BGC A C5  1 
HETATM 6929 C C6  B BGC I 8  .   ? -16.148 -19.967 -33.192 0.50 13.93  ? 1015 BGC A C6  1 
HETATM 6930 C C1  B BGC I 8  .   ? -13.806 -18.645 -30.624 0.50 12.57  ? 1015 BGC A C1  1 
HETATM 6931 O O1  B BGC I 8  .   ? -14.045 -18.475 -29.223 0.50 10.79  ? 1015 BGC A O1  1 
HETATM 6932 O O2  B BGC I 8  .   ? -11.466 -18.992 -30.210 0.50 11.93  ? 1015 BGC A O2  1 
HETATM 6933 O O3  B BGC I 8  .   ? -11.305 -20.608 -32.650 0.50 13.26  ? 1015 BGC A O3  1 
HETATM 6934 O O4  B BGC I 8  .   ? -13.458 -20.430 -34.366 0.50 10.48  ? 1015 BGC A O4  1 
HETATM 6935 O O5  B BGC I 8  .   ? -14.968 -19.181 -31.254 0.50 12.44  ? 1015 BGC A O5  1 
HETATM 6936 O O6  B BGC I 8  .   ? -16.517 -21.115 -32.415 0.50 14.62  ? 1015 BGC A O6  1 
HETATM 6937 C C1  . GLC J 7  .   ? 3.281   5.821   -9.183  1.00 23.89  ? 1016 GLC A C1  1 
HETATM 6938 C C2  . GLC J 7  .   ? 3.060   4.430   -9.759  1.00 27.34  ? 1016 GLC A C2  1 
HETATM 6939 C C3  . GLC J 7  .   ? 1.787   3.776   -9.226  1.00 22.78  ? 1016 GLC A C3  1 
HETATM 6940 C C4  . GLC J 7  .   ? 1.669   3.927   -7.709  1.00 23.24  ? 1016 GLC A C4  1 
HETATM 6941 C C5  . GLC J 7  .   ? 1.824   5.392   -7.281  1.00 23.40  ? 1016 GLC A C5  1 
HETATM 6942 C C6  . GLC J 7  .   ? 1.830   5.583   -5.769  1.00 22.74  ? 1016 GLC A C6  1 
HETATM 6943 O O2  . GLC J 7  .   ? 2.974   4.527   -11.194 1.00 23.43  ? 1016 GLC A O2  1 
HETATM 6944 O O3  . GLC J 7  .   ? 1.863   2.402   -9.593  1.00 24.52  ? 1016 GLC A O3  1 
HETATM 6945 O O4  . GLC J 7  .   ? 0.401   3.426   -7.292  1.00 21.58  ? 1016 GLC A O4  1 
HETATM 6946 O O5  . GLC J 7  .   ? 3.052   5.943   -7.777  1.00 24.45  ? 1016 GLC A O5  1 
HETATM 6947 O O6  . GLC J 7  .   ? 3.011   5.008   -5.189  1.00 18.21  ? 1016 GLC A O6  1 
HETATM 6948 C C2  . BGC K 8  .   ? -1.123  9.982   -7.447  1.00 37.52  ? 1017 BGC A C2  1 
HETATM 6949 C C3  . BGC K 8  .   ? -0.935  10.650  -8.811  1.00 38.52  ? 1017 BGC A C3  1 
HETATM 6950 C C4  . BGC K 8  .   ? 0.376   10.217  -9.461  1.00 38.41  ? 1017 BGC A C4  1 
HETATM 6951 C C5  . BGC K 8  .   ? 0.489   8.702   -9.438  1.00 33.79  ? 1017 BGC A C5  1 
HETATM 6952 C C6  . BGC K 8  .   ? 1.847   8.281   -9.941  1.00 29.02  ? 1017 BGC A C6  1 
HETATM 6953 C C1  . BGC K 8  .   ? -0.966  8.466   -7.572  1.00 33.56  ? 1017 BGC A C1  1 
HETATM 6954 O O1  . BGC K 8  .   ? -1.152  7.813   -6.308  1.00 26.05  ? 1017 BGC A O1  1 
HETATM 6955 O O2  . BGC K 8  .   ? -2.416  10.276  -6.929  1.00 37.20  ? 1017 BGC A O2  1 
HETATM 6956 O O3  . BGC K 8  .   ? -0.928  12.072  -8.671  1.00 46.94  ? 1017 BGC A O3  1 
HETATM 6957 O O4  . BGC K 8  .   ? 0.460   10.659  -10.817 1.00 35.83  ? 1017 BGC A O4  1 
HETATM 6958 O O5  . BGC K 8  .   ? 0.341   8.230   -8.091  1.00 34.49  ? 1017 BGC A O5  1 
HETATM 6959 O O6  . BGC K 8  .   ? 1.820   6.859   -10.022 1.00 28.48  ? 1017 BGC A O6  1 
HETATM 6960 C C1  . EDO L 9  .   ? 17.249  -10.410 -38.895 1.00 53.94  ? 1018 EDO A C1  1 
HETATM 6961 O O1  . EDO L 9  .   ? 17.108  -11.792 -39.249 1.00 48.65  ? 1018 EDO A O1  1 
HETATM 6962 C C2  . EDO L 9  .   ? 17.543  -9.584  -40.136 1.00 46.62  ? 1018 EDO A C2  1 
HETATM 6963 O O2  . EDO L 9  .   ? 16.934  -10.200 -41.273 1.00 49.27  ? 1018 EDO A O2  1 
HETATM 6964 C C1  . EDO M 9  .   ? 26.720  -57.962 -36.850 1.00 56.06  ? 1019 EDO A C1  1 
HETATM 6965 O O1  . EDO M 9  .   ? 28.075  -58.395 -36.669 1.00 58.74  ? 1019 EDO A O1  1 
HETATM 6966 C C2  . EDO M 9  .   ? 25.854  -58.334 -35.649 1.00 52.13  ? 1019 EDO A C2  1 
HETATM 6967 O O2  . EDO M 9  .   ? 26.014  -57.366 -34.603 1.00 52.13  ? 1019 EDO A O2  1 
HETATM 6968 C C1  . PGE N 10 .   ? -1.224  -27.048 1.705   1.00 39.64  ? 1020 PGE A C1  1 
HETATM 6969 O O1  . PGE N 10 .   ? -2.403  -27.120 2.511   1.00 33.70  ? 1020 PGE A O1  1 
HETATM 6970 C C2  . PGE N 10 .   ? -0.115  -27.854 2.368   1.00 36.41  ? 1020 PGE A C2  1 
HETATM 6971 O O2  . PGE N 10 .   ? 0.176   -27.304 3.654   1.00 40.81  ? 1020 PGE A O2  1 
HETATM 6972 C C3  . PGE N 10 .   ? 1.034   -28.164 4.413   1.00 48.02  ? 1020 PGE A C3  1 
HETATM 6973 C C4  . PGE N 10 .   ? 1.452   -27.521 5.735   1.00 44.20  ? 1020 PGE A C4  1 
HETATM 6974 O O4  . PGE N 10 .   ? -2.187  -26.870 8.343   1.00 48.09  ? 1020 PGE A O4  1 
HETATM 6975 C C6  . PGE N 10 .   ? -0.789  -26.660 8.589   1.00 37.47  ? 1020 PGE A C6  1 
HETATM 6976 C C5  . PGE N 10 .   ? 0.099   -27.588 7.763   1.00 42.03  ? 1020 PGE A C5  1 
HETATM 6977 O O3  . PGE N 10 .   ? 0.303   -27.049 6.451   1.00 49.79  ? 1020 PGE A O3  1 
HETATM 6978 C C1  . PEG O 11 .   ? -16.727 -27.866 0.899   1.00 71.06  ? 1021 PEG A C1  1 
HETATM 6979 O O1  . PEG O 11 .   ? -15.346 -27.719 0.539   1.00 58.75  ? 1021 PEG A O1  1 
HETATM 6980 C C2  . PEG O 11 .   ? -17.515 -28.399 -0.292  1.00 59.18  ? 1021 PEG A C2  1 
HETATM 6981 O O2  . PEG O 11 .   ? -17.619 -29.818 -0.193  1.00 59.20  ? 1021 PEG A O2  1 
HETATM 6982 C C3  . PEG O 11 .   ? -18.942 -30.325 0.012   1.00 56.67  ? 1021 PEG A C3  1 
HETATM 6983 C C4  . PEG O 11 .   ? -18.867 -31.700 0.671   1.00 57.89  ? 1021 PEG A C4  1 
HETATM 6984 O O4  . PEG O 11 .   ? -19.685 -32.642 -0.035  1.00 62.44  ? 1021 PEG A O4  1 
HETATM 6985 S S   . SO4 P 12 .   ? 1.885   -7.043  -39.906 1.00 44.05  ? 1022 SO4 A S   1 
HETATM 6986 O O1  . SO4 P 12 .   ? 1.317   -8.189  -40.665 1.00 29.64  ? 1022 SO4 A O1  1 
HETATM 6987 O O2  . SO4 P 12 .   ? 3.045   -6.528  -40.676 1.00 61.35  ? 1022 SO4 A O2  1 
HETATM 6988 O O3  . SO4 P 12 .   ? 2.309   -7.420  -38.523 1.00 31.14  ? 1022 SO4 A O3  1 
HETATM 6989 O O4  . SO4 P 12 .   ? 0.844   -5.993  -39.803 1.00 47.60  ? 1022 SO4 A O4  1 
HETATM 6990 S S   . SO4 Q 12 .   ? -6.475  5.633   3.565   1.00 93.07  ? 1023 SO4 A S   1 
HETATM 6991 O O1  . SO4 Q 12 .   ? -6.954  4.448   2.821   1.00 56.54  ? 1023 SO4 A O1  1 
HETATM 6992 O O2  . SO4 Q 12 .   ? -6.078  6.700   2.613   1.00 83.14  ? 1023 SO4 A O2  1 
HETATM 6993 O O3  . SO4 Q 12 .   ? -7.562  6.127   4.441   1.00 111.91 ? 1023 SO4 A O3  1 
HETATM 6994 O O4  . SO4 Q 12 .   ? -5.315  5.239   4.396   1.00 55.22  ? 1023 SO4 A O4  1 
HETATM 6995 C C1  . PEG R 11 .   ? -5.404  -3.333  -22.930 1.00 59.51  ? 1024 PEG A C1  1 
HETATM 6996 O O1  . PEG R 11 .   ? -5.700  -4.301  -23.938 1.00 58.82  ? 1024 PEG A O1  1 
HETATM 6997 C C2  . PEG R 11 .   ? -4.974  -4.014  -21.629 1.00 52.37  ? 1024 PEG A C2  1 
HETATM 6998 O O2  . PEG R 11 .   ? -5.818  -3.604  -20.542 1.00 63.41  ? 1024 PEG A O2  1 
HETATM 6999 C C3  . PEG R 11 .   ? -5.138  -3.466  -19.293 1.00 56.40  ? 1024 PEG A C3  1 
HETATM 7000 C C4  . PEG R 11 .   ? -6.137  -3.248  -18.159 1.00 51.58  ? 1024 PEG A C4  1 
HETATM 7001 O O4  . PEG R 11 .   ? -6.674  -1.922  -18.197 1.00 48.41  ? 1024 PEG A O4  1 
HETATM 7002 S S   . SO4 S 12 .   ? 1.466   -44.678 -18.746 1.00 48.02  ? 1025 SO4 A S   1 
HETATM 7003 O O1  . SO4 S 12 .   ? 1.549   -45.029 -20.181 1.00 51.61  ? 1025 SO4 A O1  1 
HETATM 7004 O O2  . SO4 S 12 .   ? 0.119   -44.140 -18.445 1.00 53.45  ? 1025 SO4 A O2  1 
HETATM 7005 O O3  . SO4 S 12 .   ? 1.718   -45.921 -17.968 1.00 46.73  ? 1025 SO4 A O3  1 
HETATM 7006 O O4  . SO4 S 12 .   ? 2.452   -43.625 -18.432 1.00 41.60  ? 1025 SO4 A O4  1 
HETATM 7007 C C1  . EDO T 9  .   ? 7.114   7.721   8.272   1.00 53.07  ? 1026 EDO A C1  1 
HETATM 7008 O O1  . EDO T 9  .   ? 6.009   7.218   9.026   1.00 49.62  ? 1026 EDO A O1  1 
HETATM 7009 C C2  . EDO T 9  .   ? 6.641   8.326   6.953   1.00 57.66  ? 1026 EDO A C2  1 
HETATM 7010 O O2  . EDO T 9  .   ? 7.116   9.674   6.820   1.00 50.87  ? 1026 EDO A O2  1 
HETATM 7011 O O   . HOH U 13 .   ? -33.403 -36.176 -17.638 1.00 30.76  ? 1101 HOH A O   1 
HETATM 7012 O O   . HOH U 13 .   ? -6.875  -43.197 -30.853 1.00 29.71  ? 1102 HOH A O   1 
HETATM 7013 O O   . HOH U 13 .   ? -26.709 -37.624 -16.936 1.00 34.52  ? 1103 HOH A O   1 
HETATM 7014 O O   . HOH U 13 .   ? 17.915  -26.508 8.973   1.00 35.59  ? 1104 HOH A O   1 
HETATM 7015 O O   . HOH U 13 .   ? -0.402  -54.303 -24.861 1.00 43.48  ? 1105 HOH A O   1 
HETATM 7016 O O   . HOH U 13 .   ? 23.112  -43.952 -24.122 1.00 47.21  ? 1106 HOH A O   1 
HETATM 7017 O O   . HOH U 13 .   ? -22.856 -27.147 -4.343  1.00 49.78  ? 1107 HOH A O   1 
HETATM 7018 O O   . HOH U 13 .   ? -0.067  -0.608  -15.441 1.00 37.57  ? 1108 HOH A O   1 
HETATM 7019 O O   . HOH U 13 .   ? -10.233 -45.298 -29.639 1.00 28.11  ? 1109 HOH A O   1 
HETATM 7020 O O   . HOH U 13 .   ? -0.764  -38.166 -52.817 1.00 42.42  ? 1110 HOH A O   1 
HETATM 7021 O O   . HOH U 13 .   ? 7.573   8.006   -16.861 1.00 35.17  ? 1111 HOH A O   1 
HETATM 7022 O O   . HOH U 13 .   ? -14.052 -15.689 -32.734 1.00 39.26  ? 1112 HOH A O   1 
HETATM 7023 O O   . HOH U 13 .   ? 21.435  -6.983  1.994   1.00 40.12  ? 1113 HOH A O   1 
HETATM 7024 O O   . HOH U 13 .   ? 3.434   -2.517  14.811  1.00 44.41  ? 1114 HOH A O   1 
HETATM 7025 O O   . HOH U 13 .   ? 10.962  -14.580 17.295  1.00 38.55  ? 1115 HOH A O   1 
HETATM 7026 O O   . HOH U 13 .   ? 12.780  -0.745  -0.207  1.00 38.98  ? 1116 HOH A O   1 
HETATM 7027 O O   . HOH U 13 .   ? -1.844  -5.927  -16.010 1.00 25.89  ? 1117 HOH A O   1 
HETATM 7028 O O   . HOH U 13 .   ? -0.227  -13.688 17.187  1.00 22.31  ? 1118 HOH A O   1 
HETATM 7029 O O   . HOH U 13 .   ? 12.534  -32.954 -6.093  1.00 42.05  ? 1119 HOH A O   1 
HETATM 7030 O O   . HOH U 13 .   ? 31.923  -54.109 -39.606 1.00 47.10  ? 1120 HOH A O   1 
HETATM 7031 O O   . HOH U 13 .   ? 13.317  -3.938  -4.700  1.00 44.75  ? 1121 HOH A O   1 
HETATM 7032 O O   . HOH U 13 .   ? -27.377 -37.631 -10.639 1.00 32.80  ? 1122 HOH A O   1 
HETATM 7033 O O   . HOH U 13 .   ? -30.033 -20.916 -25.735 1.00 18.99  ? 1123 HOH A O   1 
HETATM 7034 O O   . HOH U 13 .   ? 9.955   -25.699 -50.165 1.00 61.00  ? 1124 HOH A O   1 
HETATM 7035 O O   . HOH U 13 .   ? -21.816 -6.507  -8.953  1.00 31.31  ? 1125 HOH A O   1 
HETATM 7036 O O   . HOH U 13 .   ? -15.664 -26.101 -23.898 1.00 16.63  ? 1126 HOH A O   1 
HETATM 7037 O O   . HOH U 13 .   ? 18.029  -23.722 11.342  1.00 28.39  ? 1127 HOH A O   1 
HETATM 7038 O O   . HOH U 13 .   ? 15.200  -30.188 14.559  1.00 33.10  ? 1128 HOH A O   1 
HETATM 7039 O O   . HOH U 13 .   ? 22.203  -30.168 5.073   1.00 34.82  ? 1129 HOH A O   1 
HETATM 7040 O O   . HOH U 13 .   ? -2.869  -24.922 -0.815  1.00 15.99  ? 1130 HOH A O   1 
HETATM 7041 O O   . HOH U 13 .   ? 1.961   -24.839 -15.610 1.00 17.33  ? 1131 HOH A O   1 
HETATM 7042 O O   . HOH U 13 .   ? 33.079  -36.525 -29.854 1.00 35.71  ? 1132 HOH A O   1 
HETATM 7043 O O   . HOH U 13 .   ? -17.635 -5.175  -10.228 1.00 41.21  ? 1133 HOH A O   1 
HETATM 7044 O O   . HOH U 13 .   ? -3.771  -27.237 -2.120  1.00 20.27  ? 1134 HOH A O   1 
HETATM 7045 O O   . HOH U 13 .   ? 24.527  -19.581 -11.889 1.00 24.15  ? 1135 HOH A O   1 
HETATM 7046 O O   . HOH U 13 .   ? 28.732  -51.491 -50.764 1.00 38.33  ? 1136 HOH A O   1 
HETATM 7047 O O   . HOH U 13 .   ? 5.837   3.279   8.708   1.00 24.30  ? 1137 HOH A O   1 
HETATM 7048 O O   . HOH U 13 .   ? 4.104   -7.445  15.131  1.00 26.20  ? 1138 HOH A O   1 
HETATM 7049 O O   . HOH U 13 .   ? 25.543  -15.331 0.380   1.00 38.10  ? 1139 HOH A O   1 
HETATM 7050 O O   . HOH U 13 .   ? -4.699  -26.384 5.228   1.00 30.42  ? 1140 HOH A O   1 
HETATM 7051 O O   . HOH U 13 .   ? 17.265  -39.061 -30.828 1.00 19.18  ? 1141 HOH A O   1 
HETATM 7052 O O   . HOH U 13 .   ? 27.488  -21.777 -27.026 1.00 31.99  ? 1142 HOH A O   1 
HETATM 7053 O O   . HOH U 13 .   ? -42.237 -29.648 -22.012 1.00 38.77  ? 1143 HOH A O   1 
HETATM 7054 O O   . HOH U 13 .   ? -1.377  5.221   -6.519  1.00 22.23  ? 1144 HOH A O   1 
HETATM 7055 O O   . HOH U 13 .   ? 13.166  -15.689 -6.847  1.00 17.86  ? 1145 HOH A O   1 
HETATM 7056 O O   . HOH U 13 .   ? -1.942  -8.391  16.724  1.00 29.70  ? 1146 HOH A O   1 
HETATM 7057 O O   . HOH U 13 .   ? 1.404   -8.613  -22.266 1.00 27.33  ? 1147 HOH A O   1 
HETATM 7058 O O   . HOH U 13 .   ? -12.302 -10.475 -42.720 1.00 46.21  ? 1148 HOH A O   1 
HETATM 7059 O O   . HOH U 13 .   ? -32.725 -19.565 -19.812 1.00 24.26  ? 1149 HOH A O   1 
HETATM 7060 O O   . HOH U 13 .   ? -6.807  -42.276 -28.849 1.00 28.26  ? 1150 HOH A O   1 
HETATM 7061 O O   . HOH U 13 .   ? 5.170   10.588  -15.880 1.00 24.33  ? 1151 HOH A O   1 
HETATM 7062 O O   . HOH U 13 .   ? -34.821 -34.315 -22.242 1.00 30.93  ? 1152 HOH A O   1 
HETATM 7063 O O   . HOH U 13 .   ? -20.948 -31.293 -28.986 1.00 22.45  ? 1153 HOH A O   1 
HETATM 7064 O O   . HOH U 13 .   ? 13.852  -28.906 10.716  1.00 45.04  ? 1154 HOH A O   1 
HETATM 7065 O O   . HOH U 13 .   ? -3.812  -33.093 -8.618  1.00 57.09  ? 1155 HOH A O   1 
HETATM 7066 O O   . HOH U 13 .   ? 19.069  -26.562 -18.604 1.00 17.01  ? 1156 HOH A O   1 
HETATM 7067 O O   . HOH U 13 .   ? -23.839 -25.064 -46.256 1.00 42.96  ? 1157 HOH A O   1 
HETATM 7068 O O   . HOH U 13 .   ? -4.856  -11.478 -31.479 1.00 25.43  ? 1158 HOH A O   1 
HETATM 7069 O O   . HOH U 13 .   ? 19.114  -19.309 3.345   1.00 56.00  ? 1159 HOH A O   1 
HETATM 7070 O O   . HOH U 13 .   ? 16.149  -33.090 -31.200 1.00 21.44  ? 1160 HOH A O   1 
HETATM 7071 O O   . HOH U 13 .   ? 13.421  -11.138 -17.991 1.00 15.96  ? 1161 HOH A O   1 
HETATM 7072 O O   . HOH U 13 .   ? -10.962 -9.193  -17.853 1.00 15.33  ? 1162 HOH A O   1 
HETATM 7073 O O   . HOH U 13 .   ? -16.272 -13.170 -11.910 1.00 19.37  ? 1163 HOH A O   1 
HETATM 7074 O O   . HOH U 13 .   ? 16.880  -6.846  -5.792  1.00 28.49  ? 1164 HOH A O   1 
HETATM 7075 O O   . HOH U 13 .   ? -15.809 -34.818 -51.656 1.00 36.28  ? 1165 HOH A O   1 
HETATM 7076 O O   . HOH U 13 .   ? 13.499  -3.339  0.296   1.00 31.84  ? 1166 HOH A O   1 
HETATM 7077 O O   . HOH U 13 .   ? 5.047   -52.154 -42.964 1.00 43.47  ? 1167 HOH A O   1 
HETATM 7078 O O   . HOH U 13 .   ? -0.366  -28.622 -56.225 1.00 43.24  ? 1168 HOH A O   1 
HETATM 7079 O O   . HOH U 13 .   ? -19.531 -44.820 -28.820 1.00 39.63  ? 1169 HOH A O   1 
HETATM 7080 O O   . HOH U 13 .   ? -16.361 -17.508 -1.191  1.00 22.29  ? 1170 HOH A O   1 
HETATM 7081 O O   . HOH U 13 .   ? 14.046  -3.452  -16.205 1.00 38.10  ? 1171 HOH A O   1 
HETATM 7082 O O   . HOH U 13 .   ? 22.789  -24.712 -15.917 1.00 25.37  ? 1172 HOH A O   1 
HETATM 7083 O O   . HOH U 13 .   ? 5.188   -41.838 -39.076 1.00 18.19  ? 1173 HOH A O   1 
HETATM 7084 O O   . HOH U 13 .   ? -16.938 -21.375 -29.696 1.00 20.47  ? 1174 HOH A O   1 
HETATM 7085 O O   . HOH U 13 .   ? 5.145   -7.713  -0.147  1.00 30.53  ? 1175 HOH A O   1 
HETATM 7086 O O   . HOH U 13 .   ? -25.845 -42.462 -20.678 1.00 41.63  ? 1176 HOH A O   1 
HETATM 7087 O O   . HOH U 13 .   ? 5.252   -31.657 2.912   1.00 30.19  ? 1177 HOH A O   1 
HETATM 7088 O O   . HOH U 13 .   ? 27.895  -33.470 -43.522 1.00 29.46  ? 1178 HOH A O   1 
HETATM 7089 O O   . HOH U 13 .   ? 1.238   -56.007 -30.787 1.00 38.63  ? 1179 HOH A O   1 
HETATM 7090 O O   . HOH U 13 .   ? -20.807 -43.870 -45.742 1.00 42.50  ? 1180 HOH A O   1 
HETATM 7091 O O   . HOH U 13 .   ? -16.420 -26.112 -39.403 1.00 15.66  ? 1181 HOH A O   1 
HETATM 7092 O O   . HOH U 13 .   ? -15.921 -39.853 -47.747 1.00 58.24  ? 1182 HOH A O   1 
HETATM 7093 O O   . HOH U 13 .   ? 4.640   -28.134 9.821   1.00 41.80  ? 1183 HOH A O   1 
HETATM 7094 O O   . HOH U 13 .   ? 0.693   -15.334 -32.144 1.00 25.72  ? 1184 HOH A O   1 
HETATM 7095 O O   . HOH U 13 .   ? 17.403  -22.103 9.331   1.00 40.43  ? 1185 HOH A O   1 
HETATM 7096 O O   . HOH U 13 .   ? -1.321  -8.398  -35.172 1.00 29.26  ? 1186 HOH A O   1 
HETATM 7097 O O   . HOH U 13 .   ? -2.665  -16.872 -53.730 1.00 44.79  ? 1187 HOH A O   1 
HETATM 7098 O O   . HOH U 13 .   ? -9.950  -38.603 -27.374 1.00 16.73  ? 1188 HOH A O   1 
HETATM 7099 O O   . HOH U 13 .   ? -17.728 -40.863 -21.338 1.00 16.61  ? 1189 HOH A O   1 
HETATM 7100 O O   . HOH U 13 .   ? 14.762  -12.599 -41.752 1.00 28.31  ? 1190 HOH A O   1 
HETATM 7101 O O   . HOH U 13 .   ? -10.642 -14.627 -28.159 1.00 17.84  ? 1191 HOH A O   1 
HETATM 7102 O O   . HOH U 13 .   ? -2.341  -43.250 -36.711 1.00 28.18  ? 1192 HOH A O   1 
HETATM 7103 O O   . HOH U 13 .   ? 8.099   -8.249  5.675   1.00 21.29  ? 1193 HOH A O   1 
HETATM 7104 O O   . HOH U 13 .   ? -14.718 -13.753 -39.403 1.00 36.47  ? 1194 HOH A O   1 
HETATM 7105 O O   . HOH U 13 .   ? 23.861  -18.954 -9.173  1.00 23.60  ? 1195 HOH A O   1 
HETATM 7106 O O   . HOH U 13 .   ? 18.831  -59.403 -37.218 1.00 43.57  ? 1196 HOH A O   1 
HETATM 7107 O O   . HOH U 13 .   ? 25.740  -15.730 -16.988 1.00 41.74  ? 1197 HOH A O   1 
HETATM 7108 O O   . HOH U 13 .   ? -0.708  -45.455 -22.360 1.00 47.98  ? 1198 HOH A O   1 
HETATM 7109 O O   . HOH U 13 .   ? 7.636   -10.038 -37.530 1.00 30.25  ? 1199 HOH A O   1 
HETATM 7110 O O   . HOH U 13 .   ? 10.858  13.903  -6.253  1.00 32.96  ? 1200 HOH A O   1 
HETATM 7111 O O   . HOH U 13 .   ? 14.293  -16.329 -36.628 1.00 24.21  ? 1201 HOH A O   1 
HETATM 7112 O O   . HOH U 13 .   ? 33.073  -36.286 -37.998 1.00 36.13  ? 1202 HOH A O   1 
HETATM 7113 O O   . HOH U 13 .   ? 32.010  -42.896 -36.196 1.00 33.54  ? 1203 HOH A O   1 
HETATM 7114 O O   . HOH U 13 .   ? 8.897   -25.108 -46.998 1.00 17.83  ? 1204 HOH A O   1 
HETATM 7115 O O   . HOH U 13 .   ? 3.767   16.065  -5.897  1.00 29.11  ? 1205 HOH A O   1 
HETATM 7116 O O   . HOH U 13 .   ? 23.634  -13.819 1.815   1.00 40.53  ? 1206 HOH A O   1 
HETATM 7117 O O   . HOH U 13 .   ? -1.688  -25.204 -34.086 1.00 15.72  ? 1207 HOH A O   1 
HETATM 7118 O O   . HOH U 13 .   ? -3.886  -22.985 -2.561  1.00 14.96  ? 1208 HOH A O   1 
HETATM 7119 O O   . HOH U 13 .   ? 1.061   -22.738 7.141   1.00 16.42  ? 1209 HOH A O   1 
HETATM 7120 O O   . HOH U 13 .   ? 5.865   -30.553 -54.052 1.00 43.38  ? 1210 HOH A O   1 
HETATM 7121 O O   . HOH U 13 .   ? 2.479   -3.188  -16.590 1.00 25.37  ? 1211 HOH A O   1 
HETATM 7122 O O   . HOH U 13 .   ? -6.031  -19.582 -4.386  1.00 12.03  ? 1212 HOH A O   1 
HETATM 7123 O O   . HOH U 13 .   ? 3.173   -3.120  -2.684  1.00 22.53  ? 1213 HOH A O   1 
HETATM 7124 O O   . HOH U 13 .   ? 9.129   -13.309 -50.052 1.00 37.74  ? 1214 HOH A O   1 
HETATM 7125 O O   . HOH U 13 .   ? -24.645 -24.791 -39.498 1.00 42.24  ? 1215 HOH A O   1 
HETATM 7126 O O   . HOH U 13 .   ? -33.579 -10.043 -12.737 1.00 37.68  ? 1216 HOH A O   1 
HETATM 7127 O O   . HOH U 13 .   ? -2.390  -31.388 -13.036 1.00 27.11  ? 1217 HOH A O   1 
HETATM 7128 O O   . HOH U 13 .   ? 35.356  -42.825 -44.431 1.00 29.90  ? 1218 HOH A O   1 
HETATM 7129 O O   . HOH U 13 .   ? 4.226   1.484   -8.647  1.00 24.12  ? 1219 HOH A O   1 
HETATM 7130 O O   . HOH U 13 .   ? -33.789 -16.833 -23.484 1.00 53.30  ? 1220 HOH A O   1 
HETATM 7131 O O   . HOH U 13 .   ? -22.304 -23.694 -27.965 1.00 21.60  ? 1221 HOH A O   1 
HETATM 7132 O O   . HOH U 13 .   ? -4.618  -43.371 -44.487 1.00 24.64  ? 1222 HOH A O   1 
HETATM 7133 O O   . HOH U 13 .   ? 22.408  -44.811 -52.216 1.00 53.71  ? 1223 HOH A O   1 
HETATM 7134 O O   . HOH U 13 .   ? -29.729 -22.150 -29.841 1.00 28.37  ? 1224 HOH A O   1 
HETATM 7135 O O   . HOH U 13 .   ? 11.743  -13.821 -49.938 1.00 33.70  ? 1225 HOH A O   1 
HETATM 7136 O O   . HOH U 13 .   ? 2.463   -27.893 -55.534 1.00 57.07  ? 1226 HOH A O   1 
HETATM 7137 O O   . HOH U 13 .   ? -24.152 -14.374 -6.415  1.00 26.32  ? 1227 HOH A O   1 
HETATM 7138 O O   . HOH U 13 .   ? -5.111  -12.684 16.166  1.00 41.82  ? 1228 HOH A O   1 
HETATM 7139 O O   . HOH U 13 .   ? 0.560   -27.607 -1.310  1.00 26.00  ? 1229 HOH A O   1 
HETATM 7140 O O   . HOH U 13 .   ? -0.595  1.926   6.232   1.00 26.69  ? 1230 HOH A O   1 
HETATM 7141 O O   . HOH U 13 .   ? -7.941  -2.935  -14.992 1.00 34.20  ? 1231 HOH A O   1 
HETATM 7142 O O   . HOH U 13 .   ? -25.133 -21.863 -14.595 1.00 14.83  ? 1232 HOH A O   1 
HETATM 7143 O O   . HOH U 13 .   ? -33.261 -16.748 -20.110 1.00 34.52  ? 1233 HOH A O   1 
HETATM 7144 O O   . HOH U 13 .   ? 18.157  -40.704 -43.602 1.00 40.50  ? 1234 HOH A O   1 
HETATM 7145 O O   . HOH U 13 .   ? -13.886 -15.903 -28.428 1.00 52.89  ? 1235 HOH A O   1 
HETATM 7146 O O   . HOH U 13 .   ? 19.389  -11.674 -41.723 1.00 35.56  ? 1236 HOH A O   1 
HETATM 7147 O O   . HOH U 13 .   ? 12.739  -15.942 -51.708 1.00 32.17  ? 1237 HOH A O   1 
HETATM 7148 O O   . HOH U 13 .   ? -23.291 -28.083 -49.133 1.00 37.48  ? 1238 HOH A O   1 
HETATM 7149 O O   . HOH U 13 .   ? -12.947 -31.571 -13.230 1.00 28.63  ? 1239 HOH A O   1 
HETATM 7150 O O   . HOH U 13 .   ? -4.776  -20.774 -21.602 1.00 16.90  ? 1240 HOH A O   1 
HETATM 7151 O O   . HOH U 13 .   ? -16.572 -17.213 -29.617 1.00 44.57  ? 1241 HOH A O   1 
HETATM 7152 O O   . HOH U 13 .   ? 6.218   -6.045  13.840  1.00 33.97  ? 1242 HOH A O   1 
HETATM 7153 O O   . HOH U 13 .   ? 21.134  -12.481 -27.399 1.00 38.44  ? 1243 HOH A O   1 
HETATM 7154 O O   . HOH U 13 .   ? 15.553  -33.169 -14.915 1.00 30.12  ? 1244 HOH A O   1 
HETATM 7155 O O   . HOH U 13 .   ? -7.196  -37.237 -12.588 1.00 54.01  ? 1245 HOH A O   1 
HETATM 7156 O O   . HOH U 13 .   ? 22.642  -13.666 -11.070 1.00 36.44  ? 1246 HOH A O   1 
HETATM 7157 O O   . HOH U 13 .   ? 1.220   -37.525 -17.443 1.00 23.08  ? 1247 HOH A O   1 
HETATM 7158 O O   . HOH U 13 .   ? 16.550  -11.577 17.964  1.00 35.38  ? 1248 HOH A O   1 
HETATM 7159 O O   . HOH U 13 .   ? -10.206 -17.521 -9.677  1.00 15.09  ? 1249 HOH A O   1 
HETATM 7160 O O   . HOH U 13 .   ? 1.429   -50.254 -27.298 1.00 20.93  ? 1250 HOH A O   1 
HETATM 7161 O O   . HOH U 13 .   ? -16.855 -13.046 -23.703 1.00 28.85  ? 1251 HOH A O   1 
HETATM 7162 O O   . HOH U 13 .   ? 17.774  -9.984  -1.303  1.00 23.90  ? 1252 HOH A O   1 
HETATM 7163 O O   . HOH U 13 .   ? 30.145  -26.248 -44.221 1.00 34.02  ? 1253 HOH A O   1 
HETATM 7164 O O   . HOH U 13 .   ? 12.646  2.939   -11.232 1.00 40.52  ? 1254 HOH A O   1 
HETATM 7165 O O   . HOH U 13 .   ? -8.356  -43.171 -33.076 1.00 29.80  ? 1255 HOH A O   1 
HETATM 7166 O O   . HOH U 13 .   ? 18.607  -23.471 -38.025 1.00 18.79  ? 1256 HOH A O   1 
HETATM 7167 O O   . HOH U 13 .   ? 16.761  -15.716 -35.616 1.00 22.96  ? 1257 HOH A O   1 
HETATM 7168 O O   . HOH U 13 .   ? 25.474  -31.824 -43.499 1.00 20.52  ? 1258 HOH A O   1 
HETATM 7169 O O   . HOH U 13 .   ? 0.515   -17.651 -30.601 1.00 16.74  ? 1259 HOH A O   1 
HETATM 7170 O O   . HOH U 13 .   ? -21.031 -27.534 -2.162  1.00 31.26  ? 1260 HOH A O   1 
HETATM 7171 O O   . HOH U 13 .   ? 21.962  -28.607 -21.463 1.00 22.35  ? 1261 HOH A O   1 
HETATM 7172 O O   . HOH U 13 .   ? -16.051 -45.290 -37.223 1.00 22.62  ? 1262 HOH A O   1 
HETATM 7173 O O   . HOH U 13 .   ? 20.341  -31.819 -11.879 1.00 39.73  ? 1263 HOH A O   1 
HETATM 7174 O O   . HOH U 13 .   ? 2.326   -9.733  -31.588 1.00 42.39  ? 1264 HOH A O   1 
HETATM 7175 O O   . HOH U 13 .   ? -13.975 -10.249 2.792   1.00 36.67  ? 1265 HOH A O   1 
HETATM 7176 O O   . HOH U 13 .   ? -4.529  -32.143 -11.363 1.00 53.76  ? 1266 HOH A O   1 
HETATM 7177 O O   . HOH U 13 .   ? -4.022  -6.948  -18.107 1.00 28.13  ? 1267 HOH A O   1 
HETATM 7178 O O   . HOH U 13 .   ? -35.670 -28.230 -18.948 1.00 23.91  ? 1268 HOH A O   1 
HETATM 7179 O O   . HOH U 13 .   ? 20.824  -12.843 -24.305 1.00 36.28  ? 1269 HOH A O   1 
HETATM 7180 O O   . HOH U 13 .   ? -9.343  -7.779  -3.381  1.00 16.82  ? 1270 HOH A O   1 
HETATM 7181 O O   . HOH U 13 .   ? 14.633  -15.659 -24.483 1.00 19.84  ? 1271 HOH A O   1 
HETATM 7182 O O   . HOH U 13 .   ? -9.064  -14.942 11.193  1.00 33.06  ? 1272 HOH A O   1 
HETATM 7183 O O   . HOH U 13 .   ? 16.775  -18.922 -25.647 1.00 19.94  ? 1273 HOH A O   1 
HETATM 7184 O O   . HOH U 13 .   ? -7.313  -4.504  8.419   1.00 27.38  ? 1274 HOH A O   1 
HETATM 7185 O O   . HOH U 13 .   ? 6.614   -40.763 -41.185 1.00 18.95  ? 1275 HOH A O   1 
HETATM 7186 O O   . HOH U 13 .   ? -2.201  -23.348 -45.893 1.00 27.08  ? 1276 HOH A O   1 
HETATM 7187 O O   . HOH U 13 .   ? -13.054 -10.161 -16.210 1.00 17.69  ? 1277 HOH A O   1 
HETATM 7188 O O   . HOH U 13 .   ? -0.438  -16.225 18.537  1.00 33.04  ? 1278 HOH A O   1 
HETATM 7189 O O   . HOH U 13 .   ? 34.408  -42.212 -32.399 1.00 30.92  ? 1279 HOH A O   1 
HETATM 7190 O O   . HOH U 13 .   ? 2.709   -23.387 14.397  1.00 43.50  ? 1280 HOH A O   1 
HETATM 7191 O O   . HOH U 13 .   ? 6.035   -23.275 16.803  1.00 46.27  ? 1281 HOH A O   1 
HETATM 7192 O O   . HOH U 13 .   ? -5.660  -15.969 12.951  1.00 22.01  ? 1282 HOH A O   1 
HETATM 7193 O O   . HOH U 13 .   ? -2.643  -16.662 -26.296 1.00 26.17  ? 1283 HOH A O   1 
HETATM 7194 O O   . HOH U 13 .   ? -25.652 -42.303 -35.502 1.00 29.16  ? 1284 HOH A O   1 
HETATM 7195 O O   . HOH U 13 .   ? 7.095   -9.389  -49.528 1.00 34.26  ? 1285 HOH A O   1 
HETATM 7196 O O   . HOH U 13 .   ? 13.204  14.595  -15.278 1.00 21.12  ? 1286 HOH A O   1 
HETATM 7197 O O   . HOH U 13 .   ? 14.621  -11.527 -32.349 1.00 61.17  ? 1287 HOH A O   1 
HETATM 7198 O O   . HOH U 13 .   ? -8.828  -19.464 -32.671 1.00 12.61  ? 1288 HOH A O   1 
HETATM 7199 O O   . HOH U 13 .   ? 17.869  -0.597  -6.371  1.00 37.86  ? 1289 HOH A O   1 
HETATM 7200 O O   . HOH U 13 .   ? 6.905   -37.456 -44.965 1.00 19.09  ? 1290 HOH A O   1 
HETATM 7201 O O   . HOH U 13 .   ? 19.786  -31.132 -9.101  1.00 28.88  ? 1291 HOH A O   1 
HETATM 7202 O O   . HOH U 13 .   ? -22.808 -37.978 -8.459  1.00 58.93  ? 1292 HOH A O   1 
HETATM 7203 O O   . HOH U 13 .   ? 9.541   7.467   -5.964  1.00 30.06  ? 1293 HOH A O   1 
HETATM 7204 O O   . HOH U 13 .   ? 15.939  -32.663 -10.629 1.00 22.13  ? 1294 HOH A O   1 
HETATM 7205 O O   . HOH U 13 .   ? -27.720 -26.989 -11.645 1.00 31.35  ? 1295 HOH A O   1 
HETATM 7206 O O   . HOH U 13 .   ? 23.690  -30.808 -11.275 1.00 39.01  ? 1296 HOH A O   1 
HETATM 7207 O O   . HOH U 13 .   ? 12.450  -49.001 -20.904 1.00 44.02  ? 1297 HOH A O   1 
HETATM 7208 O O   . HOH U 13 .   ? -22.839 -27.591 -8.894  1.00 22.92  ? 1298 HOH A O   1 
HETATM 7209 O O   . HOH U 13 .   ? 14.491  -39.221 -30.539 1.00 18.44  ? 1299 HOH A O   1 
HETATM 7210 O O   . HOH U 13 .   ? 20.513  -57.274 -37.579 1.00 33.41  ? 1300 HOH A O   1 
HETATM 7211 O O   . HOH U 13 .   ? 0.336   -19.380 14.579  1.00 37.79  ? 1301 HOH A O   1 
HETATM 7212 O O   . HOH U 13 .   ? 7.644   -5.913  -6.961  1.00 16.02  ? 1302 HOH A O   1 
HETATM 7213 O O   . HOH U 13 .   ? -13.877 -42.511 -31.829 1.00 17.32  ? 1303 HOH A O   1 
HETATM 7214 O O   . HOH U 13 .   ? -28.568 -33.375 -27.388 1.00 25.73  ? 1304 HOH A O   1 
HETATM 7215 O O   . HOH U 13 .   ? -0.312  -31.788 -34.555 1.00 13.54  ? 1305 HOH A O   1 
HETATM 7216 O O   . HOH U 13 .   ? -8.742  -27.665 -55.118 1.00 40.96  ? 1306 HOH A O   1 
HETATM 7217 O O   . HOH U 13 .   ? 14.571  -19.820 -42.354 1.00 19.50  ? 1307 HOH A O   1 
HETATM 7218 O O   . HOH U 13 .   ? -0.256  13.221  6.840   1.00 39.57  ? 1308 HOH A O   1 
HETATM 7219 O O   . HOH U 13 .   ? -3.636  -19.487 -32.181 1.00 15.00  ? 1309 HOH A O   1 
HETATM 7220 O O   . HOH U 13 .   ? 0.318   -48.403 -36.313 1.00 41.84  ? 1310 HOH A O   1 
HETATM 7221 O O   . HOH U 13 .   ? -14.037 -3.281  -6.259  1.00 25.97  ? 1311 HOH A O   1 
HETATM 7222 O O   . HOH U 13 .   ? 13.149  -26.001 -46.014 1.00 39.82  ? 1312 HOH A O   1 
HETATM 7223 O O   . HOH U 13 .   ? 19.108  -58.723 -31.758 1.00 34.25  ? 1313 HOH A O   1 
HETATM 7224 O O   . HOH U 13 .   ? -1.033  -10.103 -23.156 1.00 19.46  ? 1314 HOH A O   1 
HETATM 7225 O O   . HOH U 13 .   ? 10.968  -17.610 17.233  1.00 31.61  ? 1315 HOH A O   1 
HETATM 7226 O O   . HOH U 13 .   ? -28.081 -35.308 -30.655 1.00 36.72  ? 1316 HOH A O   1 
HETATM 7227 O O   . HOH U 13 .   ? 23.368  -24.118 -43.417 1.00 29.16  ? 1317 HOH A O   1 
HETATM 7228 O O   . HOH U 13 .   ? -24.683 -10.602 -2.054  1.00 29.53  ? 1318 HOH A O   1 
HETATM 7229 O O   . HOH U 13 .   ? 29.304  -45.526 -27.993 1.00 46.23  ? 1319 HOH A O   1 
HETATM 7230 O O   . HOH U 13 .   ? -5.950  -35.068 -23.808 1.00 13.84  ? 1320 HOH A O   1 
HETATM 7231 O O   . HOH U 13 .   ? 23.279  -25.692 -4.176  1.00 18.52  ? 1321 HOH A O   1 
HETATM 7232 O O   . HOH U 13 .   ? -18.651 -20.046 -22.104 1.00 16.91  ? 1322 HOH A O   1 
HETATM 7233 O O   . HOH U 13 .   ? 1.774   -1.077  -7.597  1.00 25.30  ? 1323 HOH A O   1 
HETATM 7234 O O   . HOH U 13 .   ? 26.520  -22.263 -8.965  1.00 32.60  ? 1324 HOH A O   1 
HETATM 7235 O O   . HOH U 13 .   ? 24.173  -24.788 -13.533 1.00 28.94  ? 1325 HOH A O   1 
HETATM 7236 O O   . HOH U 13 .   ? -34.665 -27.818 -22.695 1.00 21.26  ? 1326 HOH A O   1 
HETATM 7237 O O   . HOH U 13 .   ? 9.498   -3.281  8.858   1.00 45.18  ? 1327 HOH A O   1 
HETATM 7238 O O   . HOH U 13 .   ? -7.129  -16.102 -44.440 1.00 19.09  ? 1328 HOH A O   1 
HETATM 7239 O O   . HOH U 13 .   ? 5.933   6.886   -11.431 1.00 28.87  ? 1329 HOH A O   1 
HETATM 7240 O O   . HOH U 13 .   ? -32.515 -15.091 -16.493 1.00 27.70  ? 1330 HOH A O   1 
HETATM 7241 O O   . HOH U 13 .   ? -8.246  -23.137 -42.475 1.00 16.70  ? 1331 HOH A O   1 
HETATM 7242 O O   . HOH U 13 .   ? 31.730  -31.839 -38.918 1.00 32.27  ? 1332 HOH A O   1 
HETATM 7243 O O   . HOH U 13 .   ? 9.008   15.036  -10.080 1.00 21.86  ? 1333 HOH A O   1 
HETATM 7244 O O   . HOH U 13 .   ? -9.246  -16.297 7.063   1.00 18.26  ? 1334 HOH A O   1 
HETATM 7245 O O   . HOH U 13 .   ? 2.464   -11.494 19.921  1.00 43.84  ? 1335 HOH A O   1 
HETATM 7246 O O   . HOH U 13 .   ? -22.078 -15.890 -37.130 1.00 55.34  ? 1336 HOH A O   1 
HETATM 7247 O O   . HOH U 13 .   ? -0.859  -47.806 -39.046 1.00 28.07  ? 1337 HOH A O   1 
HETATM 7248 O O   . HOH U 13 .   ? 9.682   0.250   -0.187  1.00 19.78  ? 1338 HOH A O   1 
HETATM 7249 O O   . HOH U 13 .   ? 28.974  -42.893 -29.096 1.00 35.91  ? 1339 HOH A O   1 
HETATM 7250 O O   . HOH U 13 .   ? -1.859  -8.069  6.787   1.00 18.80  ? 1340 HOH A O   1 
HETATM 7251 O O   . HOH U 13 .   ? -15.404 -36.482 -16.008 1.00 31.63  ? 1341 HOH A O   1 
HETATM 7252 O O   . HOH U 13 .   ? -4.314  -17.458 -10.001 1.00 13.12  ? 1342 HOH A O   1 
HETATM 7253 O O   . HOH U 13 .   ? 27.255  -18.341 -9.117  1.00 31.78  ? 1343 HOH A O   1 
HETATM 7254 O O   . HOH U 13 .   ? 28.199  -15.778 -25.324 1.00 47.21  ? 1344 HOH A O   1 
HETATM 7255 O O   . HOH U 13 .   ? -18.233 -38.358 -10.742 1.00 29.05  ? 1345 HOH A O   1 
HETATM 7256 O O   . HOH U 13 .   ? 2.927   -35.646 -50.344 1.00 28.49  ? 1346 HOH A O   1 
HETATM 7257 O O   . HOH U 13 .   ? 14.061  -54.414 -43.008 1.00 23.35  ? 1347 HOH A O   1 
HETATM 7258 O O   . HOH U 13 .   ? -27.281 -26.549 -42.947 1.00 37.22  ? 1348 HOH A O   1 
HETATM 7259 O O   . HOH U 13 .   ? -22.910 -44.955 -24.071 1.00 45.58  ? 1349 HOH A O   1 
HETATM 7260 O O   . HOH U 13 .   ? 11.401  -34.095 -24.984 1.00 19.78  ? 1350 HOH A O   1 
HETATM 7261 O O   . HOH U 13 .   ? 14.149  -34.714 -16.863 1.00 30.78  ? 1351 HOH A O   1 
HETATM 7262 O O   . HOH U 13 .   ? -6.195  -48.521 -24.596 1.00 23.26  ? 1352 HOH A O   1 
HETATM 7263 O O   . HOH U 13 .   ? 1.363   -15.007 25.723  1.00 60.51  ? 1353 HOH A O   1 
HETATM 7264 O O   . HOH U 13 .   ? 9.098   -19.276 -41.284 1.00 20.24  ? 1354 HOH A O   1 
HETATM 7265 O O   . HOH U 13 .   ? 9.021   -39.271 -44.995 1.00 20.31  ? 1355 HOH A O   1 
HETATM 7266 O O   . HOH U 13 .   ? -8.233  -7.466  11.407  1.00 33.35  ? 1356 HOH A O   1 
HETATM 7267 O O   . HOH U 13 .   ? 17.343  -32.638 -18.962 1.00 38.32  ? 1357 HOH A O   1 
HETATM 7268 O O   . HOH U 13 .   ? -11.439 -12.100 -38.627 1.00 38.99  ? 1358 HOH A O   1 
HETATM 7269 O O   . HOH U 13 .   ? 8.747   -29.143 -41.361 1.00 20.24  ? 1359 HOH A O   1 
HETATM 7270 O O   . HOH U 13 .   ? 1.814   -30.615 -16.989 1.00 14.17  ? 1360 HOH A O   1 
HETATM 7271 O O   . HOH U 13 .   ? 8.834   14.570  -1.564  1.00 49.59  ? 1361 HOH A O   1 
HETATM 7272 O O   . HOH U 13 .   ? 4.907   -4.187  -4.733  1.00 18.35  ? 1362 HOH A O   1 
HETATM 7273 O O   . HOH U 13 .   ? -32.535 -34.057 -26.328 1.00 24.83  ? 1363 HOH A O   1 
HETATM 7274 O O   . HOH U 13 .   ? -21.743 -42.792 -19.716 1.00 27.47  ? 1364 HOH A O   1 
HETATM 7275 O O   . HOH U 13 .   ? 9.297   -13.793 -46.019 1.00 18.76  ? 1365 HOH A O   1 
HETATM 7276 O O   . HOH U 13 .   ? 12.930  -26.998 17.561  1.00 30.22  ? 1366 HOH A O   1 
HETATM 7277 O O   . HOH U 13 .   ? -7.866  -8.010  -45.962 1.00 35.80  ? 1367 HOH A O   1 
HETATM 7278 O O   . HOH U 13 .   ? 12.513  9.144   -10.857 1.00 45.30  ? 1368 HOH A O   1 
HETATM 7279 O O   . HOH U 13 .   ? 5.998   -9.927  -32.729 1.00 22.44  ? 1369 HOH A O   1 
HETATM 7280 O O   . HOH U 13 .   ? 10.061  -31.008 -7.264  1.00 18.17  ? 1370 HOH A O   1 
HETATM 7281 O O   . HOH U 13 .   ? -32.077 -25.520 -26.183 1.00 21.14  ? 1371 HOH A O   1 
HETATM 7282 O O   . HOH U 13 .   ? -32.868 -25.818 -23.482 1.00 20.05  ? 1372 HOH A O   1 
HETATM 7283 O O   . HOH U 13 .   ? -13.959 -9.786  -24.713 1.00 23.24  ? 1373 HOH A O   1 
HETATM 7284 O O   . HOH U 13 .   ? -24.371 -4.773  -17.771 1.00 40.80  ? 1374 HOH A O   1 
HETATM 7285 O O   . HOH U 13 .   ? -28.822 -25.068 -36.876 1.00 27.25  ? 1375 HOH A O   1 
HETATM 7286 O O   . HOH U 13 .   ? 7.774   -11.648 -31.178 1.00 25.00  ? 1376 HOH A O   1 
HETATM 7287 O O   . HOH U 13 .   ? -5.105  -40.697 -38.414 1.00 20.62  ? 1377 HOH A O   1 
HETATM 7288 O O   . HOH U 13 .   ? -13.798 -14.139 -20.417 1.00 14.18  ? 1378 HOH A O   1 
HETATM 7289 O O   . HOH U 13 .   ? -19.340 -23.587 -2.384  1.00 31.22  ? 1379 HOH A O   1 
HETATM 7290 O O   . HOH U 13 .   ? -6.833  -9.030  -42.393 1.00 26.27  ? 1380 HOH A O   1 
HETATM 7291 O O   . HOH U 13 .   ? 10.114  -5.047  4.659   1.00 37.69  ? 1381 HOH A O   1 
HETATM 7292 O O   . HOH U 13 .   ? -14.337 -22.385 -12.169 1.00 14.51  ? 1382 HOH A O   1 
HETATM 7293 O O   . HOH U 13 .   ? 8.245   -23.037 -53.449 1.00 31.14  ? 1383 HOH A O   1 
HETATM 7294 O O   . HOH U 13 .   ? -29.736 -40.500 -17.333 1.00 34.38  ? 1384 HOH A O   1 
HETATM 7295 O O   . HOH U 13 .   ? 13.736  -11.460 -27.440 1.00 55.76  ? 1385 HOH A O   1 
HETATM 7296 O O   . HOH U 13 .   ? -4.895  -35.697 -47.260 1.00 18.95  ? 1386 HOH A O   1 
HETATM 7297 O O   . HOH U 13 .   ? -8.477  -3.072  -12.249 1.00 29.15  ? 1387 HOH A O   1 
HETATM 7298 O O   . HOH U 13 .   ? 22.103  -12.751 -7.832  1.00 28.80  ? 1388 HOH A O   1 
HETATM 7299 O O   . HOH U 13 .   ? -10.146 -14.137 -7.133  1.00 15.15  ? 1389 HOH A O   1 
HETATM 7300 O O   . HOH U 13 .   ? -12.599 -12.706 -41.090 1.00 48.78  ? 1390 HOH A O   1 
HETATM 7301 O O   . HOH U 13 .   ? 16.971  -33.130 -22.746 1.00 21.49  ? 1391 HOH A O   1 
HETATM 7302 O O   . HOH U 13 .   ? -6.759  -29.774 -54.625 1.00 28.09  ? 1392 HOH A O   1 
HETATM 7303 O O   . HOH U 13 .   ? 1.431   -33.494 -23.922 1.00 19.30  ? 1393 HOH A O   1 
HETATM 7304 O O   . HOH U 13 .   ? -18.742 -8.042  -19.986 1.00 23.39  ? 1394 HOH A O   1 
HETATM 7305 O O   . HOH U 13 .   ? 7.152   -8.195  -41.974 1.00 22.86  ? 1395 HOH A O   1 
HETATM 7306 O O   . HOH U 13 .   ? 9.142   -6.929  -43.494 1.00 34.96  ? 1396 HOH A O   1 
HETATM 7307 O O   . HOH U 13 .   ? 33.200  -29.252 -42.507 1.00 36.11  ? 1397 HOH A O   1 
HETATM 7308 O O   . HOH U 13 .   ? -10.322 -25.217 -0.477  1.00 30.11  ? 1398 HOH A O   1 
HETATM 7309 O O   . HOH U 13 .   ? -12.667 -22.553 -47.016 1.00 17.94  ? 1399 HOH A O   1 
HETATM 7310 O O   . HOH U 13 .   ? -26.973 -41.547 -28.150 1.00 33.21  ? 1400 HOH A O   1 
HETATM 7311 O O   . HOH U 13 .   ? 8.118   -42.807 -32.404 1.00 28.98  ? 1401 HOH A O   1 
HETATM 7312 O O   . HOH U 13 .   ? -25.104 -26.518 -41.524 1.00 33.50  ? 1402 HOH A O   1 
HETATM 7313 O O   . HOH U 13 .   ? -2.477  -52.616 -29.915 1.00 38.02  ? 1403 HOH A O   1 
HETATM 7314 O O   . HOH U 13 .   ? 18.388  -24.508 5.795   1.00 27.84  ? 1404 HOH A O   1 
HETATM 7315 O O   . HOH U 13 .   ? 13.544  -29.914 -21.019 1.00 15.16  ? 1405 HOH A O   1 
HETATM 7316 O O   . HOH U 13 .   ? -3.762  -39.301 -20.982 1.00 37.75  ? 1406 HOH A O   1 
HETATM 7317 O O   . HOH U 13 .   ? 23.799  -57.933 -43.891 1.00 27.62  ? 1407 HOH A O   1 
HETATM 7318 O O   . HOH U 13 .   ? 29.089  -54.392 -40.277 1.00 24.15  ? 1408 HOH A O   1 
HETATM 7319 O O   . HOH U 13 .   ? -19.686 -44.730 -31.809 1.00 34.18  ? 1409 HOH A O   1 
HETATM 7320 O O   . HOH U 13 .   ? -34.862 -27.571 -28.031 1.00 32.04  ? 1410 HOH A O   1 
HETATM 7321 O O   . HOH U 13 .   ? -4.406  -24.370 -33.376 1.00 14.10  ? 1411 HOH A O   1 
HETATM 7322 O O   . HOH U 13 .   ? 21.700  -32.084 -23.209 1.00 43.88  ? 1412 HOH A O   1 
HETATM 7323 O O   . HOH U 13 .   ? -23.994 -39.884 -46.556 1.00 56.12  ? 1413 HOH A O   1 
HETATM 7324 O O   . HOH U 13 .   ? -34.844 -33.714 -16.585 1.00 26.81  ? 1414 HOH A O   1 
HETATM 7325 O O   . HOH U 13 .   ? -7.131  -15.832 -41.187 1.00 18.00  ? 1415 HOH A O   1 
HETATM 7326 O O   . HOH U 13 .   ? 12.467  -29.923 -18.547 1.00 17.53  ? 1416 HOH A O   1 
HETATM 7327 O O   . HOH U 13 .   ? 14.943  -19.902 -28.157 1.00 18.81  ? 1417 HOH A O   1 
HETATM 7328 O O   . HOH U 13 .   ? 26.578  -21.431 0.870   1.00 45.43  ? 1418 HOH A O   1 
HETATM 7329 O O   . HOH U 13 .   ? 3.086   -19.506 18.875  1.00 34.48  ? 1419 HOH A O   1 
HETATM 7330 O O   . HOH U 13 .   ? -9.510  -7.935  2.455   1.00 20.89  ? 1420 HOH A O   1 
HETATM 7331 O O   . HOH U 13 .   ? 7.694   -11.687 4.146   1.00 17.95  ? 1421 HOH A O   1 
HETATM 7332 O O   . HOH U 13 .   ? -7.563  0.181   0.759   1.00 55.42  ? 1422 HOH A O   1 
HETATM 7333 O O   . HOH U 13 .   ? -10.079 -40.430 -44.407 1.00 19.43  ? 1423 HOH A O   1 
HETATM 7334 O O   . HOH U 13 .   ? 20.859  -12.598 -5.479  1.00 23.90  ? 1424 HOH A O   1 
HETATM 7335 O O   . HOH U 13 .   ? -10.577 -9.390  -28.633 1.00 53.70  ? 1425 HOH A O   1 
HETATM 7336 O O   . HOH U 13 .   ? -26.641 -43.779 -26.255 1.00 49.90  ? 1426 HOH A O   1 
HETATM 7337 O O   . HOH U 13 .   ? -12.966 -13.114 -17.732 1.00 16.51  ? 1427 HOH A O   1 
HETATM 7338 O O   . HOH U 13 .   ? 12.167  -54.101 -35.448 1.00 31.57  ? 1428 HOH A O   1 
HETATM 7339 O O   . HOH U 13 .   ? -26.208 -25.831 -25.832 1.00 16.51  ? 1429 HOH A O   1 
HETATM 7340 O O   . HOH U 13 .   ? 14.980  -9.686  12.128  1.00 33.07  ? 1430 HOH A O   1 
HETATM 7341 O O   . HOH U 13 .   ? 12.079  -43.932 -21.188 1.00 44.33  ? 1431 HOH A O   1 
HETATM 7342 O O   . HOH U 13 .   ? 10.961  -37.608 -9.212  1.00 60.39  ? 1432 HOH A O   1 
HETATM 7343 O O   . HOH U 13 .   ? 2.038   -32.072 -5.903  1.00 42.10  ? 1433 HOH A O   1 
HETATM 7344 O O   . HOH U 13 .   ? -4.024  7.872   4.770   1.00 38.15  ? 1434 HOH A O   1 
HETATM 7345 O O   . HOH U 13 .   ? -30.531 -14.889 -27.119 1.00 42.12  ? 1435 HOH A O   1 
HETATM 7346 O O   . HOH U 13 .   ? -3.749  -39.265 -24.119 1.00 37.16  ? 1436 HOH A O   1 
HETATM 7347 O O   . HOH U 13 .   ? 12.550  -53.648 -20.593 1.00 43.00  ? 1437 HOH A O   1 
HETATM 7348 O O   . HOH U 13 .   ? 18.841  -8.888  -6.207  1.00 43.98  ? 1438 HOH A O   1 
HETATM 7349 O O   . HOH U 13 .   ? -29.202 -15.821 -13.921 1.00 20.75  ? 1439 HOH A O   1 
HETATM 7350 O O   . HOH U 13 .   ? -35.649 -9.514  -16.659 1.00 53.64  ? 1440 HOH A O   1 
HETATM 7351 O O   . HOH U 13 .   ? 5.136   -42.468 -23.348 1.00 16.93  ? 1441 HOH A O   1 
HETATM 7352 O O   . HOH U 13 .   ? -23.504 -25.567 -26.165 1.00 18.44  ? 1442 HOH A O   1 
HETATM 7353 O O   . HOH U 13 .   ? 17.052  -15.537 -32.973 1.00 21.30  ? 1443 HOH A O   1 
HETATM 7354 O O   . HOH U 13 .   ? -27.577 -15.147 -11.850 1.00 21.42  ? 1444 HOH A O   1 
HETATM 7355 O O   . HOH U 13 .   ? -1.402  -37.873 -17.917 1.00 41.88  ? 1445 HOH A O   1 
HETATM 7356 O O   . HOH U 13 .   ? -21.289 -21.385 -37.607 1.00 35.93  ? 1446 HOH A O   1 
HETATM 7357 O O   . HOH U 13 .   ? 7.150   -9.856  1.482   1.00 18.37  ? 1447 HOH A O   1 
HETATM 7358 O O   . HOH U 13 .   ? -2.708  -8.156  -31.036 1.00 54.66  ? 1448 HOH A O   1 
HETATM 7359 O O   . HOH U 13 .   ? -3.336  -42.550 -46.932 1.00 36.37  ? 1449 HOH A O   1 
HETATM 7360 O O   . HOH U 13 .   ? -33.748 -11.920 -16.791 1.00 47.37  ? 1450 HOH A O   1 
HETATM 7361 O O   . HOH U 13 .   ? -0.846  -39.831 -20.653 1.00 25.03  ? 1451 HOH A O   1 
HETATM 7362 O O   . HOH U 13 .   ? 18.703  -55.157 -37.613 1.00 22.40  ? 1452 HOH A O   1 
HETATM 7363 O O   . HOH U 13 .   ? 2.764   -4.820  12.581  1.00 22.39  ? 1453 HOH A O   1 
HETATM 7364 O O   . HOH U 13 .   ? -5.267  -20.679 -1.877  1.00 16.55  ? 1454 HOH A O   1 
HETATM 7365 O O   . HOH U 13 .   ? 10.228  -11.656 -28.322 1.00 31.29  ? 1455 HOH A O   1 
HETATM 7366 O O   . HOH U 13 .   ? 12.781  -13.031 -39.874 1.00 23.42  ? 1456 HOH A O   1 
HETATM 7367 O O   . HOH U 13 .   ? 9.655   -15.990 19.476  1.00 28.99  ? 1457 HOH A O   1 
HETATM 7368 O O   . HOH U 13 .   ? 7.150   -5.599  11.218  1.00 29.37  ? 1458 HOH A O   1 
HETATM 7369 O O   . HOH U 13 .   ? -1.310  -3.509  -19.060 1.00 49.35  ? 1459 HOH A O   1 
HETATM 7370 O O   . HOH U 13 .   ? -42.159 -6.357  -15.496 1.00 59.34  ? 1460 HOH A O   1 
HETATM 7371 O O   . HOH U 13 .   ? 24.313  -28.193 -23.741 1.00 42.30  ? 1461 HOH A O   1 
HETATM 7372 O O   . HOH U 13 .   ? -12.806 -24.903 -0.874  1.00 37.75  ? 1462 HOH A O   1 
HETATM 7373 O O   . HOH U 13 .   ? 37.259  -33.708 -45.527 1.00 39.60  ? 1463 HOH A O   1 
HETATM 7374 O O   . HOH U 13 .   ? 6.856   -29.733 -21.289 1.00 16.55  ? 1464 HOH A O   1 
HETATM 7375 O O   . HOH U 13 .   ? -1.225  -12.911 -50.938 1.00 28.29  ? 1465 HOH A O   1 
HETATM 7376 O O   . HOH U 13 .   ? 8.775   -50.204 -40.911 1.00 21.72  ? 1466 HOH A O   1 
HETATM 7377 O O   . HOH U 13 .   ? 16.583  -57.778 -43.035 1.00 28.14  ? 1467 HOH A O   1 
HETATM 7378 O O   . HOH U 13 .   ? 28.409  -15.486 -28.143 1.00 47.29  ? 1468 HOH A O   1 
HETATM 7379 O O   . HOH U 13 .   ? -11.901 -16.372 3.546   1.00 45.77  ? 1469 HOH A O   1 
HETATM 7380 O O   . HOH U 13 .   ? 3.964   -35.530 -23.325 1.00 33.12  ? 1470 HOH A O   1 
HETATM 7381 O O   . HOH U 13 .   ? 8.500   -30.327 -38.750 1.00 18.28  ? 1471 HOH A O   1 
HETATM 7382 O O   . HOH U 13 .   ? 28.771  -47.519 -32.325 1.00 27.11  ? 1472 HOH A O   1 
HETATM 7383 O O   . HOH U 13 .   ? -12.323 -23.166 9.504   1.00 39.92  ? 1473 HOH A O   1 
HETATM 7384 O O   . HOH U 13 .   ? 3.952   -21.495 16.283  1.00 43.19  ? 1474 HOH A O   1 
HETATM 7385 O O   . HOH U 13 .   ? -23.968 -40.942 -14.466 1.00 30.22  ? 1475 HOH A O   1 
HETATM 7386 O O   . HOH U 13 .   ? -18.361 -33.427 -51.203 1.00 32.71  ? 1476 HOH A O   1 
HETATM 7387 O O   . HOH U 13 .   ? 3.215   -44.225 -24.289 1.00 19.14  ? 1477 HOH A O   1 
HETATM 7388 O O   . HOH U 13 .   ? -22.708 -22.386 -25.340 1.00 33.19  ? 1478 HOH A O   1 
HETATM 7389 O O   . HOH U 13 .   ? 17.694  -26.299 -43.558 1.00 39.00  ? 1479 HOH A O   1 
HETATM 7390 O O   . HOH U 13 .   ? -6.527  -22.943 4.837   1.00 21.38  ? 1480 HOH A O   1 
HETATM 7391 O O   . HOH U 13 .   ? -10.668 -20.743 -16.562 1.00 15.83  ? 1481 HOH A O   1 
HETATM 7392 O O   . HOH U 13 .   ? 23.797  -53.815 -31.998 1.00 36.93  ? 1482 HOH A O   1 
HETATM 7393 O O   . HOH U 13 .   ? 31.242  -51.456 -49.568 1.00 35.87  ? 1483 HOH A O   1 
HETATM 7394 O O   . HOH U 13 .   ? -25.373 -32.132 -7.972  1.00 28.50  ? 1484 HOH A O   1 
HETATM 7395 O O   . HOH U 13 .   ? -5.496  -23.482 9.332   1.00 43.58  ? 1485 HOH A O   1 
HETATM 7396 O O   . HOH U 13 .   ? -33.341 -21.370 -17.464 1.00 35.59  ? 1486 HOH A O   1 
HETATM 7397 O O   . HOH U 13 .   ? 20.456  -5.619  -12.129 1.00 39.81  ? 1487 HOH A O   1 
HETATM 7398 O O   . HOH U 13 .   ? 28.975  -20.295 -16.734 1.00 47.32  ? 1488 HOH A O   1 
HETATM 7399 O O   . HOH U 13 .   ? -10.973 -14.145 -0.122  1.00 18.74  ? 1489 HOH A O   1 
HETATM 7400 O O   . HOH U 13 .   ? -10.119 -41.165 -25.826 1.00 17.43  ? 1490 HOH A O   1 
HETATM 7401 O O   . HOH U 13 .   ? -29.914 -37.164 -39.529 1.00 52.68  ? 1491 HOH A O   1 
HETATM 7402 O O   . HOH U 13 .   ? 17.083  -52.671 -20.702 1.00 47.10  ? 1492 HOH A O   1 
HETATM 7403 O O   . HOH U 13 .   ? -24.792 -24.575 -35.537 1.00 26.69  ? 1493 HOH A O   1 
HETATM 7404 O O   . HOH U 13 .   ? -6.169  -31.088 -2.865  1.00 38.03  ? 1494 HOH A O   1 
HETATM 7405 O O   . HOH U 13 .   ? 30.855  -61.029 -44.711 1.00 32.24  ? 1495 HOH A O   1 
HETATM 7406 O O   . HOH U 13 .   ? 21.055  -38.364 -27.273 1.00 39.96  ? 1496 HOH A O   1 
HETATM 7407 O O   . HOH U 13 .   ? 15.414  -13.313 -12.232 1.00 23.10  ? 1497 HOH A O   1 
HETATM 7408 O O   . HOH U 13 .   ? -10.306 -16.820 -0.699  1.00 17.33  ? 1498 HOH A O   1 
HETATM 7409 O O   . HOH U 13 .   ? 33.588  -40.940 -41.016 1.00 37.17  ? 1499 HOH A O   1 
HETATM 7410 O O   . HOH U 13 .   ? 16.948  -12.903 -5.031  1.00 20.84  ? 1500 HOH A O   1 
HETATM 7411 O O   . HOH U 13 .   ? -18.401 -40.526 -12.832 1.00 44.76  ? 1501 HOH A O   1 
HETATM 7412 O O   . HOH U 13 .   ? -29.719 -36.757 -33.854 1.00 42.91  ? 1502 HOH A O   1 
HETATM 7413 O O   . HOH U 13 .   ? 9.063   4.888   -13.275 1.00 33.49  ? 1503 HOH A O   1 
HETATM 7414 O O   . HOH U 13 .   ? -33.792 -11.940 -8.892  1.00 54.42  ? 1504 HOH A O   1 
HETATM 7415 O O   . HOH U 13 .   ? 5.146   -57.842 -26.882 1.00 30.35  ? 1505 HOH A O   1 
HETATM 7416 O O   . HOH U 13 .   ? -11.008 -23.247 -50.015 1.00 27.40  ? 1506 HOH A O   1 
HETATM 7417 O O   . HOH U 13 .   ? 3.605   -13.021 -18.835 1.00 31.88  ? 1507 HOH A O   1 
HETATM 7418 O O   . HOH U 13 .   ? -26.287 -24.735 -5.422  1.00 56.32  ? 1508 HOH A O   1 
HETATM 7419 O O   . HOH U 13 .   ? 6.547   -15.222 -22.313 1.00 42.18  ? 1509 HOH A O   1 
HETATM 7420 O O   . HOH U 13 .   ? -20.795 -41.250 -15.916 1.00 28.66  ? 1510 HOH A O   1 
HETATM 7421 O O   . HOH U 13 .   ? -35.106 -34.730 -25.098 1.00 41.95  ? 1511 HOH A O   1 
HETATM 7422 O O   . HOH U 13 .   ? 20.868  -20.275 5.436   1.00 56.52  ? 1512 HOH A O   1 
HETATM 7423 O O   . HOH U 13 .   ? -40.564 -31.256 -25.113 1.00 36.27  ? 1513 HOH A O   1 
HETATM 7424 O O   . HOH U 13 .   ? -33.278 -34.061 -42.690 1.00 60.66  ? 1514 HOH A O   1 
HETATM 7425 O O   . HOH U 13 .   ? 28.175  -25.947 -26.647 1.00 36.87  ? 1515 HOH A O   1 
HETATM 7426 O O   . HOH U 13 .   ? -40.298 -25.094 -21.022 1.00 53.33  ? 1516 HOH A O   1 
HETATM 7427 O O   . HOH U 13 .   ? -8.006  -7.897  -28.558 1.00 41.88  ? 1517 HOH A O   1 
HETATM 7428 O O   . HOH U 13 .   ? -21.051 -20.700 -26.861 1.00 27.57  ? 1518 HOH A O   1 
HETATM 7429 O O   . HOH U 13 .   ? -9.534  -21.813 -44.617 1.00 15.44  ? 1519 HOH A O   1 
HETATM 7430 O O   . HOH U 13 .   ? -23.820 -43.495 -16.667 1.00 37.75  ? 1520 HOH A O   1 
HETATM 7431 O O   . HOH U 13 .   ? 9.555   -1.965  3.896   1.00 30.03  ? 1521 HOH A O   1 
HETATM 7432 O O   . HOH U 13 .   ? -7.024  -11.089 12.743  1.00 26.14  ? 1522 HOH A O   1 
HETATM 7433 O O   . HOH U 13 .   ? 4.245   -37.451 -45.687 1.00 19.59  ? 1523 HOH A O   1 
HETATM 7434 O O   . HOH U 13 .   ? 33.867  -51.130 -42.433 1.00 46.01  ? 1524 HOH A O   1 
HETATM 7435 O O   . HOH U 13 .   ? 4.358   -13.788 -27.275 1.00 29.98  ? 1525 HOH A O   1 
HETATM 7436 O O   . HOH U 13 .   ? -5.706  -28.365 -9.969  1.00 42.57  ? 1526 HOH A O   1 
HETATM 7437 O O   . HOH U 13 .   ? 26.864  -14.617 -41.171 1.00 32.22  ? 1527 HOH A O   1 
HETATM 7438 O O   . HOH U 13 .   ? -14.045 -14.276 -35.331 1.00 49.51  ? 1528 HOH A O   1 
HETATM 7439 O O   . HOH U 13 .   ? -5.137  -14.377 -17.532 1.00 16.73  ? 1529 HOH A O   1 
HETATM 7440 O O   . HOH U 13 .   ? -1.031  -24.467 -43.478 1.00 23.77  ? 1530 HOH A O   1 
HETATM 7441 O O   . HOH U 13 .   ? 16.450  -10.531 -47.617 1.00 35.50  ? 1531 HOH A O   1 
HETATM 7442 O O   . HOH U 13 .   ? 18.462  -14.742 9.153   1.00 38.97  ? 1532 HOH A O   1 
HETATM 7443 O O   . HOH U 13 .   ? 15.392  -14.067 -30.971 1.00 29.76  ? 1533 HOH A O   1 
HETATM 7444 O O   . HOH U 13 .   ? 8.814   -35.377 0.453   1.00 56.64  ? 1534 HOH A O   1 
HETATM 7445 O O   . HOH U 13 .   ? 29.807  -33.766 -53.815 1.00 57.28  ? 1535 HOH A O   1 
HETATM 7446 O O   . HOH U 13 .   ? 20.890  -58.595 -41.044 1.00 30.62  ? 1536 HOH A O   1 
HETATM 7447 O O   . HOH U 13 .   ? -10.736 -1.520  -11.429 1.00 37.89  ? 1537 HOH A O   1 
HETATM 7448 O O   . HOH U 13 .   ? -36.374 -23.054 -20.975 1.00 34.47  ? 1538 HOH A O   1 
HETATM 7449 O O   . HOH U 13 .   ? 23.188  -25.693 -7.103  1.00 17.21  ? 1539 HOH A O   1 
HETATM 7450 O O   . HOH U 13 .   ? -0.838  -51.323 -26.094 1.00 35.32  ? 1540 HOH A O   1 
HETATM 7451 O O   . HOH U 13 .   ? 6.127   -2.098  -5.983  1.00 18.09  ? 1541 HOH A O   1 
HETATM 7452 O O   . HOH U 13 .   ? 18.396  -31.310 -16.737 1.00 34.85  ? 1542 HOH A O   1 
HETATM 7453 O O   . HOH U 13 .   ? -15.618 -25.540 -13.108 1.00 20.39  ? 1543 HOH A O   1 
HETATM 7454 O O   . HOH U 13 .   ? -13.926 -18.198 -47.345 1.00 36.17  ? 1544 HOH A O   1 
HETATM 7455 O O   . HOH U 13 .   ? 20.724  -9.487  -14.713 1.00 19.68  ? 1545 HOH A O   1 
HETATM 7456 O O   . HOH U 13 .   ? 11.431  -19.736 18.921  1.00 27.29  ? 1546 HOH A O   1 
HETATM 7457 O O   . HOH U 13 .   ? 29.264  -41.947 -54.153 1.00 40.29  ? 1547 HOH A O   1 
HETATM 7458 O O   . HOH U 13 .   ? 25.620  -38.801 -50.200 1.00 31.60  ? 1548 HOH A O   1 
HETATM 7459 O O   . HOH U 13 .   ? 24.578  -24.252 -9.196  1.00 24.72  ? 1549 HOH A O   1 
HETATM 7460 O O   . HOH U 13 .   ? -10.451 -35.264 -56.402 1.00 32.54  ? 1550 HOH A O   1 
HETATM 7461 O O   . HOH U 13 .   ? -1.375  -8.738  -17.777 1.00 17.05  ? 1551 HOH A O   1 
HETATM 7462 O O   . HOH U 13 .   ? 8.533   -15.582 -5.115  1.00 21.65  ? 1552 HOH A O   1 
HETATM 7463 O O   . HOH U 13 .   ? -26.317 -13.144 -10.396 1.00 30.13  ? 1553 HOH A O   1 
HETATM 7464 O O   . HOH U 13 .   ? -5.906  -20.771 6.384   1.00 17.62  ? 1554 HOH A O   1 
HETATM 7465 O O   . HOH U 13 .   ? -26.135 -14.741 -27.305 1.00 43.31  ? 1555 HOH A O   1 
HETATM 7466 O O   . HOH U 13 .   ? 3.707   -39.471 -16.284 1.00 38.70  ? 1556 HOH A O   1 
HETATM 7467 O O   . HOH U 13 .   ? -1.329  -49.382 -34.058 1.00 58.62  ? 1557 HOH A O   1 
HETATM 7468 O O   . HOH U 13 .   ? 1.079   -43.844 -22.784 1.00 31.62  ? 1558 HOH A O   1 
HETATM 7469 O O   . HOH U 13 .   ? 4.313   -14.842 26.295  1.00 58.94  ? 1559 HOH A O   1 
HETATM 7470 O O   . HOH U 13 .   ? 28.192  -13.234 -33.288 1.00 35.68  ? 1560 HOH A O   1 
HETATM 7471 O O   . HOH U 13 .   ? 33.188  -41.428 -38.292 1.00 53.70  ? 1561 HOH A O   1 
HETATM 7472 O O   . HOH U 13 .   ? 20.716  -10.248 -1.613  1.00 47.08  ? 1562 HOH A O   1 
HETATM 7473 O O   . HOH U 13 .   ? 12.030  0.199   2.344   1.00 34.44  ? 1563 HOH A O   1 
HETATM 7474 O O   . HOH U 13 .   ? 0.800   -0.846  8.772   1.00 33.26  ? 1564 HOH A O   1 
HETATM 7475 O O   . HOH U 13 .   ? 16.678  -8.645  7.875   1.00 50.16  ? 1565 HOH A O   1 
HETATM 7476 O O   . HOH U 13 .   ? 32.165  -31.782 -33.137 1.00 29.51  ? 1566 HOH A O   1 
HETATM 7477 O O   . HOH U 13 .   ? -8.393  -22.906 -16.467 1.00 13.19  ? 1567 HOH A O   1 
HETATM 7478 O O   . HOH U 13 .   ? 14.812  -38.099 -27.875 1.00 27.50  ? 1568 HOH A O   1 
HETATM 7479 O O   . HOH U 13 .   ? 12.968  -13.303 -24.527 1.00 19.98  ? 1569 HOH A O   1 
HETATM 7480 O O   . HOH U 13 .   ? 13.962  -7.536  -17.526 1.00 44.07  ? 1570 HOH A O   1 
HETATM 7481 O O   . HOH U 13 .   ? -14.445 -6.745  -9.640  1.00 19.45  ? 1571 HOH A O   1 
HETATM 7482 O O   . HOH U 13 .   ? 19.167  5.741   -1.624  1.00 53.14  ? 1572 HOH A O   1 
HETATM 7483 O O   . HOH U 13 .   ? 8.889   -26.559 -42.282 1.00 21.07  ? 1573 HOH A O   1 
HETATM 7484 O O   . HOH U 13 .   ? -26.067 -29.469 -6.978  1.00 36.85  ? 1574 HOH A O   1 
HETATM 7485 O O   . HOH U 13 .   ? 4.379   -42.636 -16.478 1.00 52.53  ? 1575 HOH A O   1 
HETATM 7486 O O   . HOH U 13 .   ? -5.957  -18.735 -50.502 1.00 28.10  ? 1576 HOH A O   1 
HETATM 7487 O O   . HOH U 13 .   ? -15.770 -38.200 -44.906 1.00 29.06  ? 1577 HOH A O   1 
HETATM 7488 O O   . HOH U 13 .   ? -28.995 -33.725 -33.014 1.00 26.01  ? 1578 HOH A O   1 
HETATM 7489 O O   . HOH U 13 .   ? -31.845 -29.427 -37.690 1.00 42.76  ? 1579 HOH A O   1 
HETATM 7490 O O   . HOH U 13 .   ? 28.214  -16.879 -21.500 1.00 32.16  ? 1580 HOH A O   1 
HETATM 7491 O O   . HOH U 13 .   ? 31.297  -50.551 -32.274 1.00 50.90  ? 1581 HOH A O   1 
HETATM 7492 O O   . HOH U 13 .   ? 27.583  -30.185 -31.505 1.00 27.58  ? 1582 HOH A O   1 
HETATM 7493 O O   . HOH U 13 .   ? 4.888   -45.197 -31.947 1.00 22.45  ? 1583 HOH A O   1 
HETATM 7494 O O   . HOH U 13 .   ? 35.382  -35.291 -49.117 1.00 54.79  ? 1584 HOH A O   1 
HETATM 7495 O O   . HOH U 13 .   ? -13.873 -5.888  -21.146 1.00 15.52  ? 1585 HOH A O   1 
HETATM 7496 O O   . HOH U 13 .   ? -26.687 -36.423 -24.732 1.00 41.74  ? 1586 HOH A O   1 
HETATM 7497 O O   . HOH U 13 .   ? 31.268  -22.866 -40.538 1.00 42.24  ? 1587 HOH A O   1 
HETATM 7498 O O   . HOH U 13 .   ? -13.714 -31.172 -54.190 1.00 61.10  ? 1588 HOH A O   1 
HETATM 7499 O O   . HOH U 13 .   ? 12.201  9.963   -6.884  1.00 38.88  ? 1589 HOH A O   1 
HETATM 7500 O O   . HOH U 13 .   ? 12.442  -11.450 -35.627 1.00 51.54  ? 1590 HOH A O   1 
HETATM 7501 O O   . HOH U 13 .   ? 23.194  -13.143 -3.883  1.00 28.93  ? 1591 HOH A O   1 
HETATM 7502 O O   . HOH U 13 .   ? 6.225   -53.136 -35.285 1.00 43.39  ? 1592 HOH A O   1 
HETATM 7503 O O   . HOH U 13 .   ? 5.460   -11.435 -28.176 1.00 32.32  ? 1593 HOH A O   1 
HETATM 7504 O O   . HOH U 13 .   ? -2.465  -45.770 -33.618 1.00 34.45  ? 1594 HOH A O   1 
HETATM 7505 O O   . HOH U 13 .   ? 4.491   -17.516 -52.860 1.00 27.95  ? 1595 HOH A O   1 
HETATM 7506 O O   . HOH U 13 .   ? 3.887   -50.513 -35.197 1.00 40.46  ? 1596 HOH A O   1 
HETATM 7507 O O   . HOH U 13 .   ? 19.425  -11.556 5.923   1.00 43.69  ? 1597 HOH A O   1 
HETATM 7508 O O   . HOH U 13 .   ? 22.248  -53.077 -48.008 1.00 39.10  ? 1598 HOH A O   1 
HETATM 7509 O O   . HOH U 13 .   ? -1.040  16.150  0.249   1.00 46.55  ? 1599 HOH A O   1 
HETATM 7510 O O   . HOH U 13 .   ? 10.196  -32.247 -47.068 1.00 44.46  ? 1600 HOH A O   1 
HETATM 7511 O O   . HOH U 13 .   ? 5.080   -6.467  -38.285 1.00 36.07  ? 1601 HOH A O   1 
HETATM 7512 O O   . HOH U 13 .   ? 7.504   -27.829 15.471  1.00 47.80  ? 1602 HOH A O   1 
HETATM 7513 O O   . HOH U 13 .   ? 7.541   11.622  2.812   1.00 28.63  ? 1603 HOH A O   1 
HETATM 7514 O O   . HOH U 13 .   ? 26.174  -12.102 -10.018 1.00 53.98  ? 1604 HOH A O   1 
HETATM 7515 O O   . HOH U 13 .   ? 2.177   -52.843 -43.218 1.00 54.14  ? 1605 HOH A O   1 
HETATM 7516 O O   . HOH U 13 .   ? -5.933  -8.281  -31.221 1.00 43.26  ? 1606 HOH A O   1 
HETATM 7517 O O   . HOH U 13 .   ? -21.742 -33.929 -1.705  1.00 31.24  ? 1607 HOH A O   1 
HETATM 7518 O O   . HOH U 13 .   ? 2.358   -10.188 -46.289 1.00 43.21  ? 1608 HOH A O   1 
HETATM 7519 O O   . HOH U 13 .   ? -9.470  -1.230  -0.727  1.00 47.79  ? 1609 HOH A O   1 
HETATM 7520 O O   . HOH U 13 .   ? -11.665 -12.559 -31.244 1.00 38.93  ? 1610 HOH A O   1 
HETATM 7521 O O   . HOH U 13 .   ? 12.143  -8.559  16.909  1.00 63.27  ? 1611 HOH A O   1 
HETATM 7522 O O   . HOH U 13 .   ? 26.663  -22.958 -13.999 1.00 45.53  ? 1612 HOH A O   1 
HETATM 7523 O O   . HOH U 13 .   ? 21.359  -54.504 -27.442 1.00 30.53  ? 1613 HOH A O   1 
HETATM 7524 O O   . HOH U 13 .   ? -4.424  -10.820 -47.941 1.00 47.44  ? 1614 HOH A O   1 
HETATM 7525 O O   . HOH U 13 .   ? -10.792 -18.190 1.601   1.00 21.25  ? 1615 HOH A O   1 
HETATM 7526 O O   . HOH U 13 .   ? 4.992   -6.647  -42.894 1.00 33.55  ? 1616 HOH A O   1 
HETATM 7527 O O   . HOH U 13 .   ? -38.950 -22.329 -24.934 1.00 45.48  ? 1617 HOH A O   1 
HETATM 7528 O O   . HOH U 13 .   ? -37.464 -20.153 -22.837 1.00 64.51  ? 1618 HOH A O   1 
HETATM 7529 O O   . HOH U 13 .   ? 24.018  -34.347 -49.122 1.00 43.01  ? 1619 HOH A O   1 
HETATM 7530 O O   . HOH U 13 .   ? -32.030 -8.332  -15.712 1.00 52.63  ? 1620 HOH A O   1 
HETATM 7531 O O   . HOH U 13 .   ? 8.674   -3.514  6.182   1.00 49.72  ? 1621 HOH A O   1 
HETATM 7532 O O   . HOH U 13 .   ? -8.005  5.686   -7.130  1.00 48.07  ? 1622 HOH A O   1 
HETATM 7533 O O   . HOH U 13 .   ? -13.580 -13.767 1.083   1.00 45.88  ? 1623 HOH A O   1 
HETATM 7534 O O   . HOH U 13 .   ? 1.917   -46.240 -48.874 1.00 54.40  ? 1624 HOH A O   1 
HETATM 7535 O O   . HOH U 13 .   ? 17.339  7.936   -2.341  1.00 59.62  ? 1625 HOH A O   1 
HETATM 7536 O O   . HOH U 13 .   ? -23.907 -31.924 -47.014 1.00 26.58  ? 1626 HOH A O   1 
HETATM 7537 O O   . HOH U 13 .   ? -8.076  -1.890  -6.918  1.00 25.35  ? 1627 HOH A O   1 
HETATM 7538 O O   . HOH U 13 .   ? 15.999  -35.615 -2.842  1.00 39.10  ? 1628 HOH A O   1 
HETATM 7539 O O   . HOH U 13 .   ? 1.435   1.907   9.143   1.00 30.03  ? 1629 HOH A O   1 
HETATM 7540 O O   . HOH U 13 .   ? -21.026 -35.142 -49.771 1.00 44.46  ? 1630 HOH A O   1 
HETATM 7541 O O   . HOH U 13 .   ? -24.546 -16.761 -5.654  1.00 34.76  ? 1631 HOH A O   1 
HETATM 7542 O O   . HOH U 13 .   ? 11.587  -19.714 -43.042 1.00 23.64  ? 1632 HOH A O   1 
HETATM 7543 O O   . HOH U 13 .   ? -19.685 -43.877 -26.212 1.00 41.77  ? 1633 HOH A O   1 
HETATM 7544 O O   . HOH U 13 .   ? 25.220  -24.313 -21.520 1.00 24.66  ? 1634 HOH A O   1 
HETATM 7545 O O   . HOH U 13 .   ? 11.563  -6.701  -46.278 1.00 53.47  ? 1635 HOH A O   1 
HETATM 7546 O O   . HOH U 13 .   ? -25.081 -40.648 -41.410 1.00 24.81  ? 1636 HOH A O   1 
HETATM 7547 O O   . HOH U 13 .   ? 26.827  -28.718 -29.117 1.00 34.54  ? 1637 HOH A O   1 
HETATM 7548 O O   . HOH U 13 .   ? -27.147 -6.813  -4.250  1.00 39.23  ? 1638 HOH A O   1 
HETATM 7549 O O   . HOH U 13 .   ? 6.912   -8.599  -20.048 1.00 33.67  ? 1639 HOH A O   1 
HETATM 7550 O O   . HOH U 13 .   ? 9.668   -2.187  1.155   1.00 22.85  ? 1640 HOH A O   1 
HETATM 7551 O O   . HOH U 13 .   ? 23.189  -11.087 0.684   1.00 45.08  ? 1641 HOH A O   1 
HETATM 7552 O O   . HOH U 13 .   ? -2.936  -10.928 16.999  1.00 50.45  ? 1642 HOH A O   1 
HETATM 7553 O O   . HOH U 13 .   ? -27.955 -10.394 -9.611  1.00 45.17  ? 1643 HOH A O   1 
HETATM 7554 O O   . HOH U 13 .   ? 20.836  -59.474 -34.036 1.00 58.27  ? 1644 HOH A O   1 
HETATM 7555 O O   . HOH U 13 .   ? -22.882 -33.464 -5.766  1.00 44.41  ? 1645 HOH A O   1 
HETATM 7556 O O   . HOH U 13 .   ? 4.556   -14.879 -20.415 1.00 34.00  ? 1646 HOH A O   1 
HETATM 7557 O O   . HOH U 13 .   ? 11.508  -32.979 -8.405  1.00 41.62  ? 1647 HOH A O   1 
HETATM 7558 O O   . HOH U 13 .   ? -26.383 -37.334 -27.717 1.00 37.15  ? 1648 HOH A O   1 
HETATM 7559 O O   . HOH U 13 .   ? 4.109   -31.170 -1.779  1.00 33.73  ? 1649 HOH A O   1 
HETATM 7560 O O   . HOH U 13 .   ? 30.236  -29.965 -32.169 1.00 34.79  ? 1650 HOH A O   1 
HETATM 7561 O O   . HOH U 13 .   ? 23.956  -29.940 -1.395  1.00 50.65  ? 1651 HOH A O   1 
HETATM 7562 O O   . HOH U 13 .   ? 21.812  -54.573 -44.973 1.00 20.13  ? 1652 HOH A O   1 
HETATM 7563 O O   . HOH U 13 .   ? 17.139  -50.058 -48.586 1.00 40.93  ? 1653 HOH A O   1 
HETATM 7564 O O   . HOH U 13 .   ? 25.711  -33.855 -26.392 1.00 41.30  ? 1654 HOH A O   1 
HETATM 7565 O O   . HOH U 13 .   ? -15.943 -46.617 -40.088 1.00 42.17  ? 1655 HOH A O   1 
HETATM 7566 O O   . HOH U 13 .   ? 0.836   -27.995 -16.944 1.00 15.73  ? 1656 HOH A O   1 
HETATM 7567 O O   . HOH U 13 .   ? -1.857  -11.017 -43.778 1.00 51.19  ? 1657 HOH A O   1 
HETATM 7568 O O   . HOH U 13 .   ? 9.779   -6.148  -39.076 1.00 50.73  ? 1658 HOH A O   1 
HETATM 7569 O O   . HOH U 13 .   ? 28.905  -61.288 -41.748 1.00 44.14  ? 1659 HOH A O   1 
HETATM 7570 O O   . HOH U 13 .   ? 7.614   -41.013 -14.591 1.00 49.72  ? 1660 HOH A O   1 
HETATM 7571 O O   . HOH U 13 .   ? 8.913   -35.509 -6.144  1.00 44.55  ? 1661 HOH A O   1 
HETATM 7572 O O   . HOH U 13 .   ? -19.373 -9.594  -22.147 1.00 33.00  ? 1662 HOH A O   1 
HETATM 7573 O O   . HOH U 13 .   ? 25.294  -18.008 -18.614 1.00 54.22  ? 1663 HOH A O   1 
HETATM 7574 O O   . HOH U 13 .   ? 11.945  -19.650 -53.054 1.00 34.53  ? 1664 HOH A O   1 
HETATM 7575 O O   . HOH U 13 .   ? 0.099   -6.039  -36.801 1.00 47.08  ? 1665 HOH A O   1 
HETATM 7576 O O   . HOH U 13 .   ? -4.110  -27.943 -55.631 1.00 54.77  ? 1666 HOH A O   1 
HETATM 7577 O O   . HOH U 13 .   ? 7.175   -28.346 8.822   1.00 27.81  ? 1667 HOH A O   1 
HETATM 7578 O O   . HOH U 13 .   ? -36.104 -33.005 -28.856 1.00 49.53  ? 1668 HOH A O   1 
HETATM 7579 O O   . HOH U 13 .   ? -12.240 -7.809  2.362   1.00 25.81  ? 1669 HOH A O   1 
HETATM 7580 O O   . HOH U 13 .   ? -17.941 -25.386 -0.812  1.00 53.02  ? 1670 HOH A O   1 
HETATM 7581 O O   . HOH U 13 .   ? -0.004  -8.002  -32.217 1.00 48.32  ? 1671 HOH A O   1 
HETATM 7582 O O   . HOH U 13 .   ? 17.705  2.343   -7.859  1.00 35.27  ? 1672 HOH A O   1 
HETATM 7583 O O   . HOH U 13 .   ? 14.981  -32.837 2.345   1.00 46.61  ? 1673 HOH A O   1 
HETATM 7584 O O   . HOH U 13 .   ? -31.960 -17.694 -25.934 1.00 24.96  ? 1674 HOH A O   1 
HETATM 7585 O O   . HOH U 13 .   ? 30.480  -19.639 -26.570 1.00 50.82  ? 1675 HOH A O   1 
HETATM 7586 O O   . HOH U 13 .   ? -13.687 -16.885 -0.347  1.00 38.69  ? 1676 HOH A O   1 
HETATM 7587 O O   . HOH U 13 .   ? 19.325  -33.945 -49.870 1.00 53.92  ? 1677 HOH A O   1 
HETATM 7588 O O   . HOH U 13 .   ? -2.013  -43.003 -33.760 1.00 21.80  ? 1678 HOH A O   1 
HETATM 7589 O O   . HOH U 13 .   ? 14.740  10.158  -5.317  1.00 31.74  ? 1679 HOH A O   1 
HETATM 7590 O O   . HOH U 13 .   ? 4.595   -15.299 -24.456 1.00 39.44  ? 1680 HOH A O   1 
HETATM 7591 O O   . HOH U 13 .   ? 33.050  -25.420 -33.351 1.00 48.91  ? 1681 HOH A O   1 
HETATM 7592 O O   . HOH U 13 .   ? 1.657   -12.776 -50.594 1.00 24.09  ? 1682 HOH A O   1 
HETATM 7593 O O   . HOH U 13 .   ? -26.684 -13.868 -7.644  1.00 31.72  ? 1683 HOH A O   1 
HETATM 7594 O O   . HOH U 13 .   ? -2.431  -43.890 -20.253 1.00 35.85  ? 1684 HOH A O   1 
HETATM 7595 O O   . HOH U 13 .   ? 2.899   -56.824 -33.527 1.00 51.95  ? 1685 HOH A O   1 
HETATM 7596 O O   . HOH U 13 .   ? 18.597  -21.370 -49.616 1.00 48.98  ? 1686 HOH A O   1 
HETATM 7597 O O   . HOH U 13 .   ? 8.413   -36.220 -3.519  1.00 46.17  ? 1687 HOH A O   1 
HETATM 7598 O O   . HOH U 13 .   ? -23.390 -41.033 -11.578 1.00 35.55  ? 1688 HOH A O   1 
HETATM 7599 O O   . HOH U 13 .   ? 12.844  -56.484 -24.069 1.00 35.21  ? 1689 HOH A O   1 
HETATM 7600 O O   . HOH U 13 .   ? -19.058 -9.962  -24.920 1.00 70.23  ? 1690 HOH A O   1 
HETATM 7601 O O   . HOH U 13 .   ? -17.235 -19.363 -44.306 1.00 58.23  ? 1691 HOH A O   1 
HETATM 7602 O O   . HOH U 13 .   ? 6.628   -4.639  17.743  1.00 54.59  ? 1692 HOH A O   1 
HETATM 7603 O O   . HOH U 13 .   ? -27.515 -40.323 -35.041 1.00 45.03  ? 1693 HOH A O   1 
HETATM 7604 O O   . HOH U 13 .   ? 14.046  -34.416 -24.573 1.00 25.41  ? 1694 HOH A O   1 
HETATM 7605 O O   . HOH U 13 .   ? 25.422  -19.283 -43.945 1.00 40.47  ? 1695 HOH A O   1 
HETATM 7606 O O   . HOH U 13 .   ? 2.421   -16.431 -21.635 1.00 25.11  ? 1696 HOH A O   1 
HETATM 7607 O O   . HOH U 13 .   ? 36.979  -38.065 -50.126 1.00 43.32  ? 1697 HOH A O   1 
HETATM 7608 O O   . HOH U 13 .   ? 34.531  -34.241 -30.981 1.00 39.01  ? 1698 HOH A O   1 
HETATM 7609 O O   . HOH U 13 .   ? 2.797   -37.039 -13.403 1.00 29.39  ? 1699 HOH A O   1 
HETATM 7610 O O   . HOH U 13 .   ? -11.558 -4.503  8.757   1.00 31.15  ? 1700 HOH A O   1 
HETATM 7611 O O   . HOH U 13 .   ? 0.311   -30.865 -23.214 1.00 15.36  ? 1701 HOH A O   1 
HETATM 7612 O O   . HOH U 13 .   ? 19.599  -27.135 4.197   1.00 37.93  ? 1702 HOH A O   1 
HETATM 7613 O O   . HOH U 13 .   ? -25.966 -7.996  -1.532  1.00 48.68  ? 1703 HOH A O   1 
HETATM 7614 O O   . HOH U 13 .   ? -33.338 -36.142 -20.697 1.00 30.99  ? 1704 HOH A O   1 
HETATM 7615 O O   . HOH U 13 .   ? 7.049   -32.270 -50.416 1.00 34.20  ? 1705 HOH A O   1 
HETATM 7616 O O   . HOH U 13 .   ? 27.663  -27.898 -19.252 1.00 45.99  ? 1706 HOH A O   1 
HETATM 7617 O O   . HOH U 13 .   ? -0.070  -21.001 -59.615 1.00 31.63  ? 1707 HOH A O   1 
HETATM 7618 O O   . HOH U 13 .   ? 15.540  -5.231  10.906  1.00 59.54  ? 1708 HOH A O   1 
HETATM 7619 O O   . HOH U 13 .   ? 15.558  -39.701 -44.789 1.00 58.68  ? 1709 HOH A O   1 
HETATM 7620 O O   . HOH U 13 .   ? 21.650  -31.895 -20.378 1.00 41.28  ? 1710 HOH A O   1 
HETATM 7621 O O   . HOH U 13 .   ? -17.971 -1.641  -11.906 1.00 51.76  ? 1711 HOH A O   1 
HETATM 7622 O O   . HOH U 13 .   ? 24.054  -21.695 -44.817 1.00 34.19  ? 1712 HOH A O   1 
HETATM 7623 O O   . HOH U 13 .   ? 25.186  -11.625 -28.693 1.00 41.73  ? 1713 HOH A O   1 
HETATM 7624 O O   . HOH U 13 .   ? 12.363  11.555  -18.439 1.00 28.51  ? 1714 HOH A O   1 
HETATM 7625 O O   . HOH U 13 .   ? 16.924  -34.528 -29.013 1.00 22.61  ? 1715 HOH A O   1 
HETATM 7626 O O   . HOH U 13 .   ? 15.902  -35.040 -26.624 1.00 40.31  ? 1716 HOH A O   1 
HETATM 7627 O O   . HOH U 13 .   ? -25.260 -5.880  -11.897 1.00 43.59  ? 1717 HOH A O   1 
HETATM 7628 O O   . HOH U 13 .   ? 29.287  -21.260 -22.320 1.00 50.80  ? 1718 HOH A O   1 
HETATM 7629 O O   . HOH U 13 .   ? -20.009 -8.947  1.151   1.00 33.89  ? 1719 HOH A O   1 
HETATM 7630 O O   . HOH U 13 .   ? 13.969  -34.252 -9.067  1.00 36.87  ? 1720 HOH A O   1 
HETATM 7631 O O   . HOH U 13 .   ? 5.515   9.529   -12.919 1.00 34.53  ? 1721 HOH A O   1 
HETATM 7632 O O   . HOH U 13 .   ? -10.975 -13.946 7.301   1.00 42.35  ? 1722 HOH A O   1 
HETATM 7633 O O   . HOH U 13 .   ? 20.916  -57.441 -43.547 1.00 31.53  ? 1723 HOH A O   1 
HETATM 7634 O O   . HOH U 13 .   ? 36.715  -48.628 -37.722 1.00 53.23  ? 1724 HOH A O   1 
HETATM 7635 O O   . HOH U 13 .   ? -36.004 -15.887 -18.997 1.00 50.90  ? 1725 HOH A O   1 
HETATM 7636 O O   . HOH U 13 .   ? -23.594 -34.733 -48.342 1.00 55.19  ? 1726 HOH A O   1 
HETATM 7637 O O   . HOH U 13 .   ? 12.503  -0.832  -20.447 1.00 48.70  ? 1727 HOH A O   1 
HETATM 7638 O O   . HOH U 13 .   ? -23.711 -22.355 -36.778 1.00 39.51  ? 1728 HOH A O   1 
HETATM 7639 O O   . HOH U 13 .   ? -7.729  -34.924 -10.804 1.00 56.40  ? 1729 HOH A O   1 
HETATM 7640 O O   . HOH U 13 .   ? -10.111 -11.392 8.494   1.00 49.48  ? 1730 HOH A O   1 
HETATM 7641 O O   . HOH U 13 .   ? 6.279   -34.144 -0.509  1.00 46.67  ? 1731 HOH A O   1 
HETATM 7642 O O   . HOH U 13 .   ? 33.588  -34.052 -42.256 1.00 46.60  ? 1732 HOH A O   1 
HETATM 7643 O O   . HOH U 13 .   ? -5.463  -18.454 -55.390 1.00 54.88  ? 1733 HOH A O   1 
HETATM 7644 O O   . HOH U 13 .   ? 13.089  0.766   -15.554 1.00 55.94  ? 1734 HOH A O   1 
HETATM 7645 O O   . HOH U 13 .   ? 29.738  -31.223 -43.210 1.00 35.75  ? 1735 HOH A O   1 
HETATM 7646 O O   . HOH U 13 .   ? -11.792 -47.259 -20.502 1.00 50.65  ? 1736 HOH A O   1 
HETATM 7647 O O   . HOH U 13 .   ? 24.906  -59.195 -32.107 1.00 67.32  ? 1737 HOH A O   1 
HETATM 7648 O O   . HOH U 13 .   ? -2.275  -24.088 14.264  1.00 46.04  ? 1738 HOH A O   1 
HETATM 7649 O O   . HOH U 13 .   ? 15.677  -32.488 -47.100 1.00 48.81  ? 1739 HOH A O   1 
HETATM 7650 O O   . HOH U 13 .   ? -1.321  -42.643 -22.561 1.00 41.68  ? 1740 HOH A O   1 
HETATM 7651 O O   . HOH U 13 .   ? 12.609  -43.893 -45.119 1.00 50.46  ? 1741 HOH A O   1 
HETATM 7652 O O   . HOH U 13 .   ? -9.052  -40.564 -17.181 1.00 50.07  ? 1742 HOH A O   1 
HETATM 7653 O O   . HOH U 13 .   ? -5.562  -28.367 -0.035  1.00 46.36  ? 1743 HOH A O   1 
HETATM 7654 O O   . HOH U 13 .   ? -37.238 -35.539 -21.911 1.00 45.78  ? 1744 HOH A O   1 
HETATM 7655 O O   . HOH U 13 .   ? 12.215  -3.708  -21.127 1.00 58.04  ? 1745 HOH A O   1 
HETATM 7656 O O   . HOH U 13 .   ? -3.284  -5.848  17.170  1.00 51.10  ? 1746 HOH A O   1 
HETATM 7657 O O   . HOH U 13 .   ? 25.471  -28.294 -16.258 1.00 39.39  ? 1747 HOH A O   1 
HETATM 7658 O O   . HOH U 13 .   ? -6.090  -13.339 13.649  1.00 46.14  ? 1748 HOH A O   1 
HETATM 7659 O O   . HOH U 13 .   ? 26.491  -21.483 -11.636 1.00 34.24  ? 1749 HOH A O   1 
HETATM 7660 O O   . HOH U 13 .   ? -11.361 -18.170 6.631   1.00 36.72  ? 1750 HOH A O   1 
HETATM 7661 O O   . HOH U 13 .   ? -33.797 -24.576 -32.191 1.00 59.78  ? 1751 HOH A O   1 
HETATM 7662 O O   . HOH U 13 .   ? 3.267   -17.399 -57.491 1.00 46.97  ? 1752 HOH A O   1 
HETATM 7663 O O   . HOH U 13 .   ? -16.795 -46.437 -28.779 1.00 54.29  ? 1753 HOH A O   1 
HETATM 7664 O O   . HOH U 13 .   ? 17.852  -1.577  -1.528  1.00 58.70  ? 1754 HOH A O   1 
HETATM 7665 O O   . HOH U 13 .   ? 9.590   -4.217  11.390  1.00 44.96  ? 1755 HOH A O   1 
HETATM 7666 O O   . HOH U 13 .   ? -21.603 -44.758 -34.965 1.00 46.53  ? 1756 HOH A O   1 
HETATM 7667 O O   . HOH U 13 .   ? -16.426 -23.493 0.528   1.00 46.28  ? 1757 HOH A O   1 
HETATM 7668 O O   . HOH U 13 .   ? -29.613 -40.416 -10.997 1.00 53.08  ? 1758 HOH A O   1 
HETATM 7669 O O   . HOH U 13 .   ? -30.888 -31.616 -32.640 1.00 35.55  ? 1759 HOH A O   1 
HETATM 7670 O O   . HOH U 13 .   ? 27.712  -33.422 -28.443 1.00 55.63  ? 1760 HOH A O   1 
HETATM 7671 O O   . HOH U 13 .   ? 9.054   -25.628 -52.845 1.00 60.58  ? 1761 HOH A O   1 
HETATM 7672 O O   . HOH U 13 .   ? 14.253  -7.027  -47.162 1.00 49.38  ? 1762 HOH A O   1 
HETATM 7673 O O   . HOH U 13 .   ? 32.429  -18.479 -38.933 1.00 51.37  ? 1763 HOH A O   1 
HETATM 7674 O O   . HOH U 13 .   ? -8.496  -44.230 -38.432 1.00 45.33  ? 1764 HOH A O   1 
HETATM 7675 O O   . HOH U 13 .   ? 36.659  -40.260 -42.276 1.00 44.87  ? 1765 HOH A O   1 
HETATM 7676 O O   . HOH U 13 .   ? -1.898  -46.031 -36.521 1.00 36.78  ? 1766 HOH A O   1 
HETATM 7677 O O   . HOH U 13 .   ? -19.967 -21.458 -24.184 1.00 18.08  ? 1767 HOH A O   1 
HETATM 7678 O O   . HOH U 13 .   ? 17.560  -7.228  -0.966  1.00 42.16  ? 1768 HOH A O   1 
HETATM 7679 O O   . HOH U 13 .   ? 3.668   -35.851 -10.857 1.00 35.01  ? 1769 HOH A O   1 
HETATM 7680 O O   . HOH U 13 .   ? -19.041 -21.153 -1.134  1.00 34.03  ? 1770 HOH A O   1 
HETATM 7681 O O   . HOH U 13 .   ? 34.943  -39.236 -37.466 1.00 45.82  ? 1771 HOH A O   1 
HETATM 7682 O O   . HOH U 13 .   ? 20.660  -8.830  -8.583  1.00 66.68  ? 1772 HOH A O   1 
HETATM 7683 O O   . HOH U 13 .   ? 25.992  -50.521 -26.913 1.00 56.21  ? 1773 HOH A O   1 
HETATM 7684 O O   . HOH U 13 .   ? 9.445   -51.971 -48.173 1.00 38.48  ? 1774 HOH A O   1 
HETATM 7685 O O   . HOH U 13 .   ? -0.101  -22.092 14.746  1.00 55.47  ? 1775 HOH A O   1 
HETATM 7686 O O   . HOH U 13 .   ? -16.727 -20.202 -0.099  1.00 37.25  ? 1776 HOH A O   1 
HETATM 7687 O O   . HOH U 13 .   ? 7.883   -10.896 -28.487 1.00 28.91  ? 1777 HOH A O   1 
HETATM 7688 O O   . HOH U 13 .   ? 28.204  -30.230 -26.885 1.00 51.68  ? 1778 HOH A O   1 
HETATM 7689 O O   . HOH U 13 .   ? -6.887  -22.831 -55.847 1.00 54.00  ? 1779 HOH A O   1 
HETATM 7690 O O   . HOH U 13 .   ? 15.514  -4.287  -1.367  1.00 36.71  ? 1780 HOH A O   1 
HETATM 7691 O O   . HOH U 13 .   ? 14.103  -3.191  3.285   1.00 40.25  ? 1781 HOH A O   1 
HETATM 7692 O O   . HOH U 13 .   ? 9.946   -26.813 -44.956 1.00 24.79  ? 1782 HOH A O   1 
HETATM 7693 O O   . HOH U 13 .   ? -8.491  -0.423  6.966   1.00 52.17  ? 1783 HOH A O   1 
HETATM 7694 O O   . HOH U 13 .   ? -2.844  -27.684 -9.650  1.00 42.53  ? 1784 HOH A O   1 
HETATM 7695 O O   . HOH U 13 .   ? 18.460  -4.455  -4.805  1.00 48.26  ? 1785 HOH A O   1 
HETATM 7696 O O   . HOH U 13 .   ? -14.990 -4.013  -8.997  1.00 38.67  ? 1786 HOH A O   1 
HETATM 7697 O O   . HOH U 13 .   ? -10.048 -50.300 -26.427 1.00 48.26  ? 1787 HOH A O   1 
HETATM 7698 O O   . HOH U 13 .   ? -32.126 -23.565 -30.085 1.00 36.41  ? 1788 HOH A O   1 
HETATM 7699 O O   . HOH U 13 .   ? 17.320  -11.681 -35.002 1.00 42.04  ? 1789 HOH A O   1 
HETATM 7700 O O   . HOH U 13 .   ? -12.714 -46.672 -36.865 1.00 59.32  ? 1790 HOH A O   1 
HETATM 7701 O O   . HOH U 13 .   ? 17.244  -8.023  -19.775 1.00 48.95  ? 1791 HOH A O   1 
HETATM 7702 O O   . HOH U 13 .   ? -26.713 -26.360 -45.809 1.00 54.02  ? 1792 HOH A O   1 
HETATM 7703 O O   . HOH U 13 .   ? 27.489  -40.956 -27.587 1.00 44.93  ? 1793 HOH A O   1 
HETATM 7704 O O   . HOH U 13 .   ? 14.147  -10.795 -24.528 1.00 35.82  ? 1794 HOH A O   1 
HETATM 7705 O O   . HOH U 13 .   ? -13.093 -47.661 -39.701 1.00 45.83  ? 1795 HOH A O   1 
HETATM 7706 O O   . HOH U 13 .   ? -0.727  -31.208 -57.059 1.00 41.89  ? 1796 HOH A O   1 
HETATM 7707 O O   . HOH U 13 .   ? -16.400 -20.935 -46.644 1.00 48.56  ? 1797 HOH A O   1 
HETATM 7708 O O   . HOH U 13 .   ? 15.530  -36.372 -22.839 1.00 40.09  ? 1798 HOH A O   1 
HETATM 7709 O O   . HOH U 13 .   ? -3.227  -24.310 11.365  1.00 69.45  ? 1799 HOH A O   1 
HETATM 7710 O O   . HOH U 13 .   ? 2.587   -8.622  19.591  1.00 47.70  ? 1800 HOH A O   1 
HETATM 7711 O O   . HOH U 13 .   ? -8.659  -30.641 -9.354  1.00 49.35  ? 1801 HOH A O   1 
HETATM 7712 O O   . HOH U 13 .   ? 7.720   7.306   -13.700 1.00 44.92  ? 1802 HOH A O   1 
HETATM 7713 O O   . HOH U 13 .   ? -0.737  15.589  -3.895  1.00 37.31  ? 1803 HOH A O   1 
HETATM 7714 O O   . HOH U 13 .   ? 24.802  -27.819 -3.195  1.00 31.11  ? 1804 HOH A O   1 
HETATM 7715 O O   . HOH U 13 .   ? 4.604   -1.142  -8.133  1.00 21.66  ? 1805 HOH A O   1 
HETATM 7716 O O   . HOH U 13 .   ? -1.739  -29.192 -1.902  1.00 41.46  ? 1806 HOH A O   1 
HETATM 7717 O O   . HOH U 13 .   ? -8.462  -24.714 10.941  1.00 45.78  ? 1807 HOH A O   1 
HETATM 7718 O O   . HOH U 13 .   ? -9.382  -12.025 11.319  1.00 33.74  ? 1808 HOH A O   1 
HETATM 7719 O O   . HOH U 13 .   ? 3.984   -10.372 -19.389 1.00 35.28  ? 1809 HOH A O   1 
HETATM 7720 O O   . HOH U 13 .   ? -9.392  2.897   -7.549  1.00 67.63  ? 1810 HOH A O   1 
HETATM 7721 O O   . HOH U 13 .   ? 23.750  -13.901 4.557   1.00 38.45  ? 1811 HOH A O   1 
HETATM 7722 O O   . HOH U 13 .   ? 2.035   -32.264 -56.914 1.00 55.95  ? 1812 HOH A O   1 
HETATM 7723 O O   . HOH U 13 .   ? 29.372  -47.934 -29.590 1.00 44.51  ? 1813 HOH A O   1 
HETATM 7724 O O   . HOH U 13 .   ? 13.762  -13.506 -37.197 1.00 33.08  ? 1814 HOH A O   1 
HETATM 7725 O O   . HOH U 13 .   ? -24.441 -15.118 -9.175  1.00 51.00  ? 1815 HOH A O   1 
HETATM 7726 O O   . HOH U 13 .   ? -19.070 -43.047 -20.250 1.00 27.38  ? 1816 HOH A O   1 
HETATM 7727 O O   . HOH U 13 .   ? 23.040  -11.955 -14.363 1.00 53.99  ? 1817 HOH A O   1 
HETATM 7728 O O   . HOH U 13 .   ? 26.473  -11.453 -38.045 1.00 48.37  ? 1818 HOH A O   1 
HETATM 7729 O O   . HOH U 13 .   ? 28.105  -13.310 -29.975 1.00 46.46  ? 1819 HOH A O   1 
HETATM 7730 O O   . HOH U 13 .   ? 31.172  -28.917 -44.339 1.00 43.78  ? 1820 HOH A O   1 
HETATM 7731 O O   . HOH U 13 .   ? 12.940  -41.210 -44.571 1.00 48.63  ? 1821 HOH A O   1 
HETATM 7732 O O   . HOH U 13 .   ? 5.464   -7.805  -30.834 1.00 46.34  ? 1822 HOH A O   1 
HETATM 7733 O O   . HOH U 13 .   ? 20.685  -8.186  -11.498 1.00 54.03  ? 1823 HOH A O   1 
HETATM 7734 O O   . HOH U 13 .   ? 5.294   -3.490  13.356  1.00 43.60  ? 1824 HOH A O   1 
HETATM 7735 O O   . HOH U 13 .   ? -6.312  -24.797 7.060   1.00 32.48  ? 1825 HOH A O   1 
HETATM 7736 O O   . HOH U 13 .   ? 38.473  -41.584 -40.418 1.00 54.22  ? 1826 HOH A O   1 
HETATM 7737 O O   . HOH U 13 .   ? -28.790 -39.621 -27.129 1.00 49.33  ? 1827 HOH A O   1 
HETATM 7738 O O   . HOH U 13 .   ? -16.952 -8.351  -23.595 1.00 48.01  ? 1828 HOH A O   1 
HETATM 7739 O O   . HOH U 13 .   ? -25.780 -38.753 -8.596  1.00 57.15  ? 1829 HOH A O   1 
HETATM 7740 O O   . HOH U 13 .   ? 23.570  -37.237 -26.135 1.00 50.27  ? 1830 HOH A O   1 
HETATM 7741 O O   . HOH U 13 .   ? -11.030 -49.972 -22.133 1.00 59.51  ? 1831 HOH A O   1 
HETATM 7742 O O   . HOH U 13 .   ? -1.492  -19.031 16.764  1.00 42.73  ? 1832 HOH A O   1 
HETATM 7743 O O   . HOH U 13 .   ? 14.780  -8.781  -20.529 1.00 42.63  ? 1833 HOH A O   1 
HETATM 7744 O O   . HOH U 13 .   ? 15.727  13.786  -14.025 1.00 46.07  ? 1834 HOH A O   1 
HETATM 7745 O O   . HOH U 13 .   ? 24.558  -19.917 1.895   1.00 39.49  ? 1835 HOH A O   1 
HETATM 7746 O O   . HOH U 13 .   ? 5.203   -34.977 -51.814 1.00 44.99  ? 1836 HOH A O   1 
HETATM 7747 O O   . HOH U 13 .   ? 1.373   -8.417  -19.415 1.00 37.39  ? 1837 HOH A O   1 
HETATM 7748 O O   . HOH U 13 .   ? -31.078 -32.791 -28.390 1.00 26.30  ? 1838 HOH A O   1 
HETATM 7749 O O   . HOH U 13 .   ? 7.240   -8.926  -34.858 1.00 29.16  ? 1839 HOH A O   1 
HETATM 7750 O O   . HOH U 13 .   ? 25.656  -26.991 -13.140 1.00 35.84  ? 1840 HOH A O   1 
HETATM 7751 O O   . HOH U 13 .   ? 21.475  -27.910 -18.751 1.00 21.23  ? 1841 HOH A O   1 
HETATM 7752 O O   . HOH U 13 .   ? -9.303  -34.687 -59.584 1.00 59.37  ? 1842 HOH A O   1 
HETATM 7753 O O   . HOH U 13 .   ? -0.457  -11.951 19.497  1.00 41.42  ? 1843 HOH A O   1 
HETATM 7754 O O   . HOH U 13 .   ? 9.307   -20.308 -54.206 1.00 48.80  ? 1844 HOH A O   1 
HETATM 7755 O O   . HOH U 13 .   ? -10.302 -44.945 -36.582 1.00 32.82  ? 1845 HOH A O   1 
HETATM 7756 O O   . HOH U 13 .   ? 7.397   -7.834  -39.209 1.00 28.80  ? 1846 HOH A O   1 
HETATM 7757 O O   . HOH U 13 .   ? 21.037  -7.364  -16.672 1.00 33.54  ? 1847 HOH A O   1 
HETATM 7758 O O   . HOH U 13 .   ? 1.668   -51.812 -32.686 1.00 44.79  ? 1848 HOH A O   1 
HETATM 7759 O O   . HOH U 13 .   ? -14.417 -45.095 -33.109 1.00 45.64  ? 1849 HOH A O   1 
HETATM 7760 O O   . HOH U 13 .   ? 31.904  -31.702 -41.688 1.00 38.23  ? 1850 HOH A O   1 
HETATM 7761 O O   . HOH U 13 .   ? -35.243 -38.069 -22.226 1.00 53.31  ? 1851 HOH A O   1 
HETATM 7762 O O   . HOH U 13 .   ? 25.256  -26.717 -19.905 1.00 32.93  ? 1852 HOH A O   1 
HETATM 7763 O O   . HOH U 13 .   ? 17.869  -4.081  12.268  1.00 64.50  ? 1853 HOH A O   1 
HETATM 7764 O O   . HOH U 13 .   ? 1.461   -36.025 -9.027  1.00 47.78  ? 1854 HOH A O   1 
HETATM 7765 O O   . HOH U 13 .   ? 21.060  -30.619 -17.822 1.00 31.23  ? 1855 HOH A O   1 
HETATM 7766 O O   . HOH U 13 .   ? -28.869 -35.691 -26.187 1.00 32.01  ? 1856 HOH A O   1 
HETATM 7767 O O   . HOH U 13 .   ? 4.940   -23.515 20.244  1.00 49.04  ? 1857 HOH A O   1 
HETATM 7768 O O   . HOH U 13 .   ? -12.569 -50.256 -24.689 1.00 64.97  ? 1858 HOH A O   1 
HETATM 7769 O O   . HOH U 13 .   ? 3.653   2.962   10.543  1.00 38.93  ? 1859 HOH A O   1 
HETATM 7770 O O   . HOH U 13 .   ? -20.049 -45.655 -23.777 1.00 41.39  ? 1860 HOH A O   1 
HETATM 7771 O O   . HOH U 13 .   ? -4.207  -16.683 -51.432 1.00 50.12  ? 1861 HOH A O   1 
HETATM 7772 O O   . HOH U 13 .   ? -8.997  -8.773  13.764  1.00 52.91  ? 1862 HOH A O   1 
HETATM 7773 O O   . HOH U 13 .   ? -30.962 -35.822 -29.940 1.00 53.22  ? 1863 HOH A O   1 
HETATM 7774 O O   . HOH U 13 .   ? 18.167  -37.045 -29.021 1.00 31.72  ? 1864 HOH A O   1 
HETATM 7775 O O   . HOH U 13 .   ? -0.322  -8.996  18.948  1.00 41.20  ? 1865 HOH A O   1 
HETATM 7776 O O   . HOH U 13 .   ? -5.763  -16.916 15.547  1.00 31.90  ? 1866 HOH A O   1 
HETATM 7777 O O   . HOH U 13 .   ? 29.183  -22.788 -8.211  1.00 34.88  ? 1867 HOH A O   1 
HETATM 7778 O O   . HOH U 13 .   ? 26.141  -26.403 -10.333 1.00 36.12  ? 1868 HOH A O   1 
HETATM 7779 O O   . HOH U 13 .   ? -41.275 -23.347 -23.280 1.00 58.38  ? 1869 HOH A O   1 
HETATM 7780 O O   . HOH U 13 .   ? 12.538  -60.203 -28.567 1.00 53.96  ? 1870 HOH A O   1 
HETATM 7781 O O   . HOH U 13 .   ? -18.329 -22.210 -48.562 1.00 53.29  ? 1871 HOH A O   1 
HETATM 7782 O O   . HOH U 13 .   ? 5.436   -37.728 -12.144 1.00 52.55  ? 1872 HOH A O   1 
HETATM 7783 O O   . HOH U 13 .   ? 23.626  -26.768 -17.615 1.00 21.62  ? 1873 HOH A O   1 
HETATM 7784 O O   . HOH U 13 .   ? -28.505 -39.876 -37.712 1.00 47.14  ? 1874 HOH A O   1 
HETATM 7785 O O   . HOH U 13 .   ? -23.689 -43.791 -21.716 1.00 51.84  ? 1875 HOH A O   1 
HETATM 7786 O O   . HOH U 13 .   ? -21.157 -35.417 -4.430  1.00 38.39  ? 1876 HOH A O   1 
HETATM 7787 O O   . HOH U 13 .   ? 35.894  -32.608 -43.288 1.00 44.44  ? 1877 HOH A O   1 
HETATM 7788 O O   . HOH U 13 .   ? -4.277  -19.107 16.407  1.00 47.65  ? 1878 HOH A O   1 
HETATM 7789 O O   . HOH U 13 .   ? -25.756 -41.181 -44.489 1.00 53.30  ? 1879 HOH A O   1 
HETATM 7790 O O   . HOH U 13 .   ? 32.970  -53.713 -50.395 1.00 53.30  ? 1880 HOH A O   1 
HETATM 7791 O O   . HOH U 13 .   ? 22.704  -30.648 -8.613  1.00 34.62  ? 1881 HOH A O   1 
HETATM 7792 O O   . HOH U 13 .   ? 30.042  -19.532 -40.242 1.00 46.35  ? 1882 HOH A O   1 
HETATM 7793 O O   . HOH U 13 .   ? -21.652 -42.377 -13.343 1.00 39.14  ? 1883 HOH A O   1 
HETATM 7794 O O   . HOH U 13 .   ? -31.475 -36.495 -26.949 1.00 37.91  ? 1884 HOH A O   1 
HETATM 7795 O O   . HOH U 13 .   ? 27.523  -23.770 -24.716 1.00 49.12  ? 1885 HOH A O   1 
HETATM 7796 O O   . HOH U 13 .   ? -24.421 -13.969 -30.832 1.00 57.58  ? 1886 HOH A O   1 
HETATM 7797 O O   . HOH U 13 .   ? 24.089  -28.198 -7.800  1.00 29.15  ? 1887 HOH A O   1 
HETATM 7798 O O   . HOH U 13 .   ? -14.722 -24.575 7.562   1.00 49.89  ? 1888 HOH A O   1 
HETATM 7799 O O   . HOH U 13 .   ? -17.675 -15.917 0.726   1.00 48.38  ? 1889 HOH A O   1 
HETATM 7800 O O   . HOH U 13 .   ? 7.654   -3.795  -40.676 1.00 52.80  ? 1890 HOH A O   1 
HETATM 7801 O O   . HOH U 13 .   ? 25.702  -28.991 -5.605  1.00 32.88  ? 1891 HOH A O   1 
HETATM 7802 O O   . HOH U 13 .   ? -17.079 -38.557 -6.636  1.00 51.16  ? 1892 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 1   ? 1.1005 1.0568 1.0568 -0.0280 -0.0058 -0.0675 79  PRO A N   
2    C CA  . PRO A 1   ? 1.0786 1.0451 1.0364 -0.0257 -0.0080 -0.0689 79  PRO A CA  
3    C C   . PRO A 1   ? 1.0115 0.9876 0.9742 -0.0272 -0.0088 -0.0682 79  PRO A C   
4    O O   . PRO A 1   ? 0.9047 0.8804 0.8693 -0.0283 -0.0076 -0.0651 79  PRO A O   
5    C CB  . PRO A 1   ? 1.0080 0.9745 0.9631 -0.0202 -0.0083 -0.0655 79  PRO A CB  
6    C CG  . PRO A 1   ? 0.9181 0.8736 0.8695 -0.0195 -0.0067 -0.0647 79  PRO A CG  
7    C CD  . PRO A 1   ? 0.9241 0.8733 0.8764 -0.0241 -0.0051 -0.0647 79  PRO A CD  
8    N N   . THR A 2   ? 1.0953 1.0800 1.0598 -0.0270 -0.0108 -0.0711 80  THR A N   
9    C CA  . THR A 2   ? 1.1798 1.1745 1.1490 -0.0278 -0.0120 -0.0710 80  THR A CA  
10   C C   . THR A 2   ? 0.9448 0.9427 0.9149 -0.0247 -0.0118 -0.0659 80  THR A C   
11   O O   . THR A 2   ? 0.7071 0.7074 0.6807 -0.0265 -0.0111 -0.0642 80  THR A O   
12   C CB  . THR A 2   ? 1.3669 1.3702 1.3366 -0.0264 -0.0147 -0.0743 80  THR A CB  
13   O OG1 . THR A 2   ? 1.7811 1.7820 1.7499 -0.0292 -0.0151 -0.0794 80  THR A OG1 
14   C CG2 . THR A 2   ? 1.3174 1.3310 1.2921 -0.0271 -0.0162 -0.0745 80  THR A CG2 
15   N N   . GLN A 3   ? 0.7872 0.7850 0.7541 -0.0201 -0.0124 -0.0636 81  GLN A N   
16   C CA  . GLN A 3   ? 0.7607 0.7613 0.7281 -0.0168 -0.0122 -0.0590 81  GLN A CA  
17   C C   . GLN A 3   ? 0.6107 0.6048 0.5780 -0.0176 -0.0101 -0.0554 81  GLN A C   
18   O O   . GLN A 3   ? 0.6100 0.6070 0.5790 -0.0163 -0.0098 -0.0519 81  GLN A O   
19   C CB  . GLN A 3   ? 0.8206 0.8228 0.7845 -0.0120 -0.0132 -0.0577 81  GLN A CB  
20   C CG  . GLN A 3   ? 0.8922 0.8867 0.8522 -0.0098 -0.0119 -0.0562 81  GLN A CG  
21   C CD  . GLN A 3   ? 1.0796 1.0685 1.0367 -0.0108 -0.0117 -0.0601 81  GLN A CD  
22   O OE1 . GLN A 3   ? 1.3555 1.3438 1.3138 -0.0143 -0.0120 -0.0637 81  GLN A OE1 
23   N NE2 . GLN A 3   ? 0.9657 0.9505 0.9192 -0.0076 -0.0113 -0.0594 81  GLN A NE2 
24   N N   . CYS A 4   ? 0.4623 0.4477 0.4277 -0.0197 -0.0086 -0.0562 82  CYS A N   
25   C CA  . CYS A 4   ? 0.4385 0.4172 0.4033 -0.0206 -0.0066 -0.0529 82  CYS A CA  
26   C C   . CYS A 4   ? 0.4633 0.4421 0.4313 -0.0250 -0.0054 -0.0530 82  CYS A C   
27   O O   . CYS A 4   ? 0.4566 0.4296 0.4238 -0.0260 -0.0037 -0.0504 82  CYS A O   
28   C CB  . CYS A 4   ? 0.4158 0.3844 0.3763 -0.0201 -0.0055 -0.0532 82  CYS A CB  
29   S SG  . CYS A 4   ? 0.4535 0.4221 0.4105 -0.0143 -0.0064 -0.0520 82  CYS A SG  
30   N N   . ASP A 5   ? 0.4787 0.4644 0.4503 -0.0275 -0.0064 -0.0560 83  ASP A N   
31   C CA  . ASP A 5   ? 0.5322 0.5197 0.5076 -0.0317 -0.0053 -0.0566 83  ASP A CA  
32   C C   . ASP A 5   ? 0.5550 0.5487 0.5334 -0.0301 -0.0055 -0.0533 83  ASP A C   
33   O O   . ASP A 5   ? 0.6641 0.6664 0.6463 -0.0303 -0.0067 -0.0545 83  ASP A O   
34   C CB  . ASP A 5   ? 0.6370 0.6300 0.6155 -0.0349 -0.0064 -0.0616 83  ASP A CB  
35   C CG  . ASP A 5   ? 0.7924 0.7873 0.7751 -0.0399 -0.0051 -0.0629 83  ASP A CG  
36   O OD1 . ASP A 5   ? 0.8659 0.8552 0.8480 -0.0419 -0.0028 -0.0606 83  ASP A OD1 
37   O OD2 . ASP A 5   ? 1.0353 1.0379 1.0219 -0.0418 -0.0063 -0.0664 83  ASP A OD2 
38   N N   . VAL A 6   ? 0.5031 0.4922 0.4795 -0.0284 -0.0042 -0.0492 84  VAL A N   
39   C CA  . VAL A 6   ? 0.4197 0.4134 0.3983 -0.0266 -0.0042 -0.0459 84  VAL A CA  
40   C C   . VAL A 6   ? 0.3841 0.3738 0.3635 -0.0299 -0.0020 -0.0443 84  VAL A C   
41   O O   . VAL A 6   ? 0.3666 0.3475 0.3426 -0.0308 -0.0005 -0.0431 84  VAL A O   
42   C CB  . VAL A 6   ? 0.3870 0.3792 0.3627 -0.0219 -0.0046 -0.0424 84  VAL A CB  
43   C CG1 . VAL A 6   ? 0.3483 0.3441 0.3260 -0.0204 -0.0043 -0.0388 84  VAL A CG1 
44   C CG2 . VAL A 6   ? 0.3941 0.3902 0.3686 -0.0187 -0.0066 -0.0438 84  VAL A CG2 
45   N N   . PRO A 7   ? 0.4155 0.4113 0.3991 -0.0314 -0.0017 -0.0442 85  PRO A N   
46   C CA  . PRO A 7   ? 0.4045 0.3964 0.3884 -0.0345 0.0005  -0.0427 85  PRO A CA  
47   C C   . PRO A 7   ? 0.4299 0.4152 0.4101 -0.0323 0.0015  -0.0384 85  PRO A C   
48   O O   . PRO A 7   ? 0.4454 0.4332 0.4252 -0.0282 0.0004  -0.0359 85  PRO A O   
49   C CB  . PRO A 7   ? 0.3992 0.4000 0.3884 -0.0353 0.0003  -0.0429 85  PRO A CB  
50   C CG  . PRO A 7   ? 0.4519 0.4606 0.4438 -0.0341 -0.0020 -0.0459 85  PRO A CG  
51   C CD  . PRO A 7   ? 0.4531 0.4592 0.4411 -0.0305 -0.0034 -0.0455 85  PRO A CD  
52   N N   . PRO A 8   ? 0.4282 0.4051 0.4055 -0.0348 0.0034  -0.0375 86  PRO A N   
53   C CA  . PRO A 8   ? 0.3887 0.3588 0.3621 -0.0328 0.0042  -0.0337 86  PRO A CA  
54   C C   . PRO A 8   ? 0.3526 0.3271 0.3273 -0.0299 0.0038  -0.0305 86  PRO A C   
55   O O   . PRO A 8   ? 0.3486 0.3213 0.3211 -0.0261 0.0031  -0.0281 86  PRO A O   
56   C CB  . PRO A 8   ? 0.4305 0.3936 0.4021 -0.0370 0.0065  -0.0336 86  PRO A CB  
57   C CG  . PRO A 8   ? 0.4354 0.3980 0.4080 -0.0407 0.0068  -0.0376 86  PRO A CG  
58   C CD  . PRO A 8   ? 0.4651 0.4382 0.4426 -0.0400 0.0050  -0.0402 86  PRO A CD  
59   N N   . ASN A 9   ? 0.3529 0.3332 0.3315 -0.0316 0.0044  -0.0306 87  ASN A N   
60   C CA  . ASN A 9   ? 0.3597 0.3440 0.3397 -0.0291 0.0042  -0.0277 87  ASN A CA  
61   C C   . ASN A 9   ? 0.2965 0.2868 0.2779 -0.0249 0.0021  -0.0272 87  ASN A C   
62   O O   . ASN A 9   ? 0.3105 0.3025 0.2921 -0.0224 0.0019  -0.0245 87  ASN A O   
63   C CB  . ASN A 9   ? 0.3454 0.3345 0.3293 -0.0319 0.0053  -0.0283 87  ASN A CB  
64   C CG  . ASN A 9   ? 0.3862 0.3694 0.3683 -0.0358 0.0077  -0.0278 87  ASN A CG  
65   O OD1 . ASN A 9   ? 0.3685 0.3435 0.3460 -0.0357 0.0085  -0.0260 87  ASN A OD1 
66   N ND2 . ASN A 9   ? 0.3924 0.3797 0.3781 -0.0391 0.0089  -0.0294 87  ASN A ND2 
67   N N   . SER A 10  ? 0.3086 0.3021 0.2908 -0.0244 0.0007  -0.0298 88  SER A N   
68   C CA  . SER A 10  ? 0.3692 0.3684 0.3522 -0.0206 -0.0012 -0.0296 88  SER A CA  
69   C C   . SER A 10  ? 0.3487 0.3440 0.3279 -0.0177 -0.0020 -0.0291 88  SER A C   
70   O O   . SER A 10  ? 0.3464 0.3459 0.3256 -0.0150 -0.0035 -0.0295 88  SER A O   
71   C CB  . SER A 10  ? 0.3502 0.3565 0.3367 -0.0216 -0.0025 -0.0330 88  SER A CB  
72   O OG  . SER A 10  ? 0.4952 0.5058 0.4857 -0.0241 -0.0018 -0.0336 88  SER A OG  
73   N N   . ARG A 11  ? 0.3571 0.3445 0.3329 -0.0182 -0.0009 -0.0284 89  ARG A N   
74   C CA  . ARG A 11  ? 0.2945 0.2780 0.2667 -0.0153 -0.0015 -0.0279 89  ARG A CA  
75   C C   . ARG A 11  ? 0.2869 0.2707 0.2583 -0.0119 -0.0016 -0.0244 89  ARG A C   
76   O O   . ARG A 11  ? 0.2886 0.2701 0.2599 -0.0125 -0.0005 -0.0221 89  ARG A O   
77   C CB  . ARG A 11  ? 0.2903 0.2651 0.2593 -0.0171 -0.0005 -0.0288 89  ARG A CB  
78   C CG  . ARG A 11  ? 0.3316 0.3062 0.3013 -0.0205 -0.0005 -0.0327 89  ARG A CG  
79   C CD  . ARG A 11  ? 0.3508 0.3159 0.3173 -0.0230 0.0008  -0.0334 89  ARG A CD  
80   N NE  . ARG A 11  ? 0.4096 0.3751 0.3775 -0.0269 0.0010  -0.0372 89  ARG A NE  
81   C CZ  . ARG A 11  ? 0.4325 0.3903 0.3980 -0.0301 0.0023  -0.0387 89  ARG A CZ  
82   N NH1 . ARG A 11  ? 0.4098 0.3585 0.3712 -0.0295 0.0033  -0.0366 89  ARG A NH1 
83   N NH2 . ARG A 11  ? 0.3827 0.3422 0.3502 -0.0338 0.0024  -0.0424 89  ARG A NH2 
84   N N   . PHE A 12  ? 0.2507 0.2378 0.2217 -0.0086 -0.0027 -0.0241 90  PHE A N   
85   C CA  . PHE A 12  ? 0.2449 0.2325 0.2152 -0.0054 -0.0027 -0.0210 90  PHE A CA  
86   C C   . PHE A 12  ? 0.2439 0.2263 0.2107 -0.0032 -0.0027 -0.0208 90  PHE A C   
87   O O   . PHE A 12  ? 0.2573 0.2389 0.2227 -0.0027 -0.0032 -0.0232 90  PHE A O   
88   C CB  . PHE A 12  ? 0.2234 0.2182 0.1955 -0.0032 -0.0037 -0.0204 90  PHE A CB  
89   C CG  . PHE A 12  ? 0.2200 0.2198 0.1956 -0.0046 -0.0038 -0.0201 90  PHE A CG  
90   C CD1 . PHE A 12  ? 0.2525 0.2558 0.2301 -0.0067 -0.0044 -0.0229 90  PHE A CD1 
91   C CD2 . PHE A 12  ? 0.2409 0.2422 0.2179 -0.0038 -0.0033 -0.0174 90  PHE A CD2 
92   C CE1 . PHE A 12  ? 0.2460 0.2542 0.2271 -0.0078 -0.0045 -0.0228 90  PHE A CE1 
93   C CE2 . PHE A 12  ? 0.2476 0.2534 0.2277 -0.0048 -0.0034 -0.0172 90  PHE A CE2 
94   C CZ  . PHE A 12  ? 0.2439 0.2533 0.2262 -0.0067 -0.0040 -0.0199 90  PHE A CZ  
95   N N   . ASP A 13  ? 0.2848 0.2643 0.2506 -0.0017 -0.0021 -0.0182 91  ASP A N   
96   C CA  . ASP A 13  ? 0.2592 0.2331 0.2220 0.0002  -0.0019 -0.0179 91  ASP A CA  
97   C C   . ASP A 13  ? 0.2702 0.2469 0.2322 0.0035  -0.0026 -0.0184 91  ASP A C   
98   O O   . ASP A 13  ? 0.2294 0.2110 0.1927 0.0054  -0.0028 -0.0168 91  ASP A O   
99   C CB  . ASP A 13  ? 0.2630 0.2341 0.2252 0.0010  -0.0014 -0.0149 91  ASP A CB  
100  C CG  . ASP A 13  ? 0.2895 0.2541 0.2486 0.0029  -0.0013 -0.0146 91  ASP A CG  
101  O OD1 . ASP A 13  ? 0.2607 0.2218 0.2178 0.0031  -0.0014 -0.0167 91  ASP A OD1 
102  O OD2 . ASP A 13  ? 0.3733 0.3361 0.3319 0.0041  -0.0011 -0.0122 91  ASP A OD2 
103  N N   . CYS A 14  ? 0.2745 0.2479 0.2343 0.0039  -0.0028 -0.0208 92  CYS A N   
104  C CA  . CYS A 14  ? 0.3052 0.2804 0.2637 0.0070  -0.0032 -0.0216 92  CYS A CA  
105  C C   . CYS A 14  ? 0.3510 0.3217 0.3076 0.0096  -0.0029 -0.0205 92  CYS A C   
106  O O   . CYS A 14  ? 0.3032 0.2753 0.2588 0.0124  -0.0030 -0.0212 92  CYS A O   
107  C CB  . CYS A 14  ? 0.3032 0.2779 0.2605 0.0060  -0.0038 -0.0252 92  CYS A CB  
108  S SG  . CYS A 14  ? 0.2971 0.2734 0.2521 0.0096  -0.0042 -0.0269 92  CYS A SG  
109  N N   . ALA A 15  ? 0.3346 0.3002 0.2907 0.0089  -0.0024 -0.0189 93  ALA A N   
110  C CA  . ALA A 15  ? 0.3136 0.2760 0.2683 0.0118  -0.0023 -0.0173 93  ALA A CA  
111  C C   . ALA A 15  ? 0.3004 0.2635 0.2565 0.0117  -0.0020 -0.0142 93  ALA A C   
112  O O   . ALA A 15  ? 0.3138 0.2713 0.2683 0.0116  -0.0019 -0.0131 93  ALA A O   
113  C CB  . ALA A 15  ? 0.3546 0.3088 0.3062 0.0120  -0.0022 -0.0188 93  ALA A CB  
114  N N   . PRO A 16  ? 0.2916 0.2613 0.2503 0.0119  -0.0020 -0.0127 94  PRO A N   
115  C CA  . PRO A 16  ? 0.3029 0.2736 0.2630 0.0118  -0.0018 -0.0100 94  PRO A CA  
116  C C   . PRO A 16  ? 0.3240 0.2948 0.2839 0.0151  -0.0019 -0.0086 94  PRO A C   
117  O O   . PRO A 16  ? 0.2901 0.2605 0.2506 0.0153  -0.0019 -0.0065 94  PRO A O   
118  C CB  . PRO A 16  ? 0.3017 0.2794 0.2646 0.0111  -0.0018 -0.0093 94  PRO A CB  
119  C CG  . PRO A 16  ? 0.3231 0.3043 0.2857 0.0127  -0.0021 -0.0110 94  PRO A CG  
120  C CD  . PRO A 16  ? 0.3204 0.2967 0.2806 0.0122  -0.0022 -0.0135 94  PRO A CD  
121  N N   . ASP A 17  ? 0.3136 0.2849 0.2727 0.0176  -0.0021 -0.0099 95  ASP A N   
122  C CA  . ASP A 17  ? 0.3634 0.3359 0.3229 0.0208  -0.0021 -0.0090 95  ASP A CA  
123  C C   . ASP A 17  ? 0.4085 0.3745 0.3658 0.0225  -0.0025 -0.0093 95  ASP A C   
124  O O   . ASP A 17  ? 0.4295 0.3962 0.3874 0.0250  -0.0027 -0.0081 95  ASP A O   
125  C CB  . ASP A 17  ? 0.3565 0.3334 0.3164 0.0229  -0.0018 -0.0104 95  ASP A CB  
126  C CG  . ASP A 17  ? 0.4201 0.3941 0.3777 0.0228  -0.0020 -0.0133 95  ASP A CG  
127  O OD1 . ASP A 17  ? 0.4143 0.3861 0.3711 0.0201  -0.0022 -0.0143 95  ASP A OD1 
128  O OD2 . ASP A 17  ? 0.4295 0.4036 0.3862 0.0253  -0.0019 -0.0147 95  ASP A OD2 
129  N N   . LYS A 18  ? 0.4303 0.3899 0.3849 0.0214  -0.0026 -0.0108 96  LYS A N   
130  C CA  . LYS A 18  ? 0.4670 0.4196 0.4189 0.0233  -0.0030 -0.0111 96  LYS A CA  
131  C C   . LYS A 18  ? 0.4796 0.4247 0.4286 0.0209  -0.0029 -0.0125 96  LYS A C   
132  O O   . LYS A 18  ? 0.4180 0.3640 0.3672 0.0180  -0.0025 -0.0139 96  LYS A O   
133  C CB  . LYS A 18  ? 0.4671 0.4209 0.4188 0.0269  -0.0031 -0.0127 96  LYS A CB  
134  C CG  . LYS A 18  ? 0.5032 0.4577 0.4541 0.0265  -0.0028 -0.0156 96  LYS A CG  
135  C CD  . LYS A 18  ? 0.5738 0.5302 0.5247 0.0302  -0.0027 -0.0172 96  LYS A CD  
136  C CE  . LYS A 18  ? 0.6991 0.6513 0.6475 0.0300  -0.0026 -0.0204 96  LYS A CE  
137  N NZ  . LYS A 18  ? 0.9298 0.8854 0.8783 0.0332  -0.0023 -0.0223 96  LYS A NZ  
138  N N   . ALA A 19  ? 0.4802 0.4179 0.4263 0.0222  -0.0032 -0.0122 97  ALA A N   
139  C CA  . ALA A 19  ? 0.4752 0.4046 0.4180 0.0204  -0.0030 -0.0136 97  ALA A CA  
140  C C   . ALA A 19  ? 0.4378 0.3674 0.3802 0.0212  -0.0029 -0.0169 97  ALA A C   
141  O O   . ALA A 19  ? 0.3910 0.3234 0.3340 0.0247  -0.0032 -0.0177 97  ALA A O   
142  C CB  . ALA A 19  ? 0.5619 0.4830 0.5013 0.0224  -0.0035 -0.0124 97  ALA A CB  
143  N N   . ILE A 20  ? 0.4064 0.3335 0.3478 0.0180  -0.0025 -0.0188 98  ILE A N   
144  C CA  . ILE A 20  ? 0.4274 0.3552 0.3684 0.0182  -0.0024 -0.0222 98  ILE A CA  
145  C C   . ILE A 20  ? 0.4199 0.3384 0.3576 0.0163  -0.0021 -0.0242 98  ILE A C   
146  O O   . ILE A 20  ? 0.4653 0.3787 0.4017 0.0133  -0.0017 -0.0232 98  ILE A O   
147  C CB  . ILE A 20  ? 0.4453 0.3814 0.3892 0.0158  -0.0023 -0.0230 98  ILE A CB  
148  C CG1 . ILE A 20  ? 0.4550 0.3947 0.3989 0.0175  -0.0025 -0.0259 98  ILE A CG1 
149  C CG2 . ILE A 20  ? 0.4474 0.3815 0.3913 0.0111  -0.0019 -0.0237 98  ILE A CG2 
150  C CD1 . ILE A 20  ? 0.4832 0.4320 0.4298 0.0168  -0.0027 -0.0260 98  ILE A CD1 
151  N N   . THR A 21  ? 0.4369 0.3530 0.3731 0.0181  -0.0023 -0.0270 99  THR A N   
152  C CA  . THR A 21  ? 0.4356 0.3437 0.3689 0.0160  -0.0019 -0.0297 99  THR A CA  
153  C C   . THR A 21  ? 0.4453 0.3579 0.3801 0.0125  -0.0018 -0.0325 99  THR A C   
154  O O   . THR A 21  ? 0.4121 0.3338 0.3498 0.0127  -0.0021 -0.0325 99  THR A O   
155  C CB  . THR A 21  ? 0.4806 0.3835 0.4115 0.0197  -0.0022 -0.0317 99  THR A CB  
156  O OG1 . THR A 21  ? 0.4710 0.3809 0.4033 0.0217  -0.0024 -0.0340 99  THR A OG1 
157  C CG2 . THR A 21  ? 0.4678 0.3672 0.3975 0.0237  -0.0026 -0.0292 99  THR A CG2 
158  N N   . GLN A 22  ? 0.4168 0.3230 0.3497 0.0094  -0.0014 -0.0348 100 GLN A N   
159  C CA  . GLN A 22  ? 0.4595 0.3696 0.3937 0.0061  -0.0014 -0.0380 100 GLN A CA  
160  C C   . GLN A 22  ? 0.4710 0.3869 0.4058 0.0088  -0.0020 -0.0406 100 GLN A C   
161  O O   . GLN A 22  ? 0.4873 0.4111 0.4243 0.0076  -0.0025 -0.0418 100 GLN A O   
162  C CB  . GLN A 22  ? 0.4598 0.3613 0.3917 0.0024  -0.0007 -0.0404 100 GLN A CB  
163  C CG  . GLN A 22  ? 0.4938 0.3992 0.4271 -0.0007 -0.0009 -0.0444 100 GLN A CG  
164  C CD  . GLN A 22  ? 0.4776 0.3759 0.4096 -0.0056 0.0000  -0.0463 100 GLN A CD  
165  O OE1 . GLN A 22  ? 0.5710 0.4600 0.5003 -0.0064 0.0007  -0.0448 100 GLN A OE1 
166  N NE2 . GLN A 22  ? 0.4842 0.3868 0.4180 -0.0089 -0.0003 -0.0496 100 GLN A NE2 
167  N N   . GLU A 23  ? 0.4732 0.3851 0.4057 0.0125  -0.0021 -0.0416 101 GLU A N   
168  C CA  . GLU A 23  ? 0.4567 0.3732 0.3891 0.0151  -0.0025 -0.0443 101 GLU A CA  
169  C C   . GLU A 23  ? 0.4412 0.3681 0.3764 0.0172  -0.0028 -0.0423 101 GLU A C   
170  O O   . GLU A 23  ? 0.4511 0.3847 0.3872 0.0169  -0.0032 -0.0440 101 GLU A O   
171  C CB  . GLU A 23  ? 0.5809 0.4908 0.5105 0.0189  -0.0024 -0.0457 101 GLU A CB  
172  C CG  . GLU A 23  ? 0.7178 0.6315 0.6468 0.0210  -0.0026 -0.0493 101 GLU A CG  
173  C CD  . GLU A 23  ? 1.0980 1.0041 1.0240 0.0241  -0.0024 -0.0516 101 GLU A CD  
174  O OE1 . GLU A 23  ? 1.1108 1.0077 1.0349 0.0246  -0.0022 -0.0506 101 GLU A OE1 
175  O OE2 . GLU A 23  ? 0.9794 0.8887 0.9048 0.0262  -0.0025 -0.0546 101 GLU A OE2 
176  N N   . GLN A 24  ? 0.4010 0.3288 0.3372 0.0193  -0.0027 -0.0387 102 GLN A N   
177  C CA  . GLN A 24  ? 0.4768 0.4138 0.4157 0.0210  -0.0028 -0.0365 102 GLN A CA  
178  C C   . GLN A 24  ? 0.4301 0.3735 0.3714 0.0178  -0.0030 -0.0356 102 GLN A C   
179  O O   . GLN A 24  ? 0.4111 0.3624 0.3539 0.0186  -0.0032 -0.0355 102 GLN A O   
180  C CB  . GLN A 24  ? 0.5047 0.4408 0.4444 0.0233  -0.0027 -0.0329 102 GLN A CB  
181  C CG  . GLN A 24  ? 0.5167 0.4482 0.4547 0.0274  -0.0026 -0.0333 102 GLN A CG  
182  C CD  . GLN A 24  ? 0.5338 0.4631 0.4723 0.0290  -0.0028 -0.0298 102 GLN A CD  
183  O OE1 . GLN A 24  ? 0.4369 0.3645 0.3758 0.0264  -0.0028 -0.0276 102 GLN A OE1 
184  N NE2 . GLN A 24  ? 0.5905 0.5202 0.5292 0.0332  -0.0029 -0.0295 102 GLN A NE2 
185  N N   . CYS A 25  ? 0.4160 0.3560 0.3577 0.0142  -0.0029 -0.0349 103 CYS A N   
186  C CA  . CYS A 25  ? 0.4319 0.3774 0.3760 0.0109  -0.0031 -0.0346 103 CYS A CA  
187  C C   . CYS A 25  ? 0.4105 0.3604 0.3547 0.0101  -0.0037 -0.0380 103 CYS A C   
188  O O   . CYS A 25  ? 0.3480 0.3057 0.2938 0.0105  -0.0042 -0.0376 103 CYS A O   
189  C CB  . CYS A 25  ? 0.4519 0.3920 0.3959 0.0071  -0.0027 -0.0341 103 CYS A CB  
190  S SG  . CYS A 25  ? 0.3969 0.3439 0.3443 0.0032  -0.0028 -0.0338 103 CYS A SG  
191  N N   . GLU A 26  ? 0.3818 0.3264 0.3238 0.0090  -0.0037 -0.0413 104 GLU A N   
192  C CA  . GLU A 26  ? 0.4107 0.3590 0.3524 0.0081  -0.0044 -0.0450 104 GLU A CA  
193  C C   . GLU A 26  ? 0.4057 0.3597 0.3466 0.0118  -0.0048 -0.0455 104 GLU A C   
194  O O   . GLU A 26  ? 0.3966 0.3570 0.3382 0.0114  -0.0055 -0.0470 104 GLU A O   
195  C CB  . GLU A 26  ? 0.4421 0.3827 0.3815 0.0061  -0.0043 -0.0486 104 GLU A CB  
196  C CG  . GLU A 26  ? 0.4402 0.3767 0.3805 0.0015  -0.0038 -0.0484 104 GLU A CG  
197  C CD  . GLU A 26  ? 0.4480 0.3758 0.3860 -0.0008 -0.0034 -0.0516 104 GLU A CD  
198  O OE1 . GLU A 26  ? 0.4157 0.3406 0.3545 -0.0050 -0.0028 -0.0519 104 GLU A OE1 
199  O OE2 . GLU A 26  ? 0.5165 0.4403 0.4519 0.0012  -0.0034 -0.0539 104 GLU A OE2 
200  N N   . ALA A 27  ? 0.3662 0.3182 0.3060 0.0155  -0.0042 -0.0443 105 ALA A N   
201  C CA  . ALA A 27  ? 0.3876 0.3452 0.3267 0.0190  -0.0042 -0.0447 105 ALA A CA  
202  C C   . ALA A 27  ? 0.3918 0.3578 0.3333 0.0196  -0.0043 -0.0416 105 ALA A C   
203  O O   . ALA A 27  ? 0.4364 0.4083 0.3774 0.0212  -0.0045 -0.0422 105 ALA A O   
204  C CB  . ALA A 27  ? 0.3977 0.3512 0.3354 0.0227  -0.0035 -0.0444 105 ALA A CB  
205  N N   . ARG A 28  ? 0.3850 0.3513 0.3288 0.0181  -0.0042 -0.0384 106 ARG A N   
206  C CA  . ARG A 28  ? 0.3535 0.3272 0.2996 0.0180  -0.0044 -0.0358 106 ARG A CA  
207  C C   . ARG A 28  ? 0.3620 0.3404 0.3088 0.0156  -0.0053 -0.0373 106 ARG A C   
208  O O   . ARG A 28  ? 0.4263 0.4108 0.3746 0.0157  -0.0056 -0.0354 106 ARG A O   
209  C CB  . ARG A 28  ? 0.3602 0.3326 0.3085 0.0170  -0.0040 -0.0323 106 ARG A CB  
210  C CG  . ARG A 28  ? 0.3579 0.3281 0.3061 0.0198  -0.0033 -0.0302 106 ARG A CG  
211  C CD  . ARG A 28  ? 0.3550 0.3243 0.3051 0.0187  -0.0031 -0.0270 106 ARG A CD  
212  N NE  . ARG A 28  ? 0.3248 0.2938 0.2753 0.0217  -0.0026 -0.0249 106 ARG A NE  
213  C CZ  . ARG A 28  ? 0.3116 0.2808 0.2636 0.0217  -0.0024 -0.0220 106 ARG A CZ  
214  N NH1 . ARG A 28  ? 0.3122 0.2821 0.2658 0.0189  -0.0026 -0.0205 106 ARG A NH1 
215  N NH2 . ARG A 28  ? 0.3865 0.3559 0.3390 0.0246  -0.0021 -0.0206 106 ARG A NH2 
216  N N   . GLY A 29  ? 0.3267 0.3024 0.2725 0.0134  -0.0059 -0.0407 107 GLY A N   
217  C CA  . GLY A 29  ? 0.3707 0.3507 0.3176 0.0108  -0.0070 -0.0425 107 GLY A CA  
218  C C   . GLY A 29  ? 0.4309 0.4103 0.3807 0.0075  -0.0070 -0.0410 107 GLY A C   
219  O O   . GLY A 29  ? 0.3955 0.3805 0.3474 0.0059  -0.0078 -0.0411 107 GLY A O   
220  N N   . CYS A 30  ? 0.3482 0.3211 0.2980 0.0066  -0.0060 -0.0397 108 CYS A N   
221  C CA  . CYS A 30  ? 0.3473 0.3188 0.2994 0.0035  -0.0057 -0.0383 108 CYS A CA  
222  C C   . CYS A 30  ? 0.3886 0.3532 0.3398 0.0001  -0.0053 -0.0408 108 CYS A C   
223  O O   . CYS A 30  ? 0.3502 0.3098 0.2988 0.0005  -0.0052 -0.0433 108 CYS A O   
224  C CB  . CYS A 30  ? 0.3551 0.3250 0.3078 0.0049  -0.0048 -0.0343 108 CYS A CB  
225  S SG  . CYS A 30  ? 0.3245 0.3033 0.2792 0.0073  -0.0052 -0.0314 108 CYS A SG  
226  N N   . CYS A 31  ? 0.3526 0.3172 0.3060 -0.0032 -0.0049 -0.0402 109 CYS A N   
227  C CA  . CYS A 31  ? 0.3652 0.3239 0.3183 -0.0072 -0.0042 -0.0422 109 CYS A CA  
228  C C   . CYS A 31  ? 0.3720 0.3226 0.3234 -0.0075 -0.0029 -0.0398 109 CYS A C   
229  O O   . CYS A 31  ? 0.3750 0.3267 0.3274 -0.0066 -0.0026 -0.0363 109 CYS A O   
230  C CB  . CYS A 31  ? 0.3383 0.3023 0.2949 -0.0107 -0.0044 -0.0428 109 CYS A CB  
231  S SG  . CYS A 31  ? 0.3985 0.3722 0.3572 -0.0106 -0.0063 -0.0460 109 CYS A SG  
232  N N   . TYR A 32  ? 0.3516 0.2936 0.3003 -0.0089 -0.0023 -0.0415 110 TYR A N   
233  C CA  . TYR A 32  ? 0.4093 0.3426 0.3557 -0.0091 -0.0011 -0.0392 110 TYR A CA  
234  C C   . TYR A 32  ? 0.4010 0.3291 0.3472 -0.0142 0.0000  -0.0403 110 TYR A C   
235  O O   . TYR A 32  ? 0.3691 0.2929 0.3139 -0.0162 0.0001  -0.0436 110 TYR A O   
236  C CB  . TYR A 32  ? 0.4192 0.3455 0.3618 -0.0059 -0.0011 -0.0396 110 TYR A CB  
237  C CG  . TYR A 32  ? 0.4341 0.3512 0.3740 -0.0056 -0.0002 -0.0371 110 TYR A CG  
238  C CD1 . TYR A 32  ? 0.4291 0.3369 0.3664 -0.0087 0.0006  -0.0383 110 TYR A CD1 
239  C CD2 . TYR A 32  ? 0.4659 0.3835 0.4056 -0.0024 -0.0003 -0.0334 110 TYR A CD2 
240  C CE1 . TYR A 32  ? 0.4625 0.3613 0.3966 -0.0082 0.0014  -0.0358 110 TYR A CE1 
241  C CE2 . TYR A 32  ? 0.4262 0.3355 0.3631 -0.0019 0.0002  -0.0310 110 TYR A CE2 
242  C CZ  . TYR A 32  ? 0.4575 0.3572 0.3913 -0.0047 0.0011  -0.0322 110 TYR A CZ  
243  O OH  . TYR A 32  ? 0.5439 0.4349 0.4744 -0.0042 0.0016  -0.0298 110 TYR A OH  
244  N N   . ILE A 33  ? 0.3528 0.2815 0.3004 -0.0163 0.0007  -0.0378 111 ILE A N   
245  C CA  . ILE A 33  ? 0.3458 0.2697 0.2932 -0.0212 0.0022  -0.0385 111 ILE A CA  
246  C C   . ILE A 33  ? 0.3404 0.2599 0.2863 -0.0211 0.0032  -0.0345 111 ILE A C   
247  O O   . ILE A 33  ? 0.3403 0.2657 0.2886 -0.0206 0.0032  -0.0322 111 ILE A O   
248  C CB  . ILE A 33  ? 0.3695 0.3015 0.3214 -0.0249 0.0021  -0.0405 111 ILE A CB  
249  C CG1 . ILE A 33  ? 0.4016 0.3391 0.3550 -0.0246 0.0007  -0.0444 111 ILE A CG1 
250  C CG2 . ILE A 33  ? 0.4587 0.3854 0.4103 -0.0303 0.0039  -0.0416 111 ILE A CG2 
251  C CD1 . ILE A 33  ? 0.4149 0.3608 0.3728 -0.0279 0.0004  -0.0467 111 ILE A CD1 
252  N N   . PRO A 34  ? 0.3681 0.2770 0.3098 -0.0216 0.0042  -0.0337 112 PRO A N   
253  C CA  . PRO A 34  ? 0.3483 0.2531 0.2881 -0.0216 0.0051  -0.0298 112 PRO A CA  
254  C C   . PRO A 34  ? 0.3488 0.2564 0.2910 -0.0262 0.0065  -0.0293 112 PRO A C   
255  O O   . PRO A 34  ? 0.3707 0.2787 0.3143 -0.0304 0.0073  -0.0320 112 PRO A O   
256  C CB  . PRO A 34  ? 0.4008 0.2932 0.3353 -0.0214 0.0058  -0.0295 112 PRO A CB  
257  C CG  . PRO A 34  ? 0.4064 0.2975 0.3401 -0.0191 0.0048  -0.0324 112 PRO A CG  
258  C CD  . PRO A 34  ? 0.4031 0.3031 0.3411 -0.0215 0.0044  -0.0358 112 PRO A CD  
259  N N   . ALA A 35  ? 0.3783 0.2886 0.3212 -0.0253 0.0067  -0.0260 113 ALA A N   
260  C CA  . ALA A 35  ? 0.4198 0.3312 0.3639 -0.0294 0.0082  -0.0251 113 ALA A CA  
261  C C   . ALA A 35  ? 0.4676 0.3679 0.4072 -0.0327 0.0100  -0.0251 113 ALA A C   
262  O O   . ALA A 35  ? 0.4461 0.3377 0.3813 -0.0308 0.0098  -0.0246 113 ALA A O   
263  C CB  . ALA A 35  ? 0.4034 0.3177 0.3478 -0.0273 0.0081  -0.0214 113 ALA A CB  
264  N N   . LYS A 36  ? 0.4147 0.3151 0.3554 -0.0377 0.0118  -0.0257 114 LYS A N   
265  C CA  . LYS A 36  ? 0.4855 0.3753 0.4219 -0.0415 0.0138  -0.0259 114 LYS A CA  
266  C C   . LYS A 36  ? 0.4787 0.3613 0.4104 -0.0412 0.0150  -0.0218 114 LYS A C   
267  O O   . LYS A 36  ? 0.4395 0.3122 0.3667 -0.0441 0.0167  -0.0212 114 LYS A O   
268  C CB  . LYS A 36  ? 0.5694 0.4625 0.5092 -0.0474 0.0154  -0.0291 114 LYS A CB  
269  C CG  . LYS A 36  ? 0.5798 0.4768 0.5225 -0.0476 0.0142  -0.0334 114 LYS A CG  
270  C CD  . LYS A 36  ? 0.6550 0.5567 0.6019 -0.0532 0.0154  -0.0369 114 LYS A CD  
271  C CE  . LYS A 36  ? 0.6189 0.5245 0.5682 -0.0529 0.0139  -0.0412 114 LYS A CE  
272  N NZ  . LYS A 36  ? 0.7417 0.6531 0.6957 -0.0582 0.0147  -0.0450 114 LYS A NZ  
273  N N   . GLN A 37  ? 0.4476 0.3350 0.3802 -0.0379 0.0140  -0.0189 115 GLN A N   
274  C CA  . GLN A 37  ? 0.5381 0.4196 0.4662 -0.0367 0.0145  -0.0150 115 GLN A CA  
275  C C   . GLN A 37  ? 0.5676 0.4549 0.4971 -0.0315 0.0125  -0.0128 115 GLN A C   
276  O O   . GLN A 37  ? 0.4960 0.3806 0.4226 -0.0300 0.0125  -0.0096 115 GLN A O   
277  C CB  . GLN A 37  ? 0.5682 0.4501 0.4964 -0.0415 0.0169  -0.0141 115 GLN A CB  
278  C CG  . GLN A 37  ? 0.6840 0.5781 0.6185 -0.0424 0.0168  -0.0149 115 GLN A CG  
279  C CD  . GLN A 37  ? 1.0153 0.9153 0.9547 -0.0463 0.0175  -0.0189 115 GLN A CD  
280  O OE1 . GLN A 37  ? 1.5416 1.4378 1.4802 -0.0512 0.0197  -0.0202 115 GLN A OE1 
281  N NE2 . GLN A 37  ? 1.0037 0.9132 0.9483 -0.0441 0.0157  -0.0208 115 GLN A NE2 
282  N N   . MET A 44  ? 0.7026 0.6418 0.6512 -0.0046 0.0024  -0.0004 122 MET A N   
283  C CA  . MET A 44  ? 0.6551 0.5950 0.6049 -0.0055 0.0025  -0.0030 122 MET A CA  
284  C C   . MET A 44  ? 0.5375 0.4765 0.4877 -0.0099 0.0039  -0.0045 122 MET A C   
285  O O   . MET A 44  ? 0.6322 0.5715 0.5825 -0.0124 0.0050  -0.0036 122 MET A O   
286  C CB  . MET A 44  ? 0.7439 0.6920 0.6979 -0.0036 0.0017  -0.0039 122 MET A CB  
287  C CG  . MET A 44  ? 0.6856 0.6407 0.6430 -0.0035 0.0017  -0.0028 122 MET A CG  
288  S SD  . MET A 44  ? 0.5397 0.5034 0.5015 -0.0026 0.0012  -0.0043 122 MET A SD  
289  C CE  . MET A 44  ? 0.4380 0.4022 0.4010 -0.0067 0.0021  -0.0066 122 MET A CE  
290  N N   . GLY A 45  ? 0.4656 0.4035 0.4160 -0.0110 0.0040  -0.0069 123 GLY A N   
291  C CA  . GLY A 45  ? 0.4200 0.3583 0.3716 -0.0152 0.0052  -0.0090 123 GLY A CA  
292  C C   . GLY A 45  ? 0.3727 0.3167 0.3276 -0.0150 0.0044  -0.0117 123 GLY A C   
293  O O   . GLY A 45  ? 0.3562 0.3048 0.3127 -0.0118 0.0032  -0.0117 123 GLY A O   
294  N N   . GLN A 46  ? 0.3408 0.2845 0.2966 -0.0185 0.0052  -0.0142 124 GLN A N   
295  C CA  . GLN A 46  ? 0.3621 0.3101 0.3202 -0.0186 0.0045  -0.0172 124 GLN A CA  
296  C C   . GLN A 46  ? 0.3693 0.3145 0.3252 -0.0154 0.0033  -0.0178 124 GLN A C   
297  O O   . GLN A 46  ? 0.3369 0.2741 0.2890 -0.0150 0.0036  -0.0175 124 GLN A O   
298  C CB  . GLN A 46  ? 0.4015 0.3470 0.3597 -0.0232 0.0057  -0.0197 124 GLN A CB  
299  C CG  . GLN A 46  ? 0.4345 0.3835 0.3948 -0.0242 0.0049  -0.0233 124 GLN A CG  
300  C CD  . GLN A 46  ? 0.5028 0.4477 0.4627 -0.0289 0.0064  -0.0257 124 GLN A CD  
301  O OE1 . GLN A 46  ? 0.4898 0.4304 0.4479 -0.0297 0.0062  -0.0280 124 GLN A OE1 
302  N NE2 . GLN A 46  ? 0.4980 0.4439 0.4593 -0.0323 0.0078  -0.0252 124 GLN A NE2 
303  N N   . PRO A 47  ? 0.3257 0.2774 0.2839 -0.0129 0.0021  -0.0188 125 PRO A N   
304  C CA  . PRO A 47  ? 0.3263 0.2758 0.2824 -0.0096 0.0012  -0.0194 125 PRO A CA  
305  C C   . PRO A 47  ? 0.3258 0.2707 0.2802 -0.0113 0.0013  -0.0225 125 PRO A C   
306  O O   . PRO A 47  ? 0.3370 0.2851 0.2933 -0.0139 0.0013  -0.0250 125 PRO A O   
307  C CB  . PRO A 47  ? 0.3092 0.2672 0.2682 -0.0071 0.0001  -0.0195 125 PRO A CB  
308  C CG  . PRO A 47  ? 0.3255 0.2894 0.2879 -0.0098 0.0001  -0.0206 125 PRO A CG  
309  C CD  . PRO A 47  ? 0.2828 0.2436 0.2451 -0.0128 0.0014  -0.0193 125 PRO A CD  
310  N N   . TRP A 48  ? 0.3017 0.2391 0.2524 -0.0097 0.0013  -0.0223 126 TRP A N   
311  C CA  . TRP A 48  ? 0.3193 0.2515 0.2679 -0.0106 0.0014  -0.0253 126 TRP A CA  
312  C C   . TRP A 48  ? 0.3284 0.2659 0.2781 -0.0083 0.0002  -0.0276 126 TRP A C   
313  O O   . TRP A 48  ? 0.3673 0.3038 0.3167 -0.0099 0.0000  -0.0309 126 TRP A O   
314  C CB  . TRP A 48  ? 0.3437 0.2662 0.2879 -0.0088 0.0016  -0.0242 126 TRP A CB  
315  C CG  . TRP A 48  ? 0.3625 0.2777 0.3040 -0.0109 0.0028  -0.0220 126 TRP A CG  
316  C CD1 . TRP A 48  ? 0.3655 0.2825 0.3082 -0.0131 0.0036  -0.0199 126 TRP A CD1 
317  C CD2 . TRP A 48  ? 0.3580 0.2623 0.2948 -0.0107 0.0033  -0.0216 126 TRP A CD2 
318  N NE1 . TRP A 48  ? 0.3531 0.2612 0.2918 -0.0144 0.0046  -0.0182 126 TRP A NE1 
319  C CE2 . TRP A 48  ? 0.3829 0.2829 0.3179 -0.0129 0.0044  -0.0191 126 TRP A CE2 
320  C CE3 . TRP A 48  ? 0.4215 0.3191 0.3552 -0.0087 0.0029  -0.0231 126 TRP A CE3 
321  C CZ2 . TRP A 48  ? 0.4010 0.2900 0.3310 -0.0133 0.0051  -0.0178 126 TRP A CZ2 
322  C CZ3 . TRP A 48  ? 0.4679 0.3544 0.3968 -0.0089 0.0036  -0.0220 126 TRP A CZ3 
323  C CH2 . TRP A 48  ? 0.3959 0.2781 0.3229 -0.0112 0.0046  -0.0193 126 TRP A CH2 
324  N N   . CYS A 49  ? 0.3075 0.2505 0.2584 -0.0047 -0.0005 -0.0260 127 CYS A N   
325  C CA  . CYS A 49  ? 0.3270 0.2755 0.2787 -0.0022 -0.0015 -0.0277 127 CYS A CA  
326  C C   . CYS A 49  ? 0.2875 0.2452 0.2427 -0.0023 -0.0020 -0.0270 127 CYS A C   
327  O O   . CYS A 49  ? 0.3022 0.2627 0.2587 -0.0011 -0.0019 -0.0241 127 CYS A O   
328  C CB  . CYS A 49  ? 0.3413 0.2885 0.2913 0.0022  -0.0018 -0.0264 127 CYS A CB  
329  S SG  . CYS A 49  ? 0.3908 0.3441 0.3410 0.0052  -0.0027 -0.0286 127 CYS A SG  
330  N N   . PHE A 50  ? 0.3001 0.2624 0.2568 -0.0039 -0.0026 -0.0296 128 PHE A N   
331  C CA  . PHE A 50  ? 0.3209 0.2915 0.2810 -0.0043 -0.0032 -0.0291 128 PHE A CA  
332  C C   . PHE A 50  ? 0.2960 0.2726 0.2567 -0.0032 -0.0044 -0.0315 128 PHE A C   
333  O O   . PHE A 50  ? 0.2932 0.2677 0.2520 -0.0032 -0.0048 -0.0343 128 PHE A O   
334  C CB  . PHE A 50  ? 0.3128 0.2837 0.2751 -0.0084 -0.0026 -0.0295 128 PHE A CB  
335  C CG  . PHE A 50  ? 0.3486 0.3174 0.3108 -0.0117 -0.0025 -0.0331 128 PHE A CG  
336  C CD1 . PHE A 50  ? 0.3686 0.3287 0.3281 -0.0136 -0.0015 -0.0339 128 PHE A CD1 
337  C CD2 . PHE A 50  ? 0.3467 0.3220 0.3114 -0.0130 -0.0035 -0.0358 128 PHE A CD2 
338  C CE1 . PHE A 50  ? 0.3264 0.2843 0.2859 -0.0171 -0.0013 -0.0373 128 PHE A CE1 
339  C CE2 . PHE A 50  ? 0.3657 0.3395 0.3306 -0.0164 -0.0035 -0.0394 128 PHE A CE2 
340  C CZ  . PHE A 50  ? 0.3659 0.3309 0.3283 -0.0185 -0.0023 -0.0402 128 PHE A CZ  
341  N N   . PHE A 51  ? 0.2824 0.2662 0.2453 -0.0022 -0.0051 -0.0303 129 PHE A N   
342  C CA  . PHE A 51  ? 0.2735 0.2635 0.2365 -0.0007 -0.0064 -0.0319 129 PHE A CA  
343  C C   . PHE A 51  ? 0.2883 0.2809 0.2529 -0.0036 -0.0072 -0.0353 129 PHE A C   
344  O O   . PHE A 51  ? 0.2870 0.2813 0.2543 -0.0062 -0.0071 -0.0352 129 PHE A O   
345  C CB  . PHE A 51  ? 0.2728 0.2692 0.2376 0.0012  -0.0068 -0.0292 129 PHE A CB  
346  C CG  . PHE A 51  ? 0.2752 0.2702 0.2392 0.0038  -0.0060 -0.0258 129 PHE A CG  
347  C CD1 . PHE A 51  ? 0.2639 0.2574 0.2254 0.0066  -0.0058 -0.0258 129 PHE A CD1 
348  C CD2 . PHE A 51  ? 0.2900 0.2854 0.2559 0.0034  -0.0054 -0.0230 129 PHE A CD2 
349  C CE1 . PHE A 51  ? 0.2491 0.2417 0.2102 0.0088  -0.0051 -0.0229 129 PHE A CE1 
350  C CE2 . PHE A 51  ? 0.2685 0.2631 0.2340 0.0056  -0.0047 -0.0201 129 PHE A CE2 
351  C CZ  . PHE A 51  ? 0.2931 0.2864 0.2563 0.0083  -0.0046 -0.0201 129 PHE A CZ  
352  N N   . PRO A 52  ? 0.2915 0.2848 0.2544 -0.0032 -0.0082 -0.0385 130 PRO A N   
353  C CA  . PRO A 52  ? 0.3121 0.3102 0.2770 -0.0055 -0.0094 -0.0416 130 PRO A CA  
354  C C   . PRO A 52  ? 0.3220 0.3284 0.2888 -0.0037 -0.0106 -0.0403 130 PRO A C   
355  O O   . PRO A 52  ? 0.2746 0.2824 0.2403 -0.0006 -0.0105 -0.0374 130 PRO A O   
356  C CB  . PRO A 52  ? 0.3304 0.3272 0.2925 -0.0050 -0.0101 -0.0452 130 PRO A CB  
357  C CG  . PRO A 52  ? 0.3427 0.3372 0.3016 -0.0012 -0.0097 -0.0433 130 PRO A CG  
358  C CD  . PRO A 52  ? 0.3324 0.3226 0.2917 -0.0008 -0.0082 -0.0396 130 PRO A CD  
359  N N   . PRO A 53  ? 0.4107 0.4226 0.3804 -0.0056 -0.0118 -0.0424 131 PRO A N   
360  C CA  . PRO A 53  ? 0.4503 0.4698 0.4215 -0.0035 -0.0132 -0.0411 131 PRO A CA  
361  C C   . PRO A 53  ? 0.3891 0.4114 0.3571 0.0000  -0.0144 -0.0409 131 PRO A C   
362  O O   . PRO A 53  ? 0.4779 0.5045 0.4461 0.0024  -0.0150 -0.0385 131 PRO A O   
363  C CB  . PRO A 53  ? 0.4754 0.5000 0.4501 -0.0062 -0.0145 -0.0443 131 PRO A CB  
364  C CG  . PRO A 53  ? 0.5094 0.5294 0.4837 -0.0096 -0.0139 -0.0478 131 PRO A CG  
365  C CD  . PRO A 53  ? 0.4183 0.4297 0.3899 -0.0096 -0.0119 -0.0460 131 PRO A CD  
366  N N   . SER A 54  ? 0.4073 0.4267 0.3722 0.0004  -0.0145 -0.0433 132 SER A N   
367  C CA  . SER A 54  ? 0.5393 0.5606 0.5006 0.0037  -0.0152 -0.0433 132 SER A CA  
368  C C   . SER A 54  ? 0.4970 0.5146 0.4556 0.0064  -0.0137 -0.0403 132 SER A C   
369  O O   . SER A 54  ? 0.4230 0.4422 0.3785 0.0090  -0.0140 -0.0404 132 SER A O   
370  C CB  . SER A 54  ? 0.6129 0.6330 0.5719 0.0027  -0.0160 -0.0478 132 SER A CB  
371  O OG  . SER A 54  ? 0.6193 0.6318 0.5771 0.0015  -0.0145 -0.0487 132 SER A OG  
372  N N   . TYR A 55  ? 0.3239 0.3371 0.2837 0.0059  -0.0121 -0.0377 133 TYR A N   
373  C CA  . TYR A 55  ? 0.3270 0.3372 0.2846 0.0085  -0.0108 -0.0353 133 TYR A CA  
374  C C   . TYR A 55  ? 0.3648 0.3801 0.3215 0.0114  -0.0111 -0.0327 133 TYR A C   
375  O O   . TYR A 55  ? 0.3074 0.3268 0.2662 0.0112  -0.0117 -0.0312 133 TYR A O   
376  C CB  . TYR A 55  ? 0.3438 0.3493 0.3030 0.0076  -0.0093 -0.0327 133 TYR A CB  
377  C CG  . TYR A 55  ? 0.2969 0.2998 0.2544 0.0102  -0.0081 -0.0304 133 TYR A CG  
378  C CD1 . TYR A 55  ? 0.3114 0.3087 0.2669 0.0107  -0.0074 -0.0316 133 TYR A CD1 
379  C CD2 . TYR A 55  ? 0.3283 0.3343 0.2864 0.0121  -0.0077 -0.0270 133 TYR A CD2 
380  C CE1 . TYR A 55  ? 0.3697 0.3652 0.3241 0.0133  -0.0063 -0.0296 133 TYR A CE1 
381  C CE2 . TYR A 55  ? 0.3158 0.3200 0.2729 0.0144  -0.0065 -0.0251 133 TYR A CE2 
382  C CZ  . TYR A 55  ? 0.3157 0.3149 0.2710 0.0150  -0.0059 -0.0264 133 TYR A CZ  
383  O OH  . TYR A 55  ? 0.3600 0.3582 0.3147 0.0174  -0.0048 -0.0246 133 TYR A OH  
384  N N   . PRO A 56  ? 0.3603 0.3751 0.3139 0.0141  -0.0105 -0.0322 134 PRO A N   
385  C CA  . PRO A 56  ? 0.3523 0.3719 0.3047 0.0166  -0.0106 -0.0298 134 PRO A CA  
386  C C   . PRO A 56  ? 0.3101 0.3306 0.2650 0.0169  -0.0098 -0.0258 134 PRO A C   
387  O O   . PRO A 56  ? 0.3009 0.3179 0.2570 0.0166  -0.0085 -0.0241 134 PRO A O   
388  C CB  . PRO A 56  ? 0.3312 0.3494 0.2803 0.0190  -0.0095 -0.0301 134 PRO A CB  
389  C CG  . PRO A 56  ? 0.3613 0.3752 0.3093 0.0179  -0.0096 -0.0338 134 PRO A CG  
390  C CD  . PRO A 56  ? 0.3593 0.3698 0.3104 0.0150  -0.0097 -0.0341 134 PRO A CD  
391  N N   . SER A 57  ? 0.2802 0.3053 0.2356 0.0174  -0.0107 -0.0244 135 SER A N   
392  C CA  . SER A 57  ? 0.2984 0.3246 0.2558 0.0179  -0.0101 -0.0207 135 SER A CA  
393  C C   . SER A 57  ? 0.2779 0.3074 0.2326 0.0205  -0.0100 -0.0188 135 SER A C   
394  O O   . SER A 57  ? 0.3156 0.3450 0.2670 0.0220  -0.0096 -0.0195 135 SER A O   
395  C CB  . SER A 57  ? 0.2647 0.2928 0.2256 0.0160  -0.0111 -0.0208 135 SER A CB  
396  O OG  . SER A 57  ? 0.2379 0.2666 0.2008 0.0163  -0.0104 -0.0175 135 SER A OG  
397  N N   . TYR A 58  ? 0.2595 0.2915 0.2154 0.0210  -0.0103 -0.0162 136 TYR A N   
398  C CA  . TYR A 58  ? 0.2436 0.2786 0.1966 0.0232  -0.0105 -0.0143 136 TYR A CA  
399  C C   . TYR A 58  ? 0.2579 0.2968 0.2105 0.0235  -0.0129 -0.0158 136 TYR A C   
400  O O   . TYR A 58  ? 0.2688 0.3087 0.2246 0.0219  -0.0140 -0.0172 136 TYR A O   
401  C CB  . TYR A 58  ? 0.2589 0.2937 0.2133 0.0238  -0.0093 -0.0104 136 TYR A CB  
402  C CG  . TYR A 58  ? 0.2514 0.2834 0.2057 0.0240  -0.0070 -0.0088 136 TYR A CG  
403  C CD1 . TYR A 58  ? 0.2420 0.2708 0.1988 0.0225  -0.0063 -0.0095 136 TYR A CD1 
404  C CD2 . TYR A 58  ? 0.2371 0.2700 0.1888 0.0257  -0.0057 -0.0067 136 TYR A CD2 
405  C CE1 . TYR A 58  ? 0.2447 0.2716 0.2018 0.0230  -0.0045 -0.0081 136 TYR A CE1 
406  C CE2 . TYR A 58  ? 0.2375 0.2686 0.1896 0.0259  -0.0037 -0.0055 136 TYR A CE2 
407  C CZ  . TYR A 58  ? 0.2370 0.2652 0.1919 0.0247  -0.0032 -0.0063 136 TYR A CZ  
408  O OH  . TYR A 58  ? 0.2088 0.2357 0.1644 0.0251  -0.0015 -0.0053 136 TYR A OH  
409  N N   . LYS A 59  ? 0.2602 0.3017 0.2088 0.0256  -0.0135 -0.0154 137 LYS A N   
410  C CA  . LYS A 59  ? 0.2655 0.3111 0.2131 0.0265  -0.0159 -0.0162 137 LYS A CA  
411  C C   . LYS A 59  ? 0.2629 0.3098 0.2098 0.0283  -0.0159 -0.0124 137 LYS A C   
412  O O   . LYS A 59  ? 0.2547 0.3003 0.1990 0.0296  -0.0142 -0.0097 137 LYS A O   
413  C CB  . LYS A 59  ? 0.3152 0.3625 0.2579 0.0279  -0.0168 -0.0184 137 LYS A CB  
414  C CG  . LYS A 59  ? 0.3881 0.4399 0.3294 0.0290  -0.0196 -0.0196 137 LYS A CG  
415  C CD  . LYS A 59  ? 0.4539 0.5075 0.3900 0.0304  -0.0205 -0.0218 137 LYS A CD  
416  C CE  . LYS A 59  ? 0.4793 0.5376 0.4139 0.0317  -0.0235 -0.0229 137 LYS A CE  
417  N NZ  . LYS A 59  ? 0.5339 0.5941 0.4634 0.0329  -0.0246 -0.0255 137 LYS A NZ  
418  N N   . LEU A 60  ? 0.2491 0.2985 0.1982 0.0284  -0.0177 -0.0123 138 LEU A N   
419  C CA  . LEU A 60  ? 0.2862 0.3368 0.2343 0.0304  -0.0181 -0.0089 138 LEU A CA  
420  C C   . LEU A 60  ? 0.2935 0.3465 0.2360 0.0330  -0.0194 -0.0087 138 LEU A C   
421  O O   . LEU A 60  ? 0.2308 0.2868 0.1722 0.0332  -0.0215 -0.0117 138 LEU A O   
422  C CB  . LEU A 60  ? 0.3059 0.3590 0.2582 0.0301  -0.0199 -0.0094 138 LEU A CB  
423  C CG  . LEU A 60  ? 0.2967 0.3509 0.2485 0.0323  -0.0207 -0.0062 138 LEU A CG  
424  C CD1 . LEU A 60  ? 0.3244 0.3752 0.2789 0.0315  -0.0185 -0.0032 138 LEU A CD1 
425  C CD2 . LEU A 60  ? 0.3993 0.4578 0.3540 0.0327  -0.0235 -0.0082 138 LEU A CD2 
426  N N   . GLU A 61  ? 0.2794 0.3311 0.2181 0.0348  -0.0182 -0.0051 139 GLU A N   
427  C CA  . GLU A 61  ? 0.2890 0.3427 0.2218 0.0374  -0.0194 -0.0044 139 GLU A CA  
428  C C   . GLU A 61  ? 0.2558 0.3084 0.1865 0.0393  -0.0190 0.0000  139 GLU A C   
429  O O   . GLU A 61  ? 0.2129 0.2625 0.1455 0.0385  -0.0168 0.0026  139 GLU A O   
430  C CB  . GLU A 61  ? 0.3440 0.3968 0.2719 0.0377  -0.0179 -0.0050 139 GLU A CB  
431  C CG  . GLU A 61  ? 0.4525 0.5051 0.3823 0.0358  -0.0177 -0.0091 139 GLU A CG  
432  C CD  . GLU A 61  ? 0.5443 0.5969 0.4689 0.0366  -0.0168 -0.0104 139 GLU A CD  
433  O OE1 . GLU A 61  ? 0.5429 0.5928 0.4678 0.0359  -0.0143 -0.0102 139 GLU A OE1 
434  O OE2 . GLU A 61  ? 0.6051 0.6604 0.5253 0.0382  -0.0186 -0.0116 139 GLU A OE2 
435  N N   . ASN A 62  ? 0.2383 0.2932 0.1650 0.0417  -0.0211 0.0005  140 ASN A N   
436  C CA  . ASN A 62  ? 0.2613 0.3149 0.1851 0.0439  -0.0210 0.0048  140 ASN A CA  
437  C C   . ASN A 62  ? 0.2745 0.3267 0.2032 0.0436  -0.0209 0.0067  140 ASN A C   
438  O O   . ASN A 62  ? 0.2553 0.3042 0.1831 0.0440  -0.0191 0.0104  140 ASN A O   
439  C CB  . ASN A 62  ? 0.3106 0.3610 0.2293 0.0442  -0.0180 0.0076  140 ASN A CB  
440  C CG  . ASN A 62  ? 0.3676 0.4198 0.2800 0.0454  -0.0185 0.0061  140 ASN A CG  
441  O OD1 . ASN A 62  ? 0.3230 0.3786 0.2336 0.0468  -0.0214 0.0040  140 ASN A OD1 
442  N ND2 . ASN A 62  ? 0.4991 0.5495 0.4083 0.0449  -0.0156 0.0071  140 ASN A ND2 
443  N N   . LEU A 63  ? 0.2535 0.3082 0.1875 0.0427  -0.0229 0.0040  141 LEU A N   
444  C CA  . LEU A 63  ? 0.2658 0.3199 0.2046 0.0426  -0.0231 0.0055  141 LEU A CA  
445  C C   . LEU A 63  ? 0.2800 0.3339 0.2152 0.0459  -0.0244 0.0086  141 LEU A C   
446  O O   . LEU A 63  ? 0.3127 0.3696 0.2444 0.0482  -0.0270 0.0078  141 LEU A O   
447  C CB  . LEU A 63  ? 0.2906 0.3484 0.2352 0.0413  -0.0251 0.0018  141 LEU A CB  
448  C CG  . LEU A 63  ? 0.2784 0.3360 0.2281 0.0413  -0.0253 0.0028  141 LEU A CG  
449  C CD1 . LEU A 63  ? 0.3106 0.3642 0.2636 0.0389  -0.0223 0.0042  141 LEU A CD1 
450  C CD2 . LEU A 63  ? 0.3165 0.3790 0.2713 0.0405  -0.0277 -0.0010 141 LEU A CD2 
451  N N   . SER A 64  ? 0.2843 0.3346 0.2204 0.0461  -0.0228 0.0120  142 SER A N   
452  C CA  . SER A 64  ? 0.3222 0.3709 0.2546 0.0492  -0.0237 0.0155  142 SER A CA  
453  C C   . SER A 64  ? 0.3314 0.3784 0.2687 0.0491  -0.0235 0.0169  142 SER A C   
454  O O   . SER A 64  ? 0.2710 0.3163 0.2128 0.0465  -0.0213 0.0166  142 SER A O   
455  C CB  . SER A 64  ? 0.3534 0.3979 0.2798 0.0496  -0.0211 0.0191  142 SER A CB  
456  O OG  . SER A 64  ? 0.4769 0.5195 0.3988 0.0526  -0.0220 0.0225  142 SER A OG  
457  N N   . SER A 65  ? 0.2833 0.3308 0.2195 0.0522  -0.0256 0.0184  143 SER A N   
458  C CA  . SER A 65  ? 0.3846 0.4307 0.3253 0.0526  -0.0256 0.0195  143 SER A CA  
459  C C   . SER A 65  ? 0.4866 0.5268 0.4233 0.0541  -0.0240 0.0242  143 SER A C   
460  O O   . SER A 65  ? 0.5254 0.5646 0.4564 0.0571  -0.0252 0.0265  143 SER A O   
461  C CB  . SER A 65  ? 0.4380 0.4888 0.3814 0.0551  -0.0293 0.0175  143 SER A CB  
462  O OG  . SER A 65  ? 0.5136 0.5633 0.4620 0.0553  -0.0291 0.0181  143 SER A OG  
463  N N   . SER A 66  ? 0.5289 0.5653 0.4687 0.0518  -0.0211 0.0255  144 SER A N   
464  C CA  . SER A 66  ? 0.7006 0.7310 0.6376 0.0524  -0.0190 0.0297  144 SER A CA  
465  C C   . SER A 66  ? 0.6932 0.7223 0.6341 0.0537  -0.0199 0.0304  144 SER A C   
466  O O   . SER A 66  ? 0.5558 0.5889 0.5018 0.0540  -0.0218 0.0276  144 SER A O   
467  C CB  . SER A 66  ? 0.8304 0.8577 0.7686 0.0489  -0.0153 0.0305  144 SER A CB  
468  O OG  . SER A 66  ? 0.7114 0.7416 0.6501 0.0467  -0.0147 0.0279  144 SER A OG  
469  N N   . GLU A 67  ? 0.8368 0.8601 0.7752 0.0545  -0.0182 0.0341  145 GLU A N   
470  C CA  . GLU A 67  ? 0.7121 0.7331 0.6540 0.0555  -0.0184 0.0350  145 GLU A CA  
471  C C   . GLU A 67  ? 0.7777 0.7997 0.7270 0.0523  -0.0171 0.0326  145 GLU A C   
472  O O   . GLU A 67  ? 0.8588 0.8824 0.8128 0.0532  -0.0184 0.0312  145 GLU A O   
473  C CB  . GLU A 67  ? 1.0080 1.0218 0.9453 0.0563  -0.0164 0.0396  145 GLU A CB  
474  C CG  . GLU A 67  ? 1.0293 1.0394 0.9693 0.0577  -0.0165 0.0408  145 GLU A CG  
475  C CD  . GLU A 67  ? 1.2503 1.2527 1.1860 0.0575  -0.0138 0.0451  145 GLU A CD  
476  O OE1 . GLU A 67  ? 1.1936 1.1935 1.1230 0.0575  -0.0126 0.0476  145 GLU A OE1 
477  O OE2 . GLU A 67  ? 1.2433 1.2418 1.1818 0.0573  -0.0128 0.0460  145 GLU A OE2 
478  N N   . MET A 68  ? 0.6206 0.6421 0.5711 0.0488  -0.0145 0.0320  146 MET A N   
479  C CA  . MET A 68  ? 0.8675 0.8899 0.8245 0.0458  -0.0133 0.0297  146 MET A CA  
480  C C   . MET A 68  ? 0.7764 0.8048 0.7373 0.0447  -0.0150 0.0255  146 MET A C   
481  O O   . MET A 68  ? 0.4701 0.5001 0.4365 0.0432  -0.0150 0.0233  146 MET A O   
482  C CB  . MET A 68  ? 0.9501 0.9691 0.9069 0.0427  -0.0100 0.0309  146 MET A CB  
483  C CG  . MET A 68  ? 1.1844 1.2030 1.1470 0.0399  -0.0086 0.0293  146 MET A CG  
484  S SD  . MET A 68  ? 1.2203 1.2366 1.1871 0.0407  -0.0087 0.0297  146 MET A SD  
485  C CE  . MET A 68  ? 0.9997 1.0102 0.9609 0.0435  -0.0083 0.0341  146 MET A CE  
486  N N   . GLY A 69  ? 0.4325 0.4639 0.3903 0.0453  -0.0163 0.0244  147 GLY A N   
487  C CA  . GLY A 69  ? 0.3763 0.4129 0.3374 0.0440  -0.0177 0.0204  147 GLY A CA  
488  C C   . GLY A 69  ? 0.3570 0.3958 0.3139 0.0442  -0.0184 0.0195  147 GLY A C   
489  O O   . GLY A 69  ? 0.3814 0.4210 0.3339 0.0469  -0.0201 0.0205  147 GLY A O   
490  N N   . TYR A 70  ? 0.3148 0.3542 0.2728 0.0414  -0.0171 0.0176  148 TYR A N   
491  C CA  . TYR A 70  ? 0.2824 0.3241 0.2371 0.0414  -0.0178 0.0160  148 TYR A CA  
492  C C   . TYR A 70  ? 0.2840 0.3227 0.2361 0.0396  -0.0150 0.0172  148 TYR A C   
493  O O   . TYR A 70  ? 0.2357 0.2719 0.1905 0.0375  -0.0128 0.0179  148 TYR A O   
494  C CB  . TYR A 70  ? 0.2905 0.3363 0.2495 0.0396  -0.0191 0.0117  148 TYR A CB  
495  C CG  . TYR A 70  ? 0.3184 0.3683 0.2803 0.0412  -0.0219 0.0100  148 TYR A CG  
496  C CD1 . TYR A 70  ? 0.3550 0.4082 0.3137 0.0439  -0.0247 0.0093  148 TYR A CD1 
497  C CD2 . TYR A 70  ? 0.3647 0.4153 0.3323 0.0403  -0.0219 0.0090  148 TYR A CD2 
498  C CE1 . TYR A 70  ? 0.3921 0.4496 0.3537 0.0456  -0.0274 0.0076  148 TYR A CE1 
499  C CE2 . TYR A 70  ? 0.3917 0.4466 0.3623 0.0420  -0.0245 0.0073  148 TYR A CE2 
500  C CZ  . TYR A 70  ? 0.4306 0.4890 0.3982 0.0447  -0.0273 0.0066  148 TYR A CZ  
501  O OH  . TYR A 70  ? 0.4245 0.4878 0.3951 0.0466  -0.0301 0.0047  148 TYR A OH  
502  N N   . THR A 71  ? 0.2345 0.2739 0.1816 0.0405  -0.0152 0.0172  149 THR A N   
503  C CA  A THR A 71  ? 0.2634 0.3013 0.2085 0.0389  -0.0128 0.0174  149 THR A CA  
504  C CA  B THR A 71  ? 0.2656 0.3036 0.2108 0.0389  -0.0128 0.0173  149 THR A CA  
505  C C   . THR A 71  ? 0.2617 0.3028 0.2046 0.0390  -0.0141 0.0144  149 THR A C   
506  O O   . THR A 71  ? 0.2394 0.2833 0.1802 0.0409  -0.0166 0.0133  149 THR A O   
507  C CB  A THR A 71  ? 0.2884 0.3229 0.2283 0.0399  -0.0108 0.0212  149 THR A CB  
508  C CB  B THR A 71  ? 0.2984 0.3327 0.2391 0.0396  -0.0105 0.0213  149 THR A CB  
509  O OG1 A THR A 71  ? 0.3432 0.3788 0.2772 0.0425  -0.0123 0.0221  149 THR A OG1 
510  O OG1 B THR A 71  ? 0.3319 0.3651 0.2719 0.0377  -0.0080 0.0211  149 THR A OG1 
511  C CG2 A THR A 71  ? 0.2957 0.3268 0.2370 0.0400  -0.0097 0.0242  149 THR A CG2 
512  C CG2 B THR A 71  ? 0.3252 0.3599 0.2594 0.0424  -0.0119 0.0229  149 THR A CG2 
513  N N   . ALA A 72  ? 0.2468 0.2874 0.1904 0.0370  -0.0124 0.0129  150 ALA A N   
514  C CA  . ALA A 72  ? 0.2475 0.2905 0.1889 0.0370  -0.0133 0.0100  150 ALA A CA  
515  C C   . ALA A 72  ? 0.2588 0.3001 0.1994 0.0355  -0.0108 0.0096  150 ALA A C   
516  O O   . ALA A 72  ? 0.2312 0.2700 0.1741 0.0341  -0.0086 0.0111  150 ALA A O   
517  C CB  . ALA A 72  ? 0.2551 0.3009 0.2009 0.0358  -0.0154 0.0062  150 ALA A CB  
518  N N   . THR A 73  ? 0.2253 0.2682 0.1628 0.0359  -0.0113 0.0074  151 THR A N   
519  C CA  . THR A 73  ? 0.2468 0.2887 0.1840 0.0347  -0.0092 0.0063  151 THR A CA  
520  C C   . THR A 73  ? 0.2589 0.3016 0.1995 0.0331  -0.0103 0.0024  151 THR A C   
521  O O   . THR A 73  ? 0.2766 0.3217 0.2175 0.0333  -0.0128 0.0000  151 THR A O   
522  C CB  . THR A 73  ? 0.2349 0.2776 0.1659 0.0362  -0.0087 0.0064  151 THR A CB  
523  O OG1 . THR A 73  ? 0.2729 0.3143 0.2006 0.0374  -0.0074 0.0103  151 THR A OG1 
524  C CG2 . THR A 73  ? 0.2705 0.3125 0.2013 0.0352  -0.0066 0.0050  151 THR A CG2 
525  N N   . LEU A 74  ? 0.2427 0.2834 0.1857 0.0315  -0.0085 0.0017  152 LEU A N   
526  C CA  . LEU A 74  ? 0.2504 0.2908 0.1960 0.0299  -0.0091 -0.0016 152 LEU A CA  
527  C C   . LEU A 74  ? 0.2703 0.3099 0.2135 0.0300  -0.0076 -0.0029 152 LEU A C   
528  O O   . LEU A 74  ? 0.2809 0.3190 0.2236 0.0302  -0.0054 -0.0010 152 LEU A O   
529  C CB  . LEU A 74  ? 0.2354 0.2737 0.1862 0.0279  -0.0084 -0.0013 152 LEU A CB  
530  C CG  . LEU A 74  ? 0.2451 0.2839 0.1990 0.0276  -0.0092 0.0002  152 LEU A CG  
531  C CD1 . LEU A 74  ? 0.2129 0.2493 0.1712 0.0256  -0.0081 0.0003  152 LEU A CD1 
532  C CD2 . LEU A 74  ? 0.2693 0.3110 0.2237 0.0279  -0.0118 -0.0019 152 LEU A CD2 
533  N N   . THR A 75  ? 0.2223 0.2627 0.1643 0.0299  -0.0088 -0.0064 153 THR A N   
534  C CA  . THR A 75  ? 0.2507 0.2904 0.1900 0.0304  -0.0076 -0.0080 153 THR A CA  
535  C C   . THR A 75  ? 0.2557 0.2936 0.1972 0.0289  -0.0080 -0.0115 153 THR A C   
536  O O   . THR A 75  ? 0.2905 0.3291 0.2332 0.0279  -0.0099 -0.0139 153 THR A O   
537  C CB  . THR A 75  ? 0.2922 0.3345 0.2261 0.0322  -0.0086 -0.0090 153 THR A CB  
538  O OG1 . THR A 75  ? 0.3006 0.3439 0.2318 0.0336  -0.0081 -0.0055 153 THR A OG1 
539  C CG2 . THR A 75  ? 0.3472 0.3888 0.2782 0.0328  -0.0071 -0.0110 153 THR A CG2 
540  N N   . ARG A 76  ? 0.2412 0.2766 0.1835 0.0287  -0.0061 -0.0116 154 ARG A N   
541  C CA  . ARG A 76  ? 0.2623 0.2951 0.2057 0.0277  -0.0062 -0.0147 154 ARG A CA  
542  C C   . ARG A 76  ? 0.2826 0.3158 0.2221 0.0291  -0.0056 -0.0167 154 ARG A C   
543  O O   . ARG A 76  ? 0.2743 0.3083 0.2118 0.0306  -0.0038 -0.0151 154 ARG A O   
544  C CB  . ARG A 76  ? 0.2537 0.2834 0.2007 0.0268  -0.0047 -0.0134 154 ARG A CB  
545  C CG  . ARG A 76  ? 0.2710 0.2972 0.2185 0.0261  -0.0046 -0.0163 154 ARG A CG  
546  C CD  . ARG A 76  ? 0.2712 0.2942 0.2218 0.0254  -0.0034 -0.0151 154 ARG A CD  
547  N NE  . ARG A 76  ? 0.2362 0.2577 0.1899 0.0234  -0.0043 -0.0147 154 ARG A NE  
548  C CZ  . ARG A 76  ? 0.2536 0.2731 0.2081 0.0217  -0.0054 -0.0171 154 ARG A CZ  
549  N NH1 . ARG A 76  ? 0.2533 0.2719 0.2107 0.0197  -0.0058 -0.0163 154 ARG A NH1 
550  N NH2 . ARG A 76  ? 0.2855 0.3038 0.2379 0.0217  -0.0059 -0.0203 154 ARG A NH2 
551  N N   . THR A 77  ? 0.3078 0.3405 0.2462 0.0287  -0.0070 -0.0204 155 THR A N   
552  C CA  A THR A 77  ? 0.3412 0.3742 0.2757 0.0299  -0.0067 -0.0231 155 THR A CA  
553  C CA  B THR A 77  ? 0.3509 0.3839 0.2855 0.0300  -0.0065 -0.0229 155 THR A CA  
554  C C   . THR A 77  ? 0.3311 0.3601 0.2668 0.0296  -0.0057 -0.0252 155 THR A C   
555  O O   . THR A 77  ? 0.4465 0.4753 0.3798 0.0311  -0.0044 -0.0264 155 THR A O   
556  C CB  A THR A 77  ? 0.3293 0.3644 0.2617 0.0296  -0.0090 -0.0262 155 THR A CB  
557  C CB  B THR A 77  ? 0.3528 0.3885 0.2842 0.0302  -0.0087 -0.0256 155 THR A CB  
558  O OG1 A THR A 77  ? 0.3175 0.3561 0.2492 0.0300  -0.0103 -0.0242 155 THR A OG1 
559  O OG1 B THR A 77  ? 0.3225 0.3578 0.2568 0.0281  -0.0106 -0.0274 155 THR A OG1 
560  C CG2 A THR A 77  ? 0.3467 0.3826 0.2744 0.0312  -0.0087 -0.0288 155 THR A CG2 
561  C CG2 B THR A 77  ? 0.4056 0.4451 0.3340 0.0317  -0.0091 -0.0230 155 THR A CG2 
562  N N   . THR A 78  ? 0.3145 0.3403 0.2537 0.0277  -0.0062 -0.0259 156 THR A N   
563  C CA  . THR A 78  ? 0.2981 0.3192 0.2382 0.0274  -0.0054 -0.0278 156 THR A CA  
564  C C   . THR A 78  ? 0.3198 0.3387 0.2632 0.0272  -0.0041 -0.0249 156 THR A C   
565  O O   . THR A 78  ? 0.3087 0.3276 0.2550 0.0257  -0.0045 -0.0230 156 THR A O   
566  C CB  . THR A 78  ? 0.3204 0.3387 0.2614 0.0253  -0.0068 -0.0310 156 THR A CB  
567  O OG1 . THR A 78  ? 0.3427 0.3637 0.2809 0.0253  -0.0083 -0.0338 156 THR A OG1 
568  C CG2 . THR A 78  ? 0.3724 0.3852 0.3134 0.0253  -0.0060 -0.0330 156 THR A CG2 
569  N N   . PRO A 79  ? 0.2936 0.3109 0.2368 0.0288  -0.0025 -0.0247 157 PRO A N   
570  C CA  . PRO A 79  ? 0.3124 0.3281 0.2588 0.0287  -0.0015 -0.0221 157 PRO A CA  
571  C C   . PRO A 79  ? 0.2913 0.3024 0.2400 0.0267  -0.0023 -0.0225 157 PRO A C   
572  O O   . PRO A 79  ? 0.2828 0.2909 0.2307 0.0257  -0.0032 -0.0253 157 PRO A O   
573  C CB  . PRO A 79  ? 0.3805 0.3954 0.3260 0.0310  0.0000  -0.0228 157 PRO A CB  
574  C CG  . PRO A 79  ? 0.4045 0.4222 0.3463 0.0324  0.0002  -0.0247 157 PRO A CG  
575  C CD  . PRO A 79  ? 0.3321 0.3502 0.2723 0.0310  -0.0015 -0.0265 157 PRO A CD  
576  N N   . THR A 80  ? 0.2788 0.2894 0.2304 0.0260  -0.0019 -0.0197 158 THR A N   
577  C CA  . THR A 80  ? 0.3025 0.3085 0.2560 0.0245  -0.0022 -0.0197 158 THR A CA  
578  C C   . THR A 80  ? 0.3133 0.3156 0.2666 0.0261  -0.0014 -0.0203 158 THR A C   
579  O O   . THR A 80  ? 0.2703 0.2741 0.2223 0.0284  -0.0005 -0.0208 158 THR A O   
580  C CB  . THR A 80  ? 0.3232 0.3301 0.2797 0.0231  -0.0021 -0.0166 158 THR A CB  
581  O OG1 . THR A 80  ? 0.2789 0.2871 0.2364 0.0247  -0.0009 -0.0143 158 THR A OG1 
582  C CG2 . THR A 80  ? 0.3916 0.4024 0.3484 0.0221  -0.0029 -0.0159 158 THR A CG2 
583  N N   . PHE A 81  ? 0.2881 0.2857 0.2425 0.0251  -0.0016 -0.0200 159 PHE A N   
584  C CA  . PHE A 81  ? 0.3171 0.3110 0.2715 0.0268  -0.0011 -0.0202 159 PHE A CA  
585  C C   . PHE A 81  ? 0.2962 0.2923 0.2529 0.0279  -0.0003 -0.0172 159 PHE A C   
586  O O   . PHE A 81  ? 0.3173 0.3110 0.2743 0.0295  0.0000  -0.0171 159 PHE A O   
587  C CB  . PHE A 81  ? 0.3078 0.2950 0.2617 0.0252  -0.0017 -0.0212 159 PHE A CB  
588  C CG  . PHE A 81  ? 0.3089 0.2955 0.2644 0.0223  -0.0022 -0.0198 159 PHE A CG  
589  C CD1 . PHE A 81  ? 0.3190 0.3055 0.2764 0.0220  -0.0019 -0.0169 159 PHE A CD1 
590  C CD2 . PHE A 81  ? 0.3306 0.3172 0.2858 0.0198  -0.0029 -0.0214 159 PHE A CD2 
591  C CE1 . PHE A 81  ? 0.2897 0.2760 0.2486 0.0193  -0.0022 -0.0157 159 PHE A CE1 
592  C CE2 . PHE A 81  ? 0.3092 0.2957 0.2662 0.0171  -0.0031 -0.0202 159 PHE A CE2 
593  C CZ  . PHE A 81  ? 0.2941 0.2803 0.2528 0.0169  -0.0027 -0.0174 159 PHE A CZ  
594  N N   . PHE A 82  ? 0.2756 0.2763 0.2339 0.0271  0.0000  -0.0149 160 PHE A N   
595  C CA  . PHE A 82  ? 0.2703 0.2735 0.2308 0.0281  0.0007  -0.0125 160 PHE A CA  
596  C C   . PHE A 82  ? 0.3193 0.3271 0.2793 0.0301  0.0019  -0.0125 160 PHE A C   
597  O O   . PHE A 82  ? 0.3164 0.3263 0.2744 0.0302  0.0020  -0.0136 160 PHE A O   
598  C CB  . PHE A 82  ? 0.3146 0.3197 0.2771 0.0262  0.0006  -0.0099 160 PHE A CB  
599  C CG  . PHE A 82  ? 0.3263 0.3273 0.2898 0.0244  0.0000  -0.0094 160 PHE A CG  
600  C CD1 . PHE A 82  ? 0.3175 0.3163 0.2821 0.0251  0.0000  -0.0083 160 PHE A CD1 
601  C CD2 . PHE A 82  ? 0.3135 0.3131 0.2767 0.0221  -0.0008 -0.0100 160 PHE A CD2 
602  C CE1 . PHE A 82  ? 0.2886 0.2836 0.2537 0.0234  -0.0005 -0.0076 160 PHE A CE1 
603  C CE2 . PHE A 82  ? 0.3042 0.3000 0.2682 0.0203  -0.0012 -0.0095 160 PHE A CE2 
604  C CZ  . PHE A 82  ? 0.3103 0.3036 0.2749 0.0209  -0.0010 -0.0082 160 PHE A CZ  
605  N N   . PRO A 83  ? 0.3093 0.3189 0.2711 0.0316  0.0028  -0.0113 161 PRO A N   
606  C CA  . PRO A 83  ? 0.3149 0.3293 0.2763 0.0332  0.0043  -0.0112 161 PRO A CA  
607  C C   . PRO A 83  ? 0.2859 0.3043 0.2478 0.0318  0.0048  -0.0089 161 PRO A C   
608  O O   . PRO A 83  ? 0.2764 0.2942 0.2398 0.0300  0.0043  -0.0071 161 PRO A O   
609  C CB  . PRO A 83  ? 0.3319 0.3472 0.2957 0.0350  0.0050  -0.0109 161 PRO A CB  
610  C CG  . PRO A 83  ? 0.3530 0.3645 0.3185 0.0342  0.0039  -0.0099 161 PRO A CG  
611  C CD  . PRO A 83  ? 0.3289 0.3369 0.2932 0.0318  0.0027  -0.0099 161 PRO A CD  
612  N N   . LYS A 84  ? 0.2775 0.2995 0.2377 0.0327  0.0060  -0.0091 162 LYS A N   
613  C CA  . LYS A 84  ? 0.3003 0.3259 0.2605 0.0319  0.0069  -0.0067 162 LYS A CA  
614  C C   . LYS A 84  ? 0.2446 0.2695 0.2040 0.0301  0.0057  -0.0057 162 LYS A C   
615  O O   . LYS A 84  ? 0.2218 0.2478 0.1827 0.0290  0.0059  -0.0032 162 LYS A O   
616  C CB  . LYS A 84  ? 0.3501 0.3777 0.3137 0.0317  0.0081  -0.0045 162 LYS A CB  
617  C CG  . LYS A 84  ? 0.4986 0.5281 0.4632 0.0337  0.0094  -0.0056 162 LYS A CG  
618  C CD  . LYS A 84  ? 0.5988 0.6311 0.5669 0.0333  0.0107  -0.0036 162 LYS A CD  
619  C CE  . LYS A 84  ? 0.7031 0.7371 0.6734 0.0352  0.0114  -0.0050 162 LYS A CE  
620  N NZ  . LYS A 84  ? 0.6924 0.7283 0.6668 0.0346  0.0118  -0.0034 162 LYS A NZ  
621  N N   . ASP A 85  ? 0.2298 0.2531 0.1869 0.0299  0.0044  -0.0077 163 ASP A N   
622  C CA  . ASP A 85  ? 0.2605 0.2843 0.2165 0.0287  0.0032  -0.0071 163 ASP A CA  
623  C C   . ASP A 85  ? 0.2523 0.2797 0.2068 0.0291  0.0042  -0.0050 163 ASP A C   
624  O O   . ASP A 85  ? 0.2778 0.3073 0.2305 0.0305  0.0056  -0.0052 163 ASP A O   
625  C CB  . ASP A 85  ? 0.2534 0.2764 0.2068 0.0287  0.0019  -0.0100 163 ASP A CB  
626  C CG  . ASP A 85  ? 0.2568 0.2756 0.2112 0.0277  0.0007  -0.0119 163 ASP A CG  
627  O OD1 . ASP A 85  ? 0.2698 0.2869 0.2267 0.0260  0.0001  -0.0109 163 ASP A OD1 
628  O OD2 . ASP A 85  ? 0.2858 0.3030 0.2384 0.0284  0.0005  -0.0147 163 ASP A OD2 
629  N N   . ILE A 86  ? 0.2308 0.2588 0.1861 0.0280  0.0037  -0.0030 164 ILE A N   
630  C CA  . ILE A 86  ? 0.2658 0.2964 0.2190 0.0285  0.0044  -0.0009 164 ILE A CA  
631  C C   . ILE A 86  ? 0.3188 0.3500 0.2690 0.0287  0.0026  -0.0023 164 ILE A C   
632  O O   . ILE A 86  ? 0.2583 0.2888 0.2098 0.0276  0.0009  -0.0024 164 ILE A O   
633  C CB  . ILE A 86  ? 0.2821 0.3128 0.2377 0.0274  0.0049  0.0020  164 ILE A CB  
634  C CG1 . ILE A 86  ? 0.2889 0.3194 0.2476 0.0272  0.0065  0.0027  164 ILE A CG1 
635  C CG2 . ILE A 86  ? 0.3323 0.3649 0.2853 0.0279  0.0057  0.0043  164 ILE A CG2 
636  C CD1 . ILE A 86  ? 0.3581 0.3878 0.3200 0.0258  0.0065  0.0048  164 ILE A CD1 
637  N N   . LEU A 87  ? 0.2593 0.2920 0.2057 0.0300  0.0029  -0.0035 165 LEU A N   
638  C CA  . LEU A 87  ? 0.2717 0.3050 0.2153 0.0303  0.0010  -0.0057 165 LEU A CA  
639  C C   . LEU A 87  ? 0.2681 0.3032 0.2101 0.0305  0.0000  -0.0039 165 LEU A C   
640  O O   . LEU A 87  ? 0.2799 0.3155 0.2212 0.0302  -0.0021 -0.0055 165 LEU A O   
641  C CB  . LEU A 87  ? 0.2910 0.3254 0.2308 0.0318  0.0017  -0.0080 165 LEU A CB  
642  C CG  . LEU A 87  ? 0.3183 0.3508 0.2595 0.0321  0.0024  -0.0104 165 LEU A CG  
643  C CD1 . LEU A 87  ? 0.3469 0.3805 0.2841 0.0337  0.0031  -0.0128 165 LEU A CD1 
644  C CD2 . LEU A 87  ? 0.3288 0.3582 0.2724 0.0308  0.0007  -0.0125 165 LEU A CD2 
645  N N   . THR A 88  ? 0.2629 0.2988 0.2043 0.0308  0.0013  -0.0006 166 THR A N   
646  C CA  . THR A 88  ? 0.2520 0.2890 0.1916 0.0312  0.0004  0.0015  166 THR A CA  
647  C C   . THR A 88  ? 0.2476 0.2833 0.1908 0.0302  0.0009  0.0042  166 THR A C   
648  O O   . THR A 88  ? 0.2594 0.2945 0.2039 0.0298  0.0030  0.0060  166 THR A O   
649  C CB  . THR A 88  ? 0.2485 0.2870 0.1830 0.0327  0.0017  0.0030  166 THR A CB  
650  O OG1 . THR A 88  ? 0.2414 0.2812 0.1724 0.0337  0.0012  0.0001  166 THR A OG1 
651  C CG2 . THR A 88  ? 0.3059 0.3449 0.2380 0.0334  0.0008  0.0056  166 THR A CG2 
652  N N   . LEU A 89  ? 0.2461 0.2817 0.1911 0.0297  -0.0009 0.0043  167 LEU A N   
653  C CA  . LEU A 89  ? 0.2501 0.2844 0.1984 0.0288  -0.0006 0.0067  167 LEU A CA  
654  C C   . LEU A 89  ? 0.2452 0.2803 0.1916 0.0298  -0.0018 0.0086  167 LEU A C   
655  O O   . LEU A 89  ? 0.2335 0.2703 0.1767 0.0311  -0.0033 0.0077  167 LEU A O   
656  C CB  . LEU A 89  ? 0.2627 0.2959 0.2154 0.0272  -0.0018 0.0049  167 LEU A CB  
657  C CG  . LEU A 89  ? 0.2601 0.2919 0.2146 0.0263  -0.0011 0.0029  167 LEU A CG  
658  C CD1 . LEU A 89  ? 0.2462 0.2768 0.2042 0.0247  -0.0024 0.0012  167 LEU A CD1 
659  C CD2 . LEU A 89  ? 0.2513 0.2822 0.2072 0.0260  0.0010  0.0047  167 LEU A CD2 
660  N N   . ARG A 90  ? 0.2561 0.2899 0.2046 0.0293  -0.0011 0.0111  168 ARG A N   
661  C CA  . ARG A 90  ? 0.2750 0.3089 0.2225 0.0303  -0.0023 0.0131  168 ARG A CA  
662  C C   . ARG A 90  ? 0.2402 0.2736 0.1924 0.0293  -0.0035 0.0126  168 ARG A C   
663  O O   . ARG A 90  ? 0.2345 0.2663 0.1903 0.0277  -0.0023 0.0129  168 ARG A O   
664  C CB  . ARG A 90  ? 0.2996 0.3318 0.2454 0.0306  -0.0002 0.0166  168 ARG A CB  
665  C CG  . ARG A 90  ? 0.3871 0.4185 0.3309 0.0320  -0.0010 0.0191  168 ARG A CG  
666  C CD  . ARG A 90  ? 0.4308 0.4597 0.3737 0.0315  0.0014  0.0225  168 ARG A CD  
667  N NE  . ARG A 90  ? 0.4955 0.5225 0.4382 0.0324  0.0007  0.0249  168 ARG A NE  
668  C CZ  . ARG A 90  ? 0.5178 0.5439 0.4557 0.0344  0.0002  0.0271  168 ARG A CZ  
669  N NH1 . ARG A 90  ? 0.6972 0.7244 0.6298 0.0357  0.0002  0.0273  168 ARG A NH1 
670  N NH2 . ARG A 90  ? 0.5308 0.5548 0.4693 0.0352  -0.0004 0.0291  168 ARG A NH2 
671  N N   . LEU A 91  ? 0.2230 0.2579 0.1752 0.0302  -0.0058 0.0118  169 LEU A N   
672  C CA  . LEU A 91  ? 0.2230 0.2582 0.1796 0.0294  -0.0070 0.0112  169 LEU A CA  
673  C C   . LEU A 91  ? 0.2145 0.2489 0.1704 0.0309  -0.0072 0.0140  169 LEU A C   
674  O O   . LEU A 91  ? 0.2349 0.2701 0.1868 0.0329  -0.0082 0.0150  169 LEU A O   
675  C CB  . LEU A 91  ? 0.2184 0.2564 0.1760 0.0295  -0.0094 0.0079  169 LEU A CB  
676  C CG  . LEU A 91  ? 0.2255 0.2646 0.1873 0.0290  -0.0108 0.0072  169 LEU A CG  
677  C CD1 . LEU A 91  ? 0.2517 0.2889 0.2178 0.0266  -0.0095 0.0067  169 LEU A CD1 
678  C CD2 . LEU A 91  ? 0.3054 0.3481 0.2677 0.0293  -0.0133 0.0040  169 LEU A CD2 
679  N N   . ASP A 92  ? 0.1991 0.2318 0.1585 0.0299  -0.0064 0.0152  170 ASP A N   
680  C CA  . ASP A 92  ? 0.2144 0.2460 0.1736 0.0313  -0.0069 0.0175  170 ASP A CA  
681  C C   . ASP A 92  ? 0.2248 0.2571 0.1890 0.0306  -0.0079 0.0162  170 ASP A C   
682  O O   . ASP A 92  ? 0.2198 0.2513 0.1875 0.0284  -0.0068 0.0153  170 ASP A O   
683  C CB  . ASP A 92  ? 0.2379 0.2660 0.1957 0.0311  -0.0045 0.0208  170 ASP A CB  
684  C CG  . ASP A 92  ? 0.2743 0.3021 0.2269 0.0320  -0.0034 0.0223  170 ASP A CG  
685  O OD1 . ASP A 92  ? 0.3337 0.3616 0.2859 0.0308  -0.0019 0.0217  170 ASP A OD1 
686  O OD2 . ASP A 92  ? 0.3087 0.3363 0.2574 0.0341  -0.0043 0.0239  170 ASP A OD2 
687  N N   . VAL A 93  ? 0.2186 0.2529 0.1830 0.0324  -0.0101 0.0158  171 VAL A N   
688  C CA  . VAL A 93  ? 0.2413 0.2769 0.2105 0.0319  -0.0111 0.0144  171 VAL A CA  
689  C C   . VAL A 93  ? 0.2951 0.3289 0.2642 0.0338  -0.0112 0.0169  171 VAL A C   
690  O O   . VAL A 93  ? 0.2936 0.3278 0.2593 0.0365  -0.0126 0.0182  171 VAL A O   
691  C CB  . VAL A 93  ? 0.2401 0.2802 0.2105 0.0324  -0.0136 0.0112  171 VAL A CB  
692  C CG1 . VAL A 93  ? 0.2440 0.2859 0.2197 0.0318  -0.0144 0.0096  171 VAL A CG1 
693  C CG2 . VAL A 93  ? 0.2539 0.2951 0.2238 0.0307  -0.0134 0.0088  171 VAL A CG2 
694  N N   . MET A 94  ? 0.2554 0.2871 0.2279 0.0326  -0.0100 0.0175  172 MET A N   
695  C CA  . MET A 94  ? 0.2519 0.2815 0.2248 0.0342  -0.0100 0.0196  172 MET A CA  
696  C C   . MET A 94  ? 0.2505 0.2820 0.2284 0.0341  -0.0110 0.0177  172 MET A C   
697  O O   . MET A 94  ? 0.2184 0.2499 0.1999 0.0317  -0.0099 0.0162  172 MET A O   
698  C CB  . MET A 94  ? 0.2542 0.2792 0.2265 0.0329  -0.0073 0.0221  172 MET A CB  
699  C CG  . MET A 94  ? 0.3372 0.3599 0.3045 0.0332  -0.0060 0.0246  172 MET A CG  
700  S SD  . MET A 94  ? 0.3538 0.3783 0.3195 0.0315  -0.0052 0.0231  172 MET A SD  
701  C CE  . MET A 94  ? 0.3292 0.3528 0.2997 0.0282  -0.0034 0.0218  172 MET A CE  
702  N N   . MET A 95  ? 0.2404 0.2735 0.2184 0.0369  -0.0129 0.0179  173 MET A N   
703  C CA  . MET A 95  ? 0.2379 0.2734 0.2207 0.0373  -0.0140 0.0160  173 MET A CA  
704  C C   . MET A 95  ? 0.2270 0.2582 0.2104 0.0378  -0.0127 0.0182  173 MET A C   
705  O O   . MET A 95  ? 0.2304 0.2599 0.2120 0.0407  -0.0135 0.0202  173 MET A O   
706  C CB  . MET A 95  ? 0.2836 0.3236 0.2661 0.0401  -0.0170 0.0146  173 MET A CB  
707  C CG  . MET A 95  ? 0.3938 0.4374 0.3750 0.0391  -0.0181 0.0124  173 MET A CG  
708  S SD  . MET A 95  ? 0.6638 0.7131 0.6442 0.0423  -0.0217 0.0107  173 MET A SD  
709  C CE  . MET A 95  ? 0.6623 0.7173 0.6500 0.0407  -0.0227 0.0063  173 MET A CE  
710  N N   . GLU A 96  ? 0.2558 0.2849 0.2416 0.0350  -0.0105 0.0180  174 GLU A N   
711  C CA  . GLU A 96  ? 0.2535 0.2776 0.2389 0.0350  -0.0087 0.0205  174 GLU A CA  
712  C C   . GLU A 96  ? 0.2789 0.3028 0.2677 0.0363  -0.0092 0.0200  174 GLU A C   
713  O O   . GLU A 96  ? 0.2777 0.2978 0.2649 0.0381  -0.0089 0.0223  174 GLU A O   
714  C CB  . GLU A 96  ? 0.2703 0.2921 0.2564 0.0316  -0.0063 0.0206  174 GLU A CB  
715  C CG  . GLU A 96  ? 0.2451 0.2660 0.2273 0.0309  -0.0055 0.0219  174 GLU A CG  
716  C CD  . GLU A 96  ? 0.2957 0.3145 0.2785 0.0280  -0.0032 0.0222  174 GLU A CD  
717  O OE1 . GLU A 96  ? 0.2540 0.2723 0.2401 0.0262  -0.0024 0.0211  174 GLU A OE1 
718  O OE2 . GLU A 96  ? 0.2366 0.2544 0.2164 0.0275  -0.0023 0.0234  174 GLU A OE2 
719  N N   . THR A 97  ? 0.2493 0.2770 0.2426 0.0353  -0.0098 0.0170  175 THR A N   
720  C CA  . THR A 97  ? 0.2679 0.2967 0.2649 0.0369  -0.0104 0.0159  175 THR A CA  
721  C C   . THR A 97  ? 0.2670 0.3022 0.2674 0.0370  -0.0122 0.0125  175 THR A C   
722  O O   . THR A 97  ? 0.2408 0.2788 0.2406 0.0356  -0.0128 0.0112  175 THR A O   
723  C CB  . THR A 97  ? 0.2539 0.2802 0.2539 0.0345  -0.0083 0.0154  175 THR A CB  
724  O OG1 . THR A 97  ? 0.2461 0.2754 0.2489 0.0314  -0.0076 0.0128  175 THR A OG1 
725  C CG2 . THR A 97  ? 0.2721 0.2927 0.2693 0.0333  -0.0063 0.0181  175 THR A CG2 
726  N N   . GLU A 98  ? 0.2403 0.2779 0.2447 0.0385  -0.0130 0.0110  176 GLU A N   
727  C CA  . GLU A 98  ? 0.2785 0.3227 0.2869 0.0382  -0.0145 0.0074  176 GLU A CA  
728  C C   . GLU A 98  ? 0.2392 0.2849 0.2499 0.0339  -0.0129 0.0051  176 GLU A C   
729  O O   . GLU A 98  ? 0.2398 0.2904 0.2527 0.0329  -0.0138 0.0025  176 GLU A O   
730  C CB  . GLU A 98  ? 0.3535 0.4003 0.3660 0.0407  -0.0155 0.0061  176 GLU A CB  
731  C CG  . GLU A 98  ? 0.4948 0.5401 0.5108 0.0390  -0.0134 0.0051  176 GLU A CG  
732  C CD  . GLU A 98  ? 0.7281 0.7753 0.7475 0.0422  -0.0145 0.0041  176 GLU A CD  
733  O OE1 . GLU A 98  ? 0.6571 0.7105 0.6796 0.0438  -0.0165 0.0017  176 GLU A OE1 
734  O OE2 . GLU A 98  ? 0.8731 0.9158 0.8925 0.0431  -0.0133 0.0056  176 GLU A OE2 
735  N N   . ASN A 99  ? 0.2044 0.2458 0.2146 0.0314  -0.0105 0.0062  177 ASN A N   
736  C CA  . ASN A 99  ? 0.2123 0.2543 0.2241 0.0276  -0.0090 0.0044  177 ASN A CA  
737  C C   . ASN A 99  ? 0.2175 0.2569 0.2258 0.0256  -0.0081 0.0056  177 ASN A C   
738  O O   . ASN A 99  ? 0.2187 0.2589 0.2280 0.0227  -0.0072 0.0040  177 ASN A O   
739  C CB  . ASN A 99  ? 0.2662 0.3054 0.2800 0.0262  -0.0069 0.0045  177 ASN A CB  
740  C CG  . ASN A 99  ? 0.3646 0.4059 0.3820 0.0282  -0.0074 0.0033  177 ASN A CG  
741  O OD1 . ASN A 99  ? 0.4998 0.5463 0.5201 0.0291  -0.0088 0.0010  177 ASN A OD1 
742  N ND2 . ASN A 99  ? 0.3606 0.3979 0.3779 0.0289  -0.0063 0.0047  177 ASN A ND2 
743  N N   . ARG A 100 ? 0.2150 0.2511 0.2193 0.0270  -0.0082 0.0083  178 ARG A N   
744  C CA  . ARG A 100 ? 0.2087 0.2422 0.2100 0.0252  -0.0070 0.0096  178 ARG A CA  
745  C C   . ARG A 100 ? 0.2690 0.3034 0.2666 0.0268  -0.0083 0.0104  178 ARG A C   
746  O O   . ARG A 100 ? 0.2599 0.2931 0.2551 0.0294  -0.0091 0.0124  178 ARG A O   
747  C CB  . ARG A 100 ? 0.2219 0.2504 0.2216 0.0249  -0.0053 0.0122  178 ARG A CB  
748  C CG  . ARG A 100 ? 0.2347 0.2609 0.2316 0.0232  -0.0041 0.0133  178 ARG A CG  
749  C CD  . ARG A 100 ? 0.2399 0.2620 0.2362 0.0222  -0.0022 0.0153  178 ARG A CD  
750  N NE  . ARG A 100 ? 0.2570 0.2763 0.2508 0.0243  -0.0021 0.0179  178 ARG A NE  
751  C CZ  . ARG A 100 ? 0.2594 0.2759 0.2539 0.0251  -0.0015 0.0191  178 ARG A CZ  
752  N NH1 . ARG A 100 ? 0.2764 0.2926 0.2741 0.0241  -0.0009 0.0178  178 ARG A NH1 
753  N NH2 . ARG A 100 ? 0.3210 0.3346 0.3126 0.0269  -0.0014 0.0216  178 ARG A NH2 
754  N N   . LEU A 101 ? 0.2296 0.2657 0.2267 0.0250  -0.0085 0.0088  179 LEU A N   
755  C CA  . LEU A 101 ? 0.2670 0.3038 0.2605 0.0260  -0.0095 0.0092  179 LEU A CA  
756  C C   . LEU A 101 ? 0.2580 0.2915 0.2491 0.0241  -0.0077 0.0104  179 LEU A C   
757  O O   . LEU A 101 ? 0.2564 0.2889 0.2492 0.0217  -0.0064 0.0096  179 LEU A O   
758  C CB  . LEU A 101 ? 0.2216 0.2629 0.2164 0.0254  -0.0110 0.0061  179 LEU A CB  
759  C CG  . LEU A 101 ? 0.2705 0.3131 0.2620 0.0259  -0.0121 0.0056  179 LEU A CG  
760  C CD1 . LEU A 101 ? 0.2389 0.2821 0.2271 0.0293  -0.0137 0.0074  179 LEU A CD1 
761  C CD2 . LEU A 101 ? 0.2890 0.3357 0.2829 0.0245  -0.0133 0.0021  179 LEU A CD2 
762  N N   . HIS A 102 ? 0.2336 0.2657 0.2207 0.0254  -0.0076 0.0124  180 HIS A N   
763  C CA  . HIS A 102 ? 0.2209 0.2501 0.2059 0.0242  -0.0058 0.0137  180 HIS A CA  
764  C C   . HIS A 102 ? 0.2687 0.2990 0.2500 0.0250  -0.0065 0.0136  180 HIS A C   
765  O O   . HIS A 102 ? 0.2242 0.2557 0.2030 0.0273  -0.0078 0.0143  180 HIS A O   
766  C CB  . HIS A 102 ? 0.2506 0.2764 0.2345 0.0249  -0.0045 0.0167  180 HIS A CB  
767  C CG  . HIS A 102 ? 0.2728 0.2960 0.2552 0.0234  -0.0025 0.0180  180 HIS A CG  
768  N ND1 . HIS A 102 ? 0.2966 0.3169 0.2769 0.0239  -0.0012 0.0207  180 HIS A ND1 
769  C CD2 . HIS A 102 ? 0.3220 0.3453 0.3050 0.0214  -0.0016 0.0170  180 HIS A CD2 
770  C CE1 . HIS A 102 ? 0.2495 0.2688 0.2295 0.0223  0.0003  0.0211  180 HIS A CE1 
771  N NE2 . HIS A 102 ? 0.2751 0.2961 0.2566 0.0209  0.0000  0.0189  180 HIS A NE2 
772  N N   . PHE A 103 ? 0.2400 0.2701 0.2209 0.0233  -0.0058 0.0125  181 PHE A N   
773  C CA  . PHE A 103 ? 0.2266 0.2574 0.2038 0.0241  -0.0060 0.0124  181 PHE A CA  
774  C C   . PHE A 103 ? 0.2092 0.2379 0.1854 0.0228  -0.0042 0.0129  181 PHE A C   
775  O O   . PHE A 103 ? 0.2373 0.2649 0.2159 0.0209  -0.0032 0.0124  181 PHE A O   
776  C CB  . PHE A 103 ? 0.2163 0.2503 0.1934 0.0243  -0.0079 0.0096  181 PHE A CB  
777  C CG  . PHE A 103 ? 0.2168 0.2511 0.1961 0.0219  -0.0077 0.0070  181 PHE A CG  
778  C CD1 . PHE A 103 ? 0.2164 0.2495 0.1939 0.0212  -0.0070 0.0063  181 PHE A CD1 
779  C CD2 . PHE A 103 ? 0.2378 0.2733 0.2208 0.0206  -0.0083 0.0052  181 PHE A CD2 
780  C CE1 . PHE A 103 ? 0.2163 0.2491 0.1954 0.0191  -0.0069 0.0040  181 PHE A CE1 
781  C CE2 . PHE A 103 ? 0.2370 0.2724 0.2215 0.0184  -0.0081 0.0028  181 PHE A CE2 
782  C CZ  . PHE A 103 ? 0.2158 0.2495 0.1982 0.0176  -0.0074 0.0024  181 PHE A CZ  
783  N N   . THR A 104 ? 0.2277 0.2563 0.2002 0.0239  -0.0037 0.0141  182 THR A N   
784  C CA  . THR A 104 ? 0.2255 0.2529 0.1969 0.0230  -0.0021 0.0144  182 THR A CA  
785  C C   . THR A 104 ? 0.2411 0.2699 0.2094 0.0238  -0.0026 0.0130  182 THR A C   
786  O O   . THR A 104 ? 0.2432 0.2736 0.2089 0.0254  -0.0039 0.0129  182 THR A O   
787  C CB  . THR A 104 ? 0.2484 0.2740 0.2185 0.0234  -0.0003 0.0173  182 THR A CB  
788  O OG1 . THR A 104 ? 0.2752 0.3011 0.2415 0.0253  -0.0007 0.0189  182 THR A OG1 
789  C CG2 . THR A 104 ? 0.2661 0.2898 0.2392 0.0225  0.0002  0.0185  182 THR A CG2 
790  N N   . ILE A 105 ? 0.2388 0.2671 0.2075 0.0228  -0.0017 0.0119  183 ILE A N   
791  C CA  . ILE A 105 ? 0.2121 0.2413 0.1779 0.0234  -0.0017 0.0106  183 ILE A CA  
792  C C   . ILE A 105 ? 0.2399 0.2681 0.2051 0.0232  0.0003  0.0118  183 ILE A C   
793  O O   . ILE A 105 ? 0.2018 0.2287 0.1696 0.0219  0.0012  0.0118  183 ILE A O   
794  C CB  . ILE A 105 ? 0.2262 0.2558 0.1930 0.0225  -0.0028 0.0075  183 ILE A CB  
795  C CG1 . ILE A 105 ? 0.2692 0.3005 0.2371 0.0226  -0.0049 0.0060  183 ILE A CG1 
796  C CG2 . ILE A 105 ? 0.2266 0.2568 0.1904 0.0233  -0.0027 0.0061  183 ILE A CG2 
797  C CD1 . ILE A 105 ? 0.2833 0.3147 0.2528 0.0211  -0.0058 0.0029  183 ILE A CD1 
798  N N   . LYS A 106 ? 0.2088 0.2377 0.1704 0.0245  0.0011  0.0130  184 LYS A N   
799  C CA  . LYS A 106 ? 0.2937 0.3223 0.2547 0.0243  0.0034  0.0145  184 LYS A CA  
800  C C   . LYS A 106 ? 0.2459 0.2758 0.2033 0.0255  0.0039  0.0136  184 LYS A C   
801  O O   . LYS A 106 ? 0.2406 0.2716 0.1952 0.0266  0.0025  0.0124  184 LYS A O   
802  C CB  . LYS A 106 ? 0.3211 0.3488 0.2809 0.0246  0.0046  0.0177  184 LYS A CB  
803  C CG  . LYS A 106 ? 0.3637 0.3898 0.3267 0.0237  0.0044  0.0189  184 LYS A CG  
804  C CD  . LYS A 106 ? 0.3823 0.4070 0.3435 0.0241  0.0056  0.0219  184 LYS A CD  
805  C CE  . LYS A 106 ? 0.3672 0.3900 0.3318 0.0231  0.0055  0.0229  184 LYS A CE  
806  N NZ  . LYS A 106 ? 0.4171 0.4378 0.3800 0.0234  0.0067  0.0258  184 LYS A NZ  
807  N N   . ASP A 107 ? 0.2286 0.2587 0.1861 0.0252  0.0060  0.0141  185 ASP A N   
808  C CA  . ASP A 107 ? 0.2458 0.2775 0.1999 0.0263  0.0071  0.0136  185 ASP A CA  
809  C C   . ASP A 107 ? 0.2908 0.3226 0.2416 0.0269  0.0084  0.0164  185 ASP A C   
810  O O   . ASP A 107 ? 0.2738 0.3051 0.2259 0.0259  0.0102  0.0184  185 ASP A O   
811  C CB  . ASP A 107 ? 0.2205 0.2527 0.1768 0.0258  0.0087  0.0127  185 ASP A CB  
812  C CG  . ASP A 107 ? 0.2460 0.2801 0.1991 0.0270  0.0101  0.0118  185 ASP A CG  
813  O OD1 . ASP A 107 ? 0.2136 0.2485 0.1625 0.0280  0.0101  0.0123  185 ASP A OD1 
814  O OD2 . ASP A 107 ? 0.2600 0.2949 0.2149 0.0270  0.0111  0.0106  185 ASP A OD2 
815  N N   . PRO A 108 ? 0.2737 0.3061 0.2200 0.0283  0.0074  0.0165  186 PRO A N   
816  C CA  . PRO A 108 ? 0.3224 0.3544 0.2649 0.0289  0.0087  0.0195  186 PRO A CA  
817  C C   . PRO A 108 ? 0.3190 0.3519 0.2597 0.0286  0.0117  0.0204  186 PRO A C   
818  O O   . PRO A 108 ? 0.3453 0.3772 0.2838 0.0285  0.0133  0.0231  186 PRO A O   
819  C CB  . PRO A 108 ? 0.3297 0.3625 0.2675 0.0307  0.0067  0.0188  186 PRO A CB  
820  C CG  . PRO A 108 ? 0.3094 0.3439 0.2479 0.0309  0.0055  0.0152  186 PRO A CG  
821  C CD  . PRO A 108 ? 0.3131 0.3467 0.2574 0.0294  0.0051  0.0140  186 PRO A CD  
822  N N   . ALA A 109 ? 0.3113 0.3459 0.2530 0.0286  0.0124  0.0180  187 ALA A N   
823  C CA  . ALA A 109 ? 0.3522 0.3884 0.2927 0.0284  0.0153  0.0185  187 ALA A CA  
824  C C   . ALA A 109 ? 0.3793 0.4157 0.3247 0.0268  0.0173  0.0191  187 ALA A C   
825  O O   . ALA A 109 ? 0.3385 0.3766 0.2836 0.0264  0.0198  0.0195  187 ALA A O   
826  C CB  . ALA A 109 ? 0.3328 0.3711 0.2718 0.0296  0.0152  0.0154  187 ALA A CB  
827  N N   . ASN A 110 ? 0.3444 0.3795 0.2944 0.0258  0.0161  0.0188  188 ASN A N   
828  C CA  . ASN A 110 ? 0.3530 0.3886 0.3077 0.0243  0.0176  0.0190  188 ASN A CA  
829  C C   . ASN A 110 ? 0.3630 0.3964 0.3211 0.0231  0.0164  0.0200  188 ASN A C   
830  O O   . ASN A 110 ? 0.3075 0.3397 0.2665 0.0234  0.0141  0.0189  188 ASN A O   
831  C CB  . ASN A 110 ? 0.3991 0.4365 0.3566 0.0247  0.0173  0.0161  188 ASN A CB  
832  C CG  . ASN A 110 ? 0.6112 0.6507 0.5656 0.0262  0.0181  0.0145  188 ASN A CG  
833  O OD1 . ASN A 110 ? 0.6240 0.6632 0.5768 0.0274  0.0165  0.0123  188 ASN A OD1 
834  N ND2 . ASN A 110 ? 0.6811 0.7227 0.6344 0.0260  0.0209  0.0154  188 ASN A ND2 
835  N N   . ARG A 111 ? 0.3822 0.4152 0.3422 0.0216  0.0182  0.0220  189 ARG A N   
836  C CA  . ARG A 111 ? 0.4072 0.4383 0.3709 0.0203  0.0175  0.0227  189 ARG A CA  
837  C C   . ARG A 111 ? 0.3494 0.3815 0.3172 0.0200  0.0165  0.0203  189 ARG A C   
838  O O   . ARG A 111 ? 0.4814 0.5158 0.4505 0.0201  0.0177  0.0192  189 ARG A O   
839  C CB  . ARG A 111 ? 0.4651 0.4957 0.4298 0.0186  0.0199  0.0250  189 ARG A CB  
840  C CG  . ARG A 111 ? 0.6348 0.6635 0.6033 0.0170  0.0196  0.0257  189 ARG A CG  
841  C CD  . ARG A 111 ? 0.7058 0.7320 0.6738 0.0177  0.0172  0.0260  189 ARG A CD  
842  N NE  . ARG A 111 ? 1.0139 1.0377 0.9842 0.0163  0.0173  0.0273  189 ARG A NE  
843  C CZ  . ARG A 111 ? 0.8453 0.8690 0.8198 0.0150  0.0170  0.0264  189 ARG A CZ  
844  N NH1 . ARG A 111 ? 0.6785 0.7044 0.6555 0.0149  0.0165  0.0243  189 ARG A NH1 
845  N NH2 . ARG A 111 ? 0.8249 0.8462 0.8009 0.0139  0.0172  0.0276  189 ARG A NH2 
846  N N   . ARG A 112 ? 0.2802 0.3107 0.2495 0.0200  0.0143  0.0194  190 ARG A N   
847  C CA  . ARG A 112 ? 0.2367 0.2673 0.2092 0.0197  0.0133  0.0175  190 ARG A CA  
848  C C   . ARG A 112 ? 0.2347 0.2640 0.2106 0.0181  0.0132  0.0185  190 ARG A C   
849  O O   . ARG A 112 ? 0.2209 0.2487 0.1963 0.0175  0.0135  0.0203  190 ARG A O   
850  C CB  . ARG A 112 ? 0.2357 0.2653 0.2072 0.0206  0.0110  0.0156  190 ARG A CB  
851  C CG  . ARG A 112 ? 0.2243 0.2550 0.1926 0.0221  0.0109  0.0141  190 ARG A CG  
852  C CD  . ARG A 112 ? 0.2503 0.2798 0.2175 0.0227  0.0086  0.0122  190 ARG A CD  
853  N NE  . ARG A 112 ? 0.2342 0.2624 0.2044 0.0220  0.0077  0.0108  190 ARG A NE  
854  C CZ  . ARG A 112 ? 0.2453 0.2736 0.2163 0.0225  0.0079  0.0092  190 ARG A CZ  
855  N NH1 . ARG A 112 ? 0.2594 0.2896 0.2289 0.0237  0.0090  0.0085  190 ARG A NH1 
856  N NH2 . ARG A 112 ? 0.2350 0.2615 0.2082 0.0219  0.0070  0.0084  190 ARG A NH2 
857  N N   . TYR A 113 ? 0.2407 0.2704 0.2198 0.0175  0.0129  0.0173  191 TYR A N   
858  C CA  . TYR A 113 ? 0.2565 0.2851 0.2386 0.0160  0.0127  0.0179  191 TYR A CA  
859  C C   . TYR A 113 ? 0.2201 0.2461 0.2018 0.0157  0.0112  0.0183  191 TYR A C   
860  O O   . TYR A 113 ? 0.2113 0.2366 0.1918 0.0164  0.0097  0.0171  191 TYR A O   
861  C CB  . TYR A 113 ? 0.2279 0.2571 0.2128 0.0159  0.0120  0.0163  191 TYR A CB  
862  C CG  . TYR A 113 ? 0.2129 0.2406 0.2002 0.0144  0.0113  0.0166  191 TYR A CG  
863  C CD1 . TYR A 113 ? 0.2162 0.2446 0.2058 0.0130  0.0125  0.0176  191 TYR A CD1 
864  C CD2 . TYR A 113 ? 0.2389 0.2644 0.2261 0.0143  0.0096  0.0158  191 TYR A CD2 
865  C CE1 . TYR A 113 ? 0.2154 0.2424 0.2071 0.0117  0.0119  0.0178  191 TYR A CE1 
866  C CE2 . TYR A 113 ? 0.2325 0.2567 0.2217 0.0130  0.0091  0.0161  191 TYR A CE2 
867  C CZ  . TYR A 113 ? 0.2138 0.2388 0.2052 0.0118  0.0103  0.0170  191 TYR A CZ  
868  O OH  . TYR A 113 ? 0.1842 0.2078 0.1773 0.0104  0.0098  0.0171  191 TYR A OH  
869  N N   . GLU A 114 ? 0.2110 0.2358 0.1938 0.0146  0.0118  0.0198  192 GLU A N   
870  C CA  . GLU A 114 ? 0.2414 0.2641 0.2244 0.0143  0.0106  0.0202  192 GLU A CA  
871  C C   . GLU A 114 ? 0.2412 0.2630 0.2273 0.0126  0.0109  0.0204  192 GLU A C   
872  O O   . GLU A 114 ? 0.1921 0.2145 0.1796 0.0117  0.0124  0.0212  192 GLU A O   
873  C CB  . GLU A 114 ? 0.2864 0.3081 0.2669 0.0150  0.0109  0.0219  192 GLU A CB  
874  C CG  . GLU A 114 ? 0.2832 0.3059 0.2603 0.0167  0.0103  0.0215  192 GLU A CG  
875  C CD  . GLU A 114 ? 0.3247 0.3463 0.2988 0.0177  0.0101  0.0232  192 GLU A CD  
876  O OE1 . GLU A 114 ? 0.3551 0.3750 0.3301 0.0176  0.0094  0.0238  192 GLU A OE1 
877  O OE2 . GLU A 114 ? 0.3064 0.3288 0.2772 0.0188  0.0106  0.0237  192 GLU A OE2 
878  N N   . VAL A 115 ? 0.2221 0.2425 0.2092 0.0123  0.0096  0.0197  193 VAL A N   
879  C CA  . VAL A 115 ? 0.2287 0.2482 0.2185 0.0108  0.0097  0.0196  193 VAL A CA  
880  C C   . VAL A 115 ? 0.3023 0.3204 0.2924 0.0102  0.0108  0.0214  193 VAL A C   
881  O O   . VAL A 115 ? 0.2740 0.2908 0.2625 0.0110  0.0105  0.0222  193 VAL A O   
882  C CB  . VAL A 115 ? 0.2144 0.2327 0.2049 0.0105  0.0082  0.0184  193 VAL A CB  
883  C CG1 . VAL A 115 ? 0.2527 0.2702 0.2456 0.0090  0.0084  0.0183  193 VAL A CG1 
884  C CG2 . VAL A 115 ? 0.2410 0.2599 0.2307 0.0111  0.0071  0.0168  193 VAL A CG2 
885  N N   . PRO A 116 ? 0.3276 0.3459 0.3196 0.0087  0.0120  0.0218  194 PRO A N   
886  C CA  . PRO A 116 ? 0.4143 0.4305 0.4064 0.0080  0.0132  0.0234  194 PRO A CA  
887  C C   . PRO A 116 ? 0.4232 0.4372 0.4162 0.0078  0.0122  0.0232  194 PRO A C   
888  O O   . PRO A 116 ? 0.3778 0.3919 0.3727 0.0069  0.0115  0.0218  194 PRO A O   
889  C CB  . PRO A 116 ? 0.4622 0.4796 0.4567 0.0062  0.0147  0.0234  194 PRO A CB  
890  C CG  . PRO A 116 ? 0.4473 0.4670 0.4435 0.0061  0.0137  0.0216  194 PRO A CG  
891  C CD  . PRO A 116 ? 0.3401 0.3604 0.3341 0.0079  0.0125  0.0209  194 PRO A CD  
892  N N   . LEU A 117 ? 0.4155 0.4275 0.4068 0.0088  0.0122  0.0244  195 LEU A N   
893  C CA  . LEU A 117 ? 0.5547 0.5649 0.5468 0.0091  0.0113  0.0241  195 LEU A CA  
894  C C   . LEU A 117 ? 0.6697 0.6771 0.6602 0.0100  0.0119  0.0260  195 LEU A C   
895  O O   . LEU A 117 ? 0.7693 0.7767 0.7570 0.0114  0.0118  0.0272  195 LEU A O   
896  C CB  . LEU A 117 ? 0.4967 0.5082 0.4884 0.0103  0.0094  0.0227  195 LEU A CB  
897  C CG  . LEU A 117 ? 0.5204 0.5308 0.5128 0.0110  0.0084  0.0222  195 LEU A CG  
898  C CD1 . LEU A 117 ? 0.4832 0.4945 0.4776 0.0101  0.0076  0.0202  195 LEU A CD1 
899  C CD2 . LEU A 117 ? 0.5584 0.5692 0.5486 0.0132  0.0074  0.0227  195 LEU A CD2 
900  N N   . GLU A 118 ? 0.6727 0.6776 0.6647 0.0092  0.0123  0.0262  196 GLU A N   
901  C CA  . GLU A 118 ? 0.9232 0.9248 0.9137 0.0104  0.0126  0.0280  196 GLU A CA  
902  C C   . GLU A 118 ? 0.7043 0.7065 0.6940 0.0126  0.0108  0.0274  196 GLU A C   
903  O O   . GLU A 118 ? 0.7084 0.7122 0.7002 0.0125  0.0097  0.0255  196 GLU A O   
904  C CB  . GLU A 118 ? 0.9174 0.9160 0.9099 0.0091  0.0135  0.0280  196 GLU A CB  
905  C CG  . GLU A 118 ? 0.9743 0.9721 0.9678 0.0067  0.0155  0.0285  196 GLU A CG  
906  C CD  . GLU A 118 ? 1.0557 1.0509 1.0516 0.0052  0.0160  0.0278  196 GLU A CD  
907  O OE1 . GLU A 118 ? 0.8085 0.8015 0.8045 0.0063  0.0154  0.0276  196 GLU A OE1 
908  O OE2 . GLU A 118 ? 1.0659 1.0616 1.0636 0.0029  0.0171  0.0272  196 GLU A OE2 
909  N N   . THR A 119 ? 0.9405 0.9417 0.9273 0.0147  0.0104  0.0291  197 THR A N   
910  C CA  . THR A 119 ? 1.1578 1.1600 1.1441 0.0170  0.0084  0.0285  197 THR A CA  
911  C C   . THR A 119 ? 1.0490 1.0488 1.0370 0.0176  0.0081  0.0283  197 THR A C   
912  O O   . THR A 119 ? 0.8333 0.8296 0.8216 0.0168  0.0095  0.0295  197 THR A O   
913  C CB  . THR A 119 ? 1.2250 1.2272 1.2072 0.0192  0.0079  0.0302  197 THR A CB  
914  O OG1 . THR A 119 ? 1.3523 1.3507 1.3320 0.0193  0.0095  0.0328  197 THR A OG1 
915  C CG2 . THR A 119 ? 0.9591 0.9646 0.9401 0.0188  0.0078  0.0294  197 THR A CG2 
916  N N   . PRO A 120 ? 1.1387 1.1405 1.1283 0.0190  0.0064  0.0267  198 PRO A N   
917  C CA  . PRO A 120 ? 1.1967 1.1974 1.1890 0.0191  0.0062  0.0256  198 PRO A CA  
918  C C   . PRO A 120 ? 1.1100 1.1061 1.1018 0.0200  0.0070  0.0273  198 PRO A C   
919  O O   . PRO A 120 ? 1.2788 1.2730 1.2680 0.0223  0.0065  0.0291  198 PRO A O   
920  C CB  . PRO A 120 ? 1.0596 1.0636 1.0528 0.0211  0.0041  0.0240  198 PRO A CB  
921  C CG  . PRO A 120 ? 0.9415 0.9487 0.9333 0.0208  0.0035  0.0234  198 PRO A CG  
922  C CD  . PRO A 120 ? 1.0651 1.0703 1.0536 0.0206  0.0046  0.0258  198 PRO A CD  
923  N N   . SER A 128 ? 0.5331 0.6013 0.5483 0.0559  -0.0287 0.0015  206 SER A N   
924  C CA  . SER A 128 ? 0.4504 0.5199 0.4637 0.0524  -0.0283 0.0006  206 SER A CA  
925  C C   . SER A 128 ? 0.4394 0.5056 0.4538 0.0476  -0.0249 0.0004  206 SER A C   
926  O O   . SER A 128 ? 0.4007 0.4674 0.4194 0.0463  -0.0234 -0.0009 206 SER A O   
927  C CB  . SER A 128 ? 0.4604 0.5385 0.4777 0.0520  -0.0304 -0.0035 206 SER A CB  
928  O OG  . SER A 128 ? 0.4141 0.4930 0.4291 0.0491  -0.0303 -0.0043 206 SER A OG  
929  N N   . PRO A 129 ? 0.3288 0.3919 0.3391 0.0452  -0.0237 0.0016  207 PRO A N   
930  C CA  . PRO A 129 ? 0.2965 0.3568 0.3079 0.0408  -0.0208 0.0012  207 PRO A CA  
931  C C   . PRO A 129 ? 0.2590 0.3249 0.2756 0.0378  -0.0205 -0.0027 207 PRO A C   
932  O O   . PRO A 129 ? 0.2867 0.3587 0.3058 0.0388  -0.0226 -0.0053 207 PRO A O   
933  C CB  . PRO A 129 ? 0.2807 0.3374 0.2867 0.0394  -0.0201 0.0032  207 PRO A CB  
934  C CG  . PRO A 129 ? 0.2610 0.3166 0.2624 0.0432  -0.0220 0.0056  207 PRO A CG  
935  C CD  . PRO A 129 ? 0.3405 0.4018 0.3449 0.0463  -0.0248 0.0037  207 PRO A CD  
936  N N   . LEU A 130 ? 0.2421 0.3057 0.2602 0.0342  -0.0179 -0.0032 208 LEU A N   
937  C CA  . LEU A 130 ? 0.2536 0.3213 0.2760 0.0309  -0.0172 -0.0067 208 LEU A CA  
938  C C   . LEU A 130 ? 0.2425 0.3115 0.2631 0.0285  -0.0175 -0.0080 208 LEU A C   
939  O O   . LEU A 130 ? 0.1853 0.2583 0.2092 0.0260  -0.0174 -0.0111 208 LEU A O   
940  C CB  . LEU A 130 ? 0.2581 0.3224 0.2819 0.0279  -0.0143 -0.0065 208 LEU A CB  
941  C CG  . LEU A 130 ? 0.3360 0.3992 0.3622 0.0296  -0.0136 -0.0059 208 LEU A CG  
942  C CD1 . LEU A 130 ? 0.3573 0.4177 0.3847 0.0261  -0.0107 -0.0063 208 LEU A CD1 
943  C CD2 . LEU A 130 ? 0.3294 0.3989 0.3604 0.0319  -0.0152 -0.0085 208 LEU A CD2 
944  N N   . TYR A 131 ? 0.2137 0.2792 0.2291 0.0293  -0.0179 -0.0057 209 TYR A N   
945  C CA  . TYR A 131 ? 0.2336 0.2993 0.2466 0.0274  -0.0181 -0.0065 209 TYR A CA  
946  C C   . TYR A 131 ? 0.2793 0.3481 0.2899 0.0304  -0.0209 -0.0066 209 TYR A C   
947  O O   . TYR A 131 ? 0.2413 0.3099 0.2505 0.0341  -0.0223 -0.0048 209 TYR A O   
948  C CB  . TYR A 131 ? 0.2402 0.2995 0.2489 0.0260  -0.0162 -0.0039 209 TYR A CB  
949  C CG  . TYR A 131 ? 0.2241 0.2793 0.2292 0.0287  -0.0160 -0.0002 209 TYR A CG  
950  C CD1 . TYR A 131 ? 0.2652 0.3200 0.2660 0.0313  -0.0175 0.0013  209 TYR A CD1 
951  C CD2 . TYR A 131 ? 0.2254 0.2769 0.2313 0.0287  -0.0143 0.0015  209 TYR A CD2 
952  C CE1 . TYR A 131 ? 0.2456 0.2963 0.2429 0.0336  -0.0172 0.0048  209 TYR A CE1 
953  C CE2 . TYR A 131 ? 0.2256 0.2730 0.2284 0.0309  -0.0141 0.0048  209 TYR A CE2 
954  C CZ  . TYR A 131 ? 0.2615 0.3084 0.2600 0.0333  -0.0154 0.0066  209 TYR A CZ  
955  O OH  . TYR A 131 ? 0.2873 0.3298 0.2823 0.0354  -0.0149 0.0099  209 TYR A OH  
956  N N   . SER A 132 ? 0.2768 0.3479 0.2867 0.0288  -0.0217 -0.0087 210 SER A N   
957  C CA  . SER A 132 ? 0.2928 0.3647 0.2983 0.0311  -0.0238 -0.0082 210 SER A CA  
958  C C   . SER A 132 ? 0.3040 0.3724 0.3059 0.0286  -0.0224 -0.0079 210 SER A C   
959  O O   . SER A 132 ? 0.2421 0.3085 0.2455 0.0253  -0.0204 -0.0087 210 SER A O   
960  C CB  . SER A 132 ? 0.3169 0.3960 0.3249 0.0320  -0.0266 -0.0115 210 SER A CB  
961  O OG  . SER A 132 ? 0.3501 0.4320 0.3613 0.0283  -0.0260 -0.0151 210 SER A OG  
962  N N   . VAL A 133 ? 0.2625 0.3301 0.2596 0.0305  -0.0235 -0.0067 211 VAL A N   
963  C CA  . VAL A 133 ? 0.2797 0.3438 0.2730 0.0287  -0.0223 -0.0062 211 VAL A CA  
964  C C   . VAL A 133 ? 0.2517 0.3189 0.2421 0.0299  -0.0244 -0.0078 211 VAL A C   
965  O O   . VAL A 133 ? 0.2827 0.3524 0.2713 0.0331  -0.0266 -0.0071 211 VAL A O   
966  C CB  . VAL A 133 ? 0.3403 0.3985 0.3299 0.0295  -0.0203 -0.0023 211 VAL A CB  
967  C CG1 . VAL A 133 ? 0.4520 0.5098 0.4379 0.0333  -0.0216 0.0004  211 VAL A CG1 
968  C CG2 . VAL A 133 ? 0.3678 0.4228 0.3545 0.0274  -0.0187 -0.0021 211 VAL A CG2 
969  N N   . GLU A 134 ? 0.2517 0.3190 0.2417 0.0274  -0.0240 -0.0101 212 GLU A N   
970  C CA  . GLU A 134 ? 0.2597 0.3292 0.2463 0.0282  -0.0258 -0.0117 212 GLU A CA  
971  C C   . GLU A 134 ? 0.2193 0.2848 0.2032 0.0259  -0.0240 -0.0119 212 GLU A C   
972  O O   . GLU A 134 ? 0.2181 0.2795 0.2031 0.0237  -0.0216 -0.0111 212 GLU A O   
973  C CB  . GLU A 134 ? 0.2822 0.3582 0.2726 0.0276  -0.0281 -0.0159 212 GLU A CB  
974  C CG  . GLU A 134 ? 0.3803 0.4577 0.3764 0.0242  -0.0271 -0.0185 212 GLU A CG  
975  C CD  . GLU A 134 ? 0.4701 0.5542 0.4698 0.0233  -0.0293 -0.0229 212 GLU A CD  
976  O OE1 . GLU A 134 ? 0.5105 0.5952 0.5086 0.0218  -0.0299 -0.0253 212 GLU A OE1 
977  O OE2 . GLU A 134 ? 0.4691 0.5580 0.4731 0.0242  -0.0306 -0.0240 212 GLU A OE2 
978  N N   . PHE A 135 ? 0.2091 0.2754 0.1892 0.0267  -0.0251 -0.0130 213 PHE A N   
979  C CA  . PHE A 135 ? 0.2079 0.2702 0.1846 0.0254  -0.0235 -0.0129 213 PHE A CA  
980  C C   . PHE A 135 ? 0.2516 0.3160 0.2278 0.0239  -0.0246 -0.0168 213 PHE A C   
981  O O   . PHE A 135 ? 0.2523 0.3215 0.2282 0.0252  -0.0271 -0.0189 213 PHE A O   
982  C CB  . PHE A 135 ? 0.2221 0.2822 0.1932 0.0282  -0.0231 -0.0096 213 PHE A CB  
983  C CG  . PHE A 135 ? 0.2220 0.2798 0.1931 0.0297  -0.0221 -0.0057 213 PHE A CG  
984  C CD1 . PHE A 135 ? 0.2559 0.3092 0.2277 0.0283  -0.0194 -0.0036 213 PHE A CD1 
985  C CD2 . PHE A 135 ? 0.2569 0.3170 0.2275 0.0326  -0.0238 -0.0043 213 PHE A CD2 
986  C CE1 . PHE A 135 ? 0.2642 0.3154 0.2363 0.0295  -0.0185 -0.0003 213 PHE A CE1 
987  C CE2 . PHE A 135 ? 0.2558 0.3133 0.2264 0.0339  -0.0228 -0.0009 213 PHE A CE2 
988  C CZ  . PHE A 135 ? 0.2609 0.3140 0.2324 0.0323  -0.0201 0.0009  213 PHE A CZ  
989  N N   . SER A 136 ? 0.2357 0.2966 0.2118 0.0214  -0.0228 -0.0178 214 SER A N   
990  C CA  . SER A 136 ? 0.2247 0.2861 0.1992 0.0201  -0.0235 -0.0212 214 SER A CA  
991  C C   . SER A 136 ? 0.2460 0.3050 0.2148 0.0221  -0.0230 -0.0197 214 SER A C   
992  O O   . SER A 136 ? 0.2599 0.3152 0.2270 0.0227  -0.0211 -0.0166 214 SER A O   
993  C CB  . SER A 136 ? 0.2451 0.3033 0.2223 0.0164  -0.0218 -0.0231 214 SER A CB  
994  O OG  . SER A 136 ? 0.4368 0.4944 0.4119 0.0153  -0.0222 -0.0262 214 SER A OG  
995  N N   . GLU A 137 ? 0.2454 0.3069 0.2112 0.0229  -0.0247 -0.0221 215 GLU A N   
996  C CA  . GLU A 137 ? 0.2457 0.3059 0.2057 0.0250  -0.0245 -0.0210 215 GLU A CA  
997  C C   . GLU A 137 ? 0.2610 0.3170 0.2193 0.0235  -0.0225 -0.0221 215 GLU A C   
998  O O   . GLU A 137 ? 0.2412 0.2941 0.1964 0.0246  -0.0208 -0.0197 215 GLU A O   
999  C CB  . GLU A 137 ? 0.2822 0.3472 0.2395 0.0267  -0.0273 -0.0233 215 GLU A CB  
1000 C CG  . GLU A 137 ? 0.3623 0.4268 0.3132 0.0293  -0.0273 -0.0217 215 GLU A CG  
1001 C CD  . GLU A 137 ? 0.4685 0.5381 0.4164 0.0314  -0.0304 -0.0234 215 GLU A CD  
1002 O OE1 . GLU A 137 ? 0.3593 0.4327 0.3101 0.0302  -0.0325 -0.0272 215 GLU A OE1 
1003 O OE2 . GLU A 137 ? 0.4265 0.4964 0.3693 0.0342  -0.0307 -0.0211 215 GLU A OE2 
1004 N N   . GLU A 138 ? 0.2741 0.3297 0.2344 0.0209  -0.0228 -0.0257 216 GLU A N   
1005 C CA  . GLU A 138 ? 0.2939 0.3453 0.2524 0.0197  -0.0213 -0.0272 216 GLU A CA  
1006 C C   . GLU A 138 ? 0.3136 0.3638 0.2759 0.0162  -0.0212 -0.0305 216 GLU A C   
1007 O O   . GLU A 138 ? 0.3396 0.3931 0.3027 0.0152  -0.0231 -0.0340 216 GLU A O   
1008 C CB  . GLU A 138 ? 0.3170 0.3699 0.2704 0.0214  -0.0223 -0.0290 216 GLU A CB  
1009 C CG  . GLU A 138 ? 0.3703 0.4187 0.3213 0.0208  -0.0207 -0.0303 216 GLU A CG  
1010 C CD  . GLU A 138 ? 0.3722 0.4222 0.3181 0.0226  -0.0215 -0.0321 216 GLU A CD  
1011 O OE1 . GLU A 138 ? 0.4677 0.5149 0.4106 0.0236  -0.0198 -0.0314 216 GLU A OE1 
1012 O OE2 . GLU A 138 ? 0.4836 0.5378 0.4284 0.0231  -0.0238 -0.0344 216 GLU A OE2 
1013 N N   . PRO A 139 ? 0.2664 0.3120 0.2309 0.0143  -0.0192 -0.0295 217 PRO A N   
1014 C CA  . PRO A 139 ? 0.3019 0.3441 0.2660 0.0153  -0.0172 -0.0257 217 PRO A CA  
1015 C C   . PRO A 139 ? 0.2875 0.3321 0.2536 0.0164  -0.0174 -0.0226 217 PRO A C   
1016 O O   . PRO A 139 ? 0.2898 0.3374 0.2593 0.0154  -0.0185 -0.0235 217 PRO A O   
1017 C CB  . PRO A 139 ? 0.3089 0.3463 0.2752 0.0126  -0.0156 -0.0263 217 PRO A CB  
1018 C CG  . PRO A 139 ? 0.3253 0.3649 0.2952 0.0099  -0.0167 -0.0292 217 PRO A CG  
1019 C CD  . PRO A 139 ? 0.3007 0.3449 0.2689 0.0108  -0.0189 -0.0320 217 PRO A CD  
1020 N N   . PHE A 140 ? 0.2543 0.2974 0.2184 0.0184  -0.0162 -0.0191 218 PHE A N   
1021 C CA  . PHE A 140 ? 0.2559 0.3003 0.2214 0.0195  -0.0160 -0.0159 218 PHE A CA  
1022 C C   . PHE A 140 ? 0.2481 0.2912 0.2182 0.0174  -0.0152 -0.0154 218 PHE A C   
1023 O O   . PHE A 140 ? 0.2431 0.2825 0.2143 0.0156  -0.0137 -0.0156 218 PHE A O   
1024 C CB  . PHE A 140 ? 0.2785 0.3208 0.2412 0.0214  -0.0144 -0.0125 218 PHE A CB  
1025 C CG  . PHE A 140 ? 0.2330 0.2752 0.1974 0.0221  -0.0138 -0.0092 218 PHE A CG  
1026 C CD1 . PHE A 140 ? 0.2385 0.2837 0.2027 0.0238  -0.0152 -0.0080 218 PHE A CD1 
1027 C CD2 . PHE A 140 ? 0.2454 0.2843 0.2118 0.0210  -0.0119 -0.0074 218 PHE A CD2 
1028 C CE1 . PHE A 140 ? 0.2241 0.2688 0.1900 0.0244  -0.0146 -0.0051 218 PHE A CE1 
1029 C CE2 . PHE A 140 ? 0.2455 0.2841 0.2135 0.0214  -0.0113 -0.0046 218 PHE A CE2 
1030 C CZ  . PHE A 140 ? 0.2205 0.2619 0.1884 0.0231  -0.0126 -0.0035 218 PHE A CZ  
1031 N N   . GLY A 141 ? 0.2430 0.2892 0.2157 0.0179  -0.0162 -0.0147 219 GLY A N   
1032 C CA  . GLY A 141 ? 0.2454 0.2904 0.2220 0.0163  -0.0152 -0.0136 219 GLY A CA  
1033 C C   . GLY A 141 ? 0.2777 0.3257 0.2559 0.0180  -0.0160 -0.0118 219 GLY A C   
1034 O O   . GLY A 141 ? 0.2168 0.2684 0.1938 0.0201  -0.0179 -0.0121 219 GLY A O   
1035 N N   . VAL A 142 ? 0.2302 0.2764 0.2108 0.0174  -0.0147 -0.0099 220 VAL A N   
1036 C CA  . VAL A 142 ? 0.2277 0.2761 0.2104 0.0188  -0.0153 -0.0083 220 VAL A CA  
1037 C C   . VAL A 142 ? 0.2441 0.2945 0.2315 0.0165  -0.0155 -0.0105 220 VAL A C   
1038 O O   . VAL A 142 ? 0.2156 0.2633 0.2045 0.0140  -0.0140 -0.0112 220 VAL A O   
1039 C CB  . VAL A 142 ? 0.2068 0.2517 0.1891 0.0193  -0.0135 -0.0048 220 VAL A CB  
1040 C CG1 . VAL A 142 ? 0.2187 0.2652 0.2033 0.0207  -0.0140 -0.0034 220 VAL A CG1 
1041 C CG2 . VAL A 142 ? 0.2307 0.2736 0.2084 0.0212  -0.0129 -0.0026 220 VAL A CG2 
1042 N N   . ILE A 143 ? 0.2055 0.2606 0.1951 0.0176  -0.0173 -0.0117 221 ILE A N   
1043 C CA  . ILE A 143 ? 0.2182 0.2762 0.2127 0.0156  -0.0175 -0.0141 221 ILE A CA  
1044 C C   . ILE A 143 ? 0.2202 0.2798 0.2173 0.0174  -0.0177 -0.0124 221 ILE A C   
1045 O O   . ILE A 143 ? 0.2503 0.3121 0.2462 0.0204  -0.0193 -0.0113 221 ILE A O   
1046 C CB  . ILE A 143 ? 0.2374 0.3006 0.2334 0.0151  -0.0196 -0.0179 221 ILE A CB  
1047 C CG1 . ILE A 143 ? 0.2593 0.3204 0.2530 0.0131  -0.0193 -0.0199 221 ILE A CG1 
1048 C CG2 . ILE A 143 ? 0.2351 0.3022 0.2367 0.0131  -0.0197 -0.0204 221 ILE A CG2 
1049 C CD1 . ILE A 143 ? 0.3292 0.3924 0.3192 0.0153  -0.0213 -0.0207 221 ILE A CD1 
1050 N N   . VAL A 144 ? 0.2096 0.2678 0.2098 0.0155  -0.0160 -0.0122 222 VAL A N   
1051 C CA  . VAL A 144 ? 0.2480 0.3074 0.2508 0.0170  -0.0160 -0.0108 222 VAL A CA  
1052 C C   . VAL A 144 ? 0.2354 0.2991 0.2435 0.0151  -0.0161 -0.0138 222 VAL A C   
1053 O O   . VAL A 144 ? 0.2069 0.2691 0.2165 0.0118  -0.0145 -0.0152 222 VAL A O   
1054 C CB  . VAL A 144 ? 0.2449 0.2990 0.2466 0.0167  -0.0138 -0.0078 222 VAL A CB  
1055 C CG1 . VAL A 144 ? 0.2389 0.2938 0.2433 0.0180  -0.0135 -0.0066 222 VAL A CG1 
1056 C CG2 . VAL A 144 ? 0.2621 0.3128 0.2590 0.0185  -0.0136 -0.0050 222 VAL A CG2 
1057 N N   . HIS A 145 ? 0.2212 0.2901 0.2318 0.0172  -0.0180 -0.0149 223 HIS A N   
1058 C CA  . HIS A 145 ? 0.2478 0.3216 0.2640 0.0159  -0.0181 -0.0178 223 HIS A CA  
1059 C C   . HIS A 145 ? 0.2101 0.2837 0.2288 0.0173  -0.0174 -0.0162 223 HIS A C   
1060 O O   . HIS A 145 ? 0.2240 0.2958 0.2407 0.0204  -0.0180 -0.0135 223 HIS A O   
1061 C CB  . HIS A 145 ? 0.2712 0.3520 0.2894 0.0176  -0.0210 -0.0204 223 HIS A CB  
1062 C CG  . HIS A 145 ? 0.3001 0.3826 0.3175 0.0156  -0.0219 -0.0232 223 HIS A CG  
1063 N ND1 . HIS A 145 ? 0.3464 0.4281 0.3592 0.0173  -0.0234 -0.0227 223 HIS A ND1 
1064 C CD2 . HIS A 145 ? 0.2823 0.3674 0.3029 0.0120  -0.0214 -0.0268 223 HIS A CD2 
1065 C CE1 . HIS A 145 ? 0.2680 0.3517 0.2813 0.0148  -0.0239 -0.0259 223 HIS A CE1 
1066 N NE2 . HIS A 145 ? 0.3127 0.3984 0.3307 0.0116  -0.0227 -0.0284 223 HIS A NE2 
1067 N N   . ARG A 146 ? 0.2163 0.2915 0.2393 0.0149  -0.0159 -0.0180 224 ARG A N   
1068 C CA  . ARG A 146 ? 0.2293 0.3065 0.2559 0.0164  -0.0157 -0.0178 224 ARG A CA  
1069 C C   . ARG A 146 ? 0.2536 0.3380 0.2834 0.0189  -0.0184 -0.0201 224 ARG A C   
1070 O O   . ARG A 146 ? 0.2154 0.3048 0.2483 0.0169  -0.0190 -0.0235 224 ARG A O   
1071 C CB  . ARG A 146 ? 0.2112 0.2884 0.2412 0.0129  -0.0133 -0.0194 224 ARG A CB  
1072 C CG  . ARG A 146 ? 0.2111 0.2905 0.2450 0.0143  -0.0128 -0.0195 224 ARG A CG  
1073 C CD  . ARG A 146 ? 0.2056 0.2842 0.2419 0.0106  -0.0100 -0.0208 224 ARG A CD  
1074 N NE  . ARG A 146 ? 0.1950 0.2665 0.2273 0.0087  -0.0080 -0.0184 224 ARG A NE  
1075 C CZ  . ARG A 146 ? 0.1912 0.2580 0.2212 0.0102  -0.0073 -0.0154 224 ARG A CZ  
1076 N NH1 . ARG A 146 ? 0.1902 0.2580 0.2212 0.0138  -0.0083 -0.0143 224 ARG A NH1 
1077 N NH2 . ARG A 146 ? 0.2154 0.2764 0.2420 0.0083  -0.0056 -0.0136 224 ARG A NH2 
1078 N N   . GLN A 147 ? 0.2211 0.3061 0.2503 0.0232  -0.0200 -0.0182 225 GLN A N   
1079 C CA  . GLN A 147 ? 0.2821 0.3740 0.3139 0.0263  -0.0230 -0.0201 225 GLN A CA  
1080 C C   . GLN A 147 ? 0.2586 0.3570 0.2974 0.0253  -0.0229 -0.0237 225 GLN A C   
1081 O O   . GLN A 147 ? 0.2561 0.3616 0.2981 0.0260  -0.0251 -0.0267 225 GLN A O   
1082 C CB  . GLN A 147 ? 0.3171 0.4074 0.3464 0.0314  -0.0247 -0.0171 225 GLN A CB  
1083 C CG  . GLN A 147 ? 0.4727 0.5572 0.4951 0.0327  -0.0249 -0.0136 225 GLN A CG  
1084 C CD  . GLN A 147 ? 0.5197 0.6056 0.5392 0.0374  -0.0279 -0.0122 225 GLN A CD  
1085 O OE1 . GLN A 147 ? 0.5070 0.5958 0.5245 0.0380  -0.0299 -0.0133 225 GLN A OE1 
1086 N NE2 . GLN A 147 ? 0.4537 0.5372 0.4724 0.0408  -0.0282 -0.0096 225 GLN A NE2 
1087 N N   . LEU A 148 ? 0.2487 0.3454 0.2899 0.0238  -0.0205 -0.0235 226 LEU A N   
1088 C CA  . LEU A 148 ? 0.2389 0.3419 0.2868 0.0232  -0.0201 -0.0267 226 LEU A CA  
1089 C C   . LEU A 148 ? 0.2459 0.3544 0.2974 0.0193  -0.0199 -0.0308 226 LEU A C   
1090 O O   . LEU A 148 ? 0.2246 0.3408 0.2813 0.0200  -0.0213 -0.0341 226 LEU A O   
1091 C CB  . LEU A 148 ? 0.2357 0.3353 0.2850 0.0219  -0.0172 -0.0258 226 LEU A CB  
1092 C CG  . LEU A 148 ? 0.2864 0.3923 0.3425 0.0220  -0.0167 -0.0289 226 LEU A CG  
1093 C CD1 . LEU A 148 ? 0.3181 0.4292 0.3768 0.0271  -0.0197 -0.0295 226 LEU A CD1 
1094 C CD2 . LEU A 148 ? 0.2787 0.3802 0.3351 0.0208  -0.0138 -0.0276 226 LEU A CD2 
1095 N N   . ASP A 149 ? 0.2190 0.3233 0.2678 0.0152  -0.0181 -0.0307 227 ASP A N   
1096 C CA  . ASP A 149 ? 0.2342 0.3425 0.2860 0.0109  -0.0174 -0.0345 227 ASP A CA  
1097 C C   . ASP A 149 ? 0.2544 0.3611 0.3025 0.0094  -0.0184 -0.0349 227 ASP A C   
1098 O O   . ASP A 149 ? 0.2629 0.3722 0.3131 0.0057  -0.0178 -0.0380 227 ASP A O   
1099 C CB  . ASP A 149 ? 0.2238 0.3291 0.2768 0.0065  -0.0137 -0.0349 227 ASP A CB  
1100 C CG  . ASP A 149 ? 0.2555 0.3514 0.3027 0.0055  -0.0118 -0.0311 227 ASP A CG  
1101 O OD1 . ASP A 149 ? 0.2131 0.3049 0.2554 0.0071  -0.0129 -0.0288 227 ASP A OD1 
1102 O OD2 . ASP A 149 ? 0.2639 0.3566 0.3113 0.0031  -0.0091 -0.0306 227 ASP A OD2 
1103 N N   . GLY A 150 ? 0.2503 0.3527 0.2929 0.0121  -0.0197 -0.0319 228 GLY A N   
1104 C CA  . GLY A 150 ? 0.2482 0.3486 0.2869 0.0109  -0.0205 -0.0322 228 GLY A CA  
1105 C C   . GLY A 150 ? 0.2315 0.3254 0.2673 0.0068  -0.0179 -0.0316 228 GLY A C   
1106 O O   . GLY A 150 ? 0.2869 0.3798 0.3203 0.0052  -0.0184 -0.0327 228 GLY A O   
1107 N N   . ARG A 151 ? 0.2387 0.3282 0.2744 0.0051  -0.0152 -0.0300 229 ARG A N   
1108 C CA  . ARG A 151 ? 0.2581 0.3412 0.2907 0.0015  -0.0128 -0.0292 229 ARG A CA  
1109 C C   . ARG A 151 ? 0.2217 0.2989 0.2482 0.0033  -0.0133 -0.0261 229 ARG A C   
1110 O O   . ARG A 151 ? 0.1797 0.2553 0.2043 0.0067  -0.0140 -0.0234 229 ARG A O   
1111 C CB  . ARG A 151 ? 0.2623 0.3421 0.2959 -0.0003 -0.0100 -0.0281 229 ARG A CB  
1112 C CG  . ARG A 151 ? 0.2801 0.3544 0.3113 -0.0045 -0.0076 -0.0281 229 ARG A CG  
1113 C CD  . ARG A 151 ? 0.3230 0.3950 0.3553 -0.0066 -0.0050 -0.0274 229 ARG A CD  
1114 N NE  . ARG A 151 ? 0.3003 0.3787 0.3383 -0.0078 -0.0045 -0.0303 229 ARG A NE  
1115 C CZ  . ARG A 151 ? 0.3569 0.4386 0.3979 -0.0114 -0.0036 -0.0336 229 ARG A CZ  
1116 N NH1 . ARG A 151 ? 0.3588 0.4376 0.3975 -0.0144 -0.0032 -0.0345 229 ARG A NH1 
1117 N NH2 . ARG A 151 ? 0.3535 0.4415 0.4000 -0.0122 -0.0030 -0.0361 229 ARG A NH2 
1118 N N   . VAL A 152 ? 0.2351 0.3091 0.2588 0.0011  -0.0129 -0.0268 230 VAL A N   
1119 C CA  . VAL A 152 ? 0.2034 0.2720 0.2216 0.0025  -0.0131 -0.0242 230 VAL A CA  
1120 C C   . VAL A 152 ? 0.1985 0.2607 0.2146 0.0015  -0.0107 -0.0214 230 VAL A C   
1121 O O   . VAL A 152 ? 0.2463 0.3057 0.2627 -0.0017 -0.0088 -0.0222 230 VAL A O   
1122 C CB  . VAL A 152 ? 0.2226 0.2902 0.2387 0.0006  -0.0135 -0.0263 230 VAL A CB  
1123 C CG1 . VAL A 152 ? 0.2107 0.2733 0.2213 0.0023  -0.0137 -0.0239 230 VAL A CG1 
1124 C CG2 . VAL A 152 ? 0.2264 0.3010 0.2449 0.0013  -0.0160 -0.0295 230 VAL A CG2 
1125 N N   . LEU A 153 ? 0.1834 0.2433 0.1974 0.0043  -0.0107 -0.0183 231 LEU A N   
1126 C CA  . LEU A 153 ? 0.1865 0.2409 0.1987 0.0037  -0.0087 -0.0156 231 LEU A CA  
1127 C C   . LEU A 153 ? 0.1893 0.2385 0.1969 0.0038  -0.0083 -0.0140 231 LEU A C   
1128 O O   . LEU A 153 ? 0.1982 0.2431 0.2044 0.0016  -0.0067 -0.0135 231 LEU A O   
1129 C CB  . LEU A 153 ? 0.1955 0.2503 0.2085 0.0066  -0.0089 -0.0133 231 LEU A CB  
1130 C CG  . LEU A 153 ? 0.2057 0.2657 0.2233 0.0073  -0.0095 -0.0149 231 LEU A CG  
1131 C CD1 . LEU A 153 ? 0.2235 0.2824 0.2413 0.0099  -0.0093 -0.0124 231 LEU A CD1 
1132 C CD2 . LEU A 153 ? 0.2463 0.3078 0.2674 0.0037  -0.0079 -0.0173 231 LEU A CD2 
1133 N N   . LEU A 154 ? 0.2056 0.2555 0.2107 0.0063  -0.0098 -0.0132 232 LEU A N   
1134 C CA  . LEU A 154 ? 0.2558 0.3017 0.2566 0.0068  -0.0096 -0.0120 232 LEU A CA  
1135 C C   . LEU A 154 ? 0.2276 0.2759 0.2272 0.0070  -0.0113 -0.0142 232 LEU A C   
1136 O O   . LEU A 154 ? 0.2305 0.2835 0.2312 0.0087  -0.0132 -0.0154 232 LEU A O   
1137 C CB  . LEU A 154 ? 0.2944 0.3387 0.2928 0.0097  -0.0097 -0.0087 232 LEU A CB  
1138 C CG  . LEU A 154 ? 0.4447 0.4842 0.4395 0.0099  -0.0085 -0.0066 232 LEU A CG  
1139 C CD1 . LEU A 154 ? 0.4838 0.5197 0.4794 0.0080  -0.0066 -0.0056 232 LEU A CD1 
1140 C CD2 . LEU A 154 ? 0.4914 0.5307 0.4840 0.0129  -0.0088 -0.0039 232 LEU A CD2 
1141 N N   . ASN A 155 ? 0.2475 0.2925 0.2447 0.0055  -0.0107 -0.0150 233 ASN A N   
1142 C CA  . ASN A 155 ? 0.2214 0.2678 0.2166 0.0060  -0.0121 -0.0169 233 ASN A CA  
1143 C C   . ASN A 155 ? 0.2158 0.2571 0.2071 0.0059  -0.0112 -0.0160 233 ASN A C   
1144 O O   . ASN A 155 ? 0.2189 0.2568 0.2099 0.0034  -0.0101 -0.0172 233 ASN A O   
1145 C CB  . ASN A 155 ? 0.2288 0.2782 0.2267 0.0035  -0.0128 -0.0207 233 ASN A CB  
1146 C CG  . ASN A 155 ? 0.2331 0.2840 0.2289 0.0038  -0.0143 -0.0231 233 ASN A CG  
1147 O OD1 . ASN A 155 ? 0.2293 0.2789 0.2214 0.0060  -0.0148 -0.0219 233 ASN A OD1 
1148 N ND2 . ASN A 155 ? 0.2524 0.3064 0.2508 0.0016  -0.0150 -0.0266 233 ASN A ND2 
1149 N N   . THR A 156 ? 0.2469 0.2874 0.2351 0.0086  -0.0115 -0.0140 234 THR A N   
1150 C CA  . THR A 156 ? 0.2190 0.2550 0.2039 0.0087  -0.0104 -0.0130 234 THR A CA  
1151 C C   . THR A 156 ? 0.2581 0.2939 0.2405 0.0086  -0.0112 -0.0155 234 THR A C   
1152 O O   . THR A 156 ? 0.2242 0.2565 0.2038 0.0089  -0.0104 -0.0151 234 THR A O   
1153 C CB  . THR A 156 ? 0.2345 0.2692 0.2172 0.0111  -0.0097 -0.0097 234 THR A CB  
1154 O OG1 . THR A 156 ? 0.2302 0.2675 0.2105 0.0136  -0.0110 -0.0095 234 THR A OG1 
1155 C CG2 . THR A 156 ? 0.2036 0.2384 0.1886 0.0113  -0.0090 -0.0075 234 THR A CG2 
1156 N N   . THR A 157 ? 0.2565 0.2964 0.2402 0.0081  -0.0128 -0.0182 235 THR A N   
1157 C CA  . THR A 157 ? 0.2752 0.3154 0.2570 0.0076  -0.0138 -0.0212 235 THR A CA  
1158 C C   . THR A 157 ? 0.2933 0.3291 0.2752 0.0046  -0.0126 -0.0230 235 THR A C   
1159 O O   . THR A 157 ? 0.2963 0.3305 0.2759 0.0043  -0.0129 -0.0250 235 THR A O   
1160 C CB  . THR A 157 ? 0.2800 0.3263 0.2637 0.0077  -0.0160 -0.0238 235 THR A CB  
1161 O OG1 . THR A 157 ? 0.2891 0.3390 0.2729 0.0105  -0.0171 -0.0217 235 THR A OG1 
1162 C CG2 . THR A 157 ? 0.2977 0.3451 0.2787 0.0081  -0.0173 -0.0265 235 THR A CG2 
1163 N N   . VAL A 158 ? 0.2692 0.3027 0.2535 0.0025  -0.0112 -0.0224 236 VAL A N   
1164 C CA  . VAL A 158 ? 0.2580 0.2872 0.2425 -0.0006 -0.0100 -0.0240 236 VAL A CA  
1165 C C   . VAL A 158 ? 0.2715 0.2947 0.2523 -0.0002 -0.0091 -0.0235 236 VAL A C   
1166 O O   . VAL A 158 ? 0.2760 0.2954 0.2562 -0.0024 -0.0085 -0.0254 236 VAL A O   
1167 C CB  . VAL A 158 ? 0.2542 0.2818 0.2414 -0.0029 -0.0086 -0.0230 236 VAL A CB  
1168 C CG1 . VAL A 158 ? 0.2502 0.2837 0.2416 -0.0038 -0.0093 -0.0243 236 VAL A CG1 
1169 C CG2 . VAL A 158 ? 0.2410 0.2658 0.2272 -0.0013 -0.0074 -0.0194 236 VAL A CG2 
1170 N N   . ALA A 159 ? 0.2690 0.2913 0.2476 0.0025  -0.0089 -0.0210 237 ALA A N   
1171 C CA  . ALA A 159 ? 0.2649 0.2823 0.2403 0.0034  -0.0081 -0.0206 237 ALA A CA  
1172 C C   . ALA A 159 ? 0.2659 0.2852 0.2390 0.0067  -0.0085 -0.0191 237 ALA A C   
1173 O O   . ALA A 159 ? 0.3030 0.3265 0.2768 0.0082  -0.0091 -0.0177 237 ALA A O   
1174 C CB  . ALA A 159 ? 0.2501 0.2627 0.2256 0.0025  -0.0065 -0.0186 237 ALA A CB  
1175 N N   . PRO A 160 ? 0.3047 0.3210 0.2749 0.0079  -0.0080 -0.0195 238 PRO A N   
1176 C CA  . PRO A 160 ? 0.2860 0.3043 0.2538 0.0109  -0.0082 -0.0182 238 PRO A CA  
1177 C C   . PRO A 160 ? 0.3188 0.3376 0.2872 0.0123  -0.0072 -0.0146 238 PRO A C   
1178 O O   . PRO A 160 ? 0.2979 0.3140 0.2678 0.0114  -0.0063 -0.0132 238 PRO A O   
1179 C CB  . PRO A 160 ? 0.2865 0.3007 0.2516 0.0115  -0.0075 -0.0195 238 PRO A CB  
1180 C CG  . PRO A 160 ? 0.2979 0.3084 0.2634 0.0089  -0.0076 -0.0221 238 PRO A CG  
1181 C CD  . PRO A 160 ? 0.2421 0.2529 0.2108 0.0067  -0.0074 -0.0211 238 PRO A CD  
1182 N N   . LEU A 161 ? 0.2747 0.2969 0.2419 0.0144  -0.0075 -0.0133 239 LEU A N   
1183 C CA  . LEU A 161 ? 0.2670 0.2894 0.2345 0.0158  -0.0064 -0.0100 239 LEU A CA  
1184 C C   . LEU A 161 ? 0.2342 0.2543 0.1996 0.0171  -0.0053 -0.0098 239 LEU A C   
1185 O O   . LEU A 161 ? 0.2369 0.2577 0.1996 0.0183  -0.0056 -0.0113 239 LEU A O   
1186 C CB  . LEU A 161 ? 0.2348 0.2611 0.2014 0.0175  -0.0070 -0.0085 239 LEU A CB  
1187 C CG  . LEU A 161 ? 0.2101 0.2368 0.1763 0.0189  -0.0058 -0.0053 239 LEU A CG  
1188 C CD1 . LEU A 161 ? 0.2340 0.2593 0.2033 0.0177  -0.0050 -0.0035 239 LEU A CD1 
1189 C CD2 . LEU A 161 ? 0.2078 0.2378 0.1722 0.0206  -0.0065 -0.0041 239 LEU A CD2 
1190 N N   . PHE A 162 ? 0.2059 0.2236 0.1725 0.0169  -0.0042 -0.0082 240 PHE A N   
1191 C CA  . PHE A 162 ? 0.2446 0.2608 0.2098 0.0184  -0.0030 -0.0076 240 PHE A CA  
1192 C C   . PHE A 162 ? 0.2402 0.2586 0.2062 0.0194  -0.0021 -0.0047 240 PHE A C   
1193 O O   . PHE A 162 ? 0.2011 0.2197 0.1693 0.0184  -0.0019 -0.0029 240 PHE A O   
1194 C CB  . PHE A 162 ? 0.2634 0.2753 0.2297 0.0175  -0.0025 -0.0078 240 PHE A CB  
1195 C CG  . PHE A 162 ? 0.2943 0.3029 0.2592 0.0168  -0.0030 -0.0106 240 PHE A CG  
1196 C CD1 . PHE A 162 ? 0.3528 0.3609 0.3181 0.0148  -0.0040 -0.0124 240 PHE A CD1 
1197 C CD2 . PHE A 162 ? 0.3237 0.3295 0.2869 0.0182  -0.0026 -0.0115 240 PHE A CD2 
1198 C CE1 . PHE A 162 ? 0.3612 0.3659 0.3252 0.0139  -0.0043 -0.0151 240 PHE A CE1 
1199 C CE2 . PHE A 162 ? 0.3155 0.3176 0.2772 0.0176  -0.0030 -0.0141 240 PHE A CE2 
1200 C CZ  . PHE A 162 ? 0.3294 0.3307 0.2914 0.0153  -0.0038 -0.0159 240 PHE A CZ  
1201 N N   . PHE A 163 ? 0.2293 0.2493 0.1933 0.0212  -0.0013 -0.0042 241 PHE A N   
1202 C CA  . PHE A 163 ? 0.2208 0.2427 0.1854 0.0220  -0.0001 -0.0015 241 PHE A CA  
1203 C C   . PHE A 163 ? 0.2501 0.2723 0.2132 0.0235  0.0011  -0.0017 241 PHE A C   
1204 O O   . PHE A 163 ? 0.2206 0.2448 0.1811 0.0248  0.0015  -0.0021 241 PHE A O   
1205 C CB  . PHE A 163 ? 0.2261 0.2508 0.1895 0.0224  -0.0004 -0.0002 241 PHE A CB  
1206 C CG  . PHE A 163 ? 0.2420 0.2675 0.2066 0.0224  0.0006  0.0026  241 PHE A CG  
1207 C CD1 . PHE A 163 ? 0.2481 0.2743 0.2124 0.0232  0.0023  0.0040  241 PHE A CD1 
1208 C CD2 . PHE A 163 ? 0.2184 0.2441 0.1847 0.0216  0.0000  0.0040  241 PHE A CD2 
1209 C CE1 . PHE A 163 ? 0.2553 0.2821 0.2208 0.0229  0.0034  0.0066  241 PHE A CE1 
1210 C CE2 . PHE A 163 ? 0.2214 0.2474 0.1888 0.0215  0.0011  0.0066  241 PHE A CE2 
1211 C CZ  . PHE A 163 ? 0.2365 0.2629 0.2035 0.0221  0.0028  0.0079  241 PHE A CZ  
1212 N N   . ALA A 164 ? 0.2170 0.2375 0.1820 0.0235  0.0017  -0.0016 242 ALA A N   
1213 C CA  . ALA A 164 ? 0.2352 0.2562 0.1997 0.0250  0.0029  -0.0020 242 ALA A CA  
1214 C C   . ALA A 164 ? 0.2451 0.2672 0.2122 0.0249  0.0041  0.0002  242 ALA A C   
1215 O O   . ALA A 164 ? 0.2222 0.2435 0.1913 0.0235  0.0037  0.0016  242 ALA A O   
1216 C CB  . ALA A 164 ? 0.2422 0.2598 0.2065 0.0254  0.0024  -0.0042 242 ALA A CB  
1217 N N   . ASP A 165 ? 0.2184 0.2424 0.1856 0.0262  0.0054  0.0003  243 ASP A N   
1218 C CA  . ASP A 165 ? 0.2402 0.2661 0.2098 0.0259  0.0067  0.0023  243 ASP A CA  
1219 C C   . ASP A 165 ? 0.2265 0.2504 0.1990 0.0248  0.0060  0.0030  243 ASP A C   
1220 O O   . ASP A 165 ? 0.2355 0.2603 0.2099 0.0237  0.0065  0.0049  243 ASP A O   
1221 C CB  . ASP A 165 ? 0.2549 0.2835 0.2247 0.0274  0.0083  0.0019  243 ASP A CB  
1222 C CG  . ASP A 165 ? 0.2985 0.3297 0.2707 0.0268  0.0098  0.0040  243 ASP A CG  
1223 O OD1 . ASP A 165 ? 0.2820 0.3139 0.2539 0.0256  0.0103  0.0059  243 ASP A OD1 
1224 O OD2 . ASP A 165 ? 0.3177 0.3504 0.2924 0.0274  0.0105  0.0036  243 ASP A OD2 
1225 N N   . GLN A 166 ? 0.2033 0.2243 0.1759 0.0251  0.0050  0.0015  244 GLN A N   
1226 C CA  . GLN A 166 ? 0.2184 0.2371 0.1931 0.0242  0.0043  0.0021  244 GLN A CA  
1227 C C   . GLN A 166 ? 0.1964 0.2112 0.1700 0.0230  0.0029  0.0012  244 GLN A C   
1228 O O   . GLN A 166 ? 0.2109 0.2228 0.1852 0.0226  0.0022  0.0011  244 GLN A O   
1229 C CB  . GLN A 166 ? 0.2201 0.2387 0.1959 0.0257  0.0045  0.0014  244 GLN A CB  
1230 C CG  . GLN A 166 ? 0.2577 0.2807 0.2357 0.0263  0.0059  0.0025  244 GLN A CG  
1231 C CD  . GLN A 166 ? 0.2773 0.3011 0.2569 0.0281  0.0060  0.0016  244 GLN A CD  
1232 O OE1 . GLN A 166 ? 0.3423 0.3679 0.3215 0.0298  0.0067  0.0004  244 GLN A OE1 
1233 N NE2 . GLN A 166 ? 0.2439 0.2663 0.2252 0.0277  0.0051  0.0022  244 GLN A NE2 
1234 N N   . PHE A 167 ? 0.2011 0.2159 0.1731 0.0223  0.0024  0.0006  245 PHE A N   
1235 C CA  . PHE A 167 ? 0.2221 0.2339 0.1936 0.0208  0.0013  -0.0002 245 PHE A CA  
1236 C C   . PHE A 167 ? 0.2251 0.2387 0.1960 0.0199  0.0009  -0.0002 245 PHE A C   
1237 O O   . PHE A 167 ? 0.2115 0.2266 0.1804 0.0208  0.0008  -0.0013 245 PHE A O   
1238 C CB  . PHE A 167 ? 0.2062 0.2145 0.1760 0.0214  0.0007  -0.0025 245 PHE A CB  
1239 C CG  . PHE A 167 ? 0.2138 0.2186 0.1832 0.0194  -0.0001 -0.0034 245 PHE A CG  
1240 C CD1 . PHE A 167 ? 0.2410 0.2427 0.2113 0.0183  -0.0003 -0.0027 245 PHE A CD1 
1241 C CD2 . PHE A 167 ? 0.2366 0.2415 0.2048 0.0186  -0.0007 -0.0050 245 PHE A CD2 
1242 C CE1 . PHE A 167 ? 0.2432 0.2417 0.2130 0.0163  -0.0008 -0.0035 245 PHE A CE1 
1243 C CE2 . PHE A 167 ? 0.2479 0.2500 0.2161 0.0165  -0.0014 -0.0061 245 PHE A CE2 
1244 C CZ  . PHE A 167 ? 0.2390 0.2378 0.2080 0.0152  -0.0013 -0.0052 245 PHE A CZ  
1245 N N   . LEU A 168 ? 0.2194 0.2330 0.1919 0.0184  0.0006  0.0008  246 LEU A N   
1246 C CA  . LEU A 168 ? 0.2179 0.2332 0.1904 0.0176  0.0000  0.0008  246 LEU A CA  
1247 C C   . LEU A 168 ? 0.2578 0.2707 0.2310 0.0157  -0.0007 -0.0003 246 LEU A C   
1248 O O   . LEU A 168 ? 0.2430 0.2537 0.2175 0.0147  -0.0005 0.0002  246 LEU A O   
1249 C CB  . LEU A 168 ? 0.2182 0.2355 0.1923 0.0173  0.0005  0.0031  246 LEU A CB  
1250 C CG  . LEU A 168 ? 0.2692 0.2892 0.2426 0.0186  0.0014  0.0047  246 LEU A CG  
1251 C CD1 . LEU A 168 ? 0.2770 0.2976 0.2490 0.0201  0.0023  0.0043  246 LEU A CD1 
1252 C CD2 . LEU A 168 ? 0.2631 0.2836 0.2386 0.0179  0.0021  0.0069  246 LEU A CD2 
1253 N N   . GLN A 169 ? 0.2142 0.2275 0.1866 0.0152  -0.0016 -0.0022 247 GLN A N   
1254 C CA  . GLN A 169 ? 0.2437 0.2554 0.2171 0.0131  -0.0022 -0.0033 247 GLN A CA  
1255 C C   . GLN A 169 ? 0.2423 0.2573 0.2163 0.0127  -0.0031 -0.0040 247 GLN A C   
1256 O O   . GLN A 169 ? 0.2099 0.2268 0.1823 0.0138  -0.0038 -0.0051 247 GLN A O   
1257 C CB  . GLN A 169 ? 0.2466 0.2547 0.2186 0.0124  -0.0025 -0.0056 247 GLN A CB  
1258 C CG  . GLN A 169 ? 0.2639 0.2699 0.2370 0.0098  -0.0027 -0.0065 247 GLN A CG  
1259 C CD  . GLN A 169 ? 0.2840 0.2856 0.2554 0.0088  -0.0028 -0.0087 247 GLN A CD  
1260 O OE1 . GLN A 169 ? 0.3464 0.3439 0.3172 0.0083  -0.0023 -0.0082 247 GLN A OE1 
1261 N NE2 . GLN A 169 ? 0.3885 0.3909 0.3591 0.0084  -0.0035 -0.0110 247 GLN A NE2 
1262 N N   . LEU A 170 ? 0.2128 0.2284 0.1891 0.0113  -0.0032 -0.0035 248 LEU A N   
1263 C CA  . LEU A 170 ? 0.1999 0.2188 0.1775 0.0109  -0.0042 -0.0043 248 LEU A CA  
1264 C C   . LEU A 170 ? 0.2010 0.2187 0.1806 0.0084  -0.0042 -0.0055 248 LEU A C   
1265 O O   . LEU A 170 ? 0.1972 0.2128 0.1779 0.0074  -0.0033 -0.0043 248 LEU A O   
1266 C CB  . LEU A 170 ? 0.2056 0.2270 0.1842 0.0121  -0.0040 -0.0020 248 LEU A CB  
1267 C CG  . LEU A 170 ? 0.2100 0.2350 0.1899 0.0123  -0.0052 -0.0025 248 LEU A CG  
1268 C CD1 . LEU A 170 ? 0.2528 0.2801 0.2303 0.0139  -0.0063 -0.0036 248 LEU A CD1 
1269 C CD2 . LEU A 170 ? 0.2261 0.2522 0.2072 0.0133  -0.0048 0.0000  248 LEU A CD2 
1270 N N   . SER A 171 ? 0.2230 0.2421 0.2031 0.0073  -0.0050 -0.0079 249 SER A N   
1271 C CA  . SER A 171 ? 0.2100 0.2282 0.1920 0.0046  -0.0048 -0.0093 249 SER A CA  
1272 C C   . SER A 171 ? 0.1967 0.2195 0.1814 0.0041  -0.0057 -0.0103 249 SER A C   
1273 O O   . SER A 171 ? 0.1913 0.2177 0.1759 0.0059  -0.0068 -0.0103 249 SER A O   
1274 C CB  . SER A 171 ? 0.2131 0.2284 0.1937 0.0030  -0.0049 -0.0119 249 SER A CB  
1275 O OG  . SER A 171 ? 0.2181 0.2287 0.1961 0.0036  -0.0042 -0.0112 249 SER A OG  
1276 N N   . THR A 172 ? 0.1872 0.2099 0.1744 0.0018  -0.0051 -0.0111 250 THR A N   
1277 C CA  . THR A 172 ? 0.1876 0.2150 0.1779 0.0011  -0.0059 -0.0125 250 THR A CA  
1278 C C   . THR A 172 ? 0.1930 0.2196 0.1852 -0.0021 -0.0051 -0.0146 250 THR A C   
1279 O O   . THR A 172 ? 0.2215 0.2437 0.2128 -0.0039 -0.0037 -0.0139 250 THR A O   
1280 C CB  . THR A 172 ? 0.1993 0.2291 0.1915 0.0026  -0.0058 -0.0104 250 THR A CB  
1281 O OG1 . THR A 172 ? 0.1930 0.2278 0.1884 0.0024  -0.0068 -0.0120 250 THR A OG1 
1282 C CG2 . THR A 172 ? 0.1682 0.1948 0.1610 0.0014  -0.0042 -0.0088 250 THR A CG2 
1283 N N   . SER A 173 ? 0.2015 0.2326 0.1963 -0.0031 -0.0060 -0.0170 251 SER A N   
1284 C CA  . SER A 173 ? 0.2109 0.2427 0.2085 -0.0062 -0.0051 -0.0188 251 SER A CA  
1285 C C   . SER A 173 ? 0.2216 0.2542 0.2213 -0.0060 -0.0042 -0.0169 251 SER A C   
1286 O O   . SER A 173 ? 0.2098 0.2442 0.2097 -0.0033 -0.0048 -0.0149 251 SER A O   
1287 C CB  . SER A 173 ? 0.2213 0.2588 0.2219 -0.0071 -0.0064 -0.0220 251 SER A CB  
1288 O OG  . SER A 173 ? 0.2576 0.3003 0.2597 -0.0042 -0.0080 -0.0215 251 SER A OG  
1289 N N   . LEU A 174 ? 0.2202 0.2513 0.2212 -0.0090 -0.0026 -0.0175 252 LEU A N   
1290 C CA  . LEU A 174 ? 0.2193 0.2518 0.2227 -0.0093 -0.0016 -0.0165 252 LEU A CA  
1291 C C   . LEU A 174 ? 0.2354 0.2731 0.2432 -0.0114 -0.0014 -0.0193 252 LEU A C   
1292 O O   . LEU A 174 ? 0.2149 0.2535 0.2235 -0.0137 -0.0014 -0.0219 252 LEU A O   
1293 C CB  . LEU A 174 ? 0.2179 0.2447 0.2191 -0.0110 0.0002  -0.0149 252 LEU A CB  
1294 C CG  . LEU A 174 ? 0.2124 0.2347 0.2100 -0.0089 0.0002  -0.0121 252 LEU A CG  
1295 C CD1 . LEU A 174 ? 0.2214 0.2379 0.2165 -0.0109 0.0017  -0.0111 252 LEU A CD1 
1296 C CD2 . LEU A 174 ? 0.2200 0.2444 0.2186 -0.0062 -0.0001 -0.0100 252 LEU A CD2 
1297 N N   . PRO A 175 ? 0.2319 0.2731 0.2427 -0.0105 -0.0012 -0.0189 253 PRO A N   
1298 C CA  . PRO A 175 ? 0.2436 0.2908 0.2590 -0.0119 -0.0013 -0.0218 253 PRO A CA  
1299 C C   . PRO A 175 ? 0.2440 0.2899 0.2606 -0.0160 0.0009  -0.0231 253 PRO A C   
1300 O O   . PRO A 175 ? 0.2429 0.2936 0.2634 -0.0178 0.0011  -0.0259 253 PRO A O   
1301 C CB  . PRO A 175 ? 0.2393 0.2903 0.2573 -0.0090 -0.0020 -0.0207 253 PRO A CB  
1302 C CG  . PRO A 175 ? 0.2167 0.2624 0.2317 -0.0080 -0.0010 -0.0175 253 PRO A CG  
1303 C CD  . PRO A 175 ? 0.2154 0.2560 0.2259 -0.0079 -0.0012 -0.0162 253 PRO A CD  
1304 N N   . SER A 176 ? 0.2222 0.2620 0.2356 -0.0172 0.0026  -0.0212 254 SER A N   
1305 C CA  . SER A 176 ? 0.2587 0.2963 0.2722 -0.0212 0.0050  -0.0220 254 SER A CA  
1306 C C   . SER A 176 ? 0.2491 0.2788 0.2575 -0.0220 0.0060  -0.0198 254 SER A C   
1307 O O   . SER A 176 ? 0.2124 0.2390 0.2178 -0.0195 0.0049  -0.0178 254 SER A O   
1308 C CB  . SER A 176 ? 0.2374 0.2778 0.2537 -0.0212 0.0061  -0.0218 254 SER A CB  
1309 O OG  . SER A 176 ? 0.2234 0.2597 0.2369 -0.0196 0.0066  -0.0187 254 SER A OG  
1310 N N   . GLN A 177 ? 0.2054 0.2318 0.2126 -0.0254 0.0082  -0.0201 255 GLN A N   
1311 C CA  . GLN A 177 ? 0.2339 0.2527 0.2361 -0.0262 0.0092  -0.0179 255 GLN A CA  
1312 C C   . GLN A 177 ? 0.2476 0.2649 0.2486 -0.0247 0.0097  -0.0153 255 GLN A C   
1313 O O   . GLN A 177 ? 0.2315 0.2430 0.2285 -0.0253 0.0106  -0.0135 255 GLN A O   
1314 C CB  . GLN A 177 ? 0.2631 0.2784 0.2639 -0.0306 0.0114  -0.0191 255 GLN A CB  
1315 C CG  . GLN A 177 ? 0.2482 0.2636 0.2496 -0.0328 0.0111  -0.0217 255 GLN A CG  
1316 C CD  . GLN A 177 ? 0.2907 0.3015 0.2885 -0.0311 0.0097  -0.0208 255 GLN A CD  
1317 O OE1 . GLN A 177 ? 0.3096 0.3158 0.3038 -0.0289 0.0093  -0.0182 255 GLN A OE1 
1318 N NE2 . GLN A 177 ? 0.2941 0.3064 0.2930 -0.0320 0.0088  -0.0233 255 GLN A NE2 
1319 N N   . TYR A 178 ? 0.2210 0.2434 0.2254 -0.0226 0.0092  -0.0153 256 TYR A N   
1320 C CA  . TYR A 178 ? 0.2060 0.2278 0.2100 -0.0216 0.0098  -0.0134 256 TYR A CA  
1321 C C   . TYR A 178 ? 0.1945 0.2167 0.1982 -0.0177 0.0081  -0.0115 256 TYR A C   
1322 O O   . TYR A 178 ? 0.2198 0.2467 0.2265 -0.0156 0.0069  -0.0121 256 TYR A O   
1323 C CB  . TYR A 178 ? 0.2413 0.2682 0.2495 -0.0227 0.0110  -0.0151 256 TYR A CB  
1324 C CG  . TYR A 178 ? 0.3154 0.3415 0.3235 -0.0269 0.0131  -0.0168 256 TYR A CG  
1325 C CD1 . TYR A 178 ? 0.3236 0.3533 0.3347 -0.0289 0.0132  -0.0196 256 TYR A CD1 
1326 C CD2 . TYR A 178 ? 0.2981 0.3197 0.3030 -0.0289 0.0151  -0.0156 256 TYR A CD2 
1327 C CE1 . TYR A 178 ? 0.3394 0.3683 0.3505 -0.0331 0.0155  -0.0212 256 TYR A CE1 
1328 C CE2 . TYR A 178 ? 0.4243 0.4448 0.4287 -0.0330 0.0173  -0.0170 256 TYR A CE2 
1329 C CZ  . TYR A 178 ? 0.4622 0.4863 0.4698 -0.0351 0.0176  -0.0199 256 TYR A CZ  
1330 O OH  . TYR A 178 ? 0.4708 0.4938 0.4780 -0.0395 0.0200  -0.0213 256 TYR A OH  
1331 N N   . ILE A 179 ? 0.2113 0.2285 0.2112 -0.0169 0.0082  -0.0092 257 ILE A N   
1332 C CA  . ILE A 179 ? 0.2179 0.2348 0.2170 -0.0137 0.0068  -0.0072 257 ILE A CA  
1333 C C   . ILE A 179 ? 0.2311 0.2441 0.2276 -0.0135 0.0075  -0.0051 257 ILE A C   
1334 O O   . ILE A 179 ? 0.2223 0.2310 0.2158 -0.0153 0.0085  -0.0046 257 ILE A O   
1335 C CB  . ILE A 179 ? 0.1926 0.2079 0.1898 -0.0124 0.0055  -0.0070 257 ILE A CB  
1336 C CG1 . ILE A 179 ? 0.2120 0.2271 0.2083 -0.0092 0.0044  -0.0050 257 ILE A CG1 
1337 C CG2 . ILE A 179 ? 0.2210 0.2309 0.2146 -0.0143 0.0061  -0.0070 257 ILE A CG2 
1338 C CD1 . ILE A 179 ? 0.2154 0.2295 0.2099 -0.0077 0.0031  -0.0048 257 ILE A CD1 
1339 N N   . THR A 180 ? 0.2140 0.2285 0.2116 -0.0114 0.0071  -0.0039 258 THR A N   
1340 C CA  . THR A 180 ? 0.2337 0.2454 0.2294 -0.0111 0.0076  -0.0021 258 THR A CA  
1341 C C   . THR A 180 ? 0.2210 0.2329 0.2167 -0.0083 0.0064  -0.0004 258 THR A C   
1342 O O   . THR A 180 ? 0.2473 0.2621 0.2449 -0.0065 0.0055  -0.0006 258 THR A O   
1343 C CB  . THR A 180 ? 0.2557 0.2691 0.2533 -0.0121 0.0088  -0.0027 258 THR A CB  
1344 O OG1 . THR A 180 ? 0.2549 0.2653 0.2501 -0.0121 0.0092  -0.0012 258 THR A OG1 
1345 C CG2 . THR A 180 ? 0.2306 0.2484 0.2319 -0.0102 0.0083  -0.0031 258 THR A CG2 
1346 N N   . GLY A 181 ? 0.2416 0.2504 0.2348 -0.0079 0.0064  0.0011  259 GLY A N   
1347 C CA  . GLY A 181 ? 0.2026 0.2116 0.1958 -0.0056 0.0056  0.0026  259 GLY A CA  
1348 C C   . GLY A 181 ? 0.2226 0.2283 0.2128 -0.0051 0.0051  0.0037  259 GLY A C   
1349 O O   . GLY A 181 ? 0.2319 0.2344 0.2196 -0.0065 0.0055  0.0037  259 GLY A O   
1350 N N   . LEU A 182 ? 0.1984 0.2049 0.1887 -0.0031 0.0043  0.0046  260 LEU A N   
1351 C CA  . LEU A 182 ? 0.1823 0.1865 0.1702 -0.0021 0.0038  0.0053  260 LEU A CA  
1352 C C   . LEU A 182 ? 0.2208 0.2222 0.2068 -0.0026 0.0039  0.0063  260 LEU A C   
1353 O O   . LEU A 182 ? 0.2360 0.2343 0.2194 -0.0028 0.0037  0.0063  260 LEU A O   
1354 C CB  . LEU A 182 ? 0.1781 0.1808 0.1645 -0.0026 0.0035  0.0043  260 LEU A CB  
1355 C CG  . LEU A 182 ? 0.1866 0.1922 0.1747 -0.0022 0.0030  0.0031  260 LEU A CG  
1356 C CD1 . LEU A 182 ? 0.2026 0.2063 0.1892 -0.0033 0.0029  0.0017  260 LEU A CD1 
1357 C CD2 . LEU A 182 ? 0.1937 0.2011 0.1821 0.0001  0.0023  0.0039  260 LEU A CD2 
1358 N N   . ALA A 183 ? 0.1860 0.1885 0.1732 -0.0026 0.0042  0.0069  261 ALA A N   
1359 C CA  . ALA A 183 ? 0.1866 0.1873 0.1723 -0.0027 0.0041  0.0077  261 ALA A CA  
1360 C C   . ALA A 183 ? 0.1998 0.2002 0.1847 -0.0009 0.0033  0.0086  261 ALA A C   
1361 O O   . ALA A 183 ? 0.1801 0.1822 0.1661 0.0003  0.0030  0.0087  261 ALA A O   
1362 C CB  . ALA A 183 ? 0.1980 0.2004 0.1856 -0.0032 0.0047  0.0078  261 ALA A CB  
1363 N N   . GLU A 184 ? 0.1763 0.1748 0.1593 -0.0008 0.0029  0.0092  262 GLU A N   
1364 C CA  . GLU A 184 ? 0.2014 0.1979 0.1826 -0.0022 0.0031  0.0092  262 GLU A CA  
1365 C C   . GLU A 184 ? 0.2170 0.2095 0.1945 -0.0024 0.0027  0.0093  262 GLU A C   
1366 O O   . GLU A 184 ? 0.1916 0.1829 0.1679 -0.0007 0.0018  0.0098  262 GLU A O   
1367 C CB  . GLU A 184 ? 0.2164 0.2140 0.1982 -0.0018 0.0027  0.0097  262 GLU A CB  
1368 C CG  . GLU A 184 ? 0.2593 0.2553 0.2391 -0.0032 0.0029  0.0097  262 GLU A CG  
1369 C CD  . GLU A 184 ? 0.2426 0.2403 0.2235 -0.0029 0.0025  0.0099  262 GLU A CD  
1370 O OE1 . GLU A 184 ? 0.2029 0.2027 0.1856 -0.0015 0.0019  0.0103  262 GLU A OE1 
1371 O OE2 . GLU A 184 ? 0.2438 0.2411 0.2238 -0.0042 0.0029  0.0096  262 GLU A OE2 
1372 N N   . HIS A 185 ? 0.2342 0.2245 0.2101 -0.0043 0.0035  0.0088  263 HIS A N   
1373 C CA  . HIS A 185 ? 0.2933 0.2789 0.2653 -0.0049 0.0035  0.0090  263 HIS A CA  
1374 C C   . HIS A 185 ? 0.2950 0.2786 0.2649 -0.0073 0.0045  0.0088  263 HIS A C   
1375 O O   . HIS A 185 ? 0.3009 0.2871 0.2730 -0.0086 0.0055  0.0081  263 HIS A O   
1376 C CB  . HIS A 185 ? 0.2717 0.2564 0.2438 -0.0052 0.0037  0.0082  263 HIS A CB  
1377 C CG  . HIS A 185 ? 0.2435 0.2305 0.2175 -0.0030 0.0028  0.0081  263 HIS A CG  
1378 N ND1 . HIS A 185 ? 0.2543 0.2456 0.2318 -0.0025 0.0030  0.0077  263 HIS A ND1 
1379 C CD2 . HIS A 185 ? 0.2766 0.2622 0.2494 -0.0010 0.0019  0.0085  263 HIS A CD2 
1380 C CE1 . HIS A 185 ? 0.2742 0.2666 0.2523 -0.0005 0.0023  0.0079  263 HIS A CE1 
1381 N NE2 . HIS A 185 ? 0.2472 0.2365 0.2228 0.0004  0.0016  0.0083  263 HIS A NE2 
1382 N N   . LEU A 186 ? 0.3157 0.2946 0.2812 -0.0077 0.0044  0.0096  264 LEU A N   
1383 C CA  . LEU A 186 ? 0.3662 0.3425 0.3287 -0.0100 0.0055  0.0096  264 LEU A CA  
1384 C C   . LEU A 186 ? 0.3708 0.3453 0.3328 -0.0122 0.0068  0.0087  264 LEU A C   
1385 O O   . LEU A 186 ? 0.4600 0.4304 0.4194 -0.0120 0.0065  0.0090  264 LEU A O   
1386 C CB  . LEU A 186 ? 0.4822 0.4541 0.4398 -0.0093 0.0046  0.0111  264 LEU A CB  
1387 C CG  . LEU A 186 ? 0.6346 0.6050 0.5891 -0.0110 0.0054  0.0114  264 LEU A CG  
1388 C CD1 . LEU A 186 ? 0.8966 0.8719 0.8544 -0.0109 0.0054  0.0109  264 LEU A CD1 
1389 C CD2 . LEU A 186 ? 0.6765 0.6423 0.6258 -0.0097 0.0041  0.0130  264 LEU A CD2 
1390 N N   . SER A 187 ? 0.3312 0.3089 0.2961 -0.0140 0.0082  0.0075  265 SER A N   
1391 C CA  . SER A 187 ? 0.3578 0.3356 0.3238 -0.0160 0.0093  0.0061  265 SER A CA  
1392 C C   . SER A 187 ? 0.3108 0.2917 0.2791 -0.0183 0.0110  0.0048  265 SER A C   
1393 O O   . SER A 187 ? 0.3186 0.3026 0.2889 -0.0177 0.0110  0.0047  265 SER A O   
1394 C CB  . SER A 187 ? 0.4040 0.3851 0.3737 -0.0142 0.0083  0.0054  265 SER A CB  
1395 O OG  . SER A 187 ? 0.3809 0.3645 0.3534 -0.0158 0.0092  0.0037  265 SER A OG  
1396 N N   . PRO A 188 ? 0.2876 0.2679 0.2560 -0.0208 0.0125  0.0036  266 PRO A N   
1397 C CA  . PRO A 188 ? 0.2782 0.2631 0.2502 -0.0226 0.0139  0.0018  266 PRO A CA  
1398 C C   . PRO A 188 ? 0.2731 0.2637 0.2504 -0.0205 0.0129  0.0010  266 PRO A C   
1399 O O   . PRO A 188 ? 0.2502 0.2412 0.2283 -0.0183 0.0114  0.0016  266 PRO A O   
1400 C CB  . PRO A 188 ? 0.2834 0.2671 0.2552 -0.0253 0.0152  0.0005  266 PRO A CB  
1401 C CG  . PRO A 188 ? 0.3304 0.3070 0.2966 -0.0258 0.0151  0.0019  266 PRO A CG  
1402 C CD  . PRO A 188 ? 0.3301 0.3057 0.2955 -0.0223 0.0129  0.0035  266 PRO A CD  
1403 N N   . LEU A 189 ? 0.2779 0.2729 0.2587 -0.0211 0.0138  -0.0001 267 LEU A N   
1404 C CA  . LEU A 189 ? 0.2867 0.2866 0.2721 -0.0191 0.0129  -0.0008 267 LEU A CA  
1405 C C   . LEU A 189 ? 0.2860 0.2878 0.2736 -0.0187 0.0122  -0.0018 267 LEU A C   
1406 O O   . LEU A 189 ? 0.2914 0.2949 0.2806 -0.0163 0.0107  -0.0014 267 LEU A O   
1407 C CB  . LEU A 189 ? 0.2866 0.2904 0.2752 -0.0198 0.0141  -0.0021 267 LEU A CB  
1408 C CG  . LEU A 189 ? 0.2992 0.3073 0.2919 -0.0174 0.0132  -0.0023 267 LEU A CG  
1409 C CD1 . LEU A 189 ? 0.2733 0.2799 0.2649 -0.0150 0.0119  -0.0005 267 LEU A CD1 
1410 C CD2 . LEU A 189 ? 0.2774 0.2884 0.2725 -0.0182 0.0146  -0.0037 267 LEU A CD2 
1411 N N   . MET A 190 ? 0.2674 0.2689 0.2549 -0.0212 0.0133  -0.0032 268 MET A N   
1412 C CA  . MET A 190 ? 0.3006 0.3033 0.2896 -0.0213 0.0126  -0.0044 268 MET A CA  
1413 C C   . MET A 190 ? 0.3105 0.3078 0.2954 -0.0211 0.0119  -0.0033 268 MET A C   
1414 O O   . MET A 190 ? 0.2852 0.2777 0.2662 -0.0228 0.0129  -0.0026 268 MET A O   
1415 C CB  . MET A 190 ? 0.2886 0.2936 0.2797 -0.0244 0.0142  -0.0067 268 MET A CB  
1416 C CG  . MET A 190 ? 0.2555 0.2667 0.2515 -0.0241 0.0147  -0.0083 268 MET A CG  
1417 S SD  . MET A 190 ? 0.2775 0.2942 0.2779 -0.0206 0.0125  -0.0088 268 MET A SD  
1418 C CE  . MET A 190 ? 0.3055 0.3265 0.3095 -0.0196 0.0131  -0.0093 268 MET A CE  
1419 N N   . LEU A 191 ? 0.2554 0.2535 0.2410 -0.0189 0.0103  -0.0031 269 LEU A N   
1420 C CA  . LEU A 191 ? 0.2944 0.2877 0.2764 -0.0181 0.0095  -0.0021 269 LEU A CA  
1421 C C   . LEU A 191 ? 0.2816 0.2727 0.2626 -0.0203 0.0101  -0.0036 269 LEU A C   
1422 O O   . LEU A 191 ? 0.3543 0.3491 0.3384 -0.0216 0.0104  -0.0056 269 LEU A O   
1423 C CB  . LEU A 191 ? 0.2735 0.2687 0.2566 -0.0148 0.0077  -0.0014 269 LEU A CB  
1424 C CG  . LEU A 191 ? 0.2766 0.2743 0.2611 -0.0127 0.0072  -0.0001 269 LEU A CG  
1425 C CD1 . LEU A 191 ? 0.2393 0.2395 0.2253 -0.0099 0.0059  0.0002  269 LEU A CD1 
1426 C CD2 . LEU A 191 ? 0.3348 0.3289 0.3163 -0.0124 0.0074  0.0016  269 LEU A CD2 
1427 N N   . SER A 192 ? 0.2607 0.2455 0.2373 -0.0208 0.0101  -0.0027 270 SER A N   
1428 C CA  . SER A 192 ? 0.2776 0.2594 0.2528 -0.0227 0.0105  -0.0041 270 SER A CA  
1429 C C   . SER A 192 ? 0.2465 0.2304 0.2234 -0.0209 0.0090  -0.0052 270 SER A C   
1430 O O   . SER A 192 ? 0.3037 0.2869 0.2796 -0.0180 0.0077  -0.0041 270 SER A O   
1431 C CB  . SER A 192 ? 0.3010 0.2749 0.2707 -0.0232 0.0109  -0.0026 270 SER A CB  
1432 O OG  . SER A 192 ? 0.2987 0.2693 0.2671 -0.0250 0.0113  -0.0040 270 SER A OG  
1433 N N   . THR A 193 ? 0.2634 0.2502 0.2429 -0.0227 0.0093  -0.0076 271 THR A N   
1434 C CA  . THR A 193 ? 0.3109 0.2992 0.2914 -0.0215 0.0079  -0.0091 271 THR A CA  
1435 C C   . THR A 193 ? 0.3319 0.3140 0.3089 -0.0227 0.0081  -0.0097 271 THR A C   
1436 O O   . THR A 193 ? 0.2789 0.2619 0.2564 -0.0220 0.0071  -0.0112 271 THR A O   
1437 C CB  . THR A 193 ? 0.3328 0.3277 0.3179 -0.0226 0.0077  -0.0116 271 THR A CB  
1438 O OG1 . THR A 193 ? 0.3378 0.3319 0.3234 -0.0265 0.0095  -0.0133 271 THR A OG1 
1439 C CG2 . THR A 193 ? 0.2625 0.2636 0.2512 -0.0207 0.0072  -0.0111 271 THR A CG2 
1440 N N   . SER A 194 ? 0.2926 0.2680 0.2656 -0.0243 0.0093  -0.0085 272 SER A N   
1441 C CA  . SER A 194 ? 0.3545 0.3229 0.3237 -0.0254 0.0096  -0.0090 272 SER A CA  
1442 C C   . SER A 194 ? 0.3728 0.3371 0.3388 -0.0220 0.0082  -0.0075 272 SER A C   
1443 O O   . SER A 194 ? 0.3484 0.3065 0.3103 -0.0215 0.0084  -0.0056 272 SER A O   
1444 C CB  . SER A 194 ? 0.4472 0.4097 0.4130 -0.0288 0.0115  -0.0083 272 SER A CB  
1445 O OG  . SER A 194 ? 0.5851 0.5518 0.5542 -0.0322 0.0130  -0.0101 272 SER A OG  
1446 N N   . TRP A 195 ? 0.3056 0.2737 0.2736 -0.0194 0.0067  -0.0083 273 TRP A N   
1447 C CA  . TRP A 195 ? 0.3306 0.2959 0.2962 -0.0161 0.0054  -0.0074 273 TRP A CA  
1448 C C   . TRP A 195 ? 0.3449 0.3091 0.3091 -0.0137 0.0050  -0.0046 273 TRP A C   
1449 O O   . TRP A 195 ? 0.3609 0.3193 0.3214 -0.0126 0.0049  -0.0033 273 TRP A O   
1450 C CB  . TRP A 195 ? 0.3167 0.2745 0.2786 -0.0170 0.0057  -0.0083 273 TRP A CB  
1451 C CG  . TRP A 195 ? 0.3154 0.2746 0.2790 -0.0196 0.0060  -0.0113 273 TRP A CG  
1452 C CD1 . TRP A 195 ? 0.3450 0.3016 0.3082 -0.0237 0.0075  -0.0126 273 TRP A CD1 
1453 C CD2 . TRP A 195 ? 0.2895 0.2534 0.2555 -0.0185 0.0048  -0.0134 273 TRP A CD2 
1454 N NE1 . TRP A 195 ? 0.3847 0.3442 0.3502 -0.0253 0.0072  -0.0156 273 TRP A NE1 
1455 C CE2 . TRP A 195 ? 0.3367 0.3007 0.3038 -0.0220 0.0055  -0.0162 273 TRP A CE2 
1456 C CE3 . TRP A 195 ? 0.3204 0.2882 0.2874 -0.0150 0.0033  -0.0133 273 TRP A CE3 
1457 C CZ2 . TRP A 195 ? 0.3449 0.3130 0.3141 -0.0219 0.0045  -0.0189 273 TRP A CZ2 
1458 C CZ3 . TRP A 195 ? 0.2898 0.2616 0.2587 -0.0149 0.0025  -0.0159 273 TRP A CZ3 
1459 C CH2 . TRP A 195 ? 0.2928 0.2647 0.2626 -0.0182 0.0029  -0.0186 273 TRP A CH2 
1460 N N   . THR A 196 ? 0.3224 0.2925 0.2896 -0.0126 0.0048  -0.0039 274 THR A N   
1461 C CA  . THR A 196 ? 0.3251 0.2953 0.2917 -0.0110 0.0046  -0.0015 274 THR A CA  
1462 C C   . THR A 196 ? 0.2707 0.2446 0.2388 -0.0075 0.0033  -0.0009 274 THR A C   
1463 O O   . THR A 196 ? 0.2637 0.2429 0.2349 -0.0069 0.0029  -0.0018 274 THR A O   
1464 C CB  . THR A 196 ? 0.3407 0.3147 0.3097 -0.0127 0.0055  -0.0013 274 THR A CB  
1465 O OG1 . THR A 196 ? 0.3957 0.3673 0.3639 -0.0163 0.0069  -0.0022 274 THR A OG1 
1466 C CG2 . THR A 196 ? 0.3734 0.3470 0.3415 -0.0114 0.0053  0.0008  274 THR A CG2 
1467 N N   . ARG A 197 ? 0.2676 0.2387 0.2336 -0.0052 0.0026  0.0005  275 ARG A N   
1468 C CA  A ARG A 197 ? 0.2687 0.2431 0.2360 -0.0020 0.0017  0.0012  275 ARG A CA  
1469 C CA  B ARG A 197 ? 0.2889 0.2632 0.2561 -0.0020 0.0017  0.0012  275 ARG A CA  
1470 C C   . ARG A 197 ? 0.2673 0.2442 0.2358 -0.0015 0.0017  0.0029  275 ARG A C   
1471 O O   . ARG A 197 ? 0.2513 0.2250 0.2177 -0.0016 0.0017  0.0041  275 ARG A O   
1472 C CB  A ARG A 197 ? 0.2732 0.2433 0.2376 0.0001  0.0009  0.0015  275 ARG A CB  
1473 C CB  B ARG A 197 ? 0.3199 0.2894 0.2841 0.0000  0.0010  0.0015  275 ARG A CB  
1474 C CG  A ARG A 197 ? 0.2489 0.2222 0.2145 0.0034  0.0001  0.0020  275 ARG A CG  
1475 C CG  B ARG A 197 ? 0.3472 0.3194 0.3123 0.0031  0.0001  0.0013  275 ARG A CG  
1476 C CD  A ARG A 197 ? 0.2811 0.2496 0.2438 0.0056  -0.0005 0.0024  275 ARG A CD  
1477 C CD  B ARG A 197 ? 0.4020 0.3687 0.3639 0.0048  -0.0003 0.0011  275 ARG A CD  
1478 N NE  A ARG A 197 ? 0.4298 0.3963 0.3912 0.0059  -0.0007 0.0042  275 ARG A NE  
1479 N NE  B ARG A 197 ? 0.5324 0.5016 0.4952 0.0077  -0.0009 0.0005  275 ARG A NE  
1480 C CZ  A ARG A 197 ? 0.4879 0.4483 0.4457 0.0062  -0.0010 0.0049  275 ARG A CZ  
1481 C CZ  B ARG A 197 ? 0.5606 0.5272 0.5217 0.0104  -0.0015 0.0008  275 ARG A CZ  
1482 N NH1 A ARG A 197 ? 0.4906 0.4456 0.4457 0.0060  -0.0009 0.0039  275 ARG A NH1 
1483 N NH1 B ARG A 197 ? 0.5363 0.4975 0.4947 0.0106  -0.0018 0.0017  275 ARG A NH1 
1484 N NH2 A ARG A 197 ? 0.3638 0.3232 0.3204 0.0066  -0.0014 0.0065  275 ARG A NH2 
1485 N NH2 B ARG A 197 ? 0.5425 0.5121 0.5048 0.0129  -0.0019 0.0001  275 ARG A NH2 
1486 N N   . ILE A 198 ? 0.2131 0.1955 0.1849 -0.0010 0.0017  0.0030  276 ILE A N   
1487 C CA  . ILE A 198 ? 0.2479 0.2328 0.2211 -0.0008 0.0018  0.0044  276 ILE A CA  
1488 C C   . ILE A 198 ? 0.2320 0.2197 0.2065 0.0018  0.0011  0.0052  276 ILE A C   
1489 O O   . ILE A 198 ? 0.2066 0.1975 0.1828 0.0028  0.0009  0.0046  276 ILE A O   
1490 C CB  . ILE A 198 ? 0.2300 0.2188 0.2062 -0.0024 0.0025  0.0039  276 ILE A CB  
1491 C CG1 . ILE A 198 ? 0.2799 0.2663 0.2551 -0.0053 0.0034  0.0030  276 ILE A CG1 
1492 C CG2 . ILE A 198 ? 0.2086 0.1996 0.1862 -0.0020 0.0026  0.0051  276 ILE A CG2 
1493 C CD1 . ILE A 198 ? 0.3098 0.3001 0.2880 -0.0069 0.0040  0.0018  276 ILE A CD1 
1494 N N   . THR A 199 ? 0.2210 0.2074 0.1944 0.0030  0.0007  0.0063  277 THR A N   
1495 C CA  . THR A 199 ? 0.2219 0.2107 0.1964 0.0055  0.0001  0.0069  277 THR A CA  
1496 C C   . THR A 199 ? 0.1910 0.1835 0.1680 0.0056  0.0003  0.0079  277 THR A C   
1497 O O   . THR A 199 ? 0.1944 0.1859 0.1709 0.0047  0.0003  0.0086  277 THR A O   
1498 C CB  . THR A 199 ? 0.1934 0.1787 0.1655 0.0072  -0.0005 0.0072  277 THR A CB  
1499 O OG1 . THR A 199 ? 0.1956 0.1771 0.1653 0.0073  -0.0006 0.0062  277 THR A OG1 
1500 C CG2 . THR A 199 ? 0.2090 0.1975 0.1826 0.0098  -0.0010 0.0076  277 THR A CG2 
1501 N N   . LEU A 200 ? 0.1877 0.1841 0.1669 0.0066  0.0005  0.0080  278 LEU A N   
1502 C CA  . LEU A 200 ? 0.1878 0.1876 0.1695 0.0067  0.0008  0.0089  278 LEU A CA  
1503 C C   . LEU A 200 ? 0.1618 0.1634 0.1442 0.0087  0.0005  0.0094  278 LEU A C   
1504 O O   . LEU A 200 ? 0.1866 0.1902 0.1697 0.0099  0.0007  0.0092  278 LEU A O   
1505 C CB  . LEU A 200 ? 0.1999 0.2027 0.1836 0.0063  0.0014  0.0088  278 LEU A CB  
1506 C CG  . LEU A 200 ? 0.2342 0.2370 0.2187 0.0044  0.0018  0.0085  278 LEU A CG  
1507 C CD1 . LEU A 200 ? 0.2577 0.2577 0.2404 0.0031  0.0018  0.0074  278 LEU A CD1 
1508 C CD2 . LEU A 200 ? 0.2283 0.2341 0.2147 0.0046  0.0021  0.0085  278 LEU A CD2 
1509 N N   . TRP A 201 ? 0.1654 0.1662 0.1475 0.0089  0.0000  0.0098  279 TRP A N   
1510 C CA  . TRP A 201 ? 0.1680 0.1710 0.1512 0.0106  -0.0003 0.0101  279 TRP A CA  
1511 C C   . TRP A 201 ? 0.1855 0.1886 0.1690 0.0101  -0.0008 0.0106  279 TRP A C   
1512 O O   . TRP A 201 ? 0.1893 0.1891 0.1704 0.0100  -0.0015 0.0107  279 TRP A O   
1513 C CB  . TRP A 201 ? 0.2012 0.2025 0.1827 0.0126  -0.0010 0.0096  279 TRP A CB  
1514 C CG  . TRP A 201 ? 0.2139 0.2181 0.1971 0.0146  -0.0013 0.0096  279 TRP A CG  
1515 C CD1 . TRP A 201 ? 0.2095 0.2128 0.1920 0.0160  -0.0024 0.0097  279 TRP A CD1 
1516 C CD2 . TRP A 201 ? 0.1998 0.2085 0.1856 0.0153  -0.0005 0.0096  279 TRP A CD2 
1517 N NE1 . TRP A 201 ? 0.2076 0.2151 0.1926 0.0176  -0.0024 0.0094  279 TRP A NE1 
1518 C CE2 . TRP A 201 ? 0.1948 0.2056 0.1819 0.0171  -0.0011 0.0094  279 TRP A CE2 
1519 C CE3 . TRP A 201 ? 0.1897 0.2008 0.1768 0.0147  0.0005  0.0097  279 TRP A CE3 
1520 C CZ2 . TRP A 201 ? 0.1883 0.2038 0.1781 0.0180  -0.0003 0.0092  279 TRP A CZ2 
1521 C CZ3 . TRP A 201 ? 0.1837 0.1988 0.1728 0.0157  0.0013  0.0098  279 TRP A CZ3 
1522 C CH2 . TRP A 201 ? 0.1860 0.2033 0.1766 0.0171  0.0009  0.0095  279 TRP A CH2 
1523 N N   . ASN A 202 ? 0.1855 0.1919 0.1717 0.0095  -0.0003 0.0110  280 ASN A N   
1524 C CA  . ASN A 202 ? 0.1890 0.1957 0.1756 0.0085  -0.0006 0.0112  280 ASN A CA  
1525 C C   . ASN A 202 ? 0.1810 0.1872 0.1665 0.0100  -0.0020 0.0112  280 ASN A C   
1526 O O   . ASN A 202 ? 0.1922 0.2006 0.1790 0.0118  -0.0023 0.0110  280 ASN A O   
1527 C CB  . ASN A 202 ? 0.1770 0.1872 0.1668 0.0076  0.0001  0.0114  280 ASN A CB  
1528 C CG  . ASN A 202 ? 0.1934 0.2035 0.1838 0.0063  0.0012  0.0116  280 ASN A CG  
1529 O OD1 . ASN A 202 ? 0.2058 0.2137 0.1946 0.0058  0.0013  0.0114  280 ASN A OD1 
1530 N ND2 . ASN A 202 ? 0.2075 0.2201 0.2004 0.0057  0.0021  0.0119  280 ASN A ND2 
1531 N N   . ARG A 203 ? 0.1760 0.1795 0.1592 0.0094  -0.0027 0.0114  281 ARG A N   
1532 C CA  . ARG A 203 ? 0.1632 0.1647 0.1440 0.0111  -0.0042 0.0115  281 ARG A CA  
1533 C C   . ARG A 203 ? 0.1891 0.1896 0.1684 0.0100  -0.0049 0.0118  281 ARG A C   
1534 O O   . ARG A 203 ? 0.1774 0.1757 0.1551 0.0080  -0.0042 0.0119  281 ARG A O   
1535 C CB  . ARG A 203 ? 0.1772 0.1739 0.1546 0.0117  -0.0044 0.0116  281 ARG A CB  
1536 C CG  . ARG A 203 ? 0.2114 0.2042 0.1852 0.0132  -0.0059 0.0120  281 ARG A CG  
1537 C CD  . ARG A 203 ? 0.2020 0.1977 0.1773 0.0159  -0.0072 0.0118  281 ARG A CD  
1538 N NE  . ARG A 203 ? 0.2205 0.2128 0.1923 0.0175  -0.0089 0.0123  281 ARG A NE  
1539 C CZ  . ARG A 203 ? 0.2096 0.1983 0.1788 0.0198  -0.0099 0.0124  281 ARG A CZ  
1540 N NH1 . ARG A 203 ? 0.2069 0.1948 0.1766 0.0208  -0.0093 0.0118  281 ARG A NH1 
1541 N NH2 . ARG A 203 ? 0.2105 0.1962 0.1764 0.0213  -0.0115 0.0130  281 ARG A NH2 
1542 N N   . ASP A 204 ? 0.2245 0.2271 0.2044 0.0114  -0.0063 0.0117  282 ASP A N   
1543 C CA  . ASP A 204 ? 0.2548 0.2565 0.2327 0.0109  -0.0073 0.0119  282 ASP A CA  
1544 C C   . ASP A 204 ? 0.3479 0.3440 0.3207 0.0120  -0.0083 0.0126  282 ASP A C   
1545 O O   . ASP A 204 ? 0.3277 0.3231 0.2995 0.0145  -0.0097 0.0127  282 ASP A O   
1546 C CB  . ASP A 204 ? 0.2637 0.2700 0.2443 0.0123  -0.0086 0.0114  282 ASP A CB  
1547 C CG  . ASP A 204 ? 0.3439 0.3496 0.3222 0.0120  -0.0100 0.0115  282 ASP A CG  
1548 O OD1 . ASP A 204 ? 0.3436 0.3447 0.3176 0.0109  -0.0100 0.0121  282 ASP A OD1 
1549 O OD2 . ASP A 204 ? 0.3393 0.3493 0.3201 0.0126  -0.0111 0.0108  282 ASP A OD2 
1550 N N   . LEU A 205 ? 0.2991 0.2911 0.2689 0.0100  -0.0074 0.0130  283 LEU A N   
1551 C CA  . LEU A 205 ? 0.3514 0.3375 0.3158 0.0103  -0.0080 0.0138  283 LEU A CA  
1552 C C   . LEU A 205 ? 0.2565 0.2405 0.2185 0.0076  -0.0071 0.0140  283 LEU A C   
1553 O O   . LEU A 205 ? 0.2791 0.2646 0.2433 0.0054  -0.0055 0.0135  283 LEU A O   
1554 C CB  . LEU A 205 ? 0.3605 0.3428 0.3235 0.0106  -0.0073 0.0139  283 LEU A CB  
1555 C CG  . LEU A 205 ? 0.4249 0.4002 0.3821 0.0107  -0.0077 0.0148  283 LEU A CG  
1556 C CD1 . LEU A 205 ? 0.4124 0.3859 0.3674 0.0140  -0.0098 0.0153  283 LEU A CD1 
1557 C CD2 . LEU A 205 ? 0.5434 0.5153 0.4997 0.0097  -0.0064 0.0145  283 LEU A CD2 
1558 N N   . ALA A 206 ? 0.2515 0.2321 0.2090 0.0077  -0.0081 0.0148  284 ALA A N   
1559 C CA  . ALA A 206 ? 0.3135 0.2918 0.2682 0.0050  -0.0070 0.0150  284 ALA A CA  
1560 C C   . ALA A 206 ? 0.2530 0.2281 0.2068 0.0031  -0.0050 0.0149  284 ALA A C   
1561 O O   . ALA A 206 ? 0.3475 0.3187 0.2991 0.0039  -0.0052 0.0154  284 ALA A O   
1562 C CB  . ALA A 206 ? 0.2937 0.2681 0.2426 0.0057  -0.0083 0.0160  284 ALA A CB  
1563 N N   . PRO A 207 ? 0.3111 0.2878 0.2667 0.0005  -0.0033 0.0142  285 PRO A N   
1564 C CA  . PRO A 207 ? 0.3960 0.3707 0.3515 -0.0012 -0.0016 0.0139  285 PRO A CA  
1565 C C   . PRO A 207 ? 0.4392 0.4072 0.3892 -0.0017 -0.0014 0.0147  285 PRO A C   
1566 O O   . PRO A 207 ? 0.4277 0.3925 0.3733 -0.0024 -0.0014 0.0155  285 PRO A O   
1567 C CB  . PRO A 207 ? 0.3609 0.3379 0.3181 -0.0037 0.0000  0.0131  285 PRO A CB  
1568 C CG  . PRO A 207 ? 0.3791 0.3608 0.3396 -0.0029 -0.0008 0.0126  285 PRO A CG  
1569 C CD  . PRO A 207 ? 0.3240 0.3047 0.2821 -0.0008 -0.0028 0.0135  285 PRO A CD  
1570 N N   . THR A 208 ? 0.4610 0.4271 0.4113 -0.0011 -0.0012 0.0146  286 THR A N   
1571 C CA  . THR A 208 ? 0.4577 0.4173 0.4033 -0.0019 -0.0007 0.0152  286 THR A CA  
1572 C C   . THR A 208 ? 0.5158 0.4760 0.4641 -0.0032 0.0005  0.0140  286 THR A C   
1573 O O   . THR A 208 ? 0.4304 0.3952 0.3833 -0.0023 0.0004  0.0131  286 THR A O   
1574 C CB  . THR A 208 ? 0.4166 0.3724 0.3590 0.0010  -0.0026 0.0162  286 THR A CB  
1575 O OG1 . THR A 208 ? 0.6912 0.6396 0.6282 0.0001  -0.0020 0.0170  286 THR A OG1 
1576 C CG2 . THR A 208 ? 0.4938 0.4520 0.4397 0.0035  -0.0035 0.0156  286 THR A CG2 
1577 N N   . PRO A 209 ? 0.6535 0.6091 0.5989 -0.0055 0.0019  0.0139  287 PRO A N   
1578 C CA  . PRO A 209 ? 0.4853 0.4415 0.4331 -0.0069 0.0031  0.0125  287 PRO A CA  
1579 C C   . PRO A 209 ? 0.3301 0.2861 0.2792 -0.0046 0.0020  0.0121  287 PRO A C   
1580 O O   . PRO A 209 ? 0.3606 0.3131 0.3070 -0.0024 0.0007  0.0129  287 PRO A O   
1581 C CB  . PRO A 209 ? 0.5952 0.5456 0.5387 -0.0098 0.0046  0.0127  287 PRO A CB  
1582 C CG  . PRO A 209 ? 0.6866 0.6358 0.6269 -0.0108 0.0050  0.0138  287 PRO A CG  
1583 C CD  . PRO A 209 ? 0.7053 0.6558 0.6453 -0.0076 0.0028  0.0148  287 PRO A CD  
1584 N N   . GLY A 210 ? 0.3354 0.2953 0.2886 -0.0051 0.0026  0.0107  288 GLY A N   
1585 C CA  . GLY A 210 ? 0.3756 0.3356 0.3300 -0.0032 0.0018  0.0100  288 GLY A CA  
1586 C C   . GLY A 210 ? 0.3491 0.3126 0.3056 0.0000  0.0003  0.0104  288 GLY A C   
1587 O O   . GLY A 210 ? 0.3784 0.3420 0.3356 0.0018  -0.0002 0.0098  288 GLY A O   
1588 N N   . ALA A 211 ? 0.2989 0.2657 0.2567 0.0006  0.0000  0.0111  289 ALA A N   
1589 C CA  . ALA A 211 ? 0.2812 0.2518 0.2413 0.0034  -0.0013 0.0114  289 ALA A CA  
1590 C C   . ALA A 211 ? 0.2184 0.1953 0.1833 0.0032  -0.0009 0.0109  289 ALA A C   
1591 O O   . ALA A 211 ? 0.2307 0.2095 0.1970 0.0013  0.0000  0.0107  289 ALA A O   
1592 C CB  . ALA A 211 ? 0.3106 0.2803 0.2688 0.0044  -0.0024 0.0126  289 ALA A CB  
1593 N N   . ASN A 212 ? 0.2083 0.1885 0.1757 0.0053  -0.0014 0.0106  290 ASN A N   
1594 C CA  . ASN A 212 ? 0.2062 0.1920 0.1777 0.0056  -0.0012 0.0105  290 ASN A CA  
1595 C C   . ASN A 212 ? 0.1958 0.1832 0.1678 0.0056  -0.0016 0.0112  290 ASN A C   
1596 O O   . ASN A 212 ? 0.1917 0.1784 0.1625 0.0072  -0.0028 0.0117  290 ASN A O   
1597 C CB  . ASN A 212 ? 0.1874 0.1761 0.1609 0.0078  -0.0015 0.0102  290 ASN A CB  
1598 C CG  . ASN A 212 ? 0.2101 0.1972 0.1821 0.0103  -0.0027 0.0105  290 ASN A CG  
1599 O OD1 . ASN A 212 ? 0.2131 0.1954 0.1818 0.0107  -0.0033 0.0106  290 ASN A OD1 
1600 N ND2 . ASN A 212 ? 0.2140 0.2053 0.1887 0.0120  -0.0031 0.0105  290 ASN A ND2 
1601 N N   . LEU A 213 ? 0.2282 0.2179 0.2020 0.0038  -0.0008 0.0111  291 LEU A N   
1602 C CA  . LEU A 213 ? 0.2262 0.2173 0.2003 0.0035  -0.0012 0.0115  291 LEU A CA  
1603 C C   . LEU A 213 ? 0.2121 0.2082 0.1904 0.0041  -0.0011 0.0114  291 LEU A C   
1604 O O   . LEU A 213 ? 0.2035 0.2017 0.1836 0.0054  -0.0010 0.0113  291 LEU A O   
1605 C CB  . LEU A 213 ? 0.2285 0.2181 0.2012 0.0011  -0.0003 0.0114  291 LEU A CB  
1606 C CG  . LEU A 213 ? 0.2427 0.2272 0.2113 0.0000  0.0000  0.0116  291 LEU A CG  
1607 C CD1 . LEU A 213 ? 0.2832 0.2672 0.2511 -0.0024 0.0010  0.0113  291 LEU A CD1 
1608 C CD2 . LEU A 213 ? 0.2556 0.2364 0.2204 0.0015  -0.0013 0.0124  291 LEU A CD2 
1609 N N   . TYR A 214 ? 0.1915 0.1893 0.1710 0.0029  -0.0008 0.0114  292 TYR A N   
1610 C CA  . TYR A 214 ? 0.2304 0.2323 0.2133 0.0034  -0.0008 0.0113  292 TYR A CA  
1611 C C   . TYR A 214 ? 0.2604 0.2647 0.2463 0.0032  0.0002  0.0112  292 TYR A C   
1612 O O   . TYR A 214 ? 0.2184 0.2257 0.2068 0.0038  0.0003  0.0113  292 TYR A O   
1613 C CB  . TYR A 214 ? 0.2274 0.2300 0.2105 0.0020  -0.0008 0.0111  292 TYR A CB  
1614 C CG  . TYR A 214 ? 0.2162 0.2163 0.1958 0.0020  -0.0019 0.0113  292 TYR A CG  
1615 C CD1 . TYR A 214 ? 0.2321 0.2329 0.2110 0.0037  -0.0035 0.0115  292 TYR A CD1 
1616 C CD2 . TYR A 214 ? 0.2401 0.2373 0.2169 0.0003  -0.0013 0.0112  292 TYR A CD2 
1617 C CE1 . TYR A 214 ? 0.2316 0.2300 0.2069 0.0039  -0.0046 0.0117  292 TYR A CE1 
1618 C CE2 . TYR A 214 ? 0.2422 0.2368 0.2151 0.0003  -0.0023 0.0115  292 TYR A CE2 
1619 C CZ  . TYR A 214 ? 0.2088 0.2039 0.1808 0.0022  -0.0040 0.0119  292 TYR A CZ  
1620 O OH  . TYR A 214 ? 0.2433 0.2358 0.2112 0.0024  -0.0051 0.0123  292 TYR A OH  
1621 N N   . GLY A 215 ? 0.2141 0.2172 0.1997 0.0022  0.0010  0.0110  293 GLY A N   
1622 C CA  . GLY A 215 ? 0.1933 0.1984 0.1813 0.0021  0.0019  0.0110  293 GLY A CA  
1623 C C   . GLY A 215 ? 0.2119 0.2161 0.1991 0.0024  0.0021  0.0107  293 GLY A C   
1624 O O   . GLY A 215 ? 0.2180 0.2197 0.2029 0.0023  0.0018  0.0104  293 GLY A O   
1625 N N   . SER A 216 ? 0.1784 0.1847 0.1676 0.0028  0.0026  0.0109  294 SER A N   
1626 C CA  . SER A 216 ? 0.1922 0.1985 0.1809 0.0035  0.0027  0.0105  294 SER A CA  
1627 C C   . SER A 216 ? 0.1928 0.2008 0.1834 0.0031  0.0033  0.0106  294 SER A C   
1628 O O   . SER A 216 ? 0.2016 0.2113 0.1937 0.0035  0.0037  0.0112  294 SER A O   
1629 C CB  . SER A 216 ? 0.1961 0.2035 0.1847 0.0052  0.0024  0.0108  294 SER A CB  
1630 O OG  . SER A 216 ? 0.1680 0.1737 0.1548 0.0059  0.0017  0.0106  294 SER A OG  
1631 N N   . HIS A 217 ? 0.1974 0.2049 0.1877 0.0024  0.0034  0.0098  295 HIS A N   
1632 C CA  . HIS A 217 ? 0.1987 0.2078 0.1907 0.0023  0.0037  0.0097  295 HIS A CA  
1633 C C   . HIS A 217 ? 0.1876 0.1972 0.1791 0.0027  0.0033  0.0088  295 HIS A C   
1634 O O   . HIS A 217 ? 0.1702 0.1790 0.1613 0.0015  0.0034  0.0077  295 HIS A O   
1635 C CB  . HIS A 217 ? 0.1835 0.1923 0.1764 0.0009  0.0042  0.0091  295 HIS A CB  
1636 C CG  . HIS A 217 ? 0.1907 0.1993 0.1843 0.0004  0.0046  0.0097  295 HIS A CG  
1637 N ND1 . HIS A 217 ? 0.2046 0.2141 0.2001 0.0004  0.0051  0.0099  295 HIS A ND1 
1638 C CD2 . HIS A 217 ? 0.1858 0.1933 0.1783 0.0001  0.0044  0.0099  295 HIS A CD2 
1639 C CE1 . HIS A 217 ? 0.2037 0.2128 0.1994 -0.0001 0.0053  0.0102  295 HIS A CE1 
1640 N NE2 . HIS A 217 ? 0.2037 0.2117 0.1976 -0.0003 0.0048  0.0102  295 HIS A NE2 
1641 N N   . PRO A 218 ? 0.1676 0.1785 0.1590 0.0042  0.0031  0.0092  296 PRO A N   
1642 C CA  . PRO A 218 ? 0.2003 0.2118 0.1910 0.0045  0.0025  0.0082  296 PRO A CA  
1643 C C   . PRO A 218 ? 0.2056 0.2192 0.1979 0.0045  0.0024  0.0076  296 PRO A C   
1644 O O   . PRO A 218 ? 0.1947 0.2101 0.1872 0.0058  0.0019  0.0077  296 PRO A O   
1645 C CB  . PRO A 218 ? 0.1788 0.1911 0.1685 0.0063  0.0023  0.0088  296 PRO A CB  
1646 C CG  . PRO A 218 ? 0.1597 0.1728 0.1504 0.0068  0.0029  0.0103  296 PRO A CG  
1647 C CD  . PRO A 218 ? 0.1560 0.1677 0.1474 0.0054  0.0032  0.0104  296 PRO A CD  
1648 N N   . PHE A 219 ? 0.1818 0.1950 0.1751 0.0030  0.0027  0.0068  297 PHE A N   
1649 C CA  . PHE A 219 ? 0.2100 0.2255 0.2054 0.0029  0.0026  0.0059  297 PHE A CA  
1650 C C   . PHE A 219 ? 0.1815 0.1966 0.1771 0.0009  0.0028  0.0042  297 PHE A C   
1651 O O   . PHE A 219 ? 0.1831 0.1959 0.1776 -0.0004 0.0034  0.0042  297 PHE A O   
1652 C CB  . PHE A 219 ? 0.2013 0.2170 0.1984 0.0030  0.0032  0.0067  297 PHE A CB  
1653 C CG  . PHE A 219 ? 0.1823 0.2001 0.1817 0.0028  0.0033  0.0055  297 PHE A CG  
1654 C CD1 . PHE A 219 ? 0.2307 0.2508 0.2313 0.0045  0.0026  0.0056  297 PHE A CD1 
1655 C CD2 . PHE A 219 ? 0.2074 0.2250 0.2078 0.0010  0.0040  0.0044  297 PHE A CD2 
1656 C CE1 . PHE A 219 ? 0.2339 0.2562 0.2369 0.0046  0.0024  0.0044  297 PHE A CE1 
1657 C CE2 . PHE A 219 ? 0.1986 0.2185 0.2014 0.0009  0.0041  0.0031  297 PHE A CE2 
1658 C CZ  . PHE A 219 ? 0.2363 0.2588 0.2407 0.0028  0.0033  0.0030  297 PHE A CZ  
1659 N N   . TYR A 220 ? 0.1454 0.1629 0.1423 0.0009  0.0024  0.0028  298 TYR A N   
1660 C CA  . TYR A 220 ? 0.1588 0.1768 0.1567 -0.0011 0.0028  0.0010  298 TYR A CA  
1661 C C   . TYR A 220 ? 0.1973 0.2190 0.1983 -0.0008 0.0027  -0.0001 298 TYR A C   
1662 O O   . TYR A 220 ? 0.1696 0.1936 0.1716 0.0011  0.0018  0.0001  298 TYR A O   
1663 C CB  . TYR A 220 ? 0.1678 0.1847 0.1641 -0.0022 0.0025  -0.0002 298 TYR A CB  
1664 C CG  . TYR A 220 ? 0.1539 0.1734 0.1507 -0.0011 0.0014  -0.0013 298 TYR A CG  
1665 C CD1 . TYR A 220 ? 0.1997 0.2228 0.1991 -0.0018 0.0010  -0.0032 298 TYR A CD1 
1666 C CD2 . TYR A 220 ? 0.1611 0.1798 0.1559 0.0003  0.0006  -0.0006 298 TYR A CD2 
1667 C CE1 . TYR A 220 ? 0.1726 0.1984 0.1723 -0.0008 -0.0002 -0.0044 298 TYR A CE1 
1668 C CE2 . TYR A 220 ? 0.1913 0.2124 0.1861 0.0013  -0.0004 -0.0018 298 TYR A CE2 
1669 C CZ  . TYR A 220 ? 0.1821 0.2067 0.1793 0.0007  -0.0009 -0.0037 298 TYR A CZ  
1670 O OH  . TYR A 220 ? 0.1710 0.1980 0.1679 0.0017  -0.0023 -0.0049 298 TYR A OH  
1671 N N   . LEU A 221 ? 0.1998 0.2220 0.2022 -0.0028 0.0036  -0.0014 299 LEU A N   
1672 C CA  . LEU A 221 ? 0.1876 0.2138 0.1934 -0.0029 0.0036  -0.0031 299 LEU A CA  
1673 C C   . LEU A 221 ? 0.1956 0.2228 0.2018 -0.0053 0.0040  -0.0053 299 LEU A C   
1674 O O   . LEU A 221 ? 0.1921 0.2164 0.1967 -0.0077 0.0051  -0.0055 299 LEU A O   
1675 C CB  . LEU A 221 ? 0.2131 0.2394 0.2204 -0.0034 0.0048  -0.0030 299 LEU A CB  
1676 C CG  . LEU A 221 ? 0.2058 0.2364 0.2170 -0.0033 0.0050  -0.0048 299 LEU A CG  
1677 C CD1 . LEU A 221 ? 0.2355 0.2657 0.2478 -0.0026 0.0057  -0.0042 299 LEU A CD1 
1678 C CD2 . LEU A 221 ? 0.2790 0.3110 0.2913 -0.0062 0.0060  -0.0071 299 LEU A CD2 
1679 N N   . ALA A 222 ? 0.1918 0.2229 0.2001 -0.0047 0.0029  -0.0069 300 ALA A N   
1680 C CA  . ALA A 222 ? 0.2013 0.2339 0.2106 -0.0070 0.0031  -0.0093 300 ALA A CA  
1681 C C   . ALA A 222 ? 0.1969 0.2345 0.2105 -0.0076 0.0035  -0.0114 300 ALA A C   
1682 O O   . ALA A 222 ? 0.2183 0.2596 0.2343 -0.0052 0.0023  -0.0115 300 ALA A O   
1683 C CB  . ALA A 222 ? 0.2460 0.2798 0.2545 -0.0059 0.0015  -0.0099 300 ALA A CB  
1684 N N   . LEU A 223 ? 0.1821 0.2199 0.1967 -0.0108 0.0050  -0.0131 301 LEU A N   
1685 C CA  . LEU A 223 ? 0.2161 0.2592 0.2351 -0.0118 0.0056  -0.0155 301 LEU A CA  
1686 C C   . LEU A 223 ? 0.2394 0.2867 0.2607 -0.0125 0.0046  -0.0181 301 LEU A C   
1687 O O   . LEU A 223 ? 0.2949 0.3399 0.3140 -0.0139 0.0044  -0.0184 301 LEU A O   
1688 C CB  . LEU A 223 ? 0.2049 0.2465 0.2238 -0.0151 0.0081  -0.0163 301 LEU A CB  
1689 C CG  . LEU A 223 ? 0.2368 0.2761 0.2547 -0.0147 0.0093  -0.0146 301 LEU A CG  
1690 C CD1 . LEU A 223 ? 0.2411 0.2781 0.2577 -0.0183 0.0117  -0.0152 301 LEU A CD1 
1691 C CD2 . LEU A 223 ? 0.2857 0.3295 0.3076 -0.0124 0.0089  -0.0152 301 LEU A CD2 
1692 N N   . GLU A 224 ? 0.2126 0.2663 0.2386 -0.0115 0.0040  -0.0200 302 GLU A N   
1693 C CA  . GLU A 224 ? 0.2121 0.2710 0.2411 -0.0120 0.0028  -0.0229 302 GLU A CA  
1694 C C   . GLU A 224 ? 0.2089 0.2724 0.2424 -0.0148 0.0044  -0.0258 302 GLU A C   
1695 O O   . GLU A 224 ? 0.1999 0.2646 0.2352 -0.0145 0.0056  -0.0256 302 GLU A O   
1696 C CB  . GLU A 224 ? 0.1904 0.2536 0.2212 -0.0079 0.0002  -0.0227 302 GLU A CB  
1697 C CG  . GLU A 224 ? 0.2236 0.2827 0.2500 -0.0052 -0.0011 -0.0199 302 GLU A CG  
1698 C CD  . GLU A 224 ? 0.2086 0.2701 0.2358 -0.0009 -0.0031 -0.0186 302 GLU A CD  
1699 O OE1 . GLU A 224 ? 0.2038 0.2711 0.2348 0.0005  -0.0043 -0.0205 302 GLU A OE1 
1700 O OE2 . GLU A 224 ? 0.2210 0.2783 0.2448 0.0011  -0.0034 -0.0158 302 GLU A OE2 
1701 N N   . ASP A 225 ? 0.2424 0.3088 0.2777 -0.0175 0.0045  -0.0285 303 ASP A N   
1702 C CA  . ASP A 225 ? 0.3008 0.3722 0.3407 -0.0205 0.0062  -0.0317 303 ASP A CA  
1703 C C   . ASP A 225 ? 0.2393 0.3176 0.2844 -0.0177 0.0055  -0.0329 303 ASP A C   
1704 O O   . ASP A 225 ? 0.2809 0.3626 0.3274 -0.0141 0.0029  -0.0328 303 ASP A O   
1705 C CB  . ASP A 225 ? 0.3849 0.4593 0.4265 -0.0233 0.0058  -0.0347 303 ASP A CB  
1706 C CG  . ASP A 225 ? 0.4939 0.5736 0.5404 -0.0270 0.0078  -0.0382 303 ASP A CG  
1707 O OD1 . ASP A 225 ? 0.5608 0.6380 0.6066 -0.0297 0.0107  -0.0378 303 ASP A OD1 
1708 O OD2 . ASP A 225 ? 0.6808 0.7676 0.7320 -0.0272 0.0066  -0.0413 303 ASP A OD2 
1709 N N   . GLY A 226 ? 0.2827 0.3626 0.3302 -0.0192 0.0077  -0.0337 304 GLY A N   
1710 C CA  . GLY A 226 ? 0.3129 0.3985 0.3650 -0.0162 0.0071  -0.0346 304 GLY A CA  
1711 C C   . GLY A 226 ? 0.2969 0.3783 0.3466 -0.0134 0.0073  -0.0317 304 GLY A C   
1712 O O   . GLY A 226 ? 0.3455 0.4305 0.3987 -0.0115 0.0076  -0.0325 304 GLY A O   
1713 N N   . GLY A 227 ? 0.2669 0.3409 0.3110 -0.0130 0.0073  -0.0284 305 GLY A N   
1714 C CA  . GLY A 227 ? 0.2148 0.2844 0.2565 -0.0113 0.0080  -0.0258 305 GLY A CA  
1715 C C   . GLY A 227 ? 0.2257 0.2933 0.2657 -0.0069 0.0058  -0.0232 305 GLY A C   
1716 O O   . GLY A 227 ? 0.2425 0.3066 0.2807 -0.0056 0.0063  -0.0212 305 GLY A O   
1717 N N   . SER A 228 ? 0.2129 0.2824 0.2529 -0.0048 0.0033  -0.0232 306 SER A N   
1718 C CA  . SER A 228 ? 0.2158 0.2823 0.2530 -0.0012 0.0015  -0.0204 306 SER A CA  
1719 C C   . SER A 228 ? 0.1945 0.2545 0.2263 -0.0026 0.0019  -0.0180 306 SER A C   
1720 O O   . SER A 228 ? 0.2094 0.2674 0.2397 -0.0060 0.0032  -0.0187 306 SER A O   
1721 C CB  . SER A 228 ? 0.2300 0.3010 0.2688 0.0015  -0.0012 -0.0212 306 SER A CB  
1722 O OG  . SER A 228 ? 0.2521 0.3287 0.2956 0.0037  -0.0018 -0.0229 306 SER A OG  
1723 N N   . ALA A 229 ? 0.1825 0.2392 0.2115 0.0001  0.0008  -0.0153 307 ALA A N   
1724 C CA  . ALA A 229 ? 0.1746 0.2256 0.1988 -0.0005 0.0011  -0.0130 307 ALA A CA  
1725 C C   . ALA A 229 ? 0.1702 0.2197 0.1922 0.0027  -0.0005 -0.0107 307 ALA A C   
1726 O O   . ALA A 229 ? 0.1786 0.2300 0.2021 0.0057  -0.0016 -0.0102 307 ALA A O   
1727 C CB  . ALA A 229 ? 0.1706 0.2172 0.1931 -0.0022 0.0031  -0.0118 307 ALA A CB  
1728 N N   . HIS A 230 ? 0.1577 0.2034 0.1759 0.0023  -0.0007 -0.0093 308 HIS A N   
1729 C CA  . HIS A 230 ? 0.1755 0.2191 0.1910 0.0050  -0.0017 -0.0068 308 HIS A CA  
1730 C C   . HIS A 230 ? 0.1722 0.2105 0.1842 0.0038  -0.0006 -0.0049 308 HIS A C   
1731 O O   . HIS A 230 ? 0.1786 0.2151 0.1900 0.0012  0.0005  -0.0055 308 HIS A O   
1732 C CB  . HIS A 230 ? 0.1700 0.2162 0.1849 0.0064  -0.0037 -0.0075 308 HIS A CB  
1733 C CG  . HIS A 230 ? 0.1772 0.2217 0.1898 0.0044  -0.0036 -0.0082 308 HIS A CG  
1734 N ND1 . HIS A 230 ? 0.2081 0.2545 0.2222 0.0018  -0.0033 -0.0109 308 HIS A ND1 
1735 C CD2 . HIS A 230 ? 0.2135 0.2545 0.2223 0.0047  -0.0037 -0.0067 308 HIS A CD2 
1736 C CE1 . HIS A 230 ? 0.2261 0.2697 0.2373 0.0006  -0.0033 -0.0109 308 HIS A CE1 
1737 N NE2 . HIS A 230 ? 0.2345 0.2749 0.2425 0.0024  -0.0035 -0.0085 308 HIS A NE2 
1738 N N   . GLY A 231 ? 0.1985 0.2345 0.2083 0.0058  -0.0010 -0.0025 309 GLY A N   
1739 C CA  . GLY A 231 ? 0.1909 0.2226 0.1977 0.0052  -0.0002 -0.0007 309 GLY A CA  
1740 C C   . GLY A 231 ? 0.2035 0.2343 0.2075 0.0069  -0.0011 0.0006  309 GLY A C   
1741 O O   . GLY A 231 ? 0.1714 0.2044 0.1755 0.0091  -0.0024 0.0008  309 GLY A O   
1742 N N   . VAL A 232 ? 0.1742 0.2019 0.1757 0.0060  -0.0006 0.0014  310 VAL A N   
1743 C CA  . VAL A 232 ? 0.1779 0.2047 0.1767 0.0074  -0.0011 0.0026  310 VAL A CA  
1744 C C   . VAL A 232 ? 0.1731 0.1966 0.1704 0.0072  -0.0001 0.0045  310 VAL A C   
1745 O O   . VAL A 232 ? 0.1927 0.2141 0.1897 0.0055  0.0006  0.0042  310 VAL A O   
1746 C CB  . VAL A 232 ? 0.1885 0.2155 0.1860 0.0066  -0.0017 0.0010  310 VAL A CB  
1747 C CG1 . VAL A 232 ? 0.1836 0.2096 0.1781 0.0081  -0.0022 0.0021  310 VAL A CG1 
1748 C CG2 . VAL A 232 ? 0.2347 0.2655 0.2341 0.0065  -0.0028 -0.0011 310 VAL A CG2 
1749 N N   . PHE A 233 ? 0.1840 0.2070 0.1801 0.0090  -0.0001 0.0063  311 PHE A N   
1750 C CA  . PHE A 233 ? 0.1720 0.1925 0.1668 0.0089  0.0007  0.0080  311 PHE A CA  
1751 C C   . PHE A 233 ? 0.1553 0.1759 0.1477 0.0101  0.0004  0.0087  311 PHE A C   
1752 O O   . PHE A 233 ? 0.1653 0.1872 0.1569 0.0117  -0.0001 0.0091  311 PHE A O   
1753 C CB  . PHE A 233 ? 0.1698 0.1898 0.1656 0.0096  0.0013  0.0096  311 PHE A CB  
1754 C CG  . PHE A 233 ? 0.1651 0.1832 0.1600 0.0094  0.0023  0.0112  311 PHE A CG  
1755 C CD1 . PHE A 233 ? 0.2160 0.2327 0.2106 0.0080  0.0028  0.0110  311 PHE A CD1 
1756 C CD2 . PHE A 233 ? 0.1688 0.1864 0.1634 0.0106  0.0027  0.0130  311 PHE A CD2 
1757 C CE1 . PHE A 233 ? 0.1730 0.1886 0.1673 0.0079  0.0036  0.0123  311 PHE A CE1 
1758 C CE2 . PHE A 233 ? 0.1815 0.1976 0.1758 0.0101  0.0038  0.0143  311 PHE A CE2 
1759 C CZ  . PHE A 233 ? 0.1760 0.1916 0.1704 0.0088  0.0041  0.0138  311 PHE A CZ  
1760 N N   . LEU A 234 ? 0.1581 0.1771 0.1491 0.0094  0.0008  0.0085  312 LEU A N   
1761 C CA  . LEU A 234 ? 0.1624 0.1814 0.1513 0.0106  0.0008  0.0092  312 LEU A CA  
1762 C C   . LEU A 234 ? 0.1730 0.1909 0.1620 0.0107  0.0018  0.0110  312 LEU A C   
1763 O O   . LEU A 234 ? 0.1850 0.2016 0.1746 0.0097  0.0023  0.0109  312 LEU A O   
1764 C CB  . LEU A 234 ? 0.1661 0.1841 0.1537 0.0100  0.0005  0.0077  312 LEU A CB  
1765 C CG  . LEU A 234 ? 0.2164 0.2342 0.2018 0.0113  0.0006  0.0081  312 LEU A CG  
1766 C CD1 . LEU A 234 ? 0.2166 0.2365 0.2006 0.0129  0.0001  0.0082  312 LEU A CD1 
1767 C CD2 . LEU A 234 ? 0.2103 0.2264 0.1946 0.0108  0.0004  0.0067  312 LEU A CD2 
1768 N N   . LEU A 235 ? 0.1893 0.2079 0.1778 0.0119  0.0022  0.0125  313 LEU A N   
1769 C CA  . LEU A 235 ? 0.1844 0.2023 0.1731 0.0118  0.0034  0.0141  313 LEU A CA  
1770 C C   . LEU A 235 ? 0.1881 0.2063 0.1754 0.0122  0.0039  0.0141  313 LEU A C   
1771 O O   . LEU A 235 ? 0.1913 0.2104 0.1770 0.0134  0.0042  0.0149  313 LEU A O   
1772 C CB  . LEU A 235 ? 0.1959 0.2139 0.1843 0.0128  0.0038  0.0158  313 LEU A CB  
1773 C CG  . LEU A 235 ? 0.1909 0.2080 0.1798 0.0124  0.0053  0.0175  313 LEU A CG  
1774 C CD1 . LEU A 235 ? 0.2053 0.2213 0.1965 0.0107  0.0057  0.0172  313 LEU A CD1 
1775 C CD2 . LEU A 235 ? 0.2261 0.2425 0.2141 0.0134  0.0056  0.0192  313 LEU A CD2 
1776 N N   . ASN A 236 ? 0.1715 0.1889 0.1594 0.0114  0.0038  0.0133  314 ASN A N   
1777 C CA  . ASN A 236 ? 0.1985 0.2161 0.1854 0.0120  0.0040  0.0129  314 ASN A CA  
1778 C C   . ASN A 236 ? 0.1710 0.1877 0.1592 0.0110  0.0042  0.0127  314 ASN A C   
1779 O O   . ASN A 236 ? 0.1661 0.1813 0.1547 0.0100  0.0036  0.0120  314 ASN A O   
1780 C CB  . ASN A 236 ? 0.1870 0.2044 0.1721 0.0125  0.0031  0.0113  314 ASN A CB  
1781 C CG  . ASN A 236 ? 0.1954 0.2129 0.1793 0.0134  0.0033  0.0107  314 ASN A CG  
1782 O OD1 . ASN A 236 ? 0.2131 0.2295 0.1976 0.0132  0.0033  0.0104  314 ASN A OD1 
1783 N ND2 . ASN A 236 ? 0.2064 0.2251 0.1885 0.0147  0.0033  0.0105  314 ASN A ND2 
1784 N N   . SER A 237 ? 0.1707 0.1882 0.1595 0.0113  0.0049  0.0133  315 SER A N   
1785 C CA  . SER A 237 ? 0.1618 0.1790 0.1520 0.0105  0.0049  0.0132  315 SER A CA  
1786 C C   . SER A 237 ? 0.1665 0.1836 0.1560 0.0115  0.0045  0.0123  315 SER A C   
1787 O O   . SER A 237 ? 0.2028 0.2199 0.1932 0.0113  0.0043  0.0122  315 SER A O   
1788 C CB  . SER A 237 ? 0.1532 0.1718 0.1453 0.0100  0.0060  0.0143  315 SER A CB  
1789 O OG  . SER A 237 ? 0.1727 0.1933 0.1646 0.0108  0.0069  0.0149  315 SER A OG  
1790 N N   . ASN A 238 ? 0.1949 0.2119 0.1827 0.0126  0.0042  0.0116  316 ASN A N   
1791 C CA  . ASN A 238 ? 0.1747 0.1911 0.1615 0.0138  0.0037  0.0106  316 ASN A CA  
1792 C C   . ASN A 238 ? 0.1779 0.1912 0.1638 0.0133  0.0027  0.0098  316 ASN A C   
1793 O O   . ASN A 238 ? 0.2011 0.2128 0.1867 0.0120  0.0024  0.0097  316 ASN A O   
1794 C CB  . ASN A 238 ? 0.2002 0.2173 0.1853 0.0152  0.0038  0.0098  316 ASN A CB  
1795 C CG  . ASN A 238 ? 0.2305 0.2506 0.2159 0.0159  0.0051  0.0107  316 ASN A CG  
1796 O OD1 . ASN A 238 ? 0.2353 0.2562 0.2203 0.0155  0.0055  0.0115  316 ASN A OD1 
1797 N ND2 . ASN A 238 ? 0.2072 0.2292 0.1934 0.0169  0.0057  0.0104  316 ASN A ND2 
1798 N N   . ALA A 239 ? 0.1832 0.1956 0.1686 0.0144  0.0022  0.0092  317 ALA A N   
1799 C CA  . ALA A 239 ? 0.2043 0.2128 0.1878 0.0141  0.0012  0.0084  317 ALA A CA  
1800 C C   . ALA A 239 ? 0.2020 0.2088 0.1839 0.0136  0.0011  0.0075  317 ALA A C   
1801 O O   . ALA A 239 ? 0.1853 0.1933 0.1665 0.0147  0.0013  0.0069  317 ALA A O   
1802 C CB  . ALA A 239 ? 0.2010 0.2086 0.1838 0.0160  0.0007  0.0079  317 ALA A CB  
1803 N N   . MET A 240 ? 0.1905 0.1947 0.1716 0.0120  0.0008  0.0073  318 MET A N   
1804 C CA  . MET A 240 ? 0.2151 0.2180 0.1950 0.0112  0.0006  0.0061  318 MET A CA  
1805 C C   . MET A 240 ? 0.2321 0.2309 0.2105 0.0096  0.0002  0.0055  318 MET A C   
1806 O O   . MET A 240 ? 0.2215 0.2188 0.1999 0.0088  0.0002  0.0062  318 MET A O   
1807 C CB  . MET A 240 ? 0.2547 0.2604 0.2361 0.0104  0.0009  0.0064  318 MET A CB  
1808 C CG  . MET A 240 ? 0.3075 0.3133 0.2902 0.0087  0.0011  0.0070  318 MET A CG  
1809 S SD  . MET A 240 ? 0.2843 0.2931 0.2685 0.0082  0.0012  0.0068  318 MET A SD  
1810 C CE  . MET A 240 ? 0.2685 0.2801 0.2538 0.0096  0.0018  0.0084  318 MET A CE  
1811 N N   . ASP A 241 ? 0.1929 0.1899 0.1698 0.0093  0.0000  0.0041  319 ASP A N   
1812 C CA  . ASP A 241 ? 0.1942 0.1876 0.1698 0.0073  0.0000  0.0033  319 ASP A CA  
1813 C C   . ASP A 241 ? 0.2145 0.2105 0.1916 0.0058  0.0002  0.0024  319 ASP A C   
1814 O O   . ASP A 241 ? 0.1964 0.1953 0.1741 0.0067  0.0000  0.0018  319 ASP A O   
1815 C CB  . ASP A 241 ? 0.2055 0.1950 0.1786 0.0077  -0.0002 0.0020  319 ASP A CB  
1816 C CG  . ASP A 241 ? 0.2495 0.2351 0.2206 0.0090  -0.0006 0.0027  319 ASP A CG  
1817 O OD1 . ASP A 241 ? 0.2167 0.2017 0.1879 0.0088  -0.0006 0.0040  319 ASP A OD1 
1818 O OD2 . ASP A 241 ? 0.2438 0.2267 0.2131 0.0102  -0.0009 0.0018  319 ASP A OD2 
1819 N N   . VAL A 242 ? 0.1928 0.1879 0.1704 0.0036  0.0005  0.0023  320 VAL A N   
1820 C CA  . VAL A 242 ? 0.2170 0.2141 0.1959 0.0020  0.0006  0.0011  320 VAL A CA  
1821 C C   . VAL A 242 ? 0.2438 0.2370 0.2211 -0.0001 0.0009  -0.0002 320 VAL A C   
1822 O O   . VAL A 242 ? 0.2833 0.2732 0.2594 -0.0013 0.0014  0.0003  320 VAL A O   
1823 C CB  . VAL A 242 ? 0.2295 0.2296 0.2109 0.0014  0.0010  0.0019  320 VAL A CB  
1824 C CG1 . VAL A 242 ? 0.2784 0.2814 0.2617 0.0002  0.0010  0.0005  320 VAL A CG1 
1825 C CG2 . VAL A 242 ? 0.2346 0.2375 0.2171 0.0034  0.0009  0.0033  320 VAL A CG2 
1826 N N   . VAL A 243 ? 0.2046 0.1981 0.1817 -0.0005 0.0006  -0.0020 321 VAL A N   
1827 C CA  . VAL A 243 ? 0.2302 0.2196 0.2056 -0.0026 0.0009  -0.0035 321 VAL A CA  
1828 C C   . VAL A 243 ? 0.2342 0.2263 0.2118 -0.0051 0.0013  -0.0051 321 VAL A C   
1829 O O   . VAL A 243 ? 0.2601 0.2564 0.2395 -0.0046 0.0006  -0.0063 321 VAL A O   
1830 C CB  . VAL A 243 ? 0.2559 0.2430 0.2293 -0.0014 0.0003  -0.0047 321 VAL A CB  
1831 C CG1 . VAL A 243 ? 0.2667 0.2493 0.2383 -0.0039 0.0008  -0.0065 321 VAL A CG1 
1832 C CG2 . VAL A 243 ? 0.2886 0.2732 0.2600 0.0010  0.0001  -0.0033 321 VAL A CG2 
1833 N N   . LEU A 244 ? 0.2519 0.2416 0.2292 -0.0076 0.0023  -0.0052 322 LEU A N   
1834 C CA  . LEU A 244 ? 0.2745 0.2668 0.2541 -0.0103 0.0028  -0.0069 322 LEU A CA  
1835 C C   . LEU A 244 ? 0.2808 0.2690 0.2587 -0.0128 0.0034  -0.0087 322 LEU A C   
1836 O O   . LEU A 244 ? 0.2793 0.2615 0.2539 -0.0133 0.0039  -0.0079 322 LEU A O   
1837 C CB  . LEU A 244 ? 0.2779 0.2707 0.2586 -0.0117 0.0039  -0.0058 322 LEU A CB  
1838 C CG  . LEU A 244 ? 0.2684 0.2642 0.2506 -0.0096 0.0036  -0.0040 322 LEU A CG  
1839 C CD1 . LEU A 244 ? 0.3047 0.3008 0.2877 -0.0114 0.0048  -0.0034 322 LEU A CD1 
1840 C CD2 . LEU A 244 ? 0.2875 0.2890 0.2726 -0.0079 0.0026  -0.0045 322 LEU A CD2 
1841 N N   . GLN A 245 ? 0.2579 0.2493 0.2378 -0.0141 0.0031  -0.0111 323 GLN A N   
1842 C CA  . GLN A 245 ? 0.2705 0.2585 0.2493 -0.0169 0.0037  -0.0132 323 GLN A CA  
1843 C C   . GLN A 245 ? 0.2554 0.2476 0.2377 -0.0200 0.0044  -0.0153 323 GLN A C   
1844 O O   . GLN A 245 ? 0.2140 0.2124 0.1997 -0.0192 0.0040  -0.0154 323 GLN A O   
1845 C CB  . GLN A 245 ? 0.3141 0.3011 0.2915 -0.0155 0.0026  -0.0147 323 GLN A CB  
1846 C CG  . GLN A 245 ? 0.2858 0.2795 0.2659 -0.0140 0.0011  -0.0162 323 GLN A CG  
1847 C CD  . GLN A 245 ? 0.2888 0.2807 0.2666 -0.0121 0.0001  -0.0170 323 GLN A CD  
1848 O OE1 . GLN A 245 ? 0.2777 0.2684 0.2538 -0.0092 -0.0002 -0.0152 323 GLN A OE1 
1849 N NE2 . GLN A 245 ? 0.2660 0.2578 0.2438 -0.0137 -0.0001 -0.0199 323 GLN A NE2 
1850 N N   . PRO A 246 ? 0.2536 0.2425 0.2351 -0.0235 0.0056  -0.0170 324 PRO A N   
1851 C CA  . PRO A 246 ? 0.2677 0.2603 0.2525 -0.0267 0.0068  -0.0186 324 PRO A CA  
1852 C C   . PRO A 246 ? 0.2589 0.2581 0.2478 -0.0276 0.0059  -0.0218 324 PRO A C   
1853 O O   . PRO A 246 ? 0.2641 0.2668 0.2561 -0.0304 0.0069  -0.0235 324 PRO A O   
1854 C CB  . PRO A 246 ? 0.2809 0.2665 0.2626 -0.0303 0.0088  -0.0187 324 PRO A CB  
1855 C CG  . PRO A 246 ? 0.2844 0.2636 0.2621 -0.0294 0.0082  -0.0185 324 PRO A CG  
1856 C CD  . PRO A 246 ? 0.2812 0.2621 0.2584 -0.0248 0.0062  -0.0171 324 PRO A CD  
1857 N N   . SER A 247 ? 0.2665 0.2682 0.2556 -0.0251 0.0040  -0.0226 325 SER A N   
1858 C CA  . SER A 247 ? 0.2902 0.2988 0.2832 -0.0255 0.0028  -0.0256 325 SER A CA  
1859 C C   . SER A 247 ? 0.2219 0.2383 0.2198 -0.0254 0.0026  -0.0263 325 SER A C   
1860 O O   . SER A 247 ? 0.2526 0.2734 0.2537 -0.0276 0.0025  -0.0292 325 SER A O   
1861 C CB  . SER A 247 ? 0.3450 0.3552 0.3369 -0.0223 0.0007  -0.0261 325 SER A CB  
1862 O OG  . SER A 247 ? 0.2895 0.2994 0.2799 -0.0187 0.0000  -0.0232 325 SER A OG  
1863 N N   . PRO A 248 ? 0.2066 0.2251 0.2054 -0.0231 0.0025  -0.0239 326 PRO A N   
1864 C CA  . PRO A 248 ? 0.2281 0.2425 0.2237 -0.0206 0.0026  -0.0205 326 PRO A CA  
1865 C C   . PRO A 248 ? 0.2360 0.2527 0.2311 -0.0166 0.0007  -0.0194 326 PRO A C   
1866 O O   . PRO A 248 ? 0.2242 0.2466 0.2218 -0.0153 -0.0006 -0.0207 326 PRO A O   
1867 C CB  . PRO A 248 ? 0.2075 0.2240 0.2053 -0.0210 0.0038  -0.0193 326 PRO A CB  
1868 C CG  . PRO A 248 ? 0.1975 0.2217 0.2003 -0.0214 0.0031  -0.0217 326 PRO A CG  
1869 C CD  . PRO A 248 ? 0.2114 0.2366 0.2149 -0.0235 0.0026  -0.0248 326 PRO A CD  
1870 N N   . ALA A 249 ? 0.2096 0.2219 0.2014 -0.0145 0.0007  -0.0169 327 ALA A N   
1871 C CA  . ALA A 249 ? 0.2383 0.2521 0.2291 -0.0109 -0.0006 -0.0156 327 ALA A CA  
1872 C C   . ALA A 249 ? 0.2233 0.2330 0.2114 -0.0092 -0.0001 -0.0126 327 ALA A C   
1873 O O   . ALA A 249 ? 0.2188 0.2239 0.2053 -0.0106 0.0010  -0.0117 327 ALA A O   
1874 C CB  . ALA A 249 ? 0.2401 0.2532 0.2291 -0.0105 -0.0016 -0.0175 327 ALA A CB  
1875 N N   . LEU A 250 ? 0.2047 0.2163 0.1925 -0.0061 -0.0010 -0.0112 328 LEU A N   
1876 C CA  . LEU A 250 ? 0.2081 0.2173 0.1942 -0.0043 -0.0006 -0.0085 328 LEU A CA  
1877 C C   . LEU A 250 ? 0.2272 0.2365 0.2114 -0.0015 -0.0016 -0.0080 328 LEU A C   
1878 O O   . LEU A 250 ? 0.2113 0.2244 0.1962 -0.0004 -0.0026 -0.0090 328 LEU A O   
1879 C CB  . LEU A 250 ? 0.2333 0.2456 0.2218 -0.0036 -0.0004 -0.0070 328 LEU A CB  
1880 C CG  . LEU A 250 ? 0.2358 0.2467 0.2233 -0.0018 -0.0001 -0.0043 328 LEU A CG  
1881 C CD1 . LEU A 250 ? 0.2506 0.2625 0.2402 -0.0025 0.0006  -0.0034 328 LEU A CD1 
1882 C CD2 . LEU A 250 ? 0.2256 0.2389 0.2128 0.0010  -0.0009 -0.0033 328 LEU A CD2 
1883 N N   . SER A 251 ? 0.2208 0.2265 0.2027 -0.0004 -0.0012 -0.0065 329 SER A N   
1884 C CA  . SER A 251 ? 0.1907 0.1966 0.1709 0.0021  -0.0017 -0.0059 329 SER A CA  
1885 C C   . SER A 251 ? 0.2376 0.2431 0.2178 0.0036  -0.0012 -0.0033 329 SER A C   
1886 O O   . SER A 251 ? 0.2370 0.2391 0.2164 0.0030  -0.0006 -0.0024 329 SER A O   
1887 C CB  . SER A 251 ? 0.2141 0.2159 0.1916 0.0021  -0.0018 -0.0072 329 SER A CB  
1888 O OG  . SER A 251 ? 0.1980 0.1999 0.1754 0.0006  -0.0022 -0.0098 329 SER A OG  
1889 N N   . TRP A 252 ? 0.2070 0.2159 0.1878 0.0055  -0.0014 -0.0022 330 TRP A N   
1890 C CA  . TRP A 252 ? 0.2163 0.2249 0.1969 0.0070  -0.0009 0.0000  330 TRP A CA  
1891 C C   . TRP A 252 ? 0.2043 0.2117 0.1828 0.0087  -0.0010 -0.0002 330 TRP A C   
1892 O O   . TRP A 252 ? 0.1880 0.1969 0.1654 0.0097  -0.0015 -0.0012 330 TRP A O   
1893 C CB  . TRP A 252 ? 0.2184 0.2307 0.2004 0.0082  -0.0010 0.0012  330 TRP A CB  
1894 C CG  . TRP A 252 ? 0.1990 0.2134 0.1834 0.0072  -0.0010 0.0013  330 TRP A CG  
1895 C CD1 . TRP A 252 ? 0.1986 0.2159 0.1840 0.0071  -0.0018 0.0002  330 TRP A CD1 
1896 C CD2 . TRP A 252 ? 0.2052 0.2192 0.1912 0.0064  -0.0004 0.0026  330 TRP A CD2 
1897 N NE1 . TRP A 252 ? 0.2367 0.2554 0.2245 0.0065  -0.0016 0.0007  330 TRP A NE1 
1898 C CE2 . TRP A 252 ? 0.2073 0.2239 0.1953 0.0059  -0.0007 0.0021  330 TRP A CE2 
1899 C CE3 . TRP A 252 ? 0.2550 0.2669 0.2409 0.0061  0.0003  0.0039  330 TRP A CE3 
1900 C CZ2 . TRP A 252 ? 0.2446 0.2615 0.2347 0.0052  -0.0001 0.0029  330 TRP A CZ2 
1901 C CZ3 . TRP A 252 ? 0.2471 0.2594 0.2349 0.0052  0.0008  0.0046  330 TRP A CZ3 
1902 C CH2 . TRP A 252 ? 0.2619 0.2765 0.2517 0.0048  0.0006  0.0041  330 TRP A CH2 
1903 N N   . ARG A 253 ? 0.1742 0.1791 0.1520 0.0092  -0.0006 0.0006  331 ARG A N   
1904 C CA  . ARG A 253 ? 0.2004 0.2043 0.1765 0.0111  -0.0005 0.0004  331 ARG A CA  
1905 C C   . ARG A 253 ? 0.2530 0.2582 0.2301 0.0122  0.0000  0.0023  331 ARG A C   
1906 O O   . ARG A 253 ? 0.2640 0.2672 0.2414 0.0119  0.0001  0.0031  331 ARG A O   
1907 C CB  . ARG A 253 ? 0.2311 0.2303 0.2055 0.0106  -0.0007 -0.0005 331 ARG A CB  
1908 C CG  . ARG A 253 ? 0.2638 0.2613 0.2368 0.0096  -0.0011 -0.0028 331 ARG A CG  
1909 C CD  . ARG A 253 ? 0.2691 0.2611 0.2401 0.0093  -0.0011 -0.0036 331 ARG A CD  
1910 N NE  . ARG A 253 ? 0.2451 0.2350 0.2152 0.0073  -0.0013 -0.0056 331 ARG A NE  
1911 C CZ  . ARG A 253 ? 0.2896 0.2740 0.2579 0.0061  -0.0012 -0.0064 331 ARG A CZ  
1912 N NH1 . ARG A 253 ? 0.2601 0.2404 0.2268 0.0069  -0.0010 -0.0051 331 ARG A NH1 
1913 N NH2 . ARG A 253 ? 0.2863 0.2693 0.2542 0.0040  -0.0012 -0.0084 331 ARG A NH2 
1914 N N   . SER A 254 ? 0.2335 0.2419 0.2109 0.0135  0.0003  0.0031  332 SER A N   
1915 C CA  . SER A 254 ? 0.2088 0.2188 0.1875 0.0143  0.0010  0.0047  332 SER A CA  
1916 C C   . SER A 254 ? 0.2132 0.2240 0.1910 0.0163  0.0013  0.0044  332 SER A C   
1917 O O   . SER A 254 ? 0.2063 0.2173 0.1824 0.0172  0.0012  0.0032  332 SER A O   
1918 C CB  . SER A 254 ? 0.2241 0.2370 0.2041 0.0141  0.0014  0.0061  332 SER A CB  
1919 O OG  . SER A 254 ? 0.2212 0.2354 0.2025 0.0146  0.0022  0.0076  332 SER A OG  
1920 N N   . THR A 255 ? 0.2203 0.2316 0.1993 0.0169  0.0018  0.0053  333 THR A N   
1921 C CA  . THR A 255 ? 0.2080 0.2205 0.1868 0.0188  0.0022  0.0050  333 THR A CA  
1922 C C   . THR A 255 ? 0.2039 0.2204 0.1834 0.0195  0.0034  0.0059  333 THR A C   
1923 O O   . THR A 255 ? 0.2085 0.2268 0.1881 0.0210  0.0041  0.0056  333 THR A O   
1924 C CB  . THR A 255 ? 0.2089 0.2200 0.1885 0.0193  0.0019  0.0051  333 THR A CB  
1925 O OG1 . THR A 255 ? 0.2127 0.2249 0.1944 0.0181  0.0021  0.0066  333 THR A OG1 
1926 C CG2 . THR A 255 ? 0.2196 0.2261 0.1975 0.0190  0.0009  0.0041  333 THR A CG2 
1927 N N   . GLY A 256 ? 0.1879 0.2059 0.1678 0.0185  0.0038  0.0071  334 GLY A N   
1928 C CA  . GLY A 256 ? 0.1853 0.2064 0.1653 0.0191  0.0050  0.0082  334 GLY A CA  
1929 C C   . GLY A 256 ? 0.2228 0.2443 0.2026 0.0181  0.0051  0.0094  334 GLY A C   
1930 O O   . GLY A 256 ? 0.1794 0.1995 0.1590 0.0173  0.0041  0.0091  334 GLY A O   
1931 N N   . GLY A 257 ? 0.1884 0.2121 0.1684 0.0183  0.0064  0.0109  335 GLY A N   
1932 C CA  . GLY A 257 ? 0.2020 0.2258 0.1817 0.0176  0.0066  0.0124  335 GLY A CA  
1933 C C   . GLY A 257 ? 0.2093 0.2332 0.1864 0.0184  0.0058  0.0120  335 GLY A C   
1934 O O   . GLY A 257 ? 0.1732 0.1979 0.1482 0.0195  0.0058  0.0109  335 GLY A O   
1935 N N   . ILE A 258 ? 0.1768 0.2001 0.1541 0.0179  0.0051  0.0127  336 ILE A N   
1936 C CA  . ILE A 258 ? 0.1969 0.2206 0.1721 0.0186  0.0041  0.0123  336 ILE A CA  
1937 C C   . ILE A 258 ? 0.1799 0.2027 0.1566 0.0177  0.0027  0.0113  336 ILE A C   
1938 O O   . ILE A 258 ? 0.1895 0.2110 0.1685 0.0165  0.0027  0.0113  336 ILE A O   
1939 C CB  . ILE A 258 ? 0.2077 0.2322 0.1813 0.0193  0.0048  0.0144  336 ILE A CB  
1940 C CG1 . ILE A 258 ? 0.2330 0.2564 0.2087 0.0184  0.0051  0.0161  336 ILE A CG1 
1941 C CG2 . ILE A 258 ? 0.2262 0.2517 0.1982 0.0199  0.0065  0.0154  336 ILE A CG2 
1942 C CD1 . ILE A 258 ? 0.1994 0.2226 0.1733 0.0193  0.0050  0.0178  336 ILE A CD1 
1943 N N   . LEU A 259 ? 0.1861 0.2097 0.1614 0.0183  0.0015  0.0105  337 LEU A N   
1944 C CA  . LEU A 259 ? 0.1910 0.2144 0.1679 0.0175  0.0003  0.0096  337 LEU A CA  
1945 C C   . LEU A 259 ? 0.2180 0.2420 0.1954 0.0180  0.0002  0.0114  337 LEU A C   
1946 O O   . LEU A 259 ? 0.2170 0.2421 0.1921 0.0195  -0.0001 0.0121  337 LEU A O   
1947 C CB  . LEU A 259 ? 0.2216 0.2459 0.1974 0.0177  -0.0010 0.0073  337 LEU A CB  
1948 C CG  . LEU A 259 ? 0.1964 0.2194 0.1716 0.0172  -0.0011 0.0053  337 LEU A CG  
1949 C CD1 . LEU A 259 ? 0.2178 0.2420 0.1914 0.0175  -0.0024 0.0031  337 LEU A CD1 
1950 C CD2 . LEU A 259 ? 0.2227 0.2436 0.2002 0.0154  -0.0009 0.0048  337 LEU A CD2 
1951 N N   . ASP A 260 ? 0.1991 0.2221 0.1790 0.0170  0.0006  0.0121  338 ASP A N   
1952 C CA  . ASP A 260 ? 0.2135 0.2363 0.1941 0.0174  0.0007  0.0137  338 ASP A CA  
1953 C C   . ASP A 260 ? 0.1952 0.2181 0.1787 0.0163  0.0000  0.0125  338 ASP A C   
1954 O O   . ASP A 260 ? 0.1769 0.1985 0.1624 0.0147  0.0006  0.0122  338 ASP A O   
1955 C CB  . ASP A 260 ? 0.1864 0.2079 0.1675 0.0170  0.0023  0.0157  338 ASP A CB  
1956 C CG  . ASP A 260 ? 0.2246 0.2452 0.2059 0.0176  0.0026  0.0176  338 ASP A CG  
1957 O OD1 . ASP A 260 ? 0.2333 0.2545 0.2152 0.0182  0.0014  0.0172  338 ASP A OD1 
1958 O OD2 . ASP A 260 ? 0.2318 0.2512 0.2127 0.0174  0.0040  0.0195  338 ASP A OD2 
1959 N N   . VAL A 261 ? 0.1786 0.2032 0.1623 0.0171  -0.0014 0.0115  339 VAL A N   
1960 C CA  . VAL A 261 ? 0.1967 0.2222 0.1830 0.0160  -0.0021 0.0097  339 VAL A CA  
1961 C C   . VAL A 261 ? 0.2131 0.2395 0.2010 0.0169  -0.0027 0.0102  339 VAL A C   
1962 O O   . VAL A 261 ? 0.2298 0.2574 0.2163 0.0188  -0.0036 0.0110  339 VAL A O   
1963 C CB  . VAL A 261 ? 0.1976 0.2248 0.1834 0.0157  -0.0034 0.0073  339 VAL A CB  
1964 C CG1 . VAL A 261 ? 0.2180 0.2461 0.2066 0.0141  -0.0038 0.0053  339 VAL A CG1 
1965 C CG2 . VAL A 261 ? 0.2176 0.2434 0.2016 0.0151  -0.0028 0.0067  339 VAL A CG2 
1966 N N   . TYR A 262 ? 0.1910 0.2168 0.1817 0.0156  -0.0022 0.0098  340 TYR A N   
1967 C CA  . TYR A 262 ? 0.2138 0.2406 0.2065 0.0164  -0.0027 0.0099  340 TYR A CA  
1968 C C   . TYR A 262 ? 0.2363 0.2653 0.2317 0.0151  -0.0033 0.0073  340 TYR A C   
1969 O O   . TYR A 262 ? 0.1867 0.2149 0.1829 0.0129  -0.0026 0.0062  340 TYR A O   
1970 C CB  . TYR A 262 ? 0.2152 0.2397 0.2093 0.0158  -0.0013 0.0113  340 TYR A CB  
1971 C CG  . TYR A 262 ? 0.2183 0.2405 0.2102 0.0168  -0.0005 0.0139  340 TYR A CG  
1972 C CD1 . TYR A 262 ? 0.2566 0.2772 0.2472 0.0158  0.0006  0.0147  340 TYR A CD1 
1973 C CD2 . TYR A 262 ? 0.2146 0.2361 0.2059 0.0187  -0.0007 0.0155  340 TYR A CD2 
1974 C CE1 . TYR A 262 ? 0.2812 0.3001 0.2702 0.0164  0.0016  0.0169  340 TYR A CE1 
1975 C CE2 . TYR A 262 ? 0.2657 0.2848 0.2549 0.0193  0.0002  0.0179  340 TYR A CE2 
1976 C CZ  . TYR A 262 ? 0.2833 0.3013 0.2716 0.0179  0.0015  0.0185  340 TYR A CZ  
1977 O OH  . TYR A 262 ? 0.3336 0.3495 0.3201 0.0181  0.0028  0.0208  340 TYR A OH  
1978 N N   . ILE A 263 ? 0.2309 0.2627 0.2277 0.0165  -0.0046 0.0064  341 ILE A N   
1979 C CA  . ILE A 263 ? 0.2251 0.2598 0.2251 0.0153  -0.0051 0.0039  341 ILE A CA  
1980 C C   . ILE A 263 ? 0.2049 0.2405 0.2076 0.0163  -0.0051 0.0040  341 ILE A C   
1981 O O   . ILE A 263 ? 0.2391 0.2752 0.2413 0.0188  -0.0060 0.0052  341 ILE A O   
1982 C CB  . ILE A 263 ? 0.2454 0.2836 0.2452 0.0158  -0.0068 0.0018  341 ILE A CB  
1983 C CG1 . ILE A 263 ? 0.2821 0.3191 0.2790 0.0150  -0.0068 0.0015  341 ILE A CG1 
1984 C CG2 . ILE A 263 ? 0.2407 0.2819 0.2442 0.0140  -0.0070 -0.0009 341 ILE A CG2 
1985 C CD1 . ILE A 263 ? 0.3881 0.4245 0.3814 0.0172  -0.0074 0.0033  341 ILE A CD1 
1986 N N   . PHE A 264 ? 0.1976 0.2333 0.2030 0.0143  -0.0041 0.0027  342 PHE A N   
1987 C CA  . PHE A 264 ? 0.1778 0.2141 0.1861 0.0150  -0.0038 0.0026  342 PHE A CA  
1988 C C   . PHE A 264 ? 0.2072 0.2480 0.2190 0.0142  -0.0043 -0.0003 342 PHE A C   
1989 O O   . PHE A 264 ? 0.1901 0.2313 0.2026 0.0116  -0.0036 -0.0019 342 PHE A O   
1990 C CB  . PHE A 264 ? 0.2104 0.2433 0.2188 0.0133  -0.0019 0.0034  342 PHE A CB  
1991 C CG  . PHE A 264 ? 0.1833 0.2124 0.1887 0.0134  -0.0012 0.0059  342 PHE A CG  
1992 C CD1 . PHE A 264 ? 0.2152 0.2426 0.2194 0.0155  -0.0013 0.0080  342 PHE A CD1 
1993 C CD2 . PHE A 264 ? 0.2044 0.2316 0.2080 0.0115  -0.0004 0.0060  342 PHE A CD2 
1994 C CE1 . PHE A 264 ? 0.2043 0.2285 0.2059 0.0154  -0.0005 0.0101  342 PHE A CE1 
1995 C CE2 . PHE A 264 ? 0.1931 0.2175 0.1944 0.0117  0.0001  0.0080  342 PHE A CE2 
1996 C CZ  . PHE A 264 ? 0.1818 0.2049 0.1822 0.0135  0.0001  0.0100  342 PHE A CZ  
1997 N N   . LEU A 265 ? 0.1924 0.2363 0.2063 0.0166  -0.0056 -0.0009 343 LEU A N   
1998 C CA  . LEU A 265 ? 0.2131 0.2624 0.2305 0.0163  -0.0065 -0.0039 343 LEU A CA  
1999 C C   . LEU A 265 ? 0.2232 0.2745 0.2448 0.0150  -0.0054 -0.0058 343 LEU A C   
2000 O O   . LEU A 265 ? 0.2149 0.2709 0.2397 0.0142  -0.0058 -0.0085 343 LEU A O   
2001 C CB  . LEU A 265 ? 0.1911 0.2438 0.2088 0.0198  -0.0089 -0.0039 343 LEU A CB  
2002 C CG  . LEU A 265 ? 0.2060 0.2605 0.2215 0.0202  -0.0105 -0.0044 343 LEU A CG  
2003 C CD1 . LEU A 265 ? 0.2256 0.2847 0.2441 0.0179  -0.0109 -0.0080 343 LEU A CD1 
2004 C CD2 . LEU A 265 ? 0.2002 0.2500 0.2112 0.0192  -0.0097 -0.0024 343 LEU A CD2 
2005 N N   . GLY A 266 ? 0.2394 0.2874 0.2609 0.0147  -0.0039 -0.0045 344 GLY A N   
2006 C CA  . GLY A 266 ? 0.2177 0.2673 0.2427 0.0134  -0.0025 -0.0064 344 GLY A CA  
2007 C C   . GLY A 266 ? 0.2143 0.2680 0.2429 0.0162  -0.0037 -0.0076 344 GLY A C   
2008 O O   . GLY A 266 ? 0.2239 0.2759 0.2517 0.0193  -0.0045 -0.0058 344 GLY A O   
2009 N N   . PRO A 267 ? 0.2125 0.2718 0.2452 0.0154  -0.0038 -0.0107 345 PRO A N   
2010 C CA  . PRO A 267 ? 0.1857 0.2472 0.2194 0.0118  -0.0030 -0.0130 345 PRO A CA  
2011 C C   . PRO A 267 ? 0.2056 0.2651 0.2396 0.0084  -0.0004 -0.0136 345 PRO A C   
2012 O O   . PRO A 267 ? 0.1704 0.2296 0.2036 0.0052  0.0005  -0.0146 345 PRO A O   
2013 C CB  . PRO A 267 ? 0.2291 0.2979 0.2676 0.0127  -0.0042 -0.0160 345 PRO A CB  
2014 C CG  . PRO A 267 ? 0.2485 0.3184 0.2895 0.0159  -0.0045 -0.0158 345 PRO A CG  
2015 C CD  . PRO A 267 ? 0.2322 0.2962 0.2690 0.0183  -0.0051 -0.0122 345 PRO A CD  
2016 N N   . GLU A 268 ? 0.1809 0.2384 0.2155 0.0091  0.0007  -0.0129 346 GLU A N   
2017 C CA  . GLU A 268 ? 0.2284 0.2842 0.2631 0.0060  0.0031  -0.0136 346 GLU A CA  
2018 C C   . GLU A 268 ? 0.2116 0.2613 0.2414 0.0044  0.0039  -0.0111 346 GLU A C   
2019 O O   . GLU A 268 ? 0.2409 0.2873 0.2681 0.0064  0.0030  -0.0087 346 GLU A O   
2020 C CB  . GLU A 268 ? 0.2475 0.3035 0.2844 0.0075  0.0040  -0.0140 346 GLU A CB  
2021 C CG  . GLU A 268 ? 0.2420 0.3039 0.2838 0.0100  0.0029  -0.0162 346 GLU A CG  
2022 C CD  . GLU A 268 ? 0.2985 0.3606 0.3402 0.0144  0.0005  -0.0147 346 GLU A CD  
2023 O OE1 . GLU A 268 ? 0.2857 0.3431 0.3234 0.0155  -0.0001 -0.0118 346 GLU A OE1 
2024 O OE2 . GLU A 268 ? 0.2721 0.3389 0.3177 0.0168  -0.0004 -0.0164 346 GLU A OE2 
2025 N N   . PRO A 269 ? 0.2327 0.2807 0.2611 0.0009  0.0055  -0.0117 347 PRO A N   
2026 C CA  . PRO A 269 ? 0.2397 0.2821 0.2637 -0.0001 0.0061  -0.0094 347 PRO A CA  
2027 C C   . PRO A 269 ? 0.1983 0.2371 0.2210 0.0013  0.0064  -0.0074 347 PRO A C   
2028 O O   . PRO A 269 ? 0.1804 0.2157 0.2002 0.0019  0.0059  -0.0052 347 PRO A O   
2029 C CB  . PRO A 269 ? 0.2432 0.2847 0.2664 -0.0038 0.0080  -0.0106 347 PRO A CB  
2030 C CG  . PRO A 269 ? 0.2146 0.2609 0.2407 -0.0050 0.0078  -0.0132 347 PRO A CG  
2031 C CD  . PRO A 269 ? 0.2418 0.2929 0.2720 -0.0020 0.0066  -0.0142 347 PRO A CD  
2032 N N   . LYS A 270 ? 0.2090 0.2489 0.2341 0.0019  0.0073  -0.0084 348 LYS A N   
2033 C CA  . LYS A 270 ? 0.2050 0.2414 0.2291 0.0034  0.0075  -0.0067 348 LYS A CA  
2034 C C   . LYS A 270 ? 0.2062 0.2416 0.2298 0.0066  0.0058  -0.0048 348 LYS A C   
2035 O O   . LYS A 270 ? 0.1727 0.2042 0.1939 0.0071  0.0059  -0.0026 348 LYS A O   
2036 C CB  . LYS A 270 ? 0.2082 0.2461 0.2351 0.0036  0.0087  -0.0084 348 LYS A CB  
2037 C CG  . LYS A 270 ? 0.2156 0.2533 0.2421 0.0003  0.0107  -0.0098 348 LYS A CG  
2038 C CD  . LYS A 270 ? 0.2129 0.2518 0.2418 0.0005  0.0120  -0.0115 348 LYS A CD  
2039 C CE  . LYS A 270 ? 0.2455 0.2899 0.2790 0.0021  0.0118  -0.0139 348 LYS A CE  
2040 N NZ  . LYS A 270 ? 0.2598 0.3058 0.2958 0.0019  0.0134  -0.0160 348 LYS A NZ  
2041 N N   . SER A 271 ? 0.2004 0.2395 0.2260 0.0086  0.0044  -0.0055 349 SER A N   
2042 C CA  . SER A 271 ? 0.1931 0.2313 0.2176 0.0117  0.0027  -0.0036 349 SER A CA  
2043 C C   . SER A 271 ? 0.1721 0.2081 0.1930 0.0111  0.0021  -0.0018 349 SER A C   
2044 O O   . SER A 271 ? 0.1957 0.2287 0.2143 0.0126  0.0017  0.0005  349 SER A O   
2045 C CB  . SER A 271 ? 0.2052 0.2482 0.2327 0.0141  0.0011  -0.0051 349 SER A CB  
2046 O OG  . SER A 271 ? 0.2361 0.2812 0.2672 0.0151  0.0017  -0.0067 349 SER A OG  
2047 N N   . VAL A 272 ? 0.1731 0.2103 0.1933 0.0089  0.0022  -0.0028 350 VAL A N   
2048 C CA  . VAL A 272 ? 0.1569 0.1919 0.1739 0.0083  0.0018  -0.0013 350 VAL A CA  
2049 C C   . VAL A 272 ? 0.1821 0.2124 0.1965 0.0076  0.0028  0.0006  350 VAL A C   
2050 O O   . VAL A 272 ? 0.1858 0.2140 0.1979 0.0087  0.0023  0.0026  350 VAL A O   
2051 C CB  . VAL A 272 ? 0.1771 0.2132 0.1936 0.0057  0.0020  -0.0029 350 VAL A CB  
2052 C CG1 . VAL A 272 ? 0.1794 0.2125 0.1922 0.0052  0.0018  -0.0013 350 VAL A CG1 
2053 C CG2 . VAL A 272 ? 0.1691 0.2102 0.1881 0.0062  0.0008  -0.0050 350 VAL A CG2 
2054 N N   . VAL A 273 ? 0.1716 0.2006 0.1863 0.0057  0.0043  0.0000  351 VAL A N   
2055 C CA  . VAL A 273 ? 0.1720 0.1971 0.1847 0.0049  0.0051  0.0016  351 VAL A CA  
2056 C C   . VAL A 273 ? 0.1979 0.2213 0.2107 0.0070  0.0049  0.0032  351 VAL A C   
2057 O O   . VAL A 273 ? 0.1801 0.2009 0.1907 0.0073  0.0049  0.0051  351 VAL A O   
2058 C CB  . VAL A 273 ? 0.2026 0.2270 0.2157 0.0025  0.0066  0.0004  351 VAL A CB  
2059 C CG1 . VAL A 273 ? 0.2301 0.2510 0.2416 0.0020  0.0073  0.0017  351 VAL A CG1 
2060 C CG2 . VAL A 273 ? 0.2095 0.2340 0.2212 0.0001  0.0070  -0.0005 351 VAL A CG2 
2061 N N   . GLN A 274 ? 0.1819 0.2066 0.1971 0.0086  0.0048  0.0025  352 GLN A N   
2062 C CA  . GLN A 274 ? 0.2047 0.2269 0.2197 0.0107  0.0047  0.0041  352 GLN A CA  
2063 C C   . GLN A 274 ? 0.1998 0.2214 0.2128 0.0127  0.0035  0.0061  352 GLN A C   
2064 O O   . GLN A 274 ? 0.2003 0.2187 0.2116 0.0133  0.0038  0.0082  352 GLN A O   
2065 C CB  . GLN A 274 ? 0.2005 0.2243 0.2186 0.0124  0.0047  0.0028  352 GLN A CB  
2066 C CG  . GLN A 274 ? 0.2535 0.2748 0.2713 0.0152  0.0043  0.0044  352 GLN A CG  
2067 C CD  . GLN A 274 ? 0.3262 0.3498 0.3443 0.0181  0.0025  0.0048  352 GLN A CD  
2068 O OE1 . GLN A 274 ? 0.3894 0.4171 0.4100 0.0190  0.0017  0.0029  352 GLN A OE1 
2069 N NE2 . GLN A 274 ? 0.3892 0.4103 0.4045 0.0196  0.0019  0.0073  352 GLN A NE2 
2070 N N   . GLN A 275 ? 0.1906 0.2153 0.2037 0.0135  0.0023  0.0055  353 GLN A N   
2071 C CA  . GLN A 275 ? 0.2256 0.2501 0.2365 0.0153  0.0011  0.0072  353 GLN A CA  
2072 C C   . GLN A 275 ? 0.1990 0.2212 0.2069 0.0140  0.0016  0.0087  353 GLN A C   
2073 O O   . GLN A 275 ? 0.1961 0.2163 0.2018 0.0152  0.0015  0.0108  353 GLN A O   
2074 C CB  . GLN A 275 ? 0.1919 0.2207 0.2037 0.0162  -0.0003 0.0056  353 GLN A CB  
2075 C CG  . GLN A 275 ? 0.2325 0.2640 0.2472 0.0185  -0.0012 0.0045  353 GLN A CG  
2076 C CD  . GLN A 275 ? 0.2167 0.2535 0.2338 0.0183  -0.0023 0.0018  353 GLN A CD  
2077 O OE1 . GLN A 275 ? 0.2315 0.2696 0.2477 0.0167  -0.0025 0.0011  353 GLN A OE1 
2078 N NE2 . GLN A 275 ? 0.2031 0.2430 0.2235 0.0200  -0.0029 0.0003  353 GLN A NE2 
2079 N N   . TYR A 276 ? 0.1758 0.1983 0.1835 0.0116  0.0022  0.0076  354 TYR A N   
2080 C CA  . TYR A 276 ? 0.2015 0.2218 0.2069 0.0103  0.0028  0.0088  354 TYR A CA  
2081 C C   . TYR A 276 ? 0.2097 0.2269 0.2146 0.0100  0.0038  0.0103  354 TYR A C   
2082 O O   . TYR A 276 ? 0.1987 0.2144 0.2017 0.0105  0.0040  0.0121  354 TYR A O   
2083 C CB  . TYR A 276 ? 0.1842 0.2050 0.1896 0.0079  0.0032  0.0073  354 TYR A CB  
2084 C CG  . TYR A 276 ? 0.1803 0.1988 0.1836 0.0067  0.0037  0.0082  354 TYR A CG  
2085 C CD1 . TYR A 276 ? 0.1769 0.1949 0.1782 0.0075  0.0033  0.0095  354 TYR A CD1 
2086 C CD2 . TYR A 276 ? 0.1982 0.2153 0.2015 0.0047  0.0046  0.0078  354 TYR A CD2 
2087 C CE1 . TYR A 276 ? 0.1494 0.1658 0.1491 0.0066  0.0038  0.0102  354 TYR A CE1 
2088 C CE2 . TYR A 276 ? 0.1640 0.1793 0.1655 0.0039  0.0049  0.0086  354 TYR A CE2 
2089 C CZ  . TYR A 276 ? 0.1790 0.1942 0.1790 0.0049  0.0044  0.0097  354 TYR A CZ  
2090 O OH  . TYR A 276 ? 0.2032 0.2170 0.2018 0.0042  0.0047  0.0103  354 TYR A OH  
2091 N N   . LEU A 277 ? 0.1931 0.2095 0.1998 0.0094  0.0046  0.0096  355 LEU A N   
2092 C CA  . LEU A 277 ? 0.2049 0.2184 0.2114 0.0089  0.0056  0.0108  355 LEU A CA  
2093 C C   . LEU A 277 ? 0.2240 0.2357 0.2299 0.0109  0.0056  0.0126  355 LEU A C   
2094 O O   . LEU A 277 ? 0.2070 0.2161 0.2121 0.0104  0.0064  0.0139  355 LEU A O   
2095 C CB  . LEU A 277 ? 0.2090 0.2221 0.2172 0.0075  0.0065  0.0093  355 LEU A CB  
2096 C CG  . LEU A 277 ? 0.1923 0.2064 0.2001 0.0053  0.0067  0.0079  355 LEU A CG  
2097 C CD1 . LEU A 277 ? 0.2106 0.2243 0.2197 0.0039  0.0077  0.0064  355 LEU A CD1 
2098 C CD2 . LEU A 277 ? 0.2359 0.2489 0.2416 0.0042  0.0067  0.0088  355 LEU A CD2 
2099 N N   . ASP A 278 ? 0.2440 0.2570 0.2503 0.0131  0.0046  0.0126  356 ASP A N   
2100 C CA  . ASP A 278 ? 0.2657 0.2768 0.2705 0.0153  0.0043  0.0146  356 ASP A CA  
2101 C C   . ASP A 278 ? 0.2423 0.2525 0.2442 0.0153  0.0044  0.0166  356 ASP A C   
2102 O O   . ASP A 278 ? 0.2472 0.2548 0.2475 0.0163  0.0048  0.0186  356 ASP A O   
2103 C CB  . ASP A 278 ? 0.3931 0.4065 0.3986 0.0179  0.0028  0.0142  356 ASP A CB  
2104 C CG  . ASP A 278 ? 0.4442 0.4566 0.4516 0.0195  0.0027  0.0137  356 ASP A CG  
2105 O OD1 . ASP A 278 ? 0.4615 0.4737 0.4711 0.0182  0.0036  0.0123  356 ASP A OD1 
2106 O OD2 . ASP A 278 ? 0.6050 0.6169 0.6117 0.0222  0.0018  0.0149  356 ASP A OD2 
2107 N N   . VAL A 279 ? 0.2117 0.2239 0.2129 0.0143  0.0041  0.0159  357 VAL A N   
2108 C CA  . VAL A 279 ? 0.2019 0.2136 0.2006 0.0141  0.0043  0.0174  357 VAL A CA  
2109 C C   . VAL A 279 ? 0.2392 0.2494 0.2380 0.0119  0.0057  0.0177  357 VAL A C   
2110 O O   . VAL A 279 ? 0.2416 0.2502 0.2392 0.0118  0.0066  0.0194  357 VAL A O   
2111 C CB  . VAL A 279 ? 0.2087 0.2233 0.2064 0.0143  0.0032  0.0163  357 VAL A CB  
2112 C CG1 . VAL A 279 ? 0.2206 0.2350 0.2160 0.0140  0.0036  0.0173  357 VAL A CG1 
2113 C CG2 . VAL A 279 ? 0.2163 0.2327 0.2137 0.0166  0.0018  0.0161  357 VAL A CG2 
2114 N N   . VAL A 280 ? 0.2181 0.2291 0.2183 0.0102  0.0058  0.0161  358 VAL A N   
2115 C CA  . VAL A 280 ? 0.2163 0.2265 0.2165 0.0083  0.0067  0.0161  358 VAL A CA  
2116 C C   . VAL A 280 ? 0.2684 0.2765 0.2699 0.0072  0.0077  0.0163  358 VAL A C   
2117 O O   . VAL A 280 ? 0.3087 0.3163 0.3103 0.0059  0.0084  0.0166  358 VAL A O   
2118 C CB  . VAL A 280 ? 0.2237 0.2353 0.2240 0.0070  0.0063  0.0146  358 VAL A CB  
2119 C CG1 . VAL A 280 ? 0.2432 0.2564 0.2419 0.0078  0.0054  0.0145  358 VAL A CG1 
2120 C CG2 . VAL A 280 ? 0.2085 0.2205 0.2103 0.0062  0.0061  0.0129  358 VAL A CG2 
2121 N N   . GLY A 281 ? 0.2434 0.2506 0.2463 0.0078  0.0077  0.0158  359 GLY A N   
2122 C CA  . GLY A 281 ? 0.2650 0.2700 0.2691 0.0069  0.0087  0.0157  359 GLY A CA  
2123 C C   . GLY A 281 ? 0.2251 0.2307 0.2309 0.0061  0.0087  0.0136  359 GLY A C   
2124 O O   . GLY A 281 ? 0.2291 0.2364 0.2348 0.0051  0.0083  0.0124  359 GLY A O   
2125 N N   . TYR A 282 ? 0.2080 0.2119 0.2151 0.0066  0.0091  0.0133  360 TYR A N   
2126 C CA  . TYR A 282 ? 0.2273 0.2316 0.2360 0.0057  0.0094  0.0112  360 TYR A CA  
2127 C C   . TYR A 282 ? 0.2278 0.2312 0.2364 0.0033  0.0101  0.0107  360 TYR A C   
2128 O O   . TYR A 282 ? 0.2148 0.2167 0.2228 0.0026  0.0106  0.0118  360 TYR A O   
2129 C CB  . TYR A 282 ? 0.2431 0.2456 0.2532 0.0071  0.0097  0.0109  360 TYR A CB  
2130 C CG  . TYR A 282 ? 0.2397 0.2436 0.2503 0.0096  0.0088  0.0109  360 TYR A CG  
2131 C CD1 . TYR A 282 ? 0.2485 0.2554 0.2586 0.0103  0.0077  0.0110  360 TYR A CD1 
2132 C CD2 . TYR A 282 ? 0.2523 0.2546 0.2642 0.0115  0.0089  0.0108  360 TYR A CD2 
2133 C CE1 . TYR A 282 ? 0.2384 0.2471 0.2492 0.0127  0.0067  0.0108  360 TYR A CE1 
2134 C CE2 . TYR A 282 ? 0.2651 0.2691 0.2778 0.0141  0.0078  0.0107  360 TYR A CE2 
2135 C CZ  . TYR A 282 ? 0.3058 0.3132 0.3180 0.0146  0.0067  0.0106  360 TYR A CZ  
2136 O OH  . TYR A 282 ? 0.2734 0.2828 0.2865 0.0172  0.0054  0.0104  360 TYR A OH  
2137 N N   . PRO A 283 ? 0.2088 0.2134 0.2177 0.0020  0.0102  0.0089  361 PRO A N   
2138 C CA  . PRO A 283 ? 0.2163 0.2204 0.2249 0.0000  0.0107  0.0081  361 PRO A CA  
2139 C C   . PRO A 283 ? 0.1984 0.1999 0.2078 -0.0005 0.0115  0.0081  361 PRO A C   
2140 O O   . PRO A 283 ? 0.1763 0.1763 0.1869 0.0004  0.0119  0.0079  361 PRO A O   
2141 C CB  . PRO A 283 ? 0.1814 0.1867 0.1902 -0.0007 0.0108  0.0061  361 PRO A CB  
2142 C CG  . PRO A 283 ? 0.2010 0.2083 0.2098 0.0002  0.0102  0.0061  361 PRO A CG  
2143 C CD  . PRO A 283 ? 0.2207 0.2275 0.2302 0.0023  0.0099  0.0074  361 PRO A CD  
2144 N N   . PHE A 284 ? 0.2146 0.2157 0.2235 -0.0021 0.0117  0.0083  362 PHE A N   
2145 C CA  . PHE A 284 ? 0.2081 0.2070 0.2180 -0.0031 0.0125  0.0080  362 PHE A CA  
2146 C C   . PHE A 284 ? 0.2277 0.2260 0.2381 -0.0039 0.0129  0.0058  362 PHE A C   
2147 O O   . PHE A 284 ? 0.2210 0.2211 0.2308 -0.0043 0.0126  0.0047  362 PHE A O   
2148 C CB  . PHE A 284 ? 0.2578 0.2573 0.2674 -0.0047 0.0125  0.0084  362 PHE A CB  
2149 C CG  . PHE A 284 ? 0.2386 0.2395 0.2477 -0.0063 0.0121  0.0068  362 PHE A CG  
2150 C CD1 . PHE A 284 ? 0.2187 0.2217 0.2264 -0.0062 0.0112  0.0067  362 PHE A CD1 
2151 C CD2 . PHE A 284 ? 0.2177 0.2177 0.2275 -0.0080 0.0125  0.0055  362 PHE A CD2 
2152 C CE1 . PHE A 284 ? 0.2118 0.2157 0.2184 -0.0075 0.0107  0.0055  362 PHE A CE1 
2153 C CE2 . PHE A 284 ? 0.2343 0.2357 0.2432 -0.0093 0.0119  0.0041  362 PHE A CE2 
2154 C CZ  . PHE A 284 ? 0.2298 0.2331 0.2369 -0.0090 0.0110  0.0042  362 PHE A CZ  
2155 N N   . MET A 285 ? 0.1920 0.1878 0.2036 -0.0042 0.0138  0.0053  363 MET A N   
2156 C CA  . MET A 285 ? 0.2388 0.2338 0.2508 -0.0049 0.0143  0.0030  363 MET A CA  
2157 C C   . MET A 285 ? 0.2377 0.2332 0.2492 -0.0073 0.0143  0.0019  363 MET A C   
2158 O O   . MET A 285 ? 0.2307 0.2249 0.2427 -0.0083 0.0146  0.0023  363 MET A O   
2159 C CB  . MET A 285 ? 0.2344 0.2261 0.2478 -0.0039 0.0152  0.0028  363 MET A CB  
2160 C CG  . MET A 285 ? 0.2485 0.2397 0.2626 -0.0041 0.0158  0.0002  363 MET A CG  
2161 S SD  . MET A 285 ? 0.2327 0.2271 0.2470 -0.0029 0.0155  -0.0009 363 MET A SD  
2162 C CE  . MET A 285 ? 0.2692 0.2629 0.2841 -0.0040 0.0166  -0.0041 363 MET A CE  
2163 N N   . PRO A 286 ? 0.2201 0.2176 0.2305 -0.0081 0.0139  0.0005  364 PRO A N   
2164 C CA  . PRO A 286 ? 0.2303 0.2283 0.2399 -0.0101 0.0137  -0.0005 364 PRO A CA  
2165 C C   . PRO A 286 ? 0.2287 0.2246 0.2392 -0.0112 0.0145  -0.0025 364 PRO A C   
2166 O O   . PRO A 286 ? 0.2213 0.2155 0.2326 -0.0103 0.0154  -0.0034 364 PRO A O   
2167 C CB  . PRO A 286 ? 0.2816 0.2817 0.2890 -0.0105 0.0131  -0.0012 364 PRO A CB  
2168 C CG  . PRO A 286 ? 0.2787 0.2789 0.2866 -0.0093 0.0137  -0.0017 364 PRO A CG  
2169 C CD  . PRO A 286 ? 0.2350 0.2342 0.2445 -0.0075 0.0138  -0.0001 364 PRO A CD  
2170 N N   . PRO A 287 ? 0.2367 0.2327 0.2470 -0.0130 0.0143  -0.0033 365 PRO A N   
2171 C CA  . PRO A 287 ? 0.2174 0.2118 0.2280 -0.0143 0.0150  -0.0057 365 PRO A CA  
2172 C C   . PRO A 287 ? 0.2188 0.2144 0.2277 -0.0144 0.0150  -0.0075 365 PRO A C   
2173 O O   . PRO A 287 ? 0.1959 0.1937 0.2028 -0.0143 0.0143  -0.0071 365 PRO A O   
2174 C CB  . PRO A 287 ? 0.2369 0.2324 0.2476 -0.0163 0.0143  -0.0062 365 PRO A CB  
2175 C CG  . PRO A 287 ? 0.2843 0.2828 0.2937 -0.0159 0.0131  -0.0047 365 PRO A CG  
2176 C CD  . PRO A 287 ? 0.2733 0.2715 0.2830 -0.0140 0.0132  -0.0025 365 PRO A CD  
2177 N N   . TYR A 288 ? 0.1990 0.1928 0.2084 -0.0145 0.0160  -0.0096 366 TYR A N   
2178 C CA  . TYR A 288 ? 0.2083 0.2031 0.2160 -0.0148 0.0165  -0.0115 366 TYR A CA  
2179 C C   . TYR A 288 ? 0.2210 0.2180 0.2260 -0.0164 0.0156  -0.0123 366 TYR A C   
2180 O O   . TYR A 288 ? 0.2223 0.2209 0.2250 -0.0164 0.0154  -0.0123 366 TYR A O   
2181 C CB  . TYR A 288 ? 0.2025 0.1950 0.2115 -0.0148 0.0177  -0.0139 366 TYR A CB  
2182 C CG  . TYR A 288 ? 0.1956 0.1891 0.2036 -0.0145 0.0186  -0.0160 366 TYR A CG  
2183 C CD1 . TYR A 288 ? 0.1943 0.1889 0.1997 -0.0162 0.0187  -0.0180 366 TYR A CD1 
2184 C CD2 . TYR A 288 ? 0.2079 0.2011 0.2177 -0.0126 0.0196  -0.0162 366 TYR A CD2 
2185 C CE1 . TYR A 288 ? 0.2272 0.2228 0.2317 -0.0161 0.0198  -0.0200 366 TYR A CE1 
2186 C CE2 . TYR A 288 ? 0.1910 0.1854 0.2004 -0.0124 0.0207  -0.0184 366 TYR A CE2 
2187 C CZ  . TYR A 288 ? 0.2082 0.2038 0.2149 -0.0143 0.0209  -0.0203 366 TYR A CZ  
2188 O OH  . TYR A 288 ? 0.2191 0.2161 0.2254 -0.0142 0.0223  -0.0225 366 TYR A OH  
2189 N N   . TRP A 289 ? 0.1934 0.1902 0.1983 -0.0179 0.0149  -0.0128 367 TRP A N   
2190 C CA  . TRP A 289 ? 0.1996 0.1985 0.2019 -0.0192 0.0137  -0.0135 367 TRP A CA  
2191 C C   . TRP A 289 ? 0.2200 0.2210 0.2203 -0.0186 0.0125  -0.0114 367 TRP A C   
2192 O O   . TRP A 289 ? 0.2284 0.2307 0.2256 -0.0192 0.0118  -0.0118 367 TRP A O   
2193 C CB  . TRP A 289 ? 0.1952 0.1942 0.1985 -0.0209 0.0130  -0.0145 367 TRP A CB  
2194 C CG  . TRP A 289 ? 0.1813 0.1805 0.1870 -0.0208 0.0126  -0.0127 367 TRP A CG  
2195 C CD1 . TRP A 289 ? 0.2024 0.1994 0.2110 -0.0210 0.0135  -0.0126 367 TRP A CD1 
2196 C CD2 . TRP A 289 ? 0.1837 0.1855 0.1891 -0.0205 0.0112  -0.0109 367 TRP A CD2 
2197 N NE1 . TRP A 289 ? 0.2047 0.2028 0.2148 -0.0211 0.0130  -0.0107 367 TRP A NE1 
2198 C CE2 . TRP A 289 ? 0.2014 0.2027 0.2098 -0.0207 0.0115  -0.0097 367 TRP A CE2 
2199 C CE3 . TRP A 289 ? 0.2155 0.2197 0.2183 -0.0201 0.0098  -0.0101 367 TRP A CE3 
2200 C CZ2 . TRP A 289 ? 0.1923 0.1960 0.2014 -0.0205 0.0105  -0.0081 367 TRP A CZ2 
2201 C CZ3 . TRP A 289 ? 0.1836 0.1898 0.1871 -0.0196 0.0087  -0.0084 367 TRP A CZ3 
2202 C CH2 . TRP A 289 ? 0.1743 0.1805 0.1810 -0.0198 0.0091  -0.0075 367 TRP A CH2 
2203 N N   . GLY A 290 ? 0.2151 0.2162 0.2171 -0.0173 0.0124  -0.0091 368 GLY A N   
2204 C CA  . GLY A 290 ? 0.1963 0.1989 0.1967 -0.0165 0.0114  -0.0072 368 GLY A CA  
2205 C C   . GLY A 290 ? 0.2115 0.2143 0.2094 -0.0161 0.0118  -0.0071 368 GLY A C   
2206 O O   . GLY A 290 ? 0.2077 0.2114 0.2033 -0.0158 0.0108  -0.0059 368 GLY A O   
2207 N N   . LEU A 291 ? 0.1895 0.1915 0.1878 -0.0161 0.0131  -0.0086 369 LEU A N   
2208 C CA  . LEU A 291 ? 0.2025 0.2049 0.1988 -0.0161 0.0139  -0.0090 369 LEU A CA  
2209 C C   . LEU A 291 ? 0.2007 0.2033 0.1936 -0.0176 0.0141  -0.0107 369 LEU A C   
2210 O O   . LEU A 291 ? 0.1864 0.1894 0.1771 -0.0179 0.0148  -0.0110 369 LEU A O   
2211 C CB  . LEU A 291 ? 0.2063 0.2084 0.2054 -0.0151 0.0153  -0.0098 369 LEU A CB  
2212 C CG  . LEU A 291 ? 0.2409 0.2426 0.2431 -0.0134 0.0152  -0.0082 369 LEU A CG  
2213 C CD1 . LEU A 291 ? 0.2835 0.2850 0.2881 -0.0122 0.0164  -0.0092 369 LEU A CD1 
2214 C CD2 . LEU A 291 ? 0.2922 0.2949 0.2937 -0.0128 0.0143  -0.0060 369 LEU A CD2 
2215 N N   . GLY A 292 ? 0.2433 0.2457 0.2355 -0.0186 0.0134  -0.0119 370 GLY A N   
2216 C CA  . GLY A 292 ? 0.2497 0.2525 0.2380 -0.0199 0.0131  -0.0133 370 GLY A CA  
2217 C C   . GLY A 292 ? 0.2509 0.2542 0.2356 -0.0198 0.0116  -0.0115 370 GLY A C   
2218 O O   . GLY A 292 ? 0.2269 0.2305 0.2125 -0.0188 0.0109  -0.0094 370 GLY A O   
2219 N N   . PHE A 293 ? 0.2169 0.2204 0.1974 -0.0208 0.0111  -0.0124 371 PHE A N   
2220 C CA  . PHE A 293 ? 0.2300 0.2335 0.2064 -0.0207 0.0096  -0.0108 371 PHE A CA  
2221 C C   . PHE A 293 ? 0.2307 0.2354 0.2082 -0.0202 0.0074  -0.0102 371 PHE A C   
2222 O O   . PHE A 293 ? 0.2091 0.2148 0.1882 -0.0209 0.0070  -0.0119 371 PHE A O   
2223 C CB  . PHE A 293 ? 0.2179 0.2208 0.1889 -0.0218 0.0099  -0.0119 371 PHE A CB  
2224 C CG  . PHE A 293 ? 0.2375 0.2397 0.2034 -0.0216 0.0085  -0.0101 371 PHE A CG  
2225 C CD1 . PHE A 293 ? 0.2394 0.2405 0.2046 -0.0207 0.0085  -0.0078 371 PHE A CD1 
2226 C CD2 . PHE A 293 ? 0.2286 0.2308 0.1898 -0.0221 0.0071  -0.0108 371 PHE A CD2 
2227 C CE1 . PHE A 293 ? 0.2323 0.2320 0.1926 -0.0204 0.0072  -0.0061 371 PHE A CE1 
2228 C CE2 . PHE A 293 ? 0.2314 0.2324 0.1874 -0.0216 0.0058  -0.0090 371 PHE A CE2 
2229 C CZ  . PHE A 293 ? 0.2121 0.2116 0.1676 -0.0207 0.0059  -0.0066 371 PHE A CZ  
2230 N N   . HIS A 294 ? 0.2130 0.2180 0.1897 -0.0192 0.0062  -0.0080 372 HIS A N   
2231 C CA  . HIS A 294 ? 0.2021 0.2087 0.1796 -0.0185 0.0040  -0.0073 372 HIS A CA  
2232 C C   . HIS A 294 ? 0.2127 0.2189 0.1849 -0.0181 0.0023  -0.0065 372 HIS A C   
2233 O O   . HIS A 294 ? 0.2089 0.2132 0.1776 -0.0178 0.0028  -0.0052 372 HIS A O   
2234 C CB  . HIS A 294 ? 0.1900 0.1969 0.1708 -0.0171 0.0039  -0.0054 372 HIS A CB  
2235 C CG  . HIS A 294 ? 0.2230 0.2298 0.2084 -0.0172 0.0055  -0.0056 372 HIS A CG  
2236 N ND1 . HIS A 294 ? 0.2164 0.2243 0.2058 -0.0172 0.0053  -0.0059 372 HIS A ND1 
2237 C CD2 . HIS A 294 ? 0.2131 0.2186 0.1995 -0.0171 0.0073  -0.0057 372 HIS A CD2 
2238 C CE1 . HIS A 294 ? 0.2395 0.2463 0.2318 -0.0171 0.0069  -0.0059 372 HIS A CE1 
2239 N NE2 . HIS A 294 ? 0.2099 0.2155 0.2006 -0.0169 0.0080  -0.0058 372 HIS A NE2 
2240 N N   . LEU A 295 ? 0.2075 0.2156 0.1790 -0.0180 0.0003  -0.0071 373 LEU A N   
2241 C CA  . LEU A 295 ? 0.2405 0.2482 0.2067 -0.0172 -0.0015 -0.0063 373 LEU A CA  
2242 C C   . LEU A 295 ? 0.2476 0.2581 0.2156 -0.0159 -0.0040 -0.0058 373 LEU A C   
2243 O O   . LEU A 295 ? 0.2129 0.2262 0.1847 -0.0164 -0.0047 -0.0073 373 LEU A O   
2244 C CB  . LEU A 295 ? 0.2519 0.2593 0.2138 -0.0185 -0.0016 -0.0081 373 LEU A CB  
2245 C CG  . LEU A 295 ? 0.2574 0.2639 0.2128 -0.0177 -0.0035 -0.0072 373 LEU A CG  
2246 C CD1 . LEU A 295 ? 0.2975 0.3004 0.2488 -0.0171 -0.0027 -0.0048 373 LEU A CD1 
2247 C CD2 . LEU A 295 ? 0.2431 0.2496 0.1946 -0.0191 -0.0035 -0.0093 373 LEU A CD2 
2248 N N   . CYS A 296 ? 0.2237 0.2332 0.1890 -0.0142 -0.0053 -0.0037 374 CYS A N   
2249 C CA  . CYS A 296 ? 0.2350 0.2469 0.2021 -0.0125 -0.0075 -0.0029 374 CYS A CA  
2250 C C   . CYS A 296 ? 0.2308 0.2409 0.1922 -0.0107 -0.0094 -0.0013 374 CYS A C   
2251 O O   . CYS A 296 ? 0.2349 0.2412 0.1914 -0.0108 -0.0086 -0.0001 374 CYS A O   
2252 C CB  . CYS A 296 ? 0.2371 0.2492 0.2087 -0.0117 -0.0065 -0.0016 374 CYS A CB  
2253 S SG  . CYS A 296 ? 0.2268 0.2432 0.2026 -0.0100 -0.0086 -0.0014 374 CYS A SG  
2254 N N   . ARG A 297 ? 0.2057 0.2186 0.1677 -0.0091 -0.0120 -0.0012 375 ARG A N   
2255 C CA  . ARG A 297 ? 0.2194 0.2305 0.1775 -0.0067 -0.0138 0.0007  375 ARG A CA  
2256 C C   . ARG A 297 ? 0.2355 0.2509 0.1975 -0.0048 -0.0161 0.0004  375 ARG A C   
2257 O O   . ARG A 297 ? 0.2147 0.2346 0.1811 -0.0056 -0.0166 -0.0014 375 ARG A O   
2258 C CB  . ARG A 297 ? 0.2272 0.2359 0.1779 -0.0063 -0.0152 0.0010  375 ARG A CB  
2259 C CG  . ARG A 297 ? 0.2247 0.2371 0.1746 -0.0055 -0.0182 -0.0003 375 ARG A CG  
2260 C CD  . ARG A 297 ? 0.2397 0.2489 0.1812 -0.0046 -0.0198 0.0005  375 ARG A CD  
2261 N NE  . ARG A 297 ? 0.2537 0.2600 0.1919 -0.0019 -0.0212 0.0031  375 ARG A NE  
2262 C CZ  . ARG A 297 ? 0.2723 0.2740 0.2027 -0.0009 -0.0221 0.0048  375 ARG A CZ  
2263 N NH1 . ARG A 297 ? 0.3094 0.3090 0.2341 -0.0024 -0.0216 0.0044  375 ARG A NH1 
2264 N NH2 . ARG A 297 ? 0.2882 0.2868 0.2160 0.0016  -0.0233 0.0071  375 ARG A NH2 
2265 N N   . TRP A 298 ? 0.2331 0.2471 0.1932 -0.0024 -0.0173 0.0022  376 TRP A N   
2266 C CA  . TRP A 298 ? 0.2457 0.2635 0.2080 0.0000  -0.0199 0.0021  376 TRP A CA  
2267 C C   . TRP A 298 ? 0.2406 0.2586 0.1978 0.0009  -0.0225 0.0018  376 TRP A C   
2268 O O   . TRP A 298 ? 0.2377 0.2507 0.1881 0.0015  -0.0228 0.0033  376 TRP A O   
2269 C CB  . TRP A 298 ? 0.2734 0.2887 0.2351 0.0023  -0.0200 0.0042  376 TRP A CB  
2270 C CG  . TRP A 298 ? 0.2910 0.3105 0.2563 0.0049  -0.0221 0.0041  376 TRP A CG  
2271 C CD1 . TRP A 298 ? 0.3016 0.3273 0.2711 0.0052  -0.0238 0.0022  376 TRP A CD1 
2272 C CD2 . TRP A 298 ? 0.3139 0.3318 0.2790 0.0075  -0.0226 0.0056  376 TRP A CD2 
2273 N NE1 . TRP A 298 ? 0.3449 0.3733 0.3170 0.0079  -0.0253 0.0026  376 TRP A NE1 
2274 C CE2 . TRP A 298 ? 0.3315 0.3551 0.3008 0.0095  -0.0247 0.0046  376 TRP A CE2 
2275 C CE3 . TRP A 298 ? 0.3895 0.4017 0.3512 0.0082  -0.0215 0.0076  376 TRP A CE3 
2276 C CZ2 . TRP A 298 ? 0.3450 0.3687 0.3153 0.0124  -0.0256 0.0056  376 TRP A CZ2 
2277 C CZ3 . TRP A 298 ? 0.4010 0.4129 0.3634 0.0111  -0.0225 0.0085  376 TRP A CZ3 
2278 C CH2 . TRP A 298 ? 0.4217 0.4394 0.3884 0.0132  -0.0245 0.0075  376 TRP A CH2 
2279 N N   . GLY A 299 ? 0.2612 0.2846 0.2213 0.0007  -0.0243 -0.0002 377 GLY A N   
2280 C CA  . GLY A 299 ? 0.2688 0.2934 0.2245 0.0017  -0.0272 -0.0009 377 GLY A CA  
2281 C C   . GLY A 299 ? 0.2684 0.2956 0.2245 -0.0007 -0.0273 -0.0035 377 GLY A C   
2282 O O   . GLY A 299 ? 0.2660 0.2946 0.2183 0.0000  -0.0298 -0.0043 377 GLY A O   
2283 N N   . TYR A 300 ? 0.2857 0.3135 0.2459 -0.0036 -0.0246 -0.0049 378 TYR A N   
2284 C CA  . TYR A 300 ? 0.2445 0.2757 0.2066 -0.0059 -0.0247 -0.0078 378 TYR A CA  
2285 C C   . TYR A 300 ? 0.2663 0.3044 0.2348 -0.0053 -0.0267 -0.0096 378 TYR A C   
2286 O O   . TYR A 300 ? 0.2684 0.3089 0.2434 -0.0067 -0.0251 -0.0105 378 TYR A O   
2287 C CB  . TYR A 300 ? 0.2434 0.2729 0.2082 -0.0089 -0.0213 -0.0087 378 TYR A CB  
2288 C CG  . TYR A 300 ? 0.2367 0.2603 0.1962 -0.0098 -0.0191 -0.0076 378 TYR A CG  
2289 C CD1 . TYR A 300 ? 0.2290 0.2496 0.1807 -0.0092 -0.0201 -0.0068 378 TYR A CD1 
2290 C CD2 . TYR A 300 ? 0.2179 0.2391 0.1801 -0.0113 -0.0159 -0.0072 378 TYR A CD2 
2291 C CE1 . TYR A 300 ? 0.2574 0.2730 0.2046 -0.0103 -0.0178 -0.0058 378 TYR A CE1 
2292 C CE2 . TYR A 300 ? 0.2331 0.2498 0.1912 -0.0122 -0.0138 -0.0064 378 TYR A CE2 
2293 C CZ  . TYR A 300 ? 0.2789 0.2928 0.2296 -0.0118 -0.0146 -0.0057 378 TYR A CZ  
2294 O OH  . TYR A 300 ? 0.2940 0.3036 0.2409 -0.0130 -0.0122 -0.0050 378 TYR A OH  
2295 N N   . SER A 301 ? 0.2621 0.3032 0.2283 -0.0033 -0.0301 -0.0101 379 SER A N   
2296 C CA  . SER A 301 ? 0.2794 0.3271 0.2511 -0.0018 -0.0324 -0.0112 379 SER A CA  
2297 C C   . SER A 301 ? 0.2713 0.3252 0.2478 -0.0039 -0.0334 -0.0147 379 SER A C   
2298 O O   . SER A 301 ? 0.2821 0.3423 0.2631 -0.0029 -0.0355 -0.0161 379 SER A O   
2299 C CB  . SER A 301 ? 0.2766 0.3244 0.2436 0.0019  -0.0360 -0.0098 379 SER A CB  
2300 O OG  . SER A 301 ? 0.2958 0.3424 0.2563 0.0019  -0.0378 -0.0105 379 SER A OG  
2301 N N   . SER A 302 ? 0.2599 0.3123 0.2355 -0.0070 -0.0318 -0.0164 380 SER A N   
2302 C CA  . SER A 302 ? 0.2357 0.2934 0.2165 -0.0096 -0.0320 -0.0199 380 SER A CA  
2303 C C   . SER A 302 ? 0.2396 0.2938 0.2210 -0.0130 -0.0287 -0.0209 380 SER A C   
2304 O O   . SER A 302 ? 0.2213 0.2696 0.1982 -0.0131 -0.0268 -0.0192 380 SER A O   
2305 C CB  . SER A 302 ? 0.2112 0.2729 0.1890 -0.0088 -0.0358 -0.0220 380 SER A CB  
2306 O OG  . SER A 302 ? 0.2550 0.3121 0.2251 -0.0092 -0.0357 -0.0217 380 SER A OG  
2307 N N   . THR A 303 ? 0.2317 0.2896 0.2187 -0.0157 -0.0281 -0.0239 381 THR A N   
2308 C CA  . THR A 303 ? 0.2096 0.2643 0.1970 -0.0189 -0.0253 -0.0254 381 THR A CA  
2309 C C   . THR A 303 ? 0.2600 0.3122 0.2404 -0.0193 -0.0261 -0.0264 381 THR A C   
2310 O O   . THR A 303 ? 0.2641 0.3114 0.2419 -0.0205 -0.0236 -0.0261 381 THR A O   
2311 C CB  . THR A 303 ? 0.2106 0.2695 0.2049 -0.0218 -0.0247 -0.0285 381 THR A CB  
2312 O OG1 . THR A 303 ? 0.2270 0.2919 0.2218 -0.0218 -0.0280 -0.0312 381 THR A OG1 
2313 C CG2 . THR A 303 ? 0.2031 0.2639 0.2044 -0.0219 -0.0232 -0.0274 381 THR A CG2 
2314 N N   . ALA A 304 ? 0.2654 0.3211 0.2426 -0.0181 -0.0296 -0.0277 382 ALA A N   
2315 C CA  . ALA A 304 ? 0.2734 0.3270 0.2433 -0.0183 -0.0305 -0.0286 382 ALA A CA  
2316 C C   . ALA A 304 ? 0.2725 0.3194 0.2354 -0.0168 -0.0291 -0.0253 382 ALA A C   
2317 O O   . ALA A 304 ? 0.2795 0.3224 0.2386 -0.0183 -0.0272 -0.0258 382 ALA A O   
2318 C CB  . ALA A 304 ? 0.3088 0.3674 0.2762 -0.0166 -0.0349 -0.0299 382 ALA A CB  
2319 N N   . ILE A 305 ? 0.2726 0.3184 0.2342 -0.0140 -0.0300 -0.0222 383 ILE A N   
2320 C CA  . ILE A 305 ? 0.2700 0.3094 0.2255 -0.0129 -0.0284 -0.0190 383 ILE A CA  
2321 C C   . ILE A 305 ? 0.2820 0.3175 0.2401 -0.0149 -0.0243 -0.0185 383 ILE A C   
2322 O O   . ILE A 305 ? 0.2292 0.2601 0.1826 -0.0156 -0.0224 -0.0178 383 ILE A O   
2323 C CB  . ILE A 305 ? 0.2745 0.3134 0.2288 -0.0095 -0.0301 -0.0160 383 ILE A CB  
2324 C CG1 . ILE A 305 ? 0.3092 0.3503 0.2584 -0.0071 -0.0342 -0.0161 383 ILE A CG1 
2325 C CG2 . ILE A 305 ? 0.3188 0.3510 0.2689 -0.0089 -0.0278 -0.0128 383 ILE A CG2 
2326 C CD1 . ILE A 305 ? 0.3568 0.3992 0.3064 -0.0035 -0.0366 -0.0139 383 ILE A CD1 
2327 N N   . THR A 306 ? 0.2499 0.2874 0.2155 -0.0157 -0.0230 -0.0189 384 THR A N   
2328 C CA  . THR A 306 ? 0.2587 0.2928 0.2272 -0.0171 -0.0194 -0.0182 384 THR A CA  
2329 C C   . THR A 306 ? 0.2578 0.2904 0.2256 -0.0198 -0.0176 -0.0207 384 THR A C   
2330 O O   . THR A 306 ? 0.2478 0.2762 0.2137 -0.0204 -0.0150 -0.0199 384 THR A O   
2331 C CB  . THR A 306 ? 0.2520 0.2887 0.2283 -0.0174 -0.0185 -0.0181 384 THR A CB  
2332 O OG1 . THR A 306 ? 0.2202 0.2588 0.1970 -0.0148 -0.0204 -0.0161 384 THR A OG1 
2333 C CG2 . THR A 306 ? 0.2208 0.2536 0.1995 -0.0185 -0.0150 -0.0170 384 THR A CG2 
2334 N N   . ARG A 307 ? 0.2699 0.3061 0.2393 -0.0213 -0.0189 -0.0238 385 ARG A N   
2335 C CA  . ARG A 307 ? 0.2747 0.3096 0.2430 -0.0237 -0.0175 -0.0266 385 ARG A CA  
2336 C C   . ARG A 307 ? 0.2869 0.3183 0.2470 -0.0233 -0.0173 -0.0261 385 ARG A C   
2337 O O   . ARG A 307 ? 0.2851 0.3134 0.2439 -0.0248 -0.0148 -0.0271 385 ARG A O   
2338 C CB  . ARG A 307 ? 0.3172 0.3569 0.2879 -0.0252 -0.0195 -0.0302 385 ARG A CB  
2339 C CG  . ARG A 307 ? 0.3018 0.3444 0.2807 -0.0268 -0.0188 -0.0316 385 ARG A CG  
2340 C CD  . ARG A 307 ? 0.3204 0.3672 0.3009 -0.0288 -0.0205 -0.0357 385 ARG A CD  
2341 N NE  . ARG A 307 ? 0.3749 0.4247 0.3632 -0.0306 -0.0199 -0.0371 385 ARG A NE  
2342 C CZ  . ARG A 307 ? 0.3879 0.4432 0.3806 -0.0300 -0.0219 -0.0372 385 ARG A CZ  
2343 N NH1 . ARG A 307 ? 0.4547 0.5132 0.4449 -0.0273 -0.0250 -0.0360 385 ARG A NH1 
2344 N NH2 . ARG A 307 ? 0.3813 0.4387 0.3810 -0.0322 -0.0207 -0.0387 385 ARG A NH2 
2345 N N   . GLN A 308 ? 0.2868 0.3186 0.2414 -0.0212 -0.0198 -0.0246 386 GLN A N   
2346 C CA  . GLN A 308 ? 0.3211 0.3492 0.2671 -0.0208 -0.0197 -0.0237 386 GLN A CA  
2347 C C   . GLN A 308 ? 0.2959 0.3189 0.2401 -0.0208 -0.0165 -0.0213 386 GLN A C   
2348 O O   . GLN A 308 ? 0.2767 0.2967 0.2155 -0.0216 -0.0150 -0.0215 386 GLN A O   
2349 C CB  . GLN A 308 ? 0.3675 0.3964 0.3080 -0.0182 -0.0230 -0.0219 386 GLN A CB  
2350 C CG  . GLN A 308 ? 0.4425 0.4758 0.3813 -0.0181 -0.0264 -0.0244 386 GLN A CG  
2351 C CD  . GLN A 308 ? 0.6262 0.6599 0.5595 -0.0150 -0.0298 -0.0222 386 GLN A CD  
2352 O OE1 . GLN A 308 ? 0.5043 0.5335 0.4326 -0.0134 -0.0293 -0.0190 386 GLN A OE1 
2353 N NE2 . GLN A 308 ? 0.6675 0.7066 0.6018 -0.0142 -0.0334 -0.0241 386 GLN A NE2 
2354 N N   . VAL A 309 ? 0.2717 0.2939 0.2204 -0.0200 -0.0154 -0.0192 387 VAL A N   
2355 C CA  . VAL A 309 ? 0.2519 0.2699 0.1999 -0.0200 -0.0125 -0.0171 387 VAL A CA  
2356 C C   . VAL A 309 ? 0.2757 0.2924 0.2257 -0.0222 -0.0095 -0.0192 387 VAL A C   
2357 O O   . VAL A 309 ? 0.2519 0.2656 0.1977 -0.0229 -0.0076 -0.0191 387 VAL A O   
2358 C CB  . VAL A 309 ? 0.2718 0.2899 0.2247 -0.0187 -0.0122 -0.0148 387 VAL A CB  
2359 C CG1 . VAL A 309 ? 0.2666 0.2807 0.2192 -0.0189 -0.0092 -0.0130 387 VAL A CG1 
2360 C CG2 . VAL A 309 ? 0.2644 0.2836 0.2151 -0.0162 -0.0151 -0.0128 387 VAL A CG2 
2361 N N   . VAL A 310 ? 0.2489 0.2679 0.2052 -0.0234 -0.0092 -0.0213 388 VAL A N   
2362 C CA  . VAL A 310 ? 0.2729 0.2906 0.2317 -0.0253 -0.0065 -0.0235 388 VAL A CA  
2363 C C   . VAL A 310 ? 0.2740 0.2912 0.2276 -0.0265 -0.0064 -0.0260 388 VAL A C   
2364 O O   . VAL A 310 ? 0.2308 0.2454 0.1828 -0.0274 -0.0038 -0.0267 388 VAL A O   
2365 C CB  . VAL A 310 ? 0.2869 0.3069 0.2530 -0.0263 -0.0064 -0.0252 388 VAL A CB  
2366 C CG1 . VAL A 310 ? 0.2799 0.2980 0.2481 -0.0281 -0.0039 -0.0277 388 VAL A CG1 
2367 C CG2 . VAL A 310 ? 0.3240 0.3442 0.2948 -0.0251 -0.0061 -0.0226 388 VAL A CG2 
2368 N N   . GLU A 311 ? 0.2534 0.2733 0.2044 -0.0265 -0.0092 -0.0274 389 GLU A N   
2369 C CA  . GLU A 311 ? 0.2584 0.2782 0.2037 -0.0276 -0.0095 -0.0297 389 GLU A CA  
2370 C C   . GLU A 311 ? 0.2788 0.2952 0.2168 -0.0270 -0.0083 -0.0279 389 GLU A C   
2371 O O   . GLU A 311 ? 0.2868 0.3015 0.2218 -0.0283 -0.0063 -0.0296 389 GLU A O   
2372 C CB  . GLU A 311 ? 0.2725 0.2963 0.2159 -0.0271 -0.0133 -0.0310 389 GLU A CB  
2373 C CG  . GLU A 311 ? 0.3302 0.3538 0.2664 -0.0279 -0.0140 -0.0332 389 GLU A CG  
2374 C CD  . GLU A 311 ? 0.3659 0.3937 0.3000 -0.0273 -0.0180 -0.0346 389 GLU A CD  
2375 O OE1 . GLU A 311 ? 0.4827 0.5105 0.4107 -0.0279 -0.0189 -0.0365 389 GLU A OE1 
2376 O OE2 . GLU A 311 ? 0.3788 0.4100 0.3173 -0.0263 -0.0203 -0.0340 389 GLU A OE2 
2377 N N   . ASN A 312 ? 0.2699 0.2853 0.2049 -0.0252 -0.0095 -0.0246 390 ASN A N   
2378 C CA  . ASN A 312 ? 0.2606 0.2723 0.1885 -0.0248 -0.0083 -0.0225 390 ASN A CA  
2379 C C   . ASN A 312 ? 0.2485 0.2573 0.1782 -0.0257 -0.0045 -0.0219 390 ASN A C   
2380 O O   . ASN A 312 ? 0.2646 0.2710 0.1892 -0.0266 -0.0025 -0.0220 390 ASN A O   
2381 C CB  . ASN A 312 ? 0.2876 0.2983 0.2119 -0.0225 -0.0106 -0.0190 390 ASN A CB  
2382 C CG  . ASN A 312 ? 0.3143 0.3274 0.2345 -0.0214 -0.0144 -0.0196 390 ASN A CG  
2383 O OD1 . ASN A 312 ? 0.3172 0.3331 0.2374 -0.0225 -0.0154 -0.0227 390 ASN A OD1 
2384 N ND2 . ASN A 312 ? 0.3524 0.3647 0.2694 -0.0192 -0.0166 -0.0168 390 ASN A ND2 
2385 N N   . MET A 313 ? 0.2407 0.2498 0.1773 -0.0255 -0.0034 -0.0213 391 MET A N   
2386 C CA  . MET A 313 ? 0.2448 0.2517 0.1840 -0.0262 0.0000  -0.0211 391 MET A CA  
2387 C C   . MET A 313 ? 0.2588 0.2659 0.1987 -0.0279 0.0019  -0.0245 391 MET A C   
2388 O O   . MET A 313 ? 0.2856 0.2910 0.2230 -0.0287 0.0045  -0.0250 391 MET A O   
2389 C CB  . MET A 313 ? 0.2036 0.2112 0.1503 -0.0254 0.0004  -0.0199 391 MET A CB  
2390 C CG  . MET A 313 ? 0.2376 0.2445 0.1836 -0.0237 -0.0008 -0.0166 391 MET A CG  
2391 S SD  . MET A 313 ? 0.2440 0.2471 0.1863 -0.0237 0.0016  -0.0142 391 MET A SD  
2392 C CE  . MET A 313 ? 0.2118 0.2151 0.1617 -0.0240 0.0042  -0.0146 391 MET A CE  
2393 N N   . THR A 314 ? 0.2422 0.2516 0.1854 -0.0285 0.0008  -0.0271 392 THR A N   
2394 C CA  . THR A 314 ? 0.2477 0.2570 0.1923 -0.0301 0.0026  -0.0306 392 THR A CA  
2395 C C   . THR A 314 ? 0.2739 0.2826 0.2112 -0.0310 0.0030  -0.0322 392 THR A C   
2396 O O   . THR A 314 ? 0.2801 0.2874 0.2165 -0.0319 0.0058  -0.0336 392 THR A O   
2397 C CB  . THR A 314 ? 0.2344 0.2460 0.1840 -0.0308 0.0011  -0.0329 392 THR A CB  
2398 O OG1 . THR A 314 ? 0.2571 0.2689 0.2134 -0.0301 0.0012  -0.0313 392 THR A OG1 
2399 C CG2 . THR A 314 ? 0.2613 0.2724 0.2121 -0.0324 0.0027  -0.0367 392 THR A CG2 
2400 N N   . ARG A 315 ? 0.2798 0.2895 0.2116 -0.0307 0.0004  -0.0319 393 ARG A N   
2401 C CA  . ARG A 315 ? 0.3397 0.3489 0.2638 -0.0315 0.0005  -0.0332 393 ARG A CA  
2402 C C   . ARG A 315 ? 0.3529 0.3591 0.2724 -0.0316 0.0033  -0.0314 393 ARG A C   
2403 O O   . ARG A 315 ? 0.3195 0.3249 0.2345 -0.0328 0.0051  -0.0333 393 ARG A O   
2404 C CB  . ARG A 315 ? 0.4046 0.4154 0.3235 -0.0306 -0.0031 -0.0325 393 ARG A CB  
2405 C CG  . ARG A 315 ? 0.6016 0.6113 0.5110 -0.0309 -0.0034 -0.0329 393 ARG A CG  
2406 C CD  . ARG A 315 ? 0.7668 0.7786 0.6721 -0.0297 -0.0076 -0.0325 393 ARG A CD  
2407 N NE  . ARG A 315 ? 0.7926 0.8033 0.6966 -0.0277 -0.0093 -0.0284 393 ARG A NE  
2408 C CZ  . ARG A 315 ? 0.9120 0.9251 0.8180 -0.0260 -0.0128 -0.0274 393 ARG A CZ  
2409 N NH1 . ARG A 315 ? 0.8998 0.9172 0.8099 -0.0263 -0.0151 -0.0302 393 ARG A NH1 
2410 N NH2 . ARG A 315 ? 0.8547 0.8661 0.7589 -0.0240 -0.0139 -0.0237 393 ARG A NH2 
2411 N N   . ALA A 316 ? 0.3159 0.3206 0.2366 -0.0306 0.0037  -0.0280 394 ALA A N   
2412 C CA  . ALA A 316 ? 0.3360 0.3380 0.2530 -0.0309 0.0064  -0.0262 394 ALA A CA  
2413 C C   . ALA A 316 ? 0.3022 0.3039 0.2255 -0.0313 0.0096  -0.0267 394 ALA A C   
2414 O O   . ALA A 316 ? 0.2676 0.2676 0.1896 -0.0315 0.0117  -0.0250 394 ALA A O   
2415 C CB  . ALA A 316 ? 0.3240 0.3242 0.2374 -0.0296 0.0049  -0.0222 394 ALA A CB  
2416 N N   . HIS A 317 ? 0.2865 0.2897 0.2163 -0.0315 0.0099  -0.0291 395 HIS A N   
2417 C CA  . HIS A 317 ? 0.3014 0.3043 0.2368 -0.0317 0.0128  -0.0301 395 HIS A CA  
2418 C C   . HIS A 317 ? 0.2714 0.2736 0.2107 -0.0306 0.0134  -0.0271 395 HIS A C   
2419 O O   . HIS A 317 ? 0.2812 0.2829 0.2223 -0.0308 0.0160  -0.0271 395 HIS A O   
2420 C CB  . HIS A 317 ? 0.3425 0.3449 0.2745 -0.0330 0.0159  -0.0320 395 HIS A CB  
2421 C CG  . HIS A 317 ? 0.3982 0.4010 0.3250 -0.0340 0.0155  -0.0348 395 HIS A CG  
2422 N ND1 . HIS A 317 ? 0.4227 0.4266 0.3524 -0.0345 0.0153  -0.0383 395 HIS A ND1 
2423 C CD2 . HIS A 317 ? 0.4929 0.4951 0.4114 -0.0347 0.0152  -0.0346 395 HIS A CD2 
2424 C CE1 . HIS A 317 ? 0.4111 0.4153 0.3346 -0.0355 0.0149  -0.0404 395 HIS A CE1 
2425 N NE2 . HIS A 317 ? 0.4814 0.4846 0.3979 -0.0356 0.0148  -0.0381 395 HIS A NE2 
2426 N N   . PHE A 318 ? 0.2365 0.2390 0.1771 -0.0295 0.0109  -0.0247 396 PHE A N   
2427 C CA  . PHE A 318 ? 0.2585 0.2605 0.2029 -0.0284 0.0111  -0.0220 396 PHE A CA  
2428 C C   . PHE A 318 ? 0.2558 0.2589 0.2077 -0.0277 0.0107  -0.0226 396 PHE A C   
2429 O O   . PHE A 318 ? 0.2315 0.2359 0.1848 -0.0275 0.0085  -0.0231 396 PHE A O   
2430 C CB  . PHE A 318 ? 0.2455 0.2468 0.1866 -0.0274 0.0088  -0.0190 396 PHE A CB  
2431 C CG  . PHE A 318 ? 0.2654 0.2646 0.1990 -0.0278 0.0094  -0.0176 396 PHE A CG  
2432 C CD1 . PHE A 318 ? 0.2809 0.2784 0.2139 -0.0284 0.0119  -0.0165 396 PHE A CD1 
2433 C CD2 . PHE A 318 ? 0.3098 0.3084 0.2367 -0.0278 0.0074  -0.0172 396 PHE A CD2 
2434 C CE1 . PHE A 318 ? 0.3325 0.3276 0.2584 -0.0291 0.0127  -0.0150 396 PHE A CE1 
2435 C CE2 . PHE A 318 ? 0.3005 0.2966 0.2201 -0.0282 0.0080  -0.0156 396 PHE A CE2 
2436 C CZ  . PHE A 318 ? 0.2848 0.2789 0.2038 -0.0290 0.0108  -0.0145 396 PHE A CZ  
2437 N N   . PRO A 319 ? 0.2295 0.2323 0.1862 -0.0274 0.0127  -0.0226 397 PRO A N   
2438 C CA  . PRO A 319 ? 0.2305 0.2338 0.1938 -0.0266 0.0124  -0.0226 397 PRO A CA  
2439 C C   . PRO A 319 ? 0.2339 0.2378 0.1985 -0.0256 0.0101  -0.0201 397 PRO A C   
2440 O O   . PRO A 319 ? 0.2403 0.2438 0.2022 -0.0250 0.0094  -0.0177 397 PRO A O   
2441 C CB  . PRO A 319 ? 0.2587 0.2614 0.2254 -0.0261 0.0147  -0.0223 397 PRO A CB  
2442 C CG  . PRO A 319 ? 0.2797 0.2822 0.2426 -0.0271 0.0168  -0.0238 397 PRO A CG  
2443 C CD  . PRO A 319 ? 0.2749 0.2770 0.2311 -0.0278 0.0155  -0.0228 397 PRO A CD  
2444 N N   . LEU A 320 ? 0.2110 0.2159 0.1798 -0.0255 0.0090  -0.0207 398 LEU A N   
2445 C CA  . LEU A 320 ? 0.2177 0.2237 0.1887 -0.0245 0.0070  -0.0186 398 LEU A CA  
2446 C C   . LEU A 320 ? 0.2271 0.2335 0.2040 -0.0246 0.0073  -0.0195 398 LEU A C   
2447 O O   . LEU A 320 ? 0.2383 0.2452 0.2161 -0.0257 0.0070  -0.0218 398 LEU A O   
2448 C CB  . LEU A 320 ? 0.2371 0.2446 0.2045 -0.0246 0.0044  -0.0186 398 LEU A CB  
2449 C CG  . LEU A 320 ? 0.2228 0.2321 0.1928 -0.0235 0.0023  -0.0168 398 LEU A CG  
2450 C CD1 . LEU A 320 ? 0.2695 0.2777 0.2389 -0.0220 0.0024  -0.0138 398 LEU A CD1 
2451 C CD2 . LEU A 320 ? 0.2684 0.2797 0.2352 -0.0235 -0.0002 -0.0174 398 LEU A CD2 
2452 N N   . ASP A 321 ? 0.2232 0.2290 0.2038 -0.0236 0.0079  -0.0176 399 ASP A N   
2453 C CA  . ASP A 321 ? 0.2080 0.2138 0.1938 -0.0237 0.0082  -0.0180 399 ASP A CA  
2454 C C   . ASP A 321 ? 0.2204 0.2282 0.2081 -0.0235 0.0064  -0.0169 399 ASP A C   
2455 O O   . ASP A 321 ? 0.2003 0.2085 0.1913 -0.0244 0.0063  -0.0181 399 ASP A O   
2456 C CB  . ASP A 321 ? 0.2036 0.2078 0.1925 -0.0226 0.0100  -0.0167 399 ASP A CB  
2457 C CG  . ASP A 321 ? 0.2173 0.2198 0.2076 -0.0230 0.0119  -0.0188 399 ASP A CG  
2458 O OD1 . ASP A 321 ? 0.2353 0.2375 0.2230 -0.0231 0.0129  -0.0198 399 ASP A OD1 
2459 O OD2 . ASP A 321 ? 0.2098 0.2111 0.2036 -0.0232 0.0125  -0.0196 399 ASP A OD2 
2460 N N   . VAL A 322 ? 0.1664 0.1752 0.1521 -0.0224 0.0050  -0.0148 400 VAL A N   
2461 C CA  . VAL A 322 ? 0.1744 0.1853 0.1626 -0.0219 0.0035  -0.0135 400 VAL A CA  
2462 C C   . VAL A 322 ? 0.1866 0.1993 0.1712 -0.0212 0.0012  -0.0128 400 VAL A C   
2463 O O   . VAL A 322 ? 0.1976 0.2092 0.1787 -0.0201 0.0010  -0.0111 400 VAL A O   
2464 C CB  . VAL A 322 ? 0.1878 0.1980 0.1786 -0.0206 0.0043  -0.0111 400 VAL A CB  
2465 C CG1 . VAL A 322 ? 0.2083 0.2207 0.2026 -0.0204 0.0033  -0.0103 400 VAL A CG1 
2466 C CG2 . VAL A 322 ? 0.1923 0.2002 0.1854 -0.0206 0.0065  -0.0113 400 VAL A CG2 
2467 N N   . GLN A 323 ? 0.1897 0.2051 0.1751 -0.0218 -0.0004 -0.0141 401 GLN A N   
2468 C CA  . GLN A 323 ? 0.2099 0.2276 0.1927 -0.0208 -0.0030 -0.0134 401 GLN A CA  
2469 C C   . GLN A 323 ? 0.2141 0.2337 0.2003 -0.0195 -0.0038 -0.0116 401 GLN A C   
2470 O O   . GLN A 323 ? 0.1922 0.2130 0.1832 -0.0202 -0.0031 -0.0120 401 GLN A O   
2471 C CB  . GLN A 323 ? 0.2387 0.2592 0.2214 -0.0219 -0.0047 -0.0160 401 GLN A CB  
2472 C CG  . GLN A 323 ? 0.2343 0.2574 0.2138 -0.0207 -0.0076 -0.0156 401 GLN A CG  
2473 C CD  . GLN A 323 ? 0.2136 0.2340 0.1867 -0.0195 -0.0080 -0.0140 401 GLN A CD  
2474 O OE1 . GLN A 323 ? 0.2875 0.3056 0.2569 -0.0204 -0.0068 -0.0148 401 GLN A OE1 
2475 N NE2 . GLN A 323 ? 0.2587 0.2791 0.2302 -0.0174 -0.0093 -0.0116 401 GLN A NE2 
2476 N N   . TRP A 324 ? 0.1961 0.2157 0.1795 -0.0177 -0.0051 -0.0097 402 TRP A N   
2477 C CA  . TRP A 324 ? 0.1884 0.2098 0.1744 -0.0161 -0.0059 -0.0081 402 TRP A CA  
2478 C C   . TRP A 324 ? 0.2001 0.2247 0.1848 -0.0149 -0.0088 -0.0082 402 TRP A C   
2479 O O   . TRP A 324 ? 0.1940 0.2183 0.1740 -0.0146 -0.0103 -0.0086 402 TRP A O   
2480 C CB  . TRP A 324 ? 0.2214 0.2400 0.2055 -0.0147 -0.0051 -0.0056 402 TRP A CB  
2481 C CG  . TRP A 324 ? 0.2062 0.2223 0.1920 -0.0153 -0.0026 -0.0051 402 TRP A CG  
2482 C CD1 . TRP A 324 ? 0.2048 0.2193 0.1908 -0.0168 -0.0009 -0.0064 402 TRP A CD1 
2483 C CD2 . TRP A 324 ? 0.2070 0.2219 0.1943 -0.0142 -0.0016 -0.0032 402 TRP A CD2 
2484 N NE1 . TRP A 324 ? 0.2182 0.2308 0.2061 -0.0166 0.0009  -0.0055 402 TRP A NE1 
2485 C CE2 . TRP A 324 ? 0.2249 0.2377 0.2135 -0.0151 0.0005  -0.0035 402 TRP A CE2 
2486 C CE3 . TRP A 324 ? 0.1944 0.2100 0.1823 -0.0125 -0.0023 -0.0014 402 TRP A CE3 
2487 C CZ2 . TRP A 324 ? 0.2025 0.2141 0.1927 -0.0143 0.0018  -0.0020 402 TRP A CZ2 
2488 C CZ3 . TRP A 324 ? 0.1700 0.1841 0.1593 -0.0119 -0.0009 -0.0001 402 TRP A CZ3 
2489 C CH2 . TRP A 324 ? 0.1859 0.1982 0.1763 -0.0128 0.0010  -0.0003 402 TRP A CH2 
2490 N N   . ASN A 325 ? 0.1947 0.2226 0.1834 -0.0141 -0.0096 -0.0078 403 ASN A N   
2491 C CA  . ASN A 325 ? 0.1886 0.2190 0.1761 -0.0119 -0.0122 -0.0071 403 ASN A CA  
2492 C C   . ASN A 325 ? 0.2100 0.2401 0.1989 -0.0099 -0.0120 -0.0049 403 ASN A C   
2493 O O   . ASN A 325 ? 0.2120 0.2419 0.2046 -0.0104 -0.0101 -0.0044 403 ASN A O   
2494 C CB  . ASN A 325 ? 0.2009 0.2368 0.1918 -0.0123 -0.0141 -0.0092 403 ASN A CB  
2495 C CG  . ASN A 325 ? 0.2240 0.2606 0.2123 -0.0137 -0.0153 -0.0114 403 ASN A CG  
2496 O OD1 . ASN A 325 ? 0.2628 0.2988 0.2458 -0.0124 -0.0173 -0.0112 403 ASN A OD1 
2497 N ND2 . ASN A 325 ? 0.1859 0.2236 0.1776 -0.0162 -0.0141 -0.0136 403 ASN A ND2 
2498 N N   . ASP A 326 ? 0.1936 0.2235 0.1791 -0.0076 -0.0140 -0.0038 404 ASP A N   
2499 C CA  . ASP A 326 ? 0.2139 0.2440 0.2001 -0.0053 -0.0145 -0.0021 404 ASP A CA  
2500 C C   . ASP A 326 ? 0.2169 0.2531 0.2076 -0.0043 -0.0163 -0.0032 404 ASP A C   
2501 O O   . ASP A 326 ? 0.2060 0.2459 0.2003 -0.0061 -0.0164 -0.0052 404 ASP A O   
2502 C CB  . ASP A 326 ? 0.2257 0.2519 0.2055 -0.0033 -0.0158 -0.0004 404 ASP A CB  
2503 C CG  . ASP A 326 ? 0.2406 0.2645 0.2200 -0.0014 -0.0153 0.0016  404 ASP A CG  
2504 O OD1 . ASP A 326 ? 0.2167 0.2436 0.2002 -0.0003 -0.0155 0.0017  404 ASP A OD1 
2505 O OD2 . ASP A 326 ? 0.2383 0.2572 0.2130 -0.0011 -0.0146 0.0031  404 ASP A OD2 
2506 N N   . LEU A 327 ? 0.2186 0.2557 0.2090 -0.0016 -0.0178 -0.0021 405 LEU A N   
2507 C CA  . LEU A 327 ? 0.2335 0.2767 0.2285 -0.0003 -0.0194 -0.0031 405 LEU A CA  
2508 C C   . LEU A 327 ? 0.2072 0.2552 0.2031 -0.0007 -0.0217 -0.0053 405 LEU A C   
2509 O O   . LEU A 327 ? 0.2037 0.2577 0.2048 -0.0007 -0.0225 -0.0069 405 LEU A O   
2510 C CB  . LEU A 327 ? 0.2241 0.2667 0.2173 0.0031  -0.0209 -0.0015 405 LEU A CB  
2511 C CG  . LEU A 327 ? 0.2404 0.2798 0.2337 0.0039  -0.0190 0.0003  405 LEU A CG  
2512 C CD1 . LEU A 327 ? 0.2508 0.2885 0.2410 0.0075  -0.0208 0.0017  405 LEU A CD1 
2513 C CD2 . LEU A 327 ? 0.2550 0.2981 0.2547 0.0029  -0.0171 -0.0002 405 LEU A CD2 
2514 N N   . ASP A 328 ? 0.1987 0.2441 0.1894 -0.0011 -0.0228 -0.0056 406 ASP A N   
2515 C CA  . ASP A 328 ? 0.2226 0.2721 0.2131 -0.0014 -0.0253 -0.0078 406 ASP A CA  
2516 C C   . ASP A 328 ? 0.2176 0.2729 0.2148 -0.0039 -0.0248 -0.0104 406 ASP A C   
2517 O O   . ASP A 328 ? 0.2278 0.2888 0.2272 -0.0032 -0.0273 -0.0122 406 ASP A O   
2518 C CB  . ASP A 328 ? 0.2573 0.3026 0.2418 -0.0026 -0.0254 -0.0079 406 ASP A CB  
2519 C CG  . ASP A 328 ? 0.2672 0.3066 0.2445 -0.0006 -0.0258 -0.0054 406 ASP A CG  
2520 O OD1 . ASP A 328 ? 0.3031 0.3426 0.2761 0.0016  -0.0286 -0.0050 406 ASP A OD1 
2521 O OD2 . ASP A 328 ? 0.2148 0.2494 0.1908 -0.0012 -0.0233 -0.0038 406 ASP A OD2 
2522 N N   . TYR A 329 ? 0.2096 0.2633 0.2098 -0.0066 -0.0218 -0.0107 407 TYR A N   
2523 C CA  . TYR A 329 ? 0.2160 0.2741 0.2221 -0.0095 -0.0209 -0.0133 407 TYR A CA  
2524 C C   . TYR A 329 ? 0.2181 0.2826 0.2306 -0.0090 -0.0213 -0.0141 407 TYR A C   
2525 O O   . TYR A 329 ? 0.2156 0.2852 0.2325 -0.0109 -0.0219 -0.0166 407 TYR A O   
2526 C CB  . TYR A 329 ? 0.2114 0.2657 0.2189 -0.0124 -0.0175 -0.0132 407 TYR A CB  
2527 C CG  . TYR A 329 ? 0.2026 0.2554 0.2131 -0.0124 -0.0150 -0.0115 407 TYR A CG  
2528 C CD1 . TYR A 329 ? 0.2484 0.3054 0.2651 -0.0137 -0.0139 -0.0123 407 TYR A CD1 
2529 C CD2 . TYR A 329 ? 0.2098 0.2573 0.2169 -0.0111 -0.0136 -0.0090 407 TYR A CD2 
2530 C CE1 . TYR A 329 ? 0.1854 0.2410 0.2044 -0.0136 -0.0115 -0.0106 407 TYR A CE1 
2531 C CE2 . TYR A 329 ? 0.2085 0.2549 0.2181 -0.0110 -0.0115 -0.0074 407 TYR A CE2 
2532 C CZ  . TYR A 329 ? 0.1998 0.2501 0.2152 -0.0122 -0.0105 -0.0082 407 TYR A CZ  
2533 O OH  . TYR A 329 ? 0.1667 0.2157 0.1839 -0.0120 -0.0083 -0.0066 407 TYR A OH  
2534 N N   . MET A 330 ? 0.2318 0.2959 0.2449 -0.0067 -0.0210 -0.0121 408 MET A N   
2535 C CA  . MET A 330 ? 0.2635 0.3330 0.2828 -0.0065 -0.0205 -0.0126 408 MET A CA  
2536 C C   . MET A 330 ? 0.2550 0.3318 0.2769 -0.0048 -0.0237 -0.0145 408 MET A C   
2537 O O   . MET A 330 ? 0.2546 0.3314 0.2724 -0.0029 -0.0266 -0.0147 408 MET A O   
2538 C CB  . MET A 330 ? 0.2195 0.2865 0.2380 -0.0042 -0.0194 -0.0100 408 MET A CB  
2539 C CG  . MET A 330 ? 0.2367 0.2977 0.2540 -0.0057 -0.0162 -0.0083 408 MET A CG  
2540 S SD  . MET A 330 ? 0.2336 0.2911 0.2484 -0.0026 -0.0156 -0.0054 408 MET A SD  
2541 C CE  . MET A 330 ? 0.2023 0.2537 0.2161 -0.0046 -0.0121 -0.0038 408 MET A CE  
2542 N N   . ASP A 331 ? 0.2208 0.3037 0.2493 -0.0056 -0.0230 -0.0158 409 ASP A N   
2543 C CA  . ASP A 331 ? 0.2129 0.3036 0.2449 -0.0036 -0.0258 -0.0176 409 ASP A CA  
2544 C C   . ASP A 331 ? 0.2261 0.3167 0.2577 0.0001  -0.0262 -0.0156 409 ASP A C   
2545 O O   . ASP A 331 ? 0.2008 0.2916 0.2355 -0.0001 -0.0237 -0.0147 409 ASP A O   
2546 C CB  . ASP A 331 ? 0.2350 0.3329 0.2748 -0.0066 -0.0248 -0.0203 409 ASP A CB  
2547 C CG  . ASP A 331 ? 0.2880 0.3950 0.3321 -0.0045 -0.0278 -0.0225 409 ASP A CG  
2548 O OD1 . ASP A 331 ? 0.5917 0.7046 0.6396 -0.0065 -0.0290 -0.0255 409 ASP A OD1 
2549 O OD2 . ASP A 331 ? 0.3579 0.4665 0.4020 -0.0008 -0.0290 -0.0214 409 ASP A OD2 
2550 N N   . SER A 332 ? 0.2015 0.2909 0.2284 0.0038  -0.0293 -0.0148 410 SER A N   
2551 C CA  . SER A 332 ? 0.2434 0.3318 0.2689 0.0078  -0.0301 -0.0129 410 SER A CA  
2552 C C   . SER A 332 ? 0.2426 0.3243 0.2658 0.0077  -0.0271 -0.0103 410 SER A C   
2553 O O   . SER A 332 ? 0.2374 0.3204 0.2630 0.0093  -0.0261 -0.0096 410 SER A O   
2554 C CB  . SER A 332 ? 0.3170 0.4141 0.3492 0.0094  -0.0310 -0.0147 410 SER A CB  
2555 O OG  . SER A 332 ? 0.3714 0.4754 0.4063 0.0094  -0.0339 -0.0174 410 SER A OG  
2556 N N   . ARG A 333 ? 0.2157 0.2906 0.2342 0.0058  -0.0257 -0.0090 411 ARG A N   
2557 C CA  A ARG A 333 ? 0.2182 0.2864 0.2339 0.0055  -0.0231 -0.0066 411 ARG A CA  
2558 C CA  B ARG A 333 ? 0.2274 0.2956 0.2431 0.0057  -0.0231 -0.0066 411 ARG A CA  
2559 C C   . ARG A 333 ? 0.2237 0.2933 0.2444 0.0037  -0.0199 -0.0065 411 ARG A C   
2560 O O   . ARG A 333 ? 0.1993 0.2653 0.2187 0.0047  -0.0183 -0.0047 411 ARG A O   
2561 C CB  A ARG A 333 ? 0.2445 0.3083 0.2550 0.0093  -0.0245 -0.0046 411 ARG A CB  
2562 C CB  B ARG A 333 ? 0.2661 0.3309 0.2774 0.0097  -0.0247 -0.0047 411 ARG A CB  
2563 C CG  A ARG A 333 ? 0.2369 0.2967 0.2407 0.0103  -0.0269 -0.0040 411 ARG A CG  
2564 C CG  B ARG A 333 ? 0.2973 0.3597 0.3027 0.0116  -0.0278 -0.0044 411 ARG A CG  
2565 C CD  A ARG A 333 ? 0.2657 0.3218 0.2646 0.0143  -0.0288 -0.0022 411 ARG A CD  
2566 C CD  B ARG A 333 ? 0.3329 0.3936 0.3350 0.0160  -0.0300 -0.0030 411 ARG A CD  
2567 N NE  A ARG A 333 ? 0.3022 0.3545 0.2944 0.0151  -0.0310 -0.0016 411 ARG A NE  
2568 N NE  B ARG A 333 ? 0.3713 0.4389 0.3785 0.0185  -0.0314 -0.0043 411 ARG A NE  
2569 C CZ  A ARG A 333 ? 0.3460 0.3946 0.3329 0.0185  -0.0331 0.0000  411 ARG A CZ  
2570 C CZ  B ARG A 333 ? 0.3887 0.4631 0.3989 0.0193  -0.0340 -0.0064 411 ARG A CZ  
2571 N NH1 A ARG A 333 ? 0.3891 0.4375 0.3769 0.0215  -0.0334 0.0007  411 ARG A NH1 
2572 N NH1 B ARG A 333 ? 0.4530 0.5279 0.4612 0.0178  -0.0355 -0.0074 411 ARG A NH1 
2573 N NH2 A ARG A 333 ? 0.3415 0.3864 0.3219 0.0190  -0.0348 0.0006  411 ARG A NH2 
2574 N NH2 B ARG A 333 ? 0.4088 0.4898 0.4241 0.0216  -0.0351 -0.0076 411 ARG A NH2 
2575 N N   . ARG A 334 ? 0.2270 0.3015 0.2531 0.0009  -0.0189 -0.0085 412 ARG A N   
2576 C CA  . ARG A 334 ? 0.2145 0.2904 0.2452 -0.0011 -0.0157 -0.0084 412 ARG A CA  
2577 C C   . ARG A 334 ? 0.2011 0.2732 0.2317 -0.0048 -0.0131 -0.0083 412 ARG A C   
2578 O O   . ARG A 334 ? 0.1647 0.2374 0.1955 -0.0069 -0.0137 -0.0099 412 ARG A O   
2579 C CB  . ARG A 334 ? 0.2080 0.2924 0.2455 -0.0017 -0.0160 -0.0107 412 ARG A CB  
2580 C CG  . ARG A 334 ? 0.2421 0.3308 0.2807 0.0021  -0.0181 -0.0108 412 ARG A CG  
2581 C CD  . ARG A 334 ? 0.2279 0.3258 0.2737 0.0013  -0.0183 -0.0134 412 ARG A CD  
2582 N NE  . ARG A 334 ? 0.2735 0.3756 0.3210 -0.0002 -0.0203 -0.0159 412 ARG A NE  
2583 C CZ  . ARG A 334 ? 0.2826 0.3927 0.3367 -0.0020 -0.0203 -0.0186 412 ARG A CZ  
2584 N NH1 . ARG A 334 ? 0.2869 0.4019 0.3465 -0.0024 -0.0183 -0.0190 412 ARG A NH1 
2585 N NH2 . ARG A 334 ? 0.3193 0.4330 0.3746 -0.0034 -0.0223 -0.0209 412 ARG A NH2 
2586 N N   . ASP A 335 ? 0.1907 0.2589 0.2209 -0.0054 -0.0104 -0.0065 413 ASP A N   
2587 C CA  . ASP A 335 ? 0.1919 0.2566 0.2226 -0.0086 -0.0077 -0.0063 413 ASP A CA  
2588 C C   . ASP A 335 ? 0.1799 0.2490 0.2157 -0.0118 -0.0069 -0.0085 413 ASP A C   
2589 O O   . ASP A 335 ? 0.1706 0.2459 0.2110 -0.0118 -0.0071 -0.0097 413 ASP A O   
2590 C CB  . ASP A 335 ? 0.2127 0.2749 0.2437 -0.0085 -0.0051 -0.0043 413 ASP A CB  
2591 C CG  . ASP A 335 ? 0.2296 0.2860 0.2556 -0.0064 -0.0050 -0.0021 413 ASP A CG  
2592 O OD1 . ASP A 335 ? 0.2147 0.2676 0.2364 -0.0056 -0.0065 -0.0019 413 ASP A OD1 
2593 O OD2 . ASP A 335 ? 0.1926 0.2480 0.2189 -0.0057 -0.0034 -0.0008 413 ASP A OD2 
2594 N N   . PHE A 336 ? 0.1804 0.2460 0.2155 -0.0145 -0.0056 -0.0089 414 PHE A N   
2595 C CA  . PHE A 336 ? 0.1774 0.2455 0.2170 -0.0181 -0.0042 -0.0109 414 PHE A CA  
2596 C C   . PHE A 336 ? 0.1851 0.2600 0.2279 -0.0187 -0.0065 -0.0137 414 PHE A C   
2597 O O   . PHE A 336 ? 0.1616 0.2410 0.2095 -0.0210 -0.0055 -0.0154 414 PHE A O   
2598 C CB  . PHE A 336 ? 0.1830 0.2518 0.2262 -0.0194 -0.0012 -0.0099 414 PHE A CB  
2599 C CG  . PHE A 336 ? 0.1768 0.2399 0.2168 -0.0182 0.0005  -0.0071 414 PHE A CG  
2600 C CD1 . PHE A 336 ? 0.1869 0.2435 0.2237 -0.0191 0.0016  -0.0061 414 PHE A CD1 
2601 C CD2 . PHE A 336 ? 0.1956 0.2600 0.2358 -0.0160 0.0010  -0.0056 414 PHE A CD2 
2602 C CE1 . PHE A 336 ? 0.2032 0.2549 0.2372 -0.0178 0.0031  -0.0036 414 PHE A CE1 
2603 C CE2 . PHE A 336 ? 0.1796 0.2390 0.2168 -0.0148 0.0025  -0.0031 414 PHE A CE2 
2604 C CZ  . PHE A 336 ? 0.1927 0.2459 0.2268 -0.0157 0.0034  -0.0021 414 PHE A CZ  
2605 N N   . THR A 337 ? 0.1703 0.2460 0.2100 -0.0165 -0.0096 -0.0143 415 THR A N   
2606 C CA  . THR A 337 ? 0.1855 0.2670 0.2271 -0.0168 -0.0123 -0.0170 415 THR A CA  
2607 C C   . THR A 337 ? 0.1996 0.2774 0.2358 -0.0165 -0.0141 -0.0174 415 THR A C   
2608 O O   . THR A 337 ? 0.1996 0.2710 0.2308 -0.0155 -0.0136 -0.0154 415 THR A O   
2609 C CB  . THR A 337 ? 0.1941 0.2818 0.2373 -0.0135 -0.0149 -0.0174 415 THR A CB  
2610 O OG1 . THR A 337 ? 0.1624 0.2462 0.1998 -0.0098 -0.0166 -0.0153 415 THR A OG1 
2611 C CG2 . THR A 337 ? 0.2036 0.2952 0.2518 -0.0135 -0.0129 -0.0170 415 THR A CG2 
2612 N N   . PHE A 338 ? 0.1973 0.2794 0.2347 -0.0174 -0.0163 -0.0201 416 PHE A N   
2613 C CA  . PHE A 338 ? 0.2218 0.3019 0.2538 -0.0163 -0.0188 -0.0205 416 PHE A CA  
2614 C C   . PHE A 338 ? 0.2344 0.3217 0.2679 -0.0150 -0.0225 -0.0228 416 PHE A C   
2615 O O   . PHE A 338 ? 0.1984 0.2921 0.2378 -0.0169 -0.0226 -0.0253 416 PHE A O   
2616 C CB  . PHE A 338 ? 0.2035 0.2788 0.2333 -0.0193 -0.0174 -0.0214 416 PHE A CB  
2617 C CG  . PHE A 338 ? 0.2289 0.3076 0.2638 -0.0231 -0.0166 -0.0245 416 PHE A CG  
2618 C CD1 . PHE A 338 ? 0.2403 0.3177 0.2793 -0.0259 -0.0132 -0.0244 416 PHE A CD1 
2619 C CD2 . PHE A 338 ? 0.2167 0.2995 0.2517 -0.0241 -0.0191 -0.0276 416 PHE A CD2 
2620 C CE1 . PHE A 338 ? 0.2343 0.3140 0.2776 -0.0297 -0.0123 -0.0273 416 PHE A CE1 
2621 C CE2 . PHE A 338 ? 0.2354 0.3211 0.2750 -0.0279 -0.0183 -0.0306 416 PHE A CE2 
2622 C CZ  . PHE A 338 ? 0.2318 0.3157 0.2756 -0.0308 -0.0148 -0.0305 416 PHE A CZ  
2623 N N   . ASN A 339 ? 0.2250 0.3114 0.2533 -0.0118 -0.0254 -0.0220 417 ASN A N   
2624 C CA  . ASN A 339 ? 0.2642 0.3573 0.2933 -0.0099 -0.0293 -0.0240 417 ASN A CA  
2625 C C   . ASN A 339 ? 0.2967 0.3929 0.3269 -0.0128 -0.0304 -0.0273 417 ASN A C   
2626 O O   . ASN A 339 ? 0.2882 0.3796 0.3160 -0.0154 -0.0288 -0.0277 417 ASN A O   
2627 C CB  . ASN A 339 ? 0.2599 0.3504 0.2825 -0.0056 -0.0321 -0.0220 417 ASN A CB  
2628 C CG  . ASN A 339 ? 0.2790 0.3632 0.2940 -0.0059 -0.0326 -0.0212 417 ASN A CG  
2629 O OD1 . ASN A 339 ? 0.3257 0.4117 0.3393 -0.0070 -0.0344 -0.0234 417 ASN A OD1 
2630 N ND2 . ASN A 339 ? 0.2613 0.3380 0.2714 -0.0050 -0.0308 -0.0183 417 ASN A ND2 
2631 N N   . LYS A 340 ? 0.3584 0.4628 0.3926 -0.0123 -0.0332 -0.0300 418 LYS A N   
2632 C CA  . LYS A 340 ? 0.3794 0.4880 0.4157 -0.0153 -0.0344 -0.0337 418 LYS A CA  
2633 C C   . LYS A 340 ? 0.4654 0.5751 0.4961 -0.0130 -0.0386 -0.0346 418 LYS A C   
2634 O O   . LYS A 340 ? 0.4034 0.5190 0.4363 -0.0142 -0.0409 -0.0379 418 LYS A O   
2635 C CB  . LYS A 340 ? 0.3946 0.5122 0.4399 -0.0172 -0.0343 -0.0365 418 LYS A CB  
2636 C CG  . LYS A 340 ? 0.3625 0.4789 0.4129 -0.0197 -0.0300 -0.0356 418 LYS A CG  
2637 C CD  . LYS A 340 ? 0.4036 0.5131 0.4527 -0.0235 -0.0266 -0.0354 418 LYS A CD  
2638 C CE  . LYS A 340 ? 0.4356 0.5445 0.4901 -0.0265 -0.0226 -0.0350 418 LYS A CE  
2639 N NZ  . LYS A 340 ? 0.3440 0.4471 0.3961 -0.0246 -0.0202 -0.0311 418 LYS A NZ  
2640 N N   . ASP A 341 ? 0.4290 0.5327 0.4523 -0.0098 -0.0395 -0.0316 419 ASP A N   
2641 C CA  . ASP A 341 ? 0.5016 0.6045 0.5180 -0.0075 -0.0430 -0.0317 419 ASP A CA  
2642 C C   . ASP A 341 ? 0.4370 0.5314 0.4468 -0.0093 -0.0410 -0.0305 419 ASP A C   
2643 O O   . ASP A 341 ? 0.3575 0.4519 0.3686 -0.0129 -0.0397 -0.0329 419 ASP A O   
2644 C CB  . ASP A 341 ? 0.5983 0.7010 0.6113 -0.0024 -0.0455 -0.0291 419 ASP A CB  
2645 C CG  . ASP A 341 ? 0.8247 0.9369 0.8436 -0.0003 -0.0485 -0.0311 419 ASP A CG  
2646 O OD1 . ASP A 341 ? 1.1504 1.2675 1.1683 0.0004  -0.0522 -0.0334 419 ASP A OD1 
2647 O OD2 . ASP A 341 ? 0.9804 1.0953 1.0047 0.0003  -0.0472 -0.0305 419 ASP A OD2 
2648 N N   . GLY A 342 ? 0.3418 0.4293 0.3453 -0.0070 -0.0403 -0.0271 420 GLY A N   
2649 C CA  . GLY A 342 ? 0.3355 0.4153 0.3331 -0.0086 -0.0382 -0.0260 420 GLY A CA  
2650 C C   . GLY A 342 ? 0.2779 0.3550 0.2792 -0.0125 -0.0342 -0.0266 420 GLY A C   
2651 O O   . GLY A 342 ? 0.2273 0.3003 0.2253 -0.0146 -0.0328 -0.0273 420 GLY A O   
2652 N N   . PHE A 343 ? 0.2607 0.3399 0.2688 -0.0134 -0.0322 -0.0264 421 PHE A N   
2653 C CA  . PHE A 343 ? 0.2572 0.3332 0.2686 -0.0167 -0.0282 -0.0266 421 PHE A CA  
2654 C C   . PHE A 343 ? 0.2755 0.3568 0.2942 -0.0200 -0.0274 -0.0297 421 PHE A C   
2655 O O   . PHE A 343 ? 0.2248 0.3042 0.2474 -0.0224 -0.0242 -0.0295 421 PHE A O   
2656 C CB  . PHE A 343 ? 0.2618 0.3340 0.2737 -0.0154 -0.0258 -0.0233 421 PHE A CB  
2657 C CG  . PHE A 343 ? 0.2481 0.3131 0.2532 -0.0140 -0.0250 -0.0206 421 PHE A CG  
2658 C CD1 . PHE A 343 ? 0.2655 0.3294 0.2652 -0.0106 -0.0274 -0.0189 421 PHE A CD1 
2659 C CD2 . PHE A 343 ? 0.2371 0.2964 0.2411 -0.0159 -0.0218 -0.0199 421 PHE A CD2 
2660 C CE1 . PHE A 343 ? 0.2388 0.2959 0.2321 -0.0096 -0.0265 -0.0165 421 PHE A CE1 
2661 C CE2 . PHE A 343 ? 0.2399 0.2931 0.2380 -0.0148 -0.0210 -0.0176 421 PHE A CE2 
2662 C CZ  . PHE A 343 ? 0.2556 0.3077 0.2483 -0.0118 -0.0233 -0.0160 421 PHE A CZ  
2663 N N   . ARG A 344 ? 0.2749 0.3627 0.2954 -0.0203 -0.0304 -0.0326 422 ARG A N   
2664 C CA  . ARG A 344 ? 0.3420 0.4355 0.3696 -0.0237 -0.0299 -0.0360 422 ARG A CA  
2665 C C   . ARG A 344 ? 0.2937 0.3826 0.3223 -0.0277 -0.0266 -0.0372 422 ARG A C   
2666 O O   . ARG A 344 ? 0.2744 0.3648 0.3090 -0.0305 -0.0243 -0.0383 422 ARG A O   
2667 C CB  . ARG A 344 ? 0.4470 0.5473 0.4748 -0.0234 -0.0339 -0.0393 422 ARG A CB  
2668 C CG  . ARG A 344 ? 0.6510 0.7590 0.6869 -0.0266 -0.0340 -0.0431 422 ARG A CG  
2669 C CD  . ARG A 344 ? 0.7835 0.8980 0.8190 -0.0265 -0.0380 -0.0466 422 ARG A CD  
2670 N NE  . ARG A 344 ? 1.0880 1.2050 1.1193 -0.0217 -0.0420 -0.0453 422 ARG A NE  
2671 C CZ  . ARG A 344 ? 1.1260 1.2388 1.1489 -0.0193 -0.0440 -0.0440 422 ARG A CZ  
2672 N NH1 . ARG A 344 ? 1.2661 1.3723 1.2837 -0.0211 -0.0425 -0.0439 422 ARG A NH1 
2673 N NH2 . ARG A 344 ? 1.0534 1.1686 1.0730 -0.0149 -0.0476 -0.0427 422 ARG A NH2 
2674 N N   . ASP A 345 ? 0.2872 0.3704 0.3097 -0.0280 -0.0263 -0.0370 423 ASP A N   
2675 C CA  . ASP A 345 ? 0.2830 0.3614 0.3058 -0.0314 -0.0234 -0.0383 423 ASP A CA  
2676 C C   . ASP A 345 ? 0.2615 0.3319 0.2815 -0.0308 -0.0202 -0.0350 423 ASP A C   
2677 O O   . ASP A 345 ? 0.2528 0.3180 0.2699 -0.0322 -0.0186 -0.0354 423 ASP A O   
2678 C CB  . ASP A 345 ? 0.3541 0.4322 0.3726 -0.0324 -0.0252 -0.0411 423 ASP A CB  
2679 C CG  . ASP A 345 ? 0.3370 0.4110 0.3473 -0.0295 -0.0264 -0.0390 423 ASP A CG  
2680 O OD1 . ASP A 345 ? 0.3663 0.4404 0.3744 -0.0262 -0.0276 -0.0361 423 ASP A OD1 
2681 O OD2 . ASP A 345 ? 0.4956 0.5661 0.5016 -0.0307 -0.0260 -0.0402 423 ASP A OD2 
2682 N N   . PHE A 346 ? 0.2456 0.3156 0.2668 -0.0288 -0.0194 -0.0320 424 PHE A N   
2683 C CA  . PHE A 346 ? 0.2382 0.3016 0.2574 -0.0280 -0.0165 -0.0288 424 PHE A CA  
2684 C C   . PHE A 346 ? 0.2486 0.3077 0.2703 -0.0312 -0.0132 -0.0296 424 PHE A C   
2685 O O   . PHE A 346 ? 0.2768 0.3301 0.2949 -0.0312 -0.0116 -0.0287 424 PHE A O   
2686 C CB  . PHE A 346 ? 0.2530 0.3180 0.2746 -0.0258 -0.0163 -0.0262 424 PHE A CB  
2687 C CG  . PHE A 346 ? 0.2222 0.2813 0.2408 -0.0241 -0.0143 -0.0227 424 PHE A CG  
2688 C CD1 . PHE A 346 ? 0.2286 0.2821 0.2414 -0.0234 -0.0139 -0.0216 424 PHE A CD1 
2689 C CD2 . PHE A 346 ? 0.2218 0.2815 0.2435 -0.0232 -0.0130 -0.0207 424 PHE A CD2 
2690 C CE1 . PHE A 346 ? 0.2358 0.2846 0.2464 -0.0218 -0.0122 -0.0187 424 PHE A CE1 
2691 C CE2 . PHE A 346 ? 0.2087 0.2635 0.2279 -0.0216 -0.0114 -0.0177 424 PHE A CE2 
2692 C CZ  . PHE A 346 ? 0.2311 0.2806 0.2449 -0.0209 -0.0111 -0.0167 424 PHE A CZ  
2693 N N   . PRO A 347 ? 0.2724 0.3345 0.3002 -0.0339 -0.0120 -0.0313 425 PRO A N   
2694 C CA  . PRO A 347 ? 0.2699 0.3269 0.2993 -0.0366 -0.0088 -0.0318 425 PRO A CA  
2695 C C   . PRO A 347 ? 0.2630 0.3162 0.2886 -0.0379 -0.0088 -0.0338 425 PRO A C   
2696 O O   . PRO A 347 ? 0.2238 0.2709 0.2474 -0.0380 -0.0065 -0.0328 425 PRO A O   
2697 C CB  . PRO A 347 ? 0.2706 0.3319 0.3065 -0.0397 -0.0081 -0.0340 425 PRO A CB  
2698 C CG  . PRO A 347 ? 0.2499 0.3175 0.2884 -0.0378 -0.0098 -0.0330 425 PRO A CG  
2699 C CD  . PRO A 347 ? 0.2824 0.3516 0.3159 -0.0346 -0.0130 -0.0326 425 PRO A CD  
2700 N N   . ALA A 348 ? 0.2112 0.2684 0.2361 -0.0386 -0.0113 -0.0368 426 ALA A N   
2701 C CA  . ALA A 348 ? 0.2522 0.3066 0.2735 -0.0399 -0.0114 -0.0392 426 ALA A CA  
2702 C C   . ALA A 348 ? 0.2260 0.2755 0.2406 -0.0375 -0.0112 -0.0371 426 ALA A C   
2703 O O   . ALA A 348 ? 0.2857 0.3304 0.2982 -0.0384 -0.0095 -0.0379 426 ALA A O   
2704 C CB  . ALA A 348 ? 0.2805 0.3406 0.3017 -0.0408 -0.0145 -0.0427 426 ALA A CB  
2705 N N   . MET A 349 ? 0.2291 0.2798 0.2407 -0.0344 -0.0128 -0.0346 427 MET A N   
2706 C CA  . MET A 349 ? 0.2355 0.2815 0.2410 -0.0323 -0.0124 -0.0323 427 MET A CA  
2707 C C   . MET A 349 ? 0.2302 0.2704 0.2364 -0.0324 -0.0090 -0.0304 427 MET A C   
2708 O O   . MET A 349 ? 0.2156 0.2516 0.2183 -0.0324 -0.0078 -0.0304 427 MET A O   
2709 C CB  . MET A 349 ? 0.2441 0.2918 0.2469 -0.0290 -0.0144 -0.0295 427 MET A CB  
2710 C CG  . MET A 349 ? 0.2455 0.2886 0.2416 -0.0271 -0.0141 -0.0275 427 MET A CG  
2711 S SD  . MET A 349 ? 0.2932 0.3367 0.2860 -0.0234 -0.0159 -0.0239 427 MET A SD  
2712 C CE  . MET A 349 ? 0.2864 0.3271 0.2832 -0.0231 -0.0129 -0.0213 427 MET A CE  
2713 N N   . VAL A 350 ? 0.2153 0.2556 0.2259 -0.0325 -0.0076 -0.0287 428 VAL A N   
2714 C CA  . VAL A 350 ? 0.2058 0.2409 0.2170 -0.0323 -0.0047 -0.0267 428 VAL A CA  
2715 C C   . VAL A 350 ? 0.2329 0.2645 0.2457 -0.0348 -0.0025 -0.0289 428 VAL A C   
2716 O O   . VAL A 350 ? 0.2625 0.2893 0.2733 -0.0345 -0.0007 -0.0283 428 VAL A O   
2717 C CB  . VAL A 350 ? 0.2250 0.2610 0.2398 -0.0314 -0.0038 -0.0241 428 VAL A CB  
2718 C CG1 . VAL A 350 ? 0.2447 0.2753 0.2596 -0.0311 -0.0010 -0.0221 428 VAL A CG1 
2719 C CG2 . VAL A 350 ? 0.2051 0.2439 0.2177 -0.0286 -0.0059 -0.0221 428 VAL A CG2 
2720 N N   . GLN A 351 ? 0.2604 0.2945 0.2769 -0.0374 -0.0028 -0.0315 429 GLN A N   
2721 C CA  . GLN A 351 ? 0.2889 0.3197 0.3068 -0.0401 -0.0010 -0.0342 429 GLN A CA  
2722 C C   . GLN A 351 ? 0.2871 0.3155 0.3002 -0.0399 -0.0013 -0.0360 429 GLN A C   
2723 O O   . GLN A 351 ? 0.2482 0.2716 0.2607 -0.0404 0.0007  -0.0364 429 GLN A O   
2724 C CB  . GLN A 351 ? 0.3117 0.3464 0.3340 -0.0430 -0.0017 -0.0372 429 GLN A CB  
2725 C CG  . GLN A 351 ? 0.4456 0.4820 0.4732 -0.0439 -0.0006 -0.0358 429 GLN A CG  
2726 C CD  . GLN A 351 ? 0.5912 0.6338 0.6232 -0.0464 -0.0019 -0.0385 429 GLN A CD  
2727 O OE1 . GLN A 351 ? 0.6267 0.6724 0.6581 -0.0476 -0.0038 -0.0417 429 GLN A OE1 
2728 N NE2 . GLN A 351 ? 0.7829 0.8276 0.8196 -0.0472 -0.0008 -0.0374 429 GLN A NE2 
2729 N N   . GLU A 352 ? 0.2721 0.3040 0.2817 -0.0391 -0.0040 -0.0370 430 GLU A N   
2730 C CA  . GLU A 352 ? 0.2685 0.2986 0.2728 -0.0389 -0.0043 -0.0385 430 GLU A CA  
2731 C C   . GLU A 352 ? 0.2678 0.2934 0.2687 -0.0368 -0.0027 -0.0359 430 GLU A C   
2732 O O   . GLU A 352 ? 0.2411 0.2631 0.2399 -0.0372 -0.0012 -0.0371 430 GLU A O   
2733 C CB  . GLU A 352 ? 0.3544 0.3892 0.3552 -0.0380 -0.0076 -0.0395 430 GLU A CB  
2734 C CG  . GLU A 352 ? 0.4654 0.5050 0.4687 -0.0402 -0.0096 -0.0431 430 GLU A CG  
2735 C CD  . GLU A 352 ? 0.5539 0.5993 0.5550 -0.0386 -0.0132 -0.0430 430 GLU A CD  
2736 O OE1 . GLU A 352 ? 0.6960 0.7466 0.7011 -0.0397 -0.0150 -0.0448 430 GLU A OE1 
2737 O OE2 . GLU A 352 ? 0.5823 0.6269 0.5778 -0.0362 -0.0144 -0.0411 430 GLU A OE2 
2738 N N   . LEU A 353 ? 0.2826 0.3085 0.2832 -0.0346 -0.0028 -0.0324 431 LEU A N   
2739 C CA  . LEU A 353 ? 0.2639 0.2859 0.2619 -0.0328 -0.0012 -0.0300 431 LEU A CA  
2740 C C   . LEU A 353 ? 0.2268 0.2444 0.2274 -0.0336 0.0016  -0.0303 431 LEU A C   
2741 O O   . LEU A 353 ? 0.2468 0.2611 0.2450 -0.0332 0.0030  -0.0306 431 LEU A O   
2742 C CB  . LEU A 353 ? 0.2220 0.2449 0.2200 -0.0305 -0.0017 -0.0264 431 LEU A CB  
2743 C CG  . LEU A 353 ? 0.2544 0.2798 0.2482 -0.0289 -0.0042 -0.0254 431 LEU A CG  
2744 C CD1 . LEU A 353 ? 0.2636 0.2903 0.2588 -0.0269 -0.0047 -0.0223 431 LEU A CD1 
2745 C CD2 . LEU A 353 ? 0.2761 0.2989 0.2639 -0.0281 -0.0039 -0.0252 431 LEU A CD2 
2746 N N   . HIS A 354 ? 0.2373 0.2547 0.2427 -0.0347 0.0024  -0.0302 432 HIS A N   
2747 C CA  . HIS A 354 ? 0.2374 0.2503 0.2454 -0.0354 0.0050  -0.0303 432 HIS A CA  
2748 C C   . HIS A 354 ? 0.2529 0.2634 0.2601 -0.0371 0.0058  -0.0337 432 HIS A C   
2749 O O   . HIS A 354 ? 0.2265 0.2329 0.2330 -0.0365 0.0077  -0.0338 432 HIS A O   
2750 C CB  . HIS A 354 ? 0.2186 0.2317 0.2315 -0.0366 0.0058  -0.0296 432 HIS A CB  
2751 C CG  . HIS A 354 ? 0.2291 0.2436 0.2431 -0.0349 0.0056  -0.0262 432 HIS A CG  
2752 N ND1 . HIS A 354 ? 0.2588 0.2752 0.2768 -0.0359 0.0058  -0.0254 432 HIS A ND1 
2753 C CD2 . HIS A 354 ? 0.2185 0.2328 0.2302 -0.0324 0.0054  -0.0235 432 HIS A CD2 
2754 C CE1 . HIS A 354 ? 0.2328 0.2501 0.2508 -0.0339 0.0057  -0.0224 432 HIS A CE1 
2755 N NE2 . HIS A 354 ? 0.2360 0.2518 0.2502 -0.0318 0.0054  -0.0212 432 HIS A NE2 
2756 N N   . GLN A 355 ? 0.2905 0.3037 0.2977 -0.0390 0.0044  -0.0367 433 GLN A N   
2757 C CA  . GLN A 355 ? 0.2882 0.2993 0.2942 -0.0407 0.0051  -0.0404 433 GLN A CA  
2758 C C   . GLN A 355 ? 0.2910 0.3001 0.2922 -0.0392 0.0057  -0.0407 433 GLN A C   
2759 O O   . GLN A 355 ? 0.2790 0.2845 0.2800 -0.0397 0.0074  -0.0426 433 GLN A O   
2760 C CB  . GLN A 355 ? 0.4012 0.4165 0.4073 -0.0428 0.0029  -0.0436 433 GLN A CB  
2761 C CG  . GLN A 355 ? 0.5154 0.5320 0.5270 -0.0451 0.0031  -0.0445 433 GLN A CG  
2762 C CD  . GLN A 355 ? 0.8151 0.8380 0.8275 -0.0464 0.0003  -0.0465 433 GLN A CD  
2763 O OE1 . GLN A 355 ? 0.8287 0.8542 0.8376 -0.0464 -0.0015 -0.0486 433 GLN A OE1 
2764 N NE2 . GLN A 355 ? 0.8368 0.8626 0.8540 -0.0475 0.0001  -0.0459 433 GLN A NE2 
2765 N N   . GLY A 356 ? 0.2392 0.2505 0.2367 -0.0374 0.0044  -0.0387 434 GLY A N   
2766 C CA  . GLY A 356 ? 0.2559 0.2656 0.2486 -0.0361 0.0051  -0.0387 434 GLY A CA  
2767 C C   . GLY A 356 ? 0.2216 0.2280 0.2150 -0.0343 0.0072  -0.0362 434 GLY A C   
2768 O O   . GLY A 356 ? 0.2225 0.2280 0.2125 -0.0334 0.0080  -0.0360 434 GLY A O   
2769 N N   . GLY A 357 ? 0.2440 0.2491 0.2416 -0.0339 0.0081  -0.0342 435 GLY A N   
2770 C CA  . GLY A 357 ? 0.2723 0.2745 0.2706 -0.0321 0.0099  -0.0320 435 GLY A CA  
2771 C C   . GLY A 357 ? 0.2428 0.2465 0.2400 -0.0302 0.0093  -0.0285 435 GLY A C   
2772 O O   . GLY A 357 ? 0.2747 0.2766 0.2716 -0.0287 0.0106  -0.0270 435 GLY A O   
2773 N N   . ARG A 358 ? 0.2581 0.2651 0.2546 -0.0302 0.0072  -0.0274 436 ARG A N   
2774 C CA  . ARG A 358 ? 0.2298 0.2382 0.2251 -0.0284 0.0064  -0.0242 436 ARG A CA  
2775 C C   . ARG A 358 ? 0.2422 0.2517 0.2414 -0.0282 0.0060  -0.0223 436 ARG A C   
2776 O O   . ARG A 358 ? 0.2283 0.2382 0.2309 -0.0296 0.0061  -0.0235 436 ARG A O   
2777 C CB  . ARG A 358 ? 0.2378 0.2489 0.2287 -0.0282 0.0042  -0.0243 436 ARG A CB  
2778 C CG  . ARG A 358 ? 0.2285 0.2383 0.2147 -0.0283 0.0049  -0.0256 436 ARG A CG  
2779 C CD  . ARG A 358 ? 0.2293 0.2411 0.2103 -0.0279 0.0029  -0.0252 436 ARG A CD  
2780 N NE  . ARG A 358 ? 0.2560 0.2661 0.2322 -0.0281 0.0040  -0.0263 436 ARG A NE  
2781 C CZ  . ARG A 358 ? 0.2167 0.2266 0.1913 -0.0295 0.0044  -0.0294 436 ARG A CZ  
2782 N NH1 . ARG A 358 ? 0.2231 0.2342 0.2003 -0.0309 0.0037  -0.0318 436 ARG A NH1 
2783 N NH2 . ARG A 358 ? 0.2387 0.2474 0.2090 -0.0297 0.0056  -0.0303 436 ARG A NH2 
2784 N N   . ARG A 359 ? 0.2236 0.2337 0.2224 -0.0264 0.0057  -0.0194 437 ARG A N   
2785 C CA  . ARG A 359 ? 0.2184 0.2299 0.2203 -0.0259 0.0053  -0.0174 437 ARG A CA  
2786 C C   . ARG A 359 ? 0.2087 0.2235 0.2087 -0.0250 0.0031  -0.0164 437 ARG A C   
2787 O O   . ARG A 359 ? 0.1863 0.2017 0.1822 -0.0246 0.0019  -0.0167 437 ARG A O   
2788 C CB  . ARG A 359 ? 0.2387 0.2478 0.2417 -0.0244 0.0068  -0.0150 437 ARG A CB  
2789 C CG  . ARG A 359 ? 0.3484 0.3547 0.3549 -0.0251 0.0087  -0.0153 437 ARG A CG  
2790 C CD  . ARG A 359 ? 0.2791 0.2825 0.2848 -0.0255 0.0100  -0.0173 437 ARG A CD  
2791 N NE  . ARG A 359 ? 0.3529 0.3530 0.3616 -0.0258 0.0117  -0.0174 437 ARG A NE  
2792 C CZ  . ARG A 359 ? 0.3749 0.3717 0.3837 -0.0257 0.0132  -0.0188 437 ARG A CZ  
2793 N NH1 . ARG A 359 ? 0.3360 0.3328 0.3422 -0.0255 0.0133  -0.0204 437 ARG A NH1 
2794 N NH2 . ARG A 359 ? 0.3989 0.3924 0.4102 -0.0257 0.0145  -0.0185 437 ARG A NH2 
2795 N N   . TYR A 360 ? 0.2046 0.2215 0.2076 -0.0246 0.0026  -0.0150 438 TYR A N   
2796 C CA  . TYR A 360 ? 0.2016 0.2221 0.2038 -0.0235 0.0004  -0.0141 438 TYR A CA  
2797 C C   . TYR A 360 ? 0.1818 0.2025 0.1856 -0.0219 0.0008  -0.0113 438 TYR A C   
2798 O O   . TYR A 360 ? 0.2209 0.2410 0.2281 -0.0224 0.0022  -0.0107 438 TYR A O   
2799 C CB  . TYR A 360 ? 0.1891 0.2135 0.1939 -0.0251 -0.0009 -0.0162 438 TYR A CB  
2800 C CG  . TYR A 360 ? 0.2115 0.2397 0.2155 -0.0236 -0.0032 -0.0154 438 TYR A CG  
2801 C CD1 . TYR A 360 ? 0.1865 0.2154 0.1858 -0.0225 -0.0052 -0.0155 438 TYR A CD1 
2802 C CD2 . TYR A 360 ? 0.2107 0.2418 0.2185 -0.0231 -0.0034 -0.0143 438 TYR A CD2 
2803 C CE1 . TYR A 360 ? 0.1944 0.2265 0.1928 -0.0208 -0.0075 -0.0146 438 TYR A CE1 
2804 C CE2 . TYR A 360 ? 0.2188 0.2535 0.2260 -0.0214 -0.0056 -0.0136 438 TYR A CE2 
2805 C CZ  . TYR A 360 ? 0.2094 0.2444 0.2119 -0.0201 -0.0077 -0.0137 438 TYR A CZ  
2806 O OH  . TYR A 360 ? 0.2018 0.2400 0.2038 -0.0181 -0.0100 -0.0129 438 TYR A OH  
2807 N N   . MET A 361 ? 0.1880 0.2094 0.1889 -0.0201 -0.0005 -0.0098 439 MET A N   
2808 C CA  . MET A 361 ? 0.2149 0.2367 0.2167 -0.0183 -0.0004 -0.0074 439 MET A CA  
2809 C C   . MET A 361 ? 0.2387 0.2639 0.2396 -0.0170 -0.0028 -0.0070 439 MET A C   
2810 O O   . MET A 361 ? 0.1984 0.2243 0.1960 -0.0168 -0.0045 -0.0079 439 MET A O   
2811 C CB  . MET A 361 ? 0.2214 0.2399 0.2201 -0.0170 0.0003  -0.0057 439 MET A CB  
2812 C CG  . MET A 361 ? 0.2543 0.2697 0.2542 -0.0176 0.0026  -0.0056 439 MET A CG  
2813 S SD  . MET A 361 ? 0.3460 0.3613 0.3498 -0.0170 0.0038  -0.0039 439 MET A SD  
2814 C CE  . MET A 361 ? 0.2335 0.2484 0.2349 -0.0147 0.0033  -0.0015 439 MET A CE  
2815 N N   . MET A 362 ? 0.2097 0.2369 0.2132 -0.0160 -0.0029 -0.0058 440 MET A N   
2816 C CA  . MET A 362 ? 0.2155 0.2457 0.2181 -0.0142 -0.0052 -0.0053 440 MET A CA  
2817 C C   . MET A 362 ? 0.2070 0.2372 0.2105 -0.0124 -0.0048 -0.0032 440 MET A C   
2818 O O   . MET A 362 ? 0.2001 0.2290 0.2058 -0.0127 -0.0029 -0.0023 440 MET A O   
2819 C CB  . MET A 362 ? 0.1952 0.2304 0.2012 -0.0151 -0.0066 -0.0073 440 MET A CB  
2820 C CG  . MET A 362 ? 0.2349 0.2729 0.2463 -0.0159 -0.0054 -0.0073 440 MET A CG  
2821 S SD  . MET A 362 ? 0.2587 0.2937 0.2728 -0.0185 -0.0023 -0.0076 440 MET A SD  
2822 C CE  . MET A 362 ? 0.2586 0.2962 0.2776 -0.0185 -0.0010 -0.0066 440 MET A CE  
2823 N N   . ILE A 363 ? 0.1947 0.2262 0.1962 -0.0103 -0.0068 -0.0025 441 ILE A N   
2824 C CA  . ILE A 363 ? 0.1995 0.2309 0.2013 -0.0083 -0.0067 -0.0007 441 ILE A CA  
2825 C C   . ILE A 363 ? 0.1876 0.2233 0.1947 -0.0084 -0.0062 -0.0010 441 ILE A C   
2826 O O   . ILE A 363 ? 0.2099 0.2497 0.2198 -0.0092 -0.0071 -0.0027 441 ILE A O   
2827 C CB  . ILE A 363 ? 0.1768 0.2078 0.1747 -0.0059 -0.0089 0.0000  441 ILE A CB  
2828 C CG1 . ILE A 363 ? 0.1869 0.2158 0.1840 -0.0041 -0.0083 0.0019  441 ILE A CG1 
2829 C CG2 . ILE A 363 ? 0.1837 0.2196 0.1832 -0.0049 -0.0112 -0.0011 441 ILE A CG2 
2830 C CD1 . ILE A 363 ? 0.2064 0.2330 0.1987 -0.0019 -0.0100 0.0030  441 ILE A CD1 
2831 N N   . VAL A 364 ? 0.1772 0.2118 0.1854 -0.0078 -0.0047 0.0003  442 VAL A N   
2832 C CA  . VAL A 364 ? 0.1688 0.2071 0.1812 -0.0075 -0.0041 0.0004  442 VAL A CA  
2833 C C   . VAL A 364 ? 0.1871 0.2245 0.1980 -0.0050 -0.0043 0.0021  442 VAL A C   
2834 O O   . VAL A 364 ? 0.2038 0.2371 0.2121 -0.0045 -0.0034 0.0034  442 VAL A O   
2835 C CB  . VAL A 364 ? 0.2164 0.2540 0.2318 -0.0096 -0.0016 0.0005  442 VAL A CB  
2836 C CG1 . VAL A 364 ? 0.1999 0.2411 0.2192 -0.0095 -0.0006 0.0007  442 VAL A CG1 
2837 C CG2 . VAL A 364 ? 0.1801 0.2176 0.1966 -0.0121 -0.0013 -0.0011 442 VAL A CG2 
2838 N N   . ASP A 365 ? 0.1646 0.2059 0.1772 -0.0033 -0.0056 0.0018  443 ASP A N   
2839 C CA  . ASP A 365 ? 0.1826 0.2235 0.1942 -0.0008 -0.0057 0.0030  443 ASP A CA  
2840 C C   . ASP A 365 ? 0.1793 0.2227 0.1949 -0.0014 -0.0037 0.0033  443 ASP A C   
2841 O O   . ASP A 365 ? 0.2155 0.2618 0.2346 -0.0033 -0.0028 0.0023  443 ASP A O   
2842 C CB  . ASP A 365 ? 0.2050 0.2488 0.2162 0.0015  -0.0083 0.0025  443 ASP A CB  
2843 C CG  . ASP A 365 ? 0.2139 0.2544 0.2200 0.0025  -0.0103 0.0027  443 ASP A CG  
2844 O OD1 . ASP A 365 ? 0.2263 0.2617 0.2287 0.0019  -0.0096 0.0037  443 ASP A OD1 
2845 O OD2 . ASP A 365 ? 0.2628 0.3057 0.2685 0.0040  -0.0126 0.0019  443 ASP A OD2 
2846 N N   . PRO A 366 ? 0.1718 0.2138 0.1865 0.0001  -0.0029 0.0046  444 PRO A N   
2847 C CA  . PRO A 366 ? 0.1754 0.2198 0.1933 -0.0003 -0.0009 0.0049  444 PRO A CA  
2848 C C   . PRO A 366 ? 0.1782 0.2286 0.1998 0.0006  -0.0014 0.0038  444 PRO A C   
2849 O O   . PRO A 366 ? 0.1802 0.2340 0.2056 -0.0008 0.0001  0.0034  444 PRO A O   
2850 C CB  . PRO A 366 ? 0.1946 0.2353 0.2098 0.0009  -0.0001 0.0064  444 PRO A CB  
2851 C CG  . PRO A 366 ? 0.2084 0.2470 0.2201 0.0031  -0.0021 0.0066  444 PRO A CG  
2852 C CD  . PRO A 366 ? 0.1897 0.2280 0.2003 0.0022  -0.0036 0.0057  444 PRO A CD  
2853 N N   . ALA A 367 ? 0.1701 0.2219 0.1907 0.0031  -0.0036 0.0034  445 ALA A N   
2854 C CA  . ALA A 367 ? 0.2076 0.2650 0.2315 0.0048  -0.0042 0.0024  445 ALA A CA  
2855 C C   . ALA A 367 ? 0.1736 0.2364 0.2014 0.0035  -0.0051 0.0005  445 ALA A C   
2856 O O   . ALA A 367 ? 0.1614 0.2233 0.1881 0.0025  -0.0064 0.0000  445 ALA A O   
2857 C CB  . ALA A 367 ? 0.2384 0.2944 0.2593 0.0083  -0.0064 0.0027  445 ALA A CB  
2858 N N   . ILE A 368 ? 0.1755 0.2443 0.2081 0.0034  -0.0042 -0.0004 446 ILE A N   
2859 C CA  . ILE A 368 ? 0.1671 0.2418 0.2045 0.0013  -0.0044 -0.0025 446 ILE A CA  
2860 C C   . ILE A 368 ? 0.1676 0.2488 0.2080 0.0039  -0.0065 -0.0040 446 ILE A C   
2861 O O   . ILE A 368 ? 0.1749 0.2585 0.2167 0.0059  -0.0058 -0.0039 446 ILE A O   
2862 C CB  . ILE A 368 ? 0.1817 0.2582 0.2228 -0.0016 -0.0011 -0.0025 446 ILE A CB  
2863 C CG1 . ILE A 368 ? 0.1576 0.2273 0.1956 -0.0037 0.0007  -0.0008 446 ILE A CG1 
2864 C CG2 . ILE A 368 ? 0.1701 0.2528 0.2166 -0.0041 -0.0009 -0.0047 446 ILE A CG2 
2865 C CD1 . ILE A 368 ? 0.1809 0.2478 0.2175 -0.0057 0.0000  -0.0013 446 ILE A CD1 
2866 N N   . SER A 369 ? 0.1538 0.2380 0.1951 0.0041  -0.0090 -0.0056 447 SER A N   
2867 C CA  . SER A 369 ? 0.1600 0.2506 0.2041 0.0068  -0.0114 -0.0073 447 SER A CA  
2868 C C   . SER A 369 ? 0.1570 0.2547 0.2073 0.0063  -0.0095 -0.0086 447 SER A C   
2869 O O   . SER A 369 ? 0.1507 0.2514 0.2050 0.0028  -0.0075 -0.0096 447 SER A O   
2870 C CB  . SER A 369 ? 0.1700 0.2638 0.2150 0.0062  -0.0140 -0.0091 447 SER A CB  
2871 O OG  . SER A 369 ? 0.1991 0.2997 0.2473 0.0090  -0.0165 -0.0108 447 SER A OG  
2872 N N   . SER A 370 ? 0.1611 0.2613 0.2122 0.0097  -0.0101 -0.0086 448 SER A N   
2873 C CA  . SER A 370 ? 0.1925 0.2992 0.2489 0.0097  -0.0082 -0.0098 448 SER A CA  
2874 C C   . SER A 370 ? 0.2475 0.3633 0.3091 0.0119  -0.0105 -0.0124 448 SER A C   
2875 O O   . SER A 370 ? 0.2004 0.3225 0.2670 0.0121  -0.0090 -0.0137 448 SER A O   
2876 C CB  . SER A 370 ? 0.2052 0.3083 0.2588 0.0121  -0.0069 -0.0081 448 SER A CB  
2877 O OG  . SER A 370 ? 0.2090 0.3096 0.2590 0.0164  -0.0098 -0.0077 448 SER A OG  
2878 N N   . SER A 371 ? 0.1847 0.3012 0.2451 0.0135  -0.0140 -0.0132 449 SER A N   
2879 C CA  . SER A 371 ? 0.2846 0.4086 0.3486 0.0167  -0.0169 -0.0154 449 SER A CA  
2880 C C   . SER A 371 ? 0.2553 0.3872 0.3250 0.0143  -0.0179 -0.0182 449 SER A C   
2881 O O   . SER A 371 ? 0.2220 0.3612 0.2955 0.0167  -0.0202 -0.0203 449 SER A O   
2882 C CB  . SER A 371 ? 0.2990 0.4182 0.3572 0.0210  -0.0207 -0.0144 449 SER A CB  
2883 O OG  . SER A 371 ? 0.3768 0.4916 0.4310 0.0192  -0.0222 -0.0138 449 SER A OG  
2884 N N   . GLY A 372 ? 0.2739 0.4044 0.3442 0.0096  -0.0161 -0.0183 450 GLY A N   
2885 C CA  . GLY A 372 ? 0.2771 0.4145 0.3524 0.0070  -0.0171 -0.0211 450 GLY A CA  
2886 C C   . GLY A 372 ? 0.3330 0.4799 0.4164 0.0057  -0.0153 -0.0235 450 GLY A C   
2887 O O   . GLY A 372 ? 0.2910 0.4378 0.3755 0.0057  -0.0123 -0.0225 450 GLY A O   
2888 N N   . PRO A 373 ? 0.3093 0.4650 0.3985 0.0046  -0.0169 -0.0266 451 PRO A N   
2889 C CA  . PRO A 373 ? 0.3164 0.4812 0.4137 0.0023  -0.0144 -0.0290 451 PRO A CA  
2890 C C   . PRO A 373 ? 0.2658 0.4268 0.3636 -0.0028 -0.0096 -0.0278 451 PRO A C   
2891 O O   . PRO A 373 ? 0.2547 0.4085 0.3485 -0.0056 -0.0088 -0.0264 451 PRO A O   
2892 C CB  . PRO A 373 ? 0.3259 0.4992 0.4285 0.0009  -0.0170 -0.0325 451 PRO A CB  
2893 C CG  . PRO A 373 ? 0.3774 0.5479 0.4748 0.0048  -0.0218 -0.0322 451 PRO A CG  
2894 C CD  . PRO A 373 ? 0.3412 0.4994 0.4299 0.0055  -0.0211 -0.0284 451 PRO A CD  
2895 N N   . ALA A 374 ? 0.2172 0.3826 0.3193 -0.0037 -0.0064 -0.0281 452 ALA A N   
2896 C CA  . ALA A 374 ? 0.2115 0.3740 0.3143 -0.0084 -0.0017 -0.0271 452 ALA A CA  
2897 C C   . ALA A 374 ? 0.2042 0.3679 0.3098 -0.0135 -0.0011 -0.0288 452 ALA A C   
2898 O O   . ALA A 374 ? 0.2147 0.3865 0.3256 -0.0141 -0.0032 -0.0320 452 ALA A O   
2899 C CB  . ALA A 374 ? 0.2525 0.4222 0.3610 -0.0088 0.0013  -0.0281 452 ALA A CB  
2900 N N   . GLY A 375 ? 0.2299 0.3856 0.3321 -0.0170 0.0014  -0.0268 453 GLY A N   
2901 C CA  . GLY A 375 ? 0.2241 0.3798 0.3286 -0.0221 0.0023  -0.0283 453 GLY A CA  
2902 C C   . GLY A 375 ? 0.2323 0.3846 0.3334 -0.0217 -0.0011 -0.0289 453 GLY A C   
2903 O O   . GLY A 375 ? 0.2190 0.3700 0.3211 -0.0258 -0.0003 -0.0301 453 GLY A O   
2904 N N   . SER A 376 ? 0.2460 0.3962 0.3426 -0.0170 -0.0047 -0.0280 454 SER A N   
2905 C CA  . SER A 376 ? 0.2309 0.3786 0.3240 -0.0164 -0.0083 -0.0287 454 SER A CA  
2906 C C   . SER A 376 ? 0.1966 0.3328 0.2816 -0.0159 -0.0080 -0.0256 454 SER A C   
2907 O O   . SER A 376 ? 0.1931 0.3263 0.2748 -0.0158 -0.0103 -0.0259 454 SER A O   
2908 C CB  . SER A 376 ? 0.2652 0.4182 0.3584 -0.0114 -0.0128 -0.0299 454 SER A CB  
2909 O OG  . SER A 376 ? 0.2452 0.3935 0.3333 -0.0068 -0.0136 -0.0272 454 SER A OG  
2910 N N   . TYR A 377 ? 0.1920 0.3221 0.2740 -0.0156 -0.0052 -0.0227 455 TYR A N   
2911 C CA  . TYR A 377 ? 0.1778 0.2976 0.2524 -0.0149 -0.0051 -0.0198 455 TYR A CA  
2912 C C   . TYR A 377 ? 0.1482 0.2624 0.2216 -0.0171 -0.0010 -0.0175 455 TYR A C   
2913 O O   . TYR A 377 ? 0.1654 0.2782 0.2375 -0.0151 0.0003  -0.0156 455 TYR A O   
2914 C CB  . TYR A 377 ? 0.1859 0.3033 0.2557 -0.0098 -0.0080 -0.0183 455 TYR A CB  
2915 C CG  . TYR A 377 ? 0.1785 0.2859 0.2410 -0.0090 -0.0078 -0.0156 455 TYR A CG  
2916 C CD1 . TYR A 377 ? 0.1838 0.2868 0.2434 -0.0111 -0.0085 -0.0158 455 TYR A CD1 
2917 C CD2 . TYR A 377 ? 0.1567 0.2594 0.2154 -0.0064 -0.0070 -0.0130 455 TYR A CD2 
2918 C CE1 . TYR A 377 ? 0.1955 0.2900 0.2489 -0.0105 -0.0081 -0.0135 455 TYR A CE1 
2919 C CE2 . TYR A 377 ? 0.1691 0.2633 0.2216 -0.0059 -0.0069 -0.0107 455 TYR A CE2 
2920 C CZ  . TYR A 377 ? 0.1819 0.2722 0.2320 -0.0080 -0.0074 -0.0109 455 TYR A CZ  
2921 O OH  . TYR A 377 ? 0.1943 0.2766 0.2385 -0.0075 -0.0071 -0.0089 455 TYR A OH  
2922 N N   . ARG A 378 ? 0.1619 0.2730 0.2358 -0.0212 0.0008  -0.0178 456 ARG A N   
2923 C CA  . ARG A 378 ? 0.1689 0.2758 0.2427 -0.0240 0.0048  -0.0161 456 ARG A CA  
2924 C C   . ARG A 378 ? 0.1564 0.2558 0.2246 -0.0218 0.0060  -0.0127 456 ARG A C   
2925 O O   . ARG A 378 ? 0.1780 0.2770 0.2468 -0.0222 0.0088  -0.0113 456 ARG A O   
2926 C CB  . ARG A 378 ? 0.1714 0.2753 0.2460 -0.0285 0.0062  -0.0171 456 ARG A CB  
2927 C CG  . ARG A 378 ? 0.2260 0.3236 0.2994 -0.0313 0.0103  -0.0150 456 ARG A CG  
2928 C CD  . ARG A 378 ? 0.2521 0.3476 0.3273 -0.0359 0.0118  -0.0165 456 ARG A CD  
2929 N NE  . ARG A 378 ? 0.2857 0.3735 0.3583 -0.0378 0.0151  -0.0140 456 ARG A NE  
2930 C CZ  . ARG A 378 ? 0.3556 0.4434 0.4301 -0.0399 0.0186  -0.0129 456 ARG A CZ  
2931 N NH1 . ARG A 378 ? 0.3155 0.4111 0.3949 -0.0405 0.0195  -0.0142 456 ARG A NH1 
2932 N NH2 . ARG A 378 ? 0.3631 0.4430 0.4343 -0.0412 0.0213  -0.0104 456 ARG A NH2 
2933 N N   . PRO A 379 ? 0.1706 0.2643 0.2333 -0.0195 0.0039  -0.0114 457 PRO A N   
2934 C CA  . PRO A 379 ? 0.1672 0.2543 0.2249 -0.0174 0.0050  -0.0084 457 PRO A CA  
2935 C C   . PRO A 379 ? 0.2052 0.2952 0.2634 -0.0146 0.0054  -0.0075 457 PRO A C   
2936 O O   . PRO A 379 ? 0.1806 0.2674 0.2373 -0.0146 0.0079  -0.0055 457 PRO A O   
2937 C CB  . PRO A 379 ? 0.1872 0.2699 0.2398 -0.0152 0.0021  -0.0079 457 PRO A CB  
2938 C CG  . PRO A 379 ? 0.1712 0.2557 0.2254 -0.0174 0.0007  -0.0102 457 PRO A CG  
2939 C CD  . PRO A 379 ? 0.1688 0.2619 0.2295 -0.0188 0.0008  -0.0127 457 PRO A CD  
2940 N N   . TYR A 380 ? 0.1836 0.2797 0.2440 -0.0122 0.0031  -0.0090 458 TYR A N   
2941 C CA  . TYR A 380 ? 0.1867 0.2864 0.2484 -0.0096 0.0036  -0.0087 458 TYR A CA  
2942 C C   . TYR A 380 ? 0.1685 0.2736 0.2355 -0.0121 0.0066  -0.0096 458 TYR A C   
2943 O O   . TYR A 380 ? 0.1896 0.2937 0.2558 -0.0115 0.0089  -0.0081 458 TYR A O   
2944 C CB  . TYR A 380 ? 0.1827 0.2875 0.2455 -0.0060 0.0001  -0.0103 458 TYR A CB  
2945 C CG  . TYR A 380 ? 0.1751 0.2832 0.2389 -0.0029 0.0005  -0.0100 458 TYR A CG  
2946 C CD1 . TYR A 380 ? 0.1937 0.2961 0.2528 -0.0006 0.0011  -0.0077 458 TYR A CD1 
2947 C CD2 . TYR A 380 ? 0.1946 0.3116 0.2643 -0.0023 0.0002  -0.0123 458 TYR A CD2 
2948 C CE1 . TYR A 380 ? 0.1959 0.3012 0.2559 0.0022  0.0014  -0.0077 458 TYR A CE1 
2949 C CE2 . TYR A 380 ? 0.2144 0.3345 0.2852 0.0006  0.0007  -0.0123 458 TYR A CE2 
2950 C CZ  . TYR A 380 ? 0.2240 0.3381 0.2897 0.0029  0.0013  -0.0100 458 TYR A CZ  
2951 O OH  . TYR A 380 ? 0.2952 0.4124 0.3620 0.0059  0.0017  -0.0103 458 TYR A OH  
2952 N N   . ASP A 381 ? 0.1719 0.2828 0.2441 -0.0148 0.0066  -0.0121 459 ASP A N   
2953 C CA  . ASP A 381 ? 0.2078 0.3251 0.2858 -0.0174 0.0095  -0.0133 459 ASP A CA  
2954 C C   . ASP A 381 ? 0.2014 0.3132 0.2776 -0.0203 0.0136  -0.0111 459 ASP A C   
2955 O O   . ASP A 381 ? 0.1611 0.2748 0.2386 -0.0206 0.0163  -0.0104 459 ASP A O   
2956 C CB  . ASP A 381 ? 0.1908 0.3145 0.2746 -0.0205 0.0089  -0.0164 459 ASP A CB  
2957 C CG  . ASP A 381 ? 0.2260 0.3557 0.3117 -0.0176 0.0047  -0.0188 459 ASP A CG  
2958 O OD1 . ASP A 381 ? 0.2216 0.3532 0.3062 -0.0133 0.0028  -0.0185 459 ASP A OD1 
2959 O OD2 . ASP A 381 ? 0.2009 0.3330 0.2887 -0.0197 0.0031  -0.0210 459 ASP A OD2 
2960 N N   . GLU A 382 ? 0.1930 0.2977 0.2659 -0.0223 0.0139  -0.0100 460 GLU A N   
2961 C CA  . GLU A 382 ? 0.2107 0.3089 0.2810 -0.0246 0.0173  -0.0076 460 GLU A CA  
2962 C C   . GLU A 382 ? 0.1889 0.2821 0.2541 -0.0216 0.0178  -0.0047 460 GLU A C   
2963 O O   . GLU A 382 ? 0.1796 0.2709 0.2439 -0.0226 0.0209  -0.0030 460 GLU A O   
2964 C CB  . GLU A 382 ? 0.2604 0.3526 0.3288 -0.0272 0.0171  -0.0075 460 GLU A CB  
2965 C CG  . GLU A 382 ? 0.3583 0.4441 0.4247 -0.0299 0.0205  -0.0054 460 GLU A CG  
2966 C CD  . GLU A 382 ? 0.3161 0.4051 0.3870 -0.0341 0.0239  -0.0062 460 GLU A CD  
2967 O OE1 . GLU A 382 ? 0.2324 0.3298 0.3089 -0.0352 0.0242  -0.0085 460 GLU A OE1 
2968 O OE2 . GLU A 382 ? 0.3451 0.4277 0.4138 -0.0364 0.0263  -0.0045 460 GLU A OE2 
2969 N N   . GLY A 383 ? 0.1796 0.2705 0.2412 -0.0179 0.0149  -0.0042 461 GLY A N   
2970 C CA  . GLY A 383 ? 0.1804 0.2672 0.2374 -0.0149 0.0151  -0.0019 461 GLY A CA  
2971 C C   . GLY A 383 ? 0.1724 0.2641 0.2313 -0.0135 0.0166  -0.0019 461 GLY A C   
2972 O O   . GLY A 383 ? 0.1342 0.2227 0.1902 -0.0129 0.0187  0.0000  461 GLY A O   
2973 N N   . LEU A 384 ? 0.1656 0.2651 0.2292 -0.0128 0.0155  -0.0043 462 LEU A N   
2974 C CA  . LEU A 384 ? 0.1986 0.3042 0.2651 -0.0114 0.0169  -0.0050 462 LEU A CA  
2975 C C   . LEU A 384 ? 0.2036 0.3099 0.2719 -0.0150 0.0212  -0.0044 462 LEU A C   
2976 O O   . LEU A 384 ? 0.2111 0.3164 0.2775 -0.0142 0.0233  -0.0029 462 LEU A O   
2977 C CB  . LEU A 384 ? 0.2526 0.3669 0.3246 -0.0104 0.0147  -0.0081 462 LEU A CB  
2978 C CG  . LEU A 384 ? 0.3442 0.4639 0.4177 -0.0064 0.0137  -0.0091 462 LEU A CG  
2979 C CD1 . LEU A 384 ? 0.3130 0.4267 0.3806 -0.0023 0.0116  -0.0074 462 LEU A CD1 
2980 C CD2 . LEU A 384 ? 0.2514 0.3795 0.3305 -0.0056 0.0112  -0.0122 462 LEU A CD2 
2981 N N   . ARG A 385 ? 0.1701 0.2779 0.2418 -0.0191 0.0224  -0.0054 463 ARG A N   
2982 C CA  . ARG A 385 ? 0.1921 0.3003 0.2657 -0.0230 0.0265  -0.0049 463 ARG A CA  
2983 C C   . ARG A 385 ? 0.1916 0.2916 0.2593 -0.0232 0.0288  -0.0015 463 ARG A C   
2984 O O   . ARG A 385 ? 0.2271 0.3279 0.2947 -0.0241 0.0319  -0.0005 463 ARG A O   
2985 C CB  . ARG A 385 ? 0.1901 0.2990 0.2671 -0.0274 0.0270  -0.0064 463 ARG A CB  
2986 C CG  . ARG A 385 ? 0.2214 0.3307 0.3006 -0.0319 0.0314  -0.0060 463 ARG A CG  
2987 C CD  . ARG A 385 ? 0.2208 0.3301 0.3033 -0.0364 0.0320  -0.0076 463 ARG A CD  
2988 N NE  . ARG A 385 ? 0.2485 0.3486 0.3265 -0.0374 0.0316  -0.0059 463 ARG A NE  
2989 C CZ  . ARG A 385 ? 0.2653 0.3575 0.3392 -0.0390 0.0343  -0.0031 463 ARG A CZ  
2990 N NH1 . ARG A 385 ? 0.2211 0.3126 0.2939 -0.0398 0.0378  -0.0012 463 ARG A NH1 
2991 N NH2 . ARG A 385 ? 0.2093 0.2939 0.2797 -0.0395 0.0335  -0.0020 463 ARG A NH2 
2992 N N   . ARG A 386 ? 0.1789 0.2714 0.2418 -0.0222 0.0271  0.0000  464 ARG A N   
2993 C CA  . ARG A 386 ? 0.1716 0.2560 0.2291 -0.0226 0.0288  0.0030  464 ARG A CA  
2994 C C   . ARG A 386 ? 0.1892 0.2712 0.2422 -0.0186 0.0280  0.0046  464 ARG A C   
2995 O O   . ARG A 386 ? 0.2440 0.3200 0.2925 -0.0184 0.0293  0.0071  464 ARG A O   
2996 C CB  . ARG A 386 ? 0.1753 0.2533 0.2307 -0.0239 0.0277  0.0036  464 ARG A CB  
2997 C CG  . ARG A 386 ? 0.2089 0.2883 0.2684 -0.0282 0.0290  0.0021  464 ARG A CG  
2998 C CD  . ARG A 386 ? 0.2285 0.3009 0.2854 -0.0295 0.0282  0.0026  464 ARG A CD  
2999 N NE  . ARG A 386 ? 0.2878 0.3525 0.3406 -0.0305 0.0305  0.0054  464 ARG A NE  
3000 C CZ  . ARG A 386 ? 0.3158 0.3737 0.3660 -0.0313 0.0302  0.0062  464 ARG A CZ  
3001 N NH1 . ARG A 386 ? 0.3488 0.4066 0.4000 -0.0314 0.0278  0.0044  464 ARG A NH1 
3002 N NH2 . ARG A 386 ? 0.3774 0.4286 0.4238 -0.0318 0.0323  0.0088  464 ARG A NH2 
3003 N N   . GLY A 387 ? 0.1668 0.2534 0.2210 -0.0154 0.0258  0.0032  465 GLY A N   
3004 C CA  . GLY A 387 ? 0.1997 0.2843 0.2498 -0.0117 0.0250  0.0044  465 GLY A CA  
3005 C C   . GLY A 387 ? 0.1850 0.2622 0.2299 -0.0100 0.0229  0.0060  465 GLY A C   
3006 O O   . GLY A 387 ? 0.2281 0.3011 0.2687 -0.0086 0.0236  0.0079  465 GLY A O   
3007 N N   . VAL A 388 ? 0.1786 0.2545 0.2238 -0.0100 0.0204  0.0051  466 VAL A N   
3008 C CA  . VAL A 388 ? 0.1779 0.2470 0.2185 -0.0090 0.0188  0.0065  466 VAL A CA  
3009 C C   . VAL A 388 ? 0.1752 0.2433 0.2131 -0.0053 0.0161  0.0064  466 VAL A C   
3010 O O   . VAL A 388 ? 0.1683 0.2309 0.2023 -0.0043 0.0149  0.0075  466 VAL A O   
3011 C CB  . VAL A 388 ? 0.1845 0.2516 0.2260 -0.0111 0.0177  0.0057  466 VAL A CB  
3012 C CG1 . VAL A 388 ? 0.2032 0.2708 0.2475 -0.0150 0.0203  0.0056  466 VAL A CG1 
3013 C CG2 . VAL A 388 ? 0.1748 0.2462 0.2187 -0.0100 0.0148  0.0035  466 VAL A CG2 
3014 N N   . PHE A 389 ? 0.1609 0.2341 0.2008 -0.0031 0.0152  0.0050  467 PHE A N   
3015 C CA  . PHE A 389 ? 0.1685 0.2407 0.2062 0.0002  0.0125  0.0047  467 PHE A CA  
3016 C C   . PHE A 389 ? 0.2021 0.2726 0.2367 0.0026  0.0130  0.0057  467 PHE A C   
3017 O O   . PHE A 389 ? 0.2023 0.2753 0.2379 0.0024  0.0153  0.0059  467 PHE A O   
3018 C CB  . PHE A 389 ? 0.1691 0.2475 0.2106 0.0016  0.0105  0.0025  467 PHE A CB  
3019 C CG  . PHE A 389 ? 0.1532 0.2335 0.1974 -0.0003 0.0094  0.0012  467 PHE A CG  
3020 C CD1 . PHE A 389 ? 0.1656 0.2412 0.2070 -0.0007 0.0076  0.0016  467 PHE A CD1 
3021 C CD2 . PHE A 389 ? 0.1730 0.2602 0.2227 -0.0020 0.0102  -0.0006 467 PHE A CD2 
3022 C CE1 . PHE A 389 ? 0.1807 0.2582 0.2244 -0.0027 0.0066  0.0002  467 PHE A CE1 
3023 C CE2 . PHE A 389 ? 0.1709 0.2601 0.2232 -0.0040 0.0090  -0.0020 467 PHE A CE2 
3024 C CZ  . PHE A 389 ? 0.1581 0.2424 0.2073 -0.0043 0.0072  -0.0016 467 PHE A CZ  
3025 N N   . ILE A 390 ? 0.2071 0.2737 0.2381 0.0050  0.0109  0.0061  468 ILE A N   
3026 C CA  . ILE A 390 ? 0.1993 0.2644 0.2274 0.0077  0.0109  0.0065  468 ILE A CA  
3027 C C   . ILE A 390 ? 0.2119 0.2830 0.2431 0.0097  0.0108  0.0049  468 ILE A C   
3028 O O   . ILE A 390 ? 0.1694 0.2442 0.2034 0.0105  0.0091  0.0034  468 ILE A O   
3029 C CB  . ILE A 390 ? 0.2051 0.2649 0.2291 0.0095  0.0086  0.0070  468 ILE A CB  
3030 C CG1 . ILE A 390 ? 0.1968 0.2512 0.2181 0.0075  0.0090  0.0085  468 ILE A CG1 
3031 C CG2 . ILE A 390 ? 0.2138 0.2726 0.2354 0.0124  0.0082  0.0069  468 ILE A CG2 
3032 C CD1 . ILE A 390 ? 0.1588 0.2080 0.1763 0.0087  0.0070  0.0090  468 ILE A CD1 
3033 N N   . THR A 391 ? 0.1734 0.2460 0.2042 0.0105  0.0127  0.0051  469 THR A N   
3034 C CA  . THR A 391 ? 0.1870 0.2657 0.2210 0.0123  0.0131  0.0034  469 THR A CA  
3035 C C   . THR A 391 ? 0.2003 0.2772 0.2313 0.0159  0.0122  0.0031  469 THR A C   
3036 O O   . THR A 391 ? 0.2132 0.2843 0.2396 0.0164  0.0119  0.0043  469 THR A O   
3037 C CB  . THR A 391 ? 0.1827 0.2658 0.2194 0.0102  0.0165  0.0034  469 THR A CB  
3038 O OG1 . THR A 391 ? 0.1871 0.2658 0.2197 0.0095  0.0184  0.0052  469 THR A OG1 
3039 C CG2 . THR A 391 ? 0.1619 0.2475 0.2024 0.0067  0.0174  0.0031  469 THR A CG2 
3040 N N   . ASN A 392 ? 0.1960 0.2781 0.2299 0.0182  0.0118  0.0013  470 ASN A N   
3041 C CA  . ASN A 392 ? 0.2101 0.2907 0.2416 0.0219  0.0107  0.0006  470 ASN A CA  
3042 C C   . ASN A 392 ? 0.2415 0.3259 0.2739 0.0225  0.0134  0.0000  470 ASN A C   
3043 O O   . ASN A 392 ? 0.2189 0.3058 0.2526 0.0199  0.0161  0.0005  470 ASN A O   
3044 C CB  . ASN A 392 ? 0.2214 0.3040 0.2548 0.0248  0.0078  -0.0009 470 ASN A CB  
3045 C CG  . ASN A 392 ? 0.2517 0.3431 0.2912 0.0253  0.0083  -0.0029 470 ASN A CG  
3046 O OD1 . ASN A 392 ? 0.2130 0.3093 0.2555 0.0236  0.0111  -0.0034 470 ASN A OD1 
3047 N ND2 . ASN A 392 ? 0.2882 0.3816 0.3296 0.0276  0.0055  -0.0042 470 ASN A ND2 
3048 N N   . GLU A 393 ? 0.2591 0.3436 0.2903 0.0259  0.0127  -0.0011 471 GLU A N   
3049 C CA  . GLU A 393 ? 0.3429 0.4300 0.3739 0.0270  0.0150  -0.0018 471 GLU A CA  
3050 C C   . GLU A 393 ? 0.3378 0.4331 0.3740 0.0256  0.0176  -0.0030 471 GLU A C   
3051 O O   . GLU A 393 ? 0.3727 0.4695 0.4082 0.0244  0.0205  -0.0026 471 GLU A O   
3052 C CB  . GLU A 393 ? 0.5018 0.5882 0.5317 0.0313  0.0133  -0.0034 471 GLU A CB  
3053 C CG  . GLU A 393 ? 0.6730 0.7592 0.7004 0.0328  0.0150  -0.0040 471 GLU A CG  
3054 C CD  . GLU A 393 ? 0.7721 0.8548 0.7971 0.0368  0.0128  -0.0052 471 GLU A CD  
3055 O OE1 . GLU A 393 ? 0.6878 0.7719 0.7152 0.0392  0.0106  -0.0064 471 GLU A OE1 
3056 O OE2 . GLU A 393 ? 0.6782 0.7566 0.6989 0.0375  0.0132  -0.0050 471 GLU A OE2 
3057 N N   . THR A 394 ? 0.2511 0.3517 0.2924 0.0258  0.0165  -0.0044 472 THR A N   
3058 C CA  . THR A 394 ? 0.3013 0.4104 0.3483 0.0244  0.0189  -0.0058 472 THR A CA  
3059 C C   . THR A 394 ? 0.2751 0.3853 0.3242 0.0197  0.0206  -0.0047 472 THR A C   
3060 O O   . THR A 394 ? 0.3587 0.4758 0.4130 0.0180  0.0223  -0.0060 472 THR A O   
3061 C CB  . THR A 394 ? 0.3551 0.4707 0.4073 0.0273  0.0169  -0.0085 472 THR A CB  
3062 O OG1 . THR A 394 ? 0.4287 0.5417 0.4808 0.0277  0.0135  -0.0082 472 THR A OG1 
3063 C CG2 . THR A 394 ? 0.3491 0.4642 0.3995 0.0320  0.0160  -0.0098 472 THR A CG2 
3064 N N   . GLY A 395 ? 0.2528 0.3560 0.2979 0.0177  0.0202  -0.0024 473 GLY A N   
3065 C CA  . GLY A 395 ? 0.2444 0.3471 0.2905 0.0134  0.0218  -0.0012 473 GLY A CA  
3066 C C   . GLY A 395 ? 0.2530 0.3573 0.3025 0.0120  0.0198  -0.0019 473 GLY A C   
3067 O O   . GLY A 395 ? 0.2565 0.3605 0.3073 0.0083  0.0212  -0.0011 473 GLY A O   
3068 N N   . GLN A 396 ? 0.1958 0.3010 0.2464 0.0148  0.0165  -0.0032 474 GLN A N   
3069 C CA  . GLN A 396 ? 0.2078 0.3155 0.2618 0.0138  0.0145  -0.0042 474 GLN A CA  
3070 C C   . GLN A 396 ? 0.1948 0.2950 0.2444 0.0138  0.0119  -0.0027 474 GLN A C   
3071 O O   . GLN A 396 ? 0.1929 0.2869 0.2375 0.0154  0.0114  -0.0013 474 GLN A O   
3072 C CB  . GLN A 396 ? 0.2451 0.3596 0.3035 0.0169  0.0125  -0.0068 474 GLN A CB  
3073 C CG  . GLN A 396 ? 0.3938 0.5154 0.4559 0.0176  0.0151  -0.0083 474 GLN A CG  
3074 C CD  . GLN A 396 ? 0.5318 0.6595 0.5977 0.0215  0.0129  -0.0109 474 GLN A CD  
3075 O OE1 . GLN A 396 ? 0.5851 0.7111 0.6487 0.0254  0.0118  -0.0112 474 GLN A OE1 
3076 N NE2 . GLN A 396 ? 0.7235 0.8582 0.7952 0.0206  0.0120  -0.0128 474 GLN A NE2 
3077 N N   . PRO A 397 ? 0.1787 0.2794 0.2302 0.0119  0.0106  -0.0031 475 PRO A N   
3078 C CA  . PRO A 397 ? 0.1928 0.2864 0.2398 0.0119  0.0084  -0.0017 475 PRO A CA  
3079 C C   . PRO A 397 ? 0.1707 0.2614 0.2146 0.0160  0.0055  -0.0018 475 PRO A C   
3080 O O   . PRO A 397 ? 0.1676 0.2629 0.2141 0.0187  0.0039  -0.0035 475 PRO A O   
3081 C CB  . PRO A 397 ? 0.2024 0.2986 0.2526 0.0096  0.0073  -0.0027 475 PRO A CB  
3082 C CG  . PRO A 397 ? 0.2286 0.3315 0.2842 0.0070  0.0099  -0.0039 475 PRO A CG  
3083 C CD  . PRO A 397 ? 0.2012 0.3086 0.2585 0.0094  0.0111  -0.0048 475 PRO A CD  
3084 N N   . LEU A 398 ? 0.1673 0.2504 0.2056 0.0165  0.0050  -0.0001 476 LEU A N   
3085 C CA  . LEU A 398 ? 0.1956 0.2748 0.2305 0.0198  0.0022  0.0000  476 LEU A CA  
3086 C C   . LEU A 398 ? 0.1800 0.2592 0.2152 0.0197  -0.0004 -0.0004 476 LEU A C   
3087 O O   . LEU A 398 ? 0.1870 0.2640 0.2216 0.0168  -0.0002 0.0002  476 LEU A O   
3088 C CB  . LEU A 398 ? 0.1937 0.2652 0.2230 0.0198  0.0026  0.0017  476 LEU A CB  
3089 C CG  . LEU A 398 ? 0.1984 0.2649 0.2235 0.0228  0.0001  0.0020  476 LEU A CG  
3090 C CD1 . LEU A 398 ? 0.2228 0.2842 0.2438 0.0233  0.0012  0.0030  476 LEU A CD1 
3091 C CD2 . LEU A 398 ? 0.1839 0.2463 0.2066 0.0220  -0.0019 0.0026  476 LEU A CD2 
3092 N N   . ILE A 399 ? 0.1546 0.2361 0.1907 0.0228  -0.0029 -0.0017 477 ILE A N   
3093 C CA  . ILE A 399 ? 0.1603 0.2421 0.1964 0.0232  -0.0057 -0.0022 477 ILE A CA  
3094 C C   . ILE A 399 ? 0.1881 0.2631 0.2186 0.0258  -0.0081 -0.0011 477 ILE A C   
3095 O O   . ILE A 399 ? 0.1873 0.2613 0.2164 0.0292  -0.0089 -0.0013 477 ILE A O   
3096 C CB  . ILE A 399 ? 0.1789 0.2689 0.2203 0.0249  -0.0071 -0.0044 477 ILE A CB  
3097 C CG1 . ILE A 399 ? 0.1673 0.2645 0.2146 0.0221  -0.0044 -0.0056 477 ILE A CG1 
3098 C CG2 . ILE A 399 ? 0.1648 0.2549 0.2056 0.0252  -0.0103 -0.0049 477 ILE A CG2 
3099 C CD1 . ILE A 399 ? 0.1709 0.2669 0.2187 0.0174  -0.0028 -0.0049 477 ILE A CD1 
3100 N N   . GLY A 400 ? 0.1882 0.2585 0.2155 0.0241  -0.0091 -0.0001 478 GLY A N   
3101 C CA  . GLY A 400 ? 0.1997 0.2634 0.2214 0.0260  -0.0113 0.0009  478 GLY A CA  
3102 C C   . GLY A 400 ? 0.2068 0.2717 0.2283 0.0264  -0.0140 0.0003  478 GLY A C   
3103 O O   . GLY A 400 ? 0.2047 0.2765 0.2309 0.0261  -0.0145 -0.0011 478 GLY A O   
3104 N N   . LYS A 401 ? 0.2334 0.2919 0.2495 0.0271  -0.0156 0.0015  479 LYS A N   
3105 C CA  . LYS A 401 ? 0.2392 0.2977 0.2537 0.0274  -0.0182 0.0013  479 LYS A CA  
3106 C C   . LYS A 401 ? 0.2319 0.2842 0.2419 0.0248  -0.0179 0.0027  479 LYS A C   
3107 O O   . LYS A 401 ? 0.2223 0.2679 0.2275 0.0252  -0.0175 0.0041  479 LYS A O   
3108 C CB  . LYS A 401 ? 0.2907 0.3472 0.3023 0.0317  -0.0210 0.0015  479 LYS A CB  
3109 C CG  . LYS A 401 ? 0.3946 0.4577 0.4107 0.0350  -0.0220 -0.0001 479 LYS A CG  
3110 C CD  . LYS A 401 ? 0.3993 0.4702 0.4200 0.0349  -0.0237 -0.0019 479 LYS A CD  
3111 C CE  . LYS A 401 ? 0.4140 0.4903 0.4377 0.0393  -0.0258 -0.0034 479 LYS A CE  
3112 N NZ  . LYS A 401 ? 0.4321 0.5169 0.4611 0.0387  -0.0273 -0.0055 479 LYS A NZ  
3113 N N   . VAL A 402 ? 0.1973 0.2520 0.2088 0.0222  -0.0180 0.0020  480 VAL A N   
3114 C CA  . VAL A 402 ? 0.2439 0.2931 0.2510 0.0199  -0.0179 0.0031  480 VAL A CA  
3115 C C   . VAL A 402 ? 0.2061 0.2581 0.2133 0.0196  -0.0202 0.0020  480 VAL A C   
3116 O O   . VAL A 402 ? 0.1971 0.2532 0.2059 0.0222  -0.0224 0.0010  480 VAL A O   
3117 C CB  . VAL A 402 ? 0.2322 0.2798 0.2403 0.0163  -0.0149 0.0035  480 VAL A CB  
3118 C CG1 . VAL A 402 ? 0.3476 0.3878 0.3502 0.0154  -0.0144 0.0051  480 VAL A CG1 
3119 C CG2 . VAL A 402 ? 0.3375 0.3864 0.3483 0.0164  -0.0127 0.0037  480 VAL A CG2 
3120 N N   . TRP A 403 ? 0.2058 0.2559 0.2115 0.0167  -0.0197 0.0021  481 TRP A N   
3121 C CA  . TRP A 403 ? 0.2296 0.2814 0.2341 0.0166  -0.0221 0.0011  481 TRP A CA  
3122 C C   . TRP A 403 ? 0.2487 0.3090 0.2587 0.0171  -0.0236 -0.0010 481 TRP A C   
3123 O O   . TRP A 403 ? 0.2521 0.3142 0.2608 0.0192  -0.0266 -0.0016 481 TRP A O   
3124 C CB  . TRP A 403 ? 0.2607 0.3091 0.2628 0.0133  -0.0210 0.0013  481 TRP A CB  
3125 C CG  . TRP A 403 ? 0.2627 0.3033 0.2583 0.0135  -0.0206 0.0032  481 TRP A CG  
3126 C CD1 . TRP A 403 ? 0.2585 0.2947 0.2529 0.0117  -0.0181 0.0043  481 TRP A CD1 
3127 C CD2 . TRP A 403 ? 0.2855 0.3218 0.2752 0.0158  -0.0228 0.0043  481 TRP A CD2 
3128 N NE1 . TRP A 403 ? 0.3218 0.3515 0.3101 0.0124  -0.0185 0.0058  481 TRP A NE1 
3129 C CE2 . TRP A 403 ? 0.3368 0.3662 0.3219 0.0149  -0.0212 0.0059  481 TRP A CE2 
3130 C CE3 . TRP A 403 ? 0.3955 0.4331 0.3831 0.0186  -0.0259 0.0041  481 TRP A CE3 
3131 C CZ2 . TRP A 403 ? 0.3367 0.3601 0.3152 0.0163  -0.0224 0.0074  481 TRP A CZ2 
3132 C CZ3 . TRP A 403 ? 0.4655 0.4968 0.4461 0.0203  -0.0273 0.0057  481 TRP A CZ3 
3133 C CH2 . TRP A 403 ? 0.3959 0.4200 0.3719 0.0190  -0.0254 0.0074  481 TRP A CH2 
3134 N N   . PRO A 404 ? 0.2468 0.3122 0.2629 0.0153  -0.0216 -0.0022 482 PRO A N   
3135 C CA  . PRO A 404 ? 0.2448 0.3186 0.2663 0.0156  -0.0232 -0.0045 482 PRO A CA  
3136 C C   . PRO A 404 ? 0.2343 0.3124 0.2583 0.0194  -0.0247 -0.0050 482 PRO A C   
3137 O O   . PRO A 404 ? 0.2699 0.3554 0.2983 0.0200  -0.0263 -0.0071 482 PRO A O   
3138 C CB  . PRO A 404 ? 0.2593 0.3367 0.2864 0.0118  -0.0202 -0.0055 482 PRO A CB  
3139 C CG  . PRO A 404 ? 0.2293 0.3011 0.2545 0.0106  -0.0173 -0.0036 482 PRO A CG  
3140 C CD  . PRO A 404 ? 0.2302 0.2943 0.2484 0.0123  -0.0182 -0.0017 482 PRO A CD  
3141 N N   . GLY A 405 ? 0.2176 0.2915 0.2388 0.0220  -0.0243 -0.0035 483 GLY A N   
3142 C CA  . GLY A 405 ? 0.2182 0.2961 0.2422 0.0256  -0.0251 -0.0041 483 GLY A CA  
3143 C C   . GLY A 405 ? 0.2057 0.2840 0.2325 0.0245  -0.0218 -0.0038 483 GLY A C   
3144 O O   . GLY A 405 ? 0.1823 0.2546 0.2060 0.0228  -0.0197 -0.0021 483 GLY A O   
3145 N N   . SER A 406 ? 0.1834 0.2689 0.2160 0.0254  -0.0213 -0.0054 484 SER A N   
3146 C CA  . SER A 406 ? 0.1678 0.2544 0.2032 0.0244  -0.0180 -0.0052 484 SER A CA  
3147 C C   . SER A 406 ? 0.1778 0.2634 0.2143 0.0197  -0.0150 -0.0048 484 SER A C   
3148 O O   . SER A 406 ? 0.1789 0.2682 0.2184 0.0171  -0.0151 -0.0060 484 SER A O   
3149 C CB  . SER A 406 ? 0.1748 0.2706 0.2169 0.0259  -0.0179 -0.0073 484 SER A CB  
3150 O OG  . SER A 406 ? 0.1851 0.2817 0.2263 0.0307  -0.0205 -0.0077 484 SER A OG  
3151 N N   . THR A 407 ? 0.1728 0.2536 0.2071 0.0187  -0.0125 -0.0032 485 THR A N   
3152 C CA  . THR A 407 ? 0.1653 0.2443 0.2001 0.0147  -0.0097 -0.0025 485 THR A CA  
3153 C C   . THR A 407 ? 0.1726 0.2508 0.2080 0.0142  -0.0067 -0.0016 485 THR A C   
3154 O O   . THR A 407 ? 0.1656 0.2412 0.1985 0.0169  -0.0068 -0.0008 485 THR A O   
3155 C CB  . THR A 407 ? 0.2058 0.2770 0.2351 0.0135  -0.0099 -0.0008 485 THR A CB  
3156 O OG1 . THR A 407 ? 0.1603 0.2259 0.1850 0.0159  -0.0102 0.0006  485 THR A OG1 
3157 C CG2 . THR A 407 ? 0.1926 0.2637 0.2205 0.0133  -0.0125 -0.0015 485 THR A CG2 
3158 N N   . ALA A 408 ? 0.1638 0.2435 0.2019 0.0108  -0.0041 -0.0016 486 ALA A N   
3159 C CA  . ALA A 408 ? 0.1525 0.2303 0.1901 0.0098  -0.0011 -0.0004 486 ALA A CA  
3160 C C   . ALA A 408 ? 0.1707 0.2413 0.2041 0.0080  -0.0004 0.0013  486 ALA A C   
3161 O O   . ALA A 408 ? 0.1657 0.2341 0.1978 0.0067  -0.0016 0.0012  486 ALA A O   
3162 C CB  . ALA A 408 ? 0.1772 0.2608 0.2200 0.0073  0.0013  -0.0013 486 ALA A CB  
3163 N N   . PHE A 409 ? 0.1605 0.2277 0.1917 0.0079  0.0015  0.0027  487 PHE A N   
3164 C CA  . PHE A 409 ? 0.1520 0.2126 0.1792 0.0067  0.0020  0.0044  487 PHE A CA  
3165 C C   . PHE A 409 ? 0.1585 0.2186 0.1868 0.0040  0.0049  0.0052  487 PHE A C   
3166 O O   . PHE A 409 ? 0.1427 0.2044 0.1717 0.0043  0.0067  0.0056  487 PHE A O   
3167 C CB  . PHE A 409 ? 0.1902 0.2465 0.2132 0.0092  0.0014  0.0054  487 PHE A CB  
3168 C CG  . PHE A 409 ? 0.1640 0.2190 0.1848 0.0117  -0.0012 0.0049  487 PHE A CG  
3169 C CD1 . PHE A 409 ? 0.1861 0.2450 0.2086 0.0144  -0.0025 0.0038  487 PHE A CD1 
3170 C CD2 . PHE A 409 ? 0.1723 0.2224 0.1895 0.0113  -0.0025 0.0056  487 PHE A CD2 
3171 C CE1 . PHE A 409 ? 0.1882 0.2454 0.2084 0.0169  -0.0051 0.0036  487 PHE A CE1 
3172 C CE2 . PHE A 409 ? 0.2160 0.2644 0.2307 0.0135  -0.0049 0.0054  487 PHE A CE2 
3173 C CZ  . PHE A 409 ? 0.1843 0.2360 0.2003 0.0164  -0.0063 0.0044  487 PHE A CZ  
3174 N N   . PRO A 410 ? 0.1582 0.2161 0.1865 0.0014  0.0054  0.0055  488 PRO A N   
3175 C CA  . PRO A 410 ? 0.1712 0.2277 0.2000 -0.0009 0.0081  0.0065  488 PRO A CA  
3176 C C   . PRO A 410 ? 0.1912 0.2433 0.2163 0.0000  0.0092  0.0083  488 PRO A C   
3177 O O   . PRO A 410 ? 0.2009 0.2493 0.2226 0.0015  0.0078  0.0088  488 PRO A O   
3178 C CB  . PRO A 410 ? 0.1486 0.2024 0.1773 -0.0033 0.0080  0.0064  488 PRO A CB  
3179 C CG  . PRO A 410 ? 0.1873 0.2437 0.2171 -0.0029 0.0056  0.0048  488 PRO A CG  
3180 C CD  . PRO A 410 ? 0.1718 0.2287 0.1998 0.0003  0.0037  0.0047  488 PRO A CD  
3181 N N   . ASP A 411 ? 0.1727 0.2254 0.1985 -0.0009 0.0116  0.0092  489 ASP A N   
3182 C CA  . ASP A 411 ? 0.1667 0.2157 0.1891 -0.0001 0.0127  0.0108  489 ASP A CA  
3183 C C   . ASP A 411 ? 0.1543 0.1992 0.1756 -0.0022 0.0139  0.0121  489 ASP A C   
3184 O O   . ASP A 411 ? 0.1867 0.2320 0.2094 -0.0041 0.0160  0.0127  489 ASP A O   
3185 C CB  . ASP A 411 ? 0.1818 0.2341 0.2052 0.0002  0.0146  0.0111  489 ASP A CB  
3186 C CG  . ASP A 411 ? 0.1789 0.2278 0.1989 0.0007  0.0160  0.0128  489 ASP A CG  
3187 O OD1 . ASP A 411 ? 0.1750 0.2192 0.1918 0.0012  0.0151  0.0138  489 ASP A OD1 
3188 O OD2 . ASP A 411 ? 0.1950 0.2461 0.2154 0.0005  0.0180  0.0132  489 ASP A OD2 
3189 N N   . PHE A 412 ? 0.1614 0.2020 0.1801 -0.0018 0.0126  0.0125  490 PHE A N   
3190 C CA  . PHE A 412 ? 0.1992 0.2359 0.2171 -0.0035 0.0135  0.0134  490 PHE A CA  
3191 C C   . PHE A 412 ? 0.2218 0.2556 0.2371 -0.0030 0.0150  0.0153  490 PHE A C   
3192 O O   . PHE A 412 ? 0.2060 0.2361 0.2201 -0.0038 0.0155  0.0162  490 PHE A O   
3193 C CB  . PHE A 412 ? 0.1816 0.2154 0.1980 -0.0034 0.0117  0.0129  490 PHE A CB  
3194 C CG  . PHE A 412 ? 0.1754 0.2115 0.1940 -0.0042 0.0104  0.0112  490 PHE A CG  
3195 C CD1 . PHE A 412 ? 0.2068 0.2438 0.2279 -0.0067 0.0112  0.0105  490 PHE A CD1 
3196 C CD2 . PHE A 412 ? 0.1894 0.2266 0.2071 -0.0026 0.0083  0.0103  490 PHE A CD2 
3197 C CE1 . PHE A 412 ? 0.2088 0.2482 0.2318 -0.0075 0.0098  0.0088  490 PHE A CE1 
3198 C CE2 . PHE A 412 ? 0.1824 0.2218 0.2017 -0.0032 0.0069  0.0088  490 PHE A CE2 
3199 C CZ  . PHE A 412 ? 0.1940 0.2347 0.2160 -0.0056 0.0076  0.0080  490 PHE A CZ  
3200 N N   . THR A 413 ? 0.2140 0.2495 0.2284 -0.0015 0.0155  0.0157  491 THR A N   
3201 C CA  . THR A 413 ? 0.2054 0.2391 0.2175 -0.0014 0.0173  0.0174  491 THR A CA  
3202 C C   . THR A 413 ? 0.2370 0.2727 0.2509 -0.0032 0.0198  0.0180  491 THR A C   
3203 O O   . THR A 413 ? 0.2402 0.2739 0.2520 -0.0033 0.0214  0.0197  491 THR A O   
3204 C CB  . THR A 413 ? 0.2161 0.2501 0.2256 0.0010  0.0168  0.0177  491 THR A CB  
3205 O OG1 . THR A 413 ? 0.1828 0.2212 0.1938 0.0017  0.0173  0.0168  491 THR A OG1 
3206 C CG2 . THR A 413 ? 0.2047 0.2368 0.2126 0.0025  0.0145  0.0170  491 THR A CG2 
3207 N N   . ASN A 414 ? 0.2043 0.2439 0.2220 -0.0045 0.0201  0.0166  492 ASN A N   
3208 C CA  . ASN A 414 ? 0.1940 0.2359 0.2139 -0.0067 0.0226  0.0169  492 ASN A CA  
3209 C C   . ASN A 414 ? 0.1955 0.2343 0.2164 -0.0095 0.0236  0.0174  492 ASN A C   
3210 O O   . ASN A 414 ? 0.2106 0.2497 0.2335 -0.0104 0.0224  0.0160  492 ASN A O   
3211 C CB  . ASN A 414 ? 0.2098 0.2581 0.2338 -0.0069 0.0224  0.0149  492 ASN A CB  
3212 C CG  . ASN A 414 ? 0.2218 0.2734 0.2485 -0.0092 0.0252  0.0149  492 ASN A CG  
3213 O OD1 . ASN A 414 ? 0.2352 0.2839 0.2612 -0.0114 0.0274  0.0163  492 ASN A OD1 
3214 N ND2 . ASN A 414 ? 0.2723 0.3301 0.3023 -0.0088 0.0253  0.0132  492 ASN A ND2 
3215 N N   . PRO A 415 ? 0.2094 0.2450 0.2285 -0.0107 0.0259  0.0192  493 PRO A N   
3216 C CA  . PRO A 415 ? 0.2135 0.2455 0.2335 -0.0133 0.0269  0.0196  493 PRO A CA  
3217 C C   . PRO A 415 ? 0.2033 0.2391 0.2280 -0.0160 0.0275  0.0177  493 PRO A C   
3218 O O   . PRO A 415 ? 0.2287 0.2624 0.2546 -0.0176 0.0270  0.0169  493 PRO A O   
3219 C CB  . PRO A 415 ? 0.2414 0.2701 0.2588 -0.0141 0.0296  0.0221  493 PRO A CB  
3220 C CG  . PRO A 415 ? 0.2804 0.3100 0.2947 -0.0115 0.0295  0.0231  493 PRO A CG  
3221 C CD  . PRO A 415 ? 0.2307 0.2651 0.2465 -0.0096 0.0274  0.0212  493 PRO A CD  
3222 N N   . THR A 416 ? 0.1941 0.2357 0.2216 -0.0165 0.0284  0.0166  494 THR A N   
3223 C CA  . THR A 416 ? 0.2031 0.2494 0.2356 -0.0189 0.0286  0.0144  494 THR A CA  
3224 C C   . THR A 416 ? 0.2131 0.2614 0.2474 -0.0180 0.0255  0.0123  494 THR A C   
3225 O O   . THR A 416 ? 0.2243 0.2739 0.2616 -0.0202 0.0252  0.0107  494 THR A O   
3226 C CB  . THR A 416 ? 0.1967 0.2495 0.2322 -0.0194 0.0302  0.0136  494 THR A CB  
3227 O OG1 . THR A 416 ? 0.2241 0.2747 0.2575 -0.0205 0.0332  0.0157  494 THR A OG1 
3228 C CG2 . THR A 416 ? 0.2042 0.2625 0.2453 -0.0221 0.0305  0.0112  494 THR A CG2 
3229 N N   . ALA A 417 ? 0.2104 0.2591 0.2427 -0.0148 0.0232  0.0122  495 ALA A N   
3230 C CA  . ALA A 417 ? 0.2000 0.2493 0.2327 -0.0137 0.0203  0.0107  495 ALA A CA  
3231 C C   . ALA A 417 ? 0.2075 0.2515 0.2385 -0.0147 0.0196  0.0109  495 ALA A C   
3232 O O   . ALA A 417 ? 0.1766 0.2214 0.2091 -0.0154 0.0181  0.0093  495 ALA A O   
3233 C CB  . ALA A 417 ? 0.1964 0.2460 0.2266 -0.0102 0.0183  0.0108  495 ALA A CB  
3234 N N   . LEU A 418 ? 0.1833 0.2218 0.2112 -0.0145 0.0207  0.0129  496 LEU A N   
3235 C CA  . LEU A 418 ? 0.2261 0.2595 0.2526 -0.0154 0.0204  0.0132  496 LEU A CA  
3236 C C   . LEU A 418 ? 0.1973 0.2309 0.2269 -0.0187 0.0216  0.0120  496 LEU A C   
3237 O O   . LEU A 418 ? 0.1771 0.2096 0.2074 -0.0196 0.0204  0.0106  496 LEU A O   
3238 C CB  . LEU A 418 ? 0.2920 0.3200 0.3150 -0.0146 0.0216  0.0155  496 LEU A CB  
3239 C CG  . LEU A 418 ? 0.4212 0.4483 0.4409 -0.0115 0.0204  0.0166  496 LEU A CG  
3240 C CD1 . LEU A 418 ? 0.3929 0.4152 0.4093 -0.0108 0.0216  0.0188  496 LEU A CD1 
3241 C CD2 . LEU A 418 ? 0.3424 0.3693 0.3613 -0.0101 0.0179  0.0154  496 LEU A CD2 
3242 N N   . ALA A 419 ? 0.1821 0.2172 0.2136 -0.0208 0.0240  0.0124  497 ALA A N   
3243 C CA  . ALA A 419 ? 0.1854 0.2205 0.2199 -0.0243 0.0255  0.0113  497 ALA A CA  
3244 C C   . ALA A 419 ? 0.2067 0.2477 0.2453 -0.0252 0.0238  0.0084  497 ALA A C   
3245 O O   . ALA A 419 ? 0.1968 0.2370 0.2370 -0.0272 0.0234  0.0068  497 ALA A O   
3246 C CB  . ALA A 419 ? 0.2138 0.2494 0.2493 -0.0263 0.0287  0.0125  497 ALA A CB  
3247 N N   . TRP A 420 ? 0.1847 0.2314 0.2246 -0.0235 0.0227  0.0076  498 TRP A N   
3248 C CA  . TRP A 420 ? 0.1846 0.2371 0.2278 -0.0235 0.0206  0.0050  498 TRP A CA  
3249 C C   . TRP A 420 ? 0.1813 0.2316 0.2227 -0.0224 0.0179  0.0041  498 TRP A C   
3250 O O   . TRP A 420 ? 0.1689 0.2214 0.2126 -0.0239 0.0167  0.0020  498 TRP A O   
3251 C CB  . TRP A 420 ? 0.1773 0.2357 0.2217 -0.0212 0.0199  0.0047  498 TRP A CB  
3252 C CG  . TRP A 420 ? 0.1666 0.2301 0.2130 -0.0198 0.0170  0.0024  498 TRP A CG  
3253 C CD1 . TRP A 420 ? 0.1808 0.2506 0.2321 -0.0214 0.0165  0.0000  498 TRP A CD1 
3254 C CD2 . TRP A 420 ? 0.1688 0.2316 0.2125 -0.0165 0.0142  0.0025  498 TRP A CD2 
3255 N NE1 . TRP A 420 ? 0.1592 0.2323 0.2106 -0.0190 0.0134  -0.0013 498 TRP A NE1 
3256 C CE2 . TRP A 420 ? 0.1690 0.2376 0.2157 -0.0160 0.0120  0.0002  498 TRP A CE2 
3257 C CE3 . TRP A 420 ? 0.1798 0.2377 0.2188 -0.0140 0.0133  0.0042  498 TRP A CE3 
3258 C CZ2 . TRP A 420 ? 0.1772 0.2460 0.2217 -0.0130 0.0090  -0.0001 498 TRP A CZ2 
3259 C CZ3 . TRP A 420 ? 0.2133 0.2717 0.2505 -0.0113 0.0105  0.0037  498 TRP A CZ3 
3260 C CH2 . TRP A 420 ? 0.1831 0.2465 0.2227 -0.0108 0.0084  0.0016  498 TRP A CH2 
3261 N N   . TRP A 421 ? 0.1771 0.2232 0.2142 -0.0198 0.0169  0.0057  499 TRP A N   
3262 C CA  . TRP A 421 ? 0.1880 0.2318 0.2230 -0.0188 0.0146  0.0050  499 TRP A CA  
3263 C C   . TRP A 421 ? 0.2037 0.2437 0.2388 -0.0212 0.0152  0.0043  499 TRP A C   
3264 O O   . TRP A 421 ? 0.2118 0.2526 0.2475 -0.0219 0.0136  0.0025  499 TRP A O   
3265 C CB  . TRP A 421 ? 0.1935 0.2336 0.2242 -0.0159 0.0138  0.0067  499 TRP A CB  
3266 C CG  . TRP A 421 ? 0.1966 0.2351 0.2249 -0.0144 0.0115  0.0061  499 TRP A CG  
3267 C CD1 . TRP A 421 ? 0.1912 0.2247 0.2167 -0.0141 0.0113  0.0068  499 TRP A CD1 
3268 C CD2 . TRP A 421 ? 0.1701 0.2118 0.1983 -0.0129 0.0090  0.0049  499 TRP A CD2 
3269 N NE1 . TRP A 421 ? 0.2057 0.2391 0.2291 -0.0127 0.0091  0.0060  499 TRP A NE1 
3270 C CE2 . TRP A 421 ? 0.2032 0.2413 0.2280 -0.0119 0.0077  0.0050  499 TRP A CE2 
3271 C CE3 . TRP A 421 ? 0.1661 0.2133 0.1965 -0.0120 0.0079  0.0038  499 TRP A CE3 
3272 C CZ2 . TRP A 421 ? 0.1879 0.2272 0.2111 -0.0103 0.0052  0.0043  499 TRP A CZ2 
3273 C CZ3 . TRP A 421 ? 0.1749 0.2234 0.2038 -0.0101 0.0052  0.0030  499 TRP A CZ3 
3274 C CH2 . TRP A 421 ? 0.1726 0.2169 0.1977 -0.0093 0.0040  0.0033  499 TRP A CH2 
3275 N N   . GLU A 422 ? 0.2228 0.2583 0.2570 -0.0223 0.0175  0.0059  500 GLU A N   
3276 C CA  . GLU A 422 ? 0.1949 0.2262 0.2294 -0.0247 0.0185  0.0053  500 GLU A CA  
3277 C C   . GLU A 422 ? 0.2062 0.2413 0.2447 -0.0277 0.0186  0.0028  500 GLU A C   
3278 O O   . GLU A 422 ? 0.1697 0.2035 0.2085 -0.0289 0.0177  0.0011  500 GLU A O   
3279 C CB  . GLU A 422 ? 0.2429 0.2693 0.2761 -0.0255 0.0211  0.0075  500 GLU A CB  
3280 C CG  . GLU A 422 ? 0.3074 0.3295 0.3366 -0.0227 0.0209  0.0097  500 GLU A CG  
3281 C CD  . GLU A 422 ? 0.3417 0.3605 0.3694 -0.0228 0.0233  0.0122  500 GLU A CD  
3282 O OE1 . GLU A 422 ? 0.3018 0.3208 0.3314 -0.0254 0.0254  0.0123  500 GLU A OE1 
3283 O OE2 . GLU A 422 ? 0.3401 0.3562 0.3647 -0.0205 0.0231  0.0140  500 GLU A OE2 
3284 N N   . ASP A 423 ? 0.1765 0.2165 0.2182 -0.0289 0.0196  0.0024  501 ASP A