data_5L6P
# 
_entry.id   5L6P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5L6P         
WWPDB D_1200000217 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5L6P 
_pdbx_database_status.recvd_initial_deposition_date   2016-05-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schimpl, M.' 1 
'Overman, R.' 2 
'Kung, A.'    3 
'Chen, Y.-C.' 4 
'Ni, F.'      5 
'Zhu, J.'     6 
'Turner, M.'  7 
'Molina, H.'  8 
'Zhang, C.'   9 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_id_ASTM           JACSAT 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1520-5126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            138 
_citation.language                  ? 
_citation.page_first                10554 
_citation.page_last                 10560 
_citation.title                     'Development of Specific, Irreversible Inhibitors for a Receptor Tyrosine Kinase EphB3.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/jacs.6b05483 
_citation.pdbx_database_id_PubMed   27478969 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kung, A.'    1 
primary 'Chen, Y.C.'  2 
primary 'Schimpl, M.' 3 
primary 'Ni, F.'      4 
primary 'Zhu, J.'     5 
primary 'Turner, M.'  6 
primary 'Molina, H.'  7 
primary 'Overman, R.' 8 
primary 'Zhang, C.'   9 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5L6P 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     47.240 
_cell.length_a_esd                 ? 
_cell.length_b                     56.950 
_cell.length_b_esd                 ? 
_cell.length_c                     126.750 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5L6P 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ephrin type-B receptor 3'                       33765.711 1  2.7.10.1 A899P ? ? 
2 non-polymer syn '~{N}-(4-phenylazanylquinazolin-7-yl)ethanamide' 278.309   1  ?        ?     ? ? 
3 non-polymer syn '1,4-DIETHYLENE DIOXIDE'                         88.105    1  ?        ?     ? ? 
4 water       nat water                                            18.015    77 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'EPH-like tyrosine kinase 2,EPH-like kinase 2,Embryonic kinase 2,hEK2,Tyrosine-protein kinase TYRO6' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHP
NIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVC
KVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVE
QDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNPASLKVIASAQS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHP
NIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVC
KVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVE
QDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNPASLKVIASAQS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   ASP n 
1 5   PRO n 
1 6   ASN n 
1 7   GLU n 
1 8   ALA n 
1 9   VAL n 
1 10  ARG n 
1 11  GLU n 
1 12  PHE n 
1 13  ALA n 
1 14  LYS n 
1 15  GLU n 
1 16  ILE n 
1 17  ASP n 
1 18  VAL n 
1 19  SER n 
1 20  CYS n 
1 21  VAL n 
1 22  LYS n 
1 23  ILE n 
1 24  GLU n 
1 25  GLU n 
1 26  VAL n 
1 27  ILE n 
1 28  GLY n 
1 29  ALA n 
1 30  GLY n 
1 31  GLU n 
1 32  PHE n 
1 33  GLY n 
1 34  GLU n 
1 35  VAL n 
1 36  CYS n 
1 37  ARG n 
1 38  GLY n 
1 39  ARG n 
1 40  LEU n 
1 41  LYS n 
1 42  GLN n 
1 43  PRO n 
1 44  GLY n 
1 45  ARG n 
1 46  ARG n 
1 47  GLU n 
1 48  VAL n 
1 49  PHE n 
1 50  VAL n 
1 51  ALA n 
1 52  ILE n 
1 53  LYS n 
1 54  THR n 
1 55  LEU n 
1 56  LYS n 
1 57  VAL n 
1 58  GLY n 
1 59  TYR n 
1 60  THR n 
1 61  GLU n 
1 62  ARG n 
1 63  GLN n 
1 64  ARG n 
1 65  ARG n 
1 66  ASP n 
1 67  PHE n 
1 68  LEU n 
1 69  SER n 
1 70  GLU n 
1 71  ALA n 
1 72  SER n 
1 73  ILE n 
1 74  MET n 
1 75  GLY n 
1 76  GLN n 
1 77  PHE n 
1 78  ASP n 
1 79  HIS n 
1 80  PRO n 
1 81  ASN n 
1 82  ILE n 
1 83  ILE n 
1 84  ARG n 
1 85  LEU n 
1 86  GLU n 
1 87  GLY n 
1 88  VAL n 
1 89  VAL n 
1 90  THR n 
1 91  LYS n 
1 92  SER n 
1 93  ARG n 
1 94  PRO n 
1 95  VAL n 
1 96  MET n 
1 97  ILE n 
1 98  LEU n 
1 99  THR n 
1 100 GLU n 
1 101 PHE n 
1 102 MET n 
1 103 GLU n 
1 104 ASN n 
1 105 CYS n 
1 106 ALA n 
1 107 LEU n 
1 108 ASP n 
1 109 SER n 
1 110 PHE n 
1 111 LEU n 
1 112 ARG n 
1 113 LEU n 
1 114 ASN n 
1 115 ASP n 
1 116 GLY n 
1 117 GLN n 
1 118 PHE n 
1 119 THR n 
1 120 VAL n 
1 121 ILE n 
1 122 GLN n 
1 123 LEU n 
1 124 VAL n 
1 125 GLY n 
1 126 MET n 
1 127 LEU n 
1 128 ARG n 
1 129 GLY n 
1 130 ILE n 
1 131 ALA n 
1 132 ALA n 
1 133 GLY n 
1 134 MET n 
1 135 LYS n 
1 136 TYR n 
1 137 LEU n 
1 138 SER n 
1 139 GLU n 
1 140 MET n 
1 141 ASN n 
1 142 TYR n 
1 143 VAL n 
1 144 HIS n 
1 145 ARG n 
1 146 ASP n 
1 147 LEU n 
1 148 ALA n 
1 149 ALA n 
1 150 ARG n 
1 151 ASN n 
1 152 ILE n 
1 153 LEU n 
1 154 VAL n 
1 155 ASN n 
1 156 SER n 
1 157 ASN n 
1 158 LEU n 
1 159 VAL n 
1 160 CYS n 
1 161 LYS n 
1 162 VAL n 
1 163 SER n 
1 164 ASP n 
1 165 PHE n 
1 166 GLY n 
1 167 LEU n 
1 168 SER n 
1 169 ARG n 
1 170 PHE n 
1 171 LEU n 
1 172 GLU n 
1 173 ASP n 
1 174 ASP n 
1 175 PRO n 
1 176 SER n 
1 177 ASP n 
1 178 PRO n 
1 179 THR n 
1 180 TYR n 
1 181 THR n 
1 182 SER n 
1 183 SER n 
1 184 LEU n 
1 185 GLY n 
1 186 GLY n 
1 187 LYS n 
1 188 ILE n 
1 189 PRO n 
1 190 ILE n 
1 191 ARG n 
1 192 TRP n 
1 193 THR n 
1 194 ALA n 
1 195 PRO n 
1 196 GLU n 
1 197 ALA n 
1 198 ILE n 
1 199 ALA n 
1 200 TYR n 
1 201 ARG n 
1 202 LYS n 
1 203 PHE n 
1 204 THR n 
1 205 SER n 
1 206 ALA n 
1 207 SER n 
1 208 ASP n 
1 209 VAL n 
1 210 TRP n 
1 211 SER n 
1 212 TYR n 
1 213 GLY n 
1 214 ILE n 
1 215 VAL n 
1 216 MET n 
1 217 TRP n 
1 218 GLU n 
1 219 VAL n 
1 220 MET n 
1 221 SER n 
1 222 TYR n 
1 223 GLY n 
1 224 GLU n 
1 225 ARG n 
1 226 PRO n 
1 227 TYR n 
1 228 TRP n 
1 229 ASP n 
1 230 MET n 
1 231 SER n 
1 232 ASN n 
1 233 GLN n 
1 234 ASP n 
1 235 VAL n 
1 236 ILE n 
1 237 ASN n 
1 238 ALA n 
1 239 VAL n 
1 240 GLU n 
1 241 GLN n 
1 242 ASP n 
1 243 TYR n 
1 244 ARG n 
1 245 LEU n 
1 246 PRO n 
1 247 PRO n 
1 248 PRO n 
1 249 MET n 
1 250 ASP n 
1 251 CYS n 
1 252 PRO n 
1 253 THR n 
1 254 ALA n 
1 255 LEU n 
1 256 HIS n 
1 257 GLN n 
1 258 LEU n 
1 259 MET n 
1 260 LEU n 
1 261 ASP n 
1 262 CYS n 
1 263 TRP n 
1 264 VAL n 
1 265 ARG n 
1 266 ASP n 
1 267 ARG n 
1 268 ASN n 
1 269 LEU n 
1 270 ARG n 
1 271 PRO n 
1 272 LYS n 
1 273 PHE n 
1 274 SER n 
1 275 GLN n 
1 276 ILE n 
1 277 VAL n 
1 278 ASN n 
1 279 THR n 
1 280 LEU n 
1 281 ASP n 
1 282 LYS n 
1 283 LEU n 
1 284 ILE n 
1 285 ARG n 
1 286 ASN n 
1 287 PRO n 
1 288 ALA n 
1 289 SER n 
1 290 LEU n 
1 291 LYS n 
1 292 VAL n 
1 293 ILE n 
1 294 ALA n 
1 295 SER n 
1 296 ALA n 
1 297 GLN n 
1 298 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   298 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'EPHB3, ETK2, HEK2, TYRO6' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EPHB3_HUMAN 
_struct_ref.pdbx_db_accession          P54753 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNII
RLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVS
DFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDY
RLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQS
;
_struct_ref.pdbx_align_begin           616 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5L6P 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 298 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P54753 
_struct_ref_seq.db_align_beg                  616 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  910 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       616 
_struct_ref_seq.pdbx_auth_seq_align_end       910 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5L6P GLY A 1   ? UNP P54753 ?   ?   'expression tag'      613 1 
1 5L6P SER A 2   ? UNP P54753 ?   ?   'expression tag'      614 2 
1 5L6P SER A 3   ? UNP P54753 ?   ?   'expression tag'      615 3 
1 5L6P PRO A 287 ? UNP P54753 ALA 899 'engineered mutation' 899 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6P8 non-polymer         . '~{N}-(4-phenylazanylquinazolin-7-yl)ethanamide' ? 'C16 H14 N4 O'   278.309 
ALA 'L-peptide linking' y ALANINE                                          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                         ? 'C3 H7 N O2 S'   121.158 
DIO non-polymer         . '1,4-DIETHYLENE DIOXIDE'                         ? 'C4 H8 O2'       88.105  
GLN 'L-peptide linking' y GLUTAMINE                                        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                       ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                           ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5L6P 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.52 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.28 
_exptl_crystal.description                 plate 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1,4-dioxane, Tris buffer, magnesium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-01-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97949 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97949 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            38.990 
_reflns.entry_id                         5L6P 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.260 
_reflns.d_resolution_low                 37.870 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       15994 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.900 
_reflns.pdbx_Rmerge_I_obs                0.090 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             20 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.099 
_reflns.pdbx_Rpim_I_all                  0.040 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         93600 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.260 2.380  ? ? ? ? ? ? ? 75.700 ? ? ? ? 0.340 ? ? ? ? ? ? ? ? 4.000 ? ? ? ? ? ? ? 1 1 ? ? 
7.140 37.870 ? ? ? ? ? ? ? 98.900 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 5.500 ? ? ? ? ? ? ? 2 1 ? ? 
# 
_refine.aniso_B[1][1]                            8.9809 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            8.2602 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -17.2411 
_refine.B_iso_max                                166.510 
_refine.B_iso_mean                               55.8400 
_refine.B_iso_min                                17.610 
_refine.correlation_coeff_Fo_to_Fc               0.8930 
_refine.correlation_coeff_Fo_to_Fc_free          0.8840 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5L6P 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.2600 
_refine.ls_d_res_low                             37.8700 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     15939 
_refine.ls_number_reflns_R_free                  774 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.7000 
_refine.ls_percent_reflns_R_free                 4.8600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2060 
_refine.ls_R_factor_R_free                       0.2320 
_refine.ls_R_factor_R_free_error                 0.0000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2050 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3ZFY 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.1980 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.2000 
_refine.pdbx_overall_SU_R_Blow_DPI               0.2750 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.2660 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5L6P 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.320 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.2600 
_refine_hist.d_res_low                        37.8700 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               2226 
_refine_hist.pdbx_number_residues_total       274 
_refine_hist.pdbx_B_iso_mean_ligand           61.98 
_refine_hist.pdbx_B_iso_mean_solvent          42.04 
_refine_hist.pdbx_number_atoms_protein        2122 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? ?      ? 757  ? t_dihedral_angle_d        2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?      ? 51   ? t_trig_c_planes           2.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 322  ? t_gen_planes              5.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 2223 ? t_it                      20.000 HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_nbd                     ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_improper_torsion        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_pseud_angle             ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 286  ? t_chiral_improper_torsion 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_sum_occupancies         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_distance        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_angle           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_torsion         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 2535 ? t_ideal_dist_contact      4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 0.010  ? 2223 ? t_bond_d                  2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 1.030  ? 3036 ? t_angle_deg               2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 2.640  ? ?    ? t_omega_torsion           ?      ?            
'X-RAY DIFFRACTION' ? 16.690 ? ?    ? t_other_torsion           ?      ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.2600 
_refine_ls_shell.d_res_low                        2.4200 
_refine_ls_shell.number_reflns_all                2299 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_R_work             2194 
_refine_ls_shell.percent_reflns_obs               78.5200 
_refine_ls_shell.percent_reflns_R_free            4.5700 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2750 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2100 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5L6P 
_struct.title                        'EphB3 kinase domain covalently bound to an irreversible inhibitor (compound 6)' 
_struct.pdbx_descriptor              'Ephrin type-B receptor 3 (E.C.2.7.10.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5L6P 
_struct_keywords.text            'Kinase, Irreversible Inhibitor, Quinazoline, Signaling, transferase' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 60  ? GLY A 75  ? THR A 672 GLY A 687 1 ? 16 
HELX_P HELX_P2  AA2 ALA A 106 ? ASN A 114 ? ALA A 718 ASN A 726 1 ? 9  
HELX_P HELX_P3  AA3 THR A 119 ? MET A 140 ? THR A 731 MET A 752 1 ? 22 
HELX_P HELX_P4  AA4 ALA A 148 ? ARG A 150 ? ALA A 760 ARG A 762 5 ? 3  
HELX_P HELX_P5  AA5 PRO A 189 ? THR A 193 ? PRO A 801 THR A 805 5 ? 5  
HELX_P HELX_P6  AA6 ALA A 194 ? ARG A 201 ? ALA A 806 ARG A 813 1 ? 8  
HELX_P HELX_P7  AA7 THR A 204 ? SER A 221 ? THR A 816 SER A 833 1 ? 18 
HELX_P HELX_P8  AA8 SER A 231 ? GLN A 241 ? SER A 843 GLN A 853 1 ? 11 
HELX_P HELX_P9  AA9 PRO A 252 ? TRP A 263 ? PRO A 864 TRP A 875 1 ? 12 
HELX_P HELX_P10 AB1 LYS A 272 ? ASN A 286 ? LYS A 884 ASN A 898 1 ? 15 
HELX_P HELX_P11 AB2 PRO A 287 ? VAL A 292 ? PRO A 899 VAL A 904 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            105 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           6P8 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C15 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             717 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            6P8 
_struct_conn.ptnr2_auth_seq_id             1001 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.821 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           93 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            705 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    94 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     706 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.58 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 21  ? ALA A 29  ? VAL A 633 ALA A 641 
AA1 2 GLY A 33  ? LEU A 40  ? GLY A 645 LEU A 652 
AA1 3 VAL A 48  ? LEU A 55  ? VAL A 660 LEU A 667 
AA1 4 MET A 96  ? GLU A 100 ? MET A 708 GLU A 712 
AA1 5 LEU A 85  ? VAL A 89  ? LEU A 697 VAL A 701 
AA2 1 ILE A 152 ? VAL A 154 ? ILE A 764 VAL A 766 
AA2 2 CYS A 160 ? VAL A 162 ? CYS A 772 VAL A 774 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 25  ? N GLU A 637 O ARG A 37  ? O ARG A 649 
AA1 2 3 N CYS A 36  ? N CYS A 648 O ILE A 52  ? O ILE A 664 
AA1 3 4 N ALA A 51  ? N ALA A 663 O THR A 99  ? O THR A 711 
AA1 4 5 O LEU A 98  ? O LEU A 710 N GLY A 87  ? N GLY A 699 
AA2 1 2 N LEU A 153 ? N LEU A 765 O LYS A 161 ? O LYS A 773 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 6P8 1001 ? 9 'binding site for residue 6P8 A 1001' 
AC2 Software A DIO 1002 ? 6 'binding site for residue DIO A 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 ALA A 51  ? ALA A 663 . ? 1_555 ? 
2  AC1 9 LYS A 53  ? LYS A 665 . ? 1_555 ? 
3  AC1 9 THR A 99  ? THR A 711 . ? 1_555 ? 
4  AC1 9 GLU A 100 ? GLU A 712 . ? 1_555 ? 
5  AC1 9 MET A 102 ? MET A 714 . ? 1_555 ? 
6  AC1 9 CYS A 105 ? CYS A 717 . ? 1_555 ? 
7  AC1 9 LEU A 153 ? LEU A 765 . ? 1_555 ? 
8  AC1 9 SER A 163 ? SER A 775 . ? 1_555 ? 
9  AC1 9 ASP A 164 ? ASP A 776 . ? 1_555 ? 
10 AC2 6 MET A 74  ? MET A 686 . ? 1_555 ? 
11 AC2 6 PHE A 77  ? PHE A 689 . ? 1_555 ? 
12 AC2 6 TYR A 142 ? TYR A 754 . ? 1_555 ? 
13 AC2 6 HIS A 144 ? HIS A 756 . ? 1_555 ? 
14 AC2 6 VAL A 162 ? VAL A 774 . ? 1_555 ? 
15 AC2 6 PHE A 165 ? PHE A 777 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5L6P 
_atom_sites.fract_transf_matrix[1][1]   0.021169 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017559 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007890 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . CYS A 1 20  ? 18.120  -0.306  11.084  1.00 118.23 ? 632  CYS A N     1 
ATOM   2    C CA    . CYS A 1 20  ? 18.331  -1.235  9.973   1.00 113.71 ? 632  CYS A CA    1 
ATOM   3    C C     . CYS A 1 20  ? 18.353  -0.546  8.605   1.00 112.58 ? 632  CYS A C     1 
ATOM   4    O O     . CYS A 1 20  ? 19.322  -0.702  7.861   1.00 109.47 ? 632  CYS A O     1 
ATOM   5    C CB    . CYS A 1 20  ? 17.318  -2.378  10.008  1.00 112.77 ? 632  CYS A CB    1 
ATOM   6    S SG    . CYS A 1 20  ? 17.862  -3.825  10.949  1.00 120.16 ? 632  CYS A SG    1 
ATOM   7    N N     . VAL A 1 21  ? 17.285  0.208   8.276   1.00 108.26 ? 633  VAL A N     1 
ATOM   8    C CA    . VAL A 1 21  ? 17.137  0.903   6.993   1.00 104.11 ? 633  VAL A CA    1 
ATOM   9    C C     . VAL A 1 21  ? 17.089  2.424   7.131   1.00 110.40 ? 633  VAL A C     1 
ATOM   10   O O     . VAL A 1 21  ? 16.419  2.950   8.021   1.00 112.82 ? 633  VAL A O     1 
ATOM   11   C CB    . VAL A 1 21  ? 15.948  0.388   6.143   1.00 103.76 ? 633  VAL A CB    1 
ATOM   12   C CG1   . VAL A 1 21  ? 16.376  -0.763  5.245   1.00 100.44 ? 633  VAL A CG1   1 
ATOM   13   C CG2   . VAL A 1 21  ? 14.744  0.004   7.004   1.00 105.35 ? 633  VAL A CG2   1 
ATOM   14   N N     . LYS A 1 22  ? 17.794  3.119   6.220   1.00 105.93 ? 634  LYS A N     1 
ATOM   15   C CA    . LYS A 1 22  ? 17.863  4.577   6.124   1.00 106.94 ? 634  LYS A CA    1 
ATOM   16   C C     . LYS A 1 22  ? 17.797  4.997   4.647   1.00 107.20 ? 634  LYS A C     1 
ATOM   17   O O     . LYS A 1 22  ? 18.604  4.528   3.840   1.00 104.43 ? 634  LYS A O     1 
ATOM   18   C CB    . LYS A 1 22  ? 19.143  5.107   6.789   1.00 113.33 ? 634  LYS A CB    1 
ATOM   19   N N     . ILE A 1 23  ? 16.811  5.851   4.294   1.00 103.08 ? 635  ILE A N     1 
ATOM   20   C CA    . ILE A 1 23  ? 16.597  6.360   2.931   1.00 99.00  ? 635  ILE A CA    1 
ATOM   21   C C     . ILE A 1 23  ? 17.620  7.468   2.620   1.00 105.53 ? 635  ILE A C     1 
ATOM   22   O O     . ILE A 1 23  ? 17.846  8.357   3.446   1.00 108.77 ? 635  ILE A O     1 
ATOM   23   C CB    . ILE A 1 23  ? 15.110  6.788   2.701   1.00 100.06 ? 635  ILE A CB    1 
ATOM   24   C CG1   . ILE A 1 23  ? 14.164  5.571   2.750   1.00 98.63  ? 635  ILE A CG1   1 
ATOM   25   C CG2   . ILE A 1 23  ? 14.908  7.575   1.396   1.00 96.95  ? 635  ILE A CG2   1 
ATOM   26   C CD1   . ILE A 1 23  ? 12.985  5.741   3.695   1.00 106.45 ? 635  ILE A CD1   1 
ATOM   27   N N     . GLU A 1 24  ? 18.242  7.388   1.431   1.00 100.19 ? 636  GLU A N     1 
ATOM   28   C CA    . GLU A 1 24  ? 19.258  8.328   0.960   1.00 100.95 ? 636  GLU A CA    1 
ATOM   29   C C     . GLU A 1 24  ? 18.657  9.373   0.006   1.00 103.05 ? 636  GLU A C     1 
ATOM   30   O O     . GLU A 1 24  ? 18.754  10.569  0.285   1.00 104.24 ? 636  GLU A O     1 
ATOM   31   C CB    . GLU A 1 24  ? 20.409  7.556   0.286   1.00 100.91 ? 636  GLU A CB    1 
ATOM   32   C CG    . GLU A 1 24  ? 21.759  8.247   0.350   1.00 112.26 ? 636  GLU A CG    1 
ATOM   33   C CD    . GLU A 1 24  ? 22.887  7.493   -0.330  1.00 123.84 ? 636  GLU A CD    1 
ATOM   34   O OE1   . GLU A 1 24  ? 22.761  7.187   -1.539  1.00 101.28 ? 636  GLU A OE1   1 
ATOM   35   O OE2   . GLU A 1 24  ? 23.913  7.239   0.341   1.00 119.14 ? 636  GLU A OE2   1 
ATOM   36   N N     . GLU A 1 25  ? 18.037  8.923   -1.113  1.00 96.27  ? 637  GLU A N     1 
ATOM   37   C CA    . GLU A 1 25  ? 17.446  9.810   -2.121  1.00 93.97  ? 637  GLU A CA    1 
ATOM   38   C C     . GLU A 1 25  ? 16.265  9.186   -2.864  1.00 94.85  ? 637  GLU A C     1 
ATOM   39   O O     . GLU A 1 25  ? 16.340  8.023   -3.267  1.00 92.56  ? 637  GLU A O     1 
ATOM   40   C CB    . GLU A 1 25  ? 18.516  10.250  -3.134  1.00 94.31  ? 637  GLU A CB    1 
ATOM   41   N N     . VAL A 1 26  ? 15.193  9.978   -3.079  1.00 90.79  ? 638  VAL A N     1 
ATOM   42   C CA    . VAL A 1 26  ? 14.004  9.556   -3.827  1.00 87.57  ? 638  VAL A CA    1 
ATOM   43   C C     . VAL A 1 26  ? 14.401  9.544   -5.305  1.00 88.99  ? 638  VAL A C     1 
ATOM   44   O O     . VAL A 1 26  ? 14.770  10.585  -5.849  1.00 89.00  ? 638  VAL A O     1 
ATOM   45   C CB    . VAL A 1 26  ? 12.748  10.433  -3.533  1.00 92.05  ? 638  VAL A CB    1 
ATOM   46   C CG1   . VAL A 1 26  ? 11.569  10.035  -4.420  1.00 88.70  ? 638  VAL A CG1   1 
ATOM   47   C CG2   . VAL A 1 26  ? 12.351  10.352  -2.064  1.00 95.13  ? 638  VAL A CG2   1 
ATOM   48   N N     . ILE A 1 27  ? 14.394  8.353   -5.924  1.00 83.41  ? 639  ILE A N     1 
ATOM   49   C CA    . ILE A 1 27  ? 14.803  8.160   -7.321  1.00 80.36  ? 639  ILE A CA    1 
ATOM   50   C C     . ILE A 1 27  ? 13.613  8.195   -8.298  1.00 82.14  ? 639  ILE A C     1 
ATOM   51   O O     . ILE A 1 27  ? 13.816  8.446   -9.486  1.00 80.07  ? 639  ILE A O     1 
ATOM   52   C CB    . ILE A 1 27  ? 15.699  6.897   -7.517  1.00 82.55  ? 639  ILE A CB    1 
ATOM   53   C CG1   . ILE A 1 27  ? 15.084  5.629   -6.859  1.00 82.62  ? 639  ILE A CG1   1 
ATOM   54   C CG2   . ILE A 1 27  ? 17.137  7.167   -7.024  1.00 85.63  ? 639  ILE A CG2   1 
ATOM   55   C CD1   . ILE A 1 27  ? 15.700  4.280   -7.273  1.00 87.01  ? 639  ILE A CD1   1 
ATOM   56   N N     . GLY A 1 28  ? 12.400  7.970   -7.795  1.00 79.08  ? 640  GLY A N     1 
ATOM   57   C CA    . GLY A 1 28  ? 11.194  7.990   -8.615  1.00 76.96  ? 640  GLY A CA    1 
ATOM   58   C C     . GLY A 1 28  ? 9.913   7.642   -7.886  1.00 82.30  ? 640  GLY A C     1 
ATOM   59   O O     . GLY A 1 28  ? 9.874   7.644   -6.653  1.00 84.97  ? 640  GLY A O     1 
ATOM   60   N N     . ALA A 1 29  ? 8.849   7.352   -8.654  1.00 77.07  ? 641  ALA A N     1 
ATOM   61   C CA    . ALA A 1 29  ? 7.534   7.003   -8.113  1.00 77.36  ? 641  ALA A CA    1 
ATOM   62   C C     . ALA A 1 29  ? 7.023   5.644   -8.602  1.00 78.58  ? 641  ALA A C     1 
ATOM   63   O O     . ALA A 1 29  ? 7.322   5.240   -9.724  1.00 74.74  ? 641  ALA A O     1 
ATOM   64   C CB    . ALA A 1 29  ? 6.528   8.088   -8.456  1.00 77.98  ? 641  ALA A CB    1 
ATOM   65   N N     . GLY A 1 30  ? 6.264   4.969   -7.737  1.00 76.80  ? 642  GLY A N     1 
ATOM   66   C CA    . GLY A 1 30  ? 5.607   3.690   -7.996  1.00 75.33  ? 642  GLY A CA    1 
ATOM   67   C C     . GLY A 1 30  ? 4.095   3.845   -7.983  1.00 79.81  ? 642  GLY A C     1 
ATOM   68   O O     . GLY A 1 30  ? 3.590   4.927   -7.657  1.00 80.91  ? 642  GLY A O     1 
ATOM   69   N N     . GLU A 1 31  ? 3.347   2.784   -8.357  1.00 74.91  ? 643  GLU A N     1 
ATOM   70   C CA    . GLU A 1 31  ? 1.877   2.855   -8.405  1.00 74.73  ? 643  GLU A CA    1 
ATOM   71   C C     . GLU A 1 31  ? 1.208   2.878   -7.008  1.00 80.73  ? 643  GLU A C     1 
ATOM   72   O O     . GLU A 1 31  ? 0.038   3.253   -6.911  1.00 80.90  ? 643  GLU A O     1 
ATOM   73   C CB    . GLU A 1 31  ? 1.262   1.764   -9.312  1.00 74.11  ? 643  GLU A CB    1 
ATOM   74   C CG    . GLU A 1 31  ? 1.562   0.328   -8.917  1.00 86.13  ? 643  GLU A CG    1 
ATOM   75   C CD    . GLU A 1 31  ? 0.741   -0.726  -9.635  1.00 104.29 ? 643  GLU A CD    1 
ATOM   76   O OE1   . GLU A 1 31  ? -0.472  -0.840  -9.343  1.00 88.82  ? 643  GLU A OE1   1 
ATOM   77   O OE2   . GLU A 1 31  ? 1.322   -1.469  -10.459 1.00 99.02  ? 643  GLU A OE2   1 
ATOM   78   N N     . PHE A 1 32  ? 1.949   2.512   -5.940  1.00 78.92  ? 644  PHE A N     1 
ATOM   79   C CA    . PHE A 1 32  ? 1.436   2.506   -4.562  1.00 81.85  ? 644  PHE A CA    1 
ATOM   80   C C     . PHE A 1 32  ? 2.113   3.540   -3.644  1.00 87.44  ? 644  PHE A C     1 
ATOM   81   O O     . PHE A 1 32  ? 1.759   3.648   -2.467  1.00 89.55  ? 644  PHE A O     1 
ATOM   82   C CB    . PHE A 1 32  ? 1.498   1.094   -3.949  1.00 84.52  ? 644  PHE A CB    1 
ATOM   83   C CG    . PHE A 1 32  ? 0.732   0.041   -4.713  1.00 83.96  ? 644  PHE A CG    1 
ATOM   84   C CD1   . PHE A 1 32  ? -0.655  -0.021  -4.644  1.00 87.37  ? 644  PHE A CD1   1 
ATOM   85   C CD2   . PHE A 1 32  ? 1.398   -0.898  -5.491  1.00 83.91  ? 644  PHE A CD2   1 
ATOM   86   C CE1   . PHE A 1 32  ? -1.363  -0.993  -5.356  1.00 86.79  ? 644  PHE A CE1   1 
ATOM   87   C CE2   . PHE A 1 32  ? 0.690   -1.873  -6.201  1.00 85.14  ? 644  PHE A CE2   1 
ATOM   88   C CZ    . PHE A 1 32  ? -0.685  -1.907  -6.135  1.00 83.88  ? 644  PHE A CZ    1 
ATOM   89   N N     . GLY A 1 33  ? 3.062   4.292   -4.196  1.00 82.88  ? 645  GLY A N     1 
ATOM   90   C CA    . GLY A 1 33  ? 3.793   5.316   -3.462  1.00 84.97  ? 645  GLY A CA    1 
ATOM   91   C C     . GLY A 1 33  ? 5.093   5.719   -4.121  1.00 87.55  ? 645  GLY A C     1 
ATOM   92   O O     . GLY A 1 33  ? 5.140   5.913   -5.339  1.00 84.69  ? 645  GLY A O     1 
ATOM   93   N N     . GLU A 1 34  ? 6.157   5.844   -3.313  1.00 85.70  ? 646  GLU A N     1 
ATOM   94   C CA    . GLU A 1 34  ? 7.485   6.263   -3.769  1.00 84.72  ? 646  GLU A CA    1 
ATOM   95   C C     . GLU A 1 34  ? 8.498   5.108   -3.851  1.00 86.81  ? 646  GLU A C     1 
ATOM   96   O O     . GLU A 1 34  ? 8.328   4.075   -3.199  1.00 87.40  ? 646  GLU A O     1 
ATOM   97   C CB    . GLU A 1 34  ? 8.026   7.383   -2.863  1.00 89.49  ? 646  GLU A CB    1 
ATOM   98   C CG    . GLU A 1 34  ? 7.090   8.575   -2.720  1.00 103.79 ? 646  GLU A CG    1 
ATOM   99   C CD    . GLU A 1 34  ? 7.315   9.464   -1.511  1.00 135.40 ? 646  GLU A CD    1 
ATOM   100  O OE1   . GLU A 1 34  ? 7.656   8.934   -0.427  1.00 136.85 ? 646  GLU A OE1   1 
ATOM   101  O OE2   . GLU A 1 34  ? 7.098   10.691  -1.635  1.00 132.86 ? 646  GLU A OE2   1 
ATOM   102  N N     . VAL A 1 35  ? 9.542   5.292   -4.682  1.00 80.59  ? 647  VAL A N     1 
ATOM   103  C CA    . VAL A 1 35  ? 10.659  4.363   -4.884  1.00 78.89  ? 647  VAL A CA    1 
ATOM   104  C C     . VAL A 1 35  ? 11.921  5.191   -4.615  1.00 83.15  ? 647  VAL A C     1 
ATOM   105  O O     . VAL A 1 35  ? 12.103  6.242   -5.236  1.00 81.57  ? 647  VAL A O     1 
ATOM   106  C CB    . VAL A 1 35  ? 10.679  3.711   -6.296  1.00 79.08  ? 647  VAL A CB    1 
ATOM   107  C CG1   . VAL A 1 35  ? 11.728  2.601   -6.373  1.00 78.46  ? 647  VAL A CG1   1 
ATOM   108  C CG2   . VAL A 1 35  ? 9.303   3.176   -6.696  1.00 77.17  ? 647  VAL A CG2   1 
ATOM   109  N N     . CYS A 1 36  ? 12.767  4.743   -3.664  1.00 82.17  ? 648  CYS A N     1 
ATOM   110  C CA    . CYS A 1 36  ? 13.966  5.484   -3.253  1.00 84.09  ? 648  CYS A CA    1 
ATOM   111  C C     . CYS A 1 36  ? 15.203  4.613   -3.006  1.00 87.33  ? 648  CYS A C     1 
ATOM   112  O O     . CYS A 1 36  ? 15.088  3.433   -2.691  1.00 87.20  ? 648  CYS A O     1 
ATOM   113  C CB    . CYS A 1 36  ? 13.661  6.362   -2.041  1.00 88.12  ? 648  CYS A CB    1 
ATOM   114  S SG    . CYS A 1 36  ? 12.512  5.622   -0.852  1.00 94.05  ? 648  CYS A SG    1 
ATOM   115  N N     . ARG A 1 37  ? 16.390  5.220   -3.145  1.00 82.98  ? 649  ARG A N     1 
ATOM   116  C CA    . ARG A 1 37  ? 17.686  4.591   -2.907  1.00 82.80  ? 649  ARG A CA    1 
ATOM   117  C C     . ARG A 1 37  ? 18.010  4.785   -1.422  1.00 90.02  ? 649  ARG A C     1 
ATOM   118  O O     . ARG A 1 37  ? 17.766  5.865   -0.878  1.00 91.85  ? 649  ARG A O     1 
ATOM   119  C CB    . ARG A 1 37  ? 18.752  5.267   -3.788  1.00 81.18  ? 649  ARG A CB    1 
ATOM   120  C CG    . ARG A 1 37  ? 20.138  4.652   -3.708  1.00 92.55  ? 649  ARG A CG    1 
ATOM   121  C CD    . ARG A 1 37  ? 21.166  5.539   -4.371  1.00 103.34 ? 649  ARG A CD    1 
ATOM   122  N NE    . ARG A 1 37  ? 22.507  4.969   -4.268  1.00 116.88 ? 649  ARG A NE    1 
ATOM   123  C CZ    . ARG A 1 37  ? 23.601  5.520   -4.784  1.00 134.21 ? 649  ARG A CZ    1 
ATOM   124  N NH1   . ARG A 1 37  ? 23.525  6.668   -5.449  1.00 120.79 ? 649  ARG A NH1   1 
ATOM   125  N NH2   . ARG A 1 37  ? 24.779  4.929   -4.641  1.00 123.45 ? 649  ARG A NH2   1 
ATOM   126  N N     . GLY A 1 38  ? 18.536  3.743   -0.785  1.00 86.66  ? 650  GLY A N     1 
ATOM   127  C CA    . GLY A 1 38  ? 18.897  3.774   0.627   1.00 89.92  ? 650  GLY A CA    1 
ATOM   128  C C     . GLY A 1 38  ? 19.988  2.798   1.006   1.00 93.84  ? 650  GLY A C     1 
ATOM   129  O O     . GLY A 1 38  ? 20.684  2.271   0.137   1.00 91.41  ? 650  GLY A O     1 
ATOM   130  N N     . ARG A 1 39  ? 20.148  2.559   2.317   1.00 93.31  ? 651  ARG A N     1 
ATOM   131  C CA    . ARG A 1 39  ? 21.155  1.642   2.862   1.00 94.65  ? 651  ARG A CA    1 
ATOM   132  C C     . ARG A 1 39  ? 20.523  0.654   3.844   1.00 99.31  ? 651  ARG A C     1 
ATOM   133  O O     . ARG A 1 39  ? 19.621  1.028   4.593   1.00 100.67 ? 651  ARG A O     1 
ATOM   134  C CB    . ARG A 1 39  ? 22.276  2.424   3.549   1.00 20.00  ? 651  ARG A CB    1 
ATOM   135  N N     . LEU A 1 40  ? 21.002  -0.600  3.846   1.00 95.26  ? 652  LEU A N     1 
ATOM   136  C CA    . LEU A 1 40  ? 20.517  -1.647  4.745   1.00 97.07  ? 652  LEU A CA    1 
ATOM   137  C C     . LEU A 1 40  ? 21.657  -2.218  5.592   1.00 105.79 ? 652  LEU A C     1 
ATOM   138  O O     . LEU A 1 40  ? 22.691  -2.619  5.050   1.00 104.58 ? 652  LEU A O     1 
ATOM   139  C CB    . LEU A 1 40  ? 19.786  -2.760  3.961   1.00 93.28  ? 652  LEU A CB    1 
ATOM   140  C CG    . LEU A 1 40  ? 19.460  -4.077  4.692   1.00 99.23  ? 652  LEU A CG    1 
ATOM   141  C CD1   . LEU A 1 40  ? 18.310  -3.913  5.685   1.00 103.97 ? 652  LEU A CD1   1 
ATOM   142  C CD2   . LEU A 1 40  ? 19.168  -5.188  3.705   1.00 95.38  ? 652  LEU A CD2   1 
ATOM   143  N N     . LYS A 1 41  ? 21.452  -2.255  6.920   1.00 107.22 ? 653  LYS A N     1 
ATOM   144  C CA    . LYS A 1 41  ? 22.409  -2.786  7.886   1.00 111.55 ? 653  LYS A CA    1 
ATOM   145  C C     . LYS A 1 41  ? 21.888  -4.097  8.483   1.00 117.04 ? 653  LYS A C     1 
ATOM   146  O O     . LYS A 1 41  ? 21.150  -4.086  9.474   1.00 119.16 ? 653  LYS A O     1 
ATOM   147  C CB    . LYS A 1 41  ? 22.723  -1.750  8.979   1.00 119.09 ? 653  LYS A CB    1 
ATOM   148  N N     . GLN A 1 42  ? 22.252  -5.226  7.846   1.00 111.74 ? 654  GLN A N     1 
ATOM   149  C CA    . GLN A 1 42  ? 21.873  -6.570  8.281   1.00 112.52 ? 654  GLN A CA    1 
ATOM   150  C C     . GLN A 1 42  ? 22.654  -6.949  9.558   1.00 122.25 ? 654  GLN A C     1 
ATOM   151  O O     . GLN A 1 42  ? 23.821  -6.558  9.678   1.00 123.68 ? 654  GLN A O     1 
ATOM   152  C CB    . GLN A 1 42  ? 22.143  -7.584  7.163   1.00 110.02 ? 654  GLN A CB    1 
ATOM   153  N N     . PRO A 1 43  ? 22.044  -7.675  10.535  1.00 122.08 ? 655  PRO A N     1 
ATOM   154  C CA    . PRO A 1 43  ? 22.791  -8.025  11.758  1.00 127.21 ? 655  PRO A CA    1 
ATOM   155  C C     . PRO A 1 43  ? 23.862  -9.087  11.491  1.00 130.47 ? 655  PRO A C     1 
ATOM   156  O O     . PRO A 1 43  ? 23.546  -10.263 11.283  1.00 128.01 ? 655  PRO A O     1 
ATOM   157  C CB    . PRO A 1 43  ? 21.698  -8.504  12.731  1.00 131.45 ? 655  PRO A CB    1 
ATOM   158  C CG    . PRO A 1 43  ? 20.381  -8.223  12.049  1.00 131.83 ? 655  PRO A CG    1 
ATOM   159  C CD    . PRO A 1 43  ? 20.671  -8.211  10.585  1.00 122.29 ? 655  PRO A CD    1 
ATOM   160  N N     . GLY A 1 44  ? 25.117  -8.639  11.452  1.00 128.19 ? 656  GLY A N     1 
ATOM   161  C CA    . GLY A 1 44  ? 26.273  -9.488  11.188  1.00 128.39 ? 656  GLY A CA    1 
ATOM   162  C C     . GLY A 1 44  ? 26.952  -9.231  9.856   1.00 128.28 ? 656  GLY A C     1 
ATOM   163  O O     . GLY A 1 44  ? 28.179  -9.320  9.765   1.00 128.58 ? 656  GLY A O     1 
ATOM   164  N N     . ARG A 1 45  ? 26.158  -8.918  8.810   1.00 120.75 ? 657  ARG A N     1 
ATOM   165  C CA    . ARG A 1 45  ? 26.646  -8.653  7.451   1.00 116.65 ? 657  ARG A CA    1 
ATOM   166  C C     . ARG A 1 45  ? 26.941  -7.166  7.171   1.00 121.17 ? 657  ARG A C     1 
ATOM   167  O O     . ARG A 1 45  ? 26.416  -6.286  7.860   1.00 123.02 ? 657  ARG A O     1 
ATOM   168  C CB    . ARG A 1 45  ? 25.675  -9.229  6.409   1.00 111.50 ? 657  ARG A CB    1 
ATOM   169  N N     . ARG A 1 46  ? 27.790  -6.904  6.148   1.00 115.46 ? 658  ARG A N     1 
ATOM   170  C CA    . ARG A 1 46  ? 28.212  -5.570  5.694   1.00 114.57 ? 658  ARG A CA    1 
ATOM   171  C C     . ARG A 1 46  ? 27.041  -4.734  5.166   1.00 113.75 ? 658  ARG A C     1 
ATOM   172  O O     . ARG A 1 46  ? 26.053  -5.295  4.681   1.00 110.16 ? 658  ARG A O     1 
ATOM   173  C CB    . ARG A 1 46  ? 29.282  -5.700  4.596   1.00 113.44 ? 658  ARG A CB    1 
ATOM   174  C CG    . ARG A 1 46  ? 30.706  -5.451  5.071   1.00 130.06 ? 658  ARG A CG    1 
ATOM   175  C CD    . ARG A 1 46  ? 31.663  -5.412  3.895   1.00 139.92 ? 658  ARG A CD    1 
ATOM   176  N NE    . ARG A 1 46  ? 33.012  -5.002  4.288   1.00 150.60 ? 658  ARG A NE    1 
ATOM   177  C CZ    . ARG A 1 46  ? 34.024  -5.838  4.494   1.00 166.51 ? 658  ARG A CZ    1 
ATOM   178  N NH1   . ARG A 1 46  ? 33.852  -7.148  4.357   1.00 156.37 ? 658  ARG A NH1   1 
ATOM   179  N NH2   . ARG A 1 46  ? 35.215  -5.374  4.845   1.00 155.95 ? 658  ARG A NH2   1 
ATOM   180  N N     . GLU A 1 47  ? 27.164  -3.392  5.242   1.00 110.20 ? 659  GLU A N     1 
ATOM   181  C CA    . GLU A 1 47  ? 26.139  -2.465  4.756   1.00 107.01 ? 659  GLU A CA    1 
ATOM   182  C C     . GLU A 1 47  ? 26.165  -2.393  3.226   1.00 104.69 ? 659  GLU A C     1 
ATOM   183  O O     . GLU A 1 47  ? 27.227  -2.223  2.623   1.00 103.79 ? 659  GLU A O     1 
ATOM   184  C CB    . GLU A 1 47  ? 26.296  -1.068  5.383   1.00 111.47 ? 659  GLU A CB    1 
ATOM   185  C CG    . GLU A 1 47  ? 25.090  -0.161  5.176   1.00 119.76 ? 659  GLU A CG    1 
ATOM   186  C CD    . GLU A 1 47  ? 25.331  1.316   5.424   1.00 144.12 ? 659  GLU A CD    1 
ATOM   187  O OE1   . GLU A 1 47  ? 26.258  1.883   4.802   1.00 140.38 ? 659  GLU A OE1   1 
ATOM   188  O OE2   . GLU A 1 47  ? 24.560  1.918   6.205   1.00 140.18 ? 659  GLU A OE2   1 
ATOM   189  N N     . VAL A 1 48  ? 24.987  -2.536  2.612   1.00 96.84  ? 660  VAL A N     1 
ATOM   190  C CA    . VAL A 1 48  ? 24.804  -2.510  1.158   1.00 91.63  ? 660  VAL A CA    1 
ATOM   191  C C     . VAL A 1 48  ? 23.798  -1.442  0.726   1.00 92.75  ? 660  VAL A C     1 
ATOM   192  O O     . VAL A 1 48  ? 22.962  -1.018  1.530   1.00 93.58  ? 660  VAL A O     1 
ATOM   193  C CB    . VAL A 1 48  ? 24.425  -3.905  0.586   1.00 92.49  ? 660  VAL A CB    1 
ATOM   194  C CG1   . VAL A 1 48  ? 25.618  -4.856  0.602   1.00 93.47  ? 660  VAL A CG1   1 
ATOM   195  C CG2   . VAL A 1 48  ? 23.222  -4.511  1.311   1.00 92.60  ? 660  VAL A CG2   1 
ATOM   196  N N     . PHE A 1 49  ? 23.869  -1.022  -0.551  1.00 85.61  ? 661  PHE A N     1 
ATOM   197  C CA    . PHE A 1 49  ? 22.923  -0.063  -1.114  1.00 82.88  ? 661  PHE A CA    1 
ATOM   198  C C     . PHE A 1 49  ? 21.687  -0.836  -1.544  1.00 82.39  ? 661  PHE A C     1 
ATOM   199  O O     . PHE A 1 49  ? 21.810  -1.887  -2.171  1.00 80.40  ? 661  PHE A O     1 
ATOM   200  C CB    . PHE A 1 49  ? 23.542  0.727   -2.281  1.00 82.88  ? 661  PHE A CB    1 
ATOM   201  C CG    . PHE A 1 49  ? 24.450  1.848   -1.827  1.00 87.78  ? 661  PHE A CG    1 
ATOM   202  C CD1   . PHE A 1 49  ? 23.937  3.105   -1.533  1.00 91.98  ? 661  PHE A CD1   1 
ATOM   203  C CD2   . PHE A 1 49  ? 25.816  1.639   -1.669  1.00 92.17  ? 661  PHE A CD2   1 
ATOM   204  C CE1   . PHE A 1 49  ? 24.775  4.137   -1.099  1.00 96.02  ? 661  PHE A CE1   1 
ATOM   205  C CE2   . PHE A 1 49  ? 26.654  2.671   -1.236  1.00 97.95  ? 661  PHE A CE2   1 
ATOM   206  C CZ    . PHE A 1 49  ? 26.127  3.913   -0.956  1.00 97.09  ? 661  PHE A CZ    1 
ATOM   207  N N     . VAL A 1 50  ? 20.502  -0.357  -1.147  1.00 77.86  ? 662  VAL A N     1 
ATOM   208  C CA    . VAL A 1 50  ? 19.222  -1.005  -1.451  1.00 74.52  ? 662  VAL A CA    1 
ATOM   209  C C     . VAL A 1 50  ? 18.213  -0.041  -2.090  1.00 75.77  ? 662  VAL A C     1 
ATOM   210  O O     . VAL A 1 50  ? 18.381  1.176   -2.004  1.00 76.23  ? 662  VAL A O     1 
ATOM   211  C CB    . VAL A 1 50  ? 18.609  -1.740  -0.220  1.00 80.34  ? 662  VAL A CB    1 
ATOM   212  C CG1   . VAL A 1 50  ? 19.427  -2.969  0.169   1.00 81.29  ? 662  VAL A CG1   1 
ATOM   213  C CG2   . VAL A 1 50  ? 18.415  -0.802  0.969   1.00 83.69  ? 662  VAL A CG2   1 
ATOM   214  N N     . ALA A 1 51  ? 17.173  -0.607  -2.737  1.00 69.13  ? 663  ALA A N     1 
ATOM   215  C CA    . ALA A 1 51  ? 16.043  0.089   -3.346  1.00 66.92  ? 663  ALA A CA    1 
ATOM   216  C C     . ALA A 1 51  ? 14.858  -0.157  -2.415  1.00 72.74  ? 663  ALA A C     1 
ATOM   217  O O     . ALA A 1 51  ? 14.563  -1.304  -2.075  1.00 72.02  ? 663  ALA A O     1 
ATOM   218  C CB    . ALA A 1 51  ? 15.756  -0.471  -4.735  1.00 63.74  ? 663  ALA A CB    1 
ATOM   219  N N     . ILE A 1 52  ? 14.226  0.924   -1.957  1.00 72.24  ? 664  ILE A N     1 
ATOM   220  C CA    . ILE A 1 52  ? 13.118  0.901   -1.001  1.00 74.63  ? 664  ILE A CA    1 
ATOM   221  C C     . ILE A 1 52  ? 11.823  1.440   -1.628  1.00 78.28  ? 664  ILE A C     1 
ATOM   222  O O     . ILE A 1 52  ? 11.809  2.560   -2.145  1.00 77.52  ? 664  ILE A O     1 
ATOM   223  C CB    . ILE A 1 52  ? 13.517  1.694   0.289   1.00 81.68  ? 664  ILE A CB    1 
ATOM   224  C CG1   . ILE A 1 52  ? 14.826  1.155   0.908   1.00 84.34  ? 664  ILE A CG1   1 
ATOM   225  C CG2   . ILE A 1 52  ? 12.375  1.727   1.318   1.00 84.47  ? 664  ILE A CG2   1 
ATOM   226  C CD1   . ILE A 1 52  ? 15.655  2.193   1.659   1.00 95.11  ? 664  ILE A CD1   1 
ATOM   227  N N     . LYS A 1 53  ? 10.738  0.647   -1.549  1.00 75.02  ? 665  LYS A N     1 
ATOM   228  C CA    . LYS A 1 53  ? 9.398   1.011   -2.022  1.00 73.60  ? 665  LYS A CA    1 
ATOM   229  C C     . LYS A 1 53  ? 8.546   1.377   -0.799  1.00 80.73  ? 665  LYS A C     1 
ATOM   230  O O     . LYS A 1 53  ? 8.521   0.616   0.164   1.00 82.52  ? 665  LYS A O     1 
ATOM   231  C CB    . LYS A 1 53  ? 8.759   -0.163  -2.779  1.00 73.69  ? 665  LYS A CB    1 
ATOM   232  C CG    . LYS A 1 53  ? 8.665   0.044   -4.287  1.00 84.24  ? 665  LYS A CG    1 
ATOM   233  C CD    . LYS A 1 53  ? 8.255   -1.235  -5.024  1.00 91.69  ? 665  LYS A CD    1 
ATOM   234  C CE    . LYS A 1 53  ? 6.764   -1.459  -5.114  1.00 101.13 ? 665  LYS A CE    1 
ATOM   235  N NZ    . LYS A 1 53  ? 6.449   -2.777  -5.723  1.00 105.84 ? 665  LYS A NZ    1 
ATOM   236  N N     . THR A 1 54  ? 7.869   2.536   -0.824  1.00 78.09  ? 666  THR A N     1 
ATOM   237  C CA    . THR A 1 54  ? 7.037   2.983   0.306   1.00 81.35  ? 666  THR A CA    1 
ATOM   238  C C     . THR A 1 54  ? 5.551   3.071   -0.044  1.00 84.77  ? 666  THR A C     1 
ATOM   239  O O     . THR A 1 54  ? 5.208   3.462   -1.158  1.00 81.67  ? 666  THR A O     1 
ATOM   240  C CB    . THR A 1 54  ? 7.547   4.312   0.888   1.00 89.71  ? 666  THR A CB    1 
ATOM   241  O OG1   . THR A 1 54  ? 7.672   5.278   -0.158  1.00 84.80  ? 666  THR A OG1   1 
ATOM   242  C CG2   . THR A 1 54  ? 8.866   4.161   1.635   1.00 90.63  ? 666  THR A CG2   1 
ATOM   243  N N     . LEU A 1 55  ? 4.671   2.718   0.915   1.00 83.92  ? 667  LEU A N     1 
ATOM   244  C CA    . LEU A 1 55  ? 3.221   2.787   0.729   1.00 83.15  ? 667  LEU A CA    1 
ATOM   245  C C     . LEU A 1 55  ? 2.715   4.179   1.115   1.00 90.22  ? 667  LEU A C     1 
ATOM   246  O O     . LEU A 1 55  ? 2.958   4.643   2.234   1.00 92.90  ? 667  LEU A O     1 
ATOM   247  C CB    . LEU A 1 55  ? 2.489   1.675   1.514   1.00 84.75  ? 667  LEU A CB    1 
ATOM   248  C CG    . LEU A 1 55  ? 0.985   1.476   1.229   1.00 88.29  ? 667  LEU A CG    1 
ATOM   249  C CD1   . LEU A 1 55  ? 0.735   0.984   -0.189  1.00 84.39  ? 667  LEU A CD1   1 
ATOM   250  C CD2   . LEU A 1 55  ? 0.378   0.492   2.196   1.00 92.90  ? 667  LEU A CD2   1 
ATOM   251  N N     . LYS A 1 56  ? 2.024   4.843   0.162   1.00 85.50  ? 668  LYS A N     1 
ATOM   252  C CA    . LYS A 1 56  ? 1.457   6.189   0.280   1.00 86.55  ? 668  LYS A CA    1 
ATOM   253  C C     . LYS A 1 56  ? 0.602   6.379   1.531   1.00 95.29  ? 668  LYS A C     1 
ATOM   254  O O     . LYS A 1 56  ? -0.072  5.443   1.968   1.00 95.53  ? 668  LYS A O     1 
ATOM   255  C CB    . LYS A 1 56  ? 0.641   6.536   -0.975  1.00 85.47  ? 668  LYS A CB    1 
ATOM   256  N N     . VAL A 1 57  ? 0.645   7.597   2.107   1.00 95.30  ? 669  VAL A N     1 
ATOM   257  C CA    . VAL A 1 57  ? -0.135  7.972   3.291   1.00 99.37  ? 669  VAL A CA    1 
ATOM   258  C C     . VAL A 1 57  ? -1.601  8.093   2.840   1.00 103.52 ? 669  VAL A C     1 
ATOM   259  O O     . VAL A 1 57  ? -1.883  8.736   1.823   1.00 100.57 ? 669  VAL A O     1 
ATOM   260  C CB    . VAL A 1 57  ? 0.405   9.268   3.972   1.00 105.99 ? 669  VAL A CB    1 
ATOM   261  C CG1   . VAL A 1 57  ? -0.434  9.656   5.189   1.00 109.97 ? 669  VAL A CG1   1 
ATOM   262  C CG2   . VAL A 1 57  ? 1.874   9.118   4.368   1.00 106.74 ? 669  VAL A CG2   1 
ATOM   263  N N     . GLY A 1 58  ? -2.494  7.425   3.569   1.00 102.86 ? 670  GLY A N     1 
ATOM   264  C CA    . GLY A 1 58  ? -3.918  7.395   3.260   1.00 102.49 ? 670  GLY A CA    1 
ATOM   265  C C     . GLY A 1 58  ? -4.226  6.377   2.182   1.00 103.48 ? 670  GLY A C     1 
ATOM   266  O O     . GLY A 1 58  ? -4.806  6.715   1.146   1.00 100.72 ? 670  GLY A O     1 
ATOM   267  N N     . TYR A 1 59  ? -3.802  5.123   2.421   1.00 100.07 ? 671  TYR A N     1 
ATOM   268  C CA    . TYR A 1 59  ? -3.979  3.973   1.533   1.00 96.86  ? 671  TYR A CA    1 
ATOM   269  C C     . TYR A 1 59  ? -5.271  3.221   1.875   1.00 102.61 ? 671  TYR A C     1 
ATOM   270  O O     . TYR A 1 59  ? -5.711  3.252   3.028   1.00 105.74 ? 671  TYR A O     1 
ATOM   271  C CB    . TYR A 1 59  ? -2.759  3.028   1.632   1.00 97.27  ? 671  TYR A CB    1 
ATOM   272  C CG    . TYR A 1 59  ? -2.465  2.527   3.034   1.00 102.95 ? 671  TYR A CG    1 
ATOM   273  C CD1   . TYR A 1 59  ? -3.003  1.329   3.496   1.00 106.30 ? 671  TYR A CD1   1 
ATOM   274  C CD2   . TYR A 1 59  ? -1.624  3.236   3.889   1.00 106.14 ? 671  TYR A CD2   1 
ATOM   275  C CE1   . TYR A 1 59  ? -2.741  0.866   4.785   1.00 110.80 ? 671  TYR A CE1   1 
ATOM   276  C CE2   . TYR A 1 59  ? -1.353  2.782   5.180   1.00 110.63 ? 671  TYR A CE2   1 
ATOM   277  C CZ    . TYR A 1 59  ? -1.911  1.593   5.622   1.00 118.13 ? 671  TYR A CZ    1 
ATOM   278  O OH    . TYR A 1 59  ? -1.640  1.133   6.887   1.00 121.65 ? 671  TYR A OH    1 
ATOM   279  N N     . THR A 1 60  ? -5.862  2.531   0.881   1.00 96.90  ? 672  THR A N     1 
ATOM   280  C CA    . THR A 1 60  ? -7.090  1.745   1.066   1.00 98.07  ? 672  THR A CA    1 
ATOM   281  C C     . THR A 1 60  ? -6.761  0.293   1.470   1.00 102.83 ? 672  THR A C     1 
ATOM   282  O O     . THR A 1 60  ? -5.585  -0.090  1.473   1.00 101.62 ? 672  THR A O     1 
ATOM   283  C CB    . THR A 1 60  ? -7.992  1.817   -0.186  1.00 103.07 ? 672  THR A CB    1 
ATOM   284  O OG1   . THR A 1 60  ? -7.285  1.316   -1.318  1.00 96.99  ? 672  THR A OG1   1 
ATOM   285  C CG2   . THR A 1 60  ? -8.512  3.223   -0.467  1.00 102.44 ? 672  THR A CG2   1 
ATOM   286  N N     . GLU A 1 61  ? -7.798  -0.506  1.817   1.00 100.98 ? 673  GLU A N     1 
ATOM   287  C CA    . GLU A 1 61  ? -7.657  -1.917  2.195   1.00 101.58 ? 673  GLU A CA    1 
ATOM   288  C C     . GLU A 1 61  ? -7.127  -2.751  1.019   1.00 100.93 ? 673  GLU A C     1 
ATOM   289  O O     . GLU A 1 61  ? -6.282  -3.624  1.224   1.00 100.51 ? 673  GLU A O     1 
ATOM   290  C CB    . GLU A 1 61  ? -8.992  -2.485  2.704   1.00 105.62 ? 673  GLU A CB    1 
ATOM   291  N N     . ARG A 1 62  ? -7.600  -2.452  -0.209  1.00 93.70  ? 674  ARG A N     1 
ATOM   292  C CA    . ARG A 1 62  ? -7.193  -3.127  -1.440  1.00 89.65  ? 674  ARG A CA    1 
ATOM   293  C C     . ARG A 1 62  ? -5.746  -2.790  -1.819  1.00 90.59  ? 674  ARG A C     1 
ATOM   294  O O     . ARG A 1 62  ? -4.998  -3.695  -2.195  1.00 88.73  ? 674  ARG A O     1 
ATOM   295  C CB    . ARG A 1 62  ? -8.154  -2.787  -2.591  1.00 88.18  ? 674  ARG A CB    1 
ATOM   296  N N     . GLN A 1 63  ? -5.353  -1.498  -1.696  1.00 86.14  ? 675  GLN A N     1 
ATOM   297  C CA    . GLN A 1 63  ? -4.011  -0.986  -2.002  1.00 83.63  ? 675  GLN A CA    1 
ATOM   298  C C     . GLN A 1 63  ? -2.918  -1.624  -1.143  1.00 87.82  ? 675  GLN A C     1 
ATOM   299  O O     . GLN A 1 63  ? -1.830  -1.887  -1.656  1.00 84.78  ? 675  GLN A O     1 
ATOM   300  C CB    . GLN A 1 63  ? -3.967  0.539   -1.870  1.00 85.51  ? 675  GLN A CB    1 
ATOM   301  C CG    . GLN A 1 63  ? -4.498  1.270   -3.097  1.00 100.34 ? 675  GLN A CG    1 
ATOM   302  C CD    . GLN A 1 63  ? -4.797  2.732   -2.853  1.00 121.62 ? 675  GLN A CD    1 
ATOM   303  O OE1   . GLN A 1 63  ? -4.929  3.202   -1.713  1.00 119.66 ? 675  GLN A OE1   1 
ATOM   304  N NE2   . GLN A 1 63  ? -4.951  3.481   -3.934  1.00 112.78 ? 675  GLN A NE2   1 
ATOM   305  N N     . ARG A 1 64  ? -3.204  -1.867  0.159   1.00 87.72  ? 676  ARG A N     1 
ATOM   306  C CA    . ARG A 1 64  ? -2.260  -2.503  1.085   1.00 89.20  ? 676  ARG A CA    1 
ATOM   307  C C     . ARG A 1 64  ? -2.077  -3.989  0.726   1.00 91.21  ? 676  ARG A C     1 
ATOM   308  O O     . ARG A 1 64  ? -0.956  -4.500  0.800   1.00 90.07  ? 676  ARG A O     1 
ATOM   309  C CB    . ARG A 1 64  ? -2.716  -2.338  2.543   1.00 93.59  ? 676  ARG A CB    1 
ATOM   310  C CG    . ARG A 1 64  ? -1.586  -2.536  3.548   1.00 103.48 ? 676  ARG A CG    1 
ATOM   311  C CD    . ARG A 1 64  ? -2.094  -2.761  4.956   1.00 110.15 ? 676  ARG A CD    1 
ATOM   312  N NE    . ARG A 1 64  ? -0.998  -3.064  5.878   1.00 113.84 ? 676  ARG A NE    1 
ATOM   313  C CZ    . ARG A 1 64  ? -0.606  -4.292  6.203   1.00 123.63 ? 676  ARG A CZ    1 
ATOM   314  N NH1   . ARG A 1 64  ? -1.221  -5.351  5.691   1.00 106.53 ? 676  ARG A NH1   1 
ATOM   315  N NH2   . ARG A 1 64  ? 0.402   -4.471  7.046   1.00 110.96 ? 676  ARG A NH2   1 
ATOM   316  N N     . ARG A 1 65  ? -3.179  -4.665  0.323   1.00 87.02  ? 677  ARG A N     1 
ATOM   317  C CA    . ARG A 1 65  ? -3.187  -6.070  -0.094  1.00 85.76  ? 677  ARG A CA    1 
ATOM   318  C C     . ARG A 1 65  ? -2.400  -6.239  -1.396  1.00 85.85  ? 677  ARG A C     1 
ATOM   319  O O     . ARG A 1 65  ? -1.575  -7.150  -1.490  1.00 84.54  ? 677  ARG A O     1 
ATOM   320  C CB    . ARG A 1 65  ? -4.626  -6.583  -0.291  1.00 86.03  ? 677  ARG A CB    1 
ATOM   321  C CG    . ARG A 1 65  ? -5.326  -7.005  0.985   1.00 100.85 ? 677  ARG A CG    1 
ATOM   322  C CD    . ARG A 1 65  ? -6.685  -7.605  0.679   1.00 114.12 ? 677  ARG A CD    1 
ATOM   323  N NE    . ARG A 1 65  ? -7.549  -7.641  1.861   1.00 130.01 ? 677  ARG A NE    1 
ATOM   324  C CZ    . ARG A 1 65  ? -8.813  -8.057  1.857   1.00 147.70 ? 677  ARG A CZ    1 
ATOM   325  N NH1   . ARG A 1 65  ? -9.376  -8.483  0.733   1.00 132.88 ? 677  ARG A NH1   1 
ATOM   326  N NH2   . ARG A 1 65  ? -9.523  -8.051  2.978   1.00 140.43 ? 677  ARG A NH2   1 
ATOM   327  N N     . ASP A 1 66  ? -2.651  -5.352  -2.385  1.00 80.24  ? 678  ASP A N     1 
ATOM   328  C CA    . ASP A 1 66  ? -2.012  -5.371  -3.706  1.00 76.63  ? 678  ASP A CA    1 
ATOM   329  C C     . ASP A 1 66  ? -0.514  -5.058  -3.666  1.00 79.33  ? 678  ASP A C     1 
ATOM   330  O O     . ASP A 1 66  ? 0.255   -5.714  -4.366  1.00 76.35  ? 678  ASP A O     1 
ATOM   331  C CB    . ASP A 1 66  ? -2.753  -4.449  -4.690  1.00 76.56  ? 678  ASP A CB    1 
ATOM   332  C CG    . ASP A 1 66  ? -4.182  -4.866  -5.000  1.00 86.56  ? 678  ASP A CG    1 
ATOM   333  O OD1   . ASP A 1 66  ? -4.465  -6.090  -4.991  1.00 87.27  ? 678  ASP A OD1   1 
ATOM   334  O OD2   . ASP A 1 66  ? -5.014  -3.972  -5.261  1.00 92.12  ? 678  ASP A OD2   1 
ATOM   335  N N     . PHE A 1 67  ? -0.104  -4.070  -2.845  1.00 77.99  ? 679  PHE A N     1 
ATOM   336  C CA    . PHE A 1 67  ? 1.299   -3.687  -2.660  1.00 77.90  ? 679  PHE A CA    1 
ATOM   337  C C     . PHE A 1 67  ? 2.088   -4.868  -2.074  1.00 82.88  ? 679  PHE A C     1 
ATOM   338  O O     . PHE A 1 67  ? 3.141   -5.216  -2.609  1.00 80.43  ? 679  PHE A O     1 
ATOM   339  C CB    . PHE A 1 67  ? 1.394   -2.444  -1.747  1.00 82.21  ? 679  PHE A CB    1 
ATOM   340  C CG    . PHE A 1 67  ? 2.770   -1.946  -1.359  1.00 84.48  ? 679  PHE A CG    1 
ATOM   341  C CD1   . PHE A 1 67  ? 3.600   -1.341  -2.295  1.00 85.22  ? 679  PHE A CD1   1 
ATOM   342  C CD2   . PHE A 1 67  ? 3.202   -2.007  -0.041  1.00 89.78  ? 679  PHE A CD2   1 
ATOM   343  C CE1   . PHE A 1 67  ? 4.853   -0.841  -1.927  1.00 86.98  ? 679  PHE A CE1   1 
ATOM   344  C CE2   . PHE A 1 67  ? 4.457   -1.513  0.325   1.00 93.52  ? 679  PHE A CE2   1 
ATOM   345  C CZ    . PHE A 1 67  ? 5.271   -0.925  -0.618  1.00 89.13  ? 679  PHE A CZ    1 
ATOM   346  N N     . LEU A 1 68  ? 1.544   -5.509  -1.015  1.00 82.43  ? 680  LEU A N     1 
ATOM   347  C CA    . LEU A 1 68  ? 2.170   -6.644  -0.338  1.00 83.73  ? 680  LEU A CA    1 
ATOM   348  C C     . LEU A 1 68  ? 2.152   -7.942  -1.142  1.00 85.00  ? 680  LEU A C     1 
ATOM   349  O O     . LEU A 1 68  ? 3.099   -8.718  -1.015  1.00 84.74  ? 680  LEU A O     1 
ATOM   350  C CB    . LEU A 1 68  ? 1.587   -6.875  1.068   1.00 87.91  ? 680  LEU A CB    1 
ATOM   351  C CG    . LEU A 1 68  ? 1.923   -5.842  2.158   1.00 95.69  ? 680  LEU A CG    1 
ATOM   352  C CD1   . LEU A 1 68  ? 1.298   -6.239  3.478   1.00 100.20 ? 680  LEU A CD1   1 
ATOM   353  C CD2   . LEU A 1 68  ? 3.428   -5.684  2.355   1.00 98.00  ? 680  LEU A CD2   1 
ATOM   354  N N     . SER A 1 69  ? 1.096   -8.196  -1.956  1.00 79.31  ? 681  SER A N     1 
ATOM   355  C CA    . SER A 1 69  ? 1.021   -9.419  -2.771  1.00 77.06  ? 681  SER A CA    1 
ATOM   356  C C     . SER A 1 69  ? 2.133   -9.455  -3.828  1.00 77.51  ? 681  SER A C     1 
ATOM   357  O O     . SER A 1 69  ? 2.635   -10.535 -4.140  1.00 76.78  ? 681  SER A O     1 
ATOM   358  C CB    . SER A 1 69  ? -0.358  -9.600  -3.400  1.00 79.84  ? 681  SER A CB    1 
ATOM   359  O OG    . SER A 1 69  ? -0.626  -8.644  -4.413  1.00 87.72  ? 681  SER A OG    1 
ATOM   360  N N     . GLU A 1 70  ? 2.555   -8.263  -4.321  1.00 71.64  ? 682  GLU A N     1 
ATOM   361  C CA    . GLU A 1 70  ? 3.651   -8.081  -5.277  1.00 68.80  ? 682  GLU A CA    1 
ATOM   362  C C     . GLU A 1 70  ? 4.994   -8.456  -4.642  1.00 73.84  ? 682  GLU A C     1 
ATOM   363  O O     . GLU A 1 70  ? 5.902   -8.891  -5.352  1.00 72.51  ? 682  GLU A O     1 
ATOM   364  C CB    . GLU A 1 70  ? 3.684   -6.641  -5.811  1.00 68.81  ? 682  GLU A CB    1 
ATOM   365  C CG    . GLU A 1 70  ? 2.591   -6.351  -6.828  1.00 76.36  ? 682  GLU A CG    1 
ATOM   366  C CD    . GLU A 1 70  ? 2.461   -4.923  -7.331  1.00 92.37  ? 682  GLU A CD    1 
ATOM   367  O OE1   . GLU A 1 70  ? 3.364   -4.097  -7.061  1.00 81.85  ? 682  GLU A OE1   1 
ATOM   368  O OE2   . GLU A 1 70  ? 1.447   -4.634  -8.006  1.00 84.80  ? 682  GLU A OE2   1 
ATOM   369  N N     . ALA A 1 71  ? 5.112   -8.298  -3.308  1.00 72.68  ? 683  ALA A N     1 
ATOM   370  C CA    . ALA A 1 71  ? 6.302   -8.678  -2.544  1.00 73.95  ? 683  ALA A CA    1 
ATOM   371  C C     . ALA A 1 71  ? 6.343   -10.206 -2.392  1.00 77.40  ? 683  ALA A C     1 
ATOM   372  O O     . ALA A 1 71  ? 7.429   -10.787 -2.421  1.00 76.75  ? 683  ALA A O     1 
ATOM   373  C CB    . ALA A 1 71  ? 6.292   -8.012  -1.174  1.00 78.14  ? 683  ALA A CB    1 
ATOM   374  N N     . SER A 1 72  ? 5.156   -10.851 -2.252  1.00 74.04  ? 684  SER A N     1 
ATOM   375  C CA    . SER A 1 72  ? 5.003   -12.306 -2.119  1.00 74.47  ? 684  SER A CA    1 
ATOM   376  C C     . SER A 1 72  ? 5.403   -13.035 -3.400  1.00 75.12  ? 684  SER A C     1 
ATOM   377  O O     . SER A 1 72  ? 5.981   -14.115 -3.316  1.00 75.18  ? 684  SER A O     1 
ATOM   378  C CB    . SER A 1 72  ? 3.575   -12.669 -1.728  1.00 79.41  ? 684  SER A CB    1 
ATOM   379  O OG    . SER A 1 72  ? 3.243   -12.137 -0.456  1.00 91.44  ? 684  SER A OG    1 
ATOM   380  N N     . ILE A 1 73  ? 5.112   -12.433 -4.581  1.00 68.58  ? 685  ILE A N     1 
ATOM   381  C CA    . ILE A 1 73  ? 5.457   -12.955 -5.914  1.00 65.18  ? 685  ILE A CA    1 
ATOM   382  C C     . ILE A 1 73  ? 6.985   -12.924 -6.084  1.00 67.54  ? 685  ILE A C     1 
ATOM   383  O O     . ILE A 1 73  ? 7.569   -13.956 -6.396  1.00 67.28  ? 685  ILE A O     1 
ATOM   384  C CB    . ILE A 1 73  ? 4.695   -12.190 -7.038  1.00 65.93  ? 685  ILE A CB    1 
ATOM   385  C CG1   . ILE A 1 73  ? 3.171   -12.420 -6.930  1.00 67.19  ? 685  ILE A CG1   1 
ATOM   386  C CG2   . ILE A 1 73  ? 5.212   -12.552 -8.438  1.00 63.49  ? 685  ILE A CG2   1 
ATOM   387  C CD1   . ILE A 1 73  ? 2.307   -11.255 -7.458  1.00 72.04  ? 685  ILE A CD1   1 
ATOM   388  N N     . MET A 1 74  ? 7.621   -11.764 -5.825  1.00 63.88  ? 686  MET A N     1 
ATOM   389  C CA    . MET A 1 74  ? 9.076   -11.556 -5.878  1.00 63.66  ? 686  MET A CA    1 
ATOM   390  C C     . MET A 1 74  ? 9.823   -12.414 -4.837  1.00 68.69  ? 686  MET A C     1 
ATOM   391  O O     . MET A 1 74  ? 10.911  -12.910 -5.124  1.00 67.59  ? 686  MET A O     1 
ATOM   392  C CB    . MET A 1 74  ? 9.413   -10.080 -5.627  1.00 66.81  ? 686  MET A CB    1 
ATOM   393  C CG    . MET A 1 74  ? 9.114   -9.167  -6.781  1.00 68.36  ? 686  MET A CG    1 
ATOM   394  S SD    . MET A 1 74  ? 9.525   -7.455  -6.367  1.00 74.46  ? 686  MET A SD    1 
ATOM   395  C CE    . MET A 1 74  ? 11.292  -7.504  -6.498  1.00 71.12  ? 686  MET A CE    1 
ATOM   396  N N     . GLY A 1 75  ? 9.230   -12.566 -3.650  1.00 67.36  ? 687  GLY A N     1 
ATOM   397  C CA    . GLY A 1 75  ? 9.786   -13.345 -2.547  1.00 70.17  ? 687  GLY A CA    1 
ATOM   398  C C     . GLY A 1 75  ? 9.862   -14.846 -2.771  1.00 73.58  ? 687  GLY A C     1 
ATOM   399  O O     . GLY A 1 75  ? 10.531  -15.551 -2.008  1.00 74.78  ? 687  GLY A O     1 
ATOM   400  N N     . GLN A 1 76  ? 9.170   -15.344 -3.811  1.00 67.50  ? 688  GLN A N     1 
ATOM   401  C CA    . GLN A 1 76  ? 9.136   -16.759 -4.189  1.00 67.07  ? 688  GLN A CA    1 
ATOM   402  C C     . GLN A 1 76  ? 10.349  -17.178 -5.040  1.00 67.98  ? 688  GLN A C     1 
ATOM   403  O O     . GLN A 1 76  ? 10.582  -18.378 -5.200  1.00 67.70  ? 688  GLN A O     1 
ATOM   404  C CB    . GLN A 1 76  ? 7.848   -17.061 -4.983  1.00 67.00  ? 688  GLN A CB    1 
ATOM   405  C CG    . GLN A 1 76  ? 6.601   -17.288 -4.136  1.00 88.24  ? 688  GLN A CG    1 
ATOM   406  C CD    . GLN A 1 76  ? 5.325   -17.262 -4.954  1.00 106.66 ? 688  GLN A CD    1 
ATOM   407  O OE1   . GLN A 1 76  ? 5.313   -17.497 -6.170  1.00 97.25  ? 688  GLN A OE1   1 
ATOM   408  N NE2   . GLN A 1 76  ? 4.211   -16.983 -4.294  1.00 103.72 ? 688  GLN A NE2   1 
ATOM   409  N N     . PHE A 1 77  ? 11.092  -16.213 -5.574  1.00 62.25  ? 689  PHE A N     1 
ATOM   410  C CA    . PHE A 1 77  ? 12.220  -16.494 -6.463  1.00 60.04  ? 689  PHE A CA    1 
ATOM   411  C C     . PHE A 1 77  ? 13.639  -16.236 -5.975  1.00 63.23  ? 689  PHE A C     1 
ATOM   412  O O     . PHE A 1 77  ? 13.943  -15.177 -5.452  1.00 64.31  ? 689  PHE A O     1 
ATOM   413  C CB    . PHE A 1 77  ? 12.075  -15.682 -7.755  1.00 59.04  ? 689  PHE A CB    1 
ATOM   414  C CG    . PHE A 1 77  ? 10.679  -15.604 -8.292  1.00 59.44  ? 689  PHE A CG    1 
ATOM   415  C CD1   . PHE A 1 77  ? 9.936   -16.742 -8.501  1.00 62.66  ? 689  PHE A CD1   1 
ATOM   416  C CD2   . PHE A 1 77  ? 10.127  -14.386 -8.617  1.00 60.21  ? 689  PHE A CD2   1 
ATOM   417  C CE1   . PHE A 1 77  ? 8.658   -16.663 -9.013  1.00 62.33  ? 689  PHE A CE1   1 
ATOM   418  C CE2   . PHE A 1 77  ? 8.853   -14.300 -9.130  1.00 61.83  ? 689  PHE A CE2   1 
ATOM   419  C CZ    . PHE A 1 77  ? 8.116   -15.440 -9.327  1.00 59.81  ? 689  PHE A CZ    1 
ATOM   420  N N     . ASP A 1 78  ? 14.511  -17.214 -6.175  1.00 58.40  ? 690  ASP A N     1 
ATOM   421  C CA    . ASP A 1 78  ? 15.912  -17.079 -5.814  1.00 59.27  ? 690  ASP A CA    1 
ATOM   422  C C     . ASP A 1 78  ? 16.752  -17.542 -6.999  1.00 60.90  ? 690  ASP A C     1 
ATOM   423  O O     . ASP A 1 78  ? 16.890  -18.734 -7.231  1.00 61.49  ? 690  ASP A O     1 
ATOM   424  C CB    . ASP A 1 78  ? 16.208  -17.922 -4.575  1.00 64.00  ? 690  ASP A CB    1 
ATOM   425  C CG    . ASP A 1 78  ? 17.666  -17.918 -4.196  1.00 74.13  ? 690  ASP A CG    1 
ATOM   426  O OD1   . ASP A 1 78  ? 18.316  -16.866 -4.297  1.00 74.41  ? 690  ASP A OD1   1 
ATOM   427  O OD2   . ASP A 1 78  ? 18.166  -18.977 -3.789  1.00 81.17  ? 690  ASP A OD2   1 
ATOM   428  N N     . HIS A 1 79  ? 17.310  -16.596 -7.742  1.00 54.73  ? 691  HIS A N     1 
ATOM   429  C CA    . HIS A 1 79  ? 18.131  -16.893 -8.906  1.00 52.13  ? 691  HIS A CA    1 
ATOM   430  C C     . HIS A 1 79  ? 19.046  -15.696 -9.150  1.00 56.09  ? 691  HIS A C     1 
ATOM   431  O O     . HIS A 1 79  ? 18.648  -14.568 -8.888  1.00 54.47  ? 691  HIS A O     1 
ATOM   432  C CB    . HIS A 1 79  ? 17.195  -17.119 -10.101 1.00 49.80  ? 691  HIS A CB    1 
ATOM   433  C CG    . HIS A 1 79  ? 17.880  -17.561 -11.357 1.00 51.11  ? 691  HIS A CG    1 
ATOM   434  N ND1   . HIS A 1 79  ? 18.380  -16.676 -12.282 1.00 50.90  ? 691  HIS A ND1   1 
ATOM   435  C CD2   . HIS A 1 79  ? 18.114  -18.794 -11.856 1.00 52.21  ? 691  HIS A CD2   1 
ATOM   436  C CE1   . HIS A 1 79  ? 18.913  -17.344 -13.286 1.00 48.87  ? 691  HIS A CE1   1 
ATOM   437  N NE2   . HIS A 1 79  ? 18.762  -18.631 -13.052 1.00 50.06  ? 691  HIS A NE2   1 
ATOM   438  N N     . PRO A 1 80  ? 20.251  -15.913 -9.670  1.00 53.76  ? 692  PRO A N     1 
ATOM   439  C CA    . PRO A 1 80  ? 21.150  -14.771 -9.936  1.00 54.29  ? 692  PRO A CA    1 
ATOM   440  C C     . PRO A 1 80  ? 20.689  -13.740 -10.979 1.00 58.63  ? 692  PRO A C     1 
ATOM   441  O O     . PRO A 1 80  ? 21.206  -12.620 -10.960 1.00 60.25  ? 692  PRO A O     1 
ATOM   442  C CB    . PRO A 1 80  ? 22.452  -15.445 -10.379 1.00 56.26  ? 692  PRO A CB    1 
ATOM   443  C CG    . PRO A 1 80  ? 22.056  -16.801 -10.815 1.00 59.25  ? 692  PRO A CG    1 
ATOM   444  C CD    . PRO A 1 80  ? 20.945  -17.193 -9.915  1.00 55.38  ? 692  PRO A CD    1 
ATOM   445  N N     . ASN A 1 81  ? 19.739  -14.089 -11.875 1.00 51.86  ? 693  ASN A N     1 
ATOM   446  C CA    . ASN A 1 81  ? 19.246  -13.147 -12.889 1.00 49.51  ? 693  ASN A CA    1 
ATOM   447  C C     . ASN A 1 81  ? 17.795  -12.710 -12.670 1.00 52.69  ? 693  ASN A C     1 
ATOM   448  O O     . ASN A 1 81  ? 17.102  -12.335 -13.614 1.00 49.74  ? 693  ASN A O     1 
ATOM   449  C CB    . ASN A 1 81  ? 19.453  -13.686 -14.299 1.00 47.38  ? 693  ASN A CB    1 
ATOM   450  C CG    . ASN A 1 81  ? 20.887  -13.967 -14.634 1.00 54.28  ? 693  ASN A CG    1 
ATOM   451  O OD1   . ASN A 1 81  ? 21.281  -15.119 -14.829 1.00 46.44  ? 693  ASN A OD1   1 
ATOM   452  N ND2   . ASN A 1 81  ? 21.681  -12.919 -14.774 1.00 45.89  ? 693  ASN A ND2   1 
ATOM   453  N N     . ILE A 1 82  ? 17.346  -12.760 -11.414 1.00 52.35  ? 694  ILE A N     1 
ATOM   454  C CA    . ILE A 1 82  ? 16.016  -12.329 -10.982 1.00 52.19  ? 694  ILE A CA    1 
ATOM   455  C C     . ILE A 1 82  ? 16.245  -11.446 -9.765  1.00 58.81  ? 694  ILE A C     1 
ATOM   456  O O     . ILE A 1 82  ? 16.968  -11.853 -8.842  1.00 60.64  ? 694  ILE A O     1 
ATOM   457  C CB    . ILE A 1 82  ? 15.047  -13.527 -10.701 1.00 55.14  ? 694  ILE A CB    1 
ATOM   458  C CG1   . ILE A 1 82  ? 14.714  -14.284 -12.010 1.00 52.95  ? 694  ILE A CG1   1 
ATOM   459  C CG2   . ILE A 1 82  ? 13.755  -13.052 -10.003 1.00 56.29  ? 694  ILE A CG2   1 
ATOM   460  C CD1   . ILE A 1 82  ? 14.045  -15.610 -11.839 1.00 60.02  ? 694  ILE A CD1   1 
ATOM   461  N N     . ILE A 1 83  ? 15.671  -10.222 -9.796  1.00 54.86  ? 695  ILE A N     1 
ATOM   462  C CA    . ILE A 1 83  ? 15.756  -9.212  -8.733  1.00 56.52  ? 695  ILE A CA    1 
ATOM   463  C C     . ILE A 1 83  ? 15.418  -9.843  -7.371  1.00 61.21  ? 695  ILE A C     1 
ATOM   464  O O     . ILE A 1 83  ? 14.392  -10.511 -7.223  1.00 59.86  ? 695  ILE A O     1 
ATOM   465  C CB    . ILE A 1 83  ? 14.928  -7.937  -9.087  1.00 58.94  ? 695  ILE A CB    1 
ATOM   466  C CG1   . ILE A 1 83  ? 15.051  -6.829  -8.014  1.00 62.24  ? 695  ILE A CG1   1 
ATOM   467  C CG2   . ILE A 1 83  ? 13.466  -8.254  -9.407  1.00 58.84  ? 695  ILE A CG2   1 
ATOM   468  C CD1   . ILE A 1 83  ? 16.373  -6.010  -8.065  1.00 72.75  ? 695  ILE A CD1   1 
ATOM   469  N N     . ARG A 1 84  ? 16.350  -9.717  -6.426  1.00 60.52  ? 696  ARG A N     1 
ATOM   470  C CA    . ARG A 1 84  ? 16.241  -10.332 -5.112  1.00 63.37  ? 696  ARG A CA    1 
ATOM   471  C C     . ARG A 1 84  ? 15.513  -9.443  -4.125  1.00 68.82  ? 696  ARG A C     1 
ATOM   472  O O     . ARG A 1 84  ? 15.831  -8.260  -4.013  1.00 68.53  ? 696  ARG A O     1 
ATOM   473  C CB    . ARG A 1 84  ? 17.644  -10.685 -4.585  1.00 66.39  ? 696  ARG A CB    1 
ATOM   474  C CG    . ARG A 1 84  ? 17.666  -11.743 -3.480  1.00 80.30  ? 696  ARG A CG    1 
ATOM   475  C CD    . ARG A 1 84  ? 18.468  -11.299 -2.268  1.00 97.06  ? 696  ARG A CD    1 
ATOM   476  N NE    . ARG A 1 84  ? 19.895  -11.132 -2.559  1.00 110.35 ? 696  ARG A NE    1 
ATOM   477  C CZ    . ARG A 1 84  ? 20.818  -12.075 -2.382  1.00 129.02 ? 696  ARG A CZ    1 
ATOM   478  N NH1   . ARG A 1 84  ? 20.478  -13.269 -1.911  1.00 116.01 ? 696  ARG A NH1   1 
ATOM   479  N NH2   . ARG A 1 84  ? 22.089  -11.830 -2.673  1.00 118.79 ? 696  ARG A NH2   1 
ATOM   480  N N     . LEU A 1 85  ? 14.548  -10.027 -3.393  1.00 66.85  ? 697  LEU A N     1 
ATOM   481  C CA    . LEU A 1 85  ? 13.830  -9.339  -2.329  1.00 69.04  ? 697  LEU A CA    1 
ATOM   482  C C     . LEU A 1 85  ? 14.638  -9.562  -1.043  1.00 77.81  ? 697  LEU A C     1 
ATOM   483  O O     . LEU A 1 85  ? 14.801  -10.707 -0.605  1.00 78.88  ? 697  LEU A O     1 
ATOM   484  C CB    . LEU A 1 85  ? 12.381  -9.860  -2.171  1.00 68.72  ? 697  LEU A CB    1 
ATOM   485  C CG    . LEU A 1 85  ? 11.576  -9.268  -0.985  1.00 75.84  ? 697  LEU A CG    1 
ATOM   486  C CD1   . LEU A 1 85  ? 10.927  -7.944  -1.354  1.00 74.39  ? 697  LEU A CD1   1 
ATOM   487  C CD2   . LEU A 1 85  ? 10.529  -10.239 -0.487  1.00 78.43  ? 697  LEU A CD2   1 
ATOM   488  N N     . GLU A 1 86  ? 15.177  -8.474  -0.470  1.00 76.82  ? 698  GLU A N     1 
ATOM   489  C CA    . GLU A 1 86  ? 15.955  -8.533  0.767   1.00 80.74  ? 698  GLU A CA    1 
ATOM   490  C C     . GLU A 1 86  ? 15.011  -8.790  1.939   1.00 87.84  ? 698  GLU A C     1 
ATOM   491  O O     . GLU A 1 86  ? 15.173  -9.787  2.644   1.00 89.90  ? 698  GLU A O     1 
ATOM   492  C CB    . GLU A 1 86  ? 16.781  -7.245  0.984   1.00 83.50  ? 698  GLU A CB    1 
ATOM   493  C CG    . GLU A 1 86  ? 17.920  -7.027  -0.007  1.00 93.91  ? 698  GLU A CG    1 
ATOM   494  C CD    . GLU A 1 86  ? 19.079  -8.009  0.025   1.00 117.98 ? 698  GLU A CD    1 
ATOM   495  O OE1   . GLU A 1 86  ? 19.526  -8.383  1.134   1.00 114.74 ? 698  GLU A OE1   1 
ATOM   496  O OE2   . GLU A 1 86  ? 19.575  -8.364  -1.069  1.00 111.18 ? 698  GLU A OE2   1 
ATOM   497  N N     . GLY A 1 87  ? 14.009  -7.923  2.092   1.00 84.56  ? 699  GLY A N     1 
ATOM   498  C CA    . GLY A 1 87  ? 13.011  -8.016  3.153   1.00 87.48  ? 699  GLY A CA    1 
ATOM   499  C C     . GLY A 1 87  ? 11.825  -7.086  2.990   1.00 90.91  ? 699  GLY A C     1 
ATOM   500  O O     . GLY A 1 87  ? 11.843  -6.182  2.146   1.00 87.66  ? 699  GLY A O     1 
ATOM   501  N N     . VAL A 1 88  ? 10.771  -7.322  3.799   1.00 90.28  ? 700  VAL A N     1 
ATOM   502  C CA    . VAL A 1 88  ? 9.534   -6.535  3.800   1.00 90.28  ? 700  VAL A CA    1 
ATOM   503  C C     . VAL A 1 88  ? 9.243   -6.025  5.227   1.00 100.24 ? 700  VAL A C     1 
ATOM   504  O O     . VAL A 1 88  ? 9.216   -6.818  6.173   1.00 102.87 ? 700  VAL A O     1 
ATOM   505  C CB    . VAL A 1 88  ? 8.325   -7.319  3.200   1.00 92.14  ? 700  VAL A CB    1 
ATOM   506  C CG1   . VAL A 1 88  ? 7.070   -6.451  3.140   1.00 91.63  ? 700  VAL A CG1   1 
ATOM   507  C CG2   . VAL A 1 88  ? 8.642   -7.877  1.812   1.00 87.88  ? 700  VAL A CG2   1 
ATOM   508  N N     . VAL A 1 89  ? 9.038   -4.701  5.371   1.00 98.33  ? 701  VAL A N     1 
ATOM   509  C CA    . VAL A 1 89  ? 8.699   -4.052  6.643   1.00 102.81 ? 701  VAL A CA    1 
ATOM   510  C C     . VAL A 1 89  ? 7.165   -4.046  6.744   1.00 107.75 ? 701  VAL A C     1 
ATOM   511  O O     . VAL A 1 89  ? 6.495   -3.598  5.812   1.00 104.37 ? 701  VAL A O     1 
ATOM   512  C CB    . VAL A 1 89  ? 9.297   -2.622  6.778   1.00 107.54 ? 701  VAL A CB    1 
ATOM   513  C CG1   . VAL A 1 89  ? 9.134   -2.093  8.202   1.00 112.39 ? 701  VAL A CG1   1 
ATOM   514  C CG2   . VAL A 1 89  ? 10.766  -2.587  6.362   1.00 106.33 ? 701  VAL A CG2   1 
ATOM   515  N N     . THR A 1 90  ? 6.613   -4.586  7.846   1.00 108.38 ? 702  THR A N     1 
ATOM   516  C CA    . THR A 1 90  ? 5.161   -4.683  8.051   1.00 109.07 ? 702  THR A CA    1 
ATOM   517  C C     . THR A 1 90  ? 4.709   -4.151  9.416   1.00 118.10 ? 702  THR A C     1 
ATOM   518  O O     . THR A 1 90  ? 3.541   -3.780  9.565   1.00 118.50 ? 702  THR A O     1 
ATOM   519  C CB    . THR A 1 90  ? 4.656   -6.120  7.796   1.00 117.11 ? 702  THR A CB    1 
ATOM   520  O OG1   . THR A 1 90  ? 5.506   -7.068  8.453   1.00 118.65 ? 702  THR A OG1   1 
ATOM   521  C CG2   . THR A 1 90  ? 4.539   -6.449  6.306   1.00 110.76 ? 702  THR A CG2   1 
ATOM   522  N N     . LYS A 1 91  ? 5.630   -4.112  10.400  1.00 118.21 ? 703  LYS A N     1 
ATOM   523  C CA    . LYS A 1 91  ? 5.381   -3.651  11.768  1.00 123.15 ? 703  LYS A CA    1 
ATOM   524  C C     . LYS A 1 91  ? 5.113   -2.142  11.867  1.00 127.96 ? 703  LYS A C     1 
ATOM   525  O O     . LYS A 1 91  ? 4.201   -1.733  12.590  1.00 130.33 ? 703  LYS A O     1 
ATOM   526  C CB    . LYS A 1 91  ? 6.541   -4.059  12.689  1.00 129.03 ? 703  LYS A CB    1 
ATOM   527  N N     . SER A 1 92  ? 5.907   -1.321  11.152  1.00 122.40 ? 704  SER A N     1 
ATOM   528  C CA    . SER A 1 92  ? 5.780   0.140   11.151  1.00 122.62 ? 704  SER A CA    1 
ATOM   529  C C     . SER A 1 92  ? 5.033   0.666   9.922   1.00 121.83 ? 704  SER A C     1 
ATOM   530  O O     . SER A 1 92  ? 5.133   0.086   8.839   1.00 116.88 ? 704  SER A O     1 
ATOM   531  C CB    . SER A 1 92  ? 7.155   0.796   11.248  1.00 127.00 ? 704  SER A CB    1 
ATOM   532  O OG    . SER A 1 92  ? 7.932   0.564   10.083  1.00 131.08 ? 704  SER A OG    1 
ATOM   533  N N     . ARG A 1 93  ? 4.300   1.778   10.100  1.00 119.69 ? 705  ARG A N     1 
ATOM   534  C CA    . ARG A 1 93  ? 3.547   2.447   9.040   1.00 115.93 ? 705  ARG A CA    1 
ATOM   535  C C     . ARG A 1 93  ? 4.244   3.777   8.685   1.00 119.49 ? 705  ARG A C     1 
ATOM   536  O O     . ARG A 1 93  ? 4.520   4.554   9.605   1.00 122.70 ? 705  ARG A O     1 
ATOM   537  C CB    . ARG A 1 93  ? 2.094   2.688   9.479   1.00 117.59 ? 705  ARG A CB    1 
ATOM   538  N N     . PRO A 1 94  ? 4.593   4.066   7.401   1.00 112.04 ? 706  PRO A N     1 
ATOM   539  C CA    . PRO A 1 94  ? 4.343   3.291   6.163   1.00 107.25 ? 706  PRO A CA    1 
ATOM   540  C C     . PRO A 1 94  ? 5.180   2.022   5.979   1.00 109.21 ? 706  PRO A C     1 
ATOM   541  O O     . PRO A 1 94  ? 6.345   1.985   6.372   1.00 110.17 ? 706  PRO A O     1 
ATOM   542  C CB    . PRO A 1 94  ? 4.620   4.317   5.056   1.00 106.02 ? 706  PRO A CB    1 
ATOM   543  C CG    . PRO A 1 94  ? 5.640   5.236   5.649   1.00 113.05 ? 706  PRO A CG    1 
ATOM   544  C CD    . PRO A 1 94  ? 5.251   5.355   7.098   1.00 113.40 ? 706  PRO A CD    1 
ATOM   545  N N     . VAL A 1 95  ? 4.575   0.991   5.354   1.00 102.78 ? 707  VAL A N     1 
ATOM   546  C CA    . VAL A 1 95  ? 5.212   -0.306  5.078   1.00 101.07 ? 707  VAL A CA    1 
ATOM   547  C C     . VAL A 1 95  ? 6.179   -0.217  3.877   1.00 100.34 ? 707  VAL A C     1 
ATOM   548  O O     . VAL A 1 95  ? 5.943   0.560   2.946   1.00 96.92  ? 707  VAL A O     1 
ATOM   549  C CB    . VAL A 1 95  ? 4.208   -1.489  4.952   1.00 104.28 ? 707  VAL A CB    1 
ATOM   550  C CG1   . VAL A 1 95  ? 3.467   -1.730  6.265   1.00 108.40 ? 707  VAL A CG1   1 
ATOM   551  C CG2   . VAL A 1 95  ? 3.231   -1.304  3.792   1.00 100.46 ? 707  VAL A CG2   1 
ATOM   552  N N     . MET A 1 96  ? 7.270   -1.013  3.914   1.00 96.29  ? 708  MET A N     1 
ATOM   553  C CA    . MET A 1 96  ? 8.317   -0.998  2.888   1.00 92.41  ? 708  MET A CA    1 
ATOM   554  C C     . MET A 1 96  ? 8.658   -2.351  2.272   1.00 91.91  ? 708  MET A C     1 
ATOM   555  O O     . MET A 1 96  ? 8.606   -3.377  2.947   1.00 93.24  ? 708  MET A O     1 
ATOM   556  C CB    . MET A 1 96  ? 9.609   -0.369  3.446   1.00 97.12  ? 708  MET A CB    1 
ATOM   557  C CG    . MET A 1 96  ? 9.497   1.112   3.748   1.00 102.34 ? 708  MET A CG    1 
ATOM   558  S SD    . MET A 1 96  ? 10.701  1.668   4.976   1.00 111.06 ? 708  MET A SD    1 
ATOM   559  C CE    . MET A 1 96  ? 9.824   1.299   6.474   1.00 112.27 ? 708  MET A CE    1 
ATOM   560  N N     . ILE A 1 97  ? 9.056   -2.325  0.989   1.00 83.10  ? 709  ILE A N     1 
ATOM   561  C CA    . ILE A 1 97  ? 9.543   -3.466  0.213   1.00 79.43  ? 709  ILE A CA    1 
ATOM   562  C C     . ILE A 1 97  ? 11.013  -3.134  -0.082  1.00 81.23  ? 709  ILE A C     1 
ATOM   563  O O     . ILE A 1 97  ? 11.296  -2.096  -0.690  1.00 79.02  ? 709  ILE A O     1 
ATOM   564  C CB    . ILE A 1 97  ? 8.683   -3.712  -1.063  1.00 78.65  ? 709  ILE A CB    1 
ATOM   565  C CG1   . ILE A 1 97  ? 7.308   -4.310  -0.687  1.00 79.57  ? 709  ILE A CG1   1 
ATOM   566  C CG2   . ILE A 1 97  ? 9.416   -4.610  -2.081  1.00 76.60  ? 709  ILE A CG2   1 
ATOM   567  C CD1   . ILE A 1 97  ? 6.236   -4.233  -1.771  1.00 80.56  ? 709  ILE A CD1   1 
ATOM   568  N N     . LEU A 1 98  ? 11.943  -3.975  0.406   1.00 78.82  ? 710  LEU A N     1 
ATOM   569  C CA    . LEU A 1 98  ? 13.383  -3.744  0.247   1.00 78.65  ? 710  LEU A CA    1 
ATOM   570  C C     . LEU A 1 98  ? 14.030  -4.755  -0.681  1.00 80.57  ? 710  LEU A C     1 
ATOM   571  O O     . LEU A 1 98  ? 13.953  -5.960  -0.435  1.00 80.50  ? 710  LEU A O     1 
ATOM   572  C CB    . LEU A 1 98  ? 14.116  -3.713  1.608   1.00 82.78  ? 710  LEU A CB    1 
ATOM   573  C CG    . LEU A 1 98  ? 13.352  -3.166  2.825   1.00 90.56  ? 710  LEU A CG    1 
ATOM   574  C CD1   . LEU A 1 98  ? 14.037  -3.563  4.120   1.00 94.90  ? 710  LEU A CD1   1 
ATOM   575  C CD2   . LEU A 1 98  ? 13.182  -1.667  2.752   1.00 92.89  ? 710  LEU A CD2   1 
ATOM   576  N N     . THR A 1 99  ? 14.650  -4.257  -1.765  1.00 75.18  ? 711  THR A N     1 
ATOM   577  C CA    . THR A 1 99  ? 15.342  -5.066  -2.777  1.00 72.94  ? 711  THR A CA    1 
ATOM   578  C C     . THR A 1 99  ? 16.754  -4.515  -3.023  1.00 77.82  ? 711  THR A C     1 
ATOM   579  O O     . THR A 1 99  ? 17.006  -3.349  -2.727  1.00 78.37  ? 711  THR A O     1 
ATOM   580  C CB    . THR A 1 99  ? 14.509  -5.181  -4.083  1.00 76.67  ? 711  THR A CB    1 
ATOM   581  O OG1   . THR A 1 99  ? 14.342  -3.897  -4.693  1.00 76.27  ? 711  THR A OG1   1 
ATOM   582  C CG2   . THR A 1 99  ? 13.157  -5.854  -3.868  1.00 72.92  ? 711  THR A CG2   1 
ATOM   583  N N     . GLU A 1 100 ? 17.668  -5.357  -3.555  1.00 74.02  ? 712  GLU A N     1 
ATOM   584  C CA    . GLU A 1 100 ? 19.065  -5.006  -3.877  1.00 74.13  ? 712  GLU A CA    1 
ATOM   585  C C     . GLU A 1 100 ? 19.145  -3.868  -4.902  1.00 75.22  ? 712  GLU A C     1 
ATOM   586  O O     . GLU A 1 100 ? 18.320  -3.833  -5.809  1.00 71.38  ? 712  GLU A O     1 
ATOM   587  C CB    . GLU A 1 100 ? 19.842  -6.243  -4.379  1.00 74.55  ? 712  GLU A CB    1 
ATOM   588  C CG    . GLU A 1 100 ? 19.055  -7.135  -5.326  1.00 82.60  ? 712  GLU A CG    1 
ATOM   589  C CD    . GLU A 1 100 ? 19.872  -8.152  -6.094  1.00 102.89 ? 712  GLU A CD    1 
ATOM   590  O OE1   . GLU A 1 100 ? 20.481  -9.045  -5.461  1.00 113.21 ? 712  GLU A OE1   1 
ATOM   591  O OE2   . GLU A 1 100 ? 19.880  -8.067  -7.341  1.00 83.11  ? 712  GLU A OE2   1 
ATOM   592  N N     . PHE A 1 101 ? 20.114  -2.935  -4.751  1.00 73.89  ? 713  PHE A N     1 
ATOM   593  C CA    . PHE A 1 101 ? 20.246  -1.793  -5.667  1.00 72.18  ? 713  PHE A CA    1 
ATOM   594  C C     . PHE A 1 101 ? 20.951  -2.151  -6.980  1.00 72.25  ? 713  PHE A C     1 
ATOM   595  O O     . PHE A 1 101 ? 21.976  -2.842  -6.981  1.00 72.52  ? 713  PHE A O     1 
ATOM   596  C CB    . PHE A 1 101 ? 20.902  -0.573  -4.986  1.00 76.97  ? 713  PHE A CB    1 
ATOM   597  C CG    . PHE A 1 101 ? 20.767  0.733   -5.740  1.00 77.59  ? 713  PHE A CG    1 
ATOM   598  C CD1   . PHE A 1 101 ? 19.528  1.350   -5.884  1.00 79.59  ? 713  PHE A CD1   1 
ATOM   599  C CD2   . PHE A 1 101 ? 21.883  1.358   -6.285  1.00 80.10  ? 713  PHE A CD2   1 
ATOM   600  C CE1   . PHE A 1 101 ? 19.402  2.549   -6.595  1.00 79.57  ? 713  PHE A CE1   1 
ATOM   601  C CE2   . PHE A 1 101 ? 21.758  2.560   -6.990  1.00 82.07  ? 713  PHE A CE2   1 
ATOM   602  C CZ    . PHE A 1 101 ? 20.519  3.148   -7.139  1.00 78.92  ? 713  PHE A CZ    1 
ATOM   603  N N     . MET A 1 102 ? 20.389  -1.654  -8.094  1.00 65.01  ? 714  MET A N     1 
ATOM   604  C CA    . MET A 1 102 ? 20.876  -1.887  -9.453  1.00 62.08  ? 714  MET A CA    1 
ATOM   605  C C     . MET A 1 102 ? 21.423  -0.595  -10.052 1.00 67.89  ? 714  MET A C     1 
ATOM   606  O O     . MET A 1 102 ? 20.727  0.108   -10.792 1.00 66.83  ? 714  MET A O     1 
ATOM   607  C CB    . MET A 1 102 ? 19.776  -2.520  -10.323 1.00 60.66  ? 714  MET A CB    1 
ATOM   608  C CG    . MET A 1 102 ? 19.204  -3.805  -9.732  1.00 63.82  ? 714  MET A CG    1 
ATOM   609  S SD    . MET A 1 102 ? 20.368  -5.193  -9.600  1.00 68.03  ? 714  MET A SD    1 
ATOM   610  C CE    . MET A 1 102 ? 20.450  -5.700  -11.273 1.00 61.53  ? 714  MET A CE    1 
ATOM   611  N N     . GLU A 1 103 ? 22.689  -0.303  -9.705  1.00 66.21  ? 715  GLU A N     1 
ATOM   612  C CA    . GLU A 1 103 ? 23.498  0.868   -10.043 1.00 67.20  ? 715  GLU A CA    1 
ATOM   613  C C     . GLU A 1 103 ? 23.340  1.398   -11.482 1.00 68.60  ? 715  GLU A C     1 
ATOM   614  O O     . GLU A 1 103 ? 23.214  2.612   -11.657 1.00 68.03  ? 715  GLU A O     1 
ATOM   615  C CB    . GLU A 1 103 ? 24.979  0.573   -9.740  1.00 70.91  ? 715  GLU A CB    1 
ATOM   616  C CG    . GLU A 1 103 ? 25.861  1.806   -9.625  1.00 85.32  ? 715  GLU A CG    1 
ATOM   617  C CD    . GLU A 1 103 ? 27.332  1.579   -9.917  1.00 110.66 ? 715  GLU A CD    1 
ATOM   618  O OE1   . GLU A 1 103 ? 28.167  1.926   -9.050  1.00 110.26 ? 715  GLU A OE1   1 
ATOM   619  O OE2   . GLU A 1 103 ? 27.656  1.084   -11.021 1.00 105.94 ? 715  GLU A OE2   1 
ATOM   620  N N     . ASN A 1 104 ? 23.351  0.510   -12.501 1.00 63.66  ? 716  ASN A N     1 
ATOM   621  C CA    . ASN A 1 104 ? 23.255  0.935   -13.905 1.00 61.45  ? 716  ASN A CA    1 
ATOM   622  C C     . ASN A 1 104 ? 21.806  1.121   -14.416 1.00 64.82  ? 716  ASN A C     1 
ATOM   623  O O     . ASN A 1 104 ? 21.613  1.401   -15.603 1.00 62.73  ? 716  ASN A O     1 
ATOM   624  C CB    . ASN A 1 104 ? 24.073  0.020   -14.813 1.00 56.70  ? 716  ASN A CB    1 
ATOM   625  C CG    . ASN A 1 104 ? 25.561  0.300   -14.715 1.00 73.94  ? 716  ASN A CG    1 
ATOM   626  O OD1   . ASN A 1 104 ? 26.015  1.448   -14.808 1.00 70.41  ? 716  ASN A OD1   1 
ATOM   627  N ND2   . ASN A 1 104 ? 26.360  -0.737  -14.516 1.00 59.27  ? 716  ASN A ND2   1 
ATOM   628  N N     . CYS A 1 105 ? 20.808  1.038   -13.498 1.00 62.68  ? 717  CYS A N     1 
ATOM   629  C CA    . CYS A 1 105 ? 19.367  1.263   -13.711 1.00 61.17  ? 717  CYS A CA    1 
ATOM   630  C C     . CYS A 1 105 ? 18.754  0.354   -14.817 1.00 59.33  ? 717  CYS A C     1 
ATOM   631  O O     . CYS A 1 105 ? 19.240  -0.765  -15.002 1.00 58.31  ? 717  CYS A O     1 
ATOM   632  C CB    . CYS A 1 105 ? 19.089  2.749   -13.950 1.00 62.85  ? 717  CYS A CB    1 
ATOM   633  S SG    . CYS A 1 105 ? 20.037  3.859   -12.864 1.00 71.07  ? 717  CYS A SG    1 
ATOM   634  N N     . ALA A 1 106 ? 17.668  0.804   -15.499 1.00 52.06  ? 718  ALA A N     1 
ATOM   635  C CA    . ALA A 1 106 ? 16.969  0.061   -16.559 1.00 48.66  ? 718  ALA A CA    1 
ATOM   636  C C     . ALA A 1 106 ? 17.852  -0.158  -17.811 1.00 50.22  ? 718  ALA A C     1 
ATOM   637  O O     . ALA A 1 106 ? 18.564  0.759   -18.235 1.00 50.30  ? 718  ALA A O     1 
ATOM   638  C CB    . ALA A 1 106 ? 15.673  0.763   -16.923 1.00 48.04  ? 718  ALA A CB    1 
ATOM   639  N N     . LEU A 1 107 ? 17.837  -1.395  -18.353 1.00 43.93  ? 719  LEU A N     1 
ATOM   640  C CA    . LEU A 1 107 ? 18.652  -1.837  -19.499 1.00 42.19  ? 719  LEU A CA    1 
ATOM   641  C C     . LEU A 1 107 ? 18.479  -0.975  -20.766 1.00 45.92  ? 719  LEU A C     1 
ATOM   642  O O     . LEU A 1 107 ? 19.472  -0.714  -21.448 1.00 45.61  ? 719  LEU A O     1 
ATOM   643  C CB    . LEU A 1 107 ? 18.398  -3.331  -19.796 1.00 40.24  ? 719  LEU A CB    1 
ATOM   644  C CG    . LEU A 1 107 ? 19.162  -4.015  -20.948 1.00 42.32  ? 719  LEU A CG    1 
ATOM   645  C CD1   . LEU A 1 107 ? 20.651  -4.227  -20.603 1.00 43.43  ? 719  LEU A CD1   1 
ATOM   646  C CD2   . LEU A 1 107 ? 18.546  -5.365  -21.265 1.00 41.30  ? 719  LEU A CD2   1 
ATOM   647  N N     . ASP A 1 108 ? 17.241  -0.523  -21.059 1.00 43.20  ? 720  ASP A N     1 
ATOM   648  C CA    . ASP A 1 108 ? 16.931  0.305   -22.230 1.00 43.26  ? 720  ASP A CA    1 
ATOM   649  C C     . ASP A 1 108 ? 17.664  1.649   -22.200 1.00 50.50  ? 720  ASP A C     1 
ATOM   650  O O     . ASP A 1 108 ? 18.392  1.955   -23.146 1.00 51.30  ? 720  ASP A O     1 
ATOM   651  C CB    . ASP A 1 108 ? 15.410  0.472   -22.435 1.00 44.14  ? 720  ASP A CB    1 
ATOM   652  C CG    . ASP A 1 108 ? 14.640  1.120   -21.293 1.00 55.96  ? 720  ASP A CG    1 
ATOM   653  O OD1   . ASP A 1 108 ? 15.023  0.916   -20.125 1.00 56.40  ? 720  ASP A OD1   1 
ATOM   654  O OD2   . ASP A 1 108 ? 13.618  1.784   -21.569 1.00 64.17  ? 720  ASP A OD2   1 
ATOM   655  N N     . SER A 1 109 ? 17.546  2.405   -21.091 1.00 48.14  ? 721  SER A N     1 
ATOM   656  C CA    . SER A 1 109 ? 18.224  3.696   -20.930 1.00 49.19  ? 721  SER A CA    1 
ATOM   657  C C     . SER A 1 109 ? 19.728  3.500   -20.883 1.00 53.13  ? 721  SER A C     1 
ATOM   658  O O     . SER A 1 109 ? 20.441  4.247   -21.542 1.00 53.71  ? 721  SER A O     1 
ATOM   659  C CB    . SER A 1 109 ? 17.733  4.425   -19.682 1.00 54.73  ? 721  SER A CB    1 
ATOM   660  O OG    . SER A 1 109 ? 18.019  3.702   -18.496 1.00 66.05  ? 721  SER A OG    1 
ATOM   661  N N     . PHE A 1 110 ? 20.198  2.457   -20.160 1.00 49.48  ? 722  PHE A N     1 
ATOM   662  C CA    . PHE A 1 110 ? 21.608  2.093   -20.029 1.00 50.73  ? 722  PHE A CA    1 
ATOM   663  C C     . PHE A 1 110 ? 22.268  1.822   -21.382 1.00 54.65  ? 722  PHE A C     1 
ATOM   664  O O     . PHE A 1 110 ? 23.400  2.243   -21.598 1.00 55.51  ? 722  PHE A O     1 
ATOM   665  C CB    . PHE A 1 110 ? 21.778  0.898   -19.068 1.00 52.86  ? 722  PHE A CB    1 
ATOM   666  C CG    . PHE A 1 110 ? 23.172  0.326   -18.950 1.00 55.32  ? 722  PHE A CG    1 
ATOM   667  C CD1   . PHE A 1 110 ? 24.183  1.040   -18.316 1.00 61.04  ? 722  PHE A CD1   1 
ATOM   668  C CD2   . PHE A 1 110 ? 23.464  -0.941  -19.439 1.00 56.34  ? 722  PHE A CD2   1 
ATOM   669  C CE1   . PHE A 1 110 ? 25.470  0.506   -18.197 1.00 63.44  ? 722  PHE A CE1   1 
ATOM   670  C CE2   . PHE A 1 110 ? 24.751  -1.473  -19.325 1.00 60.94  ? 722  PHE A CE2   1 
ATOM   671  C CZ    . PHE A 1 110 ? 25.745  -0.744  -18.705 1.00 61.67  ? 722  PHE A CZ    1 
ATOM   672  N N     . LEU A 1 111 ? 21.566  1.145   -22.293 1.00 50.94  ? 723  LEU A N     1 
ATOM   673  C CA    . LEU A 1 111 ? 22.126  0.871   -23.614 1.00 51.10  ? 723  LEU A CA    1 
ATOM   674  C C     . LEU A 1 111 ? 22.132  2.108   -24.500 1.00 54.52  ? 723  LEU A C     1 
ATOM   675  O O     . LEU A 1 111 ? 23.091  2.307   -25.246 1.00 54.99  ? 723  LEU A O     1 
ATOM   676  C CB    . LEU A 1 111 ? 21.460  -0.337  -24.303 1.00 49.23  ? 723  LEU A CB    1 
ATOM   677  C CG    . LEU A 1 111 ? 21.938  -1.688  -23.777 1.00 54.43  ? 723  LEU A CG    1 
ATOM   678  C CD1   . LEU A 1 111 ? 21.048  -2.795  -24.225 1.00 52.55  ? 723  LEU A CD1   1 
ATOM   679  C CD2   . LEU A 1 111 ? 23.407  -1.961  -24.156 1.00 59.77  ? 723  LEU A CD2   1 
ATOM   680  N N     . ARG A 1 112 ? 21.103  2.958   -24.369 1.00 50.07  ? 724  ARG A N     1 
ATOM   681  C CA    . ARG A 1 112 ? 20.967  4.224   -25.093 1.00 50.80  ? 724  ARG A CA    1 
ATOM   682  C C     . ARG A 1 112 ? 22.093  5.214   -24.767 1.00 57.79  ? 724  ARG A C     1 
ATOM   683  O O     . ARG A 1 112 ? 22.478  5.968   -25.661 1.00 59.44  ? 724  ARG A O     1 
ATOM   684  C CB    . ARG A 1 112 ? 19.611  4.869   -24.804 1.00 51.20  ? 724  ARG A CB    1 
ATOM   685  C CG    . ARG A 1 112 ? 18.457  4.258   -25.581 1.00 62.24  ? 724  ARG A CG    1 
ATOM   686  C CD    . ARG A 1 112 ? 17.119  4.757   -25.073 1.00 74.29  ? 724  ARG A CD    1 
ATOM   687  N NE    . ARG A 1 112 ? 16.010  4.210   -25.853 1.00 82.56  ? 724  ARG A NE    1 
ATOM   688  C CZ    . ARG A 1 112 ? 15.305  4.899   -26.748 1.00 95.02  ? 724  ARG A CZ    1 
ATOM   689  N NH1   . ARG A 1 112 ? 15.580  6.179   -26.980 1.00 79.83  ? 724  ARG A NH1   1 
ATOM   690  N NH2   . ARG A 1 112 ? 14.320  4.313   -27.418 1.00 79.75  ? 724  ARG A NH2   1 
ATOM   691  N N     . LEU A 1 113 ? 22.624  5.200   -23.504 1.00 54.38  ? 725  LEU A N     1 
ATOM   692  C CA    . LEU A 1 113 ? 23.710  6.061   -22.980 1.00 56.01  ? 725  LEU A CA    1 
ATOM   693  C C     . LEU A 1 113 ? 25.121  5.501   -23.306 1.00 58.27  ? 725  LEU A C     1 
ATOM   694  O O     . LEU A 1 113 ? 26.102  6.255   -23.384 1.00 58.28  ? 725  LEU A O     1 
ATOM   695  C CB    . LEU A 1 113 ? 23.586  6.204   -21.441 1.00 57.69  ? 725  LEU A CB    1 
ATOM   696  C CG    . LEU A 1 113 ? 22.365  6.943   -20.850 1.00 63.08  ? 725  LEU A CG    1 
ATOM   697  C CD1   . LEU A 1 113 ? 22.030  6.420   -19.455 1.00 63.65  ? 725  LEU A CD1   1 
ATOM   698  C CD2   . LEU A 1 113 ? 22.604  8.455   -20.769 1.00 68.11  ? 725  LEU A CD2   1 
ATOM   699  N N     . ASN A 1 114 ? 25.214  4.166   -23.448 1.00 51.98  ? 726  ASN A N     1 
ATOM   700  C CA    . ASN A 1 114 ? 26.445  3.443   -23.736 1.00 51.24  ? 726  ASN A CA    1 
ATOM   701  C C     . ASN A 1 114 ? 26.415  2.820   -25.126 1.00 53.36  ? 726  ASN A C     1 
ATOM   702  O O     . ASN A 1 114 ? 26.750  1.642   -25.271 1.00 54.12  ? 726  ASN A O     1 
ATOM   703  C CB    . ASN A 1 114 ? 26.678  2.386   -22.658 1.00 48.36  ? 726  ASN A CB    1 
ATOM   704  C CG    . ASN A 1 114 ? 26.944  2.980   -21.302 1.00 63.31  ? 726  ASN A CG    1 
ATOM   705  O OD1   . ASN A 1 114 ? 28.036  3.479   -21.018 1.00 61.47  ? 726  ASN A OD1   1 
ATOM   706  N ND2   . ASN A 1 114 ? 25.941  2.963   -20.446 1.00 51.34  ? 726  ASN A ND2   1 
ATOM   707  N N     . ASP A 1 115 ? 26.009  3.604   -26.153 1.00 48.21  ? 727  ASP A N     1 
ATOM   708  C CA    . ASP A 1 115 ? 25.902  3.122   -27.539 1.00 46.77  ? 727  ASP A CA    1 
ATOM   709  C C     . ASP A 1 115 ? 27.268  2.749   -28.134 1.00 52.70  ? 727  ASP A C     1 
ATOM   710  O O     . ASP A 1 115 ? 28.191  3.557   -28.107 1.00 54.66  ? 727  ASP A O     1 
ATOM   711  C CB    . ASP A 1 115 ? 25.125  4.110   -28.432 1.00 47.60  ? 727  ASP A CB    1 
ATOM   712  C CG    . ASP A 1 115 ? 24.873  3.646   -29.860 1.00 58.63  ? 727  ASP A CG    1 
ATOM   713  O OD1   . ASP A 1 115 ? 24.697  2.430   -30.069 1.00 59.53  ? 727  ASP A OD1   1 
ATOM   714  O OD2   . ASP A 1 115 ? 24.806  4.507   -30.760 1.00 65.88  ? 727  ASP A OD2   1 
ATOM   715  N N     . GLY A 1 116 ? 27.380  1.499   -28.591 1.00 49.45  ? 728  GLY A N     1 
ATOM   716  C CA    . GLY A 1 116 ? 28.580  0.905   -29.180 1.00 49.94  ? 728  GLY A CA    1 
ATOM   717  C C     . GLY A 1 116 ? 29.772  0.752   -28.256 1.00 55.08  ? 728  GLY A C     1 
ATOM   718  O O     . GLY A 1 116 ? 30.906  0.631   -28.735 1.00 57.34  ? 728  GLY A O     1 
ATOM   719  N N     . GLN A 1 117 ? 29.541  0.733   -26.928 1.00 50.27  ? 729  GLN A N     1 
ATOM   720  C CA    . GLN A 1 117 ? 30.631  0.645   -25.941 1.00 51.34  ? 729  GLN A CA    1 
ATOM   721  C C     . GLN A 1 117 ? 30.969  -0.782  -25.474 1.00 53.69  ? 729  GLN A C     1 
ATOM   722  O O     . GLN A 1 117 ? 31.925  -0.956  -24.725 1.00 54.65  ? 729  GLN A O     1 
ATOM   723  C CB    . GLN A 1 117 ? 30.348  1.561   -24.733 1.00 53.46  ? 729  GLN A CB    1 
ATOM   724  C CG    . GLN A 1 117 ? 30.221  3.053   -25.072 1.00 69.12  ? 729  GLN A CG    1 
ATOM   725  C CD    . GLN A 1 117 ? 31.423  3.599   -25.811 1.00 82.77  ? 729  GLN A CD    1 
ATOM   726  O OE1   . GLN A 1 117 ? 32.472  3.878   -25.220 1.00 81.39  ? 729  GLN A OE1   1 
ATOM   727  N NE2   . GLN A 1 117 ? 31.303  3.735   -27.129 1.00 66.08  ? 729  GLN A NE2   1 
ATOM   728  N N     . PHE A 1 118 ? 30.204  -1.796  -25.916 1.00 48.73  ? 730  PHE A N     1 
ATOM   729  C CA    . PHE A 1 118 ? 30.441  -3.195  -25.538 1.00 47.23  ? 730  PHE A CA    1 
ATOM   730  C C     . PHE A 1 118 ? 30.748  -4.073  -26.736 1.00 50.03  ? 730  PHE A C     1 
ATOM   731  O O     . PHE A 1 118 ? 30.207  -3.851  -27.824 1.00 47.67  ? 730  PHE A O     1 
ATOM   732  C CB    . PHE A 1 118 ? 29.218  -3.784  -24.808 1.00 46.82  ? 730  PHE A CB    1 
ATOM   733  C CG    . PHE A 1 118 ? 28.746  -3.026  -23.591 1.00 48.88  ? 730  PHE A CG    1 
ATOM   734  C CD1   . PHE A 1 118 ? 29.533  -2.955  -22.448 1.00 54.53  ? 730  PHE A CD1   1 
ATOM   735  C CD2   . PHE A 1 118 ? 27.493  -2.429  -23.569 1.00 49.81  ? 730  PHE A CD2   1 
ATOM   736  C CE1   . PHE A 1 118 ? 29.102  -2.240  -21.329 1.00 57.00  ? 730  PHE A CE1   1 
ATOM   737  C CE2   . PHE A 1 118 ? 27.046  -1.742  -22.437 1.00 54.18  ? 730  PHE A CE2   1 
ATOM   738  C CZ    . PHE A 1 118 ? 27.856  -1.642  -21.329 1.00 54.95  ? 730  PHE A CZ    1 
ATOM   739  N N     . THR A 1 119 ? 31.554  -5.134  -26.510 1.00 47.67  ? 731  THR A N     1 
ATOM   740  C CA    . THR A 1 119 ? 31.840  -6.147  -27.530 1.00 46.83  ? 731  THR A CA    1 
ATOM   741  C C     . THR A 1 119 ? 30.592  -7.046  -27.621 1.00 48.36  ? 731  THR A C     1 
ATOM   742  O O     . THR A 1 119 ? 29.747  -7.005  -26.722 1.00 46.97  ? 731  THR A O     1 
ATOM   743  C CB    . THR A 1 119 ? 33.050  -6.998  -27.128 1.00 57.61  ? 731  THR A CB    1 
ATOM   744  O OG1   . THR A 1 119 ? 32.723  -7.713  -25.931 1.00 62.99  ? 731  THR A OG1   1 
ATOM   745  C CG2   . THR A 1 119 ? 34.349  -6.179  -26.968 1.00 51.21  ? 731  THR A CG2   1 
ATOM   746  N N     . VAL A 1 120 ? 30.498  -7.867  -28.685 1.00 44.33  ? 732  VAL A N     1 
ATOM   747  C CA    . VAL A 1 120 ? 29.410  -8.820  -28.925 1.00 41.65  ? 732  VAL A CA    1 
ATOM   748  C C     . VAL A 1 120 ? 29.336  -9.847  -27.790 1.00 45.10  ? 732  VAL A C     1 
ATOM   749  O O     . VAL A 1 120 ? 28.236  -10.154 -27.352 1.00 42.60  ? 732  VAL A O     1 
ATOM   750  C CB    . VAL A 1 120 ? 29.522  -9.479  -30.326 1.00 44.93  ? 732  VAL A CB    1 
ATOM   751  C CG1   . VAL A 1 120 ? 28.446  -10.551 -30.543 1.00 41.88  ? 732  VAL A CG1   1 
ATOM   752  C CG2   . VAL A 1 120 ? 29.461  -8.423  -31.430 1.00 45.27  ? 732  VAL A CG2   1 
ATOM   753  N N     . ILE A 1 121 ? 30.492  -10.335 -27.286 1.00 44.99  ? 733  ILE A N     1 
ATOM   754  C CA    . ILE A 1 121 ? 30.577  -11.313 -26.187 1.00 46.73  ? 733  ILE A CA    1 
ATOM   755  C C     . ILE A 1 121 ? 29.848  -10.810 -24.940 1.00 50.81  ? 733  ILE A C     1 
ATOM   756  O O     . ILE A 1 121 ? 29.070  -11.560 -24.348 1.00 51.45  ? 733  ILE A O     1 
ATOM   757  C CB    . ILE A 1 121 ? 32.054  -11.759 -25.896 1.00 53.35  ? 733  ILE A CB    1 
ATOM   758  C CG1   . ILE A 1 121 ? 32.662  -12.573 -27.071 1.00 55.12  ? 733  ILE A CG1   1 
ATOM   759  C CG2   . ILE A 1 121 ? 32.206  -12.516 -24.561 1.00 54.59  ? 733  ILE A CG2   1 
ATOM   760  C CD1   . ILE A 1 121 ? 31.823  -13.778 -27.615 1.00 60.35  ? 733  ILE A CD1   1 
ATOM   761  N N     . GLN A 1 122 ? 30.058  -9.536  -24.584 1.00 47.22  ? 734  GLN A N     1 
ATOM   762  C CA    . GLN A 1 122 ? 29.422  -8.879  -23.446 1.00 46.66  ? 734  GLN A CA    1 
ATOM   763  C C     . GLN A 1 122 ? 27.905  -8.789  -23.612 1.00 46.23  ? 734  GLN A C     1 
ATOM   764  O O     . GLN A 1 122 ? 27.195  -8.968  -22.628 1.00 46.02  ? 734  GLN A O     1 
ATOM   765  C CB    . GLN A 1 122 ? 30.016  -7.481  -23.230 1.00 49.96  ? 734  GLN A CB    1 
ATOM   766  C CG    . GLN A 1 122 ? 31.362  -7.490  -22.509 1.00 59.76  ? 734  GLN A CG    1 
ATOM   767  C CD    . GLN A 1 122 ? 31.878  -6.096  -22.281 1.00 66.02  ? 734  GLN A CD    1 
ATOM   768  O OE1   . GLN A 1 122 ? 32.130  -5.339  -23.223 1.00 58.38  ? 734  GLN A OE1   1 
ATOM   769  N NE2   . GLN A 1 122 ? 32.070  -5.737  -21.020 1.00 56.31  ? 734  GLN A NE2   1 
ATOM   770  N N     . LEU A 1 123 ? 27.411  -8.527  -24.847 1.00 39.81  ? 735  LEU A N     1 
ATOM   771  C CA    . LEU A 1 123 ? 25.962  -8.433  -25.142 1.00 36.95  ? 735  LEU A CA    1 
ATOM   772  C C     . LEU A 1 123 ? 25.298  -9.787  -25.073 1.00 40.82  ? 735  LEU A C     1 
ATOM   773  O O     . LEU A 1 123 ? 24.227  -9.900  -24.479 1.00 40.48  ? 735  LEU A O     1 
ATOM   774  C CB    . LEU A 1 123 ? 25.658  -7.719  -26.478 1.00 35.00  ? 735  LEU A CB    1 
ATOM   775  C CG    . LEU A 1 123 ? 26.188  -6.290  -26.610 1.00 38.67  ? 735  LEU A CG    1 
ATOM   776  C CD1   . LEU A 1 123 ? 26.092  -5.804  -28.026 1.00 37.51  ? 735  LEU A CD1   1 
ATOM   777  C CD2   . LEU A 1 123 ? 25.471  -5.329  -25.665 1.00 40.60  ? 735  LEU A CD2   1 
ATOM   778  N N     . VAL A 1 124 ? 25.960  -10.825 -25.616 1.00 39.03  ? 736  VAL A N     1 
ATOM   779  C CA    . VAL A 1 124 ? 25.498  -12.227 -25.577 1.00 38.70  ? 736  VAL A CA    1 
ATOM   780  C C     . VAL A 1 124 ? 25.437  -12.685 -24.091 1.00 43.49  ? 736  VAL A C     1 
ATOM   781  O O     . VAL A 1 124 ? 24.504  -13.390 -23.698 1.00 42.52  ? 736  VAL A O     1 
ATOM   782  C CB    . VAL A 1 124 ? 26.386  -13.148 -26.468 1.00 43.31  ? 736  VAL A CB    1 
ATOM   783  C CG1   . VAL A 1 124 ? 25.982  -14.625 -26.353 1.00 42.20  ? 736  VAL A CG1   1 
ATOM   784  C CG2   . VAL A 1 124 ? 26.340  -12.698 -27.929 1.00 42.53  ? 736  VAL A CG2   1 
ATOM   785  N N     . GLY A 1 125 ? 26.406  -12.228 -23.292 1.00 40.92  ? 737  GLY A N     1 
ATOM   786  C CA    . GLY A 1 125 ? 26.471  -12.489 -21.860 1.00 41.54  ? 737  GLY A CA    1 
ATOM   787  C C     . GLY A 1 125 ? 25.282  -11.908 -21.121 1.00 45.54  ? 737  GLY A C     1 
ATOM   788  O O     . GLY A 1 125 ? 24.727  -12.575 -20.243 1.00 46.06  ? 737  GLY A O     1 
ATOM   789  N N     . MET A 1 126 ? 24.867  -10.662 -21.493 1.00 41.17  ? 738  MET A N     1 
ATOM   790  C CA    . MET A 1 126 ? 23.712  -9.965  -20.911 1.00 40.85  ? 738  MET A CA    1 
ATOM   791  C C     . MET A 1 126 ? 22.437  -10.743 -21.259 1.00 42.39  ? 738  MET A C     1 
ATOM   792  O O     . MET A 1 126 ? 21.618  -10.993 -20.374 1.00 42.85  ? 738  MET A O     1 
ATOM   793  C CB    . MET A 1 126 ? 23.612  -8.499  -21.407 1.00 43.45  ? 738  MET A CB    1 
ATOM   794  C CG    . MET A 1 126 ? 24.739  -7.569  -20.926 1.00 49.61  ? 738  MET A CG    1 
ATOM   795  S SD    . MET A 1 126 ? 24.705  -5.943  -21.755 1.00 54.55  ? 738  MET A SD    1 
ATOM   796  C CE    . MET A 1 126 ? 26.333  -5.396  -21.460 1.00 53.48  ? 738  MET A CE    1 
ATOM   797  N N     . LEU A 1 127 ? 22.302  -11.158 -22.543 1.00 36.37  ? 739  LEU A N     1 
ATOM   798  C CA    . LEU A 1 127 ? 21.188  -11.951 -23.071 1.00 34.68  ? 739  LEU A CA    1 
ATOM   799  C C     . LEU A 1 127 ? 21.084  -13.349 -22.446 1.00 37.85  ? 739  LEU A C     1 
ATOM   800  O O     . LEU A 1 127 ? 19.965  -13.835 -22.254 1.00 37.03  ? 739  LEU A O     1 
ATOM   801  C CB    . LEU A 1 127 ? 21.279  -12.081 -24.606 1.00 33.66  ? 739  LEU A CB    1 
ATOM   802  C CG    . LEU A 1 127 ? 21.041  -10.794 -25.409 1.00 37.40  ? 739  LEU A CG    1 
ATOM   803  C CD1   . LEU A 1 127 ? 21.393  -10.996 -26.887 1.00 37.33  ? 739  LEU A CD1   1 
ATOM   804  C CD2   . LEU A 1 127 ? 19.605  -10.302 -25.254 1.00 34.90  ? 739  LEU A CD2   1 
ATOM   805  N N     . ARG A 1 128 ? 22.232  -13.991 -22.144 1.00 34.25  ? 740  ARG A N     1 
ATOM   806  C CA    . ARG A 1 128 ? 22.285  -15.332 -21.536 1.00 35.26  ? 740  ARG A CA    1 
ATOM   807  C C     . ARG A 1 128 ? 21.692  -15.310 -20.123 1.00 39.76  ? 740  ARG A C     1 
ATOM   808  O O     . ARG A 1 128 ? 20.980  -16.240 -19.751 1.00 39.62  ? 740  ARG A O     1 
ATOM   809  C CB    . ARG A 1 128 ? 23.727  -15.903 -21.552 1.00 37.40  ? 740  ARG A CB    1 
ATOM   810  C CG    . ARG A 1 128 ? 23.817  -17.422 -21.313 1.00 44.33  ? 740  ARG A CG    1 
ATOM   811  C CD    . ARG A 1 128 ? 24.165  -17.783 -19.878 1.00 45.46  ? 740  ARG A CD    1 
ATOM   812  N NE    . ARG A 1 128 ? 24.247  -19.233 -19.677 1.00 48.90  ? 740  ARG A NE    1 
ATOM   813  C CZ    . ARG A 1 128 ? 23.907  -19.867 -18.555 1.00 57.57  ? 740  ARG A CZ    1 
ATOM   814  N NH1   . ARG A 1 128 ? 23.445  -19.186 -17.511 1.00 36.40  ? 740  ARG A NH1   1 
ATOM   815  N NH2   . ARG A 1 128 ? 24.022  -21.185 -18.471 1.00 47.38  ? 740  ARG A NH2   1 
ATOM   816  N N     . GLY A 1 129 ? 21.990  -14.252 -19.372 1.00 37.60  ? 741  GLY A N     1 
ATOM   817  C CA    . GLY A 1 129 ? 21.468  -14.013 -18.032 1.00 38.77  ? 741  GLY A CA    1 
ATOM   818  C C     . GLY A 1 129 ? 19.954  -13.844 -18.014 1.00 41.16  ? 741  GLY A C     1 
ATOM   819  O O     . GLY A 1 129 ? 19.263  -14.553 -17.275 1.00 42.69  ? 741  GLY A O     1 
ATOM   820  N N     . ILE A 1 130 ? 19.414  -12.966 -18.880 1.00 33.91  ? 742  ILE A N     1 
ATOM   821  C CA    . ILE A 1 130 ? 17.964  -12.751 -19.026 1.00 32.32  ? 742  ILE A CA    1 
ATOM   822  C C     . ILE A 1 130 ? 17.281  -14.087 -19.362 1.00 38.56  ? 742  ILE A C     1 
ATOM   823  O O     . ILE A 1 130 ? 16.305  -14.457 -18.701 1.00 39.03  ? 742  ILE A O     1 
ATOM   824  C CB    . ILE A 1 130 ? 17.652  -11.613 -20.051 1.00 33.97  ? 742  ILE A CB    1 
ATOM   825  C CG1   . ILE A 1 130 ? 18.293  -10.278 -19.595 1.00 34.59  ? 742  ILE A CG1   1 
ATOM   826  C CG2   . ILE A 1 130 ? 16.117  -11.435 -20.288 1.00 33.93  ? 742  ILE A CG2   1 
ATOM   827  C CD1   . ILE A 1 130 ? 18.491  -9.246  -20.709 1.00 41.25  ? 742  ILE A CD1   1 
ATOM   828  N N     . ALA A 1 131 ? 17.843  -14.841 -20.339 1.00 36.01  ? 743  ALA A N     1 
ATOM   829  C CA    . ALA A 1 131 ? 17.348  -16.168 -20.735 1.00 35.20  ? 743  ALA A CA    1 
ATOM   830  C C     . ALA A 1 131 ? 17.424  -17.162 -19.565 1.00 38.79  ? 743  ALA A C     1 
ATOM   831  O O     . ALA A 1 131 ? 16.485  -17.932 -19.383 1.00 38.08  ? 743  ALA A O     1 
ATOM   832  C CB    . ALA A 1 131 ? 18.110  -16.695 -21.950 1.00 35.07  ? 743  ALA A CB    1 
ATOM   833  N N     . ALA A 1 132 ? 18.500  -17.110 -18.742 1.00 36.76  ? 744  ALA A N     1 
ATOM   834  C CA    . ALA A 1 132 ? 18.630  -17.992 -17.564 1.00 38.02  ? 744  ALA A CA    1 
ATOM   835  C C     . ALA A 1 132 ? 17.552  -17.670 -16.510 1.00 41.74  ? 744  ALA A C     1 
ATOM   836  O O     . ALA A 1 132 ? 16.949  -18.590 -15.963 1.00 41.61  ? 744  ALA A O     1 
ATOM   837  C CB    . ALA A 1 132 ? 20.027  -17.898 -16.961 1.00 39.99  ? 744  ALA A CB    1 
ATOM   838  N N     . GLY A 1 133 ? 17.283  -16.374 -16.306 1.00 38.93  ? 745  GLY A N     1 
ATOM   839  C CA    . GLY A 1 133 ? 16.265  -15.856 -15.393 1.00 38.77  ? 745  GLY A CA    1 
ATOM   840  C C     . GLY A 1 133 ? 14.862  -16.206 -15.845 1.00 40.77  ? 745  GLY A C     1 
ATOM   841  O O     . GLY A 1 133 ? 14.023  -16.571 -15.022 1.00 41.12  ? 745  GLY A O     1 
ATOM   842  N N     . MET A 1 134 ? 14.601  -16.103 -17.168 1.00 35.07  ? 746  MET A N     1 
ATOM   843  C CA    . MET A 1 134 ? 13.311  -16.456 -17.759 1.00 33.74  ? 746  MET A CA    1 
ATOM   844  C C     . MET A 1 134 ? 13.071  -17.966 -17.747 1.00 37.91  ? 746  MET A C     1 
ATOM   845  O O     . MET A 1 134 ? 11.915  -18.391 -17.685 1.00 38.00  ? 746  MET A O     1 
ATOM   846  C CB    . MET A 1 134 ? 13.168  -15.917 -19.190 1.00 33.83  ? 746  MET A CB    1 
ATOM   847  C CG    . MET A 1 134 ? 12.792  -14.429 -19.292 1.00 36.22  ? 746  MET A CG    1 
ATOM   848  S SD    . MET A 1 134 ? 11.533  -13.823 -18.143 1.00 40.69  ? 746  MET A SD    1 
ATOM   849  C CE    . MET A 1 134 ? 10.029  -14.687 -18.739 1.00 36.22  ? 746  MET A CE    1 
ATOM   850  N N     . LYS A 1 135 ? 14.152  -18.776 -17.811 1.00 34.86  ? 747  LYS A N     1 
ATOM   851  C CA    . LYS A 1 135 ? 14.063  -20.241 -17.764 1.00 35.49  ? 747  LYS A CA    1 
ATOM   852  C C     . LYS A 1 135 ? 13.609  -20.682 -16.365 1.00 42.70  ? 747  LYS A C     1 
ATOM   853  O O     . LYS A 1 135 ? 12.781  -21.590 -16.243 1.00 43.74  ? 747  LYS A O     1 
ATOM   854  C CB    . LYS A 1 135 ? 15.407  -20.872 -18.171 1.00 38.28  ? 747  LYS A CB    1 
ATOM   855  C CG    . LYS A 1 135 ? 15.498  -22.391 -18.036 1.00 45.69  ? 747  LYS A CG    1 
ATOM   856  C CD    . LYS A 1 135 ? 16.949  -22.844 -18.208 1.00 60.25  ? 747  LYS A CD    1 
ATOM   857  C CE    . LYS A 1 135 ? 17.311  -24.062 -17.391 1.00 72.84  ? 747  LYS A CE    1 
ATOM   858  N NZ    . LYS A 1 135 ? 16.744  -25.308 -17.962 1.00 82.98  ? 747  LYS A NZ    1 
ATOM   859  N N     . TYR A 1 136 ? 14.125  -20.004 -15.320 1.00 40.68  ? 748  TYR A N     1 
ATOM   860  C CA    . TYR A 1 136 ? 13.767  -20.250 -13.927 1.00 43.13  ? 748  TYR A CA    1 
ATOM   861  C C     . TYR A 1 136 ? 12.271  -19.980 -13.736 1.00 46.45  ? 748  TYR A C     1 
ATOM   862  O O     . TYR A 1 136 ? 11.581  -20.802 -13.131 1.00 46.81  ? 748  TYR A O     1 
ATOM   863  C CB    . TYR A 1 136 ? 14.627  -19.370 -12.987 1.00 46.11  ? 748  TYR A CB    1 
ATOM   864  C CG    . TYR A 1 136 ? 14.375  -19.586 -11.509 1.00 50.33  ? 748  TYR A CG    1 
ATOM   865  C CD1   . TYR A 1 136 ? 15.155  -20.470 -10.770 1.00 54.01  ? 748  TYR A CD1   1 
ATOM   866  C CD2   . TYR A 1 136 ? 13.376  -18.883 -10.841 1.00 52.07  ? 748  TYR A CD2   1 
ATOM   867  C CE1   . TYR A 1 136 ? 14.943  -20.655 -9.403  1.00 57.34  ? 748  TYR A CE1   1 
ATOM   868  C CE2   . TYR A 1 136 ? 13.153  -19.061 -9.475  1.00 55.95  ? 748  TYR A CE2   1 
ATOM   869  C CZ    . TYR A 1 136 ? 13.939  -19.946 -8.761  1.00 63.16  ? 748  TYR A CZ    1 
ATOM   870  O OH    . TYR A 1 136 ? 13.709  -20.122 -7.423  1.00 65.12  ? 748  TYR A OH    1 
ATOM   871  N N     . LEU A 1 137 ? 11.772  -18.852 -14.296 1.00 42.17  ? 749  LEU A N     1 
ATOM   872  C CA    . LEU A 1 137 ? 10.362  -18.446 -14.224 1.00 41.37  ? 749  LEU A CA    1 
ATOM   873  C C     . LEU A 1 137 ? 9.445   -19.440 -14.947 1.00 45.59  ? 749  LEU A C     1 
ATOM   874  O O     . LEU A 1 137 ? 8.414   -19.819 -14.391 1.00 44.39  ? 749  LEU A O     1 
ATOM   875  C CB    . LEU A 1 137 ? 10.152  -17.008 -14.758 1.00 39.42  ? 749  LEU A CB    1 
ATOM   876  C CG    . LEU A 1 137 ? 10.721  -15.824 -13.939 1.00 44.22  ? 749  LEU A CG    1 
ATOM   877  C CD1   . LEU A 1 137 ? 10.266  -14.488 -14.528 1.00 41.72  ? 749  LEU A CD1   1 
ATOM   878  C CD2   . LEU A 1 137 ? 10.300  -15.883 -12.463 1.00 49.73  ? 749  LEU A CD2   1 
ATOM   879  N N     . SER A 1 138 ? 9.837   -19.873 -16.173 1.00 44.17  ? 750  SER A N     1 
ATOM   880  C CA    . SER A 1 138 ? 9.105   -20.859 -16.980 1.00 45.30  ? 750  SER A CA    1 
ATOM   881  C C     . SER A 1 138 ? 8.938   -22.204 -16.241 1.00 53.44  ? 750  SER A C     1 
ATOM   882  O O     . SER A 1 138 ? 7.842   -22.769 -16.295 1.00 54.17  ? 750  SER A O     1 
ATOM   883  C CB    . SER A 1 138 ? 9.777   -21.067 -18.335 1.00 49.30  ? 750  SER A CB    1 
ATOM   884  O OG    . SER A 1 138 ? 10.814  -22.036 -18.283 1.00 66.71  ? 750  SER A OG    1 
ATOM   885  N N     . GLU A 1 139 ? 10.009  -22.689 -15.527 1.00 52.60  ? 751  GLU A N     1 
ATOM   886  C CA    . GLU A 1 139 ? 10.025  -23.935 -14.717 1.00 55.11  ? 751  GLU A CA    1 
ATOM   887  C C     . GLU A 1 139 ? 8.849   -23.950 -13.734 1.00 62.18  ? 751  GLU A C     1 
ATOM   888  O O     . GLU A 1 139 ? 8.172   -24.971 -13.591 1.00 63.60  ? 751  GLU A O     1 
ATOM   889  C CB    . GLU A 1 139 ? 11.301  -24.027 -13.854 1.00 57.95  ? 751  GLU A CB    1 
ATOM   890  C CG    . GLU A 1 139 ? 12.617  -24.370 -14.533 1.00 68.24  ? 751  GLU A CG    1 
ATOM   891  C CD    . GLU A 1 139 ? 13.843  -24.152 -13.652 1.00 92.58  ? 751  GLU A CD    1 
ATOM   892  O OE1   . GLU A 1 139 ? 13.703  -24.116 -12.406 1.00 78.45  ? 751  GLU A OE1   1 
ATOM   893  O OE2   . GLU A 1 139 ? 14.951  -24.010 -14.217 1.00 90.46  ? 751  GLU A OE2   1 
ATOM   894  N N     . MET A 1 140 ? 8.637   -22.803 -13.044 1.00 59.15  ? 752  MET A N     1 
ATOM   895  C CA    . MET A 1 140 ? 7.607   -22.573 -12.031 1.00 60.53  ? 752  MET A CA    1 
ATOM   896  C C     . MET A 1 140 ? 6.252   -22.180 -12.622 1.00 60.81  ? 752  MET A C     1 
ATOM   897  O O     . MET A 1 140 ? 5.361   -21.784 -11.865 1.00 62.07  ? 752  MET A O     1 
ATOM   898  C CB    . MET A 1 140 ? 8.079   -21.492 -11.046 1.00 64.24  ? 752  MET A CB    1 
ATOM   899  C CG    . MET A 1 140 ? 9.038   -21.998 -10.011 1.00 70.87  ? 752  MET A CG    1 
ATOM   900  S SD    . MET A 1 140 ? 9.280   -20.774 -8.705  1.00 78.00  ? 752  MET A SD    1 
ATOM   901  C CE    . MET A 1 140 ? 10.658  -21.491 -7.865  1.00 76.85  ? 752  MET A CE    1 
ATOM   902  N N     . ASN A 1 141 ? 6.088   -22.296 -13.963 1.00 53.11  ? 753  ASN A N     1 
ATOM   903  C CA    . ASN A 1 141 ? 4.864   -21.933 -14.702 1.00 50.93  ? 753  ASN A CA    1 
ATOM   904  C C     . ASN A 1 141 ? 4.455   -20.462 -14.429 1.00 51.28  ? 753  ASN A C     1 
ATOM   905  O O     . ASN A 1 141 ? 3.273   -20.146 -14.250 1.00 52.24  ? 753  ASN A O     1 
ATOM   906  C CB    . ASN A 1 141 ? 3.709   -22.947 -14.457 1.00 53.57  ? 753  ASN A CB    1 
ATOM   907  C CG    . ASN A 1 141 ? 2.590   -22.941 -15.490 1.00 76.46  ? 753  ASN A CG    1 
ATOM   908  O OD1   . ASN A 1 141 ? 2.505   -22.080 -16.381 1.00 64.97  ? 753  ASN A OD1   1 
ATOM   909  N ND2   . ASN A 1 141 ? 1.685   -23.903 -15.380 1.00 71.80  ? 753  ASN A ND2   1 
ATOM   910  N N     . TYR A 1 142 ? 5.456   -19.573 -14.385 1.00 43.77  ? 754  TYR A N     1 
ATOM   911  C CA    . TYR A 1 142 ? 5.231   -18.155 -14.175 1.00 42.74  ? 754  TYR A CA    1 
ATOM   912  C C     . TYR A 1 142 ? 5.331   -17.426 -15.510 1.00 42.17  ? 754  TYR A C     1 
ATOM   913  O O     . TYR A 1 142 ? 6.386   -17.450 -16.146 1.00 38.95  ? 754  TYR A O     1 
ATOM   914  C CB    . TYR A 1 142 ? 6.211   -17.559 -13.140 1.00 45.18  ? 754  TYR A CB    1 
ATOM   915  C CG    . TYR A 1 142 ? 5.925   -16.105 -12.825 1.00 47.34  ? 754  TYR A CG    1 
ATOM   916  C CD1   . TYR A 1 142 ? 4.984   -15.752 -11.858 1.00 51.38  ? 754  TYR A CD1   1 
ATOM   917  C CD2   . TYR A 1 142 ? 6.560   -15.081 -13.523 1.00 46.23  ? 754  TYR A CD2   1 
ATOM   918  C CE1   . TYR A 1 142 ? 4.688   -14.414 -11.588 1.00 51.78  ? 754  TYR A CE1   1 
ATOM   919  C CE2   . TYR A 1 142 ? 6.265   -13.741 -13.270 1.00 47.60  ? 754  TYR A CE2   1 
ATOM   920  C CZ    . TYR A 1 142 ? 5.335   -13.412 -12.292 1.00 58.23  ? 754  TYR A CZ    1 
ATOM   921  O OH    . TYR A 1 142 ? 5.054   -12.092 -12.018 1.00 59.27  ? 754  TYR A OH    1 
ATOM   922  N N     . VAL A 1 143 ? 4.261   -16.757 -15.917 1.00 38.35  ? 755  VAL A N     1 
ATOM   923  C CA    . VAL A 1 143 ? 4.266   -15.997 -17.156 1.00 36.39  ? 755  VAL A CA    1 
ATOM   924  C C     . VAL A 1 143 ? 4.407   -14.530 -16.781 1.00 40.86  ? 755  VAL A C     1 
ATOM   925  O O     . VAL A 1 143 ? 3.571   -13.989 -16.084 1.00 42.01  ? 755  VAL A O     1 
ATOM   926  C CB    . VAL A 1 143 ? 2.967   -16.207 -17.958 1.00 39.61  ? 755  VAL A CB    1 
ATOM   927  C CG1   . VAL A 1 143 ? 3.024   -15.459 -19.276 1.00 37.68  ? 755  VAL A CG1   1 
ATOM   928  C CG2   . VAL A 1 143 ? 2.730   -17.680 -18.219 1.00 39.56  ? 755  VAL A CG2   1 
ATOM   929  N N     . HIS A 1 144 ? 5.489   -13.901 -17.223 1.00 36.93  ? 756  HIS A N     1 
ATOM   930  C CA    . HIS A 1 144 ? 5.750   -12.496 -16.925 1.00 36.43  ? 756  HIS A CA    1 
ATOM   931  C C     . HIS A 1 144 ? 4.768   -11.488 -17.551 1.00 38.43  ? 756  HIS A C     1 
ATOM   932  O O     . HIS A 1 144 ? 4.267   -10.616 -16.864 1.00 38.26  ? 756  HIS A O     1 
ATOM   933  C CB    . HIS A 1 144 ? 7.184   -12.189 -17.359 1.00 36.41  ? 756  HIS A CB    1 
ATOM   934  C CG    . HIS A 1 144 ? 7.749   -10.919 -16.806 1.00 40.03  ? 756  HIS A CG    1 
ATOM   935  N ND1   . HIS A 1 144 ? 7.276   -9.675  -17.160 1.00 40.84  ? 756  HIS A ND1   1 
ATOM   936  C CD2   . HIS A 1 144 ? 8.784   -10.701 -15.967 1.00 42.51  ? 756  HIS A CD2   1 
ATOM   937  C CE1   . HIS A 1 144 ? 7.979   -8.748  -16.543 1.00 41.02  ? 756  HIS A CE1   1 
ATOM   938  N NE2   . HIS A 1 144 ? 8.899   -9.344  -15.812 1.00 42.66  ? 756  HIS A NE2   1 
ATOM   939  N N     . ARG A 1 145 ? 4.501   -11.627 -18.845 1.00 33.30  ? 757  ARG A N     1 
ATOM   940  C CA    . ARG A 1 145 ? 3.556   -10.778 -19.581 1.00 32.34  ? 757  ARG A CA    1 
ATOM   941  C C     . ARG A 1 145 ? 4.055   -9.379  -19.977 1.00 35.03  ? 757  ARG A C     1 
ATOM   942  O O     . ARG A 1 145 ? 3.379   -8.664  -20.690 1.00 33.61  ? 757  ARG A O     1 
ATOM   943  C CB    . ARG A 1 145 ? 2.250   -10.638 -18.796 1.00 32.98  ? 757  ARG A CB    1 
ATOM   944  C CG    . ARG A 1 145 ? 1.254   -11.754 -19.025 1.00 48.55  ? 757  ARG A CG    1 
ATOM   945  C CD    . ARG A 1 145 ? -0.005  -11.593 -18.184 1.00 60.44  ? 757  ARG A CD    1 
ATOM   946  N NE    . ARG A 1 145 ? -0.777  -12.832 -18.126 1.00 68.94  ? 757  ARG A NE    1 
ATOM   947  C CZ    . ARG A 1 145 ? -2.089  -12.917 -18.316 1.00 80.04  ? 757  ARG A CZ    1 
ATOM   948  N NH1   . ARG A 1 145 ? -2.801  -11.834 -18.572 1.00 61.37  ? 757  ARG A NH1   1 
ATOM   949  N NH2   . ARG A 1 145 ? -2.689  -14.094 -18.249 1.00 66.02  ? 757  ARG A NH2   1 
ATOM   950  N N     . ASP A 1 146 ? 5.246   -9.009  -19.538 1.00 31.76  ? 758  ASP A N     1 
ATOM   951  C CA    . ASP A 1 146 ? 5.813   -7.692  -19.806 1.00 30.79  ? 758  ASP A CA    1 
ATOM   952  C C     . ASP A 1 146 ? 7.359   -7.695  -19.923 1.00 33.94  ? 758  ASP A C     1 
ATOM   953  O O     . ASP A 1 146 ? 8.039   -6.800  -19.404 1.00 34.67  ? 758  ASP A O     1 
ATOM   954  C CB    . ASP A 1 146 ? 5.308   -6.698  -18.742 1.00 32.95  ? 758  ASP A CB    1 
ATOM   955  C CG    . ASP A 1 146 ? 5.451   -5.241  -19.112 1.00 40.93  ? 758  ASP A CG    1 
ATOM   956  O OD1   . ASP A 1 146 ? 5.707   -4.949  -20.301 1.00 38.59  ? 758  ASP A OD1   1 
ATOM   957  O OD2   . ASP A 1 146 ? 5.366   -4.396  -18.207 1.00 51.57  ? 758  ASP A OD2   1 
ATOM   958  N N     . LEU A 1 147 ? 7.902   -8.680  -20.638 1.00 27.99  ? 759  LEU A N     1 
ATOM   959  C CA    . LEU A 1 147 ? 9.349   -8.803  -20.827 1.00 26.62  ? 759  LEU A CA    1 
ATOM   960  C C     . LEU A 1 147 ? 9.812   -7.813  -21.894 1.00 30.45  ? 759  LEU A C     1 
ATOM   961  O O     . LEU A 1 147 ? 9.450   -7.910  -23.067 1.00 29.59  ? 759  LEU A O     1 
ATOM   962  C CB    . LEU A 1 147 ? 9.745   -10.271 -21.140 1.00 25.52  ? 759  LEU A CB    1 
ATOM   963  C CG    . LEU A 1 147 ? 11.247  -10.621 -21.310 1.00 29.33  ? 759  LEU A CG    1 
ATOM   964  C CD1   . LEU A 1 147 ? 12.016  -10.435 -20.008 1.00 30.70  ? 759  LEU A CD1   1 
ATOM   965  C CD2   . LEU A 1 147 ? 11.420  -12.056 -21.824 1.00 27.30  ? 759  LEU A CD2   1 
ATOM   966  N N     . ALA A 1 148 ? 10.561  -6.822  -21.450 1.00 29.35  ? 760  ALA A N     1 
ATOM   967  C CA    . ALA A 1 148 ? 11.071  -5.705  -22.246 1.00 28.68  ? 760  ALA A CA    1 
ATOM   968  C C     . ALA A 1 148 ? 12.314  -5.158  -21.538 1.00 33.39  ? 760  ALA A C     1 
ATOM   969  O O     . ALA A 1 148 ? 12.392  -5.265  -20.308 1.00 33.65  ? 760  ALA A O     1 
ATOM   970  C CB    . ALA A 1 148 ? 10.001  -4.619  -22.332 1.00 28.61  ? 760  ALA A CB    1 
ATOM   971  N N     . ALA A 1 149 ? 13.255  -4.539  -22.280 1.00 30.64  ? 761  ALA A N     1 
ATOM   972  C CA    . ALA A 1 149 ? 14.476  -3.972  -21.660 1.00 32.78  ? 761  ALA A CA    1 
ATOM   973  C C     . ALA A 1 149 ? 14.198  -2.962  -20.524 1.00 39.01  ? 761  ALA A C     1 
ATOM   974  O O     . ALA A 1 149 ? 15.024  -2.828  -19.610 1.00 39.66  ? 761  ALA A O     1 
ATOM   975  C CB    . ALA A 1 149 ? 15.398  -3.362  -22.711 1.00 33.29  ? 761  ALA A CB    1 
ATOM   976  N N     . ARG A 1 150 ? 13.009  -2.307  -20.555 1.00 35.77  ? 762  ARG A N     1 
ATOM   977  C CA    . ARG A 1 150 ? 12.563  -1.356  -19.533 1.00 36.35  ? 762  ARG A CA    1 
ATOM   978  C C     . ARG A 1 150 ? 12.295  -2.025  -18.172 1.00 41.03  ? 762  ARG A C     1 
ATOM   979  O O     . ARG A 1 150 ? 12.251  -1.331  -17.162 1.00 42.21  ? 762  ARG A O     1 
ATOM   980  C CB    . ARG A 1 150 ? 11.338  -0.569  -20.012 1.00 35.10  ? 762  ARG A CB    1 
ATOM   981  C CG    . ARG A 1 150 ? 10.088  -1.419  -20.147 1.00 40.39  ? 762  ARG A CG    1 
ATOM   982  C CD    . ARG A 1 150 ? 8.819   -0.631  -20.418 1.00 32.07  ? 762  ARG A CD    1 
ATOM   983  N NE    . ARG A 1 150 ? 7.782   -1.558  -20.863 1.00 33.73  ? 762  ARG A NE    1 
ATOM   984  C CZ    . ARG A 1 150 ? 7.656   -1.987  -22.112 1.00 42.37  ? 762  ARG A CZ    1 
ATOM   985  N NH1   . ARG A 1 150 ? 8.451   -1.521  -23.065 1.00 29.51  ? 762  ARG A NH1   1 
ATOM   986  N NH2   . ARG A 1 150 ? 6.718   -2.864  -22.424 1.00 32.85  ? 762  ARG A NH2   1 
ATOM   987  N N     . ASN A 1 151 ? 12.072  -3.360  -18.172 1.00 37.75  ? 763  ASN A N     1 
ATOM   988  C CA    . ASN A 1 151 ? 11.816  -4.206  -17.001 1.00 38.40  ? 763  ASN A CA    1 
ATOM   989  C C     . ASN A 1 151 ? 13.009  -5.116  -16.707 1.00 41.79  ? 763  ASN A C     1 
ATOM   990  O O     . ASN A 1 151 ? 12.874  -6.157  -16.057 1.00 42.92  ? 763  ASN A O     1 
ATOM   991  C CB    . ASN A 1 151 ? 10.510  -5.007  -17.169 1.00 37.66  ? 763  ASN A CB    1 
ATOM   992  C CG    . ASN A 1 151 ? 9.274   -4.218  -16.828 1.00 54.02  ? 763  ASN A CG    1 
ATOM   993  O OD1   . ASN A 1 151 ? 9.276   -3.363  -15.932 1.00 52.66  ? 763  ASN A OD1   1 
ATOM   994  N ND2   . ASN A 1 151 ? 8.181   -4.495  -17.529 1.00 39.06  ? 763  ASN A ND2   1 
ATOM   995  N N     . ILE A 1 152 ? 14.184  -4.722  -17.202 1.00 37.10  ? 764  ILE A N     1 
ATOM   996  C CA    . ILE A 1 152 ? 15.435  -5.426  -16.944 1.00 36.97  ? 764  ILE A CA    1 
ATOM   997  C C     . ILE A 1 152 ? 16.331  -4.419  -16.220 1.00 42.13  ? 764  ILE A C     1 
ATOM   998  O O     . ILE A 1 152 ? 16.531  -3.307  -16.719 1.00 41.13  ? 764  ILE A O     1 
ATOM   999  C CB    . ILE A 1 152 ? 16.109  -6.009  -18.222 1.00 37.89  ? 764  ILE A CB    1 
ATOM   1000 C CG1   . ILE A 1 152 ? 15.126  -6.835  -19.113 1.00 36.74  ? 764  ILE A CG1   1 
ATOM   1001 C CG2   . ILE A 1 152 ? 17.372  -6.806  -17.876 1.00 37.86  ? 764  ILE A CG2   1 
ATOM   1002 C CD1   . ILE A 1 152 ? 14.437  -8.043  -18.491 1.00 45.16  ? 764  ILE A CD1   1 
ATOM   1003 N N     . LEU A 1 153 ? 16.821  -4.794  -15.034 1.00 40.34  ? 765  LEU A N     1 
ATOM   1004 C CA    . LEU A 1 153 ? 17.704  -3.942  -14.249 1.00 43.84  ? 765  LEU A CA    1 
ATOM   1005 C C     . LEU A 1 153 ? 19.175  -4.442  -14.351 1.00 48.57  ? 765  LEU A C     1 
ATOM   1006 O O     . LEU A 1 153 ? 19.419  -5.646  -14.460 1.00 46.37  ? 765  LEU A O     1 
ATOM   1007 C CB    . LEU A 1 153 ? 17.221  -3.841  -12.789 1.00 46.45  ? 765  LEU A CB    1 
ATOM   1008 C CG    . LEU A 1 153 ? 15.912  -3.071  -12.527 1.00 51.23  ? 765  LEU A CG    1 
ATOM   1009 C CD1   . LEU A 1 153 ? 15.339  -3.441  -11.180 1.00 53.56  ? 765  LEU A CD1   1 
ATOM   1010 C CD2   . LEU A 1 153 ? 16.127  -1.557  -12.562 1.00 54.25  ? 765  LEU A CD2   1 
ATOM   1011 N N     . VAL A 1 154 ? 20.133  -3.503  -14.382 1.00 47.34  ? 766  VAL A N     1 
ATOM   1012 C CA    . VAL A 1 154 ? 21.561  -3.803  -14.538 1.00 48.85  ? 766  VAL A CA    1 
ATOM   1013 C C     . VAL A 1 154 ? 22.342  -3.288  -13.328 1.00 57.74  ? 766  VAL A C     1 
ATOM   1014 O O     . VAL A 1 154 ? 22.115  -2.160  -12.882 1.00 59.17  ? 766  VAL A O     1 
ATOM   1015 C CB    . VAL A 1 154 ? 22.130  -3.217  -15.866 1.00 51.60  ? 766  VAL A CB    1 
ATOM   1016 C CG1   . VAL A 1 154 ? 23.518  -3.768  -16.173 1.00 51.96  ? 766  VAL A CG1   1 
ATOM   1017 C CG2   . VAL A 1 154 ? 21.192  -3.471  -17.039 1.00 48.73  ? 766  VAL A CG2   1 
ATOM   1018 N N     . ASN A 1 155 ? 23.263  -4.113  -12.805 1.00 56.18  ? 767  ASN A N     1 
ATOM   1019 C CA    . ASN A 1 155 ? 24.102  -3.740  -11.674 1.00 58.89  ? 767  ASN A CA    1 
ATOM   1020 C C     . ASN A 1 155 ? 25.491  -3.272  -12.150 1.00 65.09  ? 767  ASN A C     1 
ATOM   1021 O O     . ASN A 1 155 ? 25.718  -3.194  -13.364 1.00 62.97  ? 767  ASN A O     1 
ATOM   1022 C CB    . ASN A 1 155 ? 24.160  -4.870  -10.624 1.00 57.33  ? 767  ASN A CB    1 
ATOM   1023 C CG    . ASN A 1 155 ? 24.951  -6.110  -10.984 1.00 72.95  ? 767  ASN A CG    1 
ATOM   1024 O OD1   . ASN A 1 155 ? 25.512  -6.258  -12.078 1.00 63.84  ? 767  ASN A OD1   1 
ATOM   1025 N ND2   . ASN A 1 155 ? 25.021  -7.038  -10.039 1.00 63.56  ? 767  ASN A ND2   1 
ATOM   1026 N N     . SER A 1 156 ? 26.407  -2.959  -11.199 1.00 64.67  ? 768  SER A N     1 
ATOM   1027 C CA    . SER A 1 156 ? 27.776  -2.486  -11.454 1.00 66.03  ? 768  SER A CA    1 
ATOM   1028 C C     . SER A 1 156 ? 28.656  -3.467  -12.251 1.00 68.54  ? 768  SER A C     1 
ATOM   1029 O O     . SER A 1 156 ? 29.555  -3.021  -12.964 1.00 68.65  ? 768  SER A O     1 
ATOM   1030 C CB    . SER A 1 156 ? 28.458  -2.098  -10.146 1.00 73.04  ? 768  SER A CB    1 
ATOM   1031 O OG    . SER A 1 156 ? 28.535  -3.211  -9.271  1.00 84.49  ? 768  SER A OG    1 
ATOM   1032 N N     . ASN A 1 157 ? 28.387  -4.785  -12.139 1.00 63.62  ? 769  ASN A N     1 
ATOM   1033 C CA    . ASN A 1 157 ? 29.104  -5.858  -12.836 1.00 62.46  ? 769  ASN A CA    1 
ATOM   1034 C C     . ASN A 1 157 ? 28.443  -6.269  -14.165 1.00 64.34  ? 769  ASN A C     1 
ATOM   1035 O O     . ASN A 1 157 ? 28.800  -7.301  -14.741 1.00 63.31  ? 769  ASN A O     1 
ATOM   1036 C CB    . ASN A 1 157 ? 29.269  -7.068  -11.914 1.00 62.51  ? 769  ASN A CB    1 
ATOM   1037 C CG    . ASN A 1 157 ? 30.148  -6.802  -10.723 1.00 80.45  ? 769  ASN A CG    1 
ATOM   1038 O OD1   . ASN A 1 157 ? 29.697  -6.815  -9.575  1.00 75.42  ? 769  ASN A OD1   1 
ATOM   1039 N ND2   . ASN A 1 157 ? 31.419  -6.528  -10.971 1.00 72.07  ? 769  ASN A ND2   1 
ATOM   1040 N N     . LEU A 1 158 ? 27.482  -5.447  -14.644 1.00 60.04  ? 770  LEU A N     1 
ATOM   1041 C CA    . LEU A 1 158 ? 26.701  -5.576  -15.891 1.00 56.79  ? 770  LEU A CA    1 
ATOM   1042 C C     . LEU A 1 158 ? 25.822  -6.851  -15.937 1.00 58.95  ? 770  LEU A C     1 
ATOM   1043 O O     . LEU A 1 158 ? 25.371  -7.258  -17.016 1.00 56.49  ? 770  LEU A O     1 
ATOM   1044 C CB    . LEU A 1 158 ? 27.568  -5.422  -17.168 1.00 56.29  ? 770  LEU A CB    1 
ATOM   1045 C CG    . LEU A 1 158 ? 28.579  -4.246  -17.175 1.00 63.83  ? 770  LEU A CG    1 
ATOM   1046 C CD1   . LEU A 1 158 ? 29.491  -4.298  -18.383 1.00 63.98  ? 770  LEU A CD1   1 
ATOM   1047 C CD2   . LEU A 1 158 ? 27.889  -2.895  -17.076 1.00 66.49  ? 770  LEU A CD2   1 
ATOM   1048 N N     . VAL A 1 159 ? 25.517  -7.427  -14.747 1.00 55.21  ? 771  VAL A N     1 
ATOM   1049 C CA    . VAL A 1 159 ? 24.636  -8.589  -14.602 1.00 52.75  ? 771  VAL A CA    1 
ATOM   1050 C C     . VAL A 1 159 ? 23.194  -8.071  -14.759 1.00 54.59  ? 771  VAL A C     1 
ATOM   1051 O O     . VAL A 1 159 ? 22.788  -7.154  -14.044 1.00 55.71  ? 771  VAL A O     1 
ATOM   1052 C CB    . VAL A 1 159 ? 24.855  -9.358  -13.265 1.00 57.66  ? 771  VAL A CB    1 
ATOM   1053 C CG1   . VAL A 1 159 ? 23.897  -10.544 -13.140 1.00 56.12  ? 771  VAL A CG1   1 
ATOM   1054 C CG2   . VAL A 1 159 ? 26.303  -9.827  -13.126 1.00 58.87  ? 771  VAL A CG2   1 
ATOM   1055 N N     . CYS A 1 160 ? 22.456  -8.632  -15.725 1.00 47.94  ? 772  CYS A N     1 
ATOM   1056 C CA    . CYS A 1 160 ? 21.072  -8.275  -16.044 1.00 46.29  ? 772  CYS A CA    1 
ATOM   1057 C C     . CYS A 1 160 ? 20.081  -9.115  -15.265 1.00 49.20  ? 772  CYS A C     1 
ATOM   1058 O O     . CYS A 1 160 ? 20.217  -10.341 -15.200 1.00 48.09  ? 772  CYS A O     1 
ATOM   1059 C CB    . CYS A 1 160 ? 20.826  -8.376  -17.545 1.00 44.23  ? 772  CYS A CB    1 
ATOM   1060 S SG    . CYS A 1 160 ? 21.823  -7.232  -18.521 1.00 48.18  ? 772  CYS A SG    1 
ATOM   1061 N N     . LYS A 1 161 ? 19.072  -8.453  -14.682 1.00 45.09  ? 773  LYS A N     1 
ATOM   1062 C CA    . LYS A 1 161 ? 18.073  -9.145  -13.876 1.00 44.74  ? 773  LYS A CA    1 
ATOM   1063 C C     . LYS A 1 161 ? 16.644  -8.825  -14.302 1.00 46.67  ? 773  LYS A C     1 
ATOM   1064 O O     . LYS A 1 161 ? 16.285  -7.658  -14.423 1.00 45.28  ? 773  LYS A O     1 
ATOM   1065 C CB    . LYS A 1 161 ? 18.284  -8.852  -12.373 1.00 48.86  ? 773  LYS A CB    1 
ATOM   1066 C CG    . LYS A 1 161 ? 19.624  -9.338  -11.841 1.00 57.29  ? 773  LYS A CG    1 
ATOM   1067 C CD    . LYS A 1 161 ? 19.692  -9.329  -10.335 1.00 67.45  ? 773  LYS A CD    1 
ATOM   1068 C CE    . LYS A 1 161 ? 21.100  -9.595  -9.854  1.00 79.11  ? 773  LYS A CE    1 
ATOM   1069 N NZ    . LYS A 1 161 ? 21.109  -10.293 -8.537  1.00 89.36  ? 773  LYS A NZ    1 
ATOM   1070 N N     . VAL A 1 162 ? 15.821  -9.871  -14.487 1.00 43.36  ? 774  VAL A N     1 
ATOM   1071 C CA    . VAL A 1 162 ? 14.413  -9.732  -14.844 1.00 42.16  ? 774  VAL A CA    1 
ATOM   1072 C C     . VAL A 1 162 ? 13.683  -9.102  -13.643 1.00 48.77  ? 774  VAL A C     1 
ATOM   1073 O O     . VAL A 1 162 ? 13.753  -9.615  -12.527 1.00 49.64  ? 774  VAL A O     1 
ATOM   1074 C CB    . VAL A 1 162 ? 13.759  -11.055 -15.355 1.00 44.98  ? 774  VAL A CB    1 
ATOM   1075 C CG1   . VAL A 1 162 ? 12.273  -10.861 -15.661 1.00 43.50  ? 774  VAL A CG1   1 
ATOM   1076 C CG2   . VAL A 1 162 ? 14.485  -11.600 -16.595 1.00 43.29  ? 774  VAL A CG2   1 
ATOM   1077 N N     . SER A 1 163 ? 13.038  -7.950  -13.887 1.00 46.24  ? 775  SER A N     1 
ATOM   1078 C CA    . SER A 1 163 ? 12.316  -7.164  -12.890 1.00 47.66  ? 775  SER A CA    1 
ATOM   1079 C C     . SER A 1 163 ? 10.853  -6.989  -13.292 1.00 51.02  ? 775  SER A C     1 
ATOM   1080 O O     . SER A 1 163 ? 10.455  -7.370  -14.399 1.00 49.08  ? 775  SER A O     1 
ATOM   1081 C CB    . SER A 1 163 ? 12.972  -5.793  -12.751 1.00 52.11  ? 775  SER A CB    1 
ATOM   1082 O OG    . SER A 1 163 ? 12.418  -5.036  -11.688 1.00 65.91  ? 775  SER A OG    1 
ATOM   1083 N N     . ASP A 1 164 ? 10.068  -6.411  -12.366 1.00 48.66  ? 776  ASP A N     1 
ATOM   1084 C CA    . ASP A 1 164 ? 8.652   -6.046  -12.445 1.00 48.52  ? 776  ASP A CA    1 
ATOM   1085 C C     . ASP A 1 164 ? 8.249   -5.358  -11.137 1.00 55.06  ? 776  ASP A C     1 
ATOM   1086 O O     . ASP A 1 164 ? 8.914   -5.547  -10.111 1.00 56.67  ? 776  ASP A O     1 
ATOM   1087 C CB    . ASP A 1 164 ? 7.737   -7.267  -12.723 1.00 49.78  ? 776  ASP A CB    1 
ATOM   1088 C CG    . ASP A 1 164 ? 6.405   -6.926  -13.379 1.00 56.29  ? 776  ASP A CG    1 
ATOM   1089 O OD1   . ASP A 1 164 ? 6.287   -5.818  -13.956 1.00 55.99  ? 776  ASP A OD1   1 
ATOM   1090 O OD2   . ASP A 1 164 ? 5.486   -7.773  -13.333 1.00 60.78  ? 776  ASP A OD2   1 
ATOM   1091 N N     . PHE A 1 165 ? 7.143   -4.586  -11.173 1.00 52.03  ? 777  PHE A N     1 
ATOM   1092 C CA    . PHE A 1 165 ? 6.564   -3.827  -10.048 1.00 54.57  ? 777  PHE A CA    1 
ATOM   1093 C C     . PHE A 1 165 ? 7.547   -2.764  -9.490  1.00 62.18  ? 777  PHE A C     1 
ATOM   1094 O O     . PHE A 1 165 ? 7.576   -2.494  -8.281  1.00 64.79  ? 777  PHE A O     1 
ATOM   1095 C CB    . PHE A 1 165 ? 5.998   -4.748  -8.934  1.00 57.90  ? 777  PHE A CB    1 
ATOM   1096 C CG    . PHE A 1 165 ? 5.474   -6.102  -9.363  1.00 57.91  ? 777  PHE A CG    1 
ATOM   1097 C CD1   . PHE A 1 165 ? 4.294   -6.213  -10.088 1.00 58.92  ? 777  PHE A CD1   1 
ATOM   1098 C CD2   . PHE A 1 165 ? 6.150   -7.267  -9.020  1.00 60.02  ? 777  PHE A CD2   1 
ATOM   1099 C CE1   . PHE A 1 165 ? 3.808   -7.468  -10.476 1.00 58.83  ? 777  PHE A CE1   1 
ATOM   1100 C CE2   . PHE A 1 165 ? 5.661   -8.519  -9.408  1.00 61.67  ? 777  PHE A CE2   1 
ATOM   1101 C CZ    . PHE A 1 165 ? 4.500   -8.610  -10.141 1.00 58.12  ? 777  PHE A CZ    1 
ATOM   1102 N N     . GLY A 1 166 ? 8.259   -2.134  -10.425 1.00 57.89  ? 778  GLY A N     1 
ATOM   1103 C CA    . GLY A 1 166 ? 9.220   -1.079  -10.166 1.00 59.42  ? 778  GLY A CA    1 
ATOM   1104 C C     . GLY A 1 166 ? 8.658   0.314   -10.409 1.00 64.02  ? 778  GLY A C     1 
ATOM   1105 O O     . GLY A 1 166 ? 7.530   0.603   -10.038 1.00 63.69  ? 778  GLY A O     1 
ATOM   1106 N N     . LEU A 1 167 ? 9.445   1.191   -11.017 1.00 61.13  ? 779  LEU A N     1 
ATOM   1107 C CA    . LEU A 1 167 ? 9.013   2.562   -11.284 1.00 60.31  ? 779  LEU A CA    1 
ATOM   1108 C C     . LEU A 1 167 ? 7.830   2.703   -12.237 1.00 63.68  ? 779  LEU A C     1 
ATOM   1109 O O     . LEU A 1 167 ? 7.751   2.002   -13.242 1.00 60.67  ? 779  LEU A O     1 
ATOM   1110 C CB    . LEU A 1 167 ? 10.174  3.366   -11.856 1.00 59.51  ? 779  LEU A CB    1 
ATOM   1111 C CG    . LEU A 1 167 ? 11.364  3.568   -10.932 1.00 66.23  ? 779  LEU A CG    1 
ATOM   1112 C CD1   . LEU A 1 167 ? 12.429  4.405   -11.609 1.00 65.81  ? 779  LEU A CD1   1 
ATOM   1113 C CD2   . LEU A 1 167 ? 10.900  4.224   -9.649  1.00 70.14  ? 779  LEU A CD2   1 
ATOM   1114 N N     . SER A 1 168 ? 6.919   3.619   -11.900 1.00 62.49  ? 780  SER A N     1 
ATOM   1115 C CA    . SER A 1 168 ? 5.737   3.939   -12.707 1.00 61.41  ? 780  SER A CA    1 
ATOM   1116 C C     . SER A 1 168 ? 6.128   4.561   -14.041 1.00 64.37  ? 780  SER A C     1 
ATOM   1117 O O     . SER A 1 168 ? 5.578   4.224   -15.080 1.00 63.91  ? 780  SER A O     1 
ATOM   1118 C CB    . SER A 1 168 ? 4.819   4.881   -11.943 1.00 67.16  ? 780  SER A CB    1 
ATOM   1119 O OG    . SER A 1 168 ? 4.481   4.332   -10.686 1.00 79.26  ? 780  SER A OG    1 
ATOM   1120 N N     . ARG A 1 169 ? 7.094   5.467   -13.987 1.00 60.21  ? 781  ARG A N     1 
ATOM   1121 C CA    . ARG A 1 169 ? 7.666   6.130   -15.157 1.00 58.67  ? 781  ARG A CA    1 
ATOM   1122 C C     . ARG A 1 169 ? 8.538   5.169   -15.990 1.00 60.86  ? 781  ARG A C     1 
ATOM   1123 O O     . ARG A 1 169 ? 9.172   4.251   -15.455 1.00 60.99  ? 781  ARG A O     1 
ATOM   1124 C CB    . ARG A 1 169 ? 8.462   7.379   -14.736 1.00 60.85  ? 781  ARG A CB    1 
ATOM   1125 N N     . PHE A 1 170 ? 8.549   5.388   -17.307 1.00 54.78  ? 782  PHE A N     1 
ATOM   1126 C CA    . PHE A 1 170 ? 9.304   4.613   -18.296 1.00 52.42  ? 782  PHE A CA    1 
ATOM   1127 C C     . PHE A 1 170 ? 9.537   5.503   -19.520 1.00 56.11  ? 782  PHE A C     1 
ATOM   1128 O O     . PHE A 1 170 ? 8.979   6.604   -19.586 1.00 57.53  ? 782  PHE A O     1 
ATOM   1129 C CB    . PHE A 1 170 ? 8.565   3.299   -18.676 1.00 52.24  ? 782  PHE A CB    1 
ATOM   1130 C CG    . PHE A 1 170 ? 7.127   3.476   -19.119 1.00 52.47  ? 782  PHE A CG    1 
ATOM   1131 C CD1   . PHE A 1 170 ? 6.088   3.459   -18.193 1.00 55.36  ? 782  PHE A CD1   1 
ATOM   1132 C CD2   . PHE A 1 170 ? 6.813   3.662   -20.461 1.00 52.17  ? 782  PHE A CD2   1 
ATOM   1133 C CE1   . PHE A 1 170 ? 4.765   3.646   -18.598 1.00 55.17  ? 782  PHE A CE1   1 
ATOM   1134 C CE2   . PHE A 1 170 ? 5.489   3.861   -20.862 1.00 54.03  ? 782  PHE A CE2   1 
ATOM   1135 C CZ    . PHE A 1 170 ? 4.475   3.842   -19.930 1.00 52.81  ? 782  PHE A CZ    1 
ATOM   1136 N N     . LEU A 1 171 ? 10.353  5.035   -20.482 1.00 50.76  ? 783  LEU A N     1 
ATOM   1137 C CA    . LEU A 1 171 ? 10.662  5.791   -21.696 1.00 49.49  ? 783  LEU A CA    1 
ATOM   1138 C C     . LEU A 1 171 ? 9.481   5.805   -22.658 1.00 49.62  ? 783  LEU A C     1 
ATOM   1139 O O     . LEU A 1 171 ? 8.979   4.738   -23.036 1.00 46.55  ? 783  LEU A O     1 
ATOM   1140 C CB    . LEU A 1 171 ? 11.940  5.270   -22.395 1.00 49.39  ? 783  LEU A CB    1 
ATOM   1141 C CG    . LEU A 1 171 ? 13.283  5.556   -21.697 1.00 55.90  ? 783  LEU A CG    1 
ATOM   1142 C CD1   . LEU A 1 171 ? 14.431  4.859   -22.417 1.00 56.19  ? 783  LEU A CD1   1 
ATOM   1143 C CD2   . LEU A 1 171 ? 13.568  7.049   -21.602 1.00 58.69  ? 783  LEU A CD2   1 
ATOM   1144 N N     . GLU A 1 172 ? 9.018   7.025   -23.018 1.00 45.19  ? 784  GLU A N     1 
ATOM   1145 C CA    . GLU A 1 172 ? 7.904   7.207   -23.945 1.00 43.87  ? 784  GLU A CA    1 
ATOM   1146 C C     . GLU A 1 172 ? 8.340   7.987   -25.192 1.00 45.88  ? 784  GLU A C     1 
ATOM   1147 O O     . GLU A 1 172 ? 8.301   9.214   -25.195 1.00 46.73  ? 784  GLU A O     1 
ATOM   1148 C CB    . GLU A 1 172 ? 6.667   7.826   -23.248 1.00 45.77  ? 784  GLU A CB    1 
ATOM   1149 C CG    . GLU A 1 172 ? 5.368   7.669   -24.037 1.00 54.55  ? 784  GLU A CG    1 
ATOM   1150 C CD    . GLU A 1 172 ? 4.772   6.274   -24.066 1.00 61.40  ? 784  GLU A CD    1 
ATOM   1151 O OE1   . GLU A 1 172 ? 5.406   5.365   -24.651 1.00 44.80  ? 784  GLU A OE1   1 
ATOM   1152 O OE2   . GLU A 1 172 ? 3.671   6.090   -23.495 1.00 47.87  ? 784  GLU A OE2   1 
ATOM   1153 N N     . ASP A 1 173 ? 8.786   7.262   -26.241 1.00 40.00  ? 785  ASP A N     1 
ATOM   1154 C CA    . ASP A 1 173 ? 9.243   7.868   -27.497 1.00 39.38  ? 785  ASP A CA    1 
ATOM   1155 C C     . ASP A 1 173 ? 8.119   8.673   -28.211 1.00 43.86  ? 785  ASP A C     1 
ATOM   1156 O O     . ASP A 1 173 ? 8.377   9.787   -28.652 1.00 45.83  ? 785  ASP A O     1 
ATOM   1157 C CB    . ASP A 1 173 ? 9.913   6.823   -28.415 1.00 39.40  ? 785  ASP A CB    1 
ATOM   1158 C CG    . ASP A 1 173 ? 11.318  6.377   -27.994 1.00 50.23  ? 785  ASP A CG    1 
ATOM   1159 O OD1   . ASP A 1 173 ? 11.862  6.936   -27.005 1.00 51.06  ? 785  ASP A OD1   1 
ATOM   1160 O OD2   . ASP A 1 173 ? 11.888  5.493   -28.670 1.00 56.29  ? 785  ASP A OD2   1 
ATOM   1161 N N     . ASP A 1 174 ? 6.877   8.152   -28.254 1.00 38.44  ? 786  ASP A N     1 
ATOM   1162 C CA    . ASP A 1 174 ? 5.736   8.871   -28.847 1.00 38.35  ? 786  ASP A CA    1 
ATOM   1163 C C     . ASP A 1 174 ? 4.395   8.535   -28.139 1.00 39.53  ? 786  ASP A C     1 
ATOM   1164 O O     . ASP A 1 174 ? 3.822   7.468   -28.392 1.00 37.23  ? 786  ASP A O     1 
ATOM   1165 C CB    . ASP A 1 174 ? 5.649   8.678   -30.389 1.00 39.90  ? 786  ASP A CB    1 
ATOM   1166 C CG    . ASP A 1 174 ? 4.437   9.302   -31.085 1.00 52.52  ? 786  ASP A CG    1 
ATOM   1167 O OD1   . ASP A 1 174 ? 3.888   10.300  -30.561 1.00 52.41  ? 786  ASP A OD1   1 
ATOM   1168 O OD2   . ASP A 1 174 ? 4.046   8.799   -32.155 1.00 64.62  ? 786  ASP A OD2   1 
ATOM   1169 N N     . PRO A 1 175 ? 3.854   9.467   -27.306 1.00 35.75  ? 787  PRO A N     1 
ATOM   1170 C CA    . PRO A 1 175 ? 2.552   9.212   -26.633 1.00 35.24  ? 787  PRO A CA    1 
ATOM   1171 C C     . PRO A 1 175 ? 1.375   8.823   -27.550 1.00 38.33  ? 787  PRO A C     1 
ATOM   1172 O O     . PRO A 1 175 ? 0.392   8.264   -27.048 1.00 35.97  ? 787  PRO A O     1 
ATOM   1173 C CB    . PRO A 1 175 ? 2.271   10.522  -25.885 1.00 38.28  ? 787  PRO A CB    1 
ATOM   1174 C CG    . PRO A 1 175 ? 3.616   11.145  -25.697 1.00 43.50  ? 787  PRO A CG    1 
ATOM   1175 C CD    . PRO A 1 175 ? 4.411   10.778  -26.918 1.00 38.06  ? 787  PRO A CD    1 
ATOM   1176 N N     . SER A 1 176 ? 1.486   9.143   -28.836 1.00 36.27  ? 788  SER A N     1 
ATOM   1177 C CA    . SER A 1 176 ? 0.497   8.806   -29.859 1.00 35.91  ? 788  SER A CA    1 
ATOM   1178 C C     . SER A 1 176 ? 0.482   7.298   -30.194 1.00 36.01  ? 788  SER A C     1 
ATOM   1179 O O     . SER A 1 176 ? -0.510  6.776   -30.664 1.00 35.68  ? 788  SER A O     1 
ATOM   1180 C CB    . SER A 1 176 ? 0.638   9.701   -31.091 1.00 39.72  ? 788  SER A CB    1 
ATOM   1181 O OG    . SER A 1 176 ? 1.009   8.982   -32.240 1.00 50.30  ? 788  SER A OG    1 
ATOM   1182 N N     . ASP A 1 177 ? 1.607   6.630   -29.956 1.00 31.61  ? 789  ASP A N     1 
ATOM   1183 C CA    . ASP A 1 177 ? 1.766   5.193   -30.149 1.00 28.95  ? 789  ASP A CA    1 
ATOM   1184 C C     . ASP A 1 177 ? 2.359   4.757   -28.818 1.00 32.68  ? 789  ASP A C     1 
ATOM   1185 O O     . ASP A 1 177 ? 3.519   4.406   -28.727 1.00 31.51  ? 789  ASP A O     1 
ATOM   1186 C CB    . ASP A 1 177 ? 2.746   4.883   -31.271 1.00 29.46  ? 789  ASP A CB    1 
ATOM   1187 C CG    . ASP A 1 177 ? 2.202   5.188   -32.639 1.00 41.77  ? 789  ASP A CG    1 
ATOM   1188 O OD1   . ASP A 1 177 ? 1.044   4.877   -32.921 1.00 47.04  ? 789  ASP A OD1   1 
ATOM   1189 O OD2   . ASP A 1 177 ? 2.947   5.735   -33.457 1.00 46.23  ? 789  ASP A OD2   1 
ATOM   1190 N N     . PRO A 1 178 ? 1.564   4.799   -27.768 1.00 31.30  ? 790  PRO A N     1 
ATOM   1191 C CA    . PRO A 1 178 ? 2.052   4.471   -26.429 1.00 31.69  ? 790  PRO A CA    1 
ATOM   1192 C C     . PRO A 1 178 ? 2.515   3.035   -26.236 1.00 35.26  ? 790  PRO A C     1 
ATOM   1193 O O     . PRO A 1 178 ? 2.079   2.122   -26.914 1.00 34.05  ? 790  PRO A O     1 
ATOM   1194 C CB    . PRO A 1 178 ? 0.850   4.777   -25.541 1.00 34.73  ? 790  PRO A CB    1 
ATOM   1195 C CG    . PRO A 1 178 ? -0.314  4.556   -26.423 1.00 38.65  ? 790  PRO A CG    1 
ATOM   1196 C CD    . PRO A 1 178 ? 0.109   4.990   -27.791 1.00 33.79  ? 790  PRO A CD    1 
ATOM   1197 N N     . THR A 1 179 ? 3.418   2.865   -25.286 1.00 33.46  ? 791  THR A N     1 
ATOM   1198 C CA    . THR A 1 179 ? 4.004   1.578   -24.968 1.00 32.16  ? 791  THR A CA    1 
ATOM   1199 C C     . THR A 1 179 ? 2.918   0.586   -24.570 1.00 37.40  ? 791  THR A C     1 
ATOM   1200 O O     . THR A 1 179 ? 2.939   -0.568  -24.980 1.00 36.99  ? 791  THR A O     1 
ATOM   1201 C CB    . THR A 1 179 ? 4.957   1.738   -23.762 1.00 34.57  ? 791  THR A CB    1 
ATOM   1202 O OG1   . THR A 1 179 ? 6.028   2.617   -24.097 1.00 29.39  ? 791  THR A OG1   1 
ATOM   1203 C CG2   . THR A 1 179 ? 5.518   0.409   -23.307 1.00 30.94  ? 791  THR A CG2   1 
ATOM   1204 N N     . TYR A 1 180 ? 1.962   1.058   -23.784 1.00 33.60  ? 792  TYR A N     1 
ATOM   1205 C CA    . TYR A 1 180 ? 0.866   0.242   -23.292 1.00 33.46  ? 792  TYR A CA    1 
ATOM   1206 C C     . TYR A 1 180 ? -0.511  0.708   -23.767 1.00 38.63  ? 792  TYR A C     1 
ATOM   1207 O O     . TYR A 1 180 ? -0.793  1.890   -23.810 1.00 36.63  ? 792  TYR A O     1 
ATOM   1208 C CB    . TYR A 1 180 ? 0.855   0.254   -21.766 1.00 34.73  ? 792  TYR A CB    1 
ATOM   1209 C CG    . TYR A 1 180 ? 2.046   -0.365  -21.084 1.00 34.53  ? 792  TYR A CG    1 
ATOM   1210 C CD1   . TYR A 1 180 ? 2.212   -1.735  -21.047 1.00 35.91  ? 792  TYR A CD1   1 
ATOM   1211 C CD2   . TYR A 1 180 ? 2.977   0.417   -20.434 1.00 35.09  ? 792  TYR A CD2   1 
ATOM   1212 C CE1   . TYR A 1 180 ? 3.288   -2.306  -20.407 1.00 35.54  ? 792  TYR A CE1   1 
ATOM   1213 C CE2   . TYR A 1 180 ? 4.056   -0.143  -19.792 1.00 36.18  ? 792  TYR A CE2   1 
ATOM   1214 C CZ    . TYR A 1 180 ? 4.208   -1.508  -19.785 1.00 41.72  ? 792  TYR A CZ    1 
ATOM   1215 O OH    . TYR A 1 180 ? 5.274   -2.078  -19.145 1.00 40.51  ? 792  TYR A OH    1 
ATOM   1216 N N     . THR A 1 181 ? -1.357  -0.248  -24.116 1.00 37.86  ? 793  THR A N     1 
ATOM   1217 C CA    . THR A 1 181 ? -2.724  0.001   -24.544 1.00 39.72  ? 793  THR A CA    1 
ATOM   1218 C C     . THR A 1 181 ? -3.602  -0.742  -23.528 1.00 48.49  ? 793  THR A C     1 
ATOM   1219 O O     . THR A 1 181 ? -3.357  -1.920  -23.264 1.00 47.71  ? 793  THR A O     1 
ATOM   1220 C CB    . THR A 1 181 ? -2.911  -0.460  -26.005 1.00 44.43  ? 793  THR A CB    1 
ATOM   1221 O OG1   . THR A 1 181 ? -1.872  0.098   -26.804 1.00 39.05  ? 793  THR A OG1   1 
ATOM   1222 C CG2   . THR A 1 181 ? -4.271  -0.066  -26.583 1.00 44.60  ? 793  THR A CG2   1 
ATOM   1223 N N     . SER A 1 182 ? -4.579  -0.042  -22.928 1.00 50.50  ? 794  SER A N     1 
ATOM   1224 C CA    . SER A 1 182 ? -5.506  -0.600  -21.930 1.00 53.52  ? 794  SER A CA    1 
ATOM   1225 C C     . SER A 1 182 ? -6.361  -1.731  -22.522 1.00 61.81  ? 794  SER A C     1 
ATOM   1226 O O     . SER A 1 182 ? -6.798  -1.621  -23.669 1.00 62.15  ? 794  SER A O     1 
ATOM   1227 C CB    . SER A 1 182 ? -6.404  0.502   -21.373 1.00 59.08  ? 794  SER A CB    1 
ATOM   1228 O OG    . SER A 1 182 ? -7.193  0.044   -20.287 1.00 70.35  ? 794  SER A OG    1 
ATOM   1229 N N     . SER A 1 183 ? -6.519  -2.806  -21.757 1.00 61.14  ? 795  SER A N     1 
ATOM   1230 C CA    . SER A 1 183 ? -7.264  -3.995  -22.146 1.00 62.35  ? 795  SER A CA    1 
ATOM   1231 C C     . SER A 1 183 ? -8.080  -4.407  -20.944 1.00 70.32  ? 795  SER A C     1 
ATOM   1232 O O     . SER A 1 183 ? -7.732  -4.060  -19.823 1.00 69.95  ? 795  SER A O     1 
ATOM   1233 C CB    . SER A 1 183 ? -6.315  -5.115  -22.535 1.00 64.67  ? 795  SER A CB    1 
ATOM   1234 O OG    . SER A 1 183 ? -6.963  -6.071  -23.342 1.00 74.92  ? 795  SER A OG    1 
ATOM   1235 N N     . LEU A 1 184 ? -9.152  -5.159  -21.156 1.00 70.14  ? 796  LEU A N     1 
ATOM   1236 C CA    . LEU A 1 184 ? -10.006 -5.517  -20.038 1.00 72.70  ? 796  LEU A CA    1 
ATOM   1237 C C     . LEU A 1 184 ? -9.251  -6.256  -18.956 1.00 79.67  ? 796  LEU A C     1 
ATOM   1238 O O     . LEU A 1 184 ? -9.373  -5.914  -17.782 1.00 81.49  ? 796  LEU A O     1 
ATOM   1239 C CB    . LEU A 1 184 ? -11.154 -6.397  -20.523 1.00 73.03  ? 796  LEU A CB    1 
ATOM   1240 N N     . GLY A 1 185 ? -8.462  -7.254  -19.327 1.00 75.80  ? 797  GLY A N     1 
ATOM   1241 C CA    . GLY A 1 185 ? -7.680  -7.947  -18.326 1.00 76.17  ? 797  GLY A CA    1 
ATOM   1242 C C     . GLY A 1 185 ? -6.546  -7.110  -17.755 1.00 79.06  ? 797  GLY A C     1 
ATOM   1243 O O     . GLY A 1 185 ? -6.363  -7.034  -16.544 1.00 80.72  ? 797  GLY A O     1 
ATOM   1244 N N     . GLY A 1 186 ? -5.791  -6.467  -18.641 1.00 71.99  ? 798  GLY A N     1 
ATOM   1245 C CA    . GLY A 1 186 ? -4.652  -5.655  -18.253 1.00 70.30  ? 798  GLY A CA    1 
ATOM   1246 C C     . GLY A 1 186 ? -4.053  -4.837  -19.382 1.00 69.76  ? 798  GLY A C     1 
ATOM   1247 O O     . GLY A 1 186 ? -4.447  -4.977  -20.533 1.00 69.50  ? 798  GLY A O     1 
ATOM   1248 N N     . LYS A 1 187 ? -3.090  -3.984  -19.047 1.00 61.69  ? 799  LYS A N     1 
ATOM   1249 C CA    . LYS A 1 187 ? -2.393  -3.159  -20.023 1.00 57.25  ? 799  LYS A CA    1 
ATOM   1250 C C     . LYS A 1 187 ? -1.590  -4.069  -20.929 1.00 54.25  ? 799  LYS A C     1 
ATOM   1251 O O     . LYS A 1 187 ? -1.072  -5.071  -20.474 1.00 55.05  ? 799  LYS A O     1 
ATOM   1252 C CB    . LYS A 1 187 ? -1.455  -2.190  -19.315 1.00 59.37  ? 799  LYS A CB    1 
ATOM   1253 N N     . ILE A 1 188 ? -1.479  -3.729  -22.206 1.00 43.85  ? 800  ILE A N     1 
ATOM   1254 C CA    . ILE A 1 188 ? -0.744  -4.581  -23.141 1.00 39.96  ? 800  ILE A CA    1 
ATOM   1255 C C     . ILE A 1 188 ? 0.318   -3.767  -23.921 1.00 38.74  ? 800  ILE A C     1 
ATOM   1256 O O     . ILE A 1 188 ? -0.039  -2.812  -24.608 1.00 38.86  ? 800  ILE A O     1 
ATOM   1257 C CB    . ILE A 1 188 ? -1.726  -5.402  -24.054 1.00 42.55  ? 800  ILE A CB    1 
ATOM   1258 C CG1   . ILE A 1 188 ? -2.377  -6.558  -23.247 1.00 44.78  ? 800  ILE A CG1   1 
ATOM   1259 C CG2   . ILE A 1 188 ? -1.069  -5.937  -25.339 1.00 40.27  ? 800  ILE A CG2   1 
ATOM   1260 C CD1   . ILE A 1 188 ? -3.650  -7.181  -23.821 1.00 52.71  ? 800  ILE A CD1   1 
ATOM   1261 N N     . PRO A 1 189 ? 1.618   -4.154  -23.859 1.00 31.51  ? 801  PRO A N     1 
ATOM   1262 C CA    . PRO A 1 189 ? 2.629   -3.472  -24.686 1.00 29.15  ? 801  PRO A CA    1 
ATOM   1263 C C     . PRO A 1 189 ? 2.673   -4.084  -26.099 1.00 29.86  ? 801  PRO A C     1 
ATOM   1264 O O     . PRO A 1 189 ? 3.343   -5.095  -26.314 1.00 29.53  ? 801  PRO A O     1 
ATOM   1265 C CB    . PRO A 1 189 ? 3.918   -3.722  -23.907 1.00 30.56  ? 801  PRO A CB    1 
ATOM   1266 C CG    . PRO A 1 189 ? 3.707   -5.056  -23.253 1.00 34.21  ? 801  PRO A CG    1 
ATOM   1267 C CD    . PRO A 1 189 ? 2.222   -5.280  -23.107 1.00 31.08  ? 801  PRO A CD    1 
ATOM   1268 N N     . ILE A 1 190 ? 1.903   -3.525  -27.038 1.00 25.71  ? 802  ILE A N     1 
ATOM   1269 C CA    . ILE A 1 190 ? 1.794   -4.042  -28.407 1.00 25.36  ? 802  ILE A CA    1 
ATOM   1270 C C     . ILE A 1 190 ? 3.157   -4.538  -29.013 1.00 27.96  ? 802  ILE A C     1 
ATOM   1271 O O     . ILE A 1 190 ? 3.224   -5.710  -29.392 1.00 26.53  ? 802  ILE A O     1 
ATOM   1272 C CB    . ILE A 1 190 ? 1.046   -3.081  -29.370 1.00 29.53  ? 802  ILE A CB    1 
ATOM   1273 C CG1   . ILE A 1 190 ? -0.475  -2.939  -29.008 1.00 32.46  ? 802  ILE A CG1   1 
ATOM   1274 C CG2   . ILE A 1 190 ? 1.200   -3.478  -30.838 1.00 30.66  ? 802  ILE A CG2   1 
ATOM   1275 C CD1   . ILE A 1 190 ? -1.370  -4.204  -29.077 1.00 44.80  ? 802  ILE A CD1   1 
ATOM   1276 N N     . ARG A 1 191 ? 4.197   -3.682  -29.091 1.00 23.19  ? 803  ARG A N     1 
ATOM   1277 C CA    . ARG A 1 191 ? 5.491   -3.991  -29.725 1.00 23.34  ? 803  ARG A CA    1 
ATOM   1278 C C     . ARG A 1 191 ? 6.269   -5.172  -29.132 1.00 27.85  ? 803  ARG A C     1 
ATOM   1279 O O     . ARG A 1 191 ? 7.146   -5.686  -29.813 1.00 27.46  ? 803  ARG A O     1 
ATOM   1280 C CB    . ARG A 1 191 ? 6.405   -2.742  -29.769 1.00 24.35  ? 803  ARG A CB    1 
ATOM   1281 C CG    . ARG A 1 191 ? 5.836   -1.661  -30.680 1.00 30.47  ? 803  ARG A CG    1 
ATOM   1282 C CD    . ARG A 1 191 ? 6.468   -0.290  -30.495 1.00 28.49  ? 803  ARG A CD    1 
ATOM   1283 N NE    . ARG A 1 191 ? 5.530   0.748   -30.931 1.00 30.57  ? 803  ARG A NE    1 
ATOM   1284 C CZ    . ARG A 1 191 ? 5.492   1.269   -32.154 1.00 40.43  ? 803  ARG A CZ    1 
ATOM   1285 N NH1   . ARG A 1 191 ? 6.393   0.921   -33.060 1.00 30.05  ? 803  ARG A NH1   1 
ATOM   1286 N NH2   . ARG A 1 191 ? 4.590   2.186   -32.459 1.00 28.62  ? 803  ARG A NH2   1 
ATOM   1287 N N     . TRP A 1 192 ? 5.966   -5.579  -27.881 1.00 24.83  ? 804  TRP A N     1 
ATOM   1288 C CA    . TRP A 1 192 ? 6.637   -6.643  -27.155 1.00 24.97  ? 804  TRP A CA    1 
ATOM   1289 C C     . TRP A 1 192 ? 5.826   -7.946  -27.050 1.00 27.22  ? 804  TRP A C     1 
ATOM   1290 O O     . TRP A 1 192 ? 6.400   -8.971  -26.712 1.00 27.82  ? 804  TRP A O     1 
ATOM   1291 C CB    . TRP A 1 192 ? 7.025   -6.134  -25.746 1.00 24.57  ? 804  TRP A CB    1 
ATOM   1292 C CG    . TRP A 1 192 ? 8.228   -5.229  -25.749 1.00 25.57  ? 804  TRP A CG    1 
ATOM   1293 C CD1   . TRP A 1 192 ? 9.531   -5.604  -25.610 1.00 28.39  ? 804  TRP A CD1   1 
ATOM   1294 C CD2   . TRP A 1 192 ? 8.234   -3.801  -25.935 1.00 25.60  ? 804  TRP A CD2   1 
ATOM   1295 N NE1   . TRP A 1 192 ? 10.351  -4.503  -25.707 1.00 28.55  ? 804  TRP A NE1   1 
ATOM   1296 C CE2   . TRP A 1 192 ? 9.583   -3.387  -25.932 1.00 29.23  ? 804  TRP A CE2   1 
ATOM   1297 C CE3   . TRP A 1 192 ? 7.222   -2.830  -26.119 1.00 27.11  ? 804  TRP A CE3   1 
ATOM   1298 C CZ2   . TRP A 1 192 ? 9.956   -2.046  -26.096 1.00 28.93  ? 804  TRP A CZ2   1 
ATOM   1299 C CZ3   . TRP A 1 192 ? 7.592   -1.503  -26.298 1.00 28.78  ? 804  TRP A CZ3   1 
ATOM   1300 C CH2   . TRP A 1 192 ? 8.945   -1.124  -26.297 1.00 29.85  ? 804  TRP A CH2   1 
ATOM   1301 N N     . THR A 1 193 ? 4.503   -7.903  -27.329 1.00 21.36  ? 805  THR A N     1 
ATOM   1302 C CA    . THR A 1 193 ? 3.545   -8.987  -27.168 1.00 19.74  ? 805  THR A CA    1 
ATOM   1303 C C     . THR A 1 193 ? 3.318   -9.824  -28.459 1.00 26.38  ? 805  THR A C     1 
ATOM   1304 O O     . THR A 1 193 ? 3.228   -9.269  -29.565 1.00 24.11  ? 805  THR A O     1 
ATOM   1305 C CB    . THR A 1 193 ? 2.237   -8.413  -26.594 1.00 28.51  ? 805  THR A CB    1 
ATOM   1306 O OG1   . THR A 1 193 ? 2.536   -7.624  -25.441 1.00 31.29  ? 805  THR A OG1   1 
ATOM   1307 C CG2   . THR A 1 193 ? 1.221   -9.486  -26.201 1.00 27.24  ? 805  THR A CG2   1 
ATOM   1308 N N     . ALA A 1 194 ? 3.233   -11.174 -28.279 1.00 24.79  ? 806  ALA A N     1 
ATOM   1309 C CA    . ALA A 1 194 ? 2.995   -12.144 -29.339 1.00 26.58  ? 806  ALA A CA    1 
ATOM   1310 C C     . ALA A 1 194 ? 1.621   -11.945 -29.941 1.00 30.41  ? 806  ALA A C     1 
ATOM   1311 O O     . ALA A 1 194 ? 0.695   -11.653 -29.199 1.00 31.71  ? 806  ALA A O     1 
ATOM   1312 C CB    . ALA A 1 194 ? 3.149   -13.563 -28.819 1.00 28.06  ? 806  ALA A CB    1 
ATOM   1313 N N     . PRO A 1 195 ? 1.468   -12.085 -31.282 1.00 26.51  ? 807  PRO A N     1 
ATOM   1314 C CA    . PRO A 1 195 ? 0.165   -11.807 -31.915 1.00 26.49  ? 807  PRO A CA    1 
ATOM   1315 C C     . PRO A 1 195 ? -1.024  -12.593 -31.373 1.00 32.05  ? 807  PRO A C     1 
ATOM   1316 O O     . PRO A 1 195 ? -2.133  -12.066 -31.409 1.00 33.67  ? 807  PRO A O     1 
ATOM   1317 C CB    . PRO A 1 195 ? 0.407   -12.096 -33.400 1.00 28.61  ? 807  PRO A CB    1 
ATOM   1318 C CG    . PRO A 1 195 ? 1.703   -12.867 -33.465 1.00 32.23  ? 807  PRO A CG    1 
ATOM   1319 C CD    . PRO A 1 195 ? 2.497   -12.410 -32.290 1.00 27.20  ? 807  PRO A CD    1 
ATOM   1320 N N     . GLU A 1 196 ? -0.810  -13.826 -30.871 1.00 27.54  ? 808  GLU A N     1 
ATOM   1321 C CA    . GLU A 1 196 ? -1.904  -14.616 -30.296 1.00 28.80  ? 808  GLU A CA    1 
ATOM   1322 C C     . GLU A 1 196 ? -2.274  -14.101 -28.894 1.00 34.13  ? 808  GLU A C     1 
ATOM   1323 O O     . GLU A 1 196 ? -3.418  -14.244 -28.468 1.00 34.02  ? 808  GLU A O     1 
ATOM   1324 C CB    . GLU A 1 196 ? -1.601  -16.141 -30.306 1.00 29.66  ? 808  GLU A CB    1 
ATOM   1325 C CG    . GLU A 1 196 ? -0.652  -16.635 -29.226 1.00 32.11  ? 808  GLU A CG    1 
ATOM   1326 C CD    . GLU A 1 196 ? 0.838   -16.435 -29.447 1.00 46.05  ? 808  GLU A CD    1 
ATOM   1327 O OE1   . GLU A 1 196 ? 1.235   -15.951 -30.534 1.00 22.08  ? 808  GLU A OE1   1 
ATOM   1328 O OE2   . GLU A 1 196 ? 1.615   -16.802 -28.532 1.00 33.32  ? 808  GLU A OE2   1 
ATOM   1329 N N     . ALA A 1 197 ? -1.294  -13.533 -28.206 1.00 31.61  ? 809  ALA A N     1 
ATOM   1330 C CA    . ALA A 1 197 ? -1.506  -12.916 -26.912 1.00 32.95  ? 809  ALA A CA    1 
ATOM   1331 C C     . ALA A 1 197 ? -2.330  -11.636 -27.074 1.00 36.66  ? 809  ALA A C     1 
ATOM   1332 O O     . ALA A 1 197 ? -3.179  -11.333 -26.254 1.00 36.74  ? 809  ALA A O     1 
ATOM   1333 C CB    . ALA A 1 197 ? -0.189  -12.647 -26.208 1.00 33.18  ? 809  ALA A CB    1 
ATOM   1334 N N     . ILE A 1 198 ? -2.042  -10.866 -28.118 1.00 33.13  ? 810  ILE A N     1 
ATOM   1335 C CA    . ILE A 1 198 ? -2.781  -9.642  -28.380 1.00 32.93  ? 810  ILE A CA    1 
ATOM   1336 C C     . ILE A 1 198 ? -4.219  -9.944  -28.799 1.00 40.41  ? 810  ILE A C     1 
ATOM   1337 O O     . ILE A 1 198 ? -5.164  -9.361  -28.292 1.00 43.03  ? 810  ILE A O     1 
ATOM   1338 C CB    . ILE A 1 198 ? -2.095  -8.830  -29.509 1.00 34.08  ? 810  ILE A CB    1 
ATOM   1339 C CG1   . ILE A 1 198 ? -0.754  -8.264  -29.046 1.00 33.20  ? 810  ILE A CG1   1 
ATOM   1340 C CG2   . ILE A 1 198 ? -2.978  -7.710  -30.039 1.00 33.87  ? 810  ILE A CG2   1 
ATOM   1341 C CD1   . ILE A 1 198 ? -0.020  -7.488  -30.118 1.00 27.85  ? 810  ILE A CD1   1 
ATOM   1342 N N     . ALA A 1 199 ? -4.343  -10.866 -29.743 1.00 36.42  ? 811  ALA A N     1 
ATOM   1343 C CA    . ALA A 1 199 ? -5.616  -11.287 -30.300 1.00 37.78  ? 811  ALA A CA    1 
ATOM   1344 C C     . ALA A 1 199 ? -6.552  -12.078 -29.408 1.00 43.82  ? 811  ALA A C     1 
ATOM   1345 O O     . ALA A 1 199 ? -7.753  -11.882 -29.433 1.00 44.18  ? 811  ALA A O     1 
ATOM   1346 C CB    . ALA A 1 199 ? -5.394  -12.037 -31.602 1.00 38.62  ? 811  ALA A CB    1 
ATOM   1347 N N     . TYR A 1 200 ? -5.993  -12.993 -28.636 1.00 42.52  ? 812  TYR A N     1 
ATOM   1348 C CA    . TYR A 1 200 ? -6.815  -13.877 -27.808 1.00 45.12  ? 812  TYR A CA    1 
ATOM   1349 C C     . TYR A 1 200 ? -6.418  -13.937 -26.337 1.00 49.32  ? 812  TYR A C     1 
ATOM   1350 O O     . TYR A 1 200 ? -6.923  -14.801 -25.622 1.00 50.75  ? 812  TYR A O     1 
ATOM   1351 C CB    . TYR A 1 200 ? -6.827  -15.297 -28.430 1.00 48.28  ? 812  TYR A CB    1 
ATOM   1352 C CG    . TYR A 1 200 ? -7.231  -15.321 -29.890 1.00 52.89  ? 812  TYR A CG    1 
ATOM   1353 C CD1   . TYR A 1 200 ? -8.536  -15.024 -30.280 1.00 57.18  ? 812  TYR A CD1   1 
ATOM   1354 C CD2   . TYR A 1 200 ? -6.299  -15.597 -30.887 1.00 53.56  ? 812  TYR A CD2   1 
ATOM   1355 C CE1   . TYR A 1 200 ? -8.906  -15.016 -31.625 1.00 60.64  ? 812  TYR A CE1   1 
ATOM   1356 C CE2   . TYR A 1 200 ? -6.658  -15.594 -32.236 1.00 55.56  ? 812  TYR A CE2   1 
ATOM   1357 C CZ    . TYR A 1 200 ? -7.964  -15.305 -32.600 1.00 69.20  ? 812  TYR A CZ    1 
ATOM   1358 O OH    . TYR A 1 200 ? -8.331  -15.316 -33.925 1.00 75.69  ? 812  TYR A OH    1 
ATOM   1359 N N     . ARG A 1 201 ? -5.538  -13.021 -25.873 1.00 44.82  ? 813  ARG A N     1 
ATOM   1360 C CA    . ARG A 1 201 ? -5.022  -12.996 -24.493 1.00 45.22  ? 813  ARG A CA    1 
ATOM   1361 C C     . ARG A 1 201 ? -4.356  -14.350 -24.090 1.00 49.98  ? 813  ARG A C     1 
ATOM   1362 O O     . ARG A 1 201 ? -4.387  -14.742 -22.915 1.00 50.68  ? 813  ARG A O     1 
ATOM   1363 C CB    . ARG A 1 201 ? -6.079  -12.524 -23.471 1.00 46.75  ? 813  ARG A CB    1 
ATOM   1364 C CG    . ARG A 1 201 ? -6.520  -11.076 -23.681 1.00 62.80  ? 813  ARG A CG    1 
ATOM   1365 C CD    . ARG A 1 201 ? -7.610  -10.661 -22.710 1.00 77.46  ? 813  ARG A CD    1 
ATOM   1366 N N     . LYS A 1 202 ? -3.739  -15.045 -25.084 1.00 45.52  ? 814  LYS A N     1 
ATOM   1367 C CA    . LYS A 1 202 ? -3.043  -16.323 -24.881 1.00 45.26  ? 814  LYS A CA    1 
ATOM   1368 C C     . LYS A 1 202 ? -1.610  -16.039 -24.422 1.00 46.88  ? 814  LYS A C     1 
ATOM   1369 O O     . LYS A 1 202 ? -0.676  -16.003 -25.240 1.00 43.63  ? 814  LYS A O     1 
ATOM   1370 C CB    . LYS A 1 202 ? -3.070  -17.204 -26.151 1.00 47.69  ? 814  LYS A CB    1 
ATOM   1371 C CG    . LYS A 1 202 ? -4.428  -17.813 -26.454 1.00 57.24  ? 814  LYS A CG    1 
ATOM   1372 C CD    . LYS A 1 202 ? -4.346  -18.751 -27.632 1.00 61.63  ? 814  LYS A CD    1 
ATOM   1373 C CE    . LYS A 1 202 ? -5.672  -19.394 -27.918 1.00 62.47  ? 814  LYS A CE    1 
ATOM   1374 N NZ    . LYS A 1 202 ? -5.547  -20.419 -28.985 1.00 72.65  ? 814  LYS A NZ    1 
ATOM   1375 N N     . PHE A 1 203 ? -1.473  -15.756 -23.099 1.00 43.48  ? 815  PHE A N     1 
ATOM   1376 C CA    . PHE A 1 203 ? -0.211  -15.450 -22.425 1.00 40.81  ? 815  PHE A CA    1 
ATOM   1377 C C     . PHE A 1 203 ? 0.329   -16.730 -21.841 1.00 44.90  ? 815  PHE A C     1 
ATOM   1378 O O     . PHE A 1 203 ? -0.288  -17.306 -20.944 1.00 46.99  ? 815  PHE A O     1 
ATOM   1379 C CB    . PHE A 1 203 ? -0.380  -14.377 -21.326 1.00 41.94  ? 815  PHE A CB    1 
ATOM   1380 C CG    . PHE A 1 203 ? -0.729  -13.006 -21.841 1.00 42.14  ? 815  PHE A CG    1 
ATOM   1381 C CD1   . PHE A 1 203 ? 0.266   -12.112 -22.216 1.00 43.41  ? 815  PHE A CD1   1 
ATOM   1382 C CD2   . PHE A 1 203 ? -2.056  -12.604 -21.956 1.00 44.69  ? 815  PHE A CD2   1 
ATOM   1383 C CE1   . PHE A 1 203 ? -0.060  -10.842 -22.697 1.00 43.41  ? 815  PHE A CE1   1 
ATOM   1384 C CE2   . PHE A 1 203 ? -2.380  -11.337 -22.442 1.00 45.82  ? 815  PHE A CE2   1 
ATOM   1385 C CZ    . PHE A 1 203 ? -1.380  -10.466 -22.812 1.00 42.97  ? 815  PHE A CZ    1 
ATOM   1386 N N     . THR A 1 204 ? 1.456   -17.207 -22.393 1.00 38.57  ? 816  THR A N     1 
ATOM   1387 C CA    . THR A 1 204 ? 2.137   -18.428 -21.951 1.00 37.41  ? 816  THR A CA    1 
ATOM   1388 C C     . THR A 1 204 ? 3.628   -18.124 -21.887 1.00 38.07  ? 816  THR A C     1 
ATOM   1389 O O     . THR A 1 204 ? 4.028   -16.999 -22.198 1.00 35.76  ? 816  THR A O     1 
ATOM   1390 C CB    . THR A 1 204 ? 1.874   -19.593 -22.953 1.00 38.65  ? 816  THR A CB    1 
ATOM   1391 O OG1   . THR A 1 204 ? 2.334   -19.212 -24.254 1.00 33.04  ? 816  THR A OG1   1 
ATOM   1392 C CG2   . THR A 1 204 ? 0.398   -20.053 -22.992 1.00 33.46  ? 816  THR A CG2   1 
ATOM   1393 N N     . SER A 1 205 ? 4.463   -19.149 -21.571 1.00 34.45  ? 817  SER A N     1 
ATOM   1394 C CA    . SER A 1 205 ? 5.916   -19.010 -21.606 1.00 32.82  ? 817  SER A CA    1 
ATOM   1395 C C     . SER A 1 205 ? 6.371   -18.841 -23.076 1.00 33.54  ? 817  SER A C     1 
ATOM   1396 O O     . SER A 1 205 ? 7.343   -18.126 -23.317 1.00 33.43  ? 817  SER A O     1 
ATOM   1397 C CB    . SER A 1 205 ? 6.598   -20.178 -20.901 1.00 36.22  ? 817  SER A CB    1 
ATOM   1398 O OG    . SER A 1 205 ? 6.357   -20.077 -19.504 1.00 42.47  ? 817  SER A OG    1 
ATOM   1399 N N     . ALA A 1 206 ? 5.574   -19.371 -24.056 1.00 26.85  ? 818  ALA A N     1 
ATOM   1400 C CA    . ALA A 1 206 ? 5.815   -19.195 -25.489 1.00 25.22  ? 818  ALA A CA    1 
ATOM   1401 C C     . ALA A 1 206 ? 5.572   -17.734 -25.925 1.00 29.48  ? 818  ALA A C     1 
ATOM   1402 O O     . ALA A 1 206 ? 6.260   -17.275 -26.828 1.00 29.90  ? 818  ALA A O     1 
ATOM   1403 C CB    . ALA A 1 206 ? 4.938   -20.139 -26.309 1.00 26.34  ? 818  ALA A CB    1 
ATOM   1404 N N     . SER A 1 207 ? 4.618   -17.003 -25.314 1.00 26.27  ? 819  SER A N     1 
ATOM   1405 C CA    . SER A 1 207 ? 4.429   -15.584 -25.684 1.00 26.56  ? 819  SER A CA    1 
ATOM   1406 C C     . SER A 1 207 ? 5.516   -14.696 -25.047 1.00 32.25  ? 819  SER A C     1 
ATOM   1407 O O     . SER A 1 207 ? 5.834   -13.658 -25.613 1.00 32.22  ? 819  SER A O     1 
ATOM   1408 C CB    . SER A 1 207 ? 3.008   -15.080 -25.421 1.00 28.84  ? 819  SER A CB    1 
ATOM   1409 O OG    . SER A 1 207 ? 2.669   -15.038 -24.044 1.00 38.82  ? 819  SER A OG    1 
ATOM   1410 N N     . ASP A 1 208 ? 6.141   -15.150 -23.917 1.00 28.82  ? 820  ASP A N     1 
ATOM   1411 C CA    . ASP A 1 208 ? 7.291   -14.489 -23.274 1.00 27.72  ? 820  ASP A CA    1 
ATOM   1412 C C     . ASP A 1 208 ? 8.547   -14.698 -24.150 1.00 29.25  ? 820  ASP A C     1 
ATOM   1413 O O     . ASP A 1 208 ? 9.454   -13.860 -24.123 1.00 27.94  ? 820  ASP A O     1 
ATOM   1414 C CB    . ASP A 1 208 ? 7.570   -15.055 -21.864 1.00 30.55  ? 820  ASP A CB    1 
ATOM   1415 C CG    . ASP A 1 208 ? 6.745   -14.501 -20.715 1.00 39.40  ? 820  ASP A CG    1 
ATOM   1416 O OD1   . ASP A 1 208 ? 6.132   -13.419 -20.883 1.00 40.83  ? 820  ASP A OD1   1 
ATOM   1417 O OD2   . ASP A 1 208 ? 6.751   -15.125 -19.628 1.00 41.68  ? 820  ASP A OD2   1 
ATOM   1418 N N     . VAL A 1 209 ? 8.581   -15.809 -24.873 1.00 26.34  ? 821  VAL A N     1 
ATOM   1419 C CA    . VAL A 1 209 ? 9.670   -16.116 -25.779 1.00 24.89  ? 821  VAL A CA    1 
ATOM   1420 C C     . VAL A 1 209 ? 9.675   -15.102 -26.922 1.00 26.24  ? 821  VAL A C     1 
ATOM   1421 O O     . VAL A 1 209 ? 10.727  -14.681 -27.360 1.00 26.16  ? 821  VAL A O     1 
ATOM   1422 C CB    . VAL A 1 209 ? 9.645   -17.578 -26.255 1.00 29.05  ? 821  VAL A CB    1 
ATOM   1423 C CG1   . VAL A 1 209 ? 10.534  -17.767 -27.467 1.00 28.02  ? 821  VAL A CG1   1 
ATOM   1424 C CG2   . VAL A 1 209 ? 10.097  -18.485 -25.131 1.00 29.41  ? 821  VAL A CG2   1 
ATOM   1425 N N     . TRP A 1 210 ? 8.489   -14.726 -27.395 1.00 20.68  ? 822  TRP A N     1 
ATOM   1426 C CA    . TRP A 1 210 ? 8.349   -13.726 -28.449 1.00 20.82  ? 822  TRP A CA    1 
ATOM   1427 C C     . TRP A 1 210 ? 8.877   -12.389 -27.927 1.00 25.19  ? 822  TRP A C     1 
ATOM   1428 O O     . TRP A 1 210 ? 9.563   -11.670 -28.635 1.00 25.43  ? 822  TRP A O     1 
ATOM   1429 C CB    . TRP A 1 210 ? 6.886   -13.602 -28.930 1.00 19.43  ? 822  TRP A CB    1 
ATOM   1430 C CG    . TRP A 1 210 ? 6.655   -12.528 -29.964 1.00 19.53  ? 822  TRP A CG    1 
ATOM   1431 C CD1   . TRP A 1 210 ? 6.761   -11.185 -29.780 1.00 22.18  ? 822  TRP A CD1   1 
ATOM   1432 C CD2   . TRP A 1 210 ? 6.274   -12.707 -31.335 1.00 19.32  ? 822  TRP A CD2   1 
ATOM   1433 N NE1   . TRP A 1 210 ? 6.491   -10.522 -30.938 1.00 20.97  ? 822  TRP A NE1   1 
ATOM   1434 C CE2   . TRP A 1 210 ? 6.180   -11.431 -31.909 1.00 22.63  ? 822  TRP A CE2   1 
ATOM   1435 C CE3   . TRP A 1 210 ? 6.004   -13.818 -32.129 1.00 22.03  ? 822  TRP A CE3   1 
ATOM   1436 C CZ2   . TRP A 1 210 ? 5.841   -11.237 -33.233 1.00 21.96  ? 822  TRP A CZ2   1 
ATOM   1437 C CZ3   . TRP A 1 210 ? 5.660   -13.619 -33.448 1.00 24.32  ? 822  TRP A CZ3   1 
ATOM   1438 C CH2   . TRP A 1 210 ? 5.586   -12.341 -33.986 1.00 24.30  ? 822  TRP A CH2   1 
ATOM   1439 N N     . SER A 1 211 ? 8.553   -12.087 -26.673 1.00 23.56  ? 823  SER A N     1 
ATOM   1440 C CA    . SER A 1 211 ? 8.994   -10.867 -26.007 1.00 23.24  ? 823  SER A CA    1 
ATOM   1441 C C     . SER A 1 211 ? 10.511  -10.835 -25.865 1.00 29.48  ? 823  SER A C     1 
ATOM   1442 O O     . SER A 1 211 ? 11.131  -9.815  -26.074 1.00 30.92  ? 823  SER A O     1 
ATOM   1443 C CB    . SER A 1 211 ? 8.361   -10.741 -24.623 1.00 26.96  ? 823  SER A CB    1 
ATOM   1444 O OG    . SER A 1 211 ? 6.961   -10.696 -24.686 1.00 28.16  ? 823  SER A OG    1 
ATOM   1445 N N     . TYR A 1 212 ? 11.083  -11.978 -25.507 1.00 24.47  ? 824  TYR A N     1 
ATOM   1446 C CA    . TYR A 1 212 ? 12.517  -12.162 -25.356 1.00 23.35  ? 824  TYR A CA    1 
ATOM   1447 C C     . TYR A 1 212 ? 13.231  -11.834 -26.669 1.00 27.27  ? 824  TYR A C     1 
ATOM   1448 O O     . TYR A 1 212 ? 14.309  -11.229 -26.636 1.00 26.79  ? 824  TYR A O     1 
ATOM   1449 C CB    . TYR A 1 212 ? 12.845  -13.613 -24.906 1.00 23.86  ? 824  TYR A CB    1 
ATOM   1450 C CG    . TYR A 1 212 ? 14.331  -13.841 -24.747 1.00 24.43  ? 824  TYR A CG    1 
ATOM   1451 C CD1   . TYR A 1 212 ? 14.990  -13.467 -23.580 1.00 26.25  ? 824  TYR A CD1   1 
ATOM   1452 C CD2   . TYR A 1 212 ? 15.098  -14.331 -25.804 1.00 25.12  ? 824  TYR A CD2   1 
ATOM   1453 C CE1   . TYR A 1 212 ? 16.370  -13.585 -23.462 1.00 29.41  ? 824  TYR A CE1   1 
ATOM   1454 C CE2   . TYR A 1 212 ? 16.476  -14.459 -25.697 1.00 26.58  ? 824  TYR A CE2   1 
ATOM   1455 C CZ    . TYR A 1 212 ? 17.110  -14.087 -24.522 1.00 36.55  ? 824  TYR A CZ    1 
ATOM   1456 O OH    . TYR A 1 212 ? 18.472  -14.214 -24.409 1.00 36.43  ? 824  TYR A OH    1 
ATOM   1457 N N     . GLY A 1 213 ? 12.639  -12.236 -27.786 1.00 23.53  ? 825  GLY A N     1 
ATOM   1458 C CA    . GLY A 1 213 ? 13.203  -11.988 -29.092 1.00 22.96  ? 825  GLY A CA    1 
ATOM   1459 C C     . GLY A 1 213 ? 13.285  -10.501 -29.326 1.00 27.63  ? 825  GLY A C     1 
ATOM   1460 O O     . GLY A 1 213 ? 14.227  -10.014 -29.913 1.00 27.55  ? 825  GLY A O     1 
ATOM   1461 N N     . ILE A 1 214 ? 12.260  -9.791  -28.878 1.00 25.70  ? 826  ILE A N     1 
ATOM   1462 C CA    . ILE A 1 214 ? 12.214  -8.351  -28.983 1.00 24.21  ? 826  ILE A CA    1 
ATOM   1463 C C     . ILE A 1 214 ? 13.325  -7.751  -28.115 1.00 26.52  ? 826  ILE A C     1 
ATOM   1464 O O     . ILE A 1 214 ? 14.002  -6.835  -28.523 1.00 25.70  ? 826  ILE A O     1 
ATOM   1465 C CB    . ILE A 1 214 ? 10.833  -7.800  -28.597 1.00 26.31  ? 826  ILE A CB    1 
ATOM   1466 C CG1   . ILE A 1 214 ? 9.749   -8.390  -29.505 1.00 26.24  ? 826  ILE A CG1   1 
ATOM   1467 C CG2   . ILE A 1 214 ? 10.829  -6.286  -28.651 1.00 24.99  ? 826  ILE A CG2   1 
ATOM   1468 C CD1   . ILE A 1 214 ? 9.774   -7.882  -30.922 1.00 27.16  ? 826  ILE A CD1   1 
ATOM   1469 N N     . VAL A 1 215 ? 13.519  -8.302  -26.927 1.00 24.26  ? 827  VAL A N     1 
ATOM   1470 C CA    . VAL A 1 215 ? 14.560  -7.836  -26.025 1.00 24.97  ? 827  VAL A CA    1 
ATOM   1471 C C     . VAL A 1 215 ? 15.940  -8.030  -26.678 1.00 30.96  ? 827  VAL A C     1 
ATOM   1472 O O     . VAL A 1 215 ? 16.782  -7.158  -26.617 1.00 33.15  ? 827  VAL A O     1 
ATOM   1473 C CB    . VAL A 1 215 ? 14.464  -8.554  -24.659 1.00 28.31  ? 827  VAL A CB    1 
ATOM   1474 C CG1   . VAL A 1 215 ? 15.759  -8.461  -23.871 1.00 28.75  ? 827  VAL A CG1   1 
ATOM   1475 C CG2   . VAL A 1 215 ? 13.325  -7.980  -23.849 1.00 27.66  ? 827  VAL A CG2   1 
ATOM   1476 N N     . MET A 1 216 ? 16.144  -9.173  -27.315 1.00 27.76  ? 828  MET A N     1 
ATOM   1477 C CA    . MET A 1 216 ? 17.398  -9.475  -28.023 1.00 27.40  ? 828  MET A CA    1 
ATOM   1478 C C     . MET A 1 216 ? 17.737  -8.363  -29.015 1.00 29.10  ? 828  MET A C     1 
ATOM   1479 O O     . MET A 1 216 ? 18.881  -7.927  -29.094 1.00 27.42  ? 828  MET A O     1 
ATOM   1480 C CB    . MET A 1 216 ? 17.270  -10.794 -28.793 1.00 28.86  ? 828  MET A CB    1 
ATOM   1481 C CG    . MET A 1 216 ? 17.574  -11.999 -27.988 1.00 32.80  ? 828  MET A CG    1 
ATOM   1482 S SD    . MET A 1 216 ? 17.460  -13.474 -29.031 1.00 36.23  ? 828  MET A SD    1 
ATOM   1483 C CE    . MET A 1 216 ? 18.978  -13.322 -29.970 1.00 32.93  ? 828  MET A CE    1 
ATOM   1484 N N     . TRP A 1 217 ? 16.721  -7.926  -29.768 1.00 26.62  ? 829  TRP A N     1 
ATOM   1485 C CA    . TRP A 1 217 ? 16.816  -6.883  -30.777 1.00 26.95  ? 829  TRP A CA    1 
ATOM   1486 C C     . TRP A 1 217 ? 17.093  -5.554  -30.102 1.00 33.00  ? 829  TRP A C     1 
ATOM   1487 O O     . TRP A 1 217 ? 17.910  -4.787  -30.622 1.00 33.36  ? 829  TRP A O     1 
ATOM   1488 C CB    . TRP A 1 217 ? 15.536  -6.851  -31.615 1.00 24.15  ? 829  TRP A CB    1 
ATOM   1489 C CG    . TRP A 1 217 ? 15.612  -5.959  -32.816 1.00 25.11  ? 829  TRP A CG    1 
ATOM   1490 C CD1   . TRP A 1 217 ? 15.932  -6.330  -34.090 1.00 27.84  ? 829  TRP A CD1   1 
ATOM   1491 C CD2   . TRP A 1 217 ? 15.298  -4.557  -32.870 1.00 24.90  ? 829  TRP A CD2   1 
ATOM   1492 N NE1   . TRP A 1 217 ? 15.862  -5.247  -34.929 1.00 27.16  ? 829  TRP A NE1   1 
ATOM   1493 C CE2   . TRP A 1 217 ? 15.434  -4.152  -34.217 1.00 28.89  ? 829  TRP A CE2   1 
ATOM   1494 C CE3   . TRP A 1 217 ? 14.907  -3.600  -31.909 1.00 25.68  ? 829  TRP A CE3   1 
ATOM   1495 C CZ2   . TRP A 1 217 ? 15.232  -2.823  -34.624 1.00 28.66  ? 829  TRP A CZ2   1 
ATOM   1496 C CZ3   . TRP A 1 217 ? 14.672  -2.293  -32.320 1.00 27.07  ? 829  TRP A CZ3   1 
ATOM   1497 C CH2   . TRP A 1 217 ? 14.832  -1.914  -33.663 1.00 27.99  ? 829  TRP A CH2   1 
ATOM   1498 N N     . GLU A 1 218 ? 16.495  -5.312  -28.897 1.00 30.35  ? 830  GLU A N     1 
ATOM   1499 C CA    . GLU A 1 218 ? 16.751  -4.065  -28.143 1.00 31.17  ? 830  GLU A CA    1 
ATOM   1500 C C     . GLU A 1 218 ? 18.222  -3.985  -27.724 1.00 35.22  ? 830  GLU A C     1 
ATOM   1501 O O     . GLU A 1 218 ? 18.830  -2.916  -27.805 1.00 35.38  ? 830  GLU A O     1 
ATOM   1502 C CB    . GLU A 1 218 ? 15.856  -3.930  -26.889 1.00 32.52  ? 830  GLU A CB    1 
ATOM   1503 C CG    . GLU A 1 218 ? 14.356  -3.771  -27.144 1.00 37.12  ? 830  GLU A CG    1 
ATOM   1504 C CD    . GLU A 1 218 ? 13.584  -3.563  -25.855 1.00 44.68  ? 830  GLU A CD    1 
ATOM   1505 O OE1   . GLU A 1 218 ? 13.123  -4.564  -25.259 1.00 24.11  ? 830  GLU A OE1   1 
ATOM   1506 O OE2   . GLU A 1 218 ? 13.513  -2.401  -25.395 1.00 40.50  ? 830  GLU A OE2   1 
ATOM   1507 N N     . VAL A 1 219 ? 18.784  -5.128  -27.294 1.00 31.79  ? 831  VAL A N     1 
ATOM   1508 C CA    . VAL A 1 219 ? 20.165  -5.254  -26.827 1.00 32.15  ? 831  VAL A CA    1 
ATOM   1509 C C     . VAL A 1 219 ? 21.154  -5.114  -27.993 1.00 35.55  ? 831  VAL A C     1 
ATOM   1510 O O     . VAL A 1 219 ? 22.176  -4.453  -27.832 1.00 37.08  ? 831  VAL A O     1 
ATOM   1511 C CB    . VAL A 1 219 ? 20.404  -6.534  -25.965 1.00 36.29  ? 831  VAL A CB    1 
ATOM   1512 C CG1   . VAL A 1 219 ? 21.861  -6.625  -25.466 1.00 38.20  ? 831  VAL A CG1   1 
ATOM   1513 C CG2   . VAL A 1 219 ? 19.450  -6.596  -24.773 1.00 35.53  ? 831  VAL A CG2   1 
ATOM   1514 N N     . MET A 1 220 ? 20.836  -5.683  -29.169 1.00 29.70  ? 832  MET A N     1 
ATOM   1515 C CA    . MET A 1 220 ? 21.755  -5.646  -30.314 1.00 30.15  ? 832  MET A CA    1 
ATOM   1516 C C     . MET A 1 220 ? 21.746  -4.310  -31.065 1.00 36.80  ? 832  MET A C     1 
ATOM   1517 O O     . MET A 1 220 ? 22.662  -4.047  -31.842 1.00 38.96  ? 832  MET A O     1 
ATOM   1518 C CB    . MET A 1 220 ? 21.512  -6.838  -31.282 1.00 31.31  ? 832  MET A CB    1 
ATOM   1519 C CG    . MET A 1 220 ? 21.877  -8.240  -30.729 1.00 32.79  ? 832  MET A CG    1 
ATOM   1520 S SD    . MET A 1 220 ? 23.215  -8.402  -29.509 1.00 36.62  ? 832  MET A SD    1 
ATOM   1521 C CE    . MET A 1 220 ? 24.649  -8.252  -30.529 1.00 33.95  ? 832  MET A CE    1 
ATOM   1522 N N     . SER A 1 221 ? 20.719  -3.474  -30.832 1.00 32.30  ? 833  SER A N     1 
ATOM   1523 C CA    . SER A 1 221 ? 20.532  -2.172  -31.481 1.00 31.31  ? 833  SER A CA    1 
ATOM   1524 C C     . SER A 1 221 ? 20.898  -1.012  -30.546 1.00 34.97  ? 833  SER A C     1 
ATOM   1525 O O     . SER A 1 221 ? 20.866  0.141   -30.971 1.00 34.08  ? 833  SER A O     1 
ATOM   1526 C CB    . SER A 1 221 ? 19.086  -2.026  -31.957 1.00 30.88  ? 833  SER A CB    1 
ATOM   1527 O OG    . SER A 1 221 ? 18.186  -2.066  -30.862 1.00 34.37  ? 833  SER A OG    1 
ATOM   1528 N N     . TYR A 1 222 ? 21.268  -1.340  -29.284 1.00 31.95  ? 834  TYR A N     1 
ATOM   1529 C CA    . TYR A 1 222 ? 21.613  -0.437  -28.186 1.00 32.59  ? 834  TYR A CA    1 
ATOM   1530 C C     . TYR A 1 222 ? 20.434  0.489   -27.802 1.00 37.53  ? 834  TYR A C     1 
ATOM   1531 O O     . TYR A 1 222 ? 20.600  1.708   -27.684 1.00 38.37  ? 834  TYR A O     1 
ATOM   1532 C CB    . TYR A 1 222 ? 22.910  0.342   -28.455 1.00 35.62  ? 834  TYR A CB    1 
ATOM   1533 C CG    . TYR A 1 222 ? 24.186  -0.459  -28.298 1.00 39.23  ? 834  TYR A CG    1 
ATOM   1534 C CD1   . TYR A 1 222 ? 24.925  -0.406  -27.120 1.00 42.25  ? 834  TYR A CD1   1 
ATOM   1535 C CD2   . TYR A 1 222 ? 24.685  -1.228  -29.347 1.00 40.23  ? 834  TYR A CD2   1 
ATOM   1536 C CE1   . TYR A 1 222 ? 26.125  -1.104  -26.984 1.00 44.53  ? 834  TYR A CE1   1 
ATOM   1537 C CE2   . TYR A 1 222 ? 25.884  -1.929  -29.224 1.00 42.23  ? 834  TYR A CE2   1 
ATOM   1538 C CZ    . TYR A 1 222 ? 26.606  -1.857  -28.043 1.00 50.08  ? 834  TYR A CZ    1 
ATOM   1539 O OH    . TYR A 1 222 ? 27.792  -2.539  -27.921 1.00 50.63  ? 834  TYR A OH    1 
ATOM   1540 N N     . GLY A 1 223 ? 19.256  -0.113  -27.616 1.00 32.46  ? 835  GLY A N     1 
ATOM   1541 C CA    . GLY A 1 223 ? 18.068  0.599   -27.174 1.00 31.60  ? 835  GLY A CA    1 
ATOM   1542 C C     . GLY A 1 223 ? 17.262  1.351   -28.209 1.00 34.51  ? 835  GLY A C     1 
ATOM   1543 O O     . GLY A 1 223 ? 16.673  2.382   -27.878 1.00 36.49  ? 835  GLY A O     1 
ATOM   1544 N N     . GLU A 1 224 ? 17.186  0.852   -29.447 1.00 28.69  ? 836  GLU A N     1 
ATOM   1545 C CA    . GLU A 1 224 ? 16.335  1.487   -30.465 1.00 27.77  ? 836  GLU A CA    1 
ATOM   1546 C C     . GLU A 1 224 ? 14.860  1.091   -30.222 1.00 29.84  ? 836  GLU A C     1 
ATOM   1547 O O     . GLU A 1 224 ? 14.571  0.094   -29.546 1.00 26.38  ? 836  GLU A O     1 
ATOM   1548 C CB    . GLU A 1 224 ? 16.737  1.052   -31.879 1.00 29.20  ? 836  GLU A CB    1 
ATOM   1549 C CG    . GLU A 1 224 ? 17.998  1.695   -32.421 1.00 37.29  ? 836  GLU A CG    1 
ATOM   1550 C CD    . GLU A 1 224 ? 18.090  1.611   -33.932 1.00 50.54  ? 836  GLU A CD    1 
ATOM   1551 O OE1   . GLU A 1 224 ? 17.256  2.244   -34.617 1.00 38.62  ? 836  GLU A OE1   1 
ATOM   1552 O OE2   . GLU A 1 224 ? 19.004  0.925   -34.436 1.00 42.95  ? 836  GLU A OE2   1 
ATOM   1553 N N     . ARG A 1 225 ? 13.932  1.876   -30.774 1.00 28.94  ? 837  ARG A N     1 
ATOM   1554 C CA    . ARG A 1 225 ? 12.503  1.610   -30.652 1.00 28.27  ? 837  ARG A CA    1 
ATOM   1555 C C     . ARG A 1 225 ? 12.091  0.475   -31.600 1.00 32.41  ? 837  ARG A C     1 
ATOM   1556 O O     . ARG A 1 225 ? 12.231  0.636   -32.818 1.00 33.00  ? 837  ARG A O     1 
ATOM   1557 C CB    . ARG A 1 225 ? 11.716  2.895   -30.946 1.00 27.00  ? 837  ARG A CB    1 
ATOM   1558 C CG    . ARG A 1 225 ? 10.201  2.765   -31.041 1.00 32.92  ? 837  ARG A CG    1 
ATOM   1559 C CD    . ARG A 1 225 ? 9.642   4.151   -31.260 1.00 30.96  ? 837  ARG A CD    1 
ATOM   1560 N NE    . ARG A 1 225 ? 8.194   4.203   -31.481 1.00 29.47  ? 837  ARG A NE    1 
ATOM   1561 C CZ    . ARG A 1 225 ? 7.282   4.280   -30.514 1.00 39.19  ? 837  ARG A CZ    1 
ATOM   1562 N NH1   . ARG A 1 225 ? 7.645   4.210   -29.239 1.00 30.28  ? 837  ARG A NH1   1 
ATOM   1563 N NH2   . ARG A 1 225 ? 5.999   4.370   -30.815 1.00 24.09  ? 837  ARG A NH2   1 
ATOM   1564 N N     . PRO A 1 226 ? 11.558  -0.668  -31.083 1.00 28.40  ? 838  PRO A N     1 
ATOM   1565 C CA    . PRO A 1 226 ? 11.075  -1.719  -31.998 1.00 26.65  ? 838  PRO A CA    1 
ATOM   1566 C C     . PRO A 1 226 ? 10.028  -1.168  -32.973 1.00 31.43  ? 838  PRO A C     1 
ATOM   1567 O O     . PRO A 1 226 ? 9.067   -0.520  -32.539 1.00 31.71  ? 838  PRO A O     1 
ATOM   1568 C CB    . PRO A 1 226 ? 10.480  -2.783  -31.055 1.00 26.98  ? 838  PRO A CB    1 
ATOM   1569 C CG    . PRO A 1 226 ? 10.996  -2.482  -29.722 1.00 31.40  ? 838  PRO A CG    1 
ATOM   1570 C CD    . PRO A 1 226 ? 11.323  -1.030  -29.665 1.00 28.76  ? 838  PRO A CD    1 
ATOM   1571 N N     . TYR A 1 227 ? 10.259  -1.395  -34.258 1.00 27.80  ? 839  TYR A N     1 
ATOM   1572 C CA    . TYR A 1 227 ? 9.362   -1.016  -35.344 1.00 27.43  ? 839  TYR A CA    1 
ATOM   1573 C C     . TYR A 1 227 ? 9.362   0.464   -35.732 1.00 36.79  ? 839  TYR A C     1 
ATOM   1574 O O     . TYR A 1 227 ? 8.633   0.866   -36.624 1.00 36.91  ? 839  TYR A O     1 
ATOM   1575 C CB    . TYR A 1 227 ? 7.944   -1.559  -35.117 1.00 25.70  ? 839  TYR A CB    1 
ATOM   1576 C CG    . TYR A 1 227 ? 7.886   -3.051  -34.854 1.00 21.93  ? 839  TYR A CG    1 
ATOM   1577 C CD1   . TYR A 1 227 ? 7.943   -3.962  -35.891 1.00 22.80  ? 839  TYR A CD1   1 
ATOM   1578 C CD2   . TYR A 1 227 ? 7.770   -3.542  -33.566 1.00 21.05  ? 839  TYR A CD2   1 
ATOM   1579 C CE1   . TYR A 1 227 ? 7.895   -5.315  -35.654 1.00 22.61  ? 839  TYR A CE1   1 
ATOM   1580 C CE2   . TYR A 1 227 ? 7.722   -4.891  -33.317 1.00 20.16  ? 839  TYR A CE2   1 
ATOM   1581 C CZ    . TYR A 1 227 ? 7.784   -5.773  -34.365 1.00 26.45  ? 839  TYR A CZ    1 
ATOM   1582 O OH    . TYR A 1 227 ? 7.727   -7.109  -34.125 1.00 20.23  ? 839  TYR A OH    1 
ATOM   1583 N N     . TRP A 1 228 ? 10.184  1.258   -35.054 1.00 35.62  ? 840  TRP A N     1 
ATOM   1584 C CA    . TRP A 1 228 ? 10.345  2.678   -35.361 1.00 36.81  ? 840  TRP A CA    1 
ATOM   1585 C C     . TRP A 1 228 ? 9.070   3.551   -35.446 1.00 40.43  ? 840  TRP A C     1 
ATOM   1586 O O     . TRP A 1 228 ? 8.281   3.617   -34.515 1.00 37.40  ? 840  TRP A O     1 
ATOM   1587 C CB    . TRP A 1 228 ? 11.278  2.870   -36.566 1.00 37.33  ? 840  TRP A CB    1 
ATOM   1588 C CG    . TRP A 1 228 ? 12.579  2.186   -36.414 1.00 39.09  ? 840  TRP A CG    1 
ATOM   1589 C CD1   . TRP A 1 228 ? 13.610  2.565   -35.620 1.00 42.40  ? 840  TRP A CD1   1 
ATOM   1590 C CD2   . TRP A 1 228 ? 12.990  0.984   -37.062 1.00 39.03  ? 840  TRP A CD2   1 
ATOM   1591 N NE1   . TRP A 1 228 ? 14.642  1.682   -35.736 1.00 42.33  ? 840  TRP A NE1   1 
ATOM   1592 C CE2   . TRP A 1 228 ? 14.288  0.699   -36.617 1.00 43.71  ? 840  TRP A CE2   1 
ATOM   1593 C CE3   . TRP A 1 228 ? 12.388  0.123   -37.980 1.00 40.22  ? 840  TRP A CE3   1 
ATOM   1594 C CZ2   . TRP A 1 228 ? 14.999  -0.411  -37.059 1.00 42.94  ? 840  TRP A CZ2   1 
ATOM   1595 C CZ3   . TRP A 1 228 ? 13.093  -0.976  -38.414 1.00 41.77  ? 840  TRP A CZ3   1 
ATOM   1596 C CH2   . TRP A 1 228 ? 14.382  -1.232  -37.956 1.00 42.51  ? 840  TRP A CH2   1 
ATOM   1597 N N     . ASP A 1 229 ? 8.943   4.194   -36.601 1.00 39.27  ? 841  ASP A N     1 
ATOM   1598 C CA    . ASP A 1 229 ? 7.870   5.109   -36.963 1.00 40.91  ? 841  ASP A CA    1 
ATOM   1599 C C     . ASP A 1 229 ? 6.479   4.486   -37.051 1.00 43.43  ? 841  ASP A C     1 
ATOM   1600 O O     . ASP A 1 229 ? 5.489   5.177   -36.874 1.00 44.31  ? 841  ASP A O     1 
ATOM   1601 C CB    . ASP A 1 229 ? 8.218   5.856   -38.262 1.00 44.93  ? 841  ASP A CB    1 
ATOM   1602 C CG    . ASP A 1 229 ? 8.413   4.925   -39.441 1.00 59.75  ? 841  ASP A CG    1 
ATOM   1603 O OD1   . ASP A 1 229 ? 9.179   3.956   -39.326 1.00 59.33  ? 841  ASP A OD1   1 
ATOM   1604 O OD2   . ASP A 1 229 ? 7.797   5.161   -40.494 1.00 69.12  ? 841  ASP A OD2   1 
ATOM   1605 N N     . MET A 1 230 ? 6.422   3.186   -37.319 1.00 36.82  ? 842  MET A N     1 
ATOM   1606 C CA    . MET A 1 230 ? 5.173   2.455   -37.461 1.00 34.86  ? 842  MET A CA    1 
ATOM   1607 C C     . MET A 1 230 ? 4.285   2.588   -36.240 1.00 35.09  ? 842  MET A C     1 
ATOM   1608 O O     . MET A 1 230 ? 4.741   2.547   -35.109 1.00 31.90  ? 842  MET A O     1 
ATOM   1609 C CB    . MET A 1 230 ? 5.472   0.957   -37.607 1.00 36.83  ? 842  MET A CB    1 
ATOM   1610 C CG    . MET A 1 230 ? 5.669   0.425   -39.014 1.00 41.47  ? 842  MET A CG    1 
ATOM   1611 S SD    . MET A 1 230 ? 6.170   -1.310  -39.092 1.00 45.12  ? 842  MET A SD    1 
ATOM   1612 C CE    . MET A 1 230 ? 4.999   -2.121  -38.026 1.00 40.84  ? 842  MET A CE    1 
ATOM   1613 N N     . SER A 1 231 ? 2.996   2.744   -36.499 1.00 31.47  ? 843  SER A N     1 
ATOM   1614 C CA    . SER A 1 231 ? 1.995   2.842   -35.452 1.00 30.11  ? 843  SER A CA    1 
ATOM   1615 C C     . SER A 1 231 ? 1.739   1.479   -34.807 1.00 32.34  ? 843  SER A C     1 
ATOM   1616 O O     . SER A 1 231 ? 2.069   0.457   -35.370 1.00 30.45  ? 843  SER A O     1 
ATOM   1617 C CB    . SER A 1 231 ? 0.699   3.424   -36.000 1.00 33.23  ? 843  SER A CB    1 
ATOM   1618 O OG    . SER A 1 231 ? 0.057   2.526   -36.872 1.00 36.32  ? 843  SER A OG    1 
ATOM   1619 N N     . ASN A 1 232 ? 1.166   1.486   -33.615 1.00 28.14  ? 844  ASN A N     1 
ATOM   1620 C CA    . ASN A 1 232 ? 0.854   0.272   -32.881 1.00 26.79  ? 844  ASN A CA    1 
ATOM   1621 C C     . ASN A 1 232 ? -0.028  -0.679  -33.714 1.00 30.64  ? 844  ASN A C     1 
ATOM   1622 O O     . ASN A 1 232 ? 0.250   -1.880  -33.770 1.00 29.64  ? 844  ASN A O     1 
ATOM   1623 C CB    . ASN A 1 232 ? 0.231   0.624   -31.542 1.00 25.43  ? 844  ASN A CB    1 
ATOM   1624 C CG    . ASN A 1 232 ? 1.224   1.179   -30.553 1.00 35.38  ? 844  ASN A CG    1 
ATOM   1625 O OD1   . ASN A 1 232 ? 2.452   1.057   -30.702 1.00 34.50  ? 844  ASN A OD1   1 
ATOM   1626 N ND2   . ASN A 1 232 ? 0.714   1.735   -29.484 1.00 19.05  ? 844  ASN A ND2   1 
ATOM   1627 N N     . GLN A 1 233 ? -1.004  -0.107  -34.435 1.00 27.13  ? 845  GLN A N     1 
ATOM   1628 C CA    . GLN A 1 233 ? -1.902  -0.792  -35.349 1.00 27.56  ? 845  GLN A CA    1 
ATOM   1629 C C     . GLN A 1 233 ? -1.148  -1.336  -36.561 1.00 32.53  ? 845  GLN A C     1 
ATOM   1630 O O     . GLN A 1 233 ? -1.474  -2.425  -37.025 1.00 33.01  ? 845  GLN A O     1 
ATOM   1631 C CB    . GLN A 1 233 ? -3.047  0.149   -35.793 1.00 29.71  ? 845  GLN A CB    1 
ATOM   1632 C CG    . GLN A 1 233 ? -4.272  -0.597  -36.389 1.00 44.81  ? 845  GLN A CG    1 
ATOM   1633 C CD    . GLN A 1 233 ? -4.706  -1.823  -35.591 1.00 60.62  ? 845  GLN A CD    1 
ATOM   1634 O OE1   . GLN A 1 233 ? -5.069  -1.749  -34.403 1.00 59.61  ? 845  GLN A OE1   1 
ATOM   1635 N NE2   . GLN A 1 233 ? -4.645  -2.986  -36.219 1.00 45.92  ? 845  GLN A NE2   1 
ATOM   1636 N N     . ASP A 1 234 ? -0.141  -0.584  -37.064 1.00 29.78  ? 846  ASP A N     1 
ATOM   1637 C CA    . ASP A 1 234 ? 0.682   -0.985  -38.217 1.00 29.87  ? 846  ASP A CA    1 
ATOM   1638 C C     . ASP A 1 234 ? 1.554   -2.160  -37.858 1.00 31.80  ? 846  ASP A C     1 
ATOM   1639 O O     . ASP A 1 234 ? 1.868   -2.938  -38.746 1.00 32.90  ? 846  ASP A O     1 
ATOM   1640 C CB    . ASP A 1 234 ? 1.574   0.172   -38.749 1.00 31.87  ? 846  ASP A CB    1 
ATOM   1641 C CG    . ASP A 1 234 ? 0.841   1.303   -39.468 1.00 41.20  ? 846  ASP A CG    1 
ATOM   1642 O OD1   . ASP A 1 234 ? -0.279  1.054   -39.989 1.00 37.65  ? 846  ASP A OD1   1 
ATOM   1643 O OD2   . ASP A 1 234 ? 1.372   2.457   -39.471 1.00 45.71  ? 846  ASP A OD2   1 
ATOM   1644 N N     . VAL A 1 235 ? 1.983   -2.262  -36.582 1.00 26.57  ? 847  VAL A N     1 
ATOM   1645 C CA    . VAL A 1 235 ? 2.822   -3.355  -36.044 1.00 25.73  ? 847  VAL A CA    1 
ATOM   1646 C C     . VAL A 1 235 ? 2.028   -4.666  -36.094 1.00 32.42  ? 847  VAL A C     1 
ATOM   1647 O O     . VAL A 1 235 ? 2.506   -5.627  -36.675 1.00 34.15  ? 847  VAL A O     1 
ATOM   1648 C CB    . VAL A 1 235 ? 3.397   -3.045  -34.624 1.00 26.62  ? 847  VAL A CB    1 
ATOM   1649 C CG1   . VAL A 1 235 ? 4.083   -4.266  -33.997 1.00 25.03  ? 847  VAL A CG1   1 
ATOM   1650 C CG2   . VAL A 1 235 ? 4.350   -1.866  -34.672 1.00 25.82  ? 847  VAL A CG2   1 
ATOM   1651 N N     . ILE A 1 236 ? 0.806   -4.681  -35.531 1.00 29.74  ? 848  ILE A N     1 
ATOM   1652 C CA    . ILE A 1 236 ? -0.096  -5.837  -35.493 1.00 28.90  ? 848  ILE A CA    1 
ATOM   1653 C C     . ILE A 1 236 ? -0.341  -6.312  -36.929 1.00 35.67  ? 848  ILE A C     1 
ATOM   1654 O O     . ILE A 1 236 ? -0.232  -7.506  -37.203 1.00 36.47  ? 848  ILE A O     1 
ATOM   1655 C CB    . ILE A 1 236 ? -1.421  -5.433  -34.768 1.00 32.23  ? 848  ILE A CB    1 
ATOM   1656 C CG1   . ILE A 1 236 ? -1.191  -5.158  -33.269 1.00 31.33  ? 848  ILE A CG1   1 
ATOM   1657 C CG2   . ILE A 1 236 ? -2.579  -6.448  -35.001 1.00 32.69  ? 848  ILE A CG2   1 
ATOM   1658 C CD1   . ILE A 1 236 ? -2.369  -4.339  -32.601 1.00 31.07  ? 848  ILE A CD1   1 
ATOM   1659 N N     . ASN A 1 237 ? -0.632  -5.363  -37.845 1.00 33.44  ? 849  ASN A N     1 
ATOM   1660 C CA    . ASN A 1 237 ? -0.917  -5.647  -39.247 1.00 33.96  ? 849  ASN A CA    1 
ATOM   1661 C C     . ASN A 1 237 ? 0.275   -6.209  -39.979 1.00 35.56  ? 849  ASN A C     1 
ATOM   1662 O O     . ASN A 1 237 ? 0.116   -7.177  -40.706 1.00 35.85  ? 849  ASN A O     1 
ATOM   1663 C CB    . ASN A 1 237 ? -1.471  -4.400  -39.959 1.00 34.47  ? 849  ASN A CB    1 
ATOM   1664 C CG    . ASN A 1 237 ? -2.895  -4.056  -39.573 1.00 50.71  ? 849  ASN A CG    1 
ATOM   1665 O OD1   . ASN A 1 237 ? -3.660  -4.903  -39.094 1.00 44.80  ? 849  ASN A OD1   1 
ATOM   1666 N ND2   . ASN A 1 237 ? -3.298  -2.809  -39.807 1.00 43.45  ? 849  ASN A ND2   1 
ATOM   1667 N N     . ALA A 1 238 ? 1.470   -5.611  -39.775 1.00 30.39  ? 850  ALA A N     1 
ATOM   1668 C CA    . ALA A 1 238 ? 2.728   -6.021  -40.407 1.00 29.46  ? 850  ALA A CA    1 
ATOM   1669 C C     . ALA A 1 238 ? 3.112   -7.420  -39.986 1.00 30.80  ? 850  ALA A C     1 
ATOM   1670 O O     . ALA A 1 238 ? 3.428   -8.224  -40.842 1.00 29.58  ? 850  ALA A O     1 
ATOM   1671 C CB    . ALA A 1 238 ? 3.834   -5.038  -40.064 1.00 29.67  ? 850  ALA A CB    1 
ATOM   1672 N N     . VAL A 1 239 ? 3.029   -7.716  -38.671 1.00 27.16  ? 851  VAL A N     1 
ATOM   1673 C CA    . VAL A 1 239 ? 3.299   -9.017  -38.056 1.00 27.29  ? 851  VAL A CA    1 
ATOM   1674 C C     . VAL A 1 239 ? 2.417   -10.124 -38.660 1.00 34.70  ? 851  VAL A C     1 
ATOM   1675 O O     . VAL A 1 239 ? 2.927   -11.206 -38.966 1.00 34.47  ? 851  VAL A O     1 
ATOM   1676 C CB    . VAL A 1 239 ? 3.214   -8.910  -36.503 1.00 30.81  ? 851  VAL A CB    1 
ATOM   1677 C CG1   . VAL A 1 239 ? 3.081   -10.276 -35.842 1.00 31.38  ? 851  VAL A CG1   1 
ATOM   1678 C CG2   . VAL A 1 239 ? 4.446   -8.183  -35.954 1.00 29.68  ? 851  VAL A CG2   1 
ATOM   1679 N N     . GLU A 1 240 ? 1.113   -9.829  -38.885 1.00 35.27  ? 852  GLU A N     1 
ATOM   1680 C CA    . GLU A 1 240 ? 0.114   -10.734 -39.474 1.00 36.90  ? 852  GLU A CA    1 
ATOM   1681 C C     . GLU A 1 240 ? 0.437   -11.041 -40.949 1.00 41.28  ? 852  GLU A C     1 
ATOM   1682 O O     . GLU A 1 240 ? 0.116   -12.125 -41.435 1.00 40.38  ? 852  GLU A O     1 
ATOM   1683 C CB    . GLU A 1 240 ? -1.296  -10.117 -39.358 1.00 39.56  ? 852  GLU A CB    1 
ATOM   1684 C CG    . GLU A 1 240 ? -1.958  -10.309 -38.001 1.00 53.32  ? 852  GLU A CG    1 
ATOM   1685 C CD    . GLU A 1 240 ? -3.141  -9.409  -37.671 1.00 81.31  ? 852  GLU A CD    1 
ATOM   1686 O OE1   . GLU A 1 240 ? -3.622  -8.670  -38.562 1.00 78.22  ? 852  GLU A OE1   1 
ATOM   1687 O OE2   . GLU A 1 240 ? -3.588  -9.449  -36.502 1.00 77.26  ? 852  GLU A OE2   1 
ATOM   1688 N N     . GLN A 1 241 ? 1.059   -10.074 -41.648 1.00 39.44  ? 853  GLN A N     1 
ATOM   1689 C CA    . GLN A 1 241 ? 1.482   -10.172 -43.049 1.00 41.32  ? 853  GLN A CA    1 
ATOM   1690 C C     . GLN A 1 241 ? 2.947   -10.709 -43.159 1.00 46.06  ? 853  GLN A C     1 
ATOM   1691 O O     . GLN A 1 241 ? 3.590   -10.569 -44.213 1.00 47.50  ? 853  GLN A O     1 
ATOM   1692 C CB    . GLN A 1 241 ? 1.315   -8.813  -43.769 1.00 43.45  ? 853  GLN A CB    1 
ATOM   1693 C CG    . GLN A 1 241 ? -0.119  -8.239  -43.786 1.00 60.65  ? 853  GLN A CG    1 
ATOM   1694 C CD    . GLN A 1 241 ? -1.119  -9.051  -44.583 1.00 87.91  ? 853  GLN A CD    1 
ATOM   1695 O OE1   . GLN A 1 241 ? -2.011  -9.704  -44.029 1.00 83.54  ? 853  GLN A OE1   1 
ATOM   1696 N NE2   . GLN A 1 241 ? -1.019  -8.999  -45.903 1.00 85.56  ? 853  GLN A NE2   1 
ATOM   1697 N N     . ASP A 1 242 ? 3.453   -11.320 -42.051 1.00 39.50  ? 854  ASP A N     1 
ATOM   1698 C CA    . ASP A 1 242 ? 4.760   -11.990 -41.896 1.00 38.50  ? 854  ASP A CA    1 
ATOM   1699 C C     . ASP A 1 242 ? 5.981   -11.074 -41.916 1.00 39.42  ? 854  ASP A C     1 
ATOM   1700 O O     . ASP A 1 242 ? 7.070   -11.548 -42.235 1.00 39.65  ? 854  ASP A O     1 
ATOM   1701 C CB    . ASP A 1 242 ? 4.951   -13.129 -42.922 1.00 41.84  ? 854  ASP A CB    1 
ATOM   1702 C CG    . ASP A 1 242 ? 3.877   -14.185 -42.875 1.00 54.94  ? 854  ASP A CG    1 
ATOM   1703 O OD1   . ASP A 1 242 ? 3.675   -14.778 -41.793 1.00 54.92  ? 854  ASP A OD1   1 
ATOM   1704 O OD2   . ASP A 1 242 ? 3.232   -14.417 -43.921 1.00 64.40  ? 854  ASP A OD2   1 
ATOM   1705 N N     . TYR A 1 243 ? 5.817   -9.777  -41.574 1.00 33.63  ? 855  TYR A N     1 
ATOM   1706 C CA    . TYR A 1 243 ? 6.929   -8.836  -41.459 1.00 30.78  ? 855  TYR A CA    1 
ATOM   1707 C C     . TYR A 1 243 ? 7.592   -9.162  -40.132 1.00 32.25  ? 855  TYR A C     1 
ATOM   1708 O O     . TYR A 1 243 ? 6.909   -9.472  -39.152 1.00 31.63  ? 855  TYR A O     1 
ATOM   1709 C CB    . TYR A 1 243 ? 6.438   -7.356  -41.424 1.00 31.17  ? 855  TYR A CB    1 
ATOM   1710 C CG    . TYR A 1 243 ? 7.532   -6.358  -41.068 1.00 31.14  ? 855  TYR A CG    1 
ATOM   1711 C CD1   . TYR A 1 243 ? 8.358   -5.814  -42.054 1.00 33.38  ? 855  TYR A CD1   1 
ATOM   1712 C CD2   . TYR A 1 243 ? 7.785   -6.010  -39.740 1.00 29.52  ? 855  TYR A CD2   1 
ATOM   1713 C CE1   . TYR A 1 243 ? 9.386   -4.929  -41.733 1.00 30.57  ? 855  TYR A CE1   1 
ATOM   1714 C CE2   . TYR A 1 243 ? 8.815   -5.130  -39.407 1.00 29.61  ? 855  TYR A CE2   1 
ATOM   1715 C CZ    . TYR A 1 243 ? 9.603   -4.581  -40.411 1.00 36.71  ? 855  TYR A CZ    1 
ATOM   1716 O OH    . TYR A 1 243 ? 10.629  -3.724  -40.096 1.00 36.02  ? 855  TYR A OH    1 
ATOM   1717 N N     . ARG A 1 244 ? 8.912   -9.067  -40.097 1.00 26.95  ? 856  ARG A N     1 
ATOM   1718 C CA    . ARG A 1 244 ? 9.717   -9.266  -38.906 1.00 25.05  ? 856  ARG A CA    1 
ATOM   1719 C C     . ARG A 1 244 ? 10.807  -8.208  -38.920 1.00 29.79  ? 856  ARG A C     1 
ATOM   1720 O O     . ARG A 1 244 ? 11.293  -7.839  -39.999 1.00 30.35  ? 856  ARG A O     1 
ATOM   1721 C CB    . ARG A 1 244 ? 10.343  -10.686 -38.867 1.00 23.16  ? 856  ARG A CB    1 
ATOM   1722 C CG    . ARG A 1 244 ? 9.342   -11.868 -38.785 1.00 18.69  ? 856  ARG A CG    1 
ATOM   1723 C CD    . ARG A 1 244 ? 8.551   -11.849 -37.474 1.00 18.39  ? 856  ARG A CD    1 
ATOM   1724 N NE    . ARG A 1 244 ? 7.664   -13.010 -37.373 1.00 25.45  ? 856  ARG A NE    1 
ATOM   1725 C CZ    . ARG A 1 244 ? 6.377   -13.015 -37.720 1.00 35.56  ? 856  ARG A CZ    1 
ATOM   1726 N NH1   . ARG A 1 244 ? 5.806   -11.917 -38.206 1.00 20.28  ? 856  ARG A NH1   1 
ATOM   1727 N NH2   . ARG A 1 244 ? 5.652   -14.116 -37.586 1.00 22.57  ? 856  ARG A NH2   1 
ATOM   1728 N N     . LEU A 1 245 ? 11.185  -7.709  -37.732 1.00 26.28  ? 857  LEU A N     1 
ATOM   1729 C CA    . LEU A 1 245 ? 12.237  -6.705  -37.591 1.00 27.93  ? 857  LEU A CA    1 
ATOM   1730 C C     . LEU A 1 245 ? 13.560  -7.124  -38.244 1.00 33.65  ? 857  LEU A C     1 
ATOM   1731 O O     . LEU A 1 245 ? 13.957  -8.296  -38.130 1.00 34.02  ? 857  LEU A O     1 
ATOM   1732 C CB    . LEU A 1 245 ? 12.455  -6.358  -36.102 1.00 27.70  ? 857  LEU A CB    1 
ATOM   1733 C CG    . LEU A 1 245 ? 11.387  -5.427  -35.475 1.00 30.28  ? 857  LEU A CG    1 
ATOM   1734 C CD1   . LEU A 1 245 ? 11.379  -5.538  -33.951 1.00 28.97  ? 857  LEU A CD1   1 
ATOM   1735 C CD2   . LEU A 1 245 ? 11.581  -3.995  -35.923 1.00 31.70  ? 857  LEU A CD2   1 
ATOM   1736 N N     . PRO A 1 246 ? 14.226  -6.210  -38.983 1.00 31.82  ? 858  PRO A N     1 
ATOM   1737 C CA    . PRO A 1 246 ? 15.507  -6.587  -39.629 1.00 32.95  ? 858  PRO A CA    1 
ATOM   1738 C C     . PRO A 1 246 ? 16.677  -6.746  -38.646 1.00 36.04  ? 858  PRO A C     1 
ATOM   1739 O O     . PRO A 1 246 ? 16.533  -6.395  -37.464 1.00 33.59  ? 858  PRO A O     1 
ATOM   1740 C CB    . PRO A 1 246 ? 15.756  -5.451  -40.635 1.00 35.70  ? 858  PRO A CB    1 
ATOM   1741 C CG    . PRO A 1 246 ? 14.993  -4.303  -40.122 1.00 39.56  ? 858  PRO A CG    1 
ATOM   1742 C CD    . PRO A 1 246 ? 13.869  -4.800  -39.255 1.00 33.38  ? 858  PRO A CD    1 
ATOM   1743 N N     . PRO A 1 247 ? 17.841  -7.299  -39.073 1.00 33.01  ? 859  PRO A N     1 
ATOM   1744 C CA    . PRO A 1 247 ? 18.967  -7.374  -38.133 1.00 32.59  ? 859  PRO A CA    1 
ATOM   1745 C C     . PRO A 1 247 ? 19.533  -5.981  -37.828 1.00 37.08  ? 859  PRO A C     1 
ATOM   1746 O O     . PRO A 1 247 ? 19.749  -5.195  -38.761 1.00 38.37  ? 859  PRO A O     1 
ATOM   1747 C CB    . PRO A 1 247 ? 19.999  -8.247  -38.861 1.00 34.94  ? 859  PRO A CB    1 
ATOM   1748 C CG    . PRO A 1 247 ? 19.675  -8.117  -40.309 1.00 39.85  ? 859  PRO A CG    1 
ATOM   1749 C CD    . PRO A 1 247 ? 18.214  -7.796  -40.420 1.00 35.21  ? 859  PRO A CD    1 
ATOM   1750 N N     . PRO A 1 248 ? 19.760  -5.641  -36.538 1.00 32.28  ? 860  PRO A N     1 
ATOM   1751 C CA    . PRO A 1 248 ? 20.400  -4.364  -36.226 1.00 32.83  ? 860  PRO A CA    1 
ATOM   1752 C C     . PRO A 1 248 ? 21.818  -4.311  -36.819 1.00 40.46  ? 860  PRO A C     1 
ATOM   1753 O O     . PRO A 1 248 ? 22.412  -5.342  -37.179 1.00 39.12  ? 860  PRO A O     1 
ATOM   1754 C CB    . PRO A 1 248 ? 20.431  -4.355  -34.687 1.00 33.88  ? 860  PRO A CB    1 
ATOM   1755 C CG    . PRO A 1 248 ? 19.407  -5.348  -34.265 1.00 36.22  ? 860  PRO A CG    1 
ATOM   1756 C CD    . PRO A 1 248 ? 19.543  -6.426  -35.304 1.00 32.32  ? 860  PRO A CD    1 
ATOM   1757 N N     . MET A 1 249 ? 22.334  -3.092  -36.975 1.00 41.02  ? 861  MET A N     1 
ATOM   1758 C CA    . MET A 1 249 ? 23.638  -2.797  -37.558 1.00 43.49  ? 861  MET A CA    1 
ATOM   1759 C C     . MET A 1 249 ? 24.739  -3.596  -36.865 1.00 48.89  ? 861  MET A C     1 
ATOM   1760 O O     . MET A 1 249 ? 24.826  -3.582  -35.634 1.00 48.35  ? 861  MET A O     1 
ATOM   1761 C CB    . MET A 1 249 ? 23.901  -1.275  -37.524 1.00 47.46  ? 861  MET A CB    1 
ATOM   1762 C CG    . MET A 1 249 ? 25.172  -0.838  -38.244 1.00 54.08  ? 861  MET A CG    1 
ATOM   1763 S SD    . MET A 1 249 ? 25.355  -1.419  -39.955 1.00 60.20  ? 861  MET A SD    1 
ATOM   1764 C CE    . MET A 1 249 ? 24.119  -0.431  -40.790 1.00 56.70  ? 861  MET A CE    1 
ATOM   1765 N N     . ASP A 1 250 ? 25.518  -4.356  -37.678 1.00 46.30  ? 862  ASP A N     1 
ATOM   1766 C CA    . ASP A 1 250 ? 26.639  -5.239  -37.311 1.00 46.61  ? 862  ASP A CA    1 
ATOM   1767 C C     . ASP A 1 250 ? 26.249  -6.401  -36.357 1.00 47.45  ? 862  ASP A C     1 
ATOM   1768 O O     . ASP A 1 250 ? 27.112  -6.947  -35.672 1.00 47.92  ? 862  ASP A O     1 
ATOM   1769 C CB    . ASP A 1 250 ? 27.835  -4.428  -36.760 1.00 50.59  ? 862  ASP A CB    1 
ATOM   1770 C CG    . ASP A 1 250 ? 28.361  -3.388  -37.729 1.00 65.73  ? 862  ASP A CG    1 
ATOM   1771 O OD1   . ASP A 1 250 ? 28.942  -3.780  -38.765 1.00 68.55  ? 862  ASP A OD1   1 
ATOM   1772 O OD2   . ASP A 1 250 ? 28.179  -2.183  -37.460 1.00 73.14  ? 862  ASP A OD2   1 
ATOM   1773 N N     . CYS A 1 251 ? 24.964  -6.801  -36.344 1.00 41.15  ? 863  CYS A N     1 
ATOM   1774 C CA    . CYS A 1 251 ? 24.448  -7.909  -35.527 1.00 37.59  ? 863  CYS A CA    1 
ATOM   1775 C C     . CYS A 1 251 ? 24.832  -9.219  -36.163 1.00 40.78  ? 863  CYS A C     1 
ATOM   1776 O O     . CYS A 1 251 ? 24.529  -9.441  -37.345 1.00 39.34  ? 863  CYS A O     1 
ATOM   1777 C CB    . CYS A 1 251 ? 22.930  -7.807  -35.349 1.00 35.44  ? 863  CYS A CB    1 
ATOM   1778 S SG    . CYS A 1 251 ? 22.149  -9.233  -34.524 1.00 37.61  ? 863  CYS A SG    1 
ATOM   1779 N N     . PRO A 1 252 ? 25.404  -10.149 -35.367 1.00 37.79  ? 864  PRO A N     1 
ATOM   1780 C CA    . PRO A 1 252 ? 25.717  -11.485 -35.916 1.00 37.84  ? 864  PRO A CA    1 
ATOM   1781 C C     . PRO A 1 252 ? 24.469  -12.199 -36.433 1.00 39.83  ? 864  PRO A C     1 
ATOM   1782 O O     . PRO A 1 252 ? 23.412  -12.132 -35.813 1.00 38.12  ? 864  PRO A O     1 
ATOM   1783 C CB    . PRO A 1 252 ? 26.372  -12.214 -34.733 1.00 39.73  ? 864  PRO A CB    1 
ATOM   1784 C CG    . PRO A 1 252 ? 26.903  -11.068 -33.856 1.00 44.85  ? 864  PRO A CG    1 
ATOM   1785 C CD    . PRO A 1 252 ? 25.818  -10.036 -33.955 1.00 38.86  ? 864  PRO A CD    1 
ATOM   1786 N N     . THR A 1 253 ? 24.589  -12.828 -37.604 1.00 37.34  ? 865  THR A N     1 
ATOM   1787 C CA    . THR A 1 253 ? 23.533  -13.581 -38.266 1.00 36.83  ? 865  THR A CA    1 
ATOM   1788 C C     . THR A 1 253 ? 22.900  -14.617 -37.323 1.00 41.08  ? 865  THR A C     1 
ATOM   1789 O O     . THR A 1 253 ? 21.666  -14.693 -37.267 1.00 38.62  ? 865  THR A O     1 
ATOM   1790 C CB    . THR A 1 253 ? 24.059  -14.175 -39.589 1.00 42.65  ? 865  THR A CB    1 
ATOM   1791 O OG1   . THR A 1 253 ? 24.470  -13.089 -40.427 1.00 43.35  ? 865  THR A OG1   1 
ATOM   1792 C CG2   . THR A 1 253 ? 23.010  -14.994 -40.326 1.00 38.31  ? 865  THR A CG2   1 
ATOM   1793 N N     . ALA A 1 254 ? 23.730  -15.382 -36.561 1.00 38.79  ? 866  ALA A N     1 
ATOM   1794 C CA    . ALA A 1 254 ? 23.208  -16.388 -35.614 1.00 38.28  ? 866  ALA A CA    1 
ATOM   1795 C C     . ALA A 1 254 ? 22.177  -15.806 -34.592 1.00 39.40  ? 866  ALA A C     1 
ATOM   1796 O O     . ALA A 1 254 ? 21.203  -16.470 -34.272 1.00 37.59  ? 866  ALA A O     1 
ATOM   1797 C CB    . ALA A 1 254 ? 24.358  -17.077 -34.882 1.00 39.55  ? 866  ALA A CB    1 
ATOM   1798 N N     . LEU A 1 255 ? 22.448  -14.610 -34.081 1.00 36.06  ? 867  LEU A N     1 
ATOM   1799 C CA    . LEU A 1 255 ? 21.569  -13.927 -33.137 1.00 34.41  ? 867  LEU A CA    1 
ATOM   1800 C C     . LEU A 1 255 ? 20.239  -13.510 -33.774 1.00 35.06  ? 867  LEU A C     1 
ATOM   1801 O O     . LEU A 1 255 ? 19.192  -13.622 -33.166 1.00 32.71  ? 867  LEU A O     1 
ATOM   1802 C CB    . LEU A 1 255 ? 22.287  -12.746 -32.489 1.00 34.49  ? 867  LEU A CB    1 
ATOM   1803 C CG    . LEU A 1 255 ? 23.388  -13.185 -31.528 1.00 39.30  ? 867  LEU A CG    1 
ATOM   1804 C CD1   . LEU A 1 255 ? 24.030  -11.987 -30.858 1.00 39.71  ? 867  LEU A CD1   1 
ATOM   1805 C CD2   . LEU A 1 255 ? 22.840  -14.144 -30.492 1.00 39.09  ? 867  LEU A CD2   1 
ATOM   1806 N N     . HIS A 1 256 ? 20.306  -13.013 -35.000 1.00 30.62  ? 868  HIS A N     1 
ATOM   1807 C CA    . HIS A 1 256 ? 19.108  -12.640 -35.722 1.00 29.28  ? 868  HIS A CA    1 
ATOM   1808 C C     . HIS A 1 256 ? 18.284  -13.885 -36.019 1.00 30.00  ? 868  HIS A C     1 
ATOM   1809 O O     . HIS A 1 256 ? 17.069  -13.857 -35.920 1.00 30.55  ? 868  HIS A O     1 
ATOM   1810 C CB    . HIS A 1 256 ? 19.410  -11.879 -37.005 1.00 30.39  ? 868  HIS A CB    1 
ATOM   1811 C CG    . HIS A 1 256 ? 18.186  -11.354 -37.677 1.00 33.90  ? 868  HIS A CG    1 
ATOM   1812 N ND1   . HIS A 1 256 ? 17.716  -11.859 -38.865 1.00 36.16  ? 868  HIS A ND1   1 
ATOM   1813 C CD2   . HIS A 1 256 ? 17.313  -10.389 -37.308 1.00 35.84  ? 868  HIS A CD2   1 
ATOM   1814 C CE1   . HIS A 1 256 ? 16.616  -11.218 -39.209 1.00 35.25  ? 868  HIS A CE1   1 
ATOM   1815 N NE2   . HIS A 1 256 ? 16.351  -10.321 -38.282 1.00 35.39  ? 868  HIS A NE2   1 
ATOM   1816 N N     . GLN A 1 257 ? 18.959  -14.972 -36.382 1.00 24.47  ? 869  GLN A N     1 
ATOM   1817 C CA    . GLN A 1 257 ? 18.276  -16.225 -36.660 1.00 24.28  ? 869  GLN A CA    1 
ATOM   1818 C C     . GLN A 1 257 ? 17.586  -16.674 -35.381 1.00 28.23  ? 869  GLN A C     1 
ATOM   1819 O O     . GLN A 1 257 ? 16.464  -17.132 -35.434 1.00 28.22  ? 869  GLN A O     1 
ATOM   1820 C CB    . GLN A 1 257 ? 19.214  -17.293 -37.216 1.00 26.47  ? 869  GLN A CB    1 
ATOM   1821 C CG    . GLN A 1 257 ? 18.531  -18.611 -37.551 1.00 41.43  ? 869  GLN A CG    1 
ATOM   1822 C CD    . GLN A 1 257 ? 17.599  -18.520 -38.747 1.00 61.08  ? 869  GLN A CD    1 
ATOM   1823 O OE1   . GLN A 1 257 ? 18.041  -18.437 -39.888 1.00 55.11  ? 869  GLN A OE1   1 
ATOM   1824 N NE2   . GLN A 1 257 ? 16.302  -18.549 -38.488 1.00 43.27  ? 869  GLN A NE2   1 
ATOM   1825 N N     . LEU A 1 258 ? 18.245  -16.521 -34.235 1.00 23.92  ? 870  LEU A N     1 
ATOM   1826 C CA    . LEU A 1 258 ? 17.599  -16.842 -32.956 1.00 23.00  ? 870  LEU A CA    1 
ATOM   1827 C C     . LEU A 1 258 ? 16.302  -15.983 -32.727 1.00 28.24  ? 870  LEU A C     1 
ATOM   1828 O O     . LEU A 1 258 ? 15.285  -16.549 -32.329 1.00 26.90  ? 870  LEU A O     1 
ATOM   1829 C CB    . LEU A 1 258 ? 18.576  -16.727 -31.761 1.00 22.86  ? 870  LEU A CB    1 
ATOM   1830 C CG    . LEU A 1 258 ? 18.023  -17.140 -30.357 1.00 27.11  ? 870  LEU A CG    1 
ATOM   1831 C CD1   . LEU A 1 258 ? 17.539  -18.599 -30.336 1.00 26.36  ? 870  LEU A CD1   1 
ATOM   1832 C CD2   . LEU A 1 258 ? 19.066  -16.926 -29.259 1.00 31.81  ? 870  LEU A CD2   1 
ATOM   1833 N N     . MET A 1 259 ? 16.346  -14.644 -33.013 1.00 25.43  ? 871  MET A N     1 
ATOM   1834 C CA    . MET A 1 259 ? 15.205  -13.717 -32.891 1.00 24.89  ? 871  MET A CA    1 
ATOM   1835 C C     . MET A 1 259 ? 14.091  -14.208 -33.789 1.00 30.29  ? 871  MET A C     1 
ATOM   1836 O O     . MET A 1 259 ? 12.927  -14.152 -33.402 1.00 30.46  ? 871  MET A O     1 
ATOM   1837 C CB    . MET A 1 259 ? 15.558  -12.269 -33.316 1.00 26.64  ? 871  MET A CB    1 
ATOM   1838 C CG    . MET A 1 259 ? 16.576  -11.557 -32.439 1.00 29.51  ? 871  MET A CG    1 
ATOM   1839 S SD    . MET A 1 259 ? 17.196  -10.100 -33.317 1.00 33.20  ? 871  MET A SD    1 
ATOM   1840 C CE    . MET A 1 259 ? 18.887  -9.983  -32.656 1.00 29.59  ? 871  MET A CE    1 
ATOM   1841 N N     . LEU A 1 260 ? 14.444  -14.667 -35.001 1.00 28.64  ? 872  LEU A N     1 
ATOM   1842 C CA    . LEU A 1 260 ? 13.459  -15.209 -35.943 1.00 28.70  ? 872  LEU A CA    1 
ATOM   1843 C C     . LEU A 1 260 ? 12.810  -16.489 -35.421 1.00 33.05  ? 872  LEU A C     1 
ATOM   1844 O O     . LEU A 1 260 ? 11.623  -16.671 -35.643 1.00 33.61  ? 872  LEU A O     1 
ATOM   1845 C CB    . LEU A 1 260 ? 14.036  -15.393 -37.358 1.00 28.92  ? 872  LEU A CB    1 
ATOM   1846 C CG    . LEU A 1 260 ? 14.359  -14.112 -38.121 1.00 32.32  ? 872  LEU A CG    1 
ATOM   1847 C CD1   . LEU A 1 260 ? 14.917  -14.447 -39.496 1.00 33.45  ? 872  LEU A CD1   1 
ATOM   1848 C CD2   . LEU A 1 260 ? 13.115  -13.214 -38.273 1.00 30.66  ? 872  LEU A CD2   1 
ATOM   1849 N N     . ASP A 1 261 ? 13.561  -17.346 -34.691 1.00 29.89  ? 873  ASP A N     1 
ATOM   1850 C CA    . ASP A 1 261 ? 12.961  -18.534 -34.074 1.00 30.05  ? 873  ASP A CA    1 
ATOM   1851 C C     . ASP A 1 261 ? 11.919  -18.083 -33.016 1.00 31.83  ? 873  ASP A C     1 
ATOM   1852 O O     . ASP A 1 261 ? 10.799  -18.614 -33.013 1.00 31.27  ? 873  ASP A O     1 
ATOM   1853 C CB    . ASP A 1 261 ? 14.015  -19.497 -33.457 1.00 31.66  ? 873  ASP A CB    1 
ATOM   1854 C CG    . ASP A 1 261 ? 15.155  -19.967 -34.372 1.00 41.73  ? 873  ASP A CG    1 
ATOM   1855 O OD1   . ASP A 1 261 ? 14.918  -20.119 -35.595 1.00 43.88  ? 873  ASP A OD1   1 
ATOM   1856 O OD2   . ASP A 1 261 ? 16.279  -20.209 -33.853 1.00 41.66  ? 873  ASP A OD2   1 
ATOM   1857 N N     . CYS A 1 262 ? 12.273  -17.077 -32.166 1.00 25.92  ? 874  CYS A N     1 
ATOM   1858 C CA    . CYS A 1 262 ? 11.394  -16.517 -31.126 1.00 25.99  ? 874  CYS A CA    1 
ATOM   1859 C C     . CYS A 1 262 ? 10.086  -15.925 -31.718 1.00 29.32  ? 874  CYS A C     1 
ATOM   1860 O O     . CYS A 1 262 ? 9.064   -15.920 -31.032 1.00 27.50  ? 874  CYS A O     1 
ATOM   1861 C CB    . CYS A 1 262 ? 12.124  -15.485 -30.259 1.00 26.69  ? 874  CYS A CB    1 
ATOM   1862 S SG    . CYS A 1 262 ? 13.498  -16.152 -29.263 1.00 32.32  ? 874  CYS A SG    1 
ATOM   1863 N N     . TRP A 1 263 ? 10.140  -15.390 -32.978 1.00 25.40  ? 875  TRP A N     1 
ATOM   1864 C CA    . TRP A 1 263 ? 9.023   -14.729 -33.643 1.00 23.38  ? 875  TRP A CA    1 
ATOM   1865 C C     . TRP A 1 263 ? 8.258   -15.595 -34.647 1.00 27.56  ? 875  TRP A C     1 
ATOM   1866 O O     . TRP A 1 263 ? 7.557   -15.052 -35.505 1.00 27.30  ? 875  TRP A O     1 
ATOM   1867 C CB    . TRP A 1 263 ? 9.473   -13.395 -34.303 1.00 21.75  ? 875  TRP A CB    1 
ATOM   1868 C CG    . TRP A 1 263 ? 10.211  -12.432 -33.413 1.00 21.79  ? 875  TRP A CG    1 
ATOM   1869 C CD1   . TRP A 1 263 ? 10.002  -12.215 -32.079 1.00 24.11  ? 875  TRP A CD1   1 
ATOM   1870 C CD2   . TRP A 1 263 ? 11.239  -11.503 -33.816 1.00 20.97  ? 875  TRP A CD2   1 
ATOM   1871 N NE1   . TRP A 1 263 ? 10.890  -11.276 -31.609 1.00 22.58  ? 875  TRP A NE1   1 
ATOM   1872 C CE2   . TRP A 1 263 ? 11.623  -10.779 -32.662 1.00 23.58  ? 875  TRP A CE2   1 
ATOM   1873 C CE3   . TRP A 1 263 ? 11.855  -11.192 -35.053 1.00 22.13  ? 875  TRP A CE3   1 
ATOM   1874 C CZ2   . TRP A 1 263 ? 12.616  -9.775  -32.695 1.00 22.16  ? 875  TRP A CZ2   1 
ATOM   1875 C CZ3   . TRP A 1 263 ? 12.836  -10.198 -35.089 1.00 23.26  ? 875  TRP A CZ3   1 
ATOM   1876 C CH2   . TRP A 1 263 ? 13.213  -9.506  -33.921 1.00 23.39  ? 875  TRP A CH2   1 
ATOM   1877 N N     . VAL A 1 264 ? 8.341   -16.927 -34.554 1.00 26.26  ? 876  VAL A N     1 
ATOM   1878 C CA    . VAL A 1 264 ? 7.531   -17.784 -35.445 1.00 27.42  ? 876  VAL A CA    1 
ATOM   1879 C C     . VAL A 1 264 ? 6.049   -17.597 -35.039 1.00 29.65  ? 876  VAL A C     1 
ATOM   1880 O O     . VAL A 1 264 ? 5.754   -17.498 -33.832 1.00 29.67  ? 876  VAL A O     1 
ATOM   1881 C CB    . VAL A 1 264 ? 7.962   -19.274 -35.392 1.00 33.51  ? 876  VAL A CB    1 
ATOM   1882 C CG1   . VAL A 1 264 ? 6.979   -20.163 -36.147 1.00 36.23  ? 876  VAL A CG1   1 
ATOM   1883 C CG2   . VAL A 1 264 ? 9.370   -19.467 -35.962 1.00 33.63  ? 876  VAL A CG2   1 
ATOM   1884 N N     . ARG A 1 265 ? 5.135   -17.505 -36.035 1.00 23.47  ? 877  ARG A N     1 
ATOM   1885 C CA    . ARG A 1 265 ? 3.707   -17.373 -35.802 0.60 22.77  ? 877  ARG A CA    1 
ATOM   1886 C C     . ARG A 1 265 ? 3.220   -18.607 -35.023 1.00 29.44  ? 877  ARG A C     1 
ATOM   1887 O O     . ARG A 1 265 ? 2.527   -18.458 -34.022 1.00 29.53  ? 877  ARG A O     1 
ATOM   1888 C CB    . ARG A 1 265 ? 2.949   -17.170 -37.137 0.60 19.77  ? 877  ARG A CB    1 
ATOM   1889 C CG    . ARG A 1 265 ? 1.428   -16.957 -36.998 0.60 21.92  ? 877  ARG A CG    1 
ATOM   1890 C CD    . ARG A 1 265 ? 0.996   -15.526 -36.712 0.60 25.68  ? 877  ARG A CD    1 
ATOM   1891 N NE    . ARG A 1 265 ? 0.080   -15.476 -35.575 0.60 27.60  ? 877  ARG A NE    1 
ATOM   1892 C CZ    . ARG A 1 265 ? -1.171  -15.036 -35.617 0.60 39.33  ? 877  ARG A CZ    1 
ATOM   1893 N NH1   . ARG A 1 265 ? -1.926  -15.066 -34.528 0.60 34.09  ? 877  ARG A NH1   1 
ATOM   1894 N NH2   . ARG A 1 265 ? -1.679  -14.564 -36.749 0.60 25.00  ? 877  ARG A NH2   1 
ATOM   1895 N N     . ASP A 1 266 ? 3.627   -19.824 -35.448 1.00 27.12  ? 878  ASP A N     1 
ATOM   1896 C CA    . ASP A 1 266 ? 3.270   -21.061 -34.760 1.00 26.58  ? 878  ASP A CA    1 
ATOM   1897 C C     . ASP A 1 266 ? 4.038   -21.056 -33.419 1.00 30.04  ? 878  ASP A C     1 
ATOM   1898 O O     . ASP A 1 266 ? 5.256   -21.238 -33.399 1.00 29.50  ? 878  ASP A O     1 
ATOM   1899 C CB    . ASP A 1 266 ? 3.636   -22.282 -35.639 1.00 28.53  ? 878  ASP A CB    1 
ATOM   1900 C CG    . ASP A 1 266 ? 3.260   -23.661 -35.106 1.00 32.94  ? 878  ASP A CG    1 
ATOM   1901 O OD1   . ASP A 1 266 ? 3.102   -23.808 -33.879 1.00 33.19  ? 878  ASP A OD1   1 
ATOM   1902 O OD2   . ASP A 1 266 ? 3.142   -24.588 -35.912 1.00 38.11  ? 878  ASP A OD2   1 
ATOM   1903 N N     . ARG A 1 267 ? 3.321   -20.811 -32.309 1.00 26.16  ? 879  ARG A N     1 
ATOM   1904 C CA    . ARG A 1 267 ? 3.921   -20.742 -30.972 1.00 26.08  ? 879  ARG A CA    1 
ATOM   1905 C C     . ARG A 1 267 ? 4.544   -22.051 -30.489 1.00 32.88  ? 879  ARG A C     1 
ATOM   1906 O O     . ARG A 1 267 ? 5.380   -22.012 -29.597 1.00 33.30  ? 879  ARG A O     1 
ATOM   1907 C CB    . ARG A 1 267 ? 2.917   -20.204 -29.930 1.00 26.36  ? 879  ARG A CB    1 
ATOM   1908 C CG    . ARG A 1 267 ? 1.702   -21.098 -29.679 1.00 31.35  ? 879  ARG A CG    1 
ATOM   1909 C CD    . ARG A 1 267 ? 0.960   -20.690 -28.439 1.00 32.23  ? 879  ARG A CD    1 
ATOM   1910 N NE    . ARG A 1 267 ? -0.335  -21.364 -28.320 1.00 35.77  ? 879  ARG A NE    1 
ATOM   1911 C CZ    . ARG A 1 267 ? -1.166  -21.206 -27.289 1.00 46.44  ? 879  ARG A CZ    1 
ATOM   1912 N NH1   . ARG A 1 267 ? -0.843  -20.401 -26.281 1.00 31.28  ? 879  ARG A NH1   1 
ATOM   1913 N NH2   . ARG A 1 267 ? -2.328  -21.839 -27.263 1.00 29.73  ? 879  ARG A NH2   1 
ATOM   1914 N N     . ASN A 1 268 ? 4.160   -23.200 -31.084 1.00 31.44  ? 880  ASN A N     1 
ATOM   1915 C CA    . ASN A 1 268 ? 4.638   -24.536 -30.709 1.00 31.24  ? 880  ASN A CA    1 
ATOM   1916 C C     . ASN A 1 268 ? 6.053   -24.863 -31.251 1.00 36.45  ? 880  ASN A C     1 
ATOM   1917 O O     . ASN A 1 268 ? 6.700   -25.824 -30.798 1.00 36.73  ? 880  ASN A O     1 
ATOM   1918 C CB    . ASN A 1 268 ? 3.601   -25.590 -31.125 1.00 26.60  ? 880  ASN A CB    1 
ATOM   1919 C CG    . ASN A 1 268 ? 2.199   -25.202 -30.760 1.00 33.63  ? 880  ASN A CG    1 
ATOM   1920 O OD1   . ASN A 1 268 ? 1.806   -25.270 -29.594 1.00 32.68  ? 880  ASN A OD1   1 
ATOM   1921 N ND2   . ASN A 1 268 ? 1.438   -24.691 -31.727 1.00 24.37  ? 880  ASN A ND2   1 
ATOM   1922 N N     . LEU A 1 269 ? 6.507   -24.062 -32.227 1.00 32.99  ? 881  LEU A N     1 
ATOM   1923 C CA    . LEU A 1 269 ? 7.803   -24.169 -32.904 1.00 32.02  ? 881  LEU A CA    1 
ATOM   1924 C C     . LEU A 1 269 ? 8.879   -23.223 -32.306 1.00 34.71  ? 881  LEU A C     1 
ATOM   1925 O O     . LEU A 1 269 ? 10.075  -23.421 -32.550 1.00 34.53  ? 881  LEU A O     1 
ATOM   1926 C CB    . LEU A 1 269 ? 7.618   -23.905 -34.419 1.00 32.11  ? 881  LEU A CB    1 
ATOM   1927 C CG    . LEU A 1 269 ? 6.721   -24.870 -35.211 1.00 38.06  ? 881  LEU A CG    1 
ATOM   1928 C CD1   . LEU A 1 269 ? 6.572   -24.409 -36.652 1.00 38.98  ? 881  LEU A CD1   1 
ATOM   1929 C CD2   . LEU A 1 269 ? 7.255   -26.315 -35.192 1.00 41.70  ? 881  LEU A CD2   1 
ATOM   1930 N N     . ARG A 1 270 ? 8.458   -22.196 -31.532 1.00 28.32  ? 882  ARG A N     1 
ATOM   1931 C CA    . ARG A 1 270 ? 9.388   -21.268 -30.884 1.00 26.94  ? 882  ARG A CA    1 
ATOM   1932 C C     . ARG A 1 270 ? 10.275  -22.046 -29.895 1.00 31.10  ? 882  ARG A C     1 
ATOM   1933 O O     . ARG A 1 270 ? 9.777   -22.982 -29.273 1.00 29.70  ? 882  ARG A O     1 
ATOM   1934 C CB    . ARG A 1 270 ? 8.624   -20.164 -30.120 1.00 25.42  ? 882  ARG A CB    1 
ATOM   1935 C CG    . ARG A 1 270 ? 7.835   -19.220 -30.999 1.00 26.38  ? 882  ARG A CG    1 
ATOM   1936 C CD    . ARG A 1 270 ? 7.078   -18.181 -30.180 1.00 28.57  ? 882  ARG A CD    1 
ATOM   1937 N NE    . ARG A 1 270 ? 5.985   -17.626 -30.983 1.00 22.83  ? 882  ARG A NE    1 
ATOM   1938 C CZ    . ARG A 1 270 ? 4.883   -17.087 -30.485 1.00 35.10  ? 882  ARG A CZ    1 
ATOM   1939 N NH1   . ARG A 1 270 ? 4.736   -16.951 -29.170 1.00 17.61  ? 882  ARG A NH1   1 
ATOM   1940 N NH2   . ARG A 1 270 ? 3.926   -16.658 -31.294 1.00 24.65  ? 882  ARG A NH2   1 
ATOM   1941 N N     . PRO A 1 271 ? 11.568  -21.668 -29.689 1.00 28.58  ? 883  PRO A N     1 
ATOM   1942 C CA    . PRO A 1 271 ? 12.389  -22.398 -28.696 1.00 28.83  ? 883  PRO A CA    1 
ATOM   1943 C C     . PRO A 1 271 ? 11.878  -22.179 -27.273 1.00 32.18  ? 883  PRO A C     1 
ATOM   1944 O O     . PRO A 1 271 ? 11.099  -21.257 -27.032 1.00 29.87  ? 883  PRO A O     1 
ATOM   1945 C CB    . PRO A 1 271 ? 13.779  -21.765 -28.855 1.00 29.94  ? 883  PRO A CB    1 
ATOM   1946 C CG    . PRO A 1 271 ? 13.519  -20.408 -29.440 1.00 31.64  ? 883  PRO A CG    1 
ATOM   1947 C CD    . PRO A 1 271 ? 12.339  -20.579 -30.328 1.00 27.71  ? 883  PRO A CD    1 
ATOM   1948 N N     . LYS A 1 272 ? 12.294  -23.049 -26.348 1.00 31.04  ? 884  LYS A N     1 
ATOM   1949 C CA    . LYS A 1 272 ? 11.971  -22.935 -24.925 1.00 31.18  ? 884  LYS A CA    1 
ATOM   1950 C C     . LYS A 1 272 ? 13.106  -22.128 -24.379 1.00 34.05  ? 884  LYS A C     1 
ATOM   1951 O O     . LYS A 1 272 ? 14.131  -22.033 -25.044 1.00 34.47  ? 884  LYS A O     1 
ATOM   1952 C CB    . LYS A 1 272 ? 11.923  -24.320 -24.223 1.00 34.76  ? 884  LYS A CB    1 
ATOM   1953 C CG    . LYS A 1 272 ? 10.903  -25.312 -24.800 1.00 43.97  ? 884  LYS A CG    1 
ATOM   1954 C CD    . LYS A 1 272 ? 9.463   -24.979 -24.479 1.00 45.55  ? 884  LYS A CD    1 
ATOM   1955 C CE    . LYS A 1 272 ? 8.525   -25.681 -25.432 1.00 61.34  ? 884  LYS A CE    1 
ATOM   1956 N NZ    . LYS A 1 272 ? 7.098   -25.307 -25.203 1.00 67.38  ? 884  LYS A NZ    1 
ATOM   1957 N N     . PHE A 1 273 ? 12.959  -21.551 -23.187 1.00 30.48  ? 885  PHE A N     1 
ATOM   1958 C CA    . PHE A 1 273 ? 14.036  -20.760 -22.614 1.00 29.80  ? 885  PHE A CA    1 
ATOM   1959 C C     . PHE A 1 273 ? 15.299  -21.616 -22.372 1.00 33.21  ? 885  PHE A C     1 
ATOM   1960 O O     . PHE A 1 273 ? 16.395  -21.129 -22.630 1.00 32.00  ? 885  PHE A O     1 
ATOM   1961 C CB    . PHE A 1 273 ? 13.578  -19.965 -21.374 1.00 31.60  ? 885  PHE A CB    1 
ATOM   1962 C CG    . PHE A 1 273 ? 12.794  -18.707 -21.705 1.00 31.14  ? 885  PHE A CG    1 
ATOM   1963 C CD1   . PHE A 1 273 ? 13.423  -17.600 -22.274 1.00 31.85  ? 885  PHE A CD1   1 
ATOM   1964 C CD2   . PHE A 1 273 ? 11.430  -18.625 -21.435 1.00 32.24  ? 885  PHE A CD2   1 
ATOM   1965 C CE1   . PHE A 1 273 ? 12.699  -16.436 -22.566 1.00 31.09  ? 885  PHE A CE1   1 
ATOM   1966 C CE2   . PHE A 1 273 ? 10.715  -17.451 -21.710 1.00 33.55  ? 885  PHE A CE2   1 
ATOM   1967 C CZ    . PHE A 1 273 ? 11.358  -16.362 -22.265 1.00 30.36  ? 885  PHE A CZ    1 
ATOM   1968 N N     . SER A 1 274 ? 15.142  -22.910 -22.031 1.00 30.90  ? 886  SER A N     1 
ATOM   1969 C CA    . SER A 1 274 ? 16.285  -23.823 -21.871 1.00 32.09  ? 886  SER A CA    1 
ATOM   1970 C C     . SER A 1 274 ? 17.050  -23.986 -23.201 1.00 35.62  ? 886  SER A C     1 
ATOM   1971 O O     . SER A 1 274 ? 18.272  -24.008 -23.185 1.00 35.58  ? 886  SER A O     1 
ATOM   1972 C CB    . SER A 1 274 ? 15.832  -25.175 -21.338 1.00 37.35  ? 886  SER A CB    1 
ATOM   1973 O OG    . SER A 1 274 ? 14.669  -25.600 -22.027 1.00 49.33  ? 886  SER A OG    1 
ATOM   1974 N N     . GLN A 1 275 ? 16.329  -24.036 -24.350 1.00 31.12  ? 887  GLN A N     1 
ATOM   1975 C CA    . GLN A 1 275 ? 16.932  -24.097 -25.693 1.00 29.04  ? 887  GLN A CA    1 
ATOM   1976 C C     . GLN A 1 275 ? 17.642  -22.796 -26.033 1.00 30.74  ? 887  GLN A C     1 
ATOM   1977 O O     . GLN A 1 275 ? 18.709  -22.853 -26.638 1.00 30.02  ? 887  GLN A O     1 
ATOM   1978 C CB    . GLN A 1 275 ? 15.902  -24.459 -26.779 1.00 29.13  ? 887  GLN A CB    1 
ATOM   1979 C CG    . GLN A 1 275 ? 15.316  -25.856 -26.587 1.00 30.33  ? 887  GLN A CG    1 
ATOM   1980 C CD    . GLN A 1 275 ? 14.182  -26.147 -27.540 1.00 42.45  ? 887  GLN A CD    1 
ATOM   1981 O OE1   . GLN A 1 275 ? 13.064  -25.637 -27.404 1.00 33.18  ? 887  GLN A OE1   1 
ATOM   1982 N NE2   . GLN A 1 275 ? 14.434  -27.020 -28.496 1.00 36.00  ? 887  GLN A NE2   1 
ATOM   1983 N N     . ILE A 1 276 ? 17.063  -21.619 -25.636 1.00 26.61  ? 888  ILE A N     1 
ATOM   1984 C CA    . ILE A 1 276 ? 17.683  -20.309 -25.862 1.00 25.81  ? 888  ILE A CA    1 
ATOM   1985 C C     . ILE A 1 276 ? 19.057  -20.248 -25.134 1.00 30.82  ? 888  ILE A C     1 
ATOM   1986 O O     . ILE A 1 276 ? 20.072  -19.930 -25.772 1.00 28.76  ? 888  ILE A O     1 
ATOM   1987 C CB    . ILE A 1 276 ? 16.732  -19.106 -25.532 1.00 28.15  ? 888  ILE A CB    1 
ATOM   1988 C CG1   . ILE A 1 276 ? 15.500  -19.086 -26.490 1.00 27.79  ? 888  ILE A CG1   1 
ATOM   1989 C CG2   . ILE A 1 276 ? 17.479  -17.785 -25.635 1.00 28.55  ? 888  ILE A CG2   1 
ATOM   1990 C CD1   . ILE A 1 276 ? 14.302  -18.200 -26.073 1.00 26.09  ? 888  ILE A CD1   1 
ATOM   1991 N N     . VAL A 1 277 ? 19.083  -20.623 -23.829 1.00 30.02  ? 889  VAL A N     1 
ATOM   1992 C CA    . VAL A 1 277 ? 20.302  -20.674 -23.002 1.00 31.76  ? 889  VAL A CA    1 
ATOM   1993 C C     . VAL A 1 277 ? 21.375  -21.525 -23.689 1.00 34.98  ? 889  VAL A C     1 
ATOM   1994 O O     . VAL A 1 277 ? 22.489  -21.038 -23.868 1.00 33.34  ? 889  VAL A O     1 
ATOM   1995 C CB    . VAL A 1 277 ? 20.017  -21.145 -21.547 1.00 37.31  ? 889  VAL A CB    1 
ATOM   1996 C CG1   . VAL A 1 277 ? 21.305  -21.271 -20.730 1.00 38.23  ? 889  VAL A CG1   1 
ATOM   1997 C CG2   . VAL A 1 277 ? 19.033  -20.206 -20.854 1.00 37.11  ? 889  VAL A CG2   1 
ATOM   1998 N N     . ASN A 1 278 ? 21.010  -22.761 -24.129 1.00 33.45  ? 890  ASN A N     1 
ATOM   1999 C CA    . ASN A 1 278 ? 21.887  -23.719 -24.819 1.00 34.49  ? 890  ASN A CA    1 
ATOM   2000 C C     . ASN A 1 278 ? 22.514  -23.166 -26.108 1.00 39.92  ? 890  ASN A C     1 
ATOM   2001 O O     . ASN A 1 278 ? 23.705  -23.422 -26.353 1.00 42.00  ? 890  ASN A O     1 
ATOM   2002 C CB    . ASN A 1 278 ? 21.155  -25.046 -25.100 1.00 34.05  ? 890  ASN A CB    1 
ATOM   2003 C CG    . ASN A 1 278 ? 20.770  -25.850 -23.870 1.00 52.04  ? 890  ASN A CG    1 
ATOM   2004 O OD1   . ASN A 1 278 ? 21.227  -25.597 -22.741 1.00 49.79  ? 890  ASN A OD1   1 
ATOM   2005 N ND2   . ASN A 1 278 ? 19.914  -26.850 -24.063 1.00 36.66  ? 890  ASN A ND2   1 
ATOM   2006 N N     . THR A 1 279 ? 21.723  -22.421 -26.927 1.00 33.80  ? 891  THR A N     1 
ATOM   2007 C CA    . THR A 1 279 ? 22.191  -21.798 -28.179 1.00 32.56  ? 891  THR A CA    1 
ATOM   2008 C C     . THR A 1 279 ? 23.170  -20.659 -27.841 1.00 36.61  ? 891  THR A C     1 
ATOM   2009 O O     . THR A 1 279 ? 24.169  -20.496 -28.526 1.00 38.34  ? 891  THR A O     1 
ATOM   2010 C CB    . THR A 1 279 ? 20.977  -21.315 -29.036 1.00 34.94  ? 891  THR A CB    1 
ATOM   2011 O OG1   . THR A 1 279 ? 20.112  -22.412 -29.313 1.00 33.78  ? 891  THR A OG1   1 
ATOM   2012 C CG2   . THR A 1 279 ? 21.386  -20.674 -30.353 1.00 30.72  ? 891  THR A CG2   1 
ATOM   2013 N N     . LEU A 1 280 ? 22.893  -19.895 -26.774 1.00 32.56  ? 892  LEU A N     1 
ATOM   2014 C CA    . LEU A 1 280 ? 23.745  -18.770 -26.359 1.00 32.39  ? 892  LEU A CA    1 
ATOM   2015 C C     . LEU A 1 280 ? 25.066  -19.256 -25.794 1.00 37.41  ? 892  LEU A C     1 
ATOM   2016 O O     . LEU A 1 280 ? 26.109  -18.665 -26.090 1.00 37.31  ? 892  LEU A O     1 
ATOM   2017 C CB    . LEU A 1 280 ? 23.023  -17.803 -25.409 1.00 31.51  ? 892  LEU A CB    1 
ATOM   2018 C CG    . LEU A 1 280 ? 21.858  -17.006 -26.046 1.00 34.95  ? 892  LEU A CG    1 
ATOM   2019 C CD1   . LEU A 1 280 ? 21.071  -16.275 -24.994 1.00 34.77  ? 892  LEU A CD1   1 
ATOM   2020 C CD2   . LEU A 1 280 ? 22.351  -15.976 -27.079 1.00 36.25  ? 892  LEU A CD2   1 
ATOM   2021 N N     . ASP A 1 281 ? 25.025  -20.381 -25.043 1.00 33.41  ? 893  ASP A N     1 
ATOM   2022 C CA    . ASP A 1 281 ? 26.200  -21.051 -24.480 1.00 33.28  ? 893  ASP A CA    1 
ATOM   2023 C C     . ASP A 1 281 ? 27.047  -21.628 -25.602 1.00 36.70  ? 893  ASP A C     1 
ATOM   2024 O O     . ASP A 1 281 ? 28.266  -21.583 -25.513 1.00 37.46  ? 893  ASP A O     1 
ATOM   2025 C CB    . ASP A 1 281 ? 25.785  -22.153 -23.495 1.00 34.29  ? 893  ASP A CB    1 
ATOM   2026 C CG    . ASP A 1 281 ? 25.428  -21.642 -22.113 1.00 41.67  ? 893  ASP A CG    1 
ATOM   2027 O OD1   . ASP A 1 281 ? 25.535  -20.419 -21.884 1.00 43.55  ? 893  ASP A OD1   1 
ATOM   2028 O OD2   . ASP A 1 281 ? 25.017  -22.458 -21.267 1.00 46.99  ? 893  ASP A OD2   1 
ATOM   2029 N N     . LYS A 1 282 ? 26.396  -22.092 -26.685 1.00 34.09  ? 894  LYS A N     1 
ATOM   2030 C CA    . LYS A 1 282 ? 27.047  -22.687 -27.865 1.00 35.17  ? 894  LYS A CA    1 
ATOM   2031 C C     . LYS A 1 282 ? 27.810  -21.617 -28.621 1.00 39.78  ? 894  LYS A C     1 
ATOM   2032 O O     . LYS A 1 282 ? 28.941  -21.854 -29.026 1.00 40.75  ? 894  LYS A O     1 
ATOM   2033 C CB    . LYS A 1 282 ? 26.016  -23.418 -28.761 1.00 36.14  ? 894  LYS A CB    1 
ATOM   2034 C CG    . LYS A 1 282 ? 26.598  -24.168 -29.966 1.00 49.29  ? 894  LYS A CG    1 
ATOM   2035 C CD    . LYS A 1 282 ? 25.520  -24.837 -30.818 1.00 53.93  ? 894  LYS A CD    1 
ATOM   2036 C CE    . LYS A 1 282 ? 25.071  -26.168 -30.252 1.00 64.32  ? 894  LYS A CE    1 
ATOM   2037 N NZ    . LYS A 1 282 ? 23.854  -26.690 -30.927 1.00 69.86  ? 894  LYS A NZ    1 
ATOM   2038 N N     . LEU A 1 283 ? 27.201  -20.437 -28.782 1.00 36.64  ? 895  LEU A N     1 
ATOM   2039 C CA    . LEU A 1 283 ? 27.801  -19.275 -29.445 1.00 36.67  ? 895  LEU A CA    1 
ATOM   2040 C C     . LEU A 1 283 ? 28.975  -18.735 -28.621 1.00 39.79  ? 895  LEU A C     1 
ATOM   2041 O O     . LEU A 1 283 ? 29.992  -18.351 -29.205 1.00 39.86  ? 895  LEU A O     1 
ATOM   2042 C CB    . LEU A 1 283 ? 26.746  -18.174 -29.688 1.00 35.85  ? 895  LEU A CB    1 
ATOM   2043 C CG    . LEU A 1 283 ? 25.595  -18.515 -30.641 1.00 39.57  ? 895  LEU A CG    1 
ATOM   2044 C CD1   . LEU A 1 283 ? 24.560  -17.412 -30.644 1.00 37.93  ? 895  LEU A CD1   1 
ATOM   2045 C CD2   . LEU A 1 283 ? 26.094  -18.821 -32.055 1.00 43.50  ? 895  LEU A CD2   1 
ATOM   2046 N N     . ILE A 1 284 ? 28.846  -18.735 -27.269 1.00 35.36  ? 896  ILE A N     1 
ATOM   2047 C CA    . ILE A 1 284 ? 29.923  -18.333 -26.343 1.00 36.63  ? 896  ILE A CA    1 
ATOM   2048 C C     . ILE A 1 284 ? 31.095  -19.319 -26.461 1.00 43.52  ? 896  ILE A C     1 
ATOM   2049 O O     . ILE A 1 284 ? 32.243  -18.869 -26.478 1.00 45.85  ? 896  ILE A O     1 
ATOM   2050 C CB    . ILE A 1 284 ? 29.423  -18.171 -24.870 1.00 39.51  ? 896  ILE A CB    1 
ATOM   2051 C CG1   . ILE A 1 284 ? 28.533  -16.909 -24.728 1.00 38.09  ? 896  ILE A CG1   1 
ATOM   2052 C CG2   . ILE A 1 284 ? 30.616  -18.117 -23.871 1.00 41.87  ? 896  ILE A CG2   1 
ATOM   2053 C CD1   . ILE A 1 284 ? 27.406  -16.978 -23.663 1.00 44.17  ? 896  ILE A CD1   1 
ATOM   2054 N N     . ARG A 1 285 ? 30.806  -20.660 -26.563 1.00 39.04  ? 897  ARG A N     1 
ATOM   2055 C CA    . ARG A 1 285 ? 31.834  -21.710 -26.712 1.00 40.09  ? 897  ARG A CA    1 
ATOM   2056 C C     . ARG A 1 285 ? 32.582  -21.605 -28.033 1.00 43.95  ? 897  ARG A C     1 
ATOM   2057 O O     . ARG A 1 285 ? 33.752  -21.945 -28.082 1.00 46.65  ? 897  ARG A O     1 
ATOM   2058 C CB    . ARG A 1 285 ? 31.229  -23.121 -26.598 1.00 39.85  ? 897  ARG A CB    1 
ATOM   2059 C CG    . ARG A 1 285 ? 30.996  -23.606 -25.177 1.00 39.53  ? 897  ARG A CG    1 
ATOM   2060 C CD    . ARG A 1 285 ? 30.777  -25.110 -25.131 1.00 38.73  ? 897  ARG A CD    1 
ATOM   2061 N NE    . ARG A 1 285 ? 29.650  -25.577 -25.957 1.00 40.39  ? 897  ARG A NE    1 
ATOM   2062 C CZ    . ARG A 1 285 ? 28.381  -25.647 -25.557 1.00 49.11  ? 897  ARG A CZ    1 
ATOM   2063 N NH1   . ARG A 1 285 ? 28.038  -25.258 -24.335 1.00 30.80  ? 897  ARG A NH1   1 
ATOM   2064 N NH2   . ARG A 1 285 ? 27.448  -26.113 -26.372 1.00 38.06  ? 897  ARG A NH2   1 
ATOM   2065 N N     . ASN A 1 286 ? 31.915  -21.152 -29.105 1.00 38.94  ? 898  ASN A N     1 
ATOM   2066 C CA    . ASN A 1 286 ? 32.532  -20.982 -30.427 1.00 39.41  ? 898  ASN A CA    1 
ATOM   2067 C C     . ASN A 1 286 ? 32.391  -19.492 -30.824 1.00 44.97  ? 898  ASN A C     1 
ATOM   2068 O O     . ASN A 1 286 ? 31.526  -19.177 -31.643 1.00 43.64  ? 898  ASN A O     1 
ATOM   2069 C CB    . ASN A 1 286 ? 31.861  -21.905 -31.459 1.00 38.02  ? 898  ASN A CB    1 
ATOM   2070 C CG    . ASN A 1 286 ? 31.688  -23.342 -31.010 1.00 45.62  ? 898  ASN A CG    1 
ATOM   2071 O OD1   . ASN A 1 286 ? 32.526  -24.201 -31.265 1.00 35.25  ? 898  ASN A OD1   1 
ATOM   2072 N ND2   . ASN A 1 286 ? 30.585  -23.642 -30.347 1.00 33.07  ? 898  ASN A ND2   1 
ATOM   2073 N N     . PRO A 1 287 ? 33.185  -18.551 -30.223 1.00 43.88  ? 899  PRO A N     1 
ATOM   2074 C CA    . PRO A 1 287 ? 32.996  -17.106 -30.522 1.00 43.77  ? 899  PRO A CA    1 
ATOM   2075 C C     . PRO A 1 287 ? 33.207  -16.665 -31.975 1.00 49.14  ? 899  PRO A C     1 
ATOM   2076 O O     . PRO A 1 287 ? 32.661  -15.628 -32.375 1.00 48.22  ? 899  PRO A O     1 
ATOM   2077 C CB    . PRO A 1 287 ? 33.978  -16.415 -29.580 1.00 46.87  ? 899  PRO A CB    1 
ATOM   2078 C CG    . PRO A 1 287 ? 35.023  -17.469 -29.294 1.00 52.53  ? 899  PRO A CG    1 
ATOM   2079 C CD    . PRO A 1 287 ? 34.250  -18.745 -29.217 1.00 46.63  ? 899  PRO A CD    1 
ATOM   2080 N N     . ALA A 1 288 ? 33.958  -17.458 -32.761 1.00 47.11  ? 900  ALA A N     1 
ATOM   2081 C CA    . ALA A 1 288 ? 34.206  -17.234 -34.188 1.00 48.21  ? 900  ALA A CA    1 
ATOM   2082 C C     . ALA A 1 288 ? 32.893  -17.262 -35.008 1.00 52.45  ? 900  ALA A C     1 
ATOM   2083 O O     . ALA A 1 288 ? 32.818  -16.618 -36.055 1.00 52.98  ? 900  ALA A O     1 
ATOM   2084 C CB    . ALA A 1 288 ? 35.180  -18.283 -34.718 1.00 50.35  ? 900  ALA A CB    1 
ATOM   2085 N N     . SER A 1 289 ? 31.864  -17.991 -34.527 1.00 47.95  ? 901  SER A N     1 
ATOM   2086 C CA    . SER A 1 289 ? 30.565  -18.087 -35.197 1.00 47.33  ? 901  SER A CA    1 
ATOM   2087 C C     . SER A 1 289 ? 29.839  -16.745 -35.219 1.00 50.98  ? 901  SER A C     1 
ATOM   2088 O O     . SER A 1 289 ? 29.111  -16.465 -36.165 1.00 50.22  ? 901  SER A O     1 
ATOM   2089 C CB    . SER A 1 289 ? 29.690  -19.156 -34.544 1.00 51.66  ? 901  SER A CB    1 
ATOM   2090 O OG    . SER A 1 289 ? 29.354  -18.833 -33.204 1.00 62.63  ? 901  SER A OG    1 
ATOM   2091 N N     . LEU A 1 290 ? 30.102  -15.899 -34.204 1.00 47.36  ? 902  LEU A N     1 
ATOM   2092 C CA    . LEU A 1 290 ? 29.549  -14.563 -34.021 1.00 46.32  ? 902  LEU A CA    1 
ATOM   2093 C C     . LEU A 1 290 ? 30.189  -13.474 -34.937 1.00 53.16  ? 902  LEU A C     1 
ATOM   2094 O O     . LEU A 1 290 ? 29.812  -12.305 -34.847 1.00 53.20  ? 902  LEU A O     1 
ATOM   2095 C CB    . LEU A 1 290 ? 29.626  -14.172 -32.531 1.00 46.02  ? 902  LEU A CB    1 
ATOM   2096 C CG    . LEU A 1 290 ? 28.778  -15.021 -31.576 1.00 49.48  ? 902  LEU A CG    1 
ATOM   2097 C CD1   . LEU A 1 290 ? 29.401  -15.087 -30.203 1.00 50.15  ? 902  LEU A CD1   1 
ATOM   2098 C CD2   . LEU A 1 290 ? 27.339  -14.510 -31.499 1.00 50.83  ? 902  LEU A CD2   1 
ATOM   2099 N N     . LYS A 1 291 ? 31.130  -13.863 -35.824 1.00 50.93  ? 903  LYS A N     1 
ATOM   2100 C CA    . LYS A 1 291 ? 31.769  -12.958 -36.788 1.00 51.53  ? 903  LYS A CA    1 
ATOM   2101 C C     . LYS A 1 291 ? 30.875  -12.794 -38.024 1.00 55.76  ? 903  LYS A C     1 
ATOM   2102 O O     . LYS A 1 291 ? 30.851  -11.717 -38.612 1.00 55.77  ? 903  LYS A O     1 
ATOM   2103 C CB    . LYS A 1 291 ? 33.145  -13.485 -37.214 1.00 54.89  ? 903  LYS A CB    1 
ATOM   2104 C CG    . LYS A 1 291 ? 34.218  -13.338 -36.156 1.00 60.76  ? 903  LYS A CG    1 
ATOM   2105 C CD    . LYS A 1 291 ? 35.509  -13.975 -36.620 1.00 75.26  ? 903  LYS A CD    1 
ATOM   2106 C CE    . LYS A 1 291 ? 36.681  -13.532 -35.786 1.00 90.55  ? 903  LYS A CE    1 
ATOM   2107 N NZ    . LYS A 1 291 ? 37.959  -14.054 -36.326 1.00 104.82 ? 903  LYS A NZ    1 
ATOM   2108 N N     . VAL A 1 292 ? 30.158  -13.872 -38.426 1.00 52.42  ? 904  VAL A N     1 
ATOM   2109 C CA    . VAL A 1 292 ? 29.241  -13.881 -39.583 1.00 52.27  ? 904  VAL A CA    1 
ATOM   2110 C C     . VAL A 1 292 ? 28.077  -12.880 -39.357 1.00 52.51  ? 904  VAL A C     1 
ATOM   2111 O O     . VAL A 1 292 ? 27.262  -13.068 -38.448 1.00 49.82  ? 904  VAL A O     1 
ATOM   2112 C CB    . VAL A 1 292 ? 28.743  -15.315 -39.940 1.00 55.82  ? 904  VAL A CB    1 
ATOM   2113 C CG1   . VAL A 1 292 ? 27.994  -15.327 -41.269 1.00 55.59  ? 904  VAL A CG1   1 
ATOM   2114 C CG2   . VAL A 1 292 ? 29.905  -16.302 -39.980 1.00 57.07  ? 904  VAL A CG2   1 
ATOM   2115 N N     . ILE A 1 293 ? 28.049  -11.809 -40.177 1.00 48.65  ? 905  ILE A N     1 
ATOM   2116 C CA    . ILE A 1 293 ? 27.092  -10.704 -40.121 1.00 66.12  ? 905  ILE A CA    1 
ATOM   2117 C C     . ILE A 1 293 ? 26.234  -10.634 -41.400 1.00 99.65  ? 905  ILE A C     1 
ATOM   2118 O O     . ILE A 1 293 ? 26.725  -10.320 -42.483 1.00 64.80  ? 905  ILE A O     1 
ATOM   2119 C CB    . ILE A 1 293 ? 27.839  -9.371  -39.789 1.00 70.23  ? 905  ILE A CB    1 
ATOM   2120 C CG1   . ILE A 1 293 ? 28.419  -9.401  -38.360 1.00 69.89  ? 905  ILE A CG1   1 
ATOM   2121 C CG2   . ILE A 1 293 ? 26.946  -8.129  -39.986 1.00 71.83  ? 905  ILE A CG2   1 
ATOM   2122 C CD1   . ILE A 1 293 ? 29.658  -8.551  -38.158 1.00 77.94  ? 905  ILE A CD1   1 
HETATM 2123 C C1    . 6P8 B 2 .   ? 11.381  -2.435  -5.962  1.00 62.34  ? 1001 6P8 A C1    1 
HETATM 2124 C C2    . 6P8 B 2 .   ? 12.243  -1.630  -6.690  1.00 62.23  ? 1001 6P8 A C2    1 
HETATM 2125 C C3    . 6P8 B 2 .   ? 12.534  -1.942  -8.013  1.00 62.83  ? 1001 6P8 A C3    1 
HETATM 2126 C C7    . 6P8 B 2 .   ? 15.444  0.117   -9.241  1.00 62.64  ? 1001 6P8 A C7    1 
HETATM 2127 C C8    . 6P8 B 2 .   ? 14.853  1.174   -9.988  1.00 62.77  ? 1001 6P8 A C8    1 
HETATM 2128 C C9    . 6P8 B 2 .   ? 15.622  2.164   -10.528 1.00 63.47  ? 1001 6P8 A C9    1 
HETATM 2129 C C10   . 6P8 B 2 .   ? 17.001  2.208   -10.307 1.00 63.32  ? 1001 6P8 A C10   1 
HETATM 2130 C C11   . 6P8 B 2 .   ? 17.611  1.179   -9.622  1.00 62.04  ? 1001 6P8 A C11   1 
HETATM 2131 C C12   . 6P8 B 2 .   ? 16.849  0.134   -9.054  1.00 61.41  ? 1001 6P8 A C12   1 
HETATM 2132 C C13   . 6P8 B 2 .   ? 16.736  -1.792  -7.848  1.00 60.34  ? 1001 6P8 A C13   1 
HETATM 2133 C C14   . 6P8 B 2 .   ? 17.592  4.310   -11.559 1.00 65.52  ? 1001 6P8 A C14   1 
HETATM 2134 C C15   . 6P8 B 2 .   ? 18.801  4.996   -12.159 1.00 64.22  ? 1001 6P8 A C15   1 
HETATM 2135 C C16   . 6P8 B 2 .   ? 10.792  -3.537  -6.549  1.00 63.00  ? 1001 6P8 A C16   1 
HETATM 2136 O O1    . 6P8 B 2 .   ? 16.472  4.798   -11.672 1.00 67.29  ? 1001 6P8 A O1    1 
HETATM 2137 N N3    . 6P8 B 2 .   ? 17.873  3.162   -10.891 1.00 64.53  ? 1001 6P8 A N3    1 
HETATM 2138 N N1    . 6P8 B 2 .   ? 17.508  -0.835  -8.345  1.00 60.21  ? 1001 6P8 A N1    1 
HETATM 2139 N N2    . 6P8 B 2 .   ? 15.407  -1.927  -7.929  1.00 62.35  ? 1001 6P8 A N2    1 
HETATM 2140 C C6    . 6P8 B 2 .   ? 14.747  -0.988  -8.620  1.00 63.15  ? 1001 6P8 A C6    1 
HETATM 2141 N N4    . 6P8 B 2 .   ? 13.395  -1.107  -8.751  1.00 62.99  ? 1001 6P8 A N4    1 
HETATM 2142 C C4    . 6P8 B 2 .   ? 11.940  -3.053  -8.602  1.00 63.35  ? 1001 6P8 A C4    1 
HETATM 2143 C C5    . 6P8 B 2 .   ? 11.086  -3.855  -7.860  1.00 63.76  ? 1001 6P8 A C5    1 
HETATM 2144 C C1    . DIO C 3 .   ? 8.320   -10.543 -10.490 1.00 58.93  ? 1002 DIO A C1    1 
HETATM 2145 C C2    . DIO C 3 .   ? 10.661  -10.647 -10.400 1.00 58.65  ? 1002 DIO A C2    1 
HETATM 2146 C "C1'" . DIO C 3 .   ? 8.353   -11.212 -11.843 1.00 58.85  ? 1002 DIO A "C1'" 1 
HETATM 2147 C "C2'" . DIO C 3 .   ? 10.682  -11.327 -11.746 1.00 57.68  ? 1002 DIO A "C2'" 1 
HETATM 2148 O O1    . DIO C 3 .   ? 9.447   -10.917 -9.700  1.00 58.37  ? 1002 DIO A O1    1 
HETATM 2149 O "O1'" . DIO C 3 .   ? 9.565   -10.922 -12.533 1.00 57.15  ? 1002 DIO A "O1'" 1 
HETATM 2150 O O     . HOH D 4 .   ? 7.044   -23.181 -28.022 1.00 29.41  ? 1101 HOH A O     1 
HETATM 2151 O O     . HOH D 4 .   ? 26.748  -15.409 -36.414 1.00 37.31  ? 1102 HOH A O     1 
HETATM 2152 O O     . HOH D 4 .   ? 29.497  -7.680  -34.856 1.00 37.78  ? 1103 HOH A O     1 
HETATM 2153 O O     . HOH D 4 .   ? 3.766   -7.423  -31.375 1.00 24.07  ? 1104 HOH A O     1 
HETATM 2154 O O     . HOH D 4 .   ? 0.986   -17.967 -26.176 1.00 19.24  ? 1105 HOH A O     1 
HETATM 2155 O O     . HOH D 4 .   ? 1.331   -7.009  -20.330 1.00 39.89  ? 1106 HOH A O     1 
HETATM 2156 O O     . HOH D 4 .   ? 7.584   -17.558 -18.529 1.00 37.57  ? 1107 HOH A O     1 
HETATM 2157 O O     . HOH D 4 .   ? 5.520   -10.350 -14.041 1.00 56.87  ? 1108 HOH A O     1 
HETATM 2158 O O     . HOH D 4 .   ? 12.267  -2.868  -42.029 1.00 48.99  ? 1109 HOH A O     1 
HETATM 2159 O O     . HOH D 4 .   ? 8.534   -21.459 -26.288 1.00 22.27  ? 1110 HOH A O     1 
HETATM 2160 O O     . HOH D 4 .   ? 24.004  -2.268  -33.437 1.00 46.41  ? 1111 HOH A O     1 
HETATM 2161 O O     . HOH D 4 .   ? 23.565  -24.692 -21.639 1.00 39.60  ? 1112 HOH A O     1 
HETATM 2162 O O     . HOH D 4 .   ? 6.526   -7.560  -31.643 1.00 18.36  ? 1113 HOH A O     1 
HETATM 2163 O O     . HOH D 4 .   ? 1.337   -16.090 -33.221 1.00 30.16  ? 1114 HOH A O     1 
HETATM 2164 O O     . HOH D 4 .   ? 3.774   -13.340 -22.265 1.00 28.19  ? 1115 HOH A O     1 
HETATM 2165 O O     . HOH D 4 .   ? 34.718  -8.968  -24.614 1.00 47.16  ? 1116 HOH A O     1 
HETATM 2166 O O     . HOH D 4 .   ? 14.272  -0.134  -26.657 1.00 27.43  ? 1117 HOH A O     1 
HETATM 2167 O O     . HOH D 4 .   ? 4.088   -11.657 -25.105 1.00 33.22  ? 1118 HOH A O     1 
HETATM 2168 O O     . HOH D 4 .   ? -8.024  0.115   -25.344 1.00 54.49  ? 1119 HOH A O     1 
HETATM 2169 O O     . HOH D 4 .   ? 3.156   -13.896 -38.741 1.00 30.10  ? 1120 HOH A O     1 
HETATM 2170 O O     . HOH D 4 .   ? 30.715  3.752   -20.715 1.00 61.71  ? 1121 HOH A O     1 
HETATM 2171 O O     . HOH D 4 .   ? -2.186  1.543   -29.078 1.00 28.48  ? 1122 HOH A O     1 
HETATM 2172 O O     . HOH D 4 .   ? -0.587  7.997   -24.531 1.00 40.65  ? 1123 HOH A O     1 
HETATM 2173 O O     . HOH D 4 .   ? 10.145  -15.139 -37.332 1.00 31.52  ? 1124 HOH A O     1 
HETATM 2174 O O     . HOH D 4 .   ? 23.765  -8.805  -39.876 1.00 42.72  ? 1125 HOH A O     1 
HETATM 2175 O O     . HOH D 4 .   ? 9.116   11.635  -26.797 1.00 55.68  ? 1126 HOH A O     1 
HETATM 2176 O O     . HOH D 4 .   ? 21.236  -0.631  -34.516 1.00 43.35  ? 1127 HOH A O     1 
HETATM 2177 O O     . HOH D 4 .   ? 6.221   -26.684 -28.257 1.00 34.80  ? 1128 HOH A O     1 
HETATM 2178 O O     . HOH D 4 .   ? 36.135  -22.587 -29.248 1.00 37.95  ? 1129 HOH A O     1 
HETATM 2179 O O     . HOH D 4 .   ? 6.452   -10.890 -21.864 1.00 26.27  ? 1130 HOH A O     1 
HETATM 2180 O O     . HOH D 4 .   ? 5.894   5.338   -27.339 1.00 25.86  ? 1131 HOH A O     1 
HETATM 2181 O O     . HOH D 4 .   ? 5.650   -22.270 -18.035 1.00 46.94  ? 1132 HOH A O     1 
HETATM 2182 O O     . HOH D 4 .   ? 6.194   2.406   -3.558  1.00 54.64  ? 1133 HOH A O     1 
HETATM 2183 O O     . HOH D 4 .   ? 13.809  -9.993  -40.267 1.00 40.23  ? 1134 HOH A O     1 
HETATM 2184 O O     . HOH D 4 .   ? 25.979  -9.688  -18.109 1.00 51.86  ? 1135 HOH A O     1 
HETATM 2185 O O     . HOH D 4 .   ? -3.665  -7.848  -41.173 1.00 65.57  ? 1136 HOH A O     1 
HETATM 2186 O O     . HOH D 4 .   ? 10.503  -25.621 -28.419 1.00 38.33  ? 1137 HOH A O     1 
HETATM 2187 O O     . HOH D 4 .   ? -2.018  3.858   -22.303 1.00 43.49  ? 1138 HOH A O     1 
HETATM 2188 O O     . HOH D 4 .   ? -3.234  -20.996 -24.779 1.00 47.35  ? 1139 HOH A O     1 
HETATM 2189 O O     . HOH D 4 .   ? 8.937   4.506   -25.927 1.00 48.20  ? 1140 HOH A O     1 
HETATM 2190 O O     . HOH D 4 .   ? 4.966   0.421   -8.952  1.00 56.22  ? 1141 HOH A O     1 
HETATM 2191 O O     . HOH D 4 .   ? 18.921  -27.415 -26.609 1.00 51.29  ? 1142 HOH A O     1 
HETATM 2192 O O     . HOH D 4 .   ? 28.447  6.054   -26.865 1.00 53.31  ? 1143 HOH A O     1 
HETATM 2193 O O     . HOH D 4 .   ? 11.914  -1.650  -23.056 1.00 34.51  ? 1144 HOH A O     1 
HETATM 2194 O O     . HOH D 4 .   ? 5.639   4.932   -33.549 1.00 27.27  ? 1145 HOH A O     1 
HETATM 2195 O O     . HOH D 4 .   ? 9.715   -8.668  -35.533 1.00 25.20  ? 1146 HOH A O     1 
HETATM 2196 O O     . HOH D 4 .   ? 4.670   1.477   -28.347 1.00 31.49  ? 1147 HOH A O     1 
HETATM 2197 O O     . HOH D 4 .   ? 0.876   -0.896  -26.885 1.00 30.00  ? 1148 HOH A O     1 
HETATM 2198 O O     . HOH D 4 .   ? 12.745  -23.894 -20.809 1.00 33.24  ? 1149 HOH A O     1 
HETATM 2199 O O     . HOH D 4 .   ? 3.901   -9.219  -23.481 1.00 36.87  ? 1150 HOH A O     1 
HETATM 2200 O O     . HOH D 4 .   ? 29.350  -21.124 -22.861 1.00 36.88  ? 1151 HOH A O     1 
HETATM 2201 O O     . HOH D 4 .   ? 19.117  -25.076 -28.634 1.00 37.93  ? 1152 HOH A O     1 
HETATM 2202 O O     . HOH D 4 .   ? 6.826   2.220   -26.897 1.00 34.99  ? 1153 HOH A O     1 
HETATM 2203 O O     . HOH D 4 .   ? 17.999  -21.261 -15.331 1.00 45.55  ? 1154 HOH A O     1 
HETATM 2204 O O     . HOH D 4 .   ? 2.096   3.871   -22.380 1.00 33.46  ? 1155 HOH A O     1 
HETATM 2205 O O     . HOH D 4 .   ? -4.827  -14.714 -34.865 1.00 61.25  ? 1156 HOH A O     1 
HETATM 2206 O O     . HOH D 4 .   ? 28.067  -9.447  -19.859 1.00 49.73  ? 1157 HOH A O     1 
HETATM 2207 O O     . HOH D 4 .   ? 4.476   -3.575  -14.600 1.00 62.65  ? 1158 HOH A O     1 
HETATM 2208 O O     . HOH D 4 .   ? 29.152  0.211   -14.285 1.00 56.63  ? 1159 HOH A O     1 
HETATM 2209 O O     . HOH D 4 .   ? 23.181  -10.912 -17.479 1.00 57.36  ? 1160 HOH A O     1 
HETATM 2210 O O     . HOH D 4 .   ? 23.278  -17.477 -15.090 1.00 52.67  ? 1161 HOH A O     1 
HETATM 2211 O O     . HOH D 4 .   ? 21.692  -25.059 -29.565 1.00 41.20  ? 1162 HOH A O     1 
HETATM 2212 O O     . HOH D 4 .   ? 30.844  3.926   -30.126 1.00 61.35  ? 1163 HOH A O     1 
HETATM 2213 O O     . HOH D 4 .   ? 32.865  -12.870 -31.044 1.00 47.72  ? 1164 HOH A O     1 
HETATM 2214 O O     . HOH D 4 .   ? -2.704  3.383   -37.945 1.00 49.56  ? 1165 HOH A O     1 
HETATM 2215 O O     . HOH D 4 .   ? -5.391  -14.659 -19.995 1.00 48.45  ? 1166 HOH A O     1 
HETATM 2216 O O     . HOH D 4 .   ? -10.365 -12.415 -27.859 1.00 53.69  ? 1167 HOH A O     1 
HETATM 2217 O O     . HOH D 4 .   ? 23.403  -6.112  -40.069 1.00 59.21  ? 1168 HOH A O     1 
HETATM 2218 O O     . HOH D 4 .   ? 10.138  -21.726 -21.779 1.00 28.22  ? 1169 HOH A O     1 
HETATM 2219 O O     . HOH D 4 .   ? 6.174   -17.327 -39.057 1.00 51.37  ? 1170 HOH A O     1 
HETATM 2220 O O     . HOH D 4 .   ? 19.213  -24.953 -20.258 1.00 43.35  ? 1171 HOH A O     1 
HETATM 2221 O O     . HOH D 4 .   ? 24.880  -13.183 -15.076 1.00 51.14  ? 1172 HOH A O     1 
HETATM 2222 O O     . HOH D 4 .   ? 4.747   -22.464 -23.596 1.00 39.97  ? 1173 HOH A O     1 
HETATM 2223 O O     . HOH D 4 .   ? 8.146   -21.543 -23.615 1.00 42.96  ? 1174 HOH A O     1 
HETATM 2224 O O     . HOH D 4 .   ? 2.199   -22.448 -25.487 1.00 38.46  ? 1175 HOH A O     1 
HETATM 2225 O O     . HOH D 4 .   ? -1.713  -8.623  -19.500 1.00 63.54  ? 1176 HOH A O     1 
HETATM 2226 O O     . HOH D 4 .   ? 10.889  -15.184 -40.042 1.00 34.03  ? 1177 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . CYS A 20  ? 2.1279 1.6259 0.7385 0.5727  -0.5478 -0.4565 632 CYS A N   
2    C CA  . CYS A 20  ? 2.0362 1.5600 0.7242 0.5467  -0.5316 -0.4206 632 CYS A CA  
3    C C   . CYS A 20  ? 1.9694 1.5250 0.7832 0.5073  -0.5244 -0.4275 632 CYS A C   
4    O O   . CYS A 20  ? 1.8954 1.4754 0.7887 0.4896  -0.5513 -0.4292 632 CYS A O   
5    C CB  . CYS A 20  ? 2.0446 1.5566 0.6837 0.5514  -0.4760 -0.3724 632 CYS A CB  
6    S SG  . CYS A 20  ? 2.1770 1.6677 0.7208 0.5846  -0.4900 -0.3447 632 CYS A SG  
7    N N   . VAL A 21  ? 1.9094 1.4639 0.7402 0.4949  -0.4873 -0.4306 633 VAL A N   
8    C CA  . VAL A 21  ? 1.8110 1.3922 0.7527 0.4595  -0.4749 -0.4344 633 VAL A CA  
9    C C   . VAL A 21  ? 1.8836 1.4620 0.8491 0.4568  -0.4921 -0.4771 633 VAL A C   
10   O O   . VAL A 21  ? 1.9461 1.5004 0.8403 0.4771  -0.4828 -0.4933 633 VAL A O   
11   C CB  . VAL A 21  ? 1.7950 1.3842 0.7632 0.4402  -0.4152 -0.3958 633 VAL A CB  
12   C CG1 . VAL A 21  ? 1.7285 1.3386 0.7494 0.4225  -0.4087 -0.3622 633 VAL A CG1 
13   C CG2 . VAL A 21  ? 1.8563 1.4182 0.7282 0.4624  -0.3740 -0.3777 633 VAL A CG2 
14   N N   . LYS A 22  ? 1.7844 1.3872 0.8532 0.4314  -0.5146 -0.4942 634 LYS A N   
15   C CA  . LYS A 22  ? 1.7813 1.3855 0.8966 0.4230  -0.5317 -0.5331 634 LYS A CA  
16   C C   . LYS A 22  ? 1.7364 1.3686 0.9680 0.3864  -0.5139 -0.5227 634 LYS A C   
17   O O   . LYS A 22  ? 1.6717 1.3263 0.9697 0.3693  -0.5264 -0.5100 634 LYS A O   
18   C CB  . LYS A 22  ? 1.8627 1.4639 0.9793 0.4364  -0.5945 -0.5743 634 LYS A CB  
19   N N   . ILE A 23  ? 1.6779 1.3077 0.9311 0.3757  -0.4831 -0.5267 635 ILE A N   
20   C CA  . ILE A 23  ? 1.5847 1.2372 0.9398 0.3434  -0.4633 -0.5169 635 ILE A CA  
21   C C   . ILE A 23  ? 1.6371 1.3005 1.0719 0.3312  -0.5037 -0.5520 635 ILE A C   
22   O O   . ILE A 23  ? 1.6909 1.3387 1.1031 0.3456  -0.5316 -0.5901 635 ILE A O   
23   C CB  . ILE A 23  ? 1.6035 1.2488 0.9495 0.3384  -0.4148 -0.5056 635 ILE A CB  
24   C CG1 . ILE A 23  ? 1.6055 1.2461 0.8960 0.3445  -0.3722 -0.4654 635 ILE A CG1 
25   C CG2 . ILE A 23  ? 1.5234 1.1888 0.9714 0.3083  -0.4004 -0.5024 635 ILE A CG2 
26   C CD1 . ILE A 23  ? 1.7401 1.3556 0.9491 0.3655  -0.3426 -0.4676 635 ILE A CD1 
27   N N   . GLU A 24  ? 1.5298 1.2191 1.0580 0.3053  -0.5060 -0.5388 636 GLU A N   
28   C CA  . GLU A 24  ? 1.5050 1.2078 1.1229 0.2902  -0.5391 -0.5653 636 GLU A CA  
29   C C   . GLU A 24  ? 1.5050 1.2150 1.1955 0.2675  -0.5140 -0.5654 636 GLU A C   
30   O O   . GLU A 24  ? 1.5144 1.2162 1.2299 0.2681  -0.5313 -0.5986 636 GLU A O   
31   C CB  . GLU A 24  ? 1.4780 1.2039 1.1522 0.2779  -0.5574 -0.5501 636 GLU A CB  
32   C CG  . GLU A 24  ? 1.5972 1.3319 1.3364 0.2745  -0.6063 -0.5836 636 GLU A CG  
33   C CD  . GLU A 24  ? 1.7158 1.4743 1.5153 0.2626  -0.6219 -0.5683 636 GLU A CD  
34   O OE1 . GLU A 24  ? 1.4047 1.1815 1.2618 0.2403  -0.5925 -0.5391 636 GLU A OE1 
35   O OE2 . GLU A 24  ? 1.6591 1.4178 1.4499 0.2762  -0.6647 -0.5870 636 GLU A OE2 
36   N N   . GLU A 25  ? 1.4031 1.1276 1.1273 0.2484  -0.4744 -0.5289 637 GLU A N   
37   C CA  . GLU A 25  ? 1.3487 1.0810 1.1409 0.2272  -0.4491 -0.5237 637 GLU A CA  
38   C C   . GLU A 25  ? 1.3615 1.0992 1.1432 0.2181  -0.4009 -0.4853 637 GLU A C   
39   O O   . GLU A 25  ? 1.3321 1.0805 1.1042 0.2146  -0.3890 -0.4562 637 GLU A O   
40   C CB  . GLU A 25  ? 1.3115 1.0647 1.2071 0.2049  -0.4666 -0.5265 637 GLU A CB  
41   N N   . VAL A 26  ? 1.3098 1.0407 1.0991 0.2138  -0.3744 -0.4862 638 VAL A N   
42   C CA  . VAL A 26  ? 1.2672 1.0038 1.0563 0.2043  -0.3303 -0.4532 638 VAL A CA  
43   C C   . VAL A 26  ? 1.2490 1.0087 1.1236 0.1787  -0.3236 -0.4329 638 VAL A C   
44   O O   . VAL A 26  ? 1.2254 0.9899 1.1663 0.1662  -0.3330 -0.4464 638 VAL A O   
45   C CB  . VAL A 26  ? 1.3348 1.0567 1.1060 0.2097  -0.3060 -0.4623 638 VAL A CB  
46   C CG1 . VAL A 26  ? 1.2851 1.0161 1.0691 0.1982  -0.2633 -0.4285 638 VAL A CG1 
47   C CG2 . VAL A 26  ? 1.4123 1.1103 1.0920 0.2370  -0.3094 -0.4807 638 VAL A CG2 
48   N N   . ILE A 27  ? 1.1746 0.9476 1.0469 0.1720  -0.3084 -0.4014 639 ILE A N   
49   C CA  . ILE A 27  ? 1.1053 0.8995 1.0486 0.1499  -0.3009 -0.3802 639 ILE A CA  
50   C C   . ILE A 27  ? 1.1195 0.9196 1.0820 0.1377  -0.2632 -0.3553 639 ILE A C   
51   O O   . ILE A 27  ? 1.0677 0.8819 1.0926 0.1200  -0.2564 -0.3428 639 ILE A O   
52   C CB  . ILE A 27  ? 1.1301 0.9364 1.0699 0.1490  -0.3116 -0.3639 639 ILE A CB  
53   C CG1 . ILE A 27  ? 1.1596 0.9577 1.0219 0.1637  -0.2966 -0.3460 639 ILE A CG1 
54   C CG2 . ILE A 27  ? 1.1616 0.9696 1.1225 0.1533  -0.3532 -0.3891 639 ILE A CG2 
55   C CD1 . ILE A 27  ? 1.2108 1.0213 1.0740 0.1604  -0.2978 -0.3230 639 ILE A CD1 
56   N N   . GLY A 28  ? 1.1018 0.8908 1.0120 0.1479  -0.2394 -0.3485 640 GLY A N   
57   C CA  . GLY A 28  ? 1.0678 0.8620 0.9944 0.1384  -0.2055 -0.3269 640 GLY A CA  
58   C C   . GLY A 28  ? 1.1595 0.9410 1.0265 0.1519  -0.1801 -0.3208 640 GLY A C   
59   O O   . GLY A 28  ? 1.2182 0.9831 1.0273 0.1704  -0.1874 -0.3373 640 GLY A O   
60   N N   . ALA A 29  ? 1.0858 0.8749 0.9676 0.1434  -0.1500 -0.2973 641 ALA A N   
61   C CA  . ALA A 29  ? 1.1073 0.8871 0.9450 0.1539  -0.1211 -0.2882 641 ALA A CA  
62   C C   . ALA A 29  ? 1.1226 0.9120 0.9510 0.1493  -0.0993 -0.2571 641 ALA A C   
63   O O   . ALA A 29  ? 1.0544 0.8600 0.9253 0.1339  -0.0997 -0.2408 641 ALA A O   
64   C CB  . ALA A 29  ? 1.1054 0.8835 0.9741 0.1497  -0.1042 -0.2931 641 ALA A CB  
65   N N   . GLY A 30  ? 1.1224 0.9005 0.8952 0.1634  -0.0800 -0.2498 642 GLY A N   
66   C CA  . GLY A 30  ? 1.1061 0.8895 0.8664 0.1616  -0.0558 -0.2217 642 GLY A CA  
67   C C   . GLY A 30  ? 1.1634 0.9443 0.9249 0.1632  -0.0224 -0.2127 642 GLY A C   
68   O O   . GLY A 30  ? 1.1786 0.9521 0.9433 0.1680  -0.0181 -0.2292 642 GLY A O   
69   N N   . GLU A 31  ? 1.0981 0.8857 0.8623 0.1590  0.0015  -0.1874 643 GLU A N   
70   C CA  . GLU A 31  ? 1.0926 0.8803 0.8667 0.1595  0.0339  -0.1776 643 GLU A CA  
71   C C   . GLU A 31  ? 1.1952 0.9627 0.9095 0.1804  0.0539  -0.1833 643 GLU A C   
72   O O   . GLU A 31  ? 1.1945 0.9604 0.9187 0.1829  0.0794  -0.1814 643 GLU A O   
73   C CB  . GLU A 31  ? 1.0697 0.8718 0.8745 0.1474  0.0518  -0.1506 643 GLU A CB  
74   C CG  . GLU A 31  ? 1.2350 1.0330 1.0045 0.1524  0.0569  -0.1336 643 GLU A CG  
75   C CD  . GLU A 31  ? 1.4517 1.2607 1.2503 0.1426  0.0788  -0.1091 643 GLU A CD  
76   O OE1 . GLU A 31  ? 1.2564 1.0624 1.0558 0.1467  0.1075  -0.1010 643 GLU A OE1 
77   O OE2 . GLU A 31  ? 1.3736 1.1937 1.1950 0.1314  0.0675  -0.0987 643 GLU A OE2 
78   N N   . PHE A 32  ? 1.1980 0.9500 0.8505 0.1962  0.0423  -0.1905 644 PHE A N   
79   C CA  . PHE A 32  ? 1.2649 0.9950 0.8501 0.2188  0.0599  -0.1961 644 PHE A CA  
80   C C   . PHE A 32  ? 1.3541 1.0680 0.9003 0.2336  0.0360  -0.2279 644 PHE A C   
81   O O   . PHE A 32  ? 1.4082 1.1018 0.8925 0.2544  0.0480  -0.2362 644 PHE A O   
82   C CB  . PHE A 32  ? 1.3185 1.0397 0.8533 0.2293  0.0725  -0.1746 644 PHE A CB  
83   C CG  . PHE A 32  ? 1.2949 1.0291 0.8660 0.2167  0.0985  -0.1448 644 PHE A CG  
84   C CD1 . PHE A 32  ? 1.3344 1.0679 0.9173 0.2179  0.1359  -0.1329 644 PHE A CD1 
85   C CD2 . PHE A 32  ? 1.2818 1.0287 0.8779 0.2039  0.0854  -0.1296 644 PHE A CD2 
86   C CE1 . PHE A 32  ? 1.3099 1.0558 0.9317 0.2059  0.1578  -0.1073 644 PHE A CE1 
87   C CE2 . PHE A 32  ? 1.2821 1.0400 0.9130 0.1925  0.1077  -0.1045 644 PHE A CE2 
88   C CZ  . PHE A 32  ? 1.2615 1.0191 0.9065 0.1932  0.1427  -0.0940 644 PHE A CZ  
89   N N   . GLY A 33  ? 1.2811 1.0035 0.8646 0.2231  0.0032  -0.2455 645 GLY A N   
90   C CA  . GLY A 33  ? 1.3198 1.0290 0.8795 0.2343  -0.0243 -0.2781 645 GLY A CA  
91   C C   . GLY A 33  ? 1.3340 1.0548 0.9375 0.2212  -0.0623 -0.2908 645 GLY A C   
92   O O   . GLY A 33  ? 1.2695 1.0086 0.9400 0.2009  -0.0635 -0.2818 645 GLY A O   
93   N N   . GLU A 34  ? 1.3269 1.0367 0.8928 0.2336  -0.0934 -0.3116 646 GLU A N   
94   C CA  . GLU A 34  ? 1.2975 1.0169 0.9045 0.2234  -0.1314 -0.3270 646 GLU A CA  
95   C C   . GLU A 34  ? 1.3252 1.0519 0.9213 0.2225  -0.1494 -0.3135 646 GLU A C   
96   O O   . GLU A 34  ? 1.3549 1.0726 0.8935 0.2359  -0.1393 -0.2992 646 GLU A O   
97   C CB  . GLU A 34  ? 1.3702 1.0737 0.9565 0.2367  -0.1588 -0.3650 646 GLU A CB  
98   C CG  . GLU A 34  ? 1.5506 1.2450 1.1478 0.2390  -0.1429 -0.3813 646 GLU A CG  
99   C CD  . GLU A 34  ? 1.9736 1.6458 1.5254 0.2591  -0.1617 -0.4181 646 GLU A CD  
100  O OE1 . GLU A 34  ? 2.0215 1.6784 1.4997 0.2797  -0.1725 -0.4256 646 GLU A OE1 
101  O OE2 . GLU A 34  ? 1.9306 1.5993 1.5180 0.2554  -0.1647 -0.4394 646 GLU A OE2 
102  N N   . VAL A 35  ? 1.2217 0.9643 0.8760 0.2068  -0.1742 -0.3171 647 VAL A N   
103  C CA  . VAL A 35  ? 1.1957 0.9476 0.8542 0.2040  -0.1951 -0.3079 647 VAL A CA  
104  C C   . VAL A 35  ? 1.2426 0.9942 0.9227 0.2053  -0.2359 -0.3382 647 VAL A C   
105  O O   . VAL A 35  ? 1.2004 0.9592 0.9396 0.1923  -0.2433 -0.3514 647 VAL A O   
106  C CB  . VAL A 35  ? 1.1715 0.9452 0.8882 0.1822  -0.1822 -0.2807 647 VAL A CB  
107  C CG1 . VAL A 35  ? 1.1627 0.9437 0.8748 0.1825  -0.1994 -0.2696 647 VAL A CG1 
108  C CG2 . VAL A 35  ? 1.1483 0.9238 0.8600 0.1781  -0.1428 -0.2555 647 VAL A CG2 
109  N N   . CYS A 36  ? 1.2489 0.9913 0.8820 0.2219  -0.2628 -0.3496 648 CYS A N   
110  C CA  . CYS A 36  ? 1.2679 1.0088 0.9181 0.2259  -0.3050 -0.3814 648 CYS A CA  
111  C C   . CYS A 36  ? 1.3102 1.0564 0.9514 0.2316  -0.3349 -0.3799 648 CYS A C   
112  O O   . CYS A 36  ? 1.3258 1.0684 0.9192 0.2411  -0.3256 -0.3588 648 CYS A O   
113  C CB  . CYS A 36  ? 1.3440 1.0622 0.9419 0.2459  -0.3154 -0.4124 648 CYS A CB  
114  S SG  . CYS A 36  ? 1.4633 1.1576 0.9524 0.2719  -0.2867 -0.4005 648 CYS A SG  
115  N N   . ARG A 37  ? 1.2355 0.9903 0.9271 0.2259  -0.3708 -0.4024 649 ARG A N   
116  C CA  . ARG A 37  ? 1.2298 0.9912 0.9252 0.2311  -0.4049 -0.4066 649 ARG A CA  
117  C C   . ARG A 37  ? 1.3519 1.0924 0.9762 0.2581  -0.4358 -0.4348 649 ARG A C   
118  O O   . ARG A 37  ? 1.3827 1.1103 0.9967 0.2649  -0.4450 -0.4632 649 ARG A O   
119  C CB  . ARG A 37  ? 1.1707 0.9516 0.9621 0.2116  -0.4270 -0.4188 649 ARG A CB  
120  C CG  . ARG A 37  ? 1.3039 1.0960 1.1166 0.2139  -0.4610 -0.4222 649 ARG A CG  
121  C CD  . ARG A 37  ? 1.4039 1.2120 1.3108 0.1973  -0.4840 -0.4405 649 ARG A CD  
122  N NE  . ARG A 37  ? 1.5629 1.3826 1.4952 0.2001  -0.5173 -0.4451 649 ARG A NE  
123  C CZ  . ARG A 37  ? 1.7489 1.5845 1.7660 0.1873  -0.5401 -0.4592 649 ARG A CZ  
124  N NH1 . ARG A 37  ? 1.5551 1.3956 1.6387 0.1706  -0.5327 -0.4691 649 ARG A NH1 
125  N NH2 . ARG A 37  ? 1.6017 1.4483 1.6405 0.1913  -0.5696 -0.4627 649 ARG A NH2 
126  N N   . GLY A 38  ? 1.3275 1.0634 0.9017 0.2740  -0.4516 -0.4269 650 GLY A N   
127  C CA  . GLY A 38  ? 1.4009 1.1163 0.8994 0.3023  -0.4828 -0.4508 650 GLY A CA  
128  C C   . GLY A 38  ? 1.4551 1.1740 0.9363 0.3137  -0.5140 -0.4462 650 GLY A C   
129  O O   . GLY A 38  ? 1.3964 1.1366 0.9402 0.2977  -0.5176 -0.4308 650 GLY A O   
130  N N   . ARG A 39  ? 1.4842 1.1818 0.8792 0.3429  -0.5369 -0.4599 651 ARG A N   
131  C CA  . ARG A 39  ? 1.5110 1.2081 0.8772 0.3590  -0.5702 -0.4571 651 ARG A CA  
132  C C   . ARG A 39  ? 1.6152 1.2881 0.8700 0.3859  -0.5536 -0.4365 651 ARG A C   
133  O O   . ARG A 39  ? 1.6631 1.3137 0.8482 0.4014  -0.5367 -0.4434 651 ARG A O   
135  N N   . LEU A 40  ? 1.5680 1.2443 0.8070 0.3920  -0.5575 -0.4109 652 LEU A N   
136  C CA  . LEU A 40  ? 1.6325 1.2857 0.7701 0.4177  -0.5424 -0.3874 652 LEU A CA  
137  C C   . LEU A 40  ? 1.7586 1.4051 0.8559 0.4417  -0.5897 -0.3957 652 LEU A C   
138  O O   . LEU A 40  ? 1.7155 1.3824 0.8755 0.4315  -0.6144 -0.3932 652 LEU A O   
139  C CB  . LEU A 40  ? 1.5780 1.2381 0.7281 0.4036  -0.4937 -0.3419 652 LEU A CB  
140  C CG  . LEU A 40  ? 1.6887 1.3287 0.7531 0.4263  -0.4768 -0.3102 652 LEU A CG  
141  C CD1 . LEU A 40  ? 1.7905 1.4010 0.7591 0.4479  -0.4484 -0.3078 652 LEU A CD1 
142  C CD2 . LEU A 40  ? 1.6209 1.2748 0.7283 0.4074  -0.4422 -0.2707 652 LEU A CD2 
143  N N   . LYS A 41  ? 1.8219 1.4392 0.8129 0.4748  -0.6017 -0.4054 653 LYS A N   
144  C CA  . LYS A 41  ? 1.8995 1.5052 0.8335 0.5032  -0.6470 -0.4134 653 LYS A CA  
145  C C   . LYS A 41  ? 2.0065 1.5907 0.8498 0.5249  -0.6198 -0.3741 653 LYS A C   
146  O O   . LYS A 41  ? 2.0767 1.6316 0.8194 0.5502  -0.6044 -0.3723 653 LYS A O   
147  C CB  . LYS A 41  ? 2.0188 1.6064 0.8998 0.5270  -0.6894 -0.4591 653 LYS A CB  
148  N N   . GLN A 42  ? 1.9218 1.5201 0.8036 0.5145  -0.6111 -0.3416 654 GLN A N   
149  C CA  . GLN A 42  ? 1.9611 1.5413 0.7729 0.5321  -0.5859 -0.3012 654 GLN A CA  
150  C C   . GLN A 42  ? 2.1207 1.6792 0.8451 0.5699  -0.6306 -0.3102 654 GLN A C   
151  O O   . GLN A 42  ? 2.1240 1.6941 0.8811 0.5735  -0.6853 -0.3396 654 GLN A O   
152  C CB  . GLN A 42  ? 1.8961 1.4992 0.7852 0.5086  -0.5686 -0.2689 654 GLN A CB  
153  N N   . PRO A 43  ? 2.1661 1.6927 0.7797 0.5993  -0.6096 -0.2861 655 PRO A N   
154  C CA  . PRO A 43  ? 2.2684 1.7725 0.7925 0.6377  -0.6535 -0.2940 655 PRO A CA  
155  C C   . PRO A 43  ? 2.2933 1.8103 0.8535 0.6387  -0.6814 -0.2756 655 PRO A C   
156  O O   . PRO A 43  ? 2.2675 1.7794 0.8171 0.6386  -0.6488 -0.2333 655 PRO A O   
157  C CB  . PRO A 43  ? 2.3755 1.8421 0.7770 0.6657  -0.6123 -0.2678 655 PRO A CB  
158  C CG  . PRO A 43  ? 2.3682 1.8393 0.8013 0.6409  -0.5503 -0.2534 655 PRO A CG  
159  C CD  . PRO A 43  ? 2.1907 1.6996 0.7560 0.6001  -0.5454 -0.2502 655 PRO A CD  
160  N N   . GLY A 44  ? 2.2414 1.7764 0.8528 0.6381  -0.7405 -0.3084 656 GLY A N   
161  C CA  . GLY A 44  ? 2.2233 1.7740 0.8808 0.6388  -0.7743 -0.2980 656 GLY A CA  
162  C C   . GLY A 44  ? 2.1617 1.7526 0.9598 0.6014  -0.7827 -0.3075 656 GLY A C   
163  O O   . GLY A 44  ? 2.1426 1.7507 0.9922 0.6027  -0.8305 -0.3223 656 GLY A O   
164  N N   . ARG A 45  ? 2.0402 1.6462 0.9014 0.5688  -0.7359 -0.2982 657 ARG A N   
165  C CA  . ARG A 45  ? 1.9330 1.5753 0.9238 0.5322  -0.7347 -0.3035 657 ARG A CA  
166  C C   . ARG A 45  ? 1.9643 1.6226 1.0169 0.5165  -0.7588 -0.3475 657 ARG A C   
167  O O   . ARG A 45  ? 2.0119 1.6527 1.0095 0.5283  -0.7620 -0.3709 657 ARG A O   
168  C CB  . ARG A 45  ? 1.8531 1.5032 0.8802 0.5063  -0.6725 -0.2669 657 ARG A CB  
169  N N   . ARG A 46  ? 1.8426 1.5332 1.0111 0.4902  -0.7742 -0.3579 658 ARG A N   
170  C CA  . ARG A 46  ? 1.7982 1.5078 1.0470 0.4712  -0.7958 -0.3958 658 ARG A CA  
171  C C   . ARG A 46  ? 1.7848 1.4928 1.0442 0.4512  -0.7515 -0.3970 658 ARG A C   
172  O O   . ARG A 46  ? 1.7460 1.4500 0.9898 0.4414  -0.7004 -0.3642 658 ARG A O   
173  C CB  . ARG A 46  ? 1.7317 1.4757 1.1027 0.4465  -0.8098 -0.3959 658 ARG A CB  
174  C CG  . ARG A 46  ? 1.9267 1.6815 1.3336 0.4586  -0.8745 -0.4270 658 ARG A CG  
175  C CD  . ARG A 46  ? 1.9965 1.7864 1.5335 0.4311  -0.8812 -0.4284 658 ARG A CD  
176  N NE  . ARG A 46  ? 2.1108 1.9138 1.6975 0.4397  -0.9429 -0.4621 658 ARG A NE  
177  C CZ  . ARG A 46  ? 2.3045 2.1159 1.9064 0.4525  -0.9756 -0.4564 658 ARG A CZ  
178  N NH1 . ARG A 46  ? 2.1884 1.9952 1.7577 0.4585  -0.9520 -0.4178 658 ARG A NH1 
179  N NH2 . ARG A 46  ? 2.1493 1.9737 1.8025 0.4595  -1.0328 -0.4899 658 ARG A NH2 
180  N N   . GLU A 47  ? 1.7281 1.4397 1.0192 0.4450  -0.7721 -0.4353 659 GLU A N   
181  C CA  . GLU A 47  ? 1.6824 1.3930 0.9905 0.4267  -0.7353 -0.4405 659 GLU A CA  
182  C C   . GLU A 47  ? 1.6067 1.3462 1.0250 0.3901  -0.7072 -0.4253 659 GLU A C   
183  O O   . GLU A 47  ? 1.5580 1.3210 1.0645 0.3761  -0.7329 -0.4364 659 GLU A O   
184  C CB  . GLU A 47  ? 1.7428 1.4453 1.0470 0.4339  -0.7682 -0.4871 659 GLU A CB  
185  C CG  . GLU A 47  ? 1.8538 1.5473 1.1490 0.4231  -0.7299 -0.4920 659 GLU A CG  
186  C CD  . GLU A 47  ? 2.1521 1.8445 1.4793 0.4208  -0.7592 -0.5381 659 GLU A CD  
187  O OE1 . GLU A 47  ? 2.0641 1.7791 1.4904 0.4027  -0.7857 -0.5570 659 GLU A OE1 
188  O OE2 . GLU A 47  ? 2.1336 1.8024 1.3901 0.4366  -0.7530 -0.5548 659 GLU A OE2 
189  N N   . VAL A 48  ? 1.5101 1.2473 0.9220 0.3760  -0.6540 -0.3996 660 VAL A N   
190  C CA  . VAL A 48  ? 1.4063 1.1673 0.9080 0.3434  -0.6217 -0.3820 660 VAL A CA  
191  C C   . VAL A 48  ? 1.4155 1.1746 0.9338 0.3280  -0.5918 -0.3901 660 VAL A C   
192  O O   . VAL A 48  ? 1.4568 1.1940 0.9047 0.3429  -0.5829 -0.3992 660 VAL A O   
193  C CB  . VAL A 48  ? 1.4186 1.1831 0.9123 0.3381  -0.5863 -0.3389 660 VAL A CB  
194  C CG1 . VAL A 48  ? 1.4205 1.1954 0.9353 0.3449  -0.6156 -0.3314 660 VAL A CG1 
195  C CG2 . VAL A 48  ? 1.4620 1.2002 0.8563 0.3556  -0.5538 -0.3171 660 VAL A CG2 
196  N N   . PHE A 49  ? 1.2871 1.0685 0.8973 0.2993  -0.5753 -0.3857 661 PHE A N   
197  C CA  . PHE A 49  ? 1.2444 1.0259 0.8787 0.2830  -0.5453 -0.3893 661 PHE A CA  
198  C C   . PHE A 49  ? 1.2508 1.0274 0.8522 0.2778  -0.4950 -0.3537 661 PHE A C   
199  O O   . PHE A 49  ? 1.2164 1.0034 0.8349 0.2703  -0.4799 -0.3259 661 PHE A O   
200  C CB  . PHE A 49  ? 1.1998 1.0055 0.9438 0.2563  -0.5497 -0.3988 661 PHE A CB  
201  C CG  . PHE A 49  ? 1.2489 1.0562 1.0301 0.2593  -0.5934 -0.4390 661 PHE A CG  
202  C CD1 . PHE A 49  ? 1.3064 1.1028 1.0855 0.2591  -0.5944 -0.4645 661 PHE A CD1 
203  C CD2 . PHE A 49  ? 1.2872 1.1066 1.1082 0.2629  -0.6346 -0.4523 661 PHE A CD2 
204  C CE1 . PHE A 49  ? 1.3449 1.1418 1.1617 0.2618  -0.6361 -0.5034 661 PHE A CE1 
205  C CE2 . PHE A 49  ? 1.3465 1.1678 1.2074 0.2655  -0.6767 -0.4911 661 PHE A CE2 
206  C CZ  . PHE A 49  ? 1.3401 1.1498 1.1988 0.2647  -0.6774 -0.5167 661 PHE A CZ  
207  N N   . VAL A 50  ? 1.2151 0.9751 0.7682 0.2833  -0.4700 -0.3552 662 VAL A N   
208  C CA  . VAL A 50  ? 1.1852 0.9393 0.7069 0.2796  -0.4220 -0.3239 662 VAL A CA  
209  C C   . VAL A 50  ? 1.1894 0.9462 0.7432 0.2633  -0.3928 -0.3269 662 VAL A C   
210  O O   . VAL A 50  ? 1.1868 0.9433 0.7665 0.2604  -0.4090 -0.3551 662 VAL A O   
211  C CB  . VAL A 50  ? 1.3025 1.0306 0.7193 0.3070  -0.4124 -0.3133 662 VAL A CB  
212  C CG1 . VAL A 50  ? 1.3245 1.0508 0.7132 0.3205  -0.4311 -0.2984 662 VAL A CG1 
213  C CG2 . VAL A 50  ? 1.3723 1.0789 0.7288 0.3279  -0.4296 -0.3440 662 VAL A CG2 
214  N N   . ALA A 51  ? 1.1042 0.8636 0.6588 0.2530  -0.3506 -0.2977 663 ALA A N   
215  C CA  . ALA A 51  ? 1.0677 0.8291 0.6460 0.2394  -0.3183 -0.2942 663 ALA A CA  
216  C C   . ALA A 51  ? 1.1754 0.9146 0.6737 0.2573  -0.2919 -0.2863 663 ALA A C   
217  O O   . ALA A 51  ? 1.1842 0.9155 0.6367 0.2672  -0.2763 -0.2627 663 ALA A O   
218  C CB  . ALA A 51  ? 1.0015 0.7822 0.6380 0.2164  -0.2921 -0.2670 663 ALA A CB  
219  N N   . ILE A 52  ? 1.1785 0.9063 0.6601 0.2628  -0.2871 -0.3067 664 ILE A N   
220  C CA  . ILE A 52  ? 1.2410 0.9466 0.6479 0.2814  -0.2621 -0.3040 664 ILE A CA  
221  C C   . ILE A 52  ? 1.2763 0.9855 0.7123 0.2681  -0.2241 -0.2959 664 ILE A C   
222  O O   . ILE A 52  ? 1.2469 0.9639 0.7346 0.2555  -0.2300 -0.3137 664 ILE A O   
223  C CB  . ILE A 52  ? 1.3562 1.0414 0.7060 0.3049  -0.2917 -0.3385 664 ILE A CB  
224  C CG1 . ILE A 52  ? 1.3998 1.0822 0.7225 0.3191  -0.3333 -0.3473 664 ILE A CG1 
225  C CG2 . ILE A 52  ? 1.4272 1.0875 0.6948 0.3262  -0.2637 -0.3369 664 ILE A CG2 
226  C CD1 . ILE A 52  ? 1.5421 1.2163 0.8554 0.3314  -0.3776 -0.3891 664 ILE A CD1 
227  N N   . LYS A 53  ? 1.2476 0.9507 0.6520 0.2716  -0.1857 -0.2691 665 LYS A N   
228  C CA  . LYS A 53  ? 1.2217 0.9271 0.6475 0.2621  -0.1476 -0.2591 665 LYS A CA  
229  C C   . LYS A 53  ? 1.3442 1.0252 0.6979 0.2849  -0.1302 -0.2686 665 LYS A C   
230  O O   . LYS A 53  ? 1.3965 1.0603 0.6787 0.3053  -0.1250 -0.2597 665 LYS A O   
231  C CB  . LYS A 53  ? 1.2127 0.9286 0.6588 0.2503  -0.1165 -0.2232 665 LYS A CB  
232  C CG  . LYS A 53  ? 1.3097 1.0498 0.8412 0.2232  -0.1112 -0.2150 665 LYS A CG  
233  C CD  . LYS A 53  ? 1.3944 1.1447 0.9447 0.2126  -0.0881 -0.1825 665 LYS A CD  
234  C CE  . LYS A 53  ? 1.5156 1.2630 1.0637 0.2112  -0.0474 -0.1651 665 LYS A CE  
235  N NZ  . LYS A 53  ? 1.5673 1.3227 1.1315 0.2026  -0.0284 -0.1357 665 LYS A NZ  
236  N N   . THR A 54  ? 1.3059 0.9843 0.6767 0.2826  -0.1205 -0.2862 666 THR A N   
237  C CA  . THR A 54  ? 1.3768 1.0319 0.6821 0.3044  -0.1021 -0.2977 666 THR A CA  
238  C C   . THR A 54  ? 1.4131 1.0704 0.7372 0.2980  -0.0564 -0.2811 666 THR A C   
239  O O   . THR A 54  ? 1.3432 1.0192 0.7408 0.2763  -0.0490 -0.2762 666 THR A O   
240  C CB  . THR A 54  ? 1.4892 1.1339 0.7854 0.3136  -0.1323 -0.3384 666 THR A CB  
241  O OG1 . THR A 54  ? 1.3928 1.0552 0.7741 0.2909  -0.1416 -0.3497 666 THR A OG1 
242  C CG2 . THR A 54  ? 1.5173 1.1533 0.7728 0.3283  -0.1760 -0.3572 666 THR A CG2 
243  N N   . LEU A 55  ? 1.4309 1.0687 0.6890 0.3180  -0.0257 -0.2725 667 LEU A N   
244  C CA  . LEU A 55  ? 1.4157 1.0542 0.6893 0.3147  0.0194  -0.2576 667 LEU A CA  
245  C C   . LEU A 55  ? 1.5089 1.1378 0.7812 0.3217  0.0224  -0.2865 667 LEU A C   
246  O O   . LEU A 55  ? 1.5721 1.1792 0.7786 0.3443  0.0116  -0.3095 667 LEU A O   
247  C CB  . LEU A 55  ? 1.4620 1.0850 0.6729 0.3317  0.0557  -0.2309 667 LEU A CB  
248  C CG  . LEU A 55  ? 1.4968 1.1238 0.7341 0.3262  0.1053  -0.2093 667 LEU A CG  
249  C CD1 . LEU A 55  ? 1.4098 1.0639 0.7327 0.2981  0.1117  -0.1876 667 LEU A CD1 
250  C CD2 . LEU A 55  ? 1.5846 1.1919 0.7532 0.3465  0.1400  -0.1863 667 LEU A CD2 
251  N N   . LYS A 56  ? 1.4193 1.0643 0.7648 0.3029  0.0358  -0.2857 668 LYS A N   
252  C CA  . LYS A 56  ? 1.4286 1.0682 0.7916 0.3052  0.0409  -0.3103 668 LYS A CA  
253  C C   . LYS A 56  ? 1.5712 1.1862 0.8632 0.3310  0.0695  -0.3178 668 LYS A C   
254  O O   . LYS A 56  ? 1.5893 1.1975 0.8427 0.3408  0.1023  -0.2934 668 LYS A O   
255  C CB  . LYS A 56  ? 1.3790 1.0401 0.8285 0.2822  0.0589  -0.2975 668 LYS A CB  
256  N N   . VAL A 57  ? 1.5815 1.1823 0.8570 0.3424  0.0577  -0.3517 669 VAL A N   
257  C CA  . VAL A 57  ? 1.6637 1.2398 0.8722 0.3681  0.0834  -0.3646 669 VAL A CA  
258  C C   . VAL A 57  ? 1.6986 1.2832 0.9514 0.3606  0.1296  -0.3469 669 VAL A C   
259  O O   . VAL A 57  ? 1.6282 1.2311 0.9620 0.3403  0.1275  -0.3483 669 VAL A O   
260  C CB  . VAL A 57  ? 1.7616 1.3204 0.9452 0.3816  0.0535  -0.4093 669 VAL A CB  
261  C CG1 . VAL A 57  ? 1.8453 1.3771 0.9559 0.4096  0.0821  -0.4235 669 VAL A CG1 
262  C CG2 . VAL A 57  ? 1.7849 1.3377 0.9331 0.3880  0.0047  -0.4271 669 VAL A CG2 
263  N N   . GLY A 58  ? 1.7114 1.2833 0.9133 0.3771  0.1706  -0.3286 670 GLY A N   
264  C CA  . GLY A 58  ? 1.6911 1.2707 0.9325 0.3722  0.2173  -0.3098 670 GLY A CA  
265  C C   . GLY A 58  ? 1.6748 1.2791 0.9778 0.3496  0.2300  -0.2739 670 GLY A C   
266  O O   . GLY A 58  ? 1.6059 1.2309 0.9900 0.3297  0.2368  -0.2674 670 GLY A O   
267  N N   . TYR A 59  ? 1.6458 1.2470 0.9095 0.3533  0.2310  -0.2514 671 TYR A N   
268  C CA  . TYR A 59  ? 1.5828 1.2038 0.8936 0.3345  0.2416  -0.2175 671 TYR A CA  
269  C C   . TYR A 59  ? 1.6591 1.2761 0.9635 0.3415  0.2947  -0.1900 671 TYR A C   
270  O O   . TYR A 59  ? 1.7289 1.3227 0.9658 0.3657  0.3208  -0.1925 671 TYR A O   
271  C CB  . TYR A 59  ? 1.6010 1.2196 0.8752 0.3353  0.2127  -0.2089 671 TYR A CB  
272  C CG  . TYR A 59  ? 1.7167 1.3069 0.8879 0.3642  0.2188  -0.2087 671 TYR A CG  
273  C CD1 . TYR A 59  ? 1.7740 1.3550 0.9097 0.3738  0.2542  -0.1772 671 TYR A CD1 
274  C CD2 . TYR A 59  ? 1.7840 1.3556 0.8933 0.3826  0.1880  -0.2397 671 TYR A CD2 
275  C CE1 . TYR A 59  ? 1.8735 1.4265 0.9101 0.4022  0.2610  -0.1747 671 TYR A CE1 
276  C CE2 . TYR A 59  ? 1.8835 1.4277 0.8925 0.4113  0.1917  -0.2399 671 TYR A CE2 
277  C CZ  . TYR A 59  ? 1.9944 1.5289 0.9651 0.4215  0.2289  -0.2062 671 TYR A CZ  
278  O OH  . TYR A 59  ? 2.0828 1.5886 0.9507 0.4512  0.2334  -0.2039 671 TYR A OH  
279  N N   . THR A 60  ? 1.5563 1.1950 0.9305 0.3211  0.3105  -0.1641 672 THR A N   
280  C CA  . THR A 60  ? 1.5677 1.2062 0.9525 0.3241  0.3600  -0.1363 672 THR A CA  
281  C C   . THR A 60  ? 1.6455 1.2749 0.9867 0.3302  0.3700  -0.1088 672 THR A C   
282  O O   . THR A 60  ? 1.6414 1.2678 0.9519 0.3302  0.3361  -0.1113 672 THR A O   
283  C CB  . THR A 60  ? 1.5878 1.2540 1.0746 0.3000  0.3715  -0.1253 672 THR A CB  
284  O OG1 . THR A 60  ? 1.4885 1.1747 1.0222 0.2780  0.3405  -0.1174 672 THR A OG1 
285  C CG2 . THR A 60  ? 1.5643 1.2365 1.0916 0.2974  0.3696  -0.1489 672 THR A CG2 
286  N N   . GLU A 61  ? 1.6235 1.2481 0.9653 0.3359  0.4172  -0.0822 673 GLU A N   
287  C CA  . GLU A 61  ? 1.6457 1.2605 0.9534 0.3417  0.4338  -0.0523 673 GLU A CA  
288  C C   . GLU A 61  ? 1.6102 1.2470 0.9777 0.3169  0.4095  -0.0379 673 GLU A C   
289  O O   . GLU A 61  ? 1.6202 1.2491 0.9498 0.3207  0.3949  -0.0264 673 GLU A O   
290  C CB  . GLU A 61  ? 1.6981 1.3052 1.0098 0.3505  0.4926  -0.0272 673 GLU A CB  
291  N N   . ARG A 62  ? 1.4793 1.1430 0.9381 0.2929  0.4038  -0.0397 674 ARG A N   
292  C CA  . ARG A 62  ? 1.4000 1.0858 0.9205 0.2690  0.3812  -0.0289 674 ARG A CA  
293  C C   . ARG A 62  ? 1.4157 1.1052 0.9210 0.2635  0.3301  -0.0472 674 ARG A C   
294  O O   . ARG A 62  ? 1.3904 1.0840 0.8970 0.2561  0.3128  -0.0353 674 ARG A O   
295  C CB  . ARG A 62  ? 1.3411 1.0526 0.9568 0.2481  0.3891  -0.0278 674 ARG A CB  
296  N N   . GLN A 63  ? 1.3639 1.0514 0.8575 0.2675  0.3071  -0.0763 675 GLN A N   
297  C CA  . GLN A 63  ? 1.3339 1.0247 0.8188 0.2629  0.2596  -0.0969 675 GLN A CA  
298  C C   . GLN A 63  ? 1.4183 1.0910 0.8276 0.2787  0.2421  -0.0958 675 GLN A C   
299  O O   . GLN A 63  ? 1.3738 1.0547 0.7929 0.2694  0.2080  -0.0984 675 GLN A O   
300  C CB  . GLN A 63  ? 1.3579 1.0465 0.8446 0.2667  0.2448  -0.1279 675 GLN A CB  
301  C CG  . GLN A 63  ? 1.5095 1.2211 1.0820 0.2456  0.2410  -0.1328 675 GLN A CG  
302  C CD  . GLN A 63  ? 1.7791 1.4858 1.3563 0.2516  0.2384  -0.1592 675 GLN A CD  
303  O OE1 . GLN A 63  ? 1.7806 1.4664 1.2996 0.2724  0.2487  -0.1735 675 GLN A OE1 
304  N NE2 . GLN A 63  ? 1.6377 1.3627 1.2846 0.2342  0.2259  -0.1660 675 GLN A NE2 
305  N N   . ARG A 64  ? 1.4506 1.0982 0.7842 0.3034  0.2655  -0.0914 676 ARG A N   
306  C CA  . ARG A 64  ? 1.5025 1.1300 0.7565 0.3222  0.2509  -0.0884 676 ARG A CA  
307  C C   . ARG A 64  ? 1.5225 1.1545 0.7885 0.3146  0.2579  -0.0569 676 ARG A C   
308  O O   . ARG A 64  ? 1.5180 1.1468 0.7574 0.3172  0.2284  -0.0563 676 ARG A O   
309  C CB  . ARG A 64  ? 1.5969 1.1949 0.7640 0.3522  0.2771  -0.0910 676 ARG A CB  
310  C CG  . ARG A 64  ? 1.7594 1.3352 0.8371 0.3747  0.2496  -0.0999 676 ARG A CG  
311  C CD  . ARG A 64  ? 1.8850 1.4298 0.8704 0.4057  0.2823  -0.0922 676 ARG A CD  
312  N NE  . ARG A 64  ? 1.9680 1.4914 0.8659 0.4283  0.2536  -0.0985 676 ARG A NE  
313  C CZ  . ARG A 64  ? 2.1081 1.6213 0.9681 0.4368  0.2569  -0.0718 676 ARG A CZ  
314  N NH1 . ARG A 64  ? 1.8744 1.3959 0.7774 0.4241  0.2889  -0.0373 676 ARG A NH1 
315  N NH2 . ARG A 64  ? 1.9806 1.4745 0.7610 0.4587  0.2273  -0.0799 676 ARG A NH2 
316  N N   . ARG A 65  ? 1.4520 1.0917 0.7629 0.3050  0.2963  -0.0319 677 ARG A N   
317  C CA  . ARG A 65  ? 1.4268 1.0711 0.7607 0.2959  0.3073  -0.0019 677 ARG A CA  
318  C C   . ARG A 65  ? 1.3990 1.0675 0.7955 0.2718  0.2714  -0.0060 677 ARG A C   
319  O O   . ARG A 65  ? 1.3869 1.0538 0.7714 0.2708  0.2555  0.0055  677 ARG A O   
320  C CB  . ARG A 65  ? 1.4135 1.0624 0.7929 0.2896  0.3554  0.0212  677 ARG A CB  
321  C CG  . ARG A 65  ? 1.6308 1.2535 0.9477 0.3135  0.3988  0.0386  677 ARG A CG  
322  C CD  . ARG A 65  ? 1.7767 1.4069 1.1526 0.3044  0.4452  0.0627  677 ARG A CD  
323  N NE  . ARG A 65  ? 2.0025 1.6097 1.3277 0.3270  0.4919  0.0748  677 ARG A NE  
324  C CZ  . ARG A 65  ? 2.2113 1.8209 1.5798 0.3240  0.5389  0.0953  677 ARG A CZ  
325  N NH1 . ARG A 65  ? 1.9837 1.6179 1.4474 0.2991  0.5427  0.1047  677 ARG A NH1 
326  N NH2 . ARG A 65  ? 2.1438 1.7308 1.4612 0.3463  0.5825  0.1060  677 ARG A NH2 
327  N N   . ASP A 66  ? 1.2992 0.9890 0.7607 0.2536  0.2595  -0.0219 678 ASP A N   
328  C CA  . ASP A 66  ? 1.2250 0.9381 0.7484 0.2308  0.2287  -0.0265 678 ASP A CA  
329  C C   . ASP A 66  ? 1.2687 0.9806 0.7648 0.2332  0.1848  -0.0441 678 ASP A C   
330  O O   . ASP A 66  ? 1.2197 0.9420 0.7395 0.2218  0.1646  -0.0375 678 ASP A O   
331  C CB  . ASP A 66  ? 1.1941 0.9273 0.7877 0.2139  0.2304  -0.0372 678 ASP A CB  
332  C CG  . ASP A 66  ? 1.3029 1.0433 0.9425 0.2071  0.2686  -0.0193 678 ASP A CG  
333  O OD1 . ASP A 66  ? 1.3108 1.0492 0.9558 0.2056  0.2875  0.0043  678 ASP A OD1 
334  O OD2 . ASP A 66  ? 1.3592 1.1075 1.0335 0.2033  0.2792  -0.0289 678 ASP A OD2 
335  N N   . PHE A 67  ? 1.2719 0.9709 0.7204 0.2483  0.1701  -0.0674 679 PHE A N   
336  C CA  . PHE A 67  ? 1.2804 0.9768 0.7025 0.2528  0.1277  -0.0871 679 PHE A CA  
337  C C   . PHE A 67  ? 1.3643 1.0484 0.7366 0.2646  0.1197  -0.0718 679 PHE A C   
338  O O   . PHE A 67  ? 1.3235 1.0176 0.7147 0.2560  0.0902  -0.0729 679 PHE A O   
339  C CB  . PHE A 67  ? 1.3548 1.0365 0.7322 0.2693  0.1179  -0.1154 679 PHE A CB  
340  C CG  . PHE A 67  ? 1.3956 1.0719 0.7423 0.2772  0.0741  -0.1396 679 PHE A CG  
341  C CD1 . PHE A 67  ? 1.3804 1.0750 0.7826 0.2596  0.0412  -0.1551 679 PHE A CD1 
342  C CD2 . PHE A 67  ? 1.4987 1.1510 0.7617 0.3030  0.0662  -0.1480 679 PHE A CD2 
343  C CE1 . PHE A 67  ? 1.4109 1.1014 0.7925 0.2664  0.0010  -0.1787 679 PHE A CE1 
344  C CE2 . PHE A 67  ? 1.5555 1.2035 0.7944 0.3105  0.0229  -0.1728 679 PHE A CE2 
345  C CZ  . PHE A 67  ? 1.4723 1.1401 0.7742 0.2916  -0.0093 -0.1884 679 PHE A CZ  
346  N N   . LEU A 68  ? 1.3858 1.0483 0.6977 0.2843  0.1483  -0.0555 680 LEU A N   
347  C CA  . LEU A 68  ? 1.4255 1.0724 0.6833 0.2990  0.1450  -0.0380 680 LEU A CA  
348  C C   . LEU A 68  ? 1.4230 1.0811 0.7257 0.2837  0.1544  -0.0104 680 LEU A C   
349  O O   . LEU A 68  ? 1.4281 1.0819 0.7098 0.2884  0.1346  -0.0027 680 LEU A O   
350  C CB  . LEU A 68  ? 1.5157 1.1335 0.6907 0.3267  0.1747  -0.0279 680 LEU A CB  
351  C CG  . LEU A 68  ? 1.6443 1.2434 0.7480 0.3497  0.1588  -0.0554 680 LEU A CG  
352  C CD1 . LEU A 68  ? 1.7394 1.3088 0.7590 0.3777  0.1929  -0.0407 680 LEU A CD1 
353  C CD2 . LEU A 68  ? 1.6832 1.2809 0.7594 0.3561  0.1076  -0.0747 680 LEU A CD2 
354  N N   . SER A 69  ? 1.3255 0.9974 0.6905 0.2664  0.1830  0.0034  681 SER A N   
355  C CA  . SER A 69  ? 1.2777 0.9601 0.6900 0.2512  0.1916  0.0271  681 SER A CA  
356  C C   . SER A 69  ? 1.2624 0.9644 0.7181 0.2343  0.1529  0.0171  681 SER A C   
357  O O   . SER A 69  ? 1.2494 0.9528 0.7149 0.2302  0.1476  0.0328  681 SER A O   
358  C CB  . SER A 69  ? 1.2896 0.9830 0.7612 0.2370  0.2271  0.0403  681 SER A CB  
359  O OG  . SER A 69  ? 1.3620 1.0772 0.8938 0.2191  0.2157  0.0224  681 SER A OG  
360  N N   . GLU A 70  ? 1.1758 0.8909 0.6552 0.2260  0.1268  -0.0088 682 GLU A N   
361  C CA  . GLU A 70  ? 1.1208 0.8537 0.6398 0.2114  0.0909  -0.0209 682 GLU A CA  
362  C C   . GLU A 70  ? 1.2033 0.9262 0.6762 0.2247  0.0615  -0.0247 682 GLU A C   
363  O O   . GLU A 70  ? 1.1725 0.9073 0.6754 0.2146  0.0394  -0.0238 682 GLU A O   
364  C CB  . GLU A 70  ? 1.1056 0.8514 0.6576 0.2018  0.0747  -0.0462 682 GLU A CB  
365  C CG  . GLU A 70  ? 1.1750 0.9369 0.7895 0.1841  0.0947  -0.0419 682 GLU A CG  
366  C CD  . GLU A 70  ? 1.3635 1.1358 1.0104 0.1760  0.0835  -0.0637 682 GLU A CD  
367  O OE1 . GLU A 70  ? 1.2362 1.0062 0.8676 0.1805  0.0562  -0.0843 682 GLU A OE1 
368  O OE2 . GLU A 70  ? 1.2494 1.0323 0.9404 0.1651  0.1015  -0.0600 682 GLU A OE2 
369  N N   . ALA A 71  ? 1.2204 0.9211 0.6200 0.2484  0.0613  -0.0291 683 ALA A N   
370  C CA  . ALA A 71  ? 1.2579 0.9463 0.6056 0.2650  0.0334  -0.0322 683 ALA A CA  
371  C C   . ALA A 71  ? 1.3094 0.9891 0.6423 0.2699  0.0479  -0.0020 683 ALA A C   
372  O O   . ALA A 71  ? 1.3025 0.9832 0.6306 0.2724  0.0221  0.0000  683 ALA A O   
373  C CB  . ALA A 71  ? 1.3444 1.0102 0.6145 0.2904  0.0300  -0.0467 683 ALA A CB  
374  N N   . SER A 72  ? 1.2702 0.9417 0.6014 0.2706  0.0896  0.0214  684 SER A N   
375  C CA  . SER A 72  ? 1.2816 0.9431 0.6050 0.2743  0.1099  0.0522  684 SER A CA  
376  C C   . SER A 72  ? 1.2595 0.9413 0.6532 0.2521  0.0998  0.0597  684 SER A C   
377  O O   . SER A 72  ? 1.2655 0.9409 0.6502 0.2564  0.0950  0.0761  684 SER A O   
378  C CB  . SER A 72  ? 1.3503 1.0001 0.6668 0.2782  0.1582  0.0730  684 SER A CB  
379  O OG  . SER A 72  ? 1.5347 1.1623 0.7772 0.3021  0.1707  0.0690  684 SER A OG  
380  N N   . ILE A 73  ? 1.1463 0.8516 0.6077 0.2295  0.0963  0.0474  685 ILE A N   
381  C CA  . ILE A 73  ? 1.0741 0.7998 0.6026 0.2080  0.0861  0.0504  685 ILE A CA  
382  C C   . ILE A 73  ? 1.1028 0.8347 0.6286 0.2091  0.0460  0.0380  685 ILE A C   
383  O O   . ILE A 73  ? 1.0951 0.8280 0.6333 0.2068  0.0397  0.0507  685 ILE A O   
384  C CB  . ILE A 73  ? 1.0555 0.8021 0.6475 0.1872  0.0930  0.0399  685 ILE A CB  
385  C CG1 . ILE A 73  ? 1.0687 0.8109 0.6733 0.1854  0.1332  0.0547  685 ILE A CG1 
386  C CG2 . ILE A 73  ? 0.9971 0.7644 0.6510 0.1669  0.0770  0.0386  685 ILE A CG2 
387  C CD1 . ILE A 73  ? 1.1136 0.8692 0.7546 0.1748  0.1404  0.0400  685 ILE A CD1 
388  N N   . MET A 74  ? 1.0606 0.7955 0.5713 0.2135  0.0197  0.0134  686 MET A N   
389  C CA  . MET A 74  ? 1.0557 0.7968 0.5662 0.2156  -0.0197 -0.0017 686 MET A CA  
390  C C   . MET A 74  ? 1.1447 0.8674 0.5978 0.2369  -0.0311 0.0087  686 MET A C   
391  O O   . MET A 74  ? 1.1237 0.8528 0.5916 0.2356  -0.0554 0.0085  686 MET A O   
392  C CB  . MET A 74  ? 1.0967 0.8413 0.6004 0.2180  -0.0416 -0.0305 686 MET A CB  
393  C CG  . MET A 74  ? 1.0885 0.8536 0.6551 0.1968  -0.0415 -0.0432 686 MET A CG  
394  S SD  . MET A 74  ? 1.1683 0.9339 0.7268 0.2011  -0.0665 -0.0765 686 MET A SD  
395  C CE  . MET A 74  ? 1.1187 0.8928 0.6907 0.2017  -0.1099 -0.0895 686 MET A CE  
396  N N   . GLY A 75  ? 1.1573 0.8568 0.5454 0.2570  -0.0131 0.0181  687 GLY A N   
397  C CA  . GLY A 75  ? 1.2218 0.8997 0.5447 0.2807  -0.0206 0.0304  687 GLY A CA  
398  C C   . GLY A 75  ? 1.2628 0.9362 0.5967 0.2796  -0.0074 0.0592  687 GLY A C   
399  O O   . GLY A 75  ? 1.2984 0.9561 0.5866 0.2980  -0.0193 0.0698  687 GLY A O   
400  N N   . GLN A 76  ? 1.1614 0.8474 0.5560 0.2588  0.0163  0.0716  688 GLN A N   
401  C CA  . GLN A 76  ? 1.1493 0.8324 0.5668 0.2543  0.0308  0.0973  688 GLN A CA  
402  C C   . GLN A 76  ? 1.1409 0.8402 0.6017 0.2440  0.0006  0.0916  688 GLN A C   
403  O O   . GLN A 76  ? 1.1355 0.8298 0.6072 0.2444  0.0061  0.1109  688 GLN A O   
404  C CB  . GLN A 76  ? 1.1288 0.8194 0.5974 0.2361  0.0668  0.1094  688 GLN A CB  
405  C CG  . GLN A 76  ? 1.4160 1.0869 0.8496 0.2472  0.1066  0.1279  688 GLN A CG  
406  C CD  . GLN A 76  ? 1.6260 1.3088 1.1179 0.2280  0.1368  0.1324  688 GLN A CD  
407  O OE1 . GLN A 76  ? 1.4786 1.1805 1.0358 0.2073  0.1322  0.1293  688 GLN A OE1 
408  N NE2 . GLN A 76  ? 1.6002 1.2715 1.0693 0.2356  0.1685  0.1397  688 GLN A NE2 
409  N N   . PHE A 77  ? 1.0525 0.7709 0.5417 0.2345  -0.0288 0.0659  689 PHE A N   
410  C CA  . PHE A 77  ? 1.0027 0.7387 0.5398 0.2233  -0.0544 0.0591  689 PHE A CA  
411  C C   . PHE A 77  ? 1.0516 0.7867 0.5642 0.2372  -0.0932 0.0458  689 PHE A C   
412  O O   . PHE A 77  ? 1.0762 0.8087 0.5585 0.2465  -0.1110 0.0268  689 PHE A O   
413  C CB  . PHE A 77  ? 0.9602 0.7210 0.5621 0.1994  -0.0563 0.0430  689 PHE A CB  
414  C CG  . PHE A 77  ? 0.9558 0.7200 0.5828 0.1861  -0.0239 0.0495  689 PHE A CG  
415  C CD1 . PHE A 77  ? 0.9922 0.7517 0.6370 0.1807  0.0027  0.0713  689 PHE A CD1 
416  C CD2 . PHE A 77  ? 0.9586 0.7316 0.5975 0.1785  -0.0213 0.0332  689 PHE A CD2 
417  C CE1 . PHE A 77  ? 0.9766 0.7409 0.6506 0.1682  0.0301  0.0757  689 PHE A CE1 
418  C CE2 . PHE A 77  ? 0.9681 0.7460 0.6353 0.1663  0.0063  0.0386  689 PHE A CE2 
419  C CZ  . PHE A 77  ? 0.9380 0.7119 0.6225 0.1615  0.0313  0.0595  689 PHE A CZ  
420  N N   . ASP A 78  ? 0.9830 0.7213 0.5148 0.2377  -0.1072 0.0542  690 ASP A N   
421  C CA  . ASP A 78  ? 0.9972 0.7371 0.5177 0.2500  -0.1452 0.0438  690 ASP A CA  
422  C C   . ASP A 78  ? 0.9889 0.7489 0.5763 0.2344  -0.1568 0.0424  690 ASP A C   
423  O O   . ASP A 78  ? 0.9944 0.7498 0.5924 0.2354  -0.1489 0.0613  690 ASP A O   
424  C CB  . ASP A 78  ? 1.0879 0.8023 0.5414 0.2762  -0.1480 0.0617  690 ASP A CB  
425  C CG  . ASP A 78  ? 1.2197 0.9349 0.6619 0.2908  -0.1889 0.0530  690 ASP A CG  
426  O OD1 . ASP A 78  ? 1.2130 0.9422 0.6719 0.2885  -0.2190 0.0267  690 ASP A OD1 
427  O OD2 . ASP A 78  ? 1.3213 1.0228 0.7401 0.3051  -0.1911 0.0726  690 ASP A OD2 
428  N N   . HIS A 79  ? 0.8880 0.6695 0.5219 0.2200  -0.1731 0.0204  691 HIS A N   
429  C CA  . HIS A 79  ? 0.8262 0.6286 0.5258 0.2042  -0.1824 0.0160  691 HIS A CA  
430  C C   . HIS A 79  ? 0.8606 0.6804 0.5903 0.1988  -0.2109 -0.0106 691 HIS A C   
431  O O   . HIS A 79  ? 0.8432 0.6637 0.5628 0.1965  -0.2111 -0.0251 691 HIS A O   
432  C CB  . HIS A 79  ? 0.7801 0.5912 0.5209 0.1837  -0.1519 0.0243  691 HIS A CB  
433  C CG  . HIS A 79  ? 0.7702 0.5997 0.5720 0.1689  -0.1561 0.0224  691 HIS A CG  
434  N ND1 . HIS A 79  ? 0.7459 0.5953 0.5928 0.1539  -0.1634 0.0054  691 HIS A ND1 
435  C CD2 . HIS A 79  ? 0.7774 0.6067 0.5998 0.1683  -0.1527 0.0356  691 HIS A CD2 
436  C CE1 . HIS A 79  ? 0.7020 0.5626 0.5923 0.1453  -0.1634 0.0089  691 HIS A CE1 
437  N NE2 . HIS A 79  ? 0.7249 0.5742 0.6031 0.1533  -0.1576 0.0258  691 HIS A NE2 
438  N N   . PRO A 80  ? 0.8122 0.6464 0.5840 0.1960  -0.2334 -0.0171 692 PRO A N   
439  C CA  . PRO A 80  ? 0.8010 0.6522 0.6095 0.1902  -0.2592 -0.0414 692 PRO A CA  
440  C C   . PRO A 80  ? 0.8369 0.7030 0.6877 0.1698  -0.2461 -0.0523 692 PRO A C   
441  O O   . PRO A 80  ? 0.8479 0.7229 0.7186 0.1670  -0.2648 -0.0725 692 PRO A O   
442  C CB  . PRO A 80  ? 0.8074 0.6710 0.6590 0.1900  -0.2774 -0.0406 692 PRO A CB  
443  C CG  . PRO A 80  ? 0.8470 0.7047 0.6996 0.1880  -0.2542 -0.0173 692 PRO A CG  
444  C CD  . PRO A 80  ? 0.8266 0.6614 0.6160 0.1994  -0.2364 -0.0026 692 PRO A CD  
445  N N   . ASN A 81  ? 0.7454 0.6137 0.6113 0.1561  -0.2156 -0.0396 693 ASN A N   
446  C CA  . ASN A 81  ? 0.6991 0.5802 0.6017 0.1382  -0.2029 -0.0479 693 ASN A CA  
447  C C   . ASN A 81  ? 0.7527 0.6238 0.6253 0.1364  -0.1802 -0.0445 693 ASN A C   
448  O O   . ASN A 81  ? 0.7038 0.5830 0.6033 0.1219  -0.1627 -0.0439 693 ASN A O   
449  C CB  . ASN A 81  ? 0.6504 0.5458 0.6039 0.1229  -0.1903 -0.0406 693 ASN A CB  
450  C CG  . ASN A 81  ? 0.7211 0.6287 0.7126 0.1232  -0.2099 -0.0454 693 ASN A CG  
451  O OD1 . ASN A 81  ? 0.6197 0.5265 0.6181 0.1260  -0.2077 -0.0338 693 ASN A OD1 
452  N ND2 . ASN A 81  ? 0.6003 0.5200 0.6232 0.1192  -0.2277 -0.0624 693 ASN A ND2 
453  N N   . ILE A 82  ? 0.7733 0.6264 0.5894 0.1524  -0.1806 -0.0422 694 ILE A N   
454  C CA  . ILE A 82  ? 0.7860 0.6278 0.5693 0.1541  -0.1594 -0.0397 694 ILE A CA  
455  C C   . ILE A 82  ? 0.8875 0.7187 0.6282 0.1695  -0.1785 -0.0559 694 ILE A C   
456  O O   . ILE A 82  ? 0.9253 0.7468 0.6320 0.1861  -0.1980 -0.0565 694 ILE A O   
457  C CB  . ILE A 82  ? 0.8378 0.6652 0.5922 0.1591  -0.1322 -0.0159 694 ILE A CB  
458  C CG1 . ILE A 82  ? 0.7905 0.6290 0.5921 0.1422  -0.1139 -0.0039 694 ILE A CG1 
459  C CG2 . ILE A 82  ? 0.8698 0.6837 0.5852 0.1648  -0.1112 -0.0139 694 ILE A CG2 
460  C CD1 . ILE A 82  ? 0.8893 0.7153 0.6759 0.1459  -0.0918 0.0184  694 ILE A CD1 
461  N N   . ILE A 83  ? 0.8357 0.6688 0.5800 0.1644  -0.1748 -0.0703 695 ILE A N   
462  C CA  . ILE A 83  ? 0.8724 0.6953 0.5797 0.1775  -0.1913 -0.0895 695 ILE A CA  
463  C C   . ILE A 83  ? 0.9643 0.7641 0.5975 0.2001  -0.1876 -0.0804 695 ILE A C   
464  O O   . ILE A 83  ? 0.9588 0.7481 0.5675 0.2024  -0.1582 -0.0611 695 ILE A O   
465  C CB  . ILE A 83  ? 0.8959 0.7228 0.6207 0.1673  -0.1797 -0.1021 695 ILE A CB  
466  C CG1 . ILE A 83  ? 0.9530 0.7689 0.6429 0.1807  -0.1981 -0.1254 695 ILE A CG1 
467  C CG2 . ILE A 83  ? 0.8980 0.7209 0.6169 0.1614  -0.1432 -0.0851 695 ILE A CG2 
468  C CD1 . ILE A 83  ? 1.0715 0.8977 0.7949 0.1790  -0.2347 -0.1493 695 ILE A CD1 
469  N N   . ARG A 84  ? 0.9689 0.7609 0.5696 0.2170  -0.2181 -0.0929 696 ARG A N   
470  C CA  . ARG A 84  ? 1.0376 0.8066 0.5634 0.2414  -0.2196 -0.0845 696 ARG A CA  
471  C C   . ARG A 84  ? 1.1305 0.8829 0.6016 0.2549  -0.2147 -0.0974 696 ARG A C   
472  O O   . ARG A 84  ? 1.1218 0.8786 0.6034 0.2538  -0.2349 -0.1236 696 ARG A O   
473  C CB  . ARG A 84  ? 1.0793 0.8480 0.5953 0.2549  -0.2580 -0.0919 696 ARG A CB  
474  C CG  . ARG A 84  ? 1.2864 1.0326 0.7323 0.2792  -0.2581 -0.0741 696 ARG A CG  
475  C CD  . ARG A 84  ? 1.5199 1.2539 0.9141 0.3029  -0.2957 -0.0936 696 ARG A CD  
476  N NE  . ARG A 84  ? 1.6670 1.4181 1.1078 0.2999  -0.3361 -0.1106 696 ARG A NE  
477  C CZ  . ARG A 84  ? 1.9036 1.6548 1.3439 0.3096  -0.3559 -0.1010 696 ARG A CZ  
478  N NH1 . ARG A 84  ? 1.7600 1.4940 1.1537 0.3231  -0.3394 -0.0735 696 ARG A NH1 
479  N NH2 . ARG A 84  ? 1.7516 1.5202 1.2415 0.3059  -0.3918 -0.1181 696 ARG A NH2 
480  N N   . LEU A 85  ? 1.1314 0.8636 0.5450 0.2681  -0.1871 -0.0789 697 LEU A N   
481  C CA  . LEU A 85  ? 1.1863 0.8992 0.5376 0.2849  -0.1788 -0.0885 697 LEU A CA  
482  C C   . LEU A 85  ? 1.3270 1.0212 0.6083 0.3126  -0.2075 -0.0949 697 LEU A C   
483  O O   . LEU A 85  ? 1.3562 1.0383 0.6025 0.3254  -0.2032 -0.0727 697 LEU A O   
484  C CB  . LEU A 85  ? 1.1950 0.8953 0.5208 0.2863  -0.1320 -0.0643 697 LEU A CB  
485  C CG  . LEU A 85  ? 1.3166 0.9941 0.5709 0.3065  -0.1176 -0.0710 697 LEU A CG  
486  C CD1 . LEU A 85  ? 1.2855 0.9716 0.5693 0.2948  -0.1104 -0.0919 697 LEU A CD1 
487  C CD2 . LEU A 85  ? 1.3695 1.0286 0.5820 0.3167  -0.0765 -0.0404 697 LEU A CD2 
488  N N   . GLU A 86  ? 1.3212 1.0127 0.5848 0.3219  -0.2386 -0.1257 698 GLU A N   
489  C CA  . GLU A 86  ? 1.3994 1.0733 0.5952 0.3495  -0.2712 -0.1371 698 GLU A CA  
490  C C   . GLU A 86  ? 1.5301 1.1742 0.6332 0.3739  -0.2455 -0.1249 698 GLU A C   
491  O O   . GLU A 86  ? 1.5805 1.2074 0.6278 0.3935  -0.2444 -0.1050 698 GLU A O   
492  C CB  . GLU A 86  ? 1.4272 1.1076 0.6379 0.3512  -0.3130 -0.1767 698 GLU A CB  
493  C CG  . GLU A 86  ? 1.5209 1.2285 0.8185 0.3314  -0.3424 -0.1890 698 GLU A CG  
494  C CD  . GLU A 86  ? 1.8213 1.5342 1.1272 0.3378  -0.3691 -0.1797 698 GLU A CD  
495  O OE1 . GLU A 86  ? 1.8084 1.5034 1.0476 0.3640  -0.3912 -0.1813 698 GLU A OE1 
496  O OE2 . GLU A 86  ? 1.7033 1.4381 1.0828 0.3176  -0.3693 -0.1720 698 GLU A OE2 
497  N N   . GLY A 87  ? 1.4949 1.1331 0.5850 0.3725  -0.2225 -0.1348 699 GLY A N   
498  C CA  . GLY A 87  ? 1.5688 1.1795 0.5756 0.3947  -0.1931 -0.1250 699 GLY A CA  
499  C C   . GLY A 87  ? 1.6086 1.2194 0.6263 0.3861  -0.1621 -0.1337 699 GLY A C   
500  O O   . GLY A 87  ? 1.5386 1.1691 0.6231 0.3651  -0.1696 -0.1525 699 GLY A O   
501  N N   . VAL A 88  ? 1.6299 1.2178 0.5826 0.4031  -0.1252 -0.1184 700 VAL A N   
502  C CA  . VAL A 88  ? 1.6302 1.2150 0.5852 0.3990  -0.0908 -0.1238 700 VAL A CA  
503  C C   . VAL A 88  ? 1.7989 1.3539 0.6560 0.4306  -0.0884 -0.1378 700 VAL A C   
504  O O   . VAL A 88  ? 1.8660 1.3974 0.6454 0.4551  -0.0784 -0.1195 700 VAL A O   
505  C CB  . VAL A 88  ? 1.6411 1.2305 0.6292 0.3848  -0.0392 -0.0896 700 VAL A CB  
506  C CG1 . VAL A 88  ? 1.6310 1.2199 0.6306 0.3798  -0.0058 -0.0968 700 VAL A CG1 
507  C CG2 . VAL A 88  ? 1.5481 1.1649 0.6262 0.3559  -0.0434 -0.0773 700 VAL A CG2 
508  N N   . VAL A 89  ? 1.7737 1.3287 0.6336 0.4307  -0.0973 -0.1702 701 VAL A N   
509  C CA  . VAL A 89  ? 1.8690 1.3965 0.6408 0.4595  -0.0944 -0.1887 701 VAL A CA  
510  C C   . VAL A 89  ? 1.9377 1.4567 0.6997 0.4599  -0.0366 -0.1705 701 VAL A C   
511  O O   . VAL A 89  ? 1.8634 1.4017 0.7004 0.4356  -0.0172 -0.1704 701 VAL A O   
512  C CB  . VAL A 89  ? 1.9243 1.4550 0.7067 0.4602  -0.1347 -0.2351 701 VAL A CB  
513  C CG1 . VAL A 89  ? 2.0307 1.5298 0.7098 0.4944  -0.1389 -0.2560 701 VAL A CG1 
514  C CG2 . VAL A 89  ? 1.8893 1.4367 0.7140 0.4512  -0.1890 -0.2518 701 VAL A CG2 
515  N N   . THR A 90  ? 1.9853 1.4756 0.6571 0.4876  -0.0082 -0.1534 702 THR A N   
516  C CA  . THR A 90  ? 2.0018 1.4819 0.6604 0.4908  0.0501  -0.1334 702 THR A CA  
517  C C   . THR A 90  ? 2.1609 1.6088 0.7175 0.5244  0.0643  -0.1469 702 THR A C   
518  O O   . THR A 90  ? 2.1686 1.6105 0.7233 0.5261  0.1073  -0.1430 702 THR A O   
519  C CB  . THR A 90  ? 2.1000 1.5798 0.7697 0.4857  0.0880  -0.0871 702 THR A CB  
520  O OG1 . THR A 90  ? 2.1460 1.6093 0.7526 0.5055  0.0688  -0.0723 702 THR A OG1 
521  C CG2 . THR A 90  ? 1.9711 1.4837 0.7535 0.4491  0.0920  -0.0744 702 THR A CG2 
522  N N   . LYS A 91  ? 2.1973 1.6244 0.6698 0.5518  0.0278  -0.1634 703 LYS A N   
523  C CA  . LYS A 91  ? 2.3077 1.7012 0.6701 0.5879  0.0340  -0.1789 703 LYS A CA  
524  C C   . LYS A 91  ? 2.3653 1.7594 0.7372 0.5875  0.0245  -0.2214 703 LYS A C   
525  O O   . LYS A 91  ? 2.4203 1.7939 0.7378 0.6059  0.0595  -0.2248 703 LYS A O   
526  C CB  . LYS A 91  ? 2.4179 1.7913 0.6934 0.6164  -0.0095 -0.1859 703 LYS A CB  
527  N N   . SER A 92  ? 2.2641 1.6807 0.7057 0.5673  -0.0213 -0.2533 704 SER A N   
528  C CA  . SER A 92  ? 2.2593 1.6779 0.7217 0.5644  -0.0357 -0.2952 704 SER A CA  
529  C C   . SER A 92  ? 2.2033 1.6496 0.7760 0.5302  -0.0120 -0.2922 704 SER A C   
530  O O   . SER A 92  ? 2.1059 1.5775 0.7575 0.5032  -0.0092 -0.2698 704 SER A O   
531  C CB  . SER A 92  ? 2.3120 1.7346 0.7787 0.5665  -0.1025 -0.3344 704 SER A CB  
532  O OG  . SER A 92  ? 2.3213 1.7750 0.8840 0.5363  -0.1297 -0.3295 704 SER A OG  
533  N N   . ARG A 93  ? 2.1771 1.6176 0.7528 0.5329  0.0039  -0.3159 705 ARG A N   
534  C CA  . ARG A 93  ? 2.0892 1.5529 0.7628 0.5044  0.0246  -0.3171 705 ARG A CA  
535  C C   . ARG A 93  ? 2.1148 1.5884 0.8369 0.4936  -0.0198 -0.3605 705 ARG A C   
536  O O   . ARG A 93  ? 2.1823 1.6350 0.8448 0.5158  -0.0404 -0.3946 705 ARG A O   
537  C CB  . ARG A 93  ? 2.1233 1.5732 0.7713 0.5153  0.0808  -0.3084 705 ARG A CB  
538  N N   . PRO A 94  ? 1.9755 1.4790 0.8023 0.4612  -0.0371 -0.3615 706 PRO A N   
539  C CA  . PRO A 94  ? 1.8793 1.4097 0.7860 0.4326  -0.0189 -0.3268 706 PRO A CA  
540  C C   . PRO A 94  ? 1.9043 1.4413 0.8038 0.4299  -0.0352 -0.3024 706 PRO A C   
541  O O   . PRO A 94  ? 1.9274 1.4597 0.7989 0.4393  -0.0783 -0.3188 706 PRO A O   
542  C CB  . PRO A 94  ? 1.8231 1.3770 0.8280 0.4055  -0.0405 -0.3467 706 PRO A CB  
543  C CG  . PRO A 94  ? 1.9238 1.4671 0.9047 0.4172  -0.0880 -0.3883 706 PRO A CG  
544  C CD  . PRO A 94  ? 1.9744 1.4853 0.8490 0.4517  -0.0770 -0.4016 706 PRO A CD  
545  N N   . VAL A 95  ? 1.8089 1.3574 0.7389 0.4167  -0.0015 -0.2639 707 VAL A N   
546  C CA  . VAL A 95  ? 1.7846 1.3399 0.7156 0.4123  -0.0099 -0.2365 707 VAL A CA  
547  C C   . VAL A 95  ? 1.7373 1.3207 0.7543 0.3852  -0.0453 -0.2421 707 VAL A C   
548  O O   . VAL A 95  ? 1.6628 1.2648 0.7549 0.3634  -0.0454 -0.2518 707 VAL A O   
549  C CB  . VAL A 95  ? 1.8267 1.3806 0.7548 0.4104  0.0397  -0.1942 707 VAL A CB  
550  C CG1 . VAL A 95  ? 1.9210 1.4440 0.7536 0.4410  0.0729  -0.1857 707 VAL A CG1 
551  C CG2 . VAL A 95  ? 1.7411 1.3177 0.7582 0.3833  0.0694  -0.1820 707 VAL A CG2 
552  N N   . MET A 96  ? 1.6894 1.2750 0.6943 0.3880  -0.0746 -0.2352 708 MET A N   
553  C CA  . MET A 96  ? 1.6072 1.2175 0.6865 0.3656  -0.1090 -0.2406 708 MET A CA  
554  C C   . MET A 96  ? 1.5889 1.2109 0.6923 0.3552  -0.1046 -0.2083 708 MET A C   
555  O O   . MET A 96  ? 1.6305 1.2371 0.6752 0.3719  -0.0927 -0.1869 708 MET A O   
556  C CB  . MET A 96  ? 1.6755 1.2807 0.7339 0.3772  -0.1616 -0.2745 708 MET A CB  
557  C CG  . MET A 96  ? 1.7425 1.3420 0.8041 0.3805  -0.1749 -0.3120 708 MET A CG  
558  S SD  . MET A 96  ? 1.8808 1.4614 0.8774 0.4073  -0.2293 -0.3514 708 MET A SD  
559  C CE  . MET A 96  ? 1.9500 1.4947 0.8212 0.4437  -0.2005 -0.3445 708 MET A CE  
560  N N   . ILE A 97  ? 1.4399 1.0883 0.6294 0.3282  -0.1151 -0.2057 709 ILE A N   
561  C CA  . ILE A 97  ? 1.3761 1.0392 0.6029 0.3148  -0.1169 -0.1808 709 ILE A CA  
562  C C   . ILE A 97  ? 1.3836 1.0593 0.6434 0.3093  -0.1651 -0.2017 709 ILE A C   
563  O O   . ILE A 97  ? 1.3328 1.0222 0.6473 0.2948  -0.1811 -0.2232 709 ILE A O   
564  C CB  . ILE A 97  ? 1.3357 1.0184 0.6344 0.2891  -0.0853 -0.1604 709 ILE A CB  
565  C CG1 . ILE A 97  ? 1.3621 1.0321 0.6290 0.2962  -0.0381 -0.1359 709 ILE A CG1 
566  C CG2 . ILE A 97  ? 1.2856 0.9873 0.6375 0.2718  -0.0964 -0.1441 709 ILE A CG2 
567  C CD1 . ILE A 97  ? 1.3468 1.0336 0.6803 0.2740  -0.0072 -0.1230 709 ILE A CD1 
568  N N   . LEU A 98  ? 1.3662 1.0361 0.5925 0.3222  -0.1881 -0.1956 710 LEU A N   
569  C CA  . LEU A 98  ? 1.3504 1.0316 0.6062 0.3196  -0.2348 -0.2151 710 LEU A CA  
570  C C   . LEU A 98  ? 1.3515 1.0510 0.6588 0.3043  -0.2387 -0.1940 710 LEU A C   
571  O O   . LEU A 98  ? 1.3638 1.0555 0.6393 0.3127  -0.2260 -0.1681 710 LEU A O   
572  C CB  . LEU A 98  ? 1.4352 1.0958 0.6141 0.3489  -0.2678 -0.2326 710 LEU A CB  
573  C CG  . LEU A 98  ? 1.5705 1.2041 0.6661 0.3732  -0.2565 -0.2451 710 LEU A CG  
574  C CD1 . LEU A 98  ? 1.6617 1.2732 0.6709 0.4045  -0.2847 -0.2520 710 LEU A CD1 
575  C CD2 . LEU A 98  ? 1.5902 1.2265 0.7126 0.3670  -0.2662 -0.2788 710 LEU A CD2 
576  N N   . THR A 99  ? 1.2485 0.9715 0.6367 0.2821  -0.2544 -0.2043 711 THR A N   
577  C CA  . THR A 99  ? 1.1944 0.9369 0.6400 0.2659  -0.2592 -0.1882 711 THR A CA  
578  C C   . THR A 99  ? 1.2360 0.9928 0.7282 0.2610  -0.3020 -0.2117 711 THR A C   
579  O O   . THR A 99  ? 1.2410 0.9966 0.7400 0.2629  -0.3223 -0.2401 711 THR A O   
580  C CB  . THR A 99  ? 1.2170 0.9752 0.7210 0.2414  -0.2252 -0.1703 711 THR A CB  
581  O OG1 . THR A 99  ? 1.1923 0.9613 0.7444 0.2269  -0.2271 -0.1895 711 THR A OG1 
582  C CG2 . THR A 99  ? 1.1859 0.9318 0.6527 0.2457  -0.1838 -0.1458 711 THR A CG2 
583  N N   . GLU A 100 ? 1.1718 0.9418 0.6987 0.2549  -0.3149 -0.2003 712 GLU A N   
584  C CA  . GLU A 100 ? 1.1500 0.9361 0.7305 0.2492  -0.3529 -0.2188 712 GLU A CA  
585  C C   . GLU A 100 ? 1.1323 0.9364 0.7893 0.2265  -0.3522 -0.2336 712 GLU A C   
586  O O   . GLU A 100 ? 1.0719 0.8831 0.7570 0.2101  -0.3206 -0.2192 712 GLU A O   
587  C CB  . GLU A 100 ? 1.1432 0.9402 0.7493 0.2458  -0.3576 -0.1988 712 GLU A CB  
588  C CG  . GLU A 100 ? 1.2367 1.0396 0.8620 0.2312  -0.3185 -0.1687 712 GLU A CG  
589  C CD  . GLU A 100 ? 1.4746 1.2919 1.1430 0.2232  -0.3227 -0.1533 712 GLU A CD  
590  O OE1 . GLU A 100 ? 1.6178 1.4277 1.2558 0.2388  -0.3386 -0.1459 712 GLU A OE1 
591  O OE2 . GLU A 100 ? 1.1972 1.0323 0.9284 0.2021  -0.3092 -0.1481 712 GLU A OE2 
592  N N   . PHE A 101 ? 1.1019 0.9126 0.7930 0.2260  -0.3871 -0.2620 713 PHE A N   
593  C CA  . PHE A 101 ? 1.0507 0.8764 0.8156 0.2056  -0.3868 -0.2759 713 PHE A CA  
594  C C   . PHE A 101 ? 1.0179 0.8669 0.8605 0.1854  -0.3831 -0.2630 713 PHE A C   
595  O O   . PHE A 101 ? 1.0131 0.8703 0.8722 0.1886  -0.4030 -0.2604 713 PHE A O   
596  C CB  . PHE A 101 ? 1.1093 0.9311 0.8840 0.2124  -0.4225 -0.3123 713 PHE A CB  
597  C CG  . PHE A 101 ? 1.0927 0.9235 0.9319 0.1941  -0.4174 -0.3267 713 PHE A CG  
598  C CD1 . PHE A 101 ? 1.1256 0.9481 0.9503 0.1897  -0.3886 -0.3243 713 PHE A CD1 
599  C CD2 . PHE A 101 ? 1.0933 0.9403 1.0099 0.1821  -0.4411 -0.3422 713 PHE A CD2 
600  C CE1 . PHE A 101 ? 1.1030 0.9327 0.9878 0.1735  -0.3838 -0.3359 713 PHE A CE1 
601  C CE2 . PHE A 101 ? 1.0958 0.9494 1.0729 0.1655  -0.4344 -0.3531 713 PHE A CE2 
602  C CZ  . PHE A 101 ? 1.0649 0.9093 1.0243 0.1617  -0.4064 -0.3497 713 PHE A CZ  
603  N N   . MET A 102 ? 0.9072 0.7664 0.7964 0.1656  -0.3573 -0.2552 714 MET A N   
604  C CA  . MET A 102 ? 0.8401 0.7197 0.7989 0.1462  -0.3475 -0.2419 714 MET A CA  
605  C C   . MET A 102 ? 0.8869 0.7776 0.9150 0.1324  -0.3580 -0.2601 714 MET A C   
606  O O   . MET A 102 ? 0.8645 0.7574 0.9172 0.1197  -0.3365 -0.2566 714 MET A O   
607  C CB  . MET A 102 ? 0.8235 0.7048 0.7765 0.1360  -0.3083 -0.2147 714 MET A CB  
608  C CG  . MET A 102 ? 0.8884 0.7578 0.7786 0.1489  -0.2956 -0.1959 714 MET A CG  
609  S SD  . MET A 102 ? 0.9402 0.8148 0.8300 0.1567  -0.3136 -0.1850 714 MET A SD  
610  C CE  . MET A 102 ? 0.8302 0.7243 0.7835 0.1350  -0.2905 -0.1655 714 MET A CE  
611  N N   . GLU A 103 ? 0.8525 0.7497 0.9134 0.1359  -0.3920 -0.2793 715 GLU A N   
612  C CA  . GLU A 103 ? 0.8383 0.7453 0.9697 0.1256  -0.4099 -0.3003 715 GLU A CA  
613  C C   . GLU A 103 ? 0.8298 0.7499 1.0269 0.1036  -0.3838 -0.2879 715 GLU A C   
614  O O   . GLU A 103 ? 0.8117 0.7305 1.0424 0.0962  -0.3843 -0.3019 715 GLU A O   
615  C CB  . GLU A 103 ? 0.8701 0.7876 1.0364 0.1306  -0.4452 -0.3127 715 GLU A CB  
616  C CG  . GLU A 103 ? 1.0297 0.9531 1.2590 0.1258  -0.4731 -0.3416 715 GLU A CG  
617  C CD  . GLU A 103 ? 1.3215 1.2634 1.6196 0.1217  -0.4967 -0.3470 715 GLU A CD  
618  O OE1 . GLU A 103 ? 1.3133 1.2543 1.6219 0.1320  -0.5359 -0.3733 715 GLU A OE1 
619  O OE2 . GLU A 103 ? 1.2416 1.1988 1.5850 0.1085  -0.4762 -0.3261 715 GLU A OE2 
620  N N   . ASN A 104 ? 0.7578 0.6893 0.9719 0.0942  -0.3614 -0.2624 716 ASN A N   
621  C CA  . ASN A 104 ? 0.7070 0.6502 0.9778 0.0754  -0.3367 -0.2492 716 ASN A CA  
622  C C   . ASN A 104 ? 0.7614 0.6971 1.0043 0.0700  -0.3045 -0.2346 716 ASN A C   
623  O O   . ASN A 104 ? 0.7196 0.6635 1.0005 0.0562  -0.2832 -0.2214 716 ASN A O   
624  C CB  . ASN A 104 ? 0.6290 0.5882 0.9373 0.0684  -0.3300 -0.2322 716 ASN A CB  
625  C CG  . ASN A 104 ? 0.8232 0.7945 1.1919 0.0673  -0.3571 -0.2475 716 ASN A CG  
626  O OD1 . ASN A 104 ? 0.7600 0.7347 1.1804 0.0604  -0.3669 -0.2632 716 ASN A OD1 
627  N ND2 . ASN A 104 ? 0.6353 0.6135 1.0033 0.0741  -0.3700 -0.2432 716 ASN A ND2 
628  N N   . CYS A 105 ? 0.7611 0.6811 0.9393 0.0817  -0.3018 -0.2379 717 CYS A N   
629  C CA  . CYS A 105 ? 0.7547 0.6662 0.9032 0.0795  -0.2747 -0.2279 717 CYS A CA  
630  C C   . CYS A 105 ? 0.7287 0.6477 0.8779 0.0704  -0.2455 -0.1999 717 CYS A C   
631  O O   . CYS A 105 ? 0.7151 0.6401 0.8602 0.0717  -0.2460 -0.1881 717 CYS A O   
632  C CB  . CYS A 105 ? 0.7654 0.6744 0.9482 0.0721  -0.2733 -0.2414 717 CYS A CB  
633  S SG  . CYS A 105 ? 0.8659 0.7685 1.0659 0.0799  -0.3108 -0.2771 717 CYS A SG  
634  N N   . ALA A 106 ? 0.6359 0.5536 0.7887 0.0626  -0.2216 -0.1905 718 ALA A N   
635  C CA  . ALA A 106 ? 0.5906 0.5144 0.7440 0.0545  -0.1959 -0.1670 718 ALA A CA  
636  C C   . ALA A 106 ? 0.5883 0.5272 0.7925 0.0428  -0.1927 -0.1569 718 ALA A C   
637  O O   . ALA A 106 ? 0.5718 0.5164 0.8232 0.0358  -0.1996 -0.1647 718 ALA A O   
638  C CB  . ALA A 106 ? 0.5857 0.5048 0.7350 0.0503  -0.1762 -0.1629 718 ALA A CB  
639  N N   . LEU A 107 ? 0.5101 0.4543 0.7048 0.0415  -0.1818 -0.1399 719 LEU A N   
640  C CA  . LEU A 107 ? 0.4707 0.4280 0.7046 0.0328  -0.1766 -0.1293 719 LEU A CA  
641  C C   . LEU A 107 ? 0.5028 0.4661 0.7760 0.0209  -0.1615 -0.1229 719 LEU A C   
642  O O   . LEU A 107 ? 0.4811 0.4536 0.7984 0.0147  -0.1632 -0.1222 719 LEU A O   
643  C CB  . LEU A 107 ? 0.4538 0.4125 0.6628 0.0349  -0.1655 -0.1133 719 LEU A CB  
644  C CG  . LEU A 107 ? 0.4655 0.4360 0.7064 0.0281  -0.1582 -0.1022 719 LEU A CG  
645  C CD1 . LEU A 107 ? 0.4681 0.4457 0.7363 0.0313  -0.1776 -0.1102 719 LEU A CD1 
646  C CD2 . LEU A 107 ? 0.4625 0.4312 0.6754 0.0296  -0.1445 -0.0876 719 LEU A CD2 
647  N N   . ASP A 108 ? 0.4751 0.4329 0.7334 0.0185  -0.1467 -0.1177 720 ASP A N   
648  C CA  . ASP A 108 ? 0.4646 0.4258 0.7533 0.0092  -0.1325 -0.1100 720 ASP A CA  
649  C C   . ASP A 108 ? 0.5417 0.5032 0.8738 0.0053  -0.1419 -0.1217 720 ASP A C   
650  O O   . ASP A 108 ? 0.5359 0.5047 0.9087 -0.0019 -0.1363 -0.1153 720 ASP A O   
651  C CB  . ASP A 108 ? 0.4862 0.4413 0.7496 0.0092  -0.1176 -0.1030 720 ASP A CB  
652  C CG  . ASP A 108 ? 0.6473 0.5916 0.8871 0.0158  -0.1228 -0.1157 720 ASP A CG  
653  O OD1 . ASP A 108 ? 0.6615 0.6006 0.8808 0.0238  -0.1371 -0.1279 720 ASP A OD1 
654  O OD2 . ASP A 108 ? 0.7527 0.6932 0.9921 0.0141  -0.1123 -0.1132 720 ASP A OD2 
655  N N   . SER A 109 ? 0.5172 0.4703 0.8417 0.0106  -0.1562 -0.1395 721 SER A N   
656  C CA  . SER A 109 ? 0.5164 0.4683 0.8845 0.0072  -0.1677 -0.1539 721 SER A CA  
657  C C   . SER A 109 ? 0.5507 0.5117 0.9564 0.0055  -0.1828 -0.1603 721 SER A C   
658  O O   . SER A 109 ? 0.5386 0.5047 0.9975 -0.0024 -0.1808 -0.1598 721 SER A O   
659  C CB  . SER A 109 ? 0.5980 0.5376 0.9438 0.0149  -0.1810 -0.1740 721 SER A CB  
660  O OG  . SER A 109 ? 0.7550 0.6911 1.0634 0.0258  -0.1983 -0.1852 721 SER A OG  
661  N N   . PHE A 110 ? 0.5122 0.4754 0.8926 0.0132  -0.1964 -0.1644 722 PHE A N   
662  C CA  . PHE A 110 ? 0.5138 0.4865 0.9272 0.0136  -0.2129 -0.1705 722 PHE A CA  
663  C C   . PHE A 110 ? 0.5448 0.5300 1.0014 0.0040  -0.1963 -0.1538 722 PHE A C   
664  O O   . PHE A 110 ? 0.5349 0.5284 1.0459 -0.0005 -0.2040 -0.1595 722 PHE A O   
665  C CB  . PHE A 110 ? 0.5562 0.5271 0.9251 0.0253  -0.2274 -0.1737 722 PHE A CB  
666  C CG  . PHE A 110 ? 0.5734 0.5551 0.9734 0.0271  -0.2445 -0.1779 722 PHE A CG  
667  C CD1 . PHE A 110 ? 0.6324 0.6168 1.0702 0.0288  -0.2705 -0.1986 722 PHE A CD1 
668  C CD2 . PHE A 110 ? 0.5862 0.5751 0.9793 0.0277  -0.2359 -0.1626 722 PHE A CD2 
669  C CE1 . PHE A 110 ? 0.6479 0.6435 1.1190 0.0310  -0.2876 -0.2029 722 PHE A CE1 
670  C CE2 . PHE A 110 ? 0.6305 0.6297 1.0553 0.0301  -0.2516 -0.1664 722 PHE A CE2 
671  C CZ  . PHE A 110 ? 0.6252 0.6283 1.0896 0.0318  -0.2774 -0.1863 722 PHE A CZ  
672  N N   . LEU A 111 ? 0.5050 0.4913 0.9391 0.0013  -0.1736 -0.1342 723 LEU A N   
673  C CA  . LEU A 111 ? 0.4927 0.4889 0.9600 -0.0061 -0.1561 -0.1184 723 LEU A CA  
674  C C   . LEU A 111 ? 0.5224 0.5183 1.0308 -0.0147 -0.1425 -0.1133 723 LEU A C   
675  O O   . LEU A 111 ? 0.5098 0.5139 1.0657 -0.0202 -0.1354 -0.1077 723 LEU A O   
676  C CB  . LEU A 111 ? 0.4814 0.4784 0.9106 -0.0049 -0.1388 -0.1013 723 LEU A CB  
677  C CG  . LEU A 111 ? 0.5528 0.5532 0.9619 0.0019  -0.1486 -0.1020 723 LEU A CG  
678  C CD1 . LEU A 111 ? 0.5438 0.5414 0.9116 0.0037  -0.1339 -0.0885 723 LEU A CD1 
679  C CD2 . LEU A 111 ? 0.6007 0.6131 1.0574 -0.0001 -0.1524 -0.1021 723 LEU A CD2 
680  N N   . ARG A 112 ? 0.4745 0.4606 0.9673 -0.0152 -0.1388 -0.1152 724 ARG A N   
681  C CA  . ARG A 112 ? 0.4730 0.4558 1.0015 -0.0221 -0.1270 -0.1103 724 ARG A CA  
682  C C   . ARG A 112 ? 0.5405 0.5255 1.1298 -0.0262 -0.1397 -0.1240 724 ARG A C   
683  O O   . ARG A 112 ? 0.5460 0.5324 1.1800 -0.0333 -0.1257 -0.1145 724 ARG A O   
684  C CB  . ARG A 112 ? 0.4919 0.4633 0.9901 -0.0201 -0.1240 -0.1123 724 ARG A CB  
685  C CG  . ARG A 112 ? 0.6457 0.6156 1.1037 -0.0191 -0.1059 -0.0948 724 ARG A CG  
686  C CD  . ARG A 112 ? 0.8115 0.7714 1.2398 -0.0156 -0.1057 -0.0994 724 ARG A CD  
687  N NE  . ARG A 112 ? 0.9266 0.8865 1.3238 -0.0151 -0.0900 -0.0834 724 ARG A NE  
688  C CZ  . ARG A 112 ? 1.0831 1.0397 1.4873 -0.0176 -0.0769 -0.0719 724 ARG A CZ  
689  N NH1 . ARG A 112 ? 0.8799 0.8320 1.3214 -0.0212 -0.0754 -0.0730 724 ARG A NH1 
690  N NH2 . ARG A 112 ? 0.8990 0.8564 1.2749 -0.0162 -0.0662 -0.0594 724 ARG A NH2 
691  N N   . LEU A 113 ? 0.4966 0.4816 1.0881 -0.0212 -0.1662 -0.1460 725 LEU A N   
692  C CA  . LEU A 113 ? 0.4971 0.4844 1.1468 -0.0239 -0.1850 -0.1645 725 LEU A CA  
693  C C   . LEU A 113 ? 0.5054 0.5073 1.2015 -0.0267 -0.1886 -0.1624 725 LEU A C   
694  O O   . LEU A 113 ? 0.4817 0.4885 1.2442 -0.0324 -0.1946 -0.1701 725 LEU A O   
695  C CB  . LEU A 113 ? 0.5298 0.5096 1.1527 -0.0149 -0.2146 -0.1908 725 LEU A CB  
696  C CG  . LEU A 113 ? 0.6153 0.5800 1.2015 -0.0109 -0.2154 -0.1997 725 LEU A CG  
697  C CD1 . LEU A 113 ? 0.6439 0.6016 1.1729 0.0019  -0.2367 -0.2170 725 LEU A CD1 
698  C CD2 . LEU A 113 ? 0.6633 0.6219 1.3028 -0.0164 -0.2215 -0.2139 725 LEU A CD2 
699  N N   . ASN A 114 ? 0.4343 0.4428 1.0980 -0.0222 -0.1853 -0.1527 726 ASN A N   
700  C CA  . ASN A 114 ? 0.4082 0.4305 1.1082 -0.0230 -0.1875 -0.1497 726 ASN A CA  
701  C C   . ASN A 114 ? 0.4336 0.4614 1.1327 -0.0271 -0.1569 -0.1248 726 ASN A C   
702  O O   . ASN A 114 ? 0.4461 0.4807 1.1294 -0.0233 -0.1552 -0.1186 726 ASN A O   
703  C CB  . ASN A 114 ? 0.3829 0.4071 1.0473 -0.0126 -0.2116 -0.1611 726 ASN A CB  
704  C CG  . ASN A 114 ? 0.5725 0.5919 1.2409 -0.0068 -0.2444 -0.1875 726 ASN A CG  
705  O OD1 . ASN A 114 ? 0.5273 0.5542 1.2542 -0.0088 -0.2622 -0.2018 726 ASN A OD1 
706  N ND2 . ASN A 114 ? 0.4454 0.4521 1.0531 0.0009  -0.2527 -0.1950 726 ASN A ND2 
707  N N   . ASP A 115 ? 0.3647 0.3883 1.0787 -0.0339 -0.1329 -0.1105 727 ASP A N   
708  C CA  . ASP A 115 ? 0.3477 0.3742 1.0550 -0.0363 -0.1032 -0.0869 727 ASP A CA  
709  C C   . ASP A 115 ? 0.4010 0.4405 1.1609 -0.0389 -0.0947 -0.0812 727 ASP A C   
710  O O   . ASP A 115 ? 0.4025 0.4469 1.2274 -0.0441 -0.0972 -0.0867 727 ASP A O   
711  C CB  . ASP A 115 ? 0.3615 0.3787 1.0684 -0.0409 -0.0818 -0.0730 727 ASP A CB  
712  C CG  . ASP A 115 ? 0.5071 0.5245 1.1962 -0.0412 -0.0526 -0.0492 727 ASP A CG  
713  O OD1 . ASP A 115 ? 0.5300 0.5509 1.1811 -0.0367 -0.0496 -0.0443 727 ASP A OD1 
714  O OD2 . ASP A 115 ? 0.5932 0.6059 1.3041 -0.0451 -0.0332 -0.0356 727 ASP A OD2 
715  N N   . GLY A 116 ? 0.3667 0.4117 1.1004 -0.0350 -0.0856 -0.0718 728 GLY A N   
716  C CA  . GLY A 116 ? 0.3552 0.4125 1.1300 -0.0356 -0.0753 -0.0656 728 GLY A CA  
717  C C   . GLY A 116 ? 0.4004 0.4689 1.2233 -0.0344 -0.1000 -0.0827 728 GLY A C   
718  O O   . GLY A 116 ? 0.4068 0.4868 1.2852 -0.0367 -0.0911 -0.0790 728 GLY A O   
719  N N   . GLN A 117 ? 0.3475 0.4128 1.1496 -0.0297 -0.1312 -0.1016 729 GLN A N   
720  C CA  . GLN A 117 ? 0.3439 0.4188 1.1880 -0.0268 -0.1603 -0.1204 729 GLN A CA  
721  C C   . GLN A 117 ? 0.3807 0.4614 1.1981 -0.0178 -0.1734 -0.1223 729 GLN A C   
722  O O   . GLN A 117 ? 0.3782 0.4677 1.2304 -0.0140 -0.1980 -0.1364 729 GLN A O   
723  C CB  . GLN A 117 ? 0.3740 0.4413 1.2158 -0.0254 -0.1893 -0.1420 729 GLN A CB  
724  C CG  . GLN A 117 ? 0.5603 0.6223 1.4435 -0.0344 -0.1806 -0.1435 729 GLN A CG  
725  C CD  . GLN A 117 ? 0.7002 0.7737 1.6709 -0.0426 -0.1680 -0.1389 729 GLN A CD  
726  O OE1 . GLN A 117 ? 0.6597 0.7426 1.6901 -0.0434 -0.1898 -0.1556 729 GLN A OE1 
727  N NE2 . GLN A 117 ? 0.4858 0.5588 1.4661 -0.0482 -0.1322 -0.1158 729 GLN A NE2 
728  N N   . PHE A 118 ? 0.3391 0.4146 1.0979 -0.0141 -0.1580 -0.1086 730 PHE A N   
729  C CA  . PHE A 118 ? 0.3279 0.4067 1.0599 -0.0055 -0.1674 -0.1082 730 PHE A CA  
730  C C   . PHE A 118 ? 0.3593 0.4442 1.0975 -0.0064 -0.1403 -0.0914 730 PHE A C   
731  O O   . PHE A 118 ? 0.3347 0.4155 1.0611 -0.0113 -0.1127 -0.0774 730 PHE A O   
732  C CB  . PHE A 118 ? 0.3532 0.4186 1.0070 0.0015  -0.1763 -0.1090 730 PHE A CB  
733  C CG  . PHE A 118 ? 0.3892 0.4457 1.0223 0.0048  -0.2008 -0.1252 730 PHE A CG  
734  C CD1 . PHE A 118 ? 0.4534 0.5134 1.1050 0.0113  -0.2328 -0.1432 730 PHE A CD1 
735  C CD2 . PHE A 118 ? 0.4186 0.4628 1.0111 0.0028  -0.1926 -0.1233 730 PHE A CD2 
736  C CE1 . PHE A 118 ? 0.4956 0.5460 1.1241 0.0158  -0.2555 -0.1599 730 PHE A CE1 
737  C CE2 . PHE A 118 ? 0.4840 0.5191 1.0554 0.0069  -0.2136 -0.1392 730 PHE A CE2 
738  C CZ  . PHE A 118 ? 0.4874 0.5251 1.0752 0.0136  -0.2446 -0.1577 730 PHE A CZ  
739  N N   . THR A 119 ? 0.3224 0.4156 1.0732 -0.0002 -0.1489 -0.0930 731 THR A N   
740  C CA  . THR A 119 ? 0.3101 0.4079 1.0613 0.0010  -0.1252 -0.0793 731 THR A CA  
741  C C   . THR A 119 ? 0.3590 0.4439 1.0345 0.0051  -0.1180 -0.0715 731 THR A C   
742  O O   . THR A 119 ? 0.3594 0.4345 0.9908 0.0081  -0.1344 -0.0773 731 THR A O   
743  C CB  . THR A 119 ? 0.4298 0.5398 1.2192 0.0073  -0.1396 -0.0849 731 THR A CB  
744  O OG1 . THR A 119 ? 0.5142 0.6179 1.2614 0.0164  -0.1673 -0.0930 731 THR A OG1 
745  C CG2 . THR A 119 ? 0.3159 0.4407 1.1891 0.0035  -0.1494 -0.0944 731 THR A CG2 
746  N N   . VAL A 120 ? 0.3123 0.3971 0.9748 0.0055  -0.0937 -0.0592 732 VAL A N   
747  C CA  . VAL A 120 ? 0.3028 0.3766 0.9031 0.0089  -0.0854 -0.0522 732 VAL A CA  
748  C C   . VAL A 120 ? 0.3568 0.4268 0.9301 0.0173  -0.1081 -0.0580 732 VAL A C   
749  O O   . VAL A 120 ? 0.3461 0.4046 0.8679 0.0193  -0.1122 -0.0570 732 VAL A O   
750  C CB  . VAL A 120 ? 0.3443 0.4192 0.9435 0.0087  -0.0567 -0.0408 732 VAL A CB  
751  C CG1 . VAL A 120 ? 0.3289 0.3927 0.8695 0.0123  -0.0513 -0.0363 732 VAL A CG1 
752  C CG2 . VAL A 120 ? 0.3431 0.4185 0.9586 0.0021  -0.0332 -0.0327 732 VAL A CG2 
753  N N   . ILE A 121 ? 0.3402 0.4195 0.9497 0.0226  -0.1227 -0.0636 733 ILE A N   
754  C CA  . ILE A 121 ? 0.3709 0.4464 0.9582 0.0324  -0.1453 -0.0677 733 ILE A CA  
755  C C   . ILE A 121 ? 0.4384 0.5040 0.9880 0.0354  -0.1676 -0.0754 733 ILE A C   
756  O O   . ILE A 121 ? 0.4673 0.5213 0.9663 0.0414  -0.1725 -0.0722 733 ILE A O   
757  C CB  . ILE A 121 ? 0.4322 0.5212 1.0737 0.0380  -0.1592 -0.0730 733 ILE A CB  
758  C CG1 . ILE A 121 ? 0.4429 0.5391 1.1123 0.0375  -0.1347 -0.0644 733 ILE A CG1 
759  C CG2 . ILE A 121 ? 0.4568 0.5411 1.0763 0.0497  -0.1886 -0.0782 733 ILE A CG2 
760  C CD1 . ILE A 121 ? 0.5293 0.6141 1.1497 0.0403  -0.1173 -0.0547 733 ILE A CD1 
761  N N   . GLN A 122 ? 0.3835 0.4528 0.9579 0.0313  -0.1787 -0.0852 734 GLN A N   
762  C CA  . GLN A 122 ? 0.3903 0.4502 0.9324 0.0343  -0.1990 -0.0949 734 GLN A CA  
763  C C   . GLN A 122 ? 0.4082 0.4544 0.8939 0.0316  -0.1839 -0.0878 734 GLN A C   
764  O O   . GLN A 122 ? 0.4246 0.4597 0.8642 0.0382  -0.1961 -0.0908 734 GLN A O   
765  C CB  . GLN A 122 ? 0.4140 0.4810 1.0034 0.0291  -0.2112 -0.1079 734 GLN A CB  
766  C CG  . GLN A 122 ? 0.5184 0.5965 1.1555 0.0348  -0.2389 -0.1209 734 GLN A CG  
767  C CD  . GLN A 122 ? 0.5793 0.6634 1.2660 0.0291  -0.2518 -0.1354 734 GLN A CD  
768  O OE1 . GLN A 122 ? 0.4651 0.5559 1.1972 0.0186  -0.2324 -0.1314 734 GLN A OE1 
769  N NE2 . GLN A 122 ? 0.4597 0.5406 1.1391 0.0366  -0.2849 -0.1527 734 GLN A NE2 
770  N N   . LEU A 123 ? 0.3256 0.3725 0.8145 0.0229  -0.1573 -0.0781 735 LEU A N   
771  C CA  . LEU A 123 ? 0.3089 0.3444 0.7504 0.0200  -0.1428 -0.0713 735 LEU A CA  
772  C C   . LEU A 123 ? 0.3749 0.4026 0.7736 0.0253  -0.1375 -0.0632 735 LEU A C   
773  O O   . LEU A 123 ? 0.3886 0.4054 0.7440 0.0278  -0.1393 -0.0624 735 LEU A O   
774  C CB  . LEU A 123 ? 0.2784 0.3162 0.7352 0.0108  -0.1189 -0.0635 735 LEU A CB  
775  C CG  . LEU A 123 ? 0.3084 0.3517 0.8092 0.0046  -0.1205 -0.0692 735 LEU A CG  
776  C CD1 . LEU A 123 ? 0.2875 0.3330 0.8048 -0.0024 -0.0944 -0.0579 735 LEU A CD1 
777  C CD2 . LEU A 123 ? 0.3416 0.3769 0.8242 0.0047  -0.1350 -0.0790 735 LEU A CD2 
778  N N   . VAL A 124 ? 0.3455 0.3783 0.7591 0.0275  -0.1308 -0.0578 736 VAL A N   
779  C CA  . VAL A 124 ? 0.3547 0.3799 0.7360 0.0327  -0.1261 -0.0506 736 VAL A CA  
780  C C   . VAL A 124 ? 0.4270 0.4443 0.7812 0.0426  -0.1478 -0.0541 736 VAL A C   
781  O O   . VAL A 124 ? 0.4323 0.4379 0.7453 0.0462  -0.1446 -0.0483 736 VAL A O   
782  C CB  . VAL A 124 ? 0.4011 0.4337 0.8108 0.0336  -0.1151 -0.0461 736 VAL A CB  
783  C CG1 . VAL A 124 ? 0.3995 0.4233 0.7807 0.0394  -0.1121 -0.0400 736 VAL A CG1 
784  C CG2 . VAL A 124 ? 0.3840 0.4217 0.8103 0.0258  -0.0917 -0.0418 736 VAL A CG2 
785  N N   . GLY A 125 ? 0.3846 0.4078 0.7623 0.0472  -0.1695 -0.0635 737 GLY A N   
786  C CA  . GLY A 125 ? 0.4041 0.4196 0.7548 0.0585  -0.1931 -0.0682 737 GLY A CA  
787  C C   . GLY A 125 ? 0.4743 0.4772 0.7788 0.0597  -0.1950 -0.0703 737 GLY A C   
788  O O   . GLY A 125 ? 0.4996 0.4901 0.7604 0.0687  -0.2000 -0.0661 737 GLY A O   
789  N N   . MET A 126 ? 0.4149 0.4202 0.7293 0.0510  -0.1889 -0.0759 738 MET A N   
790  C CA  . MET A 126 ? 0.4271 0.4215 0.7036 0.0513  -0.1881 -0.0788 738 MET A CA  
791  C C   . MET A 126 ? 0.4622 0.4472 0.7012 0.0499  -0.1674 -0.0659 738 MET A C   
792  O O   . MET A 126 ? 0.4863 0.4591 0.6828 0.0565  -0.1690 -0.0640 738 MET A O   
793  C CB  . MET A 126 ? 0.4493 0.4489 0.7528 0.0417  -0.1841 -0.0863 738 MET A CB  
794  C CG  . MET A 126 ? 0.5116 0.5189 0.8546 0.0425  -0.2060 -0.1016 738 MET A CG  
795  S SD  . MET A 126 ? 0.5579 0.5711 0.9435 0.0297  -0.1962 -0.1067 738 MET A SD  
796  C CE  . MET A 126 ? 0.5194 0.5451 0.9675 0.0300  -0.2186 -0.1210 738 MET A CE  
797  N N   . LEU A 127 ? 0.3786 0.3690 0.6343 0.0420  -0.1481 -0.0574 739 LEU A N   
798  C CA  . LEU A 127 ? 0.3680 0.3515 0.5982 0.0396  -0.1295 -0.0467 739 LEU A CA  
799  C C   . LEU A 127 ? 0.4194 0.3940 0.6248 0.0481  -0.1313 -0.0394 739 LEU A C   
800  O O   . LEU A 127 ? 0.4223 0.3869 0.5977 0.0489  -0.1213 -0.0327 739 LEU A O   
801  C CB  . LEU A 127 ? 0.3442 0.3356 0.5991 0.0311  -0.1122 -0.0419 739 LEU A CB  
802  C CG  . LEU A 127 ? 0.3841 0.3809 0.6560 0.0227  -0.1041 -0.0443 739 LEU A CG  
803  C CD1 . LEU A 127 ? 0.3734 0.3773 0.6679 0.0173  -0.0882 -0.0390 739 LEU A CD1 
804  C CD2 . LEU A 127 ? 0.3648 0.3537 0.6078 0.0203  -0.0978 -0.0429 739 LEU A CD2 
805  N N   . ARG A 128 ? 0.3673 0.3455 0.5885 0.0546  -0.1434 -0.0401 740 ARG A N   
806  C CA  . ARG A 128 ? 0.3898 0.3588 0.5910 0.0639  -0.1462 -0.0320 740 ARG A CA  
807  C C   . ARG A 128 ? 0.4661 0.4213 0.6233 0.0738  -0.1557 -0.0307 740 ARG A C   
808  O O   . ARG A 128 ? 0.4780 0.4209 0.6066 0.0784  -0.1470 -0.0202 740 ARG A O   
809  C CB  . ARG A 128 ? 0.4037 0.3807 0.6365 0.0693  -0.1587 -0.0336 740 ARG A CB  
810  C CG  . ARG A 128 ? 0.4982 0.4666 0.7196 0.0772  -0.1568 -0.0232 740 ARG A CG  
811  C CD  . ARG A 128 ? 0.5242 0.4832 0.7201 0.0918  -0.1772 -0.0215 740 ARG A CD  
812  N NE  . ARG A 128 ? 0.5740 0.5233 0.7608 0.0997  -0.1741 -0.0095 740 ARG A NE  
813  C CZ  . ARG A 128 ? 0.7021 0.6355 0.8498 0.1118  -0.1800 -0.0005 740 ARG A CZ  
814  N NH1 . ARG A 128 ? 0.4493 0.3745 0.5594 0.1181  -0.1892 -0.0029 740 ARG A NH1 
815  N NH2 . ARG A 128 ? 0.5770 0.5013 0.7221 0.1184  -0.1757 0.0114  740 ARG A NH2 
816  N N   . GLY A 129 ? 0.4397 0.3962 0.5926 0.0772  -0.1722 -0.0416 741 GLY A N   
817  C CA  . GLY A 129 ? 0.4740 0.4171 0.5820 0.0878  -0.1817 -0.0433 741 GLY A CA  
818  C C   . GLY A 129 ? 0.5178 0.4512 0.5950 0.0841  -0.1620 -0.0374 741 GLY A C   
819  O O   . GLY A 129 ? 0.5544 0.4736 0.5938 0.0922  -0.1556 -0.0277 741 GLY A O   
820  N N   . ILE A 130 ? 0.4174 0.3580 0.5131 0.0721  -0.1507 -0.0416 742 ILE A N   
821  C CA  . ILE A 130 ? 0.4061 0.3402 0.4817 0.0674  -0.1320 -0.0368 742 ILE A CA  
822  C C   . ILE A 130 ? 0.4903 0.4180 0.5569 0.0667  -0.1149 -0.0223 742 ILE A C   
823  O O   . ILE A 130 ? 0.5105 0.4261 0.5464 0.0714  -0.1051 -0.0149 742 ILE A O   
824  C CB  . ILE A 130 ? 0.4145 0.3588 0.5176 0.0550  -0.1247 -0.0431 742 ILE A CB  
825  C CG1 . ILE A 130 ? 0.4172 0.3655 0.5315 0.0560  -0.1415 -0.0577 742 ILE A CG1 
826  C CG2 . ILE A 130 ? 0.4210 0.3599 0.5081 0.0502  -0.1062 -0.0379 742 ILE A CG2 
827  C CD1 . ILE A 130 ? 0.4847 0.4445 0.6379 0.0445  -0.1372 -0.0625 742 ILE A CD1 
828  N N   . ALA A 131 ? 0.4462 0.3813 0.5407 0.0617  -0.1115 -0.0187 743 ALA A N   
829  C CA  . ALA A 131 ? 0.4386 0.3677 0.5312 0.0608  -0.0975 -0.0073 743 ALA A CA  
830  C C   . ALA A 131 ? 0.4982 0.4132 0.5627 0.0734  -0.1011 0.0022  743 ALA A C   
831  O O   . ALA A 131 ? 0.4977 0.4021 0.5470 0.0742  -0.0866 0.0126  743 ALA A O   
832  C CB  . ALA A 131 ? 0.4221 0.3613 0.5492 0.0550  -0.0953 -0.0080 743 ALA A CB  
833  N N   . ALA A 132 ? 0.4748 0.3891 0.5327 0.0837  -0.1204 -0.0011 744 ALA A N   
834  C CA  . ALA A 132 ? 0.5064 0.4059 0.5323 0.0981  -0.1260 0.0088  744 ALA A CA  
835  C C   . ALA A 132 ? 0.5733 0.4583 0.5543 0.1049  -0.1186 0.0132  744 ALA A C   
836  O O   . ALA A 132 ? 0.5846 0.4549 0.5413 0.1115  -0.1067 0.0275  744 ALA A O   
837  C CB  . ALA A 132 ? 0.5287 0.4320 0.5586 0.1083  -0.1516 0.0023  744 ALA A CB  
838  N N   . GLY A 133 ? 0.5388 0.4278 0.5126 0.1027  -0.1232 0.0014  745 GLY A N   
839  C CA  . GLY A 133 ? 0.5540 0.4309 0.4882 0.1085  -0.1153 0.0024  745 GLY A CA  
840  C C   . GLY A 133 ? 0.5804 0.4532 0.5156 0.1006  -0.0884 0.0126  745 GLY A C   
841  O O   . GLY A 133 ? 0.6007 0.4588 0.5031 0.1083  -0.0752 0.0229  745 GLY A O   
842  N N   . MET A 134 ? 0.4910 0.3765 0.4648 0.0857  -0.0801 0.0098  746 MET A N   
843  C CA  . MET A 134 ? 0.4716 0.3557 0.4548 0.0771  -0.0579 0.0172  746 MET A CA  
844  C C   . MET A 134 ? 0.5274 0.4018 0.5113 0.0793  -0.0461 0.0322  746 MET A C   
845  O O   . MET A 134 ? 0.5316 0.3989 0.5132 0.0771  -0.0273 0.0410  746 MET A O   
846  C CB  . MET A 134 ? 0.4550 0.3547 0.4757 0.0626  -0.0557 0.0092  746 MET A CB  
847  C CG  . MET A 134 ? 0.4824 0.3888 0.5049 0.0582  -0.0581 -0.0018 746 MET A CG  
848  S SD  . MET A 134 ? 0.5542 0.4489 0.5432 0.0646  -0.0468 -0.0002 746 MET A SD  
849  C CE  . MET A 134 ? 0.4933 0.3858 0.4970 0.0570  -0.0222 0.0117  746 MET A CE  
850  N N   . LYS A 135 ? 0.4862 0.3604 0.4777 0.0836  -0.0566 0.0350  747 LYS A N   
851  C CA  . LYS A 135 ? 0.4968 0.3604 0.4912 0.0868  -0.0470 0.0492  747 LYS A CA  
852  C C   . LYS A 135 ? 0.6084 0.4525 0.5615 0.1006  -0.0395 0.0633  747 LYS A C   
853  O O   . LYS A 135 ? 0.6254 0.4582 0.5785 0.1005  -0.0207 0.0771  747 LYS A O   
854  C CB  . LYS A 135 ? 0.5238 0.3927 0.5380 0.0890  -0.0614 0.0474  747 LYS A CB  
855  C CG  . LYS A 135 ? 0.6207 0.4772 0.6383 0.0941  -0.0541 0.0616  747 LYS A CG  
856  C CD  . LYS A 135 ? 0.7978 0.6596 0.8318 0.0992  -0.0711 0.0589  747 LYS A CD  
857  C CE  . LYS A 135 ? 0.9675 0.8130 0.9870 0.1124  -0.0719 0.0744  747 LYS A CE  
858  N NZ  . LYS A 135 ? 1.0917 0.9289 1.1323 0.1073  -0.0541 0.0841  747 LYS A NZ  
859  N N   . TYR A 136 ? 0.5959 0.4356 0.5141 0.1126  -0.0538 0.0595  748 TYR A N   
860  C CA  . TYR A 136 ? 0.6497 0.4698 0.5192 0.1285  -0.0481 0.0717  748 TYR A CA  
861  C C   . TYR A 136 ? 0.6972 0.5110 0.5566 0.1248  -0.0230 0.0773  748 TYR A C   
862  O O   . TYR A 136 ? 0.7132 0.5106 0.5547 0.1314  -0.0038 0.0948  748 TYR A O   
863  C CB  . TYR A 136 ? 0.6991 0.5182 0.5348 0.1415  -0.0723 0.0608  748 TYR A CB  
864  C CG  . TYR A 136 ? 0.7794 0.5768 0.5561 0.1610  -0.0692 0.0722  748 TYR A CG  
865  C CD1 . TYR A 136 ? 0.8385 0.6232 0.5905 0.1767  -0.0802 0.0836  748 TYR A CD1 
866  C CD2 . TYR A 136 ? 0.8153 0.6041 0.5590 0.1651  -0.0552 0.0716  748 TYR A CD2 
867  C CE1 . TYR A 136 ? 0.9081 0.6710 0.5996 0.1968  -0.0775 0.0950  748 TYR A CE1 
868  C CE2 . TYR A 136 ? 0.8914 0.6588 0.5755 0.1848  -0.0507 0.0822  748 TYR A CE2 
869  C CZ  . TYR A 136 ? 0.9966 0.7506 0.6526 0.2010  -0.0620 0.0943  748 TYR A CZ  
870  O OH  . TYR A 136 ? 1.0505 0.7816 0.6423 0.2221  -0.0570 0.1060  748 TYR A OH  
871  N N   . LEU A 137 ? 0.6335 0.4601 0.5086 0.1142  -0.0221 0.0633  749 LEU A N   
872  C CA  . LEU A 137 ? 0.6249 0.4489 0.4982 0.1096  0.0001  0.0660  749 LEU A CA  
873  C C   . LEU A 137 ? 0.6673 0.4907 0.5743 0.0994  0.0214  0.0773  749 LEU A C   
874  O O   . LEU A 137 ? 0.6593 0.4711 0.5563 0.1025  0.0437  0.0899  749 LEU A O   
875  C CB  . LEU A 137 ? 0.5905 0.4293 0.4780 0.1007  -0.0068 0.0479  749 LEU A CB  
876  C CG  . LEU A 137 ? 0.6622 0.4998 0.5181 0.1102  -0.0243 0.0345  749 LEU A CG  
877  C CD1 . LEU A 137 ? 0.6196 0.4698 0.4957 0.1001  -0.0254 0.0195  749 LEU A CD1 
878  C CD2 . LEU A 137 ? 0.7567 0.5745 0.5582 0.1275  -0.0154 0.0425  749 LEU A CD2 
879  N N   . SER A 138 ? 0.6317 0.4672 0.5794 0.0877  0.0147  0.0724  750 SER A N   
880  C CA  . SER A 138 ? 0.6339 0.4696 0.6175 0.0778  0.0301  0.0794  750 SER A CA  
881  C C   . SER A 138 ? 0.7469 0.5636 0.7200 0.0863  0.0444  0.0992  750 SER A C   
882  O O   . SER A 138 ? 0.7523 0.5631 0.7429 0.0818  0.0654  0.1085  750 SER A O   
883  C CB  . SER A 138 ? 0.6677 0.5177 0.6877 0.0672  0.0175  0.0688  750 SER A CB  
884  O OG  . SER A 138 ? 0.8898 0.7344 0.9105 0.0728  0.0092  0.0741  750 SER A OG  
885  N N   . GLU A 139 ? 0.7484 0.5554 0.6948 0.0992  0.0330  0.1059  751 GLU A N   
886  C CA  . GLU A 139 ? 0.7923 0.5788 0.7227 0.1103  0.0445  0.1268  751 GLU A CA  
887  C C   . GLU A 139 ? 0.8956 0.6665 0.8006 0.1170  0.0697  0.1417  751 GLU A C   
888  O O   . GLU A 139 ? 0.9132 0.6714 0.8317 0.1167  0.0912  0.1585  751 GLU A O   
889  C CB  . GLU A 139 ? 0.8435 0.6222 0.7363 0.1267  0.0249  0.1300  751 GLU A CB  
890  C CG  . GLU A 139 ? 0.9627 0.7515 0.8785 0.1249  0.0026  0.1217  751 GLU A CG  
891  C CD  . GLU A 139 ? 1.2839 1.0687 1.1649 0.1410  -0.0208 0.1207  751 GLU A CD  
892  O OE1 . GLU A 139 ? 1.1265 0.8948 0.9593 0.1567  -0.0185 0.1315  751 GLU A OE1 
893  O OE2 . GLU A 139 ? 1.2456 1.0439 1.1478 0.1386  -0.0418 0.1087  751 GLU A OE2 
894  N N   . MET A 140 ? 0.8689 0.6402 0.7383 0.1235  0.0679  0.1353  752 MET A N   
895  C CA  . MET A 140 ? 0.9016 0.6589 0.7395 0.1321  0.0913  0.1468  752 MET A CA  
896  C C   . MET A 140 ? 0.8900 0.6566 0.7639 0.1182  0.1112  0.1430  752 MET A C   
897  O O   . MET A 140 ? 0.9159 0.6740 0.7684 0.1243  0.1312  0.1494  752 MET A O   
898  C CB  . MET A 140 ? 0.9682 0.7217 0.7511 0.1464  0.0775  0.1383  752 MET A CB  
899  C CG  . MET A 140 ? 1.0740 0.8106 0.8081 0.1660  0.0657  0.1485  752 MET A CG  
900  S SD  . MET A 140 ? 1.1905 0.9183 0.8548 0.1850  0.0537  0.1387  752 MET A SD  
901  C CE  . MET A 140 ? 1.1951 0.9084 0.8165 0.2054  0.0300  0.1472  752 MET A CE  
902  N N   . ASN A 141 ? 0.7689 0.5523 0.6966 0.1008  0.1060  0.1323  753 ASN A N   
903  C CA  . ASN A 141 ? 0.7239 0.5188 0.6923 0.0869  0.1194  0.1263  753 ASN A CA  
904  C C   . ASN A 141 ? 0.7319 0.5345 0.6819 0.0881  0.1178  0.1142  753 ASN A C   
905  O O   . ASN A 141 ? 0.7406 0.5431 0.7013 0.0858  0.1377  0.1170  753 ASN A O   
906  C CB  . ASN A 141 ? 0.7533 0.5363 0.7456 0.0852  0.1495  0.1446  753 ASN A CB  
907  C CG  . ASN A 141 ? 1.0195 0.8161 1.0697 0.0688  0.1583  0.1374  753 ASN A CG  
908  O OD1 . ASN A 141 ? 0.8616 0.6762 0.9308 0.0592  0.1440  0.1195  753 ASN A OD1 
909  N ND2 . ASN A 141 ? 0.9533 0.7408 1.0341 0.0658  0.1819  0.1517  753 ASN A ND2 
910  N N   . TYR A 142 ? 0.6428 0.4519 0.5683 0.0920  0.0940  0.1004  754 TYR A N   
911  C CA  . TYR A 142 ? 0.6327 0.4485 0.5428 0.0931  0.0890  0.0868  754 TYR A CA  
912  C C   . TYR A 142 ? 0.6053 0.4421 0.5548 0.0782  0.0738  0.0698  754 TYR A C   
913  O O   . TYR A 142 ? 0.5589 0.4038 0.5172 0.0746  0.0535  0.0620  754 TYR A O   
914  C CB  . TYR A 142 ? 0.6840 0.4914 0.5411 0.1084  0.0728  0.0818  754 TYR A CB  
915  C CG  . TYR A 142 ? 0.7153 0.5271 0.5563 0.1106  0.0689  0.0671  754 TYR A CG  
916  C CD1 . TYR A 142 ? 0.7800 0.5799 0.5922 0.1200  0.0898  0.0723  754 TYR A CD1 
917  C CD2 . TYR A 142 ? 0.6906 0.5178 0.5481 0.1031  0.0465  0.0482  754 TYR A CD2 
918  C CE1 . TYR A 142 ? 0.7881 0.5913 0.5878 0.1221  0.0869  0.0575  754 TYR A CE1 
919  C CE2 . TYR A 142 ? 0.7102 0.5406 0.5577 0.1045  0.0434  0.0345  754 TYR A CE2 
920  C CZ  . TYR A 142 ? 0.8587 0.6770 0.6769 0.1142  0.0628  0.0383  754 TYR A CZ  
921  O OH  . TYR A 142 ? 0.8744 0.6947 0.6830 0.1164  0.0599  0.0236  754 TYR A OH  
922  N N   . VAL A 143 ? 0.5466 0.3916 0.5189 0.0706  0.0842  0.0647  755 VAL A N   
923  C CA  . VAL A 143 ? 0.5044 0.3677 0.5105 0.0581  0.0717  0.0502  755 VAL A CA  
924  C C   . VAL A 143 ? 0.5672 0.4335 0.5519 0.0624  0.0626  0.0379  755 VAL A C   
925  O O   . VAL A 143 ? 0.5893 0.4492 0.5578 0.0684  0.0765  0.0391  755 VAL A O   
926  C CB  . VAL A 143 ? 0.5276 0.3990 0.5786 0.0468  0.0854  0.0518  755 VAL A CB  
927  C CG1 . VAL A 143 ? 0.4875 0.3763 0.5677 0.0358  0.0697  0.0379  755 VAL A CG1 
928  C CG2 . VAL A 143 ? 0.5214 0.3872 0.5945 0.0434  0.0948  0.0633  755 VAL A CG2 
929  N N   . HIS A 144 ? 0.5142 0.3890 0.4998 0.0599  0.0403  0.0260  756 HIS A N   
930  C CA  . HIS A 144 ? 0.5119 0.3895 0.4829 0.0631  0.0287  0.0127  756 HIS A CA  
931  C C   . HIS A 144 ? 0.5256 0.4126 0.5219 0.0554  0.0350  0.0061  756 HIS A C   
932  O O   . HIS A 144 ? 0.5306 0.4127 0.5103 0.0613  0.0408  0.0014  756 HIS A O   
933  C CB  . HIS A 144 ? 0.5084 0.3930 0.4819 0.0617  0.0046  0.0032  756 HIS A CB  
934  C CG  . HIS A 144 ? 0.5596 0.4441 0.5172 0.0666  -0.0094 -0.0106 756 HIS A CG  
935  N ND1 . HIS A 144 ? 0.5620 0.4535 0.5362 0.0611  -0.0092 -0.0202 756 HIS A ND1 
936  C CD2 . HIS A 144 ? 0.6019 0.4804 0.5328 0.0764  -0.0255 -0.0171 756 HIS A CD2 
937  C CE1 . HIS A 144 ? 0.5707 0.4594 0.5286 0.0672  -0.0237 -0.0324 756 HIS A CE1 
938  N NE2 . HIS A 144 ? 0.6027 0.4839 0.5343 0.0765  -0.0348 -0.0318 756 HIS A NE2 
939  N N   . ARG A 145 ? 0.4436 0.3432 0.4785 0.0433  0.0331  0.0053  757 ARG A N   
940  C CA  . ARG A 145 ? 0.4185 0.3283 0.4820 0.0357  0.0365  0.0001  757 ARG A CA  
941  C C   . ARG A 145 ? 0.4491 0.3658 0.5161 0.0337  0.0216  -0.0119 757 ARG A C   
942  O O   . ARG A 145 ? 0.4203 0.3454 0.5114 0.0278  0.0219  -0.0154 757 ARG A O   
943  C CB  . ARG A 145 ? 0.4278 0.3329 0.4922 0.0392  0.0569  0.0044  757 ARG A CB  
944  C CG  . ARG A 145 ? 0.6238 0.5234 0.6975 0.0391  0.0751  0.0174  757 ARG A CG  
945  C CD  . ARG A 145 ? 0.7723 0.6692 0.8548 0.0416  0.0970  0.0215  757 ARG A CD  
946  N NE  . ARG A 145 ? 0.8741 0.7676 0.9777 0.0393  0.1151  0.0342  757 ARG A NE  
947  C CZ  . ARG A 145 ? 1.0006 0.8997 1.1408 0.0347  0.1303  0.0370  757 ARG A CZ  
948  N NH1 . ARG A 145 ? 0.7554 0.6635 0.9130 0.0327  0.1296  0.0287  757 ARG A NH1 
949  N NH2 . ARG A 145 ? 0.8164 0.7119 0.9800 0.0322  0.1462  0.0483  757 ARG A NH2 
950  N N   . ASP A 146 ? 0.4160 0.3289 0.4617 0.0390  0.0083  -0.0182 758 ASP A N   
951  C CA  . ASP A 146 ? 0.3999 0.3178 0.4522 0.0373  -0.0049 -0.0297 758 ASP A CA  
952  C C   . ASP A 146 ? 0.4400 0.3599 0.4897 0.0376  -0.0229 -0.0346 758 ASP A C   
953  O O   . ASP A 146 ? 0.4527 0.3703 0.4945 0.0415  -0.0344 -0.0447 758 ASP A O   
954  C CB  . ASP A 146 ? 0.4364 0.3461 0.4694 0.0451  -0.0005 -0.0370 758 ASP A CB  
955  C CG  . ASP A 146 ? 0.5306 0.4450 0.5797 0.0420  -0.0095 -0.0484 758 ASP A CG  
956  O OD1 . ASP A 146 ? 0.4881 0.4126 0.5656 0.0332  -0.0158 -0.0480 758 ASP A OD1 
957  O OD2 . ASP A 146 ? 0.6736 0.5803 0.7056 0.0491  -0.0104 -0.0576 758 ASP A OD2 
958  N N   . LEU A 147 ? 0.3595 0.2840 0.4200 0.0334  -0.0256 -0.0284 759 LEU A N   
959  C CA  . LEU A 147 ? 0.3399 0.2678 0.4039 0.0335  -0.0406 -0.0320 759 LEU A CA  
960  C C   . LEU A 147 ? 0.3757 0.3138 0.4674 0.0259  -0.0476 -0.0378 759 LEU A C   
961  O O   . LEU A 147 ? 0.3560 0.3011 0.4671 0.0187  -0.0426 -0.0338 759 LEU A O   
962  C CB  . LEU A 147 ? 0.3255 0.2533 0.3909 0.0331  -0.0388 -0.0231 759 LEU A CB  
963  C CG  . LEU A 147 ? 0.3704 0.3019 0.4419 0.0342  -0.0527 -0.0253 759 LEU A CG  
964  C CD1 . LEU A 147 ? 0.3982 0.3223 0.4459 0.0446  -0.0649 -0.0304 759 LEU A CD1 
965  C CD2 . LEU A 147 ? 0.3428 0.2742 0.4204 0.0328  -0.0479 -0.0166 759 LEU A CD2 
966  N N   . ALA A 148 ? 0.3616 0.2994 0.4543 0.0282  -0.0592 -0.0475 760 ALA A N   
967  C CA  . ALA A 148 ? 0.3416 0.2866 0.4615 0.0221  -0.0652 -0.0530 760 ALA A CA  
968  C C   . ALA A 148 ? 0.4009 0.3448 0.5229 0.0261  -0.0814 -0.0637 760 ALA A C   
969  O O   . ALA A 148 ? 0.4156 0.3512 0.5118 0.0349  -0.0879 -0.0693 760 ALA A O   
970  C CB  . ALA A 148 ? 0.3395 0.2831 0.4642 0.0203  -0.0585 -0.0557 760 ALA A CB  
971  N N   . ALA A 149 ? 0.3532 0.3048 0.5061 0.0206  -0.0880 -0.0668 761 ALA A N   
972  C CA  . ALA A 149 ? 0.3763 0.3284 0.5409 0.0234  -0.1050 -0.0784 761 ALA A CA  
973  C C   . ALA A 149 ? 0.4625 0.4060 0.6138 0.0293  -0.1136 -0.0920 761 ALA A C   
974  O O   . ALA A 149 ? 0.4734 0.4139 0.6196 0.0356  -0.1304 -0.1033 761 ALA A O   
975  C CB  . ALA A 149 ? 0.3656 0.3273 0.5720 0.0155  -0.1065 -0.0781 761 ALA A CB  
976  N N   . ARG A 150 ? 0.4253 0.3642 0.5696 0.0283  -0.1028 -0.0917 762 ARG A N   
977  C CA  . ARG A 150 ? 0.4407 0.3702 0.5703 0.0344  -0.1074 -0.1048 762 ARG A CA  
978  C C   . ARG A 150 ? 0.5190 0.4377 0.6024 0.0467  -0.1101 -0.1082 762 ARG A C   
979  O O   . ARG A 150 ? 0.5429 0.4525 0.6085 0.0545  -0.1181 -0.1220 762 ARG A O   
980  C CB  . ARG A 150 ? 0.4226 0.3509 0.5600 0.0305  -0.0934 -0.1019 762 ARG A CB  
981  C CG  . ARG A 150 ? 0.4967 0.4240 0.6140 0.0313  -0.0763 -0.0896 762 ARG A CG  
982  C CD  . ARG A 150 ? 0.3893 0.3151 0.5141 0.0295  -0.0643 -0.0885 762 ARG A CD  
983  N NE  . ARG A 150 ? 0.4114 0.3403 0.5301 0.0278  -0.0496 -0.0755 762 ARG A NE  
984  C CZ  . ARG A 150 ? 0.5115 0.4491 0.6492 0.0204  -0.0454 -0.0650 762 ARG A CZ  
985  N NH1 . ARG A 150 ? 0.3386 0.2823 0.5002 0.0145  -0.0518 -0.0640 762 ARG A NH1 
986  N NH2 . ARG A 150 ? 0.3916 0.3314 0.5252 0.0193  -0.0345 -0.0557 762 ARG A NH2 
987  N N   . ASN A 151 ? 0.4841 0.4027 0.5477 0.0489  -0.1019 -0.0953 763 ASN A N   
988  C CA  . ASN A 151 ? 0.5108 0.4183 0.5299 0.0608  -0.1006 -0.0931 763 ASN A CA  
989  C C   . ASN A 151 ? 0.5556 0.4641 0.5682 0.0655  -0.1151 -0.0917 763 ASN A C   
990  O O   . ASN A 151 ? 0.5831 0.4839 0.5636 0.0739  -0.1115 -0.0834 763 ASN A O   
991  C CB  . ASN A 151 ? 0.5069 0.4117 0.5123 0.0600  -0.0778 -0.0782 763 ASN A CB  
992  C CG  . ASN A 151 ? 0.7189 0.6180 0.7157 0.0620  -0.0647 -0.0815 763 ASN A CG  
993  O OD1 . ASN A 151 ? 0.7104 0.6011 0.6892 0.0697  -0.0708 -0.0945 763 ASN A OD1 
994  N ND2 . ASN A 151 ? 0.5234 0.4267 0.5341 0.0555  -0.0471 -0.0709 763 ASN A ND2 
995  N N   . ILE A 152 ? 0.4820 0.3998 0.5279 0.0604  -0.1306 -0.0988 764 ILE A N   
996  C CA  . ILE A 152 ? 0.4785 0.3991 0.5269 0.0649  -0.1472 -0.0998 764 ILE A CA  
997  C C   . ILE A 152 ? 0.5418 0.4612 0.5976 0.0699  -0.1710 -0.1196 764 ILE A C   
998  O O   . ILE A 152 ? 0.5155 0.4407 0.6064 0.0620  -0.1742 -0.1286 764 ILE A O   
999  C CB  . ILE A 152 ? 0.4728 0.4068 0.5599 0.0547  -0.1435 -0.0904 764 ILE A CB  
1000 C CG1 . ILE A 152 ? 0.4585 0.3940 0.5435 0.0484  -0.1209 -0.0740 764 ILE A CG1 
1001 C CG2 . ILE A 152 ? 0.4704 0.4072 0.5611 0.0606  -0.1601 -0.0912 764 ILE A CG2 
1002 C CD1 . ILE A 152 ? 0.5805 0.5063 0.6289 0.0557  -0.1113 -0.0631 764 ILE A CD1 
1003 N N   . LEU A 153 ? 0.5332 0.4440 0.5557 0.0836  -0.1879 -0.1264 765 LEU A N   
1004 C CA  . LEU A 153 ? 0.5767 0.4855 0.6037 0.0902  -0.2146 -0.1475 765 LEU A CA  
1005 C C   . LEU A 153 ? 0.6237 0.5425 0.6792 0.0911  -0.2358 -0.1501 765 LEU A C   
1006 O O   . LEU A 153 ? 0.5987 0.5189 0.6444 0.0941  -0.2326 -0.1365 765 LEU A O   
1007 C CB  . LEU A 153 ? 0.6356 0.5267 0.6025 0.1072  -0.2218 -0.1565 765 LEU A CB  
1008 C CG  . LEU A 153 ? 0.7071 0.5883 0.6511 0.1080  -0.2044 -0.1597 765 LEU A CG  
1009 C CD1 . LEU A 153 ? 0.7653 0.6281 0.6416 0.1262  -0.2030 -0.1606 765 LEU A CD1 
1010 C CD2 . LEU A 153 ? 0.7346 0.6174 0.7091 0.1034  -0.2164 -0.1808 765 LEU A CD2 
1011 N N   . VAL A 154 ? 0.5920 0.5181 0.6887 0.0878  -0.2561 -0.1674 766 VAL A N   
1012 C CA  . VAL A 154 ? 0.5940 0.5319 0.7301 0.0874  -0.2764 -0.1720 766 VAL A CA  
1013 C C   . VAL A 154 ? 0.7113 0.6440 0.8387 0.0999  -0.3105 -0.1950 766 VAL A C   
1014 O O   . VAL A 154 ? 0.7316 0.6582 0.8585 0.1009  -0.3190 -0.2126 766 VAL A O   
1015 C CB  . VAL A 154 ? 0.6000 0.5541 0.8065 0.0706  -0.2683 -0.1702 766 VAL A CB  
1016 C CG1 . VAL A 154 ? 0.5859 0.5534 0.8350 0.0696  -0.2820 -0.1699 766 VAL A CG1 
1017 C CG2 . VAL A 154 ? 0.5621 0.5186 0.7706 0.0595  -0.2361 -0.1509 766 VAL A CG2 
1018 N N   . ASN A 155 ? 0.6927 0.6274 0.8144 0.1101  -0.3312 -0.1959 767 ASN A N   
1019 C CA  . ASN A 155 ? 0.7309 0.6615 0.8450 0.1235  -0.3679 -0.2183 767 ASN A CA  
1020 C C   . ASN A 155 ? 0.7775 0.7262 0.9693 0.1155  -0.3887 -0.2310 767 ASN A C   
1021 O O   . ASN A 155 ? 0.7278 0.6904 0.9744 0.0997  -0.3705 -0.2208 767 ASN A O   
1022 C CB  . ASN A 155 ? 0.7360 0.6547 0.7876 0.1432  -0.3804 -0.2122 767 ASN A CB  
1023 C CG  . ASN A 155 ? 0.9247 0.8528 0.9943 0.1444  -0.3829 -0.1969 767 ASN A CG  
1024 O OD1 . ASN A 155 ? 0.7837 0.7285 0.9133 0.1305  -0.3739 -0.1900 767 ASN A OD1 
1025 N ND2 . ASN A 155 ? 0.8275 0.7438 0.8435 0.1624  -0.3947 -0.1910 767 ASN A ND2 
1026 N N   . SER A 156 ? 0.7709 0.7188 0.9676 0.1270  -0.4264 -0.2533 768 SER A N   
1027 C CA  . SER A 156 ? 0.7568 0.7215 1.0304 0.1213  -0.4509 -0.2687 768 SER A CA  
1028 C C   . SER A 156 ? 0.7680 0.7496 1.0867 0.1159  -0.4457 -0.2526 768 SER A C   
1029 O O   . SER A 156 ? 0.7381 0.7364 1.1340 0.1044  -0.4488 -0.2577 768 SER A O   
1030 C CB  . SER A 156 ? 0.8524 0.8109 1.1118 0.1378  -0.4950 -0.2964 768 SER A CB  
1031 O OG  . SER A 156 ? 1.0210 0.9702 1.2190 0.1570  -0.5094 -0.2900 768 SER A OG  
1032 N N   . ASN A 157 ? 0.7227 0.6992 0.9956 0.1244  -0.4360 -0.2330 769 ASN A N   
1033 C CA  . ASN A 157 ? 0.6923 0.6820 0.9987 0.1214  -0.4291 -0.2168 769 ASN A CA  
1034 C C   . ASN A 157 ? 0.7110 0.7052 1.0285 0.1063  -0.3874 -0.1935 769 ASN A C   
1035 O O   . ASN A 157 ? 0.6910 0.6923 1.0223 0.1051  -0.3766 -0.1780 769 ASN A O   
1036 C CB  . ASN A 157 ? 0.7138 0.6941 0.9673 0.1405  -0.4454 -0.2098 769 ASN A CB  
1037 C CG  . ASN A 157 ? 0.9429 0.9214 1.1924 0.1568  -0.4903 -0.2323 769 ASN A CG  
1038 O OD1 . ASN A 157 ? 0.9081 0.8687 1.0889 0.1735  -0.5059 -0.2391 769 ASN A OD1 
1039 N ND2 . ASN A 157 ? 0.8060 0.8027 1.1295 0.1529  -0.5122 -0.2449 769 ASN A ND2 
1040 N N   . LEU A 158 ? 0.6601 0.6497 0.9715 0.0957  -0.3654 -0.1922 770 LEU A N   
1041 C CA  . LEU A 158 ? 0.6158 0.6081 0.9341 0.0818  -0.3280 -0.1734 770 LEU A CA  
1042 C C   . LEU A 158 ? 0.6646 0.6473 0.9279 0.0867  -0.3081 -0.1528 770 LEU A C   
1043 O O   . LEU A 158 ? 0.6290 0.6157 0.9016 0.0768  -0.2808 -0.1370 770 LEU A O   
1044 C CB  . LEU A 158 ? 0.5783 0.5890 0.9713 0.0680  -0.3165 -0.1685 770 LEU A CB  
1045 C CG  . LEU A 158 ? 0.6479 0.6694 1.1078 0.0624  -0.3349 -0.1873 770 LEU A CG  
1046 C CD1 . LEU A 158 ? 0.6202 0.6593 1.1513 0.0510  -0.3206 -0.1792 770 LEU A CD1 
1047 C CD2 . LEU A 158 ? 0.6845 0.6986 1.1430 0.0565  -0.3320 -0.1980 770 LEU A CD2 
1048 N N   . VAL A 159 ? 0.6416 0.6102 0.8461 0.1026  -0.3215 -0.1533 771 VAL A N   
1049 C CA  . VAL A 159 ? 0.6321 0.5888 0.7834 0.1086  -0.3033 -0.1343 771 VAL A CA  
1050 C C   . VAL A 159 ? 0.6690 0.6161 0.7891 0.1028  -0.2794 -0.1299 771 VAL A C   
1051 O O   . VAL A 159 ? 0.6934 0.6323 0.7911 0.1072  -0.2878 -0.1431 771 VAL A O   
1052 C CB  . VAL A 159 ? 0.7158 0.6594 0.8155 0.1288  -0.3244 -0.1344 771 VAL A CB  
1053 C CG1 . VAL A 159 ? 0.7177 0.6477 0.7670 0.1341  -0.3020 -0.1127 771 VAL A CG1 
1054 C CG2 . VAL A 159 ? 0.7155 0.6699 0.8512 0.1350  -0.3506 -0.1395 771 VAL A CG2 
1055 N N   . CYS A 160 ? 0.5835 0.5322 0.7058 0.0932  -0.2509 -0.1129 772 CYS A N   
1056 C CA  . CYS A 160 ? 0.5722 0.5142 0.6726 0.0869  -0.2269 -0.1067 772 CYS A CA  
1057 C C   . CYS A 160 ? 0.6340 0.5599 0.6755 0.0972  -0.2164 -0.0954 772 CYS A C   
1058 O O   . CYS A 160 ? 0.6254 0.5480 0.6540 0.1023  -0.2129 -0.0824 772 CYS A O   
1059 C CB  . CYS A 160 ? 0.5303 0.4831 0.6671 0.0716  -0.2041 -0.0960 772 CYS A CB  
1060 S SG  . CYS A 160 ? 0.5523 0.5217 0.7567 0.0592  -0.2094 -0.1064 772 CYS A SG  
1061 N N   . LYS A 161 ? 0.5967 0.5118 0.6048 0.1004  -0.2097 -0.0996 773 LYS A N   
1062 C CA  . LYS A 161 ? 0.6161 0.5148 0.5689 0.1108  -0.1967 -0.0886 773 LYS A CA  
1063 C C   . LYS A 161 ? 0.6437 0.5394 0.5899 0.1029  -0.1700 -0.0820 773 LYS A C   
1064 O O   . LYS A 161 ? 0.6219 0.5196 0.5789 0.0978  -0.1694 -0.0932 773 LYS A O   
1065 C CB  . LYS A 161 ? 0.6891 0.5736 0.5939 0.1289  -0.2165 -0.0999 773 LYS A CB  
1066 C CG  . LYS A 161 ? 0.7949 0.6810 0.7009 0.1396  -0.2447 -0.1047 773 LYS A CG  
1067 C CD  . LYS A 161 ? 0.9492 0.8180 0.7955 0.1606  -0.2625 -0.1119 773 LYS A CD  
1068 C CE  . LYS A 161 ? 1.0926 0.9653 0.9477 0.1709  -0.2963 -0.1208 773 LYS A CE  
1069 N NZ  . LYS A 161 ? 1.2512 1.1047 1.0394 0.1937  -0.3075 -0.1156 773 LYS A NZ  
1070 N N   . VAL A 162 ? 0.6088 0.4991 0.5395 0.1024  -0.1487 -0.0642 774 VAL A N   
1071 C CA  . VAL A 162 ? 0.5959 0.4835 0.5225 0.0959  -0.1236 -0.0568 774 VAL A CA  
1072 C C   . VAL A 162 ? 0.6991 0.5724 0.5816 0.1074  -0.1210 -0.0630 774 VAL A C   
1073 O O   . VAL A 162 ? 0.7296 0.5889 0.5678 0.1224  -0.1246 -0.0596 774 VAL A O   
1074 C CB  . VAL A 162 ? 0.6318 0.5176 0.5597 0.0921  -0.1029 -0.0375 774 VAL A CB  
1075 C CG1 . VAL A 162 ? 0.6137 0.4975 0.5416 0.0860  -0.0790 -0.0317 774 VAL A CG1 
1076 C CG2 . VAL A 162 ? 0.5917 0.4912 0.5620 0.0814  -0.1054 -0.0341 774 VAL A CG2 
1077 N N   . SER A 163 ? 0.6622 0.5382 0.5565 0.1013  -0.1151 -0.0724 775 SER A N   
1078 C CA  . SER A 163 ? 0.6961 0.5598 0.5551 0.1109  -0.1113 -0.0812 775 SER A CA  
1079 C C   . SER A 163 ? 0.7367 0.6001 0.6016 0.1043  -0.0842 -0.0732 775 SER A C   
1080 O O   . SER A 163 ? 0.6975 0.5712 0.5961 0.0917  -0.0722 -0.0632 775 SER A O   
1081 C CB  . SER A 163 ? 0.7463 0.6134 0.6201 0.1104  -0.1324 -0.1034 775 SER A CB  
1082 O OG  . SER A 163 ? 0.9383 0.7918 0.7743 0.1219  -0.1319 -0.1150 775 SER A OG  
1083 N N   . ASP A 164 ? 0.7220 0.5732 0.5535 0.1140  -0.0756 -0.0789 776 ASP A N   
1084 C CA  . ASP A 164 ? 0.7205 0.5695 0.5537 0.1113  -0.0510 -0.0747 776 ASP A CA  
1085 C C   . ASP A 164 ? 0.8240 0.6569 0.6112 0.1267  -0.0486 -0.0857 776 ASP A C   
1086 O O   . ASP A 164 ? 0.8625 0.6836 0.6070 0.1413  -0.0620 -0.0910 776 ASP A O   
1087 C CB  . ASP A 164 ? 0.7362 0.5843 0.5707 0.1084  -0.0260 -0.0531 776 ASP A CB  
1088 C CG  . ASP A 164 ? 0.8070 0.6614 0.6703 0.0990  -0.0045 -0.0486 776 ASP A CG  
1089 O OD1 . ASP A 164 ? 0.7913 0.6541 0.6820 0.0915  -0.0101 -0.0599 776 ASP A OD1 
1090 O OD2 . ASP A 164 ? 0.8654 0.7165 0.7273 0.0990  0.0175  -0.0336 776 ASP A OD2 
1091 N N   . PHE A 165 ? 0.7834 0.6155 0.5781 0.1247  -0.0316 -0.0892 777 PHE A N   
1092 C CA  . PHE A 165 ? 0.8336 0.6508 0.5890 0.1387  -0.0245 -0.1006 777 PHE A CA  
1093 C C   . PHE A 165 ? 0.9358 0.7483 0.6783 0.1457  -0.0531 -0.1255 777 PHE A C   
1094 O O   . PHE A 165 ? 0.9913 0.7874 0.6830 0.1628  -0.0568 -0.1362 777 PHE A O   
1095 C CB  . PHE A 165 ? 0.9000 0.6998 0.6002 0.1548  -0.0046 -0.0871 777 PHE A CB  
1096 C CG  . PHE A 165 ? 0.8953 0.6981 0.6069 0.1493  0.0163  -0.0620 777 PHE A CG  
1097 C CD1 . PHE A 165 ? 0.8928 0.7041 0.6418 0.1382  0.0405  -0.0513 777 PHE A CD1 
1098 C CD2 . PHE A 165 ? 0.9323 0.7288 0.6193 0.1558  0.0109  -0.0496 777 PHE A CD2 
1099 C CE1 . PHE A 165 ? 0.8859 0.6995 0.6497 0.1328  0.0584  -0.0301 777 PHE A CE1 
1100 C CE2 . PHE A 165 ? 0.9481 0.7460 0.6491 0.1505  0.0305  -0.0271 777 PHE A CE2 
1101 C CZ  . PHE A 165 ? 0.8871 0.6936 0.6275 0.1387  0.0538  -0.0183 777 PHE A CZ  
1102 N N   . GLY A 166 ? 0.8613 0.6876 0.6509 0.1328  -0.0724 -0.1346 778 GLY A N   
1103 C CA  . GLY A 166 ? 0.8795 0.7043 0.6737 0.1357  -0.1003 -0.1584 778 GLY A CA  
1104 C C   . GLY A 166 ? 0.9158 0.7516 0.7651 0.1214  -0.1027 -0.1673 778 GLY A C   
1105 O O   . GLY A 166 ? 0.8917 0.7423 0.7858 0.1064  -0.0992 -0.1560 778 GLY A O   
1106 N N   . LEU A 167 ? 0.8837 0.7110 0.7277 0.1270  -0.1074 -0.1873 779 LEU A N   
1107 C CA  . LEU A 167 ? 0.8556 0.6887 0.7472 0.1166  -0.1099 -0.1985 779 LEU A CA  
1108 C C   . LEU A 167 ? 0.8846 0.7264 0.8083 0.1053  -0.0849 -0.1827 779 LEU A C   
1109 O O   . LEU A 167 ? 0.8347 0.6887 0.7817 0.0947  -0.0771 -0.1640 779 LEU A O   
1110 C CB  . LEU A 167 ? 0.8265 0.6700 0.7648 0.1062  -0.1347 -0.2075 779 LEU A CB  
1111 C CG  . LEU A 167 ? 0.9183 0.7544 0.8438 0.1155  -0.1651 -0.2314 779 LEU A CG  
1112 C CD1 . LEU A 167 ? 0.8888 0.7374 0.8742 0.1026  -0.1840 -0.2377 779 LEU A CD1 
1113 C CD2 . LEU A 167 ? 0.9808 0.8013 0.8828 0.1269  -0.1689 -0.2546 779 LEU A CD2 
1114 N N   . SER A 168 ? 0.8710 0.7062 0.7972 0.1084  -0.0742 -0.1921 780 SER A N   
1115 C CA  . SER A 168 ? 0.8443 0.6862 0.8026 0.1000  -0.0532 -0.1814 780 SER A CA  
1116 C C   . SER A 168 ? 0.8584 0.7132 0.8741 0.0845  -0.0622 -0.1787 780 SER A C   
1117 O O   . SER A 168 ? 0.8400 0.7059 0.8824 0.0748  -0.0501 -0.1615 780 SER A O   
1118 C CB  . SER A 168 ? 0.9255 0.7553 0.8711 0.1094  -0.0427 -0.1957 780 SER A CB  
1119 O OG  . SER A 168 ? 1.0994 0.9181 0.9940 0.1233  -0.0257 -0.1923 780 SER A OG  
1120 N N   . ARG A 169 ? 0.8000 0.6528 0.8349 0.0829  -0.0833 -0.1956 781 ARG A N   
1121 C CA  . ARG A 169 ? 0.7591 0.6219 0.8483 0.0694  -0.0913 -0.1931 781 ARG A CA  
1122 C C   . ARG A 169 ? 0.7779 0.6534 0.8810 0.0607  -0.0972 -0.1782 781 ARG A C   
1123 O O   . ARG A 169 ? 0.7890 0.6639 0.8645 0.0658  -0.1055 -0.1781 781 ARG A O   
1124 C CB  . ARG A 169 ? 0.7826 0.6379 0.8914 0.0708  -0.1109 -0.2166 781 ARG A CB  
1125 N N   . PHE A 170 ? 0.6836 0.5697 0.8281 0.0487  -0.0923 -0.1655 782 PHE A N   
1126 C CA  . PHE A 170 ? 0.6437 0.5419 0.8062 0.0399  -0.0948 -0.1511 782 PHE A CA  
1127 C C   . PHE A 170 ? 0.6722 0.5765 0.8833 0.0293  -0.0938 -0.1454 782 PHE A C   
1128 O O   . PHE A 170 ? 0.6860 0.5851 0.9147 0.0290  -0.0901 -0.1507 782 PHE A O   
1129 C CB  . PHE A 170 ? 0.6464 0.5503 0.7882 0.0393  -0.0797 -0.1325 782 PHE A CB  
1130 C CG  . PHE A 170 ? 0.6475 0.5523 0.7938 0.0380  -0.0618 -0.1234 782 PHE A CG  
1131 C CD1 . PHE A 170 ? 0.6957 0.5925 0.8152 0.0466  -0.0508 -0.1274 782 PHE A CD1 
1132 C CD2 . PHE A 170 ? 0.6303 0.5440 0.8078 0.0291  -0.0557 -0.1106 782 PHE A CD2 
1133 C CE1 . PHE A 170 ? 0.6889 0.5879 0.8193 0.0454  -0.0347 -0.1197 782 PHE A CE1 
1134 C CE2 . PHE A 170 ? 0.6510 0.5662 0.8356 0.0287  -0.0422 -0.1034 782 PHE A CE2 
1135 C CZ  . PHE A 170 ? 0.6446 0.5533 0.8086 0.0364  -0.0320 -0.1081 782 PHE A CZ  
1136 N N   . LEU A 171 ? 0.5941 0.5083 0.8262 0.0216  -0.0957 -0.1340 783 LEU A N   
1137 C CA  . LEU A 171 ? 0.5622 0.4813 0.8370 0.0127  -0.0925 -0.1256 783 LEU A CA  
1138 C C   . LEU A 171 ? 0.5622 0.4841 0.8391 0.0100  -0.0765 -0.1097 783 LEU A C   
1139 O O   . LEU A 171 ? 0.5278 0.4554 0.7854 0.0099  -0.0688 -0.0979 783 LEU A O   
1140 C CB  . LEU A 171 ? 0.5513 0.4794 0.8459 0.0067  -0.0975 -0.1186 783 LEU A CB  
1141 C CG  . LEU A 171 ? 0.6284 0.5557 0.9400 0.0075  -0.1157 -0.1345 783 LEU A CG  
1142 C CD1 . LEU A 171 ? 0.6219 0.5599 0.9532 0.0022  -0.1174 -0.1254 783 LEU A CD1 
1143 C CD2 . LEU A 171 ? 0.6531 0.5743 1.0027 0.0048  -0.1217 -0.1465 783 LEU A CD2 
1144 N N   . GLU A 172 ? 0.4993 0.4167 0.8013 0.0084  -0.0728 -0.1101 784 GLU A N   
1145 C CA  . GLU A 172 ? 0.4798 0.3995 0.7877 0.0070  -0.0604 -0.0958 784 GLU A CA  
1146 C C   . GLU A 172 ? 0.4930 0.4140 0.8362 0.0009  -0.0578 -0.0841 784 GLU A C   
1147 O O   . GLU A 172 ? 0.4975 0.4113 0.8667 0.0005  -0.0583 -0.0883 784 GLU A O   
1148 C CB  . GLU A 172 ? 0.5087 0.4211 0.8094 0.0130  -0.0552 -0.1038 784 GLU A CB  
1149 C CG  . GLU A 172 ? 0.6181 0.5349 0.9197 0.0132  -0.0438 -0.0897 784 GLU A CG  
1150 C CD  . GLU A 172 ? 0.7112 0.6354 0.9864 0.0143  -0.0380 -0.0819 784 GLU A CD  
1151 O OE1 . GLU A 172 ? 0.5008 0.4317 0.7698 0.0104  -0.0401 -0.0736 784 GLU A OE1 
1152 O OE2 . GLU A 172 ? 0.5442 0.4672 0.8076 0.0191  -0.0303 -0.0844 784 GLU A OE2 
1153 N N   . ASP A 173 ? 0.4159 0.3448 0.7590 -0.0031 -0.0541 -0.0691 785 ASP A N   
1154 C CA  . ASP A 173 ? 0.3987 0.3282 0.7692 -0.0075 -0.0488 -0.0550 785 ASP A CA  
1155 C C   . ASP A 173 ? 0.4540 0.3794 0.8330 -0.0055 -0.0416 -0.0447 785 ASP A C   
1156 O O   . ASP A 173 ? 0.4713 0.3906 0.8793 -0.0071 -0.0392 -0.0402 785 ASP A O   
1157 C CB  . ASP A 173 ? 0.3991 0.3370 0.7610 -0.0102 -0.0452 -0.0424 785 ASP A CB  
1158 C CG  . ASP A 173 ? 0.5323 0.4738 0.9024 -0.0129 -0.0517 -0.0497 785 ASP A CG  
1159 O OD1 . ASP A 173 ? 0.5394 0.4768 0.9239 -0.0129 -0.0612 -0.0651 785 ASP A OD1 
1160 O OD2 . ASP A 173 ? 0.6088 0.5571 0.9727 -0.0145 -0.0481 -0.0408 785 ASP A OD2 
1161 N N   . ASP A 174 ? 0.3915 0.3200 0.7490 -0.0018 -0.0386 -0.0415 786 ASP A N   
1162 C CA  . ASP A 174 ? 0.3882 0.3140 0.7550 0.0012  -0.0341 -0.0329 786 ASP A CA  
1163 C C   . ASP A 174 ? 0.4076 0.3350 0.7593 0.0059  -0.0329 -0.0399 786 ASP A C   
1164 O O   . ASP A 174 ? 0.3822 0.3172 0.7151 0.0066  -0.0314 -0.0350 786 ASP A O   
1165 C CB  . ASP A 174 ? 0.4071 0.3365 0.7724 0.0011  -0.0299 -0.0128 786 ASP A CB  
1166 C CG  . ASP A 174 ? 0.5655 0.4929 0.9373 0.0058  -0.0279 -0.0028 786 ASP A CG  
1167 O OD1 . ASP A 174 ? 0.5602 0.4811 0.9502 0.0080  -0.0278 -0.0087 786 ASP A OD1 
1168 O OD2 . ASP A 174 ? 0.7214 0.6534 1.0805 0.0079  -0.0276 0.0102  786 ASP A OD2 
1169 N N   . PRO A 175 ? 0.3583 0.2783 0.7217 0.0093  -0.0323 -0.0511 787 PRO A N   
1170 C CA  . PRO A 175 ? 0.3550 0.2764 0.7077 0.0144  -0.0279 -0.0569 787 PRO A CA  
1171 C C   . PRO A 175 ? 0.3909 0.3201 0.7452 0.0161  -0.0245 -0.0436 787 PRO A C   
1172 O O   . PRO A 175 ? 0.3625 0.2958 0.7084 0.0191  -0.0201 -0.0471 787 PRO A O   
1173 C CB  . PRO A 175 ? 0.3908 0.3016 0.7622 0.0181  -0.0271 -0.0691 787 PRO A CB  
1174 C CG  . PRO A 175 ? 0.4551 0.3589 0.8390 0.0144  -0.0337 -0.0763 787 PRO A CG  
1175 C CD  . PRO A 175 ? 0.3825 0.2921 0.7716 0.0088  -0.0349 -0.0598 787 PRO A CD  
1176 N N   . SER A 176 ? 0.3606 0.2914 0.7260 0.0149  -0.0267 -0.0283 788 SER A N   
1177 C CA  . SER A 176 ? 0.3536 0.2917 0.7191 0.0176  -0.0275 -0.0164 788 SER A CA  
1178 C C   . SER A 176 ? 0.3593 0.3069 0.7021 0.0153  -0.0294 -0.0129 788 SER A C   
1179 O O   . SER A 176 ? 0.3528 0.3075 0.6953 0.0175  -0.0312 -0.0084 788 SER A O   
1180 C CB  . SER A 176 ? 0.3981 0.3323 0.7787 0.0197  -0.0297 -0.0015 788 SER A CB  
1181 O OG  . SER A 176 ? 0.5361 0.4714 0.9038 0.0172  -0.0311 0.0096  788 SER A OG  
1182 N N   . ASP A 177 ? 0.3087 0.2563 0.6359 0.0111  -0.0298 -0.0156 789 ASP A N   
1183 C CA  . ASP A 177 ? 0.2796 0.2346 0.5858 0.0089  -0.0307 -0.0146 789 ASP A CA  
1184 C C   . ASP A 177 ? 0.3315 0.2842 0.6260 0.0074  -0.0287 -0.0270 789 ASP A C   
1185 O O   . ASP A 177 ? 0.3193 0.2706 0.6073 0.0046  -0.0310 -0.0287 789 ASP A O   
1186 C CB  . ASP A 177 ? 0.2883 0.2448 0.5864 0.0069  -0.0331 -0.0042 789 ASP A CB  
1187 C CG  . ASP A 177 ? 0.4428 0.4000 0.7444 0.0104  -0.0358 0.0087  789 ASP A CG  
1188 O OD1 . ASP A 177 ? 0.5075 0.4699 0.8098 0.0135  -0.0394 0.0095  789 ASP A OD1 
1189 O OD2 . ASP A 177 ? 0.5000 0.4526 0.8038 0.0108  -0.0344 0.0183  789 ASP A OD2 
1190 N N   . PRO A 178 ? 0.3151 0.2662 0.6080 0.0105  -0.0243 -0.0359 790 PRO A N   
1191 C CA  . PRO A 178 ? 0.3270 0.2732 0.6038 0.0115  -0.0230 -0.0476 790 PRO A CA  
1192 C C   . PRO A 178 ? 0.3781 0.3283 0.6332 0.0100  -0.0228 -0.0464 790 PRO A C   
1193 O O   . PRO A 178 ? 0.3612 0.3181 0.6143 0.0086  -0.0211 -0.0390 790 PRO A O   
1194 C CB  . PRO A 178 ? 0.3659 0.3083 0.6452 0.0168  -0.0156 -0.0553 790 PRO A CB  
1195 C CG  . PRO A 178 ? 0.4086 0.3588 0.7011 0.0171  -0.0120 -0.0465 790 PRO A CG  
1196 C CD  . PRO A 178 ? 0.3418 0.2950 0.6470 0.0142  -0.0197 -0.0358 790 PRO A CD  
1197 N N   . THR A 179 ? 0.3619 0.3073 0.6021 0.0107  -0.0260 -0.0545 791 THR A N   
1198 C CA  . THR A 179 ? 0.3523 0.2991 0.5707 0.0106  -0.0266 -0.0543 791 THR A CA  
1199 C C   . THR A 179 ? 0.4213 0.3701 0.6297 0.0128  -0.0170 -0.0509 791 THR A C   
1200 O O   . THR A 179 ? 0.4154 0.3696 0.6206 0.0101  -0.0162 -0.0438 791 THR A O   
1201 C CB  . THR A 179 ? 0.3901 0.3294 0.5941 0.0142  -0.0324 -0.0662 791 THR A CB  
1202 O OG1 . THR A 179 ? 0.3186 0.2570 0.5408 0.0111  -0.0411 -0.0696 791 THR A OG1 
1203 C CG2 . THR A 179 ? 0.3519 0.2912 0.5323 0.0158  -0.0342 -0.0657 791 THR A CG2 
1204 N N   . TYR A 180 ? 0.3751 0.3194 0.5821 0.0178  -0.0089 -0.0561 792 TYR A N   
1205 C CA  . TYR A 180 ? 0.3745 0.3200 0.5769 0.0204  0.0035  -0.0528 792 TYR A CA  
1206 C C   . TYR A 180 ? 0.4294 0.3802 0.6581 0.0203  0.0096  -0.0497 792 TYR A C   
1207 O O   . TYR A 180 ? 0.4001 0.3488 0.6427 0.0222  0.0087  -0.0539 792 TYR A O   
1208 C CB  . TYR A 180 ? 0.4027 0.3379 0.5790 0.0282  0.0116  -0.0605 792 TYR A CB  
1209 C CG  . TYR A 180 ? 0.4115 0.3409 0.5596 0.0305  0.0042  -0.0639 792 TYR A CG  
1210 C CD1 . TYR A 180 ? 0.4338 0.3638 0.5668 0.0303  0.0073  -0.0564 792 TYR A CD1 
1211 C CD2 . TYR A 180 ? 0.4244 0.3467 0.5623 0.0338  -0.0062 -0.0755 792 TYR A CD2 
1212 C CE1 . TYR A 180 ? 0.4395 0.3639 0.5472 0.0336  -0.0004 -0.0591 792 TYR A CE1 
1213 C CE2 . TYR A 180 ? 0.4476 0.3654 0.5618 0.0369  -0.0154 -0.0796 792 TYR A CE2 
1214 C CZ  . TYR A 180 ? 0.5226 0.4416 0.6210 0.0371  -0.0126 -0.0707 792 TYR A CZ  
1215 O OH  . TYR A 180 ? 0.5163 0.4307 0.5921 0.0412  -0.0227 -0.0740 792 TYR A OH  
1216 N N   . THR A 181 ? 0.4143 0.3718 0.6524 0.0184  0.0157  -0.0429 793 THR A N   
1217 C CA  . THR A 181 ? 0.4260 0.3902 0.6929 0.0187  0.0209  -0.0402 793 THR A CA  
1218 C C   . THR A 181 ? 0.5383 0.5008 0.8033 0.0221  0.0381  -0.0397 793 THR A C   
1219 O O   . THR A 181 ? 0.5331 0.4946 0.7849 0.0207  0.0422  -0.0357 793 THR A O   
1220 C CB  . THR A 181 ? 0.4765 0.4507 0.7610 0.0134  0.0102  -0.0333 793 THR A CB  
1221 O OG1 . THR A 181 ? 0.4109 0.3840 0.6887 0.0114  -0.0021 -0.0321 793 THR A OG1 
1222 C CG2 . THR A 181 ? 0.4650 0.4472 0.7825 0.0144  0.0105  -0.0313 793 THR A CG2 
1223 N N   . SER A 182 ? 0.5598 0.5209 0.8381 0.0270  0.0497  -0.0431 794 SER A N   
1224 C CA  . SER A 182 ? 0.5986 0.5573 0.8778 0.0315  0.0704  -0.0416 794 SER A CA  
1225 C C   . SER A 182 ? 0.6906 0.6597 0.9981 0.0264  0.0745  -0.0335 794 SER A C   
1226 O O   . SER A 182 ? 0.6816 0.6612 1.0188 0.0219  0.0628  -0.0318 794 SER A O   
1227 C CB  . SER A 182 ? 0.6648 0.6213 0.9588 0.0378  0.0816  -0.0474 794 SER A CB  
1228 O OG  . SER A 182 ? 0.8105 0.7624 1.1000 0.0437  0.1048  -0.0460 794 SER A OG  
1229 N N   . SER A 183 ? 0.6868 0.6517 0.9845 0.0277  0.0903  -0.0285 795 SER A N   
1230 C CA  . SER A 183 ? 0.6898 0.6625 1.0169 0.0227  0.0964  -0.0213 795 SER A CA  
1231 C C   . SER A 183 ? 0.7945 0.7600 1.1174 0.0274  0.1232  -0.0154 795 SER A C   
1232 O O   . SER A 183 ? 0.8081 0.7603 1.0892 0.0341  0.1323  -0.0151 795 SER A O   
1233 C CB  . SER A 183 ? 0.7212 0.6961 1.0398 0.0161  0.0807  -0.0186 795 SER A CB  
1234 O OG  . SER A 183 ? 0.8416 0.8208 1.1841 0.0118  0.0873  -0.0129 795 SER A OG  
1235 N N   . LEU A 184 ? 0.7746 0.7486 1.1420 0.0245  0.1352  -0.0104 796 LEU A N   
1236 C CA  . LEU A 184 ? 0.8045 0.7740 1.1836 0.0277  0.1641  -0.0023 796 LEU A CA  
1237 C C   . LEU A 184 ? 0.9166 0.8681 1.2422 0.0356  0.1804  0.0030  796 LEU A C   
1238 O O   . LEU A 184 ? 0.9484 0.8910 1.2570 0.0450  0.2015  0.0035  796 LEU A O   
1239 C CB  . LEU A 184 ? 0.7905 0.7695 1.2147 0.0192  0.1643  0.0036  796 LEU A CB  
1240 N N   . GLY A 185 ? 0.8786 0.8246 1.1768 0.0331  0.1699  0.0065  797 GLY A N   
1241 C CA  . GLY A 185 ? 0.9067 0.8357 1.1518 0.0413  0.1798  0.0116  797 GLY A CA  
1242 C C   . GLY A 185 ? 0.9610 0.8822 1.1607 0.0483  0.1675  0.0013  797 GLY A C   
1243 O O   . GLY A 185 ? 0.9942 0.9053 1.1676 0.0587  0.1822  -0.0013 797 GLY A O   
1244 N N   . GLY A 186 ? 0.8718 0.7980 1.0654 0.0428  0.1409  -0.0053 798 GLY A N   
1245 C CA  . GLY A 186 ? 0.8637 0.7841 1.0233 0.0474  0.1258  -0.0160 798 GLY A CA  
1246 C C   . GLY A 186 ? 0.8473 0.7782 1.0250 0.0395  0.1012  -0.0233 798 GLY A C   
1247 O O   . GLY A 186 ? 0.8278 0.7709 1.0419 0.0313  0.0945  -0.0207 798 GLY A O   
1248 N N   . LYS A 187 ? 0.7554 0.6810 0.9075 0.0428  0.0874  -0.0326 799 LYS A N   
1249 C CA  . LYS A 187 ? 0.6926 0.6252 0.8575 0.0367  0.0663  -0.0386 799 LYS A CA  
1250 C C   . LYS A 187 ? 0.6517 0.5900 0.8195 0.0295  0.0538  -0.0330 799 LYS A C   
1251 O O   . LYS A 187 ? 0.6716 0.6039 0.8160 0.0315  0.0552  -0.0291 799 LYS A O   
1252 C CB  . LYS A 187 ? 0.7315 0.6550 0.8692 0.0424  0.0567  -0.0498 799 LYS A CB  
1253 N N   . ILE A 188 ? 0.5077 0.4565 0.7018 0.0222  0.0417  -0.0325 800 ILE A N   
1254 C CA  . ILE A 188 ? 0.4562 0.4100 0.6521 0.0161  0.0305  -0.0284 800 ILE A CA  
1255 C C   . ILE A 188 ? 0.4404 0.3964 0.6350 0.0134  0.0143  -0.0323 800 ILE A C   
1256 O O   . ILE A 188 ? 0.4345 0.3950 0.6472 0.0119  0.0096  -0.0338 800 ILE A O   
1257 C CB  . ILE A 188 ? 0.4760 0.4389 0.7016 0.0107  0.0327  -0.0228 800 ILE A CB  
1258 C CG1 . ILE A 188 ? 0.5055 0.4643 0.7315 0.0123  0.0493  -0.0170 800 ILE A CG1 
1259 C CG2 . ILE A 188 ? 0.4436 0.4125 0.6739 0.0050  0.0183  -0.0215 800 ILE A CG2 
1260 C CD1 . ILE A 188 ? 0.5905 0.5577 0.8545 0.0080  0.0551  -0.0136 800 ILE A CD1 
1261 N N   . PRO A 189 ? 0.3559 0.3090 0.5322 0.0130  0.0062  -0.0330 801 PRO A N   
1262 C CA  . PRO A 189 ? 0.3235 0.2795 0.5045 0.0099  -0.0066 -0.0351 801 PRO A CA  
1263 C C   . PRO A 189 ? 0.3256 0.2896 0.5196 0.0044  -0.0117 -0.0292 801 PRO A C   
1264 O O   . PRO A 189 ? 0.3238 0.2883 0.5098 0.0029  -0.0140 -0.0269 801 PRO A O   
1265 C CB  . PRO A 189 ? 0.3505 0.3006 0.5099 0.0126  -0.0120 -0.0389 801 PRO A CB  
1266 C CG  . PRO A 189 ? 0.4033 0.3496 0.5468 0.0152  -0.0044 -0.0343 801 PRO A CG  
1267 C CD  . PRO A 189 ? 0.3600 0.3072 0.5138 0.0157  0.0089  -0.0305 801 PRO A CD  
1268 N N   . ILE A 190 ? 0.2649 0.2344 0.4775 0.0026  -0.0136 -0.0272 802 ILE A N   
1269 C CA  . ILE A 190 ? 0.2555 0.2315 0.4765 -0.0005 -0.0195 -0.0229 802 ILE A CA  
1270 C C   . ILE A 190 ? 0.2924 0.2683 0.5016 -0.0024 -0.0252 -0.0214 802 ILE A C   
1271 O O   . ILE A 190 ? 0.2749 0.2524 0.4807 -0.0038 -0.0257 -0.0202 802 ILE A O   
1272 C CB  . ILE A 190 ? 0.3013 0.2816 0.5391 -0.0001 -0.0242 -0.0208 802 ILE A CB  
1273 C CG1 . ILE A 190 ? 0.3311 0.3144 0.5877 0.0015  -0.0189 -0.0219 802 ILE A CG1 
1274 C CG2 . ILE A 190 ? 0.3143 0.2990 0.5517 -0.0012 -0.0325 -0.0169 802 ILE A CG2 
1275 C CD1 . ILE A 190 ? 0.4822 0.4702 0.7499 -0.0003 -0.0161 -0.0216 802 ILE A CD1 
1276 N N   . ARG A 191 ? 0.2336 0.2074 0.4403 -0.0023 -0.0286 -0.0218 803 ARG A N   
1277 C CA  . ARG A 191 ? 0.2370 0.2116 0.4384 -0.0037 -0.0321 -0.0198 803 ARG A CA  
1278 C C   . ARG A 191 ? 0.2983 0.2715 0.4884 -0.0037 -0.0317 -0.0216 803 ARG A C   
1279 O O   . ARG A 191 ? 0.2934 0.2685 0.4816 -0.0047 -0.0334 -0.0197 803 ARG A O   
1280 C CB  . ARG A 191 ? 0.2479 0.2205 0.4568 -0.0039 -0.0341 -0.0201 803 ARG A CB  
1281 C CG  . ARG A 191 ? 0.3216 0.2946 0.5416 -0.0035 -0.0342 -0.0150 803 ARG A CG  
1282 C CD  . ARG A 191 ? 0.2933 0.2624 0.5266 -0.0038 -0.0346 -0.0156 803 ARG A CD  
1283 N NE  . ARG A 191 ? 0.3165 0.2841 0.5609 -0.0021 -0.0340 -0.0119 803 ARG A NE  
1284 C CZ  . ARG A 191 ? 0.4400 0.4075 0.6888 -0.0010 -0.0337 -0.0024 803 ARG A CZ  
1285 N NH1 . ARG A 191 ? 0.3102 0.2786 0.5531 -0.0016 -0.0321 0.0041  803 ARG A NH1 
1286 N NH2 . ARG A 191 ? 0.2876 0.2532 0.5467 0.0016  -0.0343 0.0013  803 ARG A NH2 
1287 N N   . TRP A 192 ? 0.2642 0.2332 0.4460 -0.0016 -0.0286 -0.0245 804 TRP A N   
1288 C CA  . TRP A 192 ? 0.2712 0.2370 0.4404 0.0001  -0.0284 -0.0250 804 TRP A CA  
1289 C C   . TRP A 192 ? 0.3009 0.2655 0.4677 0.0000  -0.0224 -0.0217 804 TRP A C   
1290 O O   . TRP A 192 ? 0.3122 0.2739 0.4707 0.0012  -0.0221 -0.0201 804 TRP A O   
1291 C CB  . TRP A 192 ? 0.2722 0.2318 0.4295 0.0046  -0.0299 -0.0300 804 TRP A CB  
1292 C CG  . TRP A 192 ? 0.2827 0.2430 0.4457 0.0044  -0.0384 -0.0347 804 TRP A CG  
1293 C CD1 . TRP A 192 ? 0.3185 0.2795 0.4806 0.0052  -0.0451 -0.0363 804 TRP A CD1 
1294 C CD2 . TRP A 192 ? 0.2786 0.2392 0.4549 0.0033  -0.0408 -0.0384 804 TRP A CD2 
1295 N NE1 . TRP A 192 ? 0.3153 0.2778 0.4919 0.0040  -0.0515 -0.0412 804 TRP A NE1 
1296 C CE2 . TRP A 192 ? 0.3212 0.2829 0.5065 0.0026  -0.0486 -0.0421 804 TRP A CE2 
1297 C CE3 . TRP A 192 ? 0.2951 0.2551 0.4800 0.0028  -0.0371 -0.0387 804 TRP A CE3 
1298 C CZ2 . TRP A 192 ? 0.3114 0.2727 0.5150 0.0009  -0.0521 -0.0459 804 TRP A CZ2 
1299 C CZ3 . TRP A 192 ? 0.3114 0.2704 0.5117 0.0018  -0.0407 -0.0420 804 TRP A CZ3 
1300 C CH2 . TRP A 192 ? 0.3216 0.2810 0.5317 0.0005  -0.0477 -0.0454 804 TRP A CH2 
1301 N N   . THR A 193 ? 0.2222 0.1892 0.4000 -0.0014 -0.0178 -0.0205 805 THR A N   
1302 C CA  . THR A 193 ? 0.2000 0.1660 0.3839 -0.0021 -0.0109 -0.0179 805 THR A CA  
1303 C C   . THR A 193 ? 0.2784 0.2494 0.4747 -0.0059 -0.0153 -0.0180 805 THR A C   
1304 O O   . THR A 193 ? 0.2458 0.2222 0.4482 -0.0072 -0.0222 -0.0195 805 THR A O   
1305 C CB  . THR A 193 ? 0.3079 0.2738 0.5015 -0.0009 -0.0029 -0.0179 805 THR A CB  
1306 O OG1 . THR A 193 ? 0.3504 0.3103 0.5283 0.0038  0.0005  -0.0199 805 THR A OG1 
1307 C CG2 . THR A 193 ? 0.2886 0.2530 0.4934 -0.0015 0.0077  -0.0143 805 THR A CG2 
1308 N N   . ALA A 194 ? 0.2585 0.2263 0.4570 -0.0067 -0.0114 -0.0163 806 ALA A N   
1309 C CA  . ALA A 194 ? 0.2763 0.2468 0.4868 -0.0097 -0.0157 -0.0186 806 ALA A CA  
1310 C C   . ALA A 194 ? 0.3156 0.2920 0.5479 -0.0118 -0.0179 -0.0213 806 ALA A C   
1311 O O   . ALA A 194 ? 0.3282 0.3047 0.5718 -0.0116 -0.0103 -0.0193 806 ALA A O   
1312 C CB  . ALA A 194 ? 0.2967 0.2608 0.5088 -0.0099 -0.0098 -0.0161 806 ALA A CB  
1313 N N   . PRO A 195 ? 0.2626 0.2437 0.5007 -0.0129 -0.0284 -0.0262 807 PRO A N   
1314 C CA  . PRO A 195 ? 0.2531 0.2406 0.5128 -0.0138 -0.0343 -0.0299 807 PRO A CA  
1315 C C   . PRO A 195 ? 0.3135 0.3017 0.6023 -0.0167 -0.0279 -0.0306 807 PRO A C   
1316 O O   . PRO A 195 ? 0.3250 0.3189 0.6353 -0.0169 -0.0288 -0.0316 807 PRO A O   
1317 C CB  . PRO A 195 ? 0.2812 0.2711 0.5348 -0.0127 -0.0477 -0.0358 807 PRO A CB  
1318 C CG  . PRO A 195 ? 0.3350 0.3193 0.5701 -0.0124 -0.0455 -0.0358 807 PRO A CG  
1319 C CD  . PRO A 195 ? 0.2765 0.2571 0.4998 -0.0119 -0.0357 -0.0290 807 PRO A CD  
1320 N N   . GLU A 196 ? 0.2571 0.2393 0.5499 -0.0186 -0.0206 -0.0292 808 GLU A N   
1321 C CA  . GLU A 196 ? 0.2628 0.2443 0.5870 -0.0215 -0.0112 -0.0279 808 GLU A CA  
1322 C C   . GLU A 196 ? 0.3319 0.3101 0.6547 -0.0196 0.0060  -0.0193 808 GLU A C   
1323 O O   . GLU A 196 ? 0.3201 0.3003 0.6721 -0.0211 0.0155  -0.0174 808 GLU A O   
1324 C CB  . GLU A 196 ? 0.2732 0.2478 0.6057 -0.0240 -0.0085 -0.0287 808 GLU A CB  
1325 C CG  . GLU A 196 ? 0.3152 0.2793 0.6254 -0.0216 0.0039  -0.0195 808 GLU A CG  
1326 C CD  . GLU A 196 ? 0.5040 0.4654 0.7803 -0.0184 -0.0027 -0.0198 808 GLU A CD  
1327 O OE1 . GLU A 196 ? 0.2014 0.1684 0.4693 -0.0182 -0.0153 -0.0265 808 GLU A OE1 
1328 O OE2 . GLU A 196 ? 0.3511 0.3045 0.6103 -0.0155 0.0051  -0.0128 808 GLU A OE2 
1329 N N   . ALA A 197 ? 0.3129 0.2856 0.6027 -0.0156 0.0100  -0.0148 809 ALA A N   
1330 C CA  . ALA A 197 ? 0.3348 0.3027 0.6145 -0.0117 0.0245  -0.0086 809 ALA A CA  
1331 C C   . ALA A 197 ? 0.3765 0.3517 0.6648 -0.0107 0.0220  -0.0118 809 ALA A C   
1332 O O   . ALA A 197 ? 0.3759 0.3496 0.6704 -0.0082 0.0353  -0.0087 809 ALA A O   
1333 C CB  . ALA A 197 ? 0.3528 0.3125 0.5953 -0.0071 0.0255  -0.0054 809 ALA A CB  
1334 N N   . ILE A 198 ? 0.3294 0.3116 0.6179 -0.0117 0.0061  -0.0173 810 ILE A N   
1335 C CA  . ILE A 198 ? 0.3209 0.3096 0.6205 -0.0103 0.0024  -0.0195 810 ILE A CA  
1336 C C   . ILE A 198 ? 0.3998 0.3962 0.7394 -0.0127 0.0028  -0.0216 810 ILE A C   
1337 O O   . ILE A 198 ? 0.4262 0.4251 0.7837 -0.0111 0.0120  -0.0203 810 ILE A O   
1338 C CB  . ILE A 198 ? 0.3387 0.3308 0.6254 -0.0096 -0.0135 -0.0223 810 ILE A CB  
1339 C CG1 . ILE A 198 ? 0.3397 0.3257 0.5962 -0.0073 -0.0130 -0.0207 810 ILE A CG1 
1340 C CG2 . ILE A 198 ? 0.3269 0.3264 0.6335 -0.0081 -0.0199 -0.0239 810 ILE A CG2 
1341 C CD1 . ILE A 198 ? 0.2750 0.2632 0.5201 -0.0068 -0.0256 -0.0212 810 ILE A CD1 
1342 N N   . ALA A 199 ? 0.3427 0.3430 0.6981 -0.0161 -0.0080 -0.0260 811 ALA A N   
1343 C CA  . ALA A 199 ? 0.3430 0.3518 0.7406 -0.0186 -0.0130 -0.0306 811 ALA A CA  
1344 C C   . ALA A 199 ? 0.4091 0.4169 0.8388 -0.0213 0.0049  -0.0270 811 ALA A C   
1345 O O   . ALA A 199 ? 0.3983 0.4140 0.8666 -0.0221 0.0070  -0.0286 811 ALA A O   
1346 C CB  . ALA A 199 ? 0.3517 0.3633 0.7526 -0.0204 -0.0317 -0.0386 811 ALA A CB  
1347 N N   . TYR A 200 ? 0.4001 0.3981 0.8172 -0.0223 0.0179  -0.0215 812 TYR A N   
1348 C CA  . TYR A 200 ? 0.4237 0.4187 0.8720 -0.0247 0.0369  -0.0160 812 TYR A CA  
1349 C C   . TYR A 200 ? 0.4897 0.4727 0.9115 -0.0204 0.0602  -0.0045 812 TYR A C   
1350 O O   . TYR A 200 ? 0.5032 0.4806 0.9445 -0.0214 0.0785  0.0028  812 TYR A O   
1351 C CB  . TYR A 200 ? 0.4566 0.4503 0.9274 -0.0300 0.0304  -0.0201 812 TYR A CB  
1352 C CG  . TYR A 200 ? 0.5041 0.5082 0.9972 -0.0326 0.0055  -0.0334 812 TYR A CG  
1353 C CD1 . TYR A 200 ? 0.5394 0.5551 1.0781 -0.0343 -0.0002 -0.0390 812 TYR A CD1 
1354 C CD2 . TYR A 200 ? 0.5219 0.5243 0.9889 -0.0321 -0.0126 -0.0406 812 TYR A CD2 
1355 C CE1 . TYR A 200 ? 0.5748 0.5995 1.1299 -0.0348 -0.0260 -0.0519 812 TYR A CE1 
1356 C CE2 . TYR A 200 ? 0.5403 0.5505 1.0202 -0.0324 -0.0359 -0.0531 812 TYR A CE2 
1357 C CZ  . TYR A 200 ? 0.6952 0.7163 1.2177 -0.0334 -0.0438 -0.0589 812 TYR A CZ  
1358 O OH  . TYR A 200 ? 0.7717 0.7999 1.3044 -0.0321 -0.0693 -0.0720 812 TYR A OH  
1359 N N   . ARG A 201 ? 0.4487 0.4270 0.8273 -0.0151 0.0595  -0.0030 813 ARG A N   
1360 C CA  . ARG A 201 ? 0.4693 0.4350 0.8138 -0.0090 0.0772  0.0057  813 ARG A CA  
1361 C C   . ARG A 201 ? 0.5375 0.4922 0.8693 -0.0091 0.0836  0.0129  813 ARG A C   
1362 O O   . ARG A 201 ? 0.5549 0.4985 0.8721 -0.0041 0.1029  0.0230  813 ARG A O   
1363 C CB  . ARG A 201 ? 0.4849 0.4492 0.8420 -0.0050 0.0992  0.0110  813 ARG A CB  
1364 C CG  . ARG A 201 ? 0.6839 0.6564 1.0459 -0.0030 0.0935  0.0043  813 ARG A CG  
1365 C CD  . ARG A 201 ? 0.8646 0.8359 1.2425 0.0015  0.1168  0.0086  813 ARG A CD  
1366 N N   . LYS A 202 ? 0.4790 0.4360 0.8145 -0.0136 0.0674  0.0078  814 LYS A N   
1367 C CA  . LYS A 202 ? 0.4819 0.4289 0.8090 -0.0138 0.0706  0.0131  814 LYS A CA  
1368 C C   . LYS A 202 ? 0.5208 0.4605 0.8000 -0.0079 0.0654  0.0152  814 LYS A C   
1369 O O   . LYS A 202 ? 0.4824 0.4254 0.7500 -0.0093 0.0488  0.0087  814 LYS A O   
1370 C CB  . LYS A 202 ? 0.5018 0.4539 0.8562 -0.0205 0.0560  0.0048  814 LYS A CB  
1371 C CG  . LYS A 202 ? 0.6035 0.5605 1.0107 -0.0262 0.0613  0.0029  814 LYS A CG  
1372 C CD  . LYS A 202 ? 0.6508 0.6102 1.0806 -0.0316 0.0454  -0.0074 814 LYS A CD  
1373 C CE  . LYS A 202 ? 0.6405 0.6050 1.1281 -0.0376 0.0484  -0.0112 814 LYS A CE  
1374 N NZ  . LYS A 202 ? 0.7624 0.7269 1.2709 -0.0421 0.0324  -0.0229 814 LYS A NZ  
1375 N N   . PHE A 203 ? 0.4900 0.4201 0.7418 -0.0006 0.0796  0.0236  815 PHE A N   
1376 C CA  . PHE A 203 ? 0.4735 0.3960 0.6809 0.0066  0.0747  0.0253  815 PHE A CA  
1377 C C   . PHE A 203 ? 0.5334 0.4433 0.7292 0.0100  0.0819  0.0354  815 PHE A C   
1378 O O   . PHE A 203 ? 0.5629 0.4629 0.7597 0.0137  0.1014  0.0466  815 PHE A O   
1379 C CB  . PHE A 203 ? 0.4983 0.4162 0.6791 0.0143  0.0833  0.0264  815 PHE A CB  
1380 C CG  . PHE A 203 ? 0.4944 0.4231 0.6836 0.0121  0.0749  0.0164  815 PHE A CG  
1381 C CD1 . PHE A 203 ? 0.5152 0.4476 0.6865 0.0126  0.0576  0.0083  815 PHE A CD1 
1382 C CD2 . PHE A 203 ? 0.5147 0.4496 0.7336 0.0096  0.0846  0.0157  815 PHE A CD2 
1383 C CE1 . PHE A 203 ? 0.5093 0.4500 0.6901 0.0108  0.0509  0.0006  815 PHE A CE1 
1384 C CE2 . PHE A 203 ? 0.5231 0.4671 0.7509 0.0084  0.0764  0.0074  815 PHE A CE2 
1385 C CZ  . PHE A 203 ? 0.4929 0.4391 0.7006 0.0091  0.0598  0.0004  815 PHE A CZ  
1386 N N   . THR A 204 ? 0.4560 0.3660 0.6436 0.0091  0.0674  0.0322  816 THR A N   
1387 C CA  . THR A 204 ? 0.4485 0.3469 0.6260 0.0128  0.0710  0.0411  816 THR A CA  
1388 C C   . THR A 204 ? 0.4672 0.3652 0.6142 0.0177  0.0552  0.0374  816 THR A C   
1389 O O   . THR A 204 ? 0.4381 0.3446 0.5761 0.0171  0.0435  0.0283  816 THR A O   
1390 C CB  . THR A 204 ? 0.4514 0.3517 0.6656 0.0049  0.0691  0.0392  816 THR A CB  
1391 O OG1 . THR A 204 ? 0.3735 0.2858 0.5962 -0.0005 0.0506  0.0257  816 THR A OG1 
1392 C CG2 . THR A 204 ? 0.3726 0.2730 0.6258 -0.0004 0.0843  0.0427  816 THR A CG2 
1393 N N   . SER A 205 ? 0.4278 0.3164 0.5646 0.0220  0.0542  0.0443  817 SER A N   
1394 C CA  . SER A 205 ? 0.4135 0.3033 0.5302 0.0263  0.0382  0.0403  817 SER A CA  
1395 C C   . SER A 205 ? 0.4110 0.3139 0.5493 0.0181  0.0246  0.0282  817 SER A C   
1396 O O   . SER A 205 ? 0.4110 0.3203 0.5388 0.0193  0.0118  0.0215  817 SER A O   
1397 C CB  . SER A 205 ? 0.4656 0.3419 0.5689 0.0338  0.0409  0.0515  817 SER A CB  
1398 O OG  . SER A 205 ? 0.5591 0.4228 0.6317 0.0440  0.0516  0.0623  817 SER A OG  
1399 N N   . ALA A 206 ? 0.3148 0.2218 0.4835 0.0101  0.0276  0.0247  818 ALA A N   
1400 C CA  . ALA A 206 ? 0.2851 0.2031 0.4699 0.0038  0.0161  0.0132  818 ALA A CA  
1401 C C   . ALA A 206 ? 0.3367 0.2655 0.5179 0.0015  0.0098  0.0059  818 ALA A C   
1402 O O   . ALA A 206 ? 0.3399 0.2761 0.5202 -0.0001 -0.0004 -0.0012 818 ALA A O   
1403 C CB  . ALA A 206 ? 0.2891 0.2070 0.5048 -0.0024 0.0193  0.0100  818 ALA A CB  
1404 N N   . SER A 207 ? 0.2963 0.2254 0.4764 0.0019  0.0171  0.0082  819 SER A N   
1405 C CA  . SER A 207 ? 0.2977 0.2359 0.4755 0.0005  0.0111  0.0018  819 SER A CA  
1406 C C   . SER A 207 ? 0.3785 0.3157 0.5311 0.0057  0.0048  0.0009  819 SER A C   
1407 O O   . SER A 207 ? 0.3756 0.3200 0.5286 0.0040  -0.0033 -0.0050 819 SER A O   
1408 C CB  . SER A 207 ? 0.3215 0.2617 0.5128 -0.0011 0.0200  0.0027  819 SER A CB  
1409 O OG  . SER A 207 ? 0.4555 0.3870 0.6325 0.0045  0.0330  0.0101  819 SER A OG  
1410 N N   . ASP A 208 ? 0.3450 0.2728 0.4772 0.0125  0.0073  0.0066  820 ASP A N   
1411 C CA  . ASP A 208 ? 0.3388 0.2652 0.4493 0.0182  -0.0021 0.0040  820 ASP A CA  
1412 C C   . ASP A 208 ? 0.3534 0.2861 0.4720 0.0161  -0.0137 -0.0002 820 ASP A C   
1413 O O   . ASP A 208 ? 0.3367 0.2736 0.4511 0.0174  -0.0234 -0.0054 820 ASP A O   
1414 C CB  . ASP A 208 ? 0.3875 0.3011 0.4720 0.0278  0.0021  0.0116  820 ASP A CB  
1415 C CG  . ASP A 208 ? 0.5088 0.4148 0.5733 0.0337  0.0121  0.0144  820 ASP A CG  
1416 O OD1 . ASP A 208 ? 0.5232 0.4347 0.5935 0.0309  0.0132  0.0082  820 ASP A OD1 
1417 O OD2 . ASP A 208 ? 0.5497 0.4433 0.5909 0.0424  0.0192  0.0229  820 ASP A OD2 
1418 N N   . VAL A 209 ? 0.3121 0.2445 0.4443 0.0132  -0.0119 0.0018  821 VAL A N   
1419 C CA  . VAL A 209 ? 0.2889 0.2268 0.4301 0.0117  -0.0197 -0.0022 821 VAL A CA  
1420 C C   . VAL A 209 ? 0.2992 0.2475 0.4502 0.0065  -0.0239 -0.0091 821 VAL A C   
1421 O O   . VAL A 209 ? 0.2963 0.2496 0.4482 0.0072  -0.0303 -0.0122 821 VAL A O   
1422 C CB  . VAL A 209 ? 0.3396 0.2728 0.4916 0.0110  -0.0161 0.0003  821 VAL A CB  
1423 C CG1 . VAL A 209 ? 0.3207 0.2604 0.4834 0.0090  -0.0217 -0.0058 821 VAL A CG1 
1424 C CG2 . VAL A 209 ? 0.3516 0.2739 0.4921 0.0180  -0.0138 0.0088  821 VAL A CG2 
1425 N N   . TRP A 210 ? 0.2253 0.1764 0.3838 0.0023  -0.0202 -0.0107 822 TRP A N   
1426 C CA  . TRP A 210 ? 0.2226 0.1817 0.3869 -0.0011 -0.0239 -0.0151 822 TRP A CA  
1427 C C   . TRP A 210 ? 0.2793 0.2404 0.4372 0.0007  -0.0275 -0.0161 822 TRP A C   
1428 O O   . TRP A 210 ? 0.2792 0.2455 0.4414 -0.0004 -0.0314 -0.0182 822 TRP A O   
1429 C CB  . TRP A 210 ? 0.2008 0.1622 0.3752 -0.0044 -0.0211 -0.0163 822 TRP A CB  
1430 C CG  . TRP A 210 ? 0.1986 0.1669 0.3766 -0.0062 -0.0259 -0.0194 822 TRP A CG  
1431 C CD1 . TRP A 210 ? 0.2321 0.2030 0.4077 -0.0057 -0.0274 -0.0191 822 TRP A CD1 
1432 C CD2 . TRP A 210 ? 0.1928 0.1648 0.3764 -0.0077 -0.0299 -0.0228 822 TRP A CD2 
1433 N NE1 . TRP A 210 ? 0.2139 0.1895 0.3933 -0.0067 -0.0310 -0.0200 822 TRP A NE1 
1434 C CE2 . TRP A 210 ? 0.2339 0.2102 0.4156 -0.0074 -0.0332 -0.0225 822 TRP A CE2 
1435 C CE3 . TRP A 210 ? 0.2255 0.1966 0.4151 -0.0087 -0.0319 -0.0269 822 TRP A CE3 
1436 C CZ2 . TRP A 210 ? 0.2248 0.2041 0.4054 -0.0067 -0.0383 -0.0246 822 TRP A CZ2 
1437 C CZ3 . TRP A 210 ? 0.2535 0.2280 0.4425 -0.0082 -0.0384 -0.0315 822 TRP A CZ3 
1438 C CH2 . TRP A 210 ? 0.2542 0.2327 0.4363 -0.0067 -0.0415 -0.0297 822 TRP A CH2 
1439 N N   . SER A 211 ? 0.2638 0.2198 0.4116 0.0039  -0.0253 -0.0148 823 SER A N   
1440 C CA  . SER A 211 ? 0.2620 0.2180 0.4029 0.0064  -0.0300 -0.0181 823 SER A CA  
1441 C C   . SER A 211 ? 0.3408 0.2981 0.4812 0.0088  -0.0387 -0.0204 823 SER A C   
1442 O O   . SER A 211 ? 0.3553 0.3165 0.5032 0.0078  -0.0443 -0.0246 823 SER A O   
1443 C CB  . SER A 211 ? 0.3171 0.2651 0.4420 0.0114  -0.0251 -0.0170 823 SER A CB  
1444 O OG  . SER A 211 ? 0.3306 0.2781 0.4611 0.0094  -0.0155 -0.0147 823 SER A OG  
1445 N N   . TYR A 212 ? 0.2803 0.2340 0.4155 0.0120  -0.0398 -0.0175 824 TYR A N   
1446 C CA  . TYR A 212 ? 0.2642 0.2199 0.4031 0.0149  -0.0485 -0.0194 824 TYR A CA  
1447 C C   . TYR A 212 ? 0.3040 0.2688 0.4632 0.0101  -0.0491 -0.0214 824 TYR A C   
1448 O O   . TYR A 212 ? 0.2927 0.2620 0.4632 0.0106  -0.0558 -0.0248 824 TYR A O   
1449 C CB  . TYR A 212 ? 0.2752 0.2247 0.4068 0.0195  -0.0479 -0.0142 824 TYR A CB  
1450 C CG  . TYR A 212 ? 0.2789 0.2313 0.4178 0.0233  -0.0579 -0.0161 824 TYR A CG  
1451 C CD1 . TYR A 212 ? 0.3065 0.2560 0.4348 0.0301  -0.0692 -0.0190 824 TYR A CD1 
1452 C CD2 . TYR A 212 ? 0.2792 0.2380 0.4373 0.0205  -0.0569 -0.0166 824 TYR A CD2 
1453 C CE1 . TYR A 212 ? 0.3407 0.2948 0.4819 0.0336  -0.0807 -0.0221 824 TYR A CE1 
1454 C CE2 . TYR A 212 ? 0.2918 0.2549 0.4630 0.0239  -0.0654 -0.0187 824 TYR A CE2 
1455 C CZ  . TYR A 212 ? 0.4208 0.3822 0.5858 0.0301  -0.0781 -0.0214 824 TYR A CZ  
1456 O OH  . TYR A 212 ? 0.4112 0.3783 0.5944 0.0336  -0.0884 -0.0244 824 TYR A OH  
1457 N N   . GLY A 213 ? 0.2545 0.2211 0.4184 0.0062  -0.0420 -0.0194 825 GLY A N   
1458 C CA  . GLY A 213 ? 0.2409 0.2141 0.4173 0.0032  -0.0398 -0.0201 825 GLY A CA  
1459 C C   . GLY A 213 ? 0.2961 0.2735 0.4804 0.0010  -0.0409 -0.0213 825 GLY A C   
1460 O O   . GLY A 213 ? 0.2890 0.2712 0.4866 0.0002  -0.0401 -0.0211 825 GLY A O   
1461 N N   . ILE A 214 ? 0.2743 0.2494 0.4527 0.0002  -0.0412 -0.0220 826 ILE A N   
1462 C CA  . ILE A 214 ? 0.2522 0.2292 0.4386 -0.0015 -0.0425 -0.0233 826 ILE A CA  
1463 C C   . ILE A 214 ? 0.2784 0.2558 0.4734 0.0002  -0.0502 -0.0280 826 ILE A C   
1464 O O   . ILE A 214 ? 0.2606 0.2419 0.4739 -0.0018 -0.0508 -0.0285 826 ILE A O   
1465 C CB  . ILE A 214 ? 0.2823 0.2561 0.4612 -0.0019 -0.0405 -0.0236 826 ILE A CB  
1466 C CG1 . ILE A 214 ? 0.2820 0.2568 0.4581 -0.0036 -0.0355 -0.0202 826 ILE A CG1 
1467 C CG2 . ILE A 214 ? 0.2620 0.2363 0.4510 -0.0030 -0.0421 -0.0255 826 ILE A CG2 
1468 C CD1 . ILE A 214 ? 0.2906 0.2693 0.4719 -0.0051 -0.0339 -0.0172 826 ILE A CD1 
1469 N N   . VAL A 215 ? 0.2554 0.2283 0.4381 0.0046  -0.0563 -0.0312 827 VAL A N   
1470 C CA  . VAL A 215 ? 0.2624 0.2353 0.4510 0.0080  -0.0675 -0.0376 827 VAL A CA  
1471 C C   . VAL A 215 ? 0.3276 0.3081 0.5405 0.0065  -0.0696 -0.0371 827 VAL A C   
1472 O O   . VAL A 215 ? 0.3470 0.3313 0.5813 0.0055  -0.0760 -0.0420 827 VAL A O   
1473 C CB  . VAL A 215 ? 0.3153 0.2806 0.4796 0.0153  -0.0737 -0.0393 827 VAL A CB  
1474 C CG1 . VAL A 215 ? 0.3184 0.2848 0.4892 0.0202  -0.0887 -0.0459 827 VAL A CG1 
1475 C CG2 . VAL A 215 ? 0.3161 0.2741 0.4607 0.0177  -0.0714 -0.0416 827 VAL A CG2 
1476 N N   . MET A 216 ? 0.2867 0.2691 0.4991 0.0064  -0.0636 -0.0319 828 MET A N   
1477 C CA  . MET A 216 ? 0.2722 0.2615 0.5074 0.0058  -0.0623 -0.0309 828 MET A CA  
1478 C C   . MET A 216 ? 0.2846 0.2793 0.5418 0.0011  -0.0556 -0.0294 828 MET A C   
1479 O O   . MET A 216 ? 0.2522 0.2527 0.5368 0.0004  -0.0579 -0.0313 828 MET A O   
1480 C CB  . MET A 216 ? 0.2934 0.2820 0.5210 0.0064  -0.0539 -0.0261 828 MET A CB  
1481 C CG  . MET A 216 ? 0.3472 0.3321 0.5669 0.0116  -0.0597 -0.0262 828 MET A CG  
1482 S SD  . MET A 216 ? 0.3922 0.3755 0.6091 0.0118  -0.0494 -0.0224 828 MET A SD  
1483 C CE  . MET A 216 ? 0.3373 0.3302 0.5836 0.0117  -0.0453 -0.0232 828 MET A CE  
1484 N N   . TRP A 217 ? 0.2575 0.2499 0.5040 -0.0016 -0.0471 -0.0252 829 TRP A N   
1485 C CA  . TRP A 217 ? 0.2562 0.2509 0.5170 -0.0049 -0.0389 -0.0208 829 TRP A CA  
1486 C C   . TRP A 217 ? 0.3265 0.3212 0.6062 -0.0067 -0.0455 -0.0252 829 TRP A C   
1487 O O   . TRP A 217 ? 0.3208 0.3191 0.6277 -0.0091 -0.0410 -0.0229 829 TRP A O   
1488 C CB  . TRP A 217 ? 0.2286 0.2198 0.4691 -0.0055 -0.0319 -0.0158 829 TRP A CB  
1489 C CG  . TRP A 217 ? 0.2379 0.2297 0.4864 -0.0067 -0.0222 -0.0087 829 TRP A CG  
1490 C CD1 . TRP A 217 ? 0.2735 0.2662 0.5179 -0.0050 -0.0117 -0.0025 829 TRP A CD1 
1491 C CD2 . TRP A 217 ? 0.2325 0.2223 0.4914 -0.0087 -0.0213 -0.0061 829 TRP A CD2 
1492 N NE1 . TRP A 217 ? 0.2638 0.2549 0.5132 -0.0053 -0.0037 0.0052  829 TRP A NE1 
1493 C CE2 . TRP A 217 ? 0.2830 0.2722 0.5427 -0.0079 -0.0096 0.0036  829 TRP A CE2 
1494 C CE3 . TRP A 217 ? 0.2406 0.2279 0.5071 -0.0102 -0.0288 -0.0111 829 TRP A CE3 
1495 C CZ2 . TRP A 217 ? 0.2774 0.2635 0.5479 -0.0088 -0.0050 0.0101  829 TRP A CZ2 
1496 C CZ3 . TRP A 217 ? 0.2550 0.2396 0.5340 -0.0117 -0.0248 -0.0065 829 TRP A CZ3 
1497 C CH2 . TRP A 217 ? 0.2659 0.2498 0.5479 -0.0112 -0.0130 0.0048  829 TRP A CH2 
1498 N N   . GLU A 218 ? 0.2986 0.2888 0.5659 -0.0052 -0.0556 -0.0322 830 GLU A N   
1499 C CA  . GLU A 218 ? 0.3039 0.2927 0.5879 -0.0060 -0.0641 -0.0397 830 GLU A CA  
1500 C C   . GLU A 218 ? 0.3438 0.3380 0.6566 -0.0057 -0.0733 -0.0459 830 GLU A C   
1501 O O   . GLU A 218 ? 0.3347 0.3309 0.6787 -0.0088 -0.0750 -0.0489 830 GLU A O   
1502 C CB  . GLU A 218 ? 0.3313 0.3129 0.5912 -0.0024 -0.0724 -0.0471 830 GLU A CB  
1503 C CG  . GLU A 218 ? 0.3977 0.3748 0.6378 -0.0029 -0.0643 -0.0428 830 GLU A CG  
1504 C CD  . GLU A 218 ? 0.5026 0.4726 0.7224 0.0014  -0.0699 -0.0503 830 GLU A CD  
1505 O OE1 . GLU A 218 ? 0.2513 0.2180 0.4469 0.0053  -0.0694 -0.0493 830 GLU A OE1 
1506 O OE2 . GLU A 218 ? 0.4478 0.4146 0.6765 0.0014  -0.0742 -0.0573 830 GLU A OE2 
1507 N N   . VAL A 219 ? 0.3020 0.2983 0.6077 -0.0018 -0.0793 -0.0475 831 VAL A N   
1508 C CA  . VAL A 219 ? 0.2953 0.2977 0.6285 0.0000  -0.0905 -0.0538 831 VAL A CA  
1509 C C   . VAL A 219 ? 0.3231 0.3341 0.6934 -0.0042 -0.0791 -0.0476 831 VAL A C   
1510 O O   . VAL A 219 ? 0.3278 0.3443 0.7368 -0.0061 -0.0851 -0.0528 831 VAL A O   
1511 C CB  . VAL A 219 ? 0.3551 0.3560 0.6677 0.0070  -0.1010 -0.0562 831 VAL A CB  
1512 C CG1 . VAL A 219 ? 0.3664 0.3745 0.7106 0.0098  -0.1156 -0.0635 831 VAL A CG1 
1513 C CG2 . VAL A 219 ? 0.3614 0.3524 0.6361 0.0123  -0.1095 -0.0609 831 VAL A CG2 
1514 N N   . MET A 220 ? 0.2525 0.2639 0.6120 -0.0054 -0.0622 -0.0370 832 MET A N   
1515 C CA  . MET A 220 ? 0.2463 0.2644 0.6351 -0.0076 -0.0480 -0.0299 832 MET A CA  
1516 C C   . MET A 220 ? 0.3234 0.3409 0.7337 -0.0124 -0.0368 -0.0242 832 MET A C   
1517 O O   . MET A 220 ? 0.3385 0.3612 0.7805 -0.0141 -0.0248 -0.0184 832 MET A O   
1518 C CB  . MET A 220 ? 0.2687 0.2861 0.6348 -0.0052 -0.0348 -0.0224 832 MET A CB  
1519 C CG  . MET A 220 ? 0.2899 0.3086 0.6474 -0.0005 -0.0426 -0.0262 832 MET A CG  
1520 S SD  . MET A 220 ? 0.3254 0.3510 0.7152 0.0026  -0.0615 -0.0354 832 MET A SD  
1521 C CE  . MET A 220 ? 0.2715 0.3080 0.7103 0.0008  -0.0478 -0.0314 832 MET A CE  
1522 N N   . SER A 221 ? 0.2739 0.2846 0.6688 -0.0139 -0.0394 -0.0249 833 SER A N   
1523 C CA  . SER A 221 ? 0.2566 0.2644 0.6687 -0.0177 -0.0295 -0.0185 833 SER A CA  
1524 C C   . SER A 221 ? 0.2925 0.2997 0.7364 -0.0206 -0.0421 -0.0287 833 SER A C   
1525 O O   . SER A 221 ? 0.2750 0.2791 0.7409 -0.0240 -0.0348 -0.0241 833 SER A O   
1526 C CB  . SER A 221 ? 0.2658 0.2661 0.6414 -0.0167 -0.0238 -0.0122 833 SER A CB  
1527 O OG  . SER A 221 ? 0.3187 0.3148 0.6725 -0.0154 -0.0374 -0.0215 833 SER A OG  
1528 N N   . TYR A 222 ? 0.2531 0.2622 0.6987 -0.0183 -0.0615 -0.0426 834 TYR A N   
1529 C CA  . TYR A 222 ? 0.2538 0.2617 0.7228 -0.0191 -0.0790 -0.0570 834 TYR A CA  
1530 C C   . TYR A 222 ? 0.3261 0.3241 0.7758 -0.0193 -0.0813 -0.0605 834 TYR A C   
1531 O O   . TYR A 222 ? 0.3275 0.3227 0.8075 -0.0227 -0.0835 -0.0653 834 TYR A O   
1532 C CB  . TYR A 222 ? 0.2697 0.2843 0.7994 -0.0238 -0.0779 -0.0587 834 TYR A CB  
1533 C CG  . TYR A 222 ? 0.3030 0.3282 0.8594 -0.0223 -0.0843 -0.0624 834 TYR A CG  
1534 C CD1 . TYR A 222 ? 0.3331 0.3619 0.9102 -0.0198 -0.1087 -0.0793 834 TYR A CD1 
1535 C CD2 . TYR A 222 ? 0.3115 0.3429 0.8743 -0.0224 -0.0664 -0.0496 834 TYR A CD2 
1536 C CE1 . TYR A 222 ? 0.3485 0.3880 0.9555 -0.0179 -0.1160 -0.0826 834 TYR A CE1 
1537 C CE2 . TYR A 222 ? 0.3234 0.3650 0.9162 -0.0207 -0.0713 -0.0529 834 TYR A CE2 
1538 C CZ  . TYR A 222 ? 0.4131 0.4594 1.0302 -0.0187 -0.0965 -0.0691 834 TYR A CZ  
1539 O OH  . TYR A 222 ? 0.4054 0.4627 1.0556 -0.0163 -0.1028 -0.0724 834 TYR A OH  
1540 N N   . GLY A 223 ? 0.2791 0.2720 0.6824 -0.0157 -0.0799 -0.0583 835 GLY A N   
1541 C CA  . GLY A 223 ? 0.2778 0.2620 0.6608 -0.0148 -0.0815 -0.0619 835 GLY A CA  
1542 C C   . GLY A 223 ? 0.3152 0.2958 0.7002 -0.0179 -0.0664 -0.0502 835 GLY A C   
1543 O O   . GLY A 223 ? 0.3408 0.3150 0.7306 -0.0184 -0.0687 -0.0548 835 GLY A O   
1544 N N   . GLU A 224 ? 0.2425 0.2261 0.6216 -0.0189 -0.0518 -0.0356 836 GLU A N   
1545 C CA  . GLU A 224 ? 0.2340 0.2132 0.6079 -0.0198 -0.0391 -0.0235 836 GLU A CA  
1546 C C   . GLU A 224 ? 0.2741 0.2494 0.6104 -0.0166 -0.0409 -0.0241 836 GLU A C   
1547 O O   . GLU A 224 ? 0.2377 0.2142 0.5503 -0.0140 -0.0471 -0.0299 836 GLU A O   
1548 C CB  . GLU A 224 ? 0.2510 0.2334 0.6250 -0.0199 -0.0236 -0.0085 836 GLU A CB  
1549 C CG  . GLU A 224 ? 0.3389 0.3238 0.7543 -0.0231 -0.0148 -0.0028 836 GLU A CG  
1550 C CD  . GLU A 224 ? 0.5090 0.4929 0.9183 -0.0215 0.0046  0.0148  836 GLU A CD  
1551 O OE1 . GLU A 224 ? 0.3646 0.3417 0.7610 -0.0198 0.0116  0.0247  836 GLU A OE1 
1552 O OE2 . GLU A 224 ? 0.4087 0.3980 0.8251 -0.0209 0.0128  0.0188  836 GLU A OE2 
1553 N N   . ARG A 225 ? 0.2651 0.2356 0.5989 -0.0164 -0.0349 -0.0172 837 ARG A N   
1554 C CA  . ARG A 225 ? 0.2666 0.2347 0.5730 -0.0136 -0.0358 -0.0172 837 ARG A CA  
1555 C C   . ARG A 225 ? 0.3257 0.2974 0.6083 -0.0119 -0.0302 -0.0085 837 ARG A C   
1556 O O   . ARG A 225 ? 0.3327 0.3044 0.6166 -0.0114 -0.0219 0.0027  837 ARG A O   
1557 C CB  . ARG A 225 ? 0.2488 0.2110 0.5659 -0.0133 -0.0328 -0.0131 837 ARG A CB  
1558 C CG  . ARG A 225 ? 0.3312 0.2920 0.6277 -0.0103 -0.0324 -0.0111 837 ARG A CG  
1559 C CD  . ARG A 225 ? 0.3027 0.2573 0.6163 -0.0096 -0.0303 -0.0076 837 ARG A CD  
1560 N NE  . ARG A 225 ? 0.2882 0.2421 0.5895 -0.0062 -0.0301 -0.0045 837 ARG A NE  
1561 C CZ  . ARG A 225 ? 0.4132 0.3658 0.7100 -0.0044 -0.0334 -0.0140 837 ARG A CZ  
1562 N NH1 . ARG A 225 ? 0.3014 0.2523 0.5968 -0.0047 -0.0376 -0.0273 837 ARG A NH1 
1563 N NH2 . ARG A 225 ? 0.2232 0.1764 0.5158 -0.0014 -0.0325 -0.0103 837 ARG A NH2 
1564 N N   . PRO A 226 ? 0.2818 0.2554 0.5420 -0.0102 -0.0341 -0.0135 838 PRO A N   
1565 C CA  . PRO A 226 ? 0.2652 0.2413 0.5062 -0.0088 -0.0302 -0.0073 838 PRO A CA  
1566 C C   . PRO A 226 ? 0.3280 0.3023 0.5639 -0.0070 -0.0271 0.0005  838 PRO A C   
1567 O O   . PRO A 226 ? 0.3315 0.3034 0.5699 -0.0064 -0.0296 -0.0016 838 PRO A O   
1568 C CB  . PRO A 226 ? 0.2747 0.2512 0.4994 -0.0077 -0.0349 -0.0143 838 PRO A CB  
1569 C CG  . PRO A 226 ? 0.3295 0.3040 0.5597 -0.0075 -0.0407 -0.0230 838 PRO A CG  
1570 C CD  . PRO A 226 ? 0.2900 0.2620 0.5409 -0.0089 -0.0416 -0.0244 838 PRO A CD  
1571 N N   . TYR A 227 ? 0.2845 0.2593 0.5124 -0.0051 -0.0216 0.0094  839 TYR A N   
1572 C CA  . TYR A 227 ? 0.2840 0.2565 0.5015 -0.0013 -0.0204 0.0177  839 TYR A CA  
1573 C C   . TYR A 227 ? 0.3992 0.3667 0.6322 -0.0006 -0.0170 0.0256  839 TYR A C   
1574 O O   . TYR A 227 ? 0.4040 0.3688 0.6297 0.0035  -0.0181 0.0324  839 TYR A O   
1575 C CB  . TYR A 227 ? 0.2653 0.2397 0.4715 0.0001  -0.0279 0.0126  839 TYR A CB  
1576 C CG  . TYR A 227 ? 0.2201 0.1980 0.4152 -0.0010 -0.0305 0.0054  839 TYR A CG  
1577 C CD1 . TYR A 227 ? 0.2361 0.2149 0.4153 0.0016  -0.0309 0.0066  839 TYR A CD1 
1578 C CD2 . TYR A 227 ? 0.2072 0.1859 0.4066 -0.0037 -0.0324 -0.0024 839 TYR A CD2 
1579 C CE1 . TYR A 227 ? 0.2351 0.2160 0.4080 0.0004  -0.0331 -0.0003 839 TYR A CE1 
1580 C CE2 . TYR A 227 ? 0.1982 0.1785 0.3891 -0.0043 -0.0336 -0.0071 839 TYR A CE2 
1581 C CZ  . TYR A 227 ? 0.2811 0.2625 0.4613 -0.0028 -0.0339 -0.0061 839 TYR A CZ  
1582 O OH  . TYR A 227 ? 0.2037 0.1856 0.3793 -0.0035 -0.0348 -0.0110 839 TYR A OH  
1583 N N   . TRP A 228 ? 0.3770 0.3428 0.6337 -0.0041 -0.0137 0.0244  840 TRP A N   
1584 C CA  . TRP A 228 ? 0.3864 0.3464 0.6660 -0.0046 -0.0094 0.0308  840 TRP A CA  
1585 C C   . TRP A 228 ? 0.4339 0.3892 0.7131 -0.0014 -0.0125 0.0345  840 TRP A C   
1586 O O   . TRP A 228 ? 0.3940 0.3497 0.6773 -0.0023 -0.0192 0.0247  840 TRP A O   
1587 C CB  . TRP A 228 ? 0.3919 0.3491 0.6773 -0.0032 0.0032  0.0448  840 TRP A CB  
1588 C CG  . TRP A 228 ? 0.4102 0.3725 0.7026 -0.0059 0.0078  0.0421  840 TRP A CG  
1589 C CD1 . TRP A 228 ? 0.4411 0.4056 0.7642 -0.0109 0.0073  0.0354  840 TRP A CD1 
1590 C CD2 . TRP A 228 ? 0.4158 0.3819 0.6855 -0.0033 0.0115  0.0435  840 TRP A CD2 
1591 N NE1 . TRP A 228 ? 0.4383 0.4083 0.7616 -0.0114 0.0115  0.0345  840 TRP A NE1 
1592 C CE2 . TRP A 228 ? 0.4666 0.4374 0.7568 -0.0068 0.0150  0.0394  840 TRP A CE2 
1593 C CE3 . TRP A 228 ? 0.4422 0.4079 0.6781 0.0022  0.0114  0.0469  840 TRP A CE3 
1594 C CZ2 . TRP A 228 ? 0.4595 0.4344 0.7376 -0.0049 0.0203  0.0396  840 TRP A CZ2 
1595 C CZ3 . TRP A 228 ? 0.4653 0.4343 0.6874 0.0039  0.0159  0.0456  840 TRP A CZ3 
1596 C CH2 . TRP A 228 ? 0.4663 0.4396 0.7093 0.0005  0.0213  0.0426  840 TRP A CH2 
1597 N N   . ASP A 229 ? 0.4223 0.3726 0.6970 0.0032  -0.0066 0.0494  841 ASP A N   
1598 C CA  . ASP A 229 ? 0.4442 0.3890 0.7212 0.0077  -0.0086 0.0568  841 ASP A CA  
1599 C C   . ASP A 229 ? 0.4808 0.4300 0.7394 0.0114  -0.0189 0.0523  841 ASP A C   
1600 O O   . ASP A 229 ? 0.4890 0.4360 0.7586 0.0134  -0.0232 0.0517  841 ASP A O   
1601 C CB  . ASP A 229 ? 0.4991 0.4360 0.7719 0.0131  0.0014  0.0764  841 ASP A CB  
1602 C CG  . ASP A 229 ? 0.6977 0.6360 0.9366 0.0188  0.0044  0.0839  841 ASP A CG  
1603 O OD1 . ASP A 229 ? 0.6929 0.6368 0.9247 0.0157  0.0067  0.0773  841 ASP A OD1 
1604 O OD2 . ASP A 229 ? 0.8248 0.7580 1.0435 0.0272  0.0039  0.0960  841 ASP A OD2 
1605 N N   . MET A 230 ? 0.4033 0.3582 0.6377 0.0127  -0.0224 0.0491  842 MET A N   
1606 C CA  . MET A 230 ? 0.3812 0.3414 0.6020 0.0155  -0.0325 0.0435  842 MET A CA  
1607 C C   . MET A 230 ? 0.3774 0.3407 0.6153 0.0125  -0.0370 0.0328  842 MET A C   
1608 O O   . MET A 230 ? 0.3335 0.2974 0.5810 0.0075  -0.0343 0.0240  842 MET A O   
1609 C CB  . MET A 230 ? 0.4105 0.3761 0.6129 0.0140  -0.0341 0.0366  842 MET A CB  
1610 C CG  . MET A 230 ? 0.4785 0.4423 0.6548 0.0202  -0.0339 0.0439  842 MET A CG  
1611 S SD  . MET A 230 ? 0.5288 0.4972 0.6884 0.0180  -0.0336 0.0345  842 MET A SD  
1612 C CE  . MET A 230 ? 0.4711 0.4457 0.6350 0.0159  -0.0452 0.0224  842 MET A CE  
1613 N N   . SER A 231 ? 0.3300 0.2953 0.5704 0.0165  -0.0443 0.0332  843 SER A N   
1614 C CA  . SER A 231 ? 0.3061 0.2749 0.5630 0.0149  -0.0466 0.0238  843 SER A CA  
1615 C C   . SER A 231 ? 0.3344 0.3097 0.5848 0.0112  -0.0476 0.0133  843 SER A C   
1616 O O   . SER A 231 ? 0.3149 0.2928 0.5492 0.0109  -0.0498 0.0133  843 SER A O   
1617 C CB  . SER A 231 ? 0.3420 0.3122 0.6084 0.0208  -0.0539 0.0279  843 SER A CB  
1618 O OG  . SER A 231 ? 0.3833 0.3593 0.6374 0.0240  -0.0632 0.0278  843 SER A OG  
1619 N N   . ASN A 232 ? 0.2766 0.2534 0.5394 0.0092  -0.0448 0.0049  844 ASN A N   
1620 C CA  . ASN A 232 ? 0.2592 0.2404 0.5183 0.0064  -0.0432 -0.0029 844 ASN A CA  
1621 C C   . ASN A 232 ? 0.3059 0.2937 0.5646 0.0077  -0.0504 -0.0027 844 ASN A C   
1622 O O   . ASN A 232 ? 0.2958 0.2857 0.5447 0.0054  -0.0508 -0.0058 844 ASN A O   
1623 C CB  . ASN A 232 ? 0.2383 0.2184 0.5095 0.0063  -0.0370 -0.0097 844 ASN A CB  
1624 C CG  . ASN A 232 ? 0.3682 0.3416 0.6346 0.0050  -0.0322 -0.0143 844 ASN A CG  
1625 O OD1 . ASN A 232 ? 0.3610 0.3321 0.6176 0.0029  -0.0331 -0.0132 844 ASN A OD1 
1626 N ND2 . ASN A 232 ? 0.1599 0.1302 0.4339 0.0068  -0.0272 -0.0206 844 ASN A ND2 
1627 N N   . GLN A 233 ? 0.2568 0.2471 0.5269 0.0120  -0.0575 0.0008  845 GLN A N   
1628 C CA  . GLN A 233 ? 0.2592 0.2558 0.5321 0.0147  -0.0684 -0.0001 845 GLN A CA  
1629 C C   . GLN A 233 ? 0.3314 0.3260 0.5787 0.0169  -0.0748 0.0033  845 GLN A C   
1630 O O   . GLN A 233 ? 0.3374 0.3360 0.5809 0.0168  -0.0819 -0.0021 845 GLN A O   
1631 C CB  . GLN A 233 ? 0.2791 0.2784 0.5713 0.0203  -0.0762 0.0032  845 GLN A CB  
1632 C CG  . GLN A 233 ? 0.4626 0.4708 0.7694 0.0225  -0.0891 -0.0016 845 GLN A CG  
1633 C CD  . GLN A 233 ? 0.6560 0.6699 0.9774 0.0166  -0.0841 -0.0109 845 GLN A CD  
1634 O OE1 . GLN A 233 ? 0.6370 0.6519 0.9759 0.0134  -0.0721 -0.0136 845 GLN A OE1 
1635 N NE2 . GLN A 233 ? 0.4717 0.4882 0.7850 0.0155  -0.0920 -0.0155 845 GLN A NE2 
1636 N N   . ASP A 234 ? 0.3041 0.2919 0.5356 0.0191  -0.0711 0.0118  846 ASP A N   
1637 C CA  . ASP A 234 ? 0.3152 0.2996 0.5199 0.0224  -0.0732 0.0166  846 ASP A CA  
1638 C C   . ASP A 234 ? 0.3428 0.3279 0.5375 0.0173  -0.0677 0.0103  846 ASP A C   
1639 O O   . ASP A 234 ? 0.3633 0.3478 0.5387 0.0200  -0.0714 0.0094  846 ASP A O   
1640 C CB  . ASP A 234 ? 0.3464 0.3226 0.5419 0.0258  -0.0663 0.0292  846 ASP A CB  
1641 C CG  . ASP A 234 ? 0.4646 0.4375 0.6632 0.0334  -0.0723 0.0389  846 ASP A CG  
1642 O OD1 . ASP A 234 ? 0.4182 0.3953 0.6171 0.0384  -0.0855 0.0364  846 ASP A OD1 
1643 O OD2 . ASP A 234 ? 0.5222 0.4880 0.7263 0.0344  -0.0645 0.0489  846 ASP A OD2 
1644 N N   . VAL A 235 ? 0.2728 0.2582 0.4785 0.0112  -0.0592 0.0061  847 VAL A N   
1645 C CA  . VAL A 235 ? 0.2644 0.2500 0.4632 0.0068  -0.0542 0.0008  847 VAL A CA  
1646 C C   . VAL A 235 ? 0.3470 0.3369 0.5479 0.0057  -0.0599 -0.0070 847 VAL A C   
1647 O O   . VAL A 235 ? 0.3735 0.3628 0.5611 0.0061  -0.0616 -0.0095 847 VAL A O   
1648 C CB  . VAL A 235 ? 0.2733 0.2571 0.4811 0.0025  -0.0462 -0.0018 847 VAL A CB  
1649 C CG1 . VAL A 235 ? 0.2553 0.2393 0.4564 -0.0007 -0.0430 -0.0070 847 VAL A CG1 
1650 C CG2 . VAL A 235 ? 0.2640 0.2434 0.4737 0.0028  -0.0417 0.0040  847 VAL A CG2 
1651 N N   . ILE A 236 ? 0.3053 0.2992 0.5256 0.0047  -0.0622 -0.0108 848 ILE A N   
1652 C CA  . ILE A 236 ? 0.2891 0.2874 0.5214 0.0029  -0.0667 -0.0179 848 ILE A CA  
1653 C C   . ILE A 236 ? 0.3777 0.3774 0.6000 0.0071  -0.0798 -0.0205 848 ILE A C   
1654 O O   . ILE A 236 ? 0.3890 0.3888 0.6079 0.0057  -0.0827 -0.0269 848 ILE A O   
1655 C CB  . ILE A 236 ? 0.3205 0.3234 0.5806 0.0022  -0.0654 -0.0195 848 ILE A CB  
1656 C CG1 . ILE A 236 ? 0.3088 0.3085 0.5730 -0.0006 -0.0515 -0.0188 848 ILE A CG1 
1657 C CG2 . ILE A 236 ? 0.3170 0.3260 0.5990 0.0009  -0.0722 -0.0263 848 ILE A CG2 
1658 C CD1 . ILE A 236 ? 0.2965 0.2991 0.5847 0.0007  -0.0474 -0.0190 848 ILE A CD1 
1659 N N   . ASN A 237 ? 0.3517 0.3513 0.5674 0.0132  -0.0878 -0.0156 849 ASN A N   
1660 C CA  . ASN A 237 ? 0.3635 0.3630 0.5636 0.0199  -0.1020 -0.0177 849 ASN A CA  
1661 C C   . ASN A 237 ? 0.3962 0.3898 0.5653 0.0221  -0.0991 -0.0173 849 ASN A C   
1662 O O   . ASN A 237 ? 0.4030 0.3965 0.5626 0.0245  -0.1082 -0.0256 849 ASN A O   
1663 C CB  . ASN A 237 ? 0.3711 0.3700 0.5686 0.0274  -0.1101 -0.0100 849 ASN A CB  
1664 C CG  . ASN A 237 ? 0.5633 0.5695 0.7940 0.0273  -0.1179 -0.0131 849 ASN A CG  
1665 O OD1 . ASN A 237 ? 0.4782 0.4908 0.7334 0.0228  -0.1207 -0.0225 849 ASN A OD1 
1666 N ND2 . ASN A 237 ? 0.4701 0.4754 0.7053 0.0326  -0.1209 -0.0049 849 ASN A ND2 
1667 N N   . ALA A 238 ? 0.3365 0.3251 0.4929 0.0214  -0.0862 -0.0085 850 ALA A N   
1668 C CA  . ALA A 238 ? 0.3350 0.3184 0.4660 0.0237  -0.0796 -0.0064 850 ALA A CA  
1669 C C   . ALA A 238 ? 0.3507 0.3352 0.4842 0.0189  -0.0773 -0.0160 850 ALA A C   
1670 O O   . ALA A 238 ? 0.3424 0.3242 0.4575 0.0227  -0.0807 -0.0210 850 ALA A O   
1671 C CB  . ALA A 238 ? 0.3393 0.3190 0.4690 0.0223  -0.0659 0.0044  850 ALA A CB  
1672 N N   . VAL A 239 ? 0.2965 0.2837 0.4517 0.0115  -0.0718 -0.0187 851 VAL A N   
1673 C CA  . VAL A 239 ? 0.2960 0.2832 0.4576 0.0069  -0.0687 -0.0259 851 VAL A CA  
1674 C C   . VAL A 239 ? 0.3879 0.3765 0.5541 0.0078  -0.0799 -0.0364 851 VAL A C   
1675 O O   . VAL A 239 ? 0.3883 0.3740 0.5472 0.0078  -0.0797 -0.0425 851 VAL A O   
1676 C CB  . VAL A 239 ? 0.3339 0.3224 0.5143 0.0010  -0.0606 -0.0244 851 VAL A CB  
1677 C CG1 . VAL A 239 ? 0.3380 0.3258 0.5286 -0.0028 -0.0584 -0.0304 851 VAL A CG1 
1678 C CG2 . VAL A 239 ? 0.3226 0.3086 0.4964 0.0002  -0.0515 -0.0180 851 VAL A CG2 
1679 N N   . GLU A 240 ? 0.3887 0.3817 0.5696 0.0090  -0.0905 -0.0393 852 GLU A N   
1680 C CA  . GLU A 240 ? 0.4047 0.4001 0.5974 0.0099  -0.1045 -0.0508 852 GLU A CA  
1681 C C   . GLU A 240 ? 0.4713 0.4627 0.6343 0.0180  -0.1155 -0.0564 852 GLU A C   
1682 O O   . GLU A 240 ? 0.4593 0.4498 0.6254 0.0186  -0.1252 -0.0688 852 GLU A O   
1683 C CB  . GLU A 240 ? 0.4274 0.4297 0.6460 0.0102  -0.1136 -0.0514 852 GLU A CB  
1684 C CG  . GLU A 240 ? 0.5888 0.5951 0.8421 0.0027  -0.1040 -0.0509 852 GLU A CG  
1685 C CD  . GLU A 240 ? 0.9323 0.9454 1.2119 0.0031  -0.1068 -0.0484 852 GLU A CD  
1686 O OE1 . GLU A 240 ? 0.8936 0.9093 1.1691 0.0093  -0.1201 -0.0481 852 GLU A OE1 
1687 O OE2 . GLU A 240 ? 0.8723 0.8874 1.1760 -0.0019 -0.0950 -0.0464 852 GLU A OE2 
1688 N N   . GLN A 241 ? 0.4588 0.4466 0.5931 0.0247  -0.1133 -0.0472 853 GLN A N   
1689 C CA  . GLN A 241 ? 0.4968 0.4786 0.5946 0.0346  -0.1199 -0.0493 853 GLN A CA  
1690 C C   . GLN A 241 ? 0.5657 0.5415 0.6428 0.0348  -0.1053 -0.0478 853 GLN A C   
1691 O O   . GLN A 241 ? 0.5973 0.5669 0.6407 0.0435  -0.1033 -0.0453 853 GLN A O   
1692 C CB  . GLN A 241 ? 0.5309 0.5107 0.6094 0.0431  -0.1232 -0.0376 853 GLN A CB  
1693 C CG  . GLN A 241 ? 0.7398 0.7256 0.8390 0.0448  -0.1392 -0.0390 853 GLN A CG  
1694 C CD  . GLN A 241 ? 1.0840 1.0719 1.1844 0.0498  -0.1618 -0.0545 853 GLN A CD  
1695 O OE1 . GLN A 241 ? 1.0143 1.0093 1.1508 0.0433  -0.1694 -0.0651 853 GLN A OE1 
1696 N NE2 . GLN A 241 ? 1.0692 1.0507 1.1311 0.0622  -0.1731 -0.0561 853 GLN A NE2 
1697 N N   . ASP A 242 ? 0.4752 0.4527 0.5729 0.0260  -0.0945 -0.0488 854 ASP A N   
1698 C CA  . ASP A 242 ? 0.4667 0.4403 0.5558 0.0247  -0.0818 -0.0487 854 ASP A CA  
1699 C C   . ASP A 242 ? 0.4833 0.4551 0.5593 0.0264  -0.0670 -0.0357 854 ASP A C   
1700 O O   . ASP A 242 ? 0.4915 0.4599 0.5552 0.0286  -0.0578 -0.0358 854 ASP A O   
1701 C CB  . ASP A 242 ? 0.5172 0.4854 0.5870 0.0305  -0.0877 -0.0612 854 ASP A CB  
1702 C CG  . ASP A 242 ? 0.6762 0.6457 0.7655 0.0278  -0.1021 -0.0762 854 ASP A CG  
1703 O OD1 . ASP A 242 ? 0.6653 0.6371 0.7843 0.0194  -0.0983 -0.0776 854 ASP A OD1 
1704 O OD2 . ASP A 242 ? 0.8013 0.7687 0.8767 0.0347  -0.1174 -0.0864 854 ASP A OD2 
1705 N N   . TYR A 243 ? 0.4072 0.3810 0.4897 0.0254  -0.0643 -0.0248 855 TYR A N   
1706 C CA  . TYR A 243 ? 0.3726 0.3449 0.4520 0.0255  -0.0504 -0.0127 855 TYR A CA  
1707 C C   . TYR A 243 ? 0.3827 0.3581 0.4845 0.0174  -0.0431 -0.0137 855 TYR A C   
1708 O O   . TYR A 243 ? 0.3679 0.3463 0.4876 0.0121  -0.0477 -0.0183 855 TYR A O   
1709 C CB  . TYR A 243 ? 0.3758 0.3484 0.4600 0.0266  -0.0511 -0.0022 855 TYR A CB  
1710 C CG  . TYR A 243 ? 0.3733 0.3446 0.4654 0.0246  -0.0371 0.0091  855 TYR A CG  
1711 C CD1 . TYR A 243 ? 0.4092 0.3752 0.4837 0.0309  -0.0269 0.0194  855 TYR A CD1 
1712 C CD2 . TYR A 243 ? 0.3431 0.3178 0.4606 0.0169  -0.0337 0.0089  855 TYR A CD2 
1713 C CE1 . TYR A 243 ? 0.3691 0.3342 0.4583 0.0282  -0.0134 0.0293  855 TYR A CE1 
1714 C CE2 . TYR A 243 ? 0.3406 0.3143 0.4699 0.0148  -0.0232 0.0168  855 TYR A CE2 
1715 C CZ  . TYR A 243 ? 0.4357 0.4051 0.5542 0.0198  -0.0131 0.0270  855 TYR A CZ  
1716 O OH  . TYR A 243 ? 0.4209 0.3897 0.5580 0.0171  -0.0022 0.0345  855 TYR A OH  
1717 N N   . ARG A 244 ? 0.3161 0.2905 0.4173 0.0174  -0.0314 -0.0088 856 ARG A N   
1718 C CA  . ARG A 244 ? 0.2847 0.2617 0.4053 0.0115  -0.0260 -0.0091 856 ARG A CA  
1719 C C   . ARG A 244 ? 0.3423 0.3196 0.4701 0.0116  -0.0157 0.0004  856 ARG A C   
1720 O O   . ARG A 244 ? 0.3547 0.3291 0.4694 0.0168  -0.0081 0.0068  856 ARG A O   
1721 C CB  . ARG A 244 ? 0.2614 0.2376 0.3808 0.0116  -0.0241 -0.0164 856 ARG A CB  
1722 C CG  . ARG A 244 ? 0.2053 0.1804 0.3245 0.0106  -0.0334 -0.0265 856 ARG A CG  
1723 C CD  . ARG A 244 ? 0.1947 0.1719 0.3320 0.0048  -0.0377 -0.0272 856 ARG A CD  
1724 N NE  . ARG A 244 ? 0.2826 0.2583 0.4259 0.0033  -0.0438 -0.0355 856 ARG A NE  
1725 C CZ  . ARG A 244 ? 0.4092 0.3859 0.5560 0.0033  -0.0524 -0.0398 856 ARG A CZ  
1726 N NH1 . ARG A 244 ? 0.2166 0.1957 0.3583 0.0056  -0.0567 -0.0362 856 ARG A NH1 
1727 N NH2 . ARG A 244 ? 0.2410 0.2165 0.4000 0.0012  -0.0572 -0.0476 856 ARG A NH2 
1728 N N   . LEU A 245 ? 0.2900 0.2699 0.4386 0.0064  -0.0152 0.0011  857 LEU A N   
1729 C CA  . LEU A 245 ? 0.3055 0.2862 0.4696 0.0052  -0.0073 0.0080  857 LEU A CA  
1730 C C   . LEU A 245 ? 0.3773 0.3586 0.5427 0.0077  0.0037  0.0108  857 LEU A C   
1731 O O   . LEU A 245 ? 0.3823 0.3649 0.5454 0.0082  0.0034  0.0046  857 LEU A O   
1732 C CB  . LEU A 245 ? 0.2947 0.2779 0.4797 0.0000  -0.0120 0.0041  857 LEU A CB  
1733 C CG  . LEU A 245 ? 0.3265 0.3084 0.5154 -0.0018 -0.0182 0.0037  857 LEU A CG  
1734 C CD1 . LEU A 245 ? 0.3065 0.2892 0.5049 -0.0048 -0.0241 -0.0034 857 LEU A CD1 
1735 C CD2 . LEU A 245 ? 0.3419 0.3217 0.5411 -0.0014 -0.0133 0.0118  857 LEU A CD2 
1736 N N   . PRO A 246 ? 0.3531 0.3328 0.5230 0.0099  0.0151  0.0208  858 PRO A N   
1737 C CA  . PRO A 246 ? 0.3657 0.3463 0.5399 0.0127  0.0288  0.0243  858 PRO A CA  
1738 C C   . PRO A 246 ? 0.3918 0.3788 0.5989 0.0080  0.0295  0.0205  858 PRO A C   
1739 O O   . PRO A 246 ? 0.3542 0.3438 0.5782 0.0030  0.0191  0.0159  858 PRO A O   
1740 C CB  . PRO A 246 ? 0.4029 0.3790 0.5744 0.0166  0.0423  0.0381  858 PRO A CB  
1741 C CG  . PRO A 246 ? 0.4491 0.4237 0.6302 0.0131  0.0349  0.0413  858 PRO A CG  
1742 C CD  . PRO A 246 ? 0.3726 0.3491 0.5467 0.0101  0.0177  0.0302  858 PRO A CD  
1743 N N   . PRO A 247 ? 0.3493 0.3389 0.5659 0.0103  0.0407  0.0216  859 PRO A N   
1744 C CA  . PRO A 247 ? 0.3298 0.3263 0.5821 0.0064  0.0391  0.0179  859 PRO A CA  
1745 C C   . PRO A 247 ? 0.3750 0.3738 0.6602 0.0023  0.0427  0.0239  859 PRO A C   
1746 O O   . PRO A 247 ? 0.3915 0.3872 0.6790 0.0041  0.0575  0.0349  859 PRO A O   
1747 C CB  . PRO A 247 ? 0.3576 0.3563 0.6135 0.0109  0.0524  0.0185  859 PRO A CB  
1748 C CG  . PRO A 247 ? 0.4320 0.4239 0.6583 0.0173  0.0666  0.0263  859 PRO A CG  
1749 C CD  . PRO A 247 ? 0.3851 0.3711 0.5816 0.0175  0.0556  0.0259  859 PRO A CD  
1750 N N   . PRO A 248 ? 0.3045 0.3075 0.6146 -0.0027 0.0294  0.0167  860 PRO A N   
1751 C CA  . PRO A 248 ? 0.2984 0.3034 0.6457 -0.0068 0.0314  0.0197  860 PRO A CA  
1752 C C   . PRO A 248 ? 0.3819 0.3924 0.7631 -0.0063 0.0472  0.0256  860 PRO A C   
1753 O O   . PRO A 248 ? 0.3646 0.3785 0.7434 -0.0029 0.0533  0.0245  860 PRO A O   
1754 C CB  . PRO A 248 ? 0.3060 0.3142 0.6671 -0.0100 0.0112  0.0071  860 PRO A CB  
1755 C CG  . PRO A 248 ? 0.3491 0.3541 0.6730 -0.0078 0.0012  0.0015  860 PRO A CG  
1756 C CD  . PRO A 248 ? 0.3057 0.3106 0.6118 -0.0037 0.0123  0.0055  860 PRO A CD  
1757 N N   . MET A 249 ? 0.3776 0.3882 0.7929 -0.0096 0.0556  0.0324  861 MET A N   
1758 C CA  . MET A 249 ? 0.3937 0.4091 0.8496 -0.0100 0.0737  0.0401  861 MET A CA  
1759 C C   . MET A 249 ? 0.4479 0.4741 0.9355 -0.0108 0.0661  0.0299  861 MET A C   
1760 O O   . MET A 249 ? 0.4345 0.4648 0.9377 -0.0139 0.0446  0.0174  861 MET A O   
1761 C CB  . MET A 249 ? 0.4318 0.4449 0.9266 -0.0150 0.0795  0.0468  861 MET A CB  
1762 C CG  . MET A 249 ? 0.4991 0.5159 1.0397 -0.0156 0.1029  0.0580  861 MET A CG  
1763 S SD  . MET A 249 ? 0.5893 0.6008 1.0973 -0.0065 0.1350  0.0757  861 MET A SD  
1764 C CE  . MET A 249 ? 0.5638 0.5600 1.0307 -0.0030 0.1429  0.0907  861 MET A CE  
1765 N N   . ASP A 250 ? 0.4125 0.4422 0.9045 -0.0065 0.0834  0.0350  862 ASP A N   
1766 C CA  . ASP A 250 ? 0.4028 0.4429 0.9254 -0.0053 0.0812  0.0279  862 ASP A CA  
1767 C C   . ASP A 250 ? 0.4210 0.4624 0.9194 -0.0035 0.0583  0.0147  862 ASP A C   
1768 O O   . ASP A 250 ? 0.4143 0.4642 0.9423 -0.0030 0.0484  0.0070  862 ASP A O   
1769 C CB  . ASP A 250 ? 0.4268 0.4767 1.0185 -0.0107 0.0793  0.0257  862 ASP A CB  
1770 C CG  . ASP A 250 ? 0.6085 0.6570 1.2319 -0.0124 0.1058  0.0406  862 ASP A CG  
1771 O OD1 . ASP A 250 ? 0.6433 0.6926 1.2689 -0.0078 0.1311  0.0507  862 ASP A OD1 
1772 O OD2 . ASP A 250 ? 0.6959 0.7415 1.3415 -0.0178 0.1025  0.0426  862 ASP A OD2 
1773 N N   . CYS A 251 ? 0.3612 0.3941 0.8081 -0.0018 0.0507  0.0130  863 CYS A N   
1774 C CA  . CYS A 251 ? 0.3252 0.3568 0.7464 0.0002  0.0327  0.0032  863 CYS A CA  
1775 C C   . CYS A 251 ? 0.3689 0.4012 0.7793 0.0057  0.0422  0.0031  863 CYS A C   
1776 O O   . CYS A 251 ? 0.3607 0.3878 0.7463 0.0093  0.0589  0.0091  863 CYS A O   
1777 C CB  . CYS A 251 ? 0.3154 0.3381 0.6930 -0.0005 0.0239  0.0022  863 CYS A CB  
1778 S SG  . CYS A 251 ? 0.3552 0.3741 0.6997 0.0023  0.0076  -0.0066 863 CYS A SG  
1779 N N   . PRO A 252 ? 0.3249 0.3620 0.7490 0.0077  0.0303  -0.0045 864 PRO A N   
1780 C CA  . PRO A 252 ? 0.3290 0.3655 0.7433 0.0134  0.0385  -0.0057 864 PRO A CA  
1781 C C   . PRO A 252 ? 0.3746 0.4004 0.7383 0.0157  0.0397  -0.0065 864 PRO A C   
1782 O O   . PRO A 252 ? 0.3627 0.3833 0.7025 0.0134  0.0262  -0.0090 864 PRO A O   
1783 C CB  . PRO A 252 ? 0.3437 0.3856 0.7803 0.0151  0.0206  -0.0132 864 PRO A CB  
1784 C CG  . PRO A 252 ? 0.3941 0.4432 0.8668 0.0107  0.0082  -0.0153 864 PRO A CG  
1785 C CD  . PRO A 252 ? 0.3286 0.3710 0.7768 0.0061  0.0084  -0.0124 864 PRO A CD  
1786 N N   . THR A 253 ? 0.3491 0.3716 0.6980 0.0207  0.0564  -0.0048 865 THR A N   
1787 C CA  . THR A 253 ? 0.3605 0.3732 0.6657 0.0239  0.0576  -0.0077 865 THR A CA  
1788 C C   . THR A 253 ? 0.4195 0.4284 0.7131 0.0233  0.0399  -0.0153 865 THR A C   
1789 O O   . THR A 253 ? 0.4000 0.4023 0.6650 0.0217  0.0322  -0.0172 865 THR A O   
1790 C CB  . THR A 253 ? 0.4381 0.4481 0.7342 0.0311  0.0780  -0.0071 865 THR A CB  
1791 O OG1 . THR A 253 ? 0.4446 0.4560 0.7464 0.0319  0.0959  0.0028  865 THR A OG1 
1792 C CG2 . THR A 253 ? 0.4013 0.4008 0.6533 0.0353  0.0771  -0.0130 865 THR A CG2 
1793 N N   . ALA A 254 ? 0.3809 0.3940 0.6990 0.0250  0.0335  -0.0187 866 ALA A N   
1794 C CA  . ALA A 254 ? 0.3794 0.3874 0.6876 0.0255  0.0184  -0.0234 866 ALA A CA  
1795 C C   . ALA A 254 ? 0.3995 0.4045 0.6929 0.0208  0.0035  -0.0226 866 ALA A C   
1796 O O   . ALA A 254 ? 0.3864 0.3838 0.6582 0.0206  -0.0027 -0.0246 866 ALA A O   
1797 C CB  . ALA A 254 ? 0.3835 0.3967 0.7225 0.0290  0.0127  -0.0251 866 ALA A CB  
1798 N N   . LEU A 255 ? 0.3507 0.3613 0.6582 0.0174  -0.0009 -0.0201 867 LEU A N   
1799 C CA  . LEU A 255 ? 0.3346 0.3426 0.6302 0.0138  -0.0135 -0.0203 867 LEU A CA  
1800 C C   . LEU A 255 ? 0.3539 0.3563 0.6220 0.0110  -0.0089 -0.0185 867 LEU A C   
1801 O O   . LEU A 255 ? 0.3321 0.3291 0.5816 0.0097  -0.0167 -0.0197 867 LEU A O   
1802 C CB  . LEU A 255 ? 0.3241 0.3393 0.6473 0.0116  -0.0204 -0.0206 867 LEU A CB  
1803 C CG  . LEU A 255 ? 0.3742 0.3950 0.7239 0.0150  -0.0322 -0.0243 867 LEU A CG  
1804 C CD1 . LEU A 255 ? 0.3674 0.3951 0.7463 0.0126  -0.0413 -0.0271 867 LEU A CD1 
1805 C CD2 . LEU A 255 ? 0.3814 0.3949 0.7090 0.0189  -0.0459 -0.0262 867 LEU A CD2 
1806 N N   . HIS A 256 ? 0.2983 0.3015 0.5637 0.0111  0.0044  -0.0151 868 HIS A N   
1807 C CA  . HIS A 256 ? 0.2921 0.2899 0.5306 0.0102  0.0074  -0.0134 868 HIS A CA  
1808 C C   . HIS A 256 ? 0.3110 0.3023 0.5268 0.0125  0.0053  -0.0185 868 HIS A C   
1809 O O   . HIS A 256 ? 0.3248 0.3119 0.5241 0.0106  -0.0012 -0.0200 868 HIS A O   
1810 C CB  . HIS A 256 ? 0.3064 0.3049 0.5433 0.0118  0.0219  -0.0072 868 HIS A CB  
1811 C CG  . HIS A 256 ? 0.3619 0.3548 0.5712 0.0119  0.0215  -0.0050 868 HIS A CG  
1812 N ND1 . HIS A 256 ? 0.4014 0.3889 0.5838 0.0167  0.0262  -0.0069 868 HIS A ND1 
1813 C CD2 . HIS A 256 ? 0.3879 0.3798 0.5938 0.0085  0.0147  -0.0026 868 HIS A CD2 
1814 C CE1 . HIS A 256 ? 0.3969 0.3811 0.5615 0.0162  0.0215  -0.0048 868 HIS A CE1 
1815 N NE2 . HIS A 256 ? 0.3930 0.3798 0.5720 0.0112  0.0154  -0.0016 868 HIS A NE2 
1816 N N   . GLN A 257 ? 0.2400 0.2304 0.4594 0.0165  0.0107  -0.0220 869 GLN A N   
1817 C CA  . GLN A 257 ? 0.2449 0.2283 0.4492 0.0185  0.0081  -0.0284 869 GLN A CA  
1818 C C   . GLN A 257 ? 0.2957 0.2759 0.5009 0.0156  -0.0040 -0.0293 869 GLN A C   
1819 O O   . GLN A 257 ? 0.3020 0.2767 0.4933 0.0142  -0.0078 -0.0323 869 GLN A O   
1820 C CB  . GLN A 257 ? 0.2705 0.2530 0.4823 0.0238  0.0162  -0.0324 869 GLN A CB  
1821 C CG  . GLN A 257 ? 0.4671 0.4408 0.6661 0.0259  0.0136  -0.0408 869 GLN A CG  
1822 C CD  . GLN A 257 ? 0.7267 0.6952 0.8989 0.0271  0.0142  -0.0458 869 GLN A CD  
1823 O OE1 . GLN A 257 ? 0.6562 0.6231 0.8147 0.0325  0.0238  -0.0483 869 GLN A OE1 
1824 N NE2 . GLN A 257 ? 0.5050 0.4703 0.6689 0.0231  0.0038  -0.0477 869 GLN A NE2 
1825 N N   . LEU A 258 ? 0.2347 0.2182 0.4560 0.0151  -0.0101 -0.0264 870 LEU A N   
1826 C CA  . LEU A 258 ? 0.2260 0.2050 0.4428 0.0140  -0.0198 -0.0253 870 LEU A CA  
1827 C C   . LEU A 258 ? 0.2977 0.2751 0.5003 0.0099  -0.0228 -0.0241 870 LEU A C   
1828 O O   . LEU A 258 ? 0.2857 0.2572 0.4793 0.0089  -0.0251 -0.0244 870 LEU A O   
1829 C CB  . LEU A 258 ? 0.2183 0.2004 0.4498 0.0164  -0.0276 -0.0231 870 LEU A CB  
1830 C CG  . LEU A 258 ? 0.2779 0.2532 0.4990 0.0180  -0.0365 -0.0207 870 LEU A CG  
1831 C CD1 . LEU A 258 ? 0.2733 0.2395 0.4887 0.0199  -0.0339 -0.0200 870 LEU A CD1 
1832 C CD2 . LEU A 258 ? 0.3328 0.3110 0.5647 0.0222  -0.0469 -0.0199 870 LEU A CD2 
1833 N N   . MET A 259 ? 0.2599 0.2424 0.4640 0.0078  -0.0217 -0.0223 871 MET A N   
1834 C CA  . MET A 259 ? 0.2567 0.2382 0.4507 0.0046  -0.0239 -0.0211 871 MET A CA  
1835 C C   . MET A 259 ? 0.3307 0.3086 0.5114 0.0041  -0.0218 -0.0234 871 MET A C   
1836 O O   . MET A 259 ? 0.3357 0.3111 0.5107 0.0021  -0.0252 -0.0237 871 MET A O   
1837 C CB  . MET A 259 ? 0.2749 0.2614 0.4758 0.0031  -0.0212 -0.0182 871 MET A CB  
1838 C CG  . MET A 259 ? 0.3037 0.2943 0.5231 0.0027  -0.0256 -0.0180 871 MET A CG  
1839 S SD  . MET A 259 ? 0.3434 0.3390 0.5790 0.0008  -0.0179 -0.0137 871 MET A SD  
1840 C CE  . MET A 259 ? 0.2843 0.2868 0.5531 0.0014  -0.0212 -0.0157 871 MET A CE  
1841 N N   . LEU A 260 ? 0.3113 0.2890 0.4879 0.0065  -0.0163 -0.0256 872 LEU A N   
1842 C CA  . LEU A 260 ? 0.3177 0.2916 0.4810 0.0073  -0.0171 -0.0305 872 LEU A CA  
1843 C C   . LEU A 260 ? 0.3736 0.3421 0.5401 0.0063  -0.0212 -0.0351 872 LEU A C   
1844 O O   . LEU A 260 ? 0.3826 0.3488 0.5455 0.0046  -0.0254 -0.0385 872 LEU A O   
1845 C CB  . LEU A 260 ? 0.3242 0.2974 0.4772 0.0121  -0.0102 -0.0330 872 LEU A CB  
1846 C CG  . LEU A 260 ? 0.3685 0.3447 0.5147 0.0138  -0.0040 -0.0267 872 LEU A CG  
1847 C CD1 . LEU A 260 ? 0.3887 0.3623 0.5201 0.0203  0.0052  -0.0286 872 LEU A CD1 
1848 C CD2 . LEU A 260 ? 0.3510 0.3269 0.4872 0.0122  -0.0101 -0.0245 872 LEU A CD2 
1849 N N   . ASP A 261 ? 0.3310 0.2973 0.5074 0.0075  -0.0202 -0.0345 873 ASP A N   
1850 C CA  . ASP A 261 ? 0.3335 0.2930 0.5152 0.0067  -0.0224 -0.0361 873 ASP A CA  
1851 C C   . ASP A 261 ? 0.3565 0.3149 0.5381 0.0033  -0.0251 -0.0315 873 ASP A C   
1852 O O   . ASP A 261 ? 0.3495 0.3040 0.5347 0.0010  -0.0258 -0.0337 873 ASP A O   
1853 C CB  . ASP A 261 ? 0.3517 0.3079 0.5432 0.0099  -0.0208 -0.0343 873 ASP A CB  
1854 C CG  . ASP A 261 ? 0.4775 0.4350 0.6731 0.0140  -0.0162 -0.0387 873 ASP A CG  
1855 O OD1 . ASP A 261 ? 0.5076 0.4642 0.6955 0.0150  -0.0135 -0.0456 873 ASP A OD1 
1856 O OD2 . ASP A 261 ? 0.4724 0.4315 0.6789 0.0170  -0.0155 -0.0356 873 ASP A OD2 
1857 N N   . CYS A 262 ? 0.2812 0.2431 0.4606 0.0034  -0.0263 -0.0261 874 CYS A N   
1858 C CA  . CYS A 262 ? 0.2836 0.2441 0.4598 0.0017  -0.0273 -0.0222 874 CYS A CA  
1859 C C   . CYS A 262 ? 0.3253 0.2880 0.5009 -0.0016 -0.0277 -0.0245 874 CYS A C   
1860 O O   . CYS A 262 ? 0.3022 0.2624 0.4801 -0.0032 -0.0263 -0.0226 874 CYS A O   
1861 C CB  . CYS A 262 ? 0.2925 0.2560 0.4657 0.0033  -0.0302 -0.0192 874 CYS A CB  
1862 S SG  . CYS A 262 ? 0.3640 0.3248 0.5391 0.0087  -0.0339 -0.0166 874 CYS A SG  
1863 N N   . TRP A 263 ? 0.2751 0.2423 0.4476 -0.0018 -0.0291 -0.0279 875 TRP A N   
1864 C CA  . TRP A 263 ? 0.2492 0.2191 0.4202 -0.0034 -0.0319 -0.0298 875 TRP A CA  
1865 C C   . TRP A 263 ? 0.3022 0.2703 0.4747 -0.0034 -0.0355 -0.0370 875 TRP A C   
1866 O O   . TRP A 263 ? 0.2994 0.2702 0.4679 -0.0028 -0.0403 -0.0396 875 TRP A O   
1867 C CB  . TRP A 263 ? 0.2293 0.2037 0.3935 -0.0021 -0.0318 -0.0271 875 TRP A CB  
1868 C CG  . TRP A 263 ? 0.2281 0.2043 0.3954 -0.0025 -0.0302 -0.0224 875 TRP A CG  
1869 C CD1 . TRP A 263 ? 0.2571 0.2317 0.4273 -0.0034 -0.0309 -0.0209 875 TRP A CD1 
1870 C CD2 . TRP A 263 ? 0.2162 0.1956 0.3850 -0.0015 -0.0277 -0.0193 875 TRP A CD2 
1871 N NE1 . TRP A 263 ? 0.2360 0.2127 0.4091 -0.0029 -0.0316 -0.0192 875 TRP A NE1 
1872 C CE2 . TRP A 263 ? 0.2466 0.2267 0.4225 -0.0025 -0.0294 -0.0179 875 TRP A CE2 
1873 C CE3 . TRP A 263 ? 0.2317 0.2126 0.3966 0.0006  -0.0233 -0.0174 875 TRP A CE3 
1874 C CZ2 . TRP A 263 ? 0.2244 0.2075 0.4100 -0.0027 -0.0282 -0.0157 875 TRP A CZ2 
1875 C CZ3 . TRP A 263 ? 0.2421 0.2258 0.4160 0.0006  -0.0191 -0.0128 875 TRP A CZ3 
1876 C CH2 . TRP A 263 ? 0.2388 0.2239 0.4260 -0.0016 -0.0222 -0.0125 875 TRP A CH2 
1877 N N   . VAL A 264 ? 0.2851 0.2482 0.4645 -0.0035 -0.0346 -0.0408 876 VAL A N   
1878 C CA  . VAL A 264 ? 0.2987 0.2594 0.4837 -0.0038 -0.0400 -0.0502 876 VAL A CA  
1879 C C   . VAL A 264 ? 0.3213 0.2837 0.5216 -0.0076 -0.0431 -0.0503 876 VAL A C   
1880 O O   . VAL A 264 ? 0.3190 0.2804 0.5280 -0.0099 -0.0371 -0.0433 876 VAL A O   
1881 C CB  . VAL A 264 ? 0.3753 0.3290 0.5689 -0.0033 -0.0378 -0.0547 876 VAL A CB  
1882 C CG1 . VAL A 264 ? 0.4068 0.3573 0.6123 -0.0044 -0.0448 -0.0663 876 VAL A CG1 
1883 C CG2 . VAL A 264 ? 0.3811 0.3340 0.5626 0.0013  -0.0345 -0.0561 876 VAL A CG2 
1884 N N   . ARG A 265 ? 0.2412 0.2062 0.4442 -0.0073 -0.0523 -0.0583 877 ARG A N   
1885 C CA  . ARG A 265 ? 0.2244 0.1926 0.4482 -0.0106 -0.0564 -0.0600 877 ARG A CA  
1886 C C   . ARG A 265 ? 0.3019 0.2649 0.5516 -0.0148 -0.0512 -0.0608 877 ARG A C   
1887 O O   . ARG A 265 ? 0.2976 0.2611 0.5633 -0.0178 -0.0443 -0.0542 877 ARG A O   
1888 C CB  . ARG A 265 ? 0.1858 0.1575 0.4076 -0.0080 -0.0707 -0.0702 877 ARG A CB  
1889 C CG  . ARG A 265 ? 0.2023 0.1794 0.4511 -0.0110 -0.0773 -0.0730 877 ARG A CG  
1890 C CD  . ARG A 265 ? 0.2488 0.2321 0.4948 -0.0103 -0.0765 -0.0649 877 ARG A CD  
1891 N NE  . ARG A 265 ? 0.2629 0.2486 0.5371 -0.0149 -0.0688 -0.0602 877 ARG A NE  
1892 C CZ  . ARG A 265 ? 0.4015 0.3937 0.6993 -0.0159 -0.0742 -0.0622 877 ARG A CZ  
1893 N NH1 . ARG A 265 ? 0.3260 0.3196 0.6498 -0.0197 -0.0634 -0.0571 877 ARG A NH1 
1894 N NH2 . ARG A 265 ? 0.2191 0.2162 0.5145 -0.0122 -0.0901 -0.0688 877 ARG A NH2 
1895 N N   . ASP A 266 ? 0.2733 0.2300 0.5270 -0.0143 -0.0528 -0.0681 878 ASP A N   
1896 C CA  . ASP A 266 ? 0.2600 0.2098 0.5401 -0.0180 -0.0467 -0.0677 878 ASP A CA  
1897 C C   . ASP A 266 ? 0.3082 0.2533 0.5799 -0.0173 -0.0332 -0.0533 878 ASP A C   
1898 O O   . ASP A 266 ? 0.3081 0.2502 0.5627 -0.0139 -0.0311 -0.0511 878 ASP A O   
1899 C CB  . ASP A 266 ? 0.2853 0.2286 0.5700 -0.0167 -0.0526 -0.0802 878 ASP A CB  
1900 C CG  . ASP A 266 ? 0.3336 0.2680 0.6501 -0.0205 -0.0472 -0.0811 878 ASP A CG  
1901 O OD1 . ASP A 266 ? 0.3342 0.2650 0.6619 -0.0228 -0.0347 -0.0680 878 ASP A OD1 
1902 O OD2 . ASP A 266 ? 0.3964 0.3261 0.7256 -0.0205 -0.0549 -0.0949 878 ASP A OD2 
1903 N N   . ARG A 267 ? 0.2554 0.2001 0.5385 -0.0195 -0.0243 -0.0438 879 ARG A N   
1904 C CA  . ARG A 267 ? 0.2604 0.1997 0.5308 -0.0171 -0.0128 -0.0305 879 ARG A CA  
1905 C C   . ARG A 267 ? 0.3486 0.2769 0.6237 -0.0156 -0.0065 -0.0261 879 ARG A C   
1906 O O   . ARG A 267 ? 0.3614 0.2850 0.6189 -0.0114 -0.0012 -0.0167 879 ARG A O   
1907 C CB  . ARG A 267 ? 0.2610 0.2008 0.5397 -0.0183 -0.0031 -0.0220 879 ARG A CB  
1908 C CG  . ARG A 267 ? 0.3138 0.2497 0.6276 -0.0225 0.0046  -0.0210 879 ARG A CG  
1909 C CD  . ARG A 267 ? 0.3245 0.2583 0.6418 -0.0218 0.0195  -0.0094 879 ARG A CD  
1910 N NE  . ARG A 267 ? 0.3562 0.2888 0.7142 -0.0266 0.0279  -0.0086 879 ARG A NE  
1911 C CZ  . ARG A 267 ? 0.4885 0.4184 0.8575 -0.0261 0.0447  0.0019  879 ARG A CZ  
1912 N NH1 . ARG A 267 ? 0.3079 0.2351 0.6455 -0.0204 0.0536  0.0113  879 ARG A NH1 
1913 N NH2 . ARG A 267 ? 0.2624 0.1921 0.6751 -0.0310 0.0531  0.0024  879 ARG A NH2 
1914 N N   . ASN A 268 ? 0.3239 0.2474 0.6232 -0.0184 -0.0084 -0.0335 880 ASN A N   
1915 C CA  . ASN A 268 ? 0.3218 0.2334 0.6317 -0.0172 -0.0022 -0.0297 880 ASN A CA  
1916 C C   . ASN A 268 ? 0.3942 0.3041 0.6866 -0.0126 -0.0077 -0.0343 880 ASN A C   
1917 O O   . ASN A 268 ? 0.3998 0.3000 0.6959 -0.0098 -0.0027 -0.0289 880 ASN A O   
1918 C CB  . ASN A 268 ? 0.2516 0.1585 0.6004 -0.0225 -0.0021 -0.0372 880 ASN A CB  
1919 C CG  . ASN A 268 ? 0.3316 0.2427 0.7036 -0.0272 0.0028  -0.0344 880 ASN A CG  
1920 O OD1 . ASN A 268 ? 0.3194 0.2251 0.6973 -0.0270 0.0178  -0.0199 880 ASN A OD1 
1921 N ND2 . ASN A 268 ? 0.2072 0.1284 0.5903 -0.0303 -0.0094 -0.0475 880 ASN A ND2 
1922 N N   . LEU A 269 ? 0.3532 0.2722 0.6282 -0.0113 -0.0170 -0.0433 881 LEU A N   
1923 C CA  . LEU A 269 ? 0.3458 0.2655 0.6051 -0.0068 -0.0207 -0.0484 881 LEU A CA  
1924 C C   . LEU A 269 ? 0.3857 0.3103 0.6226 -0.0030 -0.0188 -0.0392 881 LEU A C   
1925 O O   . LEU A 269 ? 0.3859 0.3105 0.6157 0.0011  -0.0191 -0.0401 881 LEU A O   
1926 C CB  . LEU A 269 ? 0.3472 0.2723 0.6007 -0.0067 -0.0302 -0.0636 881 LEU A CB  
1927 C CG  . LEU A 269 ? 0.4169 0.3373 0.6917 -0.0092 -0.0366 -0.0776 881 LEU A CG  
1928 C CD1 . LEU A 269 ? 0.4320 0.3577 0.6915 -0.0067 -0.0478 -0.0918 881 LEU A CD1 
1929 C CD2 . LEU A 269 ? 0.4618 0.3708 0.7519 -0.0078 -0.0332 -0.0815 881 LEU A CD2 
1930 N N   . ARG A 270 ? 0.3061 0.2351 0.5348 -0.0040 -0.0172 -0.0314 882 ARG A N   
1931 C CA  . ARG A 270 ? 0.2931 0.2263 0.5041 -0.0006 -0.0173 -0.0246 882 ARG A CA  
1932 C C   . ARG A 270 ? 0.3489 0.2743 0.5584 0.0042  -0.0141 -0.0164 882 ARG A C   
1933 O O   . ARG A 270 ? 0.3313 0.2471 0.5500 0.0043  -0.0086 -0.0110 882 ARG A O   
1934 C CB  . ARG A 270 ? 0.2750 0.2115 0.4791 -0.0021 -0.0157 -0.0191 882 ARG A CB  
1935 C CG  . ARG A 270 ? 0.2843 0.2290 0.4892 -0.0055 -0.0199 -0.0254 882 ARG A CG  
1936 C CD  . ARG A 270 ? 0.3123 0.2594 0.5137 -0.0064 -0.0173 -0.0202 882 ARG A CD  
1937 N NE  . ARG A 270 ? 0.2346 0.1878 0.4450 -0.0098 -0.0209 -0.0257 882 ARG A NE  
1938 C CZ  . ARG A 270 ? 0.3868 0.3418 0.6051 -0.0116 -0.0176 -0.0233 882 ARG A CZ  
1939 N NH1 . ARG A 270 ? 0.1682 0.1186 0.3821 -0.0099 -0.0091 -0.0154 882 ARG A NH1 
1940 N NH2 . ARG A 270 ? 0.2487 0.2097 0.4783 -0.0139 -0.0230 -0.0288 882 ARG A NH2 
1941 N N   . PRO A 271 ? 0.3190 0.2479 0.5192 0.0085  -0.0176 -0.0147 883 PRO A N   
1942 C CA  . PRO A 271 ? 0.3251 0.2466 0.5239 0.0144  -0.0172 -0.0067 883 PRO A CA  
1943 C C   . PRO A 271 ? 0.3738 0.2889 0.5599 0.0172  -0.0145 0.0038  883 PRO A C   
1944 O O   . PRO A 271 ? 0.3460 0.2645 0.5246 0.0146  -0.0132 0.0040  883 PRO A O   
1945 C CB  . PRO A 271 ? 0.3374 0.2673 0.5329 0.0179  -0.0235 -0.0090 883 PRO A CB  
1946 C CG  . PRO A 271 ? 0.3574 0.2973 0.5475 0.0138  -0.0253 -0.0139 883 PRO A CG  
1947 C CD  . PRO A 271 ? 0.3067 0.2460 0.5004 0.0087  -0.0220 -0.0191 883 PRO A CD  
1948 N N   . LYS A 272 ? 0.3639 0.2688 0.5468 0.0234  -0.0129 0.0130  884 LYS A N   
1949 C CA  . LYS A 272 ? 0.3749 0.2711 0.5389 0.0290  -0.0096 0.0244  884 LYS A CA  
1950 C C   . LYS A 272 ? 0.4146 0.3162 0.5629 0.0351  -0.0211 0.0234  884 LYS A C   
1951 O O   . LYS A 272 ? 0.4137 0.3234 0.5725 0.0350  -0.0286 0.0168  884 LYS A O   
1952 C CB  . LYS A 272 ? 0.4246 0.3051 0.5910 0.0344  -0.0024 0.0363  884 LYS A CB  
1953 C CG  . LYS A 272 ? 0.5351 0.4092 0.7262 0.0280  0.0083  0.0363  884 LYS A CG  
1954 C CD  . LYS A 272 ? 0.5552 0.4274 0.7482 0.0235  0.0191  0.0399  884 LYS A CD  
1955 C CE  . LYS A 272 ? 0.7444 0.6164 0.9699 0.0149  0.0242  0.0331  884 LYS A CE  
1956 N NZ  . LYS A 272 ? 0.8176 0.6902 1.0524 0.0099  0.0340  0.0354  884 LYS A NZ  
1957 N N   . PHE A 273 ? 0.3789 0.2759 0.5035 0.0409  -0.0224 0.0291  885 PHE A N   
1958 C CA  . PHE A 273 ? 0.3730 0.2748 0.4844 0.0471  -0.0362 0.0259  885 PHE A CA  
1959 C C   . PHE A 273 ? 0.4156 0.3145 0.5316 0.0548  -0.0449 0.0292  885 PHE A C   
1960 O O   . PHE A 273 ? 0.3938 0.3027 0.5195 0.0558  -0.0568 0.0220  885 PHE A O   
1961 C CB  . PHE A 273 ? 0.4076 0.3036 0.4893 0.0531  -0.0370 0.0291  885 PHE A CB  
1962 C CG  . PHE A 273 ? 0.3991 0.3030 0.4811 0.0461  -0.0342 0.0215  885 PHE A CG  
1963 C CD1 . PHE A 273 ? 0.4005 0.3170 0.4926 0.0422  -0.0445 0.0106  885 PHE A CD1 
1964 C CD2 . PHE A 273 ? 0.4171 0.3155 0.4924 0.0439  -0.0206 0.0259  885 PHE A CD2 
1965 C CE1 . PHE A 273 ? 0.3885 0.3109 0.4817 0.0365  -0.0419 0.0047  885 PHE A CE1 
1966 C CE2 . PHE A 273 ? 0.4307 0.3363 0.5079 0.0385  -0.0187 0.0191  885 PHE A CE2 
1967 C CZ  . PHE A 273 ? 0.3839 0.3009 0.4688 0.0351  -0.0298 0.0086  885 PHE A CZ  
1968 N N   . SER A 274 ? 0.3907 0.2767 0.5065 0.0593  -0.0382 0.0398  886 SER A N   
1969 C CA  . SER A 274 ? 0.4043 0.2868 0.5280 0.0670  -0.0459 0.0437  886 SER A CA  
1970 C C   . SER A 274 ? 0.4345 0.3290 0.5898 0.0610  -0.0483 0.0331  886 SER A C   
1971 O O   . SER A 274 ? 0.4288 0.3291 0.5940 0.0661  -0.0592 0.0304  886 SER A O   
1972 C CB  . SER A 274 ? 0.4782 0.3429 0.5982 0.0723  -0.0356 0.0581  886 SER A CB  
1973 O OG  . SER A 274 ? 0.6257 0.4875 0.7612 0.0628  -0.0202 0.0578  886 SER A OG  
1974 N N   . GLN A 275 ? 0.3712 0.2698 0.5416 0.0509  -0.0384 0.0265  887 GLN A N   
1975 C CA  . GLN A 275 ? 0.3336 0.2424 0.5273 0.0459  -0.0385 0.0158  887 GLN A CA  
1976 C C   . GLN A 275 ? 0.3494 0.2732 0.5454 0.0440  -0.0461 0.0078  887 GLN A C   
1977 O O   . GLN A 275 ? 0.3317 0.2634 0.5456 0.0451  -0.0491 0.0027  887 GLN A O   
1978 C CB  . GLN A 275 ? 0.3318 0.2395 0.5355 0.0374  -0.0281 0.0100  887 GLN A CB  
1979 C CG  . GLN A 275 ? 0.3491 0.2422 0.5610 0.0385  -0.0203 0.0163  887 GLN A CG  
1980 C CD  . GLN A 275 ? 0.4991 0.3911 0.7228 0.0301  -0.0129 0.0089  887 GLN A CD  
1981 O OE1 . GLN A 275 ? 0.3835 0.2758 0.6015 0.0252  -0.0091 0.0097  887 GLN A OE1 
1982 N NE2 . GLN A 275 ? 0.4121 0.3020 0.6537 0.0291  -0.0112 0.0010  887 GLN A NE2 
1983 N N   . ILE A 276 ? 0.3010 0.2283 0.4816 0.0412  -0.0482 0.0068  888 ILE A N   
1984 C CA  . ILE A 276 ? 0.2852 0.2251 0.4704 0.0391  -0.0552 -0.0002 888 ILE A CA  
1985 C C   . ILE A 276 ? 0.3451 0.2885 0.5373 0.0470  -0.0687 -0.0002 888 ILE A C   
1986 O O   . ILE A 276 ? 0.3078 0.2621 0.5228 0.0459  -0.0717 -0.0058 888 ILE A O   
1987 C CB  . ILE A 276 ? 0.3198 0.2610 0.4889 0.0352  -0.0546 -0.0016 888 ILE A CB  
1988 C CG1 . ILE A 276 ? 0.3148 0.2560 0.4850 0.0272  -0.0434 -0.0034 888 ILE A CG1 
1989 C CG2 . ILE A 276 ? 0.3184 0.2706 0.4956 0.0338  -0.0628 -0.0083 888 ILE A CG2 
1990 C CD1 . ILE A 276 ? 0.2985 0.2382 0.4545 0.0242  -0.0405 -0.0028 888 ILE A CD1 
1991 N N   . VAL A 277 ? 0.3444 0.2782 0.5179 0.0557  -0.0763 0.0066  889 VAL A N   
1992 C CA  . VAL A 277 ? 0.3650 0.3003 0.5417 0.0653  -0.0926 0.0068  889 VAL A CA  
1993 C C   . VAL A 277 ? 0.3938 0.3343 0.6009 0.0671  -0.0930 0.0059  889 VAL A C   
1994 O O   . VAL A 277 ? 0.3612 0.3137 0.5917 0.0681  -0.1023 -0.0005 889 VAL A O   
1995 C CB  . VAL A 277 ? 0.4509 0.3712 0.5954 0.0765  -0.0989 0.0164  889 VAL A CB  
1996 C CG1 . VAL A 277 ? 0.4613 0.3829 0.6084 0.0881  -0.1189 0.0160  889 VAL A CG1 
1997 C CG2 . VAL A 277 ? 0.4599 0.3755 0.5745 0.0758  -0.0972 0.0160  889 VAL A CG2 
1998 N N   . ASN A 278 ? 0.3762 0.3081 0.5867 0.0669  -0.0818 0.0113  890 ASN A N   
1999 C CA  . ASN A 278 ? 0.3795 0.3137 0.6174 0.0691  -0.0794 0.0102  890 ASN A CA  
2000 C C   . ASN A 278 ? 0.4343 0.3835 0.6991 0.0626  -0.0741 0.0000  890 ASN A C   
2001 O O   . ASN A 278 ? 0.4492 0.4059 0.7407 0.0667  -0.0780 -0.0027 890 ASN A O   
2002 C CB  . ASN A 278 ? 0.3792 0.2996 0.6151 0.0687  -0.0670 0.0160  890 ASN A CB  
2003 C CG  . ASN A 278 ? 0.6193 0.5230 0.8351 0.0772  -0.0693 0.0293  890 ASN A CG  
2004 O OD1 . ASN A 278 ? 0.5967 0.4980 0.7971 0.0863  -0.0823 0.0348  890 ASN A OD1 
2005 N ND2 . ASN A 278 ? 0.4289 0.3197 0.6444 0.0752  -0.0568 0.0349  890 ASN A ND2 
2006 N N   . THR A 279 ? 0.3576 0.3107 0.6159 0.0534  -0.0645 -0.0049 891 THR A N   
2007 C CA  . THR A 279 ? 0.3315 0.2968 0.6086 0.0479  -0.0570 -0.0125 891 THR A CA  
2008 C C   . THR A 279 ? 0.3732 0.3510 0.6668 0.0486  -0.0669 -0.0155 891 THR A C   
2009 O O   . THR A 279 ? 0.3825 0.3704 0.7038 0.0485  -0.0633 -0.0192 891 THR A O   
2010 C CB  . THR A 279 ? 0.3675 0.3314 0.6285 0.0397  -0.0463 -0.0153 891 THR A CB  
2011 O OG1 . THR A 279 ? 0.3595 0.3123 0.6116 0.0390  -0.0393 -0.0143 891 THR A OG1 
2012 C CG2 . THR A 279 ? 0.3066 0.2804 0.5801 0.0357  -0.0371 -0.0211 891 THR A CG2 
2013 N N   . LEU A 280 ? 0.3274 0.3039 0.6058 0.0496  -0.0788 -0.0144 892 LEU A N   
2014 C CA  . LEU A 280 ? 0.3159 0.3032 0.6115 0.0501  -0.0908 -0.0193 892 LEU A CA  
2015 C C   . LEU A 280 ? 0.3697 0.3618 0.6899 0.0585  -0.1044 -0.0200 892 LEU A C   
2016 O O   . LEU A 280 ? 0.3526 0.3576 0.7074 0.0575  -0.1079 -0.0253 892 LEU A O   
2017 C CB  . LEU A 280 ? 0.3145 0.2978 0.5850 0.0495  -0.1000 -0.0204 892 LEU A CB  
2018 C CG  . LEU A 280 ? 0.3634 0.3457 0.6191 0.0407  -0.0879 -0.0211 892 LEU A CG  
2019 C CD1 . LEU A 280 ? 0.3720 0.3480 0.6011 0.0418  -0.0956 -0.0217 892 LEU A CD1 
2020 C CD2 . LEU A 280 ? 0.3671 0.3613 0.6490 0.0339  -0.0815 -0.0257 892 LEU A CD2 
2021 N N   . ASP A 281 ? 0.3273 0.3088 0.6332 0.0669  -0.1106 -0.0139 893 ASP A N   
2022 C CA  . ASP A 281 ? 0.3179 0.3019 0.6448 0.0768  -0.1245 -0.0129 893 ASP A CA  
2023 C C   . ASP A 281 ? 0.3457 0.3383 0.7105 0.0755  -0.1130 -0.0150 893 ASP A C   
2024 O O   . ASP A 281 ? 0.3400 0.3434 0.7399 0.0800  -0.1224 -0.0184 893 ASP A O   
2025 C CB  . ASP A 281 ? 0.3458 0.3134 0.6438 0.0865  -0.1303 -0.0031 893 ASP A CB  
2026 C CG  . ASP A 281 ? 0.4532 0.4131 0.7172 0.0932  -0.1465 -0.0011 893 ASP A CG  
2027 O OD1 . ASP A 281 ? 0.4741 0.4417 0.7388 0.0901  -0.1554 -0.0093 893 ASP A OD1 
2028 O OD2 . ASP A 281 ? 0.5351 0.4798 0.7706 0.1019  -0.1492 0.0089  893 ASP A OD2 
2029 N N   . LYS A 282 ? 0.3161 0.3044 0.6747 0.0696  -0.0929 -0.0143 894 LYS A N   
2030 C CA  . LYS A 282 ? 0.3184 0.3122 0.7056 0.0691  -0.0785 -0.0172 894 LYS A CA  
2031 C C   . LYS A 282 ? 0.3615 0.3713 0.7786 0.0641  -0.0727 -0.0231 894 LYS A C   
2032 O O   . LYS A 282 ? 0.3584 0.3776 0.8125 0.0675  -0.0697 -0.0254 894 LYS A O   
2033 C CB  . LYS A 282 ? 0.3413 0.3242 0.7078 0.0649  -0.0612 -0.0168 894 LYS A CB  
2034 C CG  . LYS A 282 ? 0.4996 0.4848 0.8884 0.0661  -0.0459 -0.0214 894 LYS A CG  
2035 C CD  . LYS A 282 ? 0.5696 0.5433 0.9362 0.0624  -0.0323 -0.0239 894 LYS A CD  
2036 C CE  . LYS A 282 ? 0.7088 0.6674 1.0678 0.0670  -0.0355 -0.0196 894 LYS A CE  
2037 N NZ  . LYS A 282 ? 0.7893 0.7366 1.1284 0.0621  -0.0256 -0.0230 894 LYS A NZ  
2038 N N   . LEU A 283 ? 0.3254 0.3379 0.7289 0.0567  -0.0704 -0.0247 895 LEU A N   
2039 C CA  . LEU A 283 ? 0.3125 0.3381 0.7428 0.0513  -0.0638 -0.0283 895 LEU A CA  
2040 C C   . LEU A 283 ? 0.3358 0.3730 0.8031 0.0548  -0.0814 -0.0316 895 LEU A C   
2041 O O   . LEU A 283 ? 0.3184 0.3683 0.8277 0.0537  -0.0747 -0.0340 895 LEU A O   
2042 C CB  . LEU A 283 ? 0.3115 0.3345 0.7161 0.0433  -0.0590 -0.0282 895 LEU A CB  
2043 C CG  . LEU A 283 ? 0.3720 0.3861 0.7454 0.0395  -0.0428 -0.0265 895 LEU A CG  
2044 C CD1 . LEU A 283 ? 0.3596 0.3715 0.7101 0.0330  -0.0425 -0.0260 895 LEU A CD1 
2045 C CD2 . LEU A 283 ? 0.4156 0.4335 0.8036 0.0395  -0.0230 -0.0276 895 LEU A CD2 
2046 N N   . ILE A 284 ? 0.2863 0.3188 0.7384 0.0598  -0.1040 -0.0320 896 ILE A N   
2047 C CA  . ILE A 284 ? 0.2887 0.3308 0.7721 0.0651  -0.1265 -0.0371 896 ILE A CA  
2048 C C   . ILE A 284 ? 0.3614 0.4101 0.8823 0.0727  -0.1287 -0.0366 896 ILE A C   
2049 O O   . ILE A 284 ? 0.3697 0.4331 0.9395 0.0735  -0.1356 -0.0418 896 ILE A O   
2050 C CB  . ILE A 284 ? 0.3402 0.3728 0.7884 0.0711  -0.1502 -0.0378 896 ILE A CB  
2051 C CG1 . ILE A 284 ? 0.3307 0.3608 0.7557 0.0636  -0.1497 -0.0413 896 ILE A CG1 
2052 C CG2 . ILE A 284 ? 0.3576 0.3982 0.8352 0.0804  -0.1776 -0.0437 896 ILE A CG2 
2053 C CD1 . ILE A 284 ? 0.4311 0.4455 0.8016 0.0678  -0.1586 -0.0386 896 ILE A CD1 
2054 N N   . ARG A 285 ? 0.3143 0.3523 0.8168 0.0782  -0.1223 -0.0305 897 ARG A N   
2055 C CA  . ARG A 285 ? 0.3148 0.3571 0.8515 0.0862  -0.1228 -0.0295 897 ARG A CA  
2056 C C   . ARG A 285 ? 0.3455 0.4001 0.9242 0.0820  -0.1009 -0.0326 897 ARG A C   
2057 O O   . ARG A 285 ? 0.3608 0.4261 0.9855 0.0875  -0.1041 -0.0346 897 ARG A O   
2058 C CB  . ARG A 285 ? 0.3272 0.3528 0.8343 0.0920  -0.1181 -0.0224 897 ARG A CB  
2059 C CG  . ARG A 285 ? 0.3362 0.3501 0.8157 0.1017  -0.1405 -0.0165 897 ARG A CG  
2060 C CD  . ARG A 285 ? 0.3347 0.3341 0.8027 0.1089  -0.1350 -0.0084 897 ARG A CD  
2061 N NE  . ARG A 285 ? 0.3681 0.3560 0.8105 0.1016  -0.1126 -0.0064 897 ARG A NE  
2062 C CZ  . ARG A 285 ? 0.4977 0.4713 0.8971 0.0988  -0.1101 -0.0010 897 ARG A CZ  
2063 N NH1 . ARG A 285 ? 0.2771 0.2447 0.6485 0.1032  -0.1262 0.0038  897 ARG A NH1 
2064 N NH2 . ARG A 285 ? 0.3655 0.3304 0.7503 0.0923  -0.0915 -0.0009 897 ARG A NH2 
2065 N N   . ASN A 286 ? 0.2880 0.3408 0.8507 0.0733  -0.0784 -0.0326 898 ASN A N   
2066 C CA  . ASN A 286 ? 0.2804 0.3426 0.8743 0.0703  -0.0542 -0.0342 898 ASN A CA  
2067 C C   . ASN A 286 ? 0.3464 0.4161 0.9460 0.0611  -0.0472 -0.0352 898 ASN A C   
2068 O O   . ASN A 286 ? 0.3422 0.4052 0.9108 0.0556  -0.0305 -0.0332 898 ASN A O   
2069 C CB  . ASN A 286 ? 0.2763 0.3268 0.8415 0.0705  -0.0325 -0.0330 898 ASN A CB  
2070 C CG  . ASN A 286 ? 0.3806 0.4194 0.9331 0.0781  -0.0394 -0.0315 898 ASN A CG  
2071 O OD1 . ASN A 286 ? 0.2388 0.2802 0.8204 0.0848  -0.0345 -0.0326 898 ASN A OD1 
2072 N ND2 . ASN A 286 ? 0.2403 0.2652 0.7509 0.0774  -0.0491 -0.0282 898 ASN A ND2 
2073 N N   . PRO A 287 ? 0.3154 0.3978 0.9540 0.0598  -0.0615 -0.0385 899 PRO A N   
2074 C CA  . PRO A 287 ? 0.3100 0.3976 0.9555 0.0509  -0.0556 -0.0390 899 PRO A CA  
2075 C C   . PRO A 287 ? 0.3714 0.4633 1.0324 0.0461  -0.0241 -0.0350 899 PRO A C   
2076 O O   . PRO A 287 ? 0.3647 0.4547 1.0129 0.0392  -0.0154 -0.0326 899 PRO A O   
2077 C CB  . PRO A 287 ? 0.3289 0.4294 1.0223 0.0518  -0.0787 -0.0453 899 PRO A CB  
2078 C CG  . PRO A 287 ? 0.3866 0.4941 1.1150 0.0610  -0.0871 -0.0469 899 PRO A CG  
2079 C CD  . PRO A 287 ? 0.3334 0.4256 1.0125 0.0667  -0.0856 -0.0426 899 PRO A CD  
2080 N N   . ALA A 288 ? 0.3363 0.4324 1.0214 0.0510  -0.0063 -0.0338 900 ALA A N   
2081 C CA  . ALA A 288 ? 0.3464 0.4446 1.0406 0.0495  0.0265  -0.0293 900 ALA A CA  
2082 C C   . ALA A 288 ? 0.4262 0.5092 1.0575 0.0471  0.0411  -0.0259 900 ALA A C   
2083 O O   . ALA A 288 ? 0.4346 0.5171 1.0614 0.0446  0.0641  -0.0210 900 ALA A O   
2084 C CB  . ALA A 288 ? 0.3614 0.4647 1.0868 0.0573  0.0404  -0.0302 900 ALA A CB  
2085 N N   . SER A 289 ? 0.3889 0.4595 0.9736 0.0483  0.0274  -0.0281 901 SER A N   
2086 C CA  . SER A 289 ? 0.4041 0.4611 0.9333 0.0462  0.0366  -0.0268 901 SER A CA  
2087 C C   . SER A 289 ? 0.4562 0.5122 0.9686 0.0388  0.0358  -0.0233 901 SER A C   
2088 O O   . SER A 289 ? 0.4594 0.5085 0.9402 0.0373  0.0505  -0.0204 901 SER A O   
2089 C CB  . SER A 289 ? 0.4746 0.5197 0.9687 0.0487  0.0214  -0.0297 901 SER A CB  
2090 O OG  . SER A 289 ? 0.6152 0.6598 1.1045 0.0466  -0.0027 -0.0297 901 SER A OG  
2091 N N   . LEU A 290 ? 0.4004 0.4633 0.9360 0.0350  0.0181  -0.0241 902 LEU A N   
2092 C CA  . LEU A 290 ? 0.3896 0.4523 0.9182 0.0282  0.0143  -0.0221 902 LEU A CA  
2093 C C   . LEU A 290 ? 0.4632 0.5331 1.0236 0.0246  0.0351  -0.0164 902 LEU A C   
2094 O O   . LEU A 290 ? 0.4639 0.5332 1.0242 0.0190  0.0335  -0.0140 902 LEU A O   
2095 C CB  . LEU A 290 ? 0.3808 0.4465 0.9213 0.0270  -0.0138 -0.0275 902 LEU A CB  
2096 C CG  . LEU A 290 ? 0.4413 0.4968 0.9420 0.0304  -0.0320 -0.0301 902 LEU A CG  
2097 C CD1 . LEU A 290 ? 0.4415 0.5016 0.9624 0.0344  -0.0578 -0.0355 902 LEU A CD1 
2098 C CD2 . LEU A 290 ? 0.4770 0.5221 0.9323 0.0260  -0.0332 -0.0286 902 LEU A CD2 
2099 N N   . LYS A 291 ? 0.4240 0.4995 1.0117 0.0285  0.0561  -0.0135 903 LYS A N   
2100 C CA  . LYS A 291 ? 0.4199 0.5008 1.0373 0.0266  0.0811  -0.0057 903 LYS A CA  
2101 C C   . LYS A 291 ? 0.4941 0.5631 1.0616 0.0278  0.1027  0.0016  903 LYS A C   
2102 O O   . LYS A 291 ? 0.4926 0.5609 1.0655 0.0248  0.1176  0.0101  903 LYS A O   
2103 C CB  . LYS A 291 ? 0.4421 0.5339 1.1096 0.0315  0.0968  -0.0053 903 LYS A CB  
2104 C CG  . LYS A 291 ? 0.4905 0.5969 1.2211 0.0301  0.0776  -0.0112 903 LYS A CG  
2105 C CD  . LYS A 291 ? 0.6538 0.7711 1.4345 0.0357  0.0938  -0.0109 903 LYS A CD  
2106 C CE  . LYS A 291 ? 0.8170 0.9513 1.6724 0.0336  0.0782  -0.0157 903 LYS A CE  
2107 N NZ  . LYS A 291 ? 0.9749 1.1213 1.8864 0.0389  0.0972  -0.0145 903 LYS A NZ  
2108 N N   . VAL A 292 ? 0.4709 0.5298 0.9910 0.0329  0.1037  -0.0019 904 VAL A N   
2109 C CA  . VAL A 292 ? 0.4905 0.5373 0.9581 0.0359  0.1194  0.0021  904 VAL A CA  
2110 C C   . VAL A 292 ? 0.5053 0.5459 0.9440 0.0299  0.1088  0.0055  904 VAL A C   
2111 O O   . VAL A 292 ? 0.4780 0.5157 0.8994 0.0267  0.0863  -0.0003 904 VAL A O   
2112 C CB  . VAL A 292 ? 0.5511 0.5889 0.9811 0.0423  0.1183  -0.0057 904 VAL A CB  
2113 C CG1 . VAL A 292 ? 0.5687 0.5947 0.9486 0.0472  0.1350  -0.0034 904 VAL A CG1 
2114 C CG2 . VAL A 292 ? 0.5536 0.5976 1.0173 0.0482  0.1263  -0.0099 904 VAL A CG2 
2115 N N   . ILE A 293 ? 0.4580 0.4964 0.8942 0.0292  0.1265  0.0158  905 ILE A N   
2116 C CA  . ILE A 293 ? 0.6878 0.7207 1.1036 0.0245  0.1206  0.0211  905 ILE A CA  
2117 C C   . ILE A 293 ? 1.1340 1.1548 1.4973 0.0302  0.1352  0.0273  905 ILE A C   
2118 O O   . ILE A 293 ? 0.6942 0.7124 1.0557 0.0354  0.1601  0.0369  905 ILE A O   
2119 C CB  . ILE A 293 ? 0.7204 0.7610 1.1869 0.0184  0.1248  0.0280  905 ILE A CB  
2120 C CG1 . ILE A 293 ? 0.6982 0.7493 1.2081 0.0132  0.1015  0.0183  905 ILE A CG1 
2121 C CG2 . ILE A 293 ? 0.7495 0.7827 1.1971 0.0148  0.1249  0.0359  905 ILE A CG2 
2122 C CD1 . ILE A 293 ? 0.7744 0.8365 1.3504 0.0093  0.1081  0.0215  905 ILE A CD1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   613 ?   ?   ?   A . n 
A 1 2   SER 2   614 ?   ?   ?   A . n 
A 1 3   SER 3   615 ?   ?   ?   A . n 
A 1 4   ASP 4   616 ?   ?   ?   A . n 
A 1 5   PRO 5   617 ?   ?   ?   A . n 
A 1 6   ASN 6   618 ?   ?   ?   A . n 
A 1 7   GLU 7   619 ?   ?   ?   A . n 
A 1 8   ALA 8   620 ?   ?   ?   A . n 
A 1 9   VAL 9   621 ?   ?   ?   A . n 
A 1 10  ARG 10  622 ?   ?   ?   A . n 
A 1 11  GLU 11  623 ?   ?   ?   A . n 
A 1 12  PHE 12  624 ?   ?   ?   A . n 
A 1 13  ALA 13  625 ?   ?   ?   A . n 
A 1 14  LYS 14  626 ?   ?   ?   A . n 
A 1 15  GLU 15  627 ?   ?   ?   A . n 
A 1 16  ILE 16  628 ?   ?   ?   A . n 
A 1 17  ASP 17  629 ?   ?   ?   A . n 
A 1 18  VAL 18  630 ?   ?   ?   A . n 
A 1 19  SER 19  631 ?   ?   ?   A . n 
A 1 20  CYS 20  632 632 CYS CYS A . n 
A 1 21  VAL 21  633 633 VAL VAL A . n 
A 1 22  LYS 22  634 634 LYS LYS A . n 
A 1 23  ILE 23  635 635 ILE ILE A . n 
A 1 24  GLU 24  636 636 GLU GLU A . n 
A 1 25  GLU 25  637 637 GLU GLU A . n 
A 1 26  VAL 26  638 638 VAL VAL A . n 
A 1 27  ILE 27  639 639 ILE ILE A . n 
A 1 28  GLY 28  640 640 GLY GLY A . n 
A 1 29  ALA 29  641 641 ALA ALA A . n 
A 1 30  GLY 30  642 642 GLY GLY A . n 
A 1 31  GLU 31  643 643 GLU GLU A . n 
A 1 32  PHE 32  644 644 PHE PHE A . n 
A 1 33  GLY 33  645 645 GLY GLY A . n 
A 1 34  GLU 34  646 646 GLU GLU A . n 
A 1 35  VAL 35  647 647 VAL VAL A . n 
A 1 36  CYS 36  648 648 CYS CYS A . n 
A 1 37  ARG 37  649 649 ARG ARG A . n 
A 1 38  GLY 38  650 650 GLY GLY A . n 
A 1 39  ARG 39  651 651 ARG ARG A . n 
A 1 40  LEU 40  652 652 LEU LEU A . n 
A 1 41  LYS 41  653 653 LYS LYS A . n 
A 1 42  GLN 42  654 654 GLN GLN A . n 
A 1 43  PRO 43  655 655 PRO PRO A . n 
A 1 44  GLY 44  656 656 GLY GLY A . n 
A 1 45  ARG 45  657 657 ARG ARG A . n 
A 1 46  ARG 46  658 658 ARG ARG A . n 
A 1 47  GLU 47  659 659 GLU GLU A . n 
A 1 48  VAL 48  660 660 VAL VAL A . n 
A 1 49  PHE 49  661 661 PHE PHE A . n 
A 1 50  VAL 50  662 662 VAL VAL A . n 
A 1 51  ALA 51  663 663 ALA ALA A . n 
A 1 52  ILE 52  664 664 ILE ILE A . n 
A 1 53  LYS 53  665 665 LYS LYS A . n 
A 1 54  THR 54  666 666 THR THR A . n 
A 1 55  LEU 55  667 667 LEU LEU A . n 
A 1 56  LYS 56  668 668 LYS LYS A . n 
A 1 57  VAL 57  669 669 VAL VAL A . n 
A 1 58  GLY 58  670 670 GLY GLY A . n 
A 1 59  TYR 59  671 671 TYR TYR A . n 
A 1 60  THR 60  672 672 THR THR A . n 
A 1 61  GLU 61  673 673 GLU GLU A . n 
A 1 62  ARG 62  674 674 ARG ARG A . n 
A 1 63  GLN 63  675 675 GLN GLN A . n 
A 1 64  ARG 64  676 676 ARG ARG A . n 
A 1 65  ARG 65  677 677 ARG ARG A . n 
A 1 66  ASP 66  678 678 ASP ASP A . n 
A 1 67  PHE 67  679 679 PHE PHE A . n 
A 1 68  LEU 68  680 680 LEU LEU A . n 
A 1 69  SER 69  681 681 SER SER A . n 
A 1 70  GLU 70  682 682 GLU GLU A . n 
A 1 71  ALA 71  683 683 ALA ALA A . n 
A 1 72  SER 72  684 684 SER SER A . n 
A 1 73  ILE 73  685 685 ILE ILE A . n 
A 1 74  MET 74  686 686 MET MET A . n 
A 1 75  GLY 75  687 687 GLY GLY A . n 
A 1 76  GLN 76  688 688 GLN GLN A . n 
A 1 77  PHE 77  689 689 PHE PHE A . n 
A 1 78  ASP 78  690 690 ASP ASP A . n 
A 1 79  HIS 79  691 691 HIS HIS A . n 
A 1 80  PRO 80  692 692 PRO PRO A . n 
A 1 81  ASN 81  693 693 ASN ASN A . n 
A 1 82  ILE 82  694 694 ILE ILE A . n 
A 1 83  ILE 83  695 695 ILE ILE A . n 
A 1 84  ARG 84  696 696 ARG ARG A . n 
A 1 85  LEU 85  697 697 LEU LEU A . n 
A 1 86  GLU 86  698 698 GLU GLU A . n 
A 1 87  GLY 87  699 699 GLY GLY A . n 
A 1 88  VAL 88  700 700 VAL VAL A . n 
A 1 89  VAL 89  701 701 VAL VAL A . n 
A 1 90  THR 90  702 702 THR THR A . n 
A 1 91  LYS 91  703 703 LYS LYS A . n 
A 1 92  SER 92  704 704 SER SER A . n 
A 1 93  ARG 93  705 705 ARG ARG A . n 
A 1 94  PRO 94  706 706 PRO PRO A . n 
A 1 95  VAL 95  707 707 VAL VAL A . n 
A 1 96  MET 96  708 708 MET MET A . n 
A 1 97  ILE 97  709 709 ILE ILE A . n 
A 1 98  LEU 98  710 710 LEU LEU A . n 
A 1 99  THR 99  711 711 THR THR A . n 
A 1 100 GLU 100 712 712 GLU GLU A . n 
A 1 101 PHE 101 713 713 PHE PHE A . n 
A 1 102 MET 102 714 714 MET MET A . n 
A 1 103 GLU 103 715 715 GLU GLU A . n 
A 1 104 ASN 104 716 716 ASN ASN A . n 
A 1 105 CYS 105 717 717 CYS CYS A . n 
A 1 106 ALA 106 718 718 ALA ALA A . n 
A 1 107 LEU 107 719 719 LEU LEU A . n 
A 1 108 ASP 108 720 720 ASP ASP A . n 
A 1 109 SER 109 721 721 SER SER A . n 
A 1 110 PHE 110 722 722 PHE PHE A . n 
A 1 111 LEU 111 723 723 LEU LEU A . n 
A 1 112 ARG 112 724 724 ARG ARG A . n 
A 1 113 LEU 113 725 725 LEU LEU A . n 
A 1 114 ASN 114 726 726 ASN ASN A . n 
A 1 115 ASP 115 727 727 ASP ASP A . n 
A 1 116 GLY 116 728 728 GLY GLY A . n 
A 1 117 GLN 117 729 729 GLN GLN A . n 
A 1 118 PHE 118 730 730 PHE PHE A . n 
A 1 119 THR 119 731 731 THR THR A . n 
A 1 120 VAL 120 732 732 VAL VAL A . n 
A 1 121 ILE 121 733 733 ILE ILE A . n 
A 1 122 GLN 122 734 734 GLN GLN A . n 
A 1 123 LEU 123 735 735 LEU LEU A . n 
A 1 124 VAL 124 736 736 VAL VAL A . n 
A 1 125 GLY 125 737 737 GLY GLY A . n 
A 1 126 MET 126 738 738 MET MET A . n 
A 1 127 LEU 127 739 739 LEU LEU A . n 
A 1 128 ARG 128 740 740 ARG ARG A . n 
A 1 129 GLY 129 741 741 GLY GLY A . n 
A 1 130 ILE 130 742 742 ILE ILE A . n 
A 1 131 ALA 131 743 743 ALA ALA A . n 
A 1 132 ALA 132 744 744 ALA ALA A . n 
A 1 133 GLY 133 745 745 GLY GLY A . n 
A 1 134 MET 134 746 746 MET MET A . n 
A 1 135 LYS 135 747 747 LYS LYS A . n 
A 1 136 TYR 136 748 748 TYR TYR A . n 
A 1 137 LEU 137 749 749 LEU LEU A . n 
A 1 138 SER 138 750 750 SER SER A . n 
A 1 139 GLU 139 751 751 GLU GLU A . n 
A 1 140 MET 140 752 752 MET MET A . n 
A 1 141 ASN 141 753 753 ASN ASN A . n 
A 1 142 TYR 142 754 754 TYR TYR A . n 
A 1 143 VAL 143 755 755 VAL VAL A . n 
A 1 144 HIS 144 756 756 HIS HIS A . n 
A 1 145 ARG 145 757 757 ARG ARG A . n 
A 1 146 ASP 146 758 758 ASP ASP A . n 
A 1 147 LEU 147 759 759 LEU LEU A . n 
A 1 148 ALA 148 760 760 ALA ALA A . n 
A 1 149 ALA 149 761 761 ALA ALA A . n 
A 1 150 ARG 150 762 762 ARG ARG A . n 
A 1 151 ASN 151 763 763 ASN ASN A . n 
A 1 152 ILE 152 764 764 ILE ILE A . n 
A 1 153 LEU 153 765 765 LEU LEU A . n 
A 1 154 VAL 154 766 766 VAL VAL A . n 
A 1 155 ASN 155 767 767 ASN ASN A . n 
A 1 156 SER 156 768 768 SER SER A . n 
A 1 157 ASN 157 769 769 ASN ASN A . n 
A 1 158 LEU 158 770 770 LEU LEU A . n 
A 1 159 VAL 159 771 771 VAL VAL A . n 
A 1 160 CYS 160 772 772 CYS CYS A . n 
A 1 161 LYS 161 773 773 LYS LYS A . n 
A 1 162 VAL 162 774 774 VAL VAL A . n 
A 1 163 SER 163 775 775 SER SER A . n 
A 1 164 ASP 164 776 776 ASP ASP A . n 
A 1 165 PHE 165 777 777 PHE PHE A . n 
A 1 166 GLY 166 778 778 GLY GLY A . n 
A 1 167 LEU 167 779 779 LEU LEU A . n 
A 1 168 SER 168 780 780 SER SER A . n 
A 1 169 ARG 169 781 781 ARG ARG A . n 
A 1 170 PHE 170 782 782 PHE PHE A . n 
A 1 171 LEU 171 783 783 LEU LEU A . n 
A 1 172 GLU 172 784 784 GLU GLU A . n 
A 1 173 ASP 173 785 785 ASP ASP A . n 
A 1 174 ASP 174 786 786 ASP ASP A . n 
A 1 175 PRO 175 787 787 PRO PRO A . n 
A 1 176 SER 176 788 788 SER SER A . n 
A 1 177 ASP 177 789 789 ASP ASP A . n 
A 1 178 PRO 178 790 790 PRO PRO A . n 
A 1 179 THR 179 791 791 THR THR A . n 
A 1 180 TYR 180 792 792 TYR TYR A . n 
A 1 181 THR 181 793 793 THR THR A . n 
A 1 182 SER 182 794 794 SER SER A . n 
A 1 183 SER 183 795 795 SER SER A . n 
A 1 184 LEU 184 796 796 LEU LEU A . n 
A 1 185 GLY 185 797 797 GLY GLY A . n 
A 1 186 GLY 186 798 798 GLY GLY A . n 
A 1 187 LYS 187 799 799 LYS LYS A . n 
A 1 188 ILE 188 800 800 ILE ILE A . n 
A 1 189 PRO 189 801 801 PRO PRO A . n 
A 1 190 ILE 190 802 802 ILE ILE A . n 
A 1 191 ARG 191 803 803 ARG ARG A . n 
A 1 192 TRP 192 804 804 TRP TRP A . n 
A 1 193 THR 193 805 805 THR THR A . n 
A 1 194 ALA 194 806 806 ALA ALA A . n 
A 1 195 PRO 195 807 807 PRO PRO A . n 
A 1 196 GLU 196 808 808 GLU GLU A . n 
A 1 197 ALA 197 809 809 ALA ALA A . n 
A 1 198 ILE 198 810 810 ILE ILE A . n 
A 1 199 ALA 199 811 811 ALA ALA A . n 
A 1 200 TYR 200 812 812 TYR TYR A . n 
A 1 201 ARG 201 813 813 ARG ARG A . n 
A 1 202 LYS 202 814 814 LYS LYS A . n 
A 1 203 PHE 203 815 815 PHE PHE A . n 
A 1 204 THR 204 816 816 THR THR A . n 
A 1 205 SER 205 817 817 SER SER A . n 
A 1 206 ALA 206 818 818 ALA ALA A . n 
A 1 207 SER 207 819 819 SER SER A . n 
A 1 208 ASP 208 820 820 ASP ASP A . n 
A 1 209 VAL 209 821 821 VAL VAL A . n 
A 1 210 TRP 210 822 822 TRP TRP A . n 
A 1 211 SER 211 823 823 SER SER A . n 
A 1 212 TYR 212 824 824 TYR TYR A . n 
A 1 213 GLY 213 825 825 GLY GLY A . n 
A 1 214 ILE 214 826 826 ILE ILE A . n 
A 1 215 VAL 215 827 827 VAL VAL A . n 
A 1 216 MET 216 828 828 MET MET A . n 
A 1 217 TRP 217 829 829 TRP TRP A . n 
A 1 218 GLU 218 830 830 GLU GLU A . n 
A 1 219 VAL 219 831 831 VAL VAL A . n 
A 1 220 MET 220 832 832 MET MET A . n 
A 1 221 SER 221 833 833 SER SER A . n 
A 1 222 TYR 222 834 834 TYR TYR A . n 
A 1 223 GLY 223 835 835 GLY GLY A . n 
A 1 224 GLU 224 836 836 GLU GLU A . n 
A 1 225 ARG 225 837 837 ARG ARG A . n 
A 1 226 PRO 226 838 838 PRO PRO A . n 
A 1 227 TYR 227 839 839 TYR TYR A . n 
A 1 228 TRP 228 840 840 TRP TRP A . n 
A 1 229 ASP 229 841 841 ASP ASP A . n 
A 1 230 MET 230 842 842 MET MET A . n 
A 1 231 SER 231 843 843 SER SER A . n 
A 1 232 ASN 232 844 844 ASN ASN A . n 
A 1 233 GLN 233 845 845 GLN GLN A . n 
A 1 234 ASP 234 846 846 ASP ASP A . n 
A 1 235 VAL 235 847 847 VAL VAL A . n 
A 1 236 ILE 236 848 848 ILE ILE A . n 
A 1 237 ASN 237 849 849 ASN ASN A . n 
A 1 238 ALA 238 850 850 ALA ALA A . n 
A 1 239 VAL 239 851 851 VAL VAL A . n 
A 1 240 GLU 240 852 852 GLU GLU A . n 
A 1 241 GLN 241 853 853 GLN GLN A . n 
A 1 242 ASP 242 854 854 ASP ASP A . n 
A 1 243 TYR 243 855 855 TYR TYR A . n 
A 1 244 ARG 244 856 856 ARG ARG A . n 
A 1 245 LEU 245 857 857 LEU LEU A . n 
A 1 246 PRO 246 858 858 PRO PRO A . n 
A 1 247 PRO 247 859 859 PRO PRO A . n 
A 1 248 PRO 248 860 860 PRO PRO A . n 
A 1 249 MET 249 861 861 MET MET A . n 
A 1 250 ASP 250 862 862 ASP ASP A . n 
A 1 251 CYS 251 863 863 CYS CYS A . n 
A 1 252 PRO 252 864 864 PRO PRO A . n 
A 1 253 THR 253 865 865 THR THR A . n 
A 1 254 ALA 254 866 866 ALA ALA A . n 
A 1 255 LEU 255 867 867 LEU LEU A . n 
A 1 256 HIS 256 868 868 HIS HIS A . n 
A 1 257 GLN 257 869 869 GLN GLN A . n 
A 1 258 LEU 258 870 870 LEU LEU A . n 
A 1 259 MET 259 871 871 MET MET A . n 
A 1 260 LEU 260 872 872 LEU LEU A . n 
A 1 261 ASP 261 873 873 ASP ASP A . n 
A 1 262 CYS 262 874 874 CYS CYS A . n 
A 1 263 TRP 263 875 875 TRP TRP A . n 
A 1 264 VAL 264 876 876 VAL VAL A . n 
A 1 265 ARG 265 877 877 ARG ARG A . n 
A 1 266 ASP 266 878 878 ASP ASP A . n 
A 1 267 ARG 267 879 879 ARG ARG A . n 
A 1 268 ASN 268 880 880 ASN ASN A . n 
A 1 269 LEU 269 881 881 LEU LEU A . n 
A 1 270 ARG 270 882 882 ARG ARG A . n 
A 1 271 PRO 271 883 883 PRO PRO A . n 
A 1 272 LYS 272 884 884 LYS LYS A . n 
A 1 273 PHE 273 885 885 PHE PHE A . n 
A 1 274 SER 274 886 886 SER SER A . n 
A 1 275 GLN 275 887 887 GLN GLN A . n 
A 1 276 ILE 276 888 888 ILE ILE A . n 
A 1 277 VAL 277 889 889 VAL VAL A . n 
A 1 278 ASN 278 890 890 ASN ASN A . n 
A 1 279 THR 279 891 891 THR THR A . n 
A 1 280 LEU 280 892 892 LEU LEU A . n 
A 1 281 ASP 281 893 893 ASP ASP A . n 
A 1 282 LYS 282 894 894 LYS LYS A . n 
A 1 283 LEU 283 895 895 LEU LEU A . n 
A 1 284 ILE 284 896 896 ILE ILE A . n 
A 1 285 ARG 285 897 897 ARG ARG A . n 
A 1 286 ASN 286 898 898 ASN ASN A . n 
A 1 287 PRO 287 899 899 PRO PRO A . n 
A 1 288 ALA 288 900 900 ALA ALA A . n 
A 1 289 SER 289 901 901 SER SER A . n 
A 1 290 LEU 290 902 902 LEU LEU A . n 
A 1 291 LYS 291 903 903 LYS LYS A . n 
A 1 292 VAL 292 904 904 VAL VAL A . n 
A 1 293 ILE 293 905 905 ILE ILE A . n 
A 1 294 ALA 294 906 ?   ?   ?   A . n 
A 1 295 SER 295 907 ?   ?   ?   A . n 
A 1 296 ALA 296 908 ?   ?   ?   A . n 
A 1 297 GLN 297 909 ?   ?   ?   A . n 
A 1 298 SER 298 910 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 6P8 1  1001 1  6P8 INH A . 
C 3 DIO 1  1002 1  DIO DIO A . 
D 4 HOH 1  1101 26 HOH HOH A . 
D 4 HOH 2  1102 31 HOH HOH A . 
D 4 HOH 3  1103 50 HOH HOH A . 
D 4 HOH 4  1104 19 HOH HOH A . 
D 4 HOH 5  1105 23 HOH HOH A . 
D 4 HOH 6  1106 64 HOH HOH A . 
D 4 HOH 7  1107 6  HOH HOH A . 
D 4 HOH 8  1108 63 HOH HOH A . 
D 4 HOH 9  1109 70 HOH HOH A . 
D 4 HOH 10 1110 25 HOH HOH A . 
D 4 HOH 11 1111 49 HOH HOH A . 
D 4 HOH 12 1112 39 HOH HOH A . 
D 4 HOH 13 1113 20 HOH HOH A . 
D 4 HOH 14 1114 24 HOH HOH A . 
D 4 HOH 15 1115 9  HOH HOH A . 
D 4 HOH 16 1116 36 HOH HOH A . 
D 4 HOH 17 1117 1  HOH HOH A . 
D 4 HOH 18 1118 22 HOH HOH A . 
D 4 HOH 19 1119 77 HOH HOH A . 
D 4 HOH 20 1120 44 HOH HOH A . 
D 4 HOH 21 1121 74 HOH HOH A . 
D 4 HOH 22 1122 16 HOH HOH A . 
D 4 HOH 23 1123 67 HOH HOH A . 
D 4 HOH 24 1124 30 HOH HOH A . 
D 4 HOH 25 1125 57 HOH HOH A . 
D 4 HOH 26 1126 66 HOH HOH A . 
D 4 HOH 27 1127 72 HOH HOH A . 
D 4 HOH 28 1128 27 HOH HOH A . 
D 4 HOH 29 1129 53 HOH HOH A . 
D 4 HOH 30 1130 10 HOH HOH A . 
D 4 HOH 31 1131 13 HOH HOH A . 
D 4 HOH 32 1132 8  HOH HOH A . 
D 4 HOH 33 1133 35 HOH HOH A . 
D 4 HOH 34 1134 47 HOH HOH A . 
D 4 HOH 35 1135 60 HOH HOH A . 
D 4 HOH 36 1136 69 HOH HOH A . 
D 4 HOH 37 1137 32 HOH HOH A . 
D 4 HOH 38 1138 68 HOH HOH A . 
D 4 HOH 39 1139 28 HOH HOH A . 
D 4 HOH 40 1140 76 HOH HOH A . 
D 4 HOH 41 1141 58 HOH HOH A . 
D 4 HOH 42 1142 33 HOH HOH A . 
D 4 HOH 43 1143 3  HOH HOH A . 
D 4 HOH 44 1144 2  HOH HOH A . 
D 4 HOH 45 1145 14 HOH HOH A . 
D 4 HOH 46 1146 21 HOH HOH A . 
D 4 HOH 47 1147 43 HOH HOH A . 
D 4 HOH 48 1148 15 HOH HOH A . 
D 4 HOH 49 1149 55 HOH HOH A . 
D 4 HOH 50 1150 11 HOH HOH A . 
D 4 HOH 51 1151 34 HOH HOH A . 
D 4 HOH 52 1152 78 HOH HOH A . 
D 4 HOH 53 1153 42 HOH HOH A . 
D 4 HOH 54 1154 37 HOH HOH A . 
D 4 HOH 55 1155 12 HOH HOH A . 
D 4 HOH 56 1156 45 HOH HOH A . 
D 4 HOH 57 1157 61 HOH HOH A . 
D 4 HOH 58 1158 73 HOH HOH A . 
D 4 HOH 59 1159 62 HOH HOH A . 
D 4 HOH 60 1160 59 HOH HOH A . 
D 4 HOH 61 1161 4  HOH HOH A . 
D 4 HOH 62 1162 52 HOH HOH A . 
D 4 HOH 63 1163 54 HOH HOH A . 
D 4 HOH 64 1164 79 HOH HOH A . 
D 4 HOH 65 1165 56 HOH HOH A . 
D 4 HOH 66 1166 65 HOH HOH A . 
D 4 HOH 67 1167 46 HOH HOH A . 
D 4 HOH 68 1168 71 HOH HOH A . 
D 4 HOH 69 1169 7  HOH HOH A . 
D 4 HOH 70 1170 48 HOH HOH A . 
D 4 HOH 71 1171 38 HOH HOH A . 
D 4 HOH 72 1172 75 HOH HOH A . 
D 4 HOH 73 1173 41 HOH HOH A . 
D 4 HOH 74 1174 40 HOH HOH A . 
D 4 HOH 75 1175 29 HOH HOH A . 
D 4 HOH 76 1176 17 HOH HOH A . 
D 4 HOH 77 1177 51 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 280   ? 
1 MORE         6     ? 
1 'SSA (A^2)'  13410 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-10 
2 'Structure model' 1 1 2016-09-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         12.4196 
_pdbx_refine_tls.origin_y         -7.2007 
_pdbx_refine_tls.origin_z         -19.3001 
_pdbx_refine_tls.T[1][1]          -0.1251 
_pdbx_refine_tls.T[2][2]          -0.1988 
_pdbx_refine_tls.T[3][3]          -0.0698 
_pdbx_refine_tls.T[1][2]          0.0457 
_pdbx_refine_tls.T[1][3]          -0.0855 
_pdbx_refine_tls.T[2][3]          -0.0588 
_pdbx_refine_tls.L[1][1]          2.3870 
_pdbx_refine_tls.L[2][2]          3.2786 
_pdbx_refine_tls.L[3][3]          0.6879 
_pdbx_refine_tls.L[1][2]          -1.0621 
_pdbx_refine_tls.L[1][3]          -0.1805 
_pdbx_refine_tls.L[2][3]          0.1626 
_pdbx_refine_tls.S[1][1]          -0.2322 
_pdbx_refine_tls.S[2][2]          0.2330 
_pdbx_refine_tls.S[3][3]          -0.0008 
_pdbx_refine_tls.S[1][2]          -0.4626 
_pdbx_refine_tls.S[1][3]          0.2022 
_pdbx_refine_tls.S[2][3]          -0.2457 
_pdbx_refine_tls.S[2][1]          0.6909 
_pdbx_refine_tls.S[3][1]          0.0402 
_pdbx_refine_tls.S[3][2]          0.0921 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     632 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     905 
_pdbx_refine_tls_group.selection_details   '{ A|* }' 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.17 1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .      2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER      ? ? ? 2.11.6 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20   4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? .      5 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .      6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 717 ? ? 56.70   -152.38 
2 1 ARG A 757 ? ? 77.70   -5.20   
3 1 ASP A 758 ? ? -148.38 44.00   
4 1 TRP A 840 ? ? 52.27   -124.20 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 634 ? CG  ? A LYS 22  CG  
2  1 Y 1 A LYS 634 ? CD  ? A LYS 22  CD  
3  1 Y 1 A LYS 634 ? CE  ? A LYS 22  CE  
4  1 Y 1 A LYS 634 ? NZ  ? A LYS 22  NZ  
5  1 Y 1 A GLU 637 ? CG  ? A GLU 25  CG  
6  1 Y 1 A GLU 637 ? CD  ? A GLU 25  CD  
7  1 Y 1 A GLU 637 ? OE1 ? A GLU 25  OE1 
8  1 Y 1 A GLU 637 ? OE2 ? A GLU 25  OE2 
9  1 Y 1 A ARG 651 ? CG  ? A ARG 39  CG  
10 1 Y 1 A ARG 651 ? CD  ? A ARG 39  CD  
11 1 Y 1 A ARG 651 ? NE  ? A ARG 39  NE  
12 1 Y 1 A ARG 651 ? CZ  ? A ARG 39  CZ  
13 1 Y 1 A ARG 651 ? NH1 ? A ARG 39  NH1 
14 1 Y 1 A ARG 651 ? NH2 ? A ARG 39  NH2 
15 1 Y 1 A LYS 653 ? CG  ? A LYS 41  CG  
16 1 Y 1 A LYS 653 ? CD  ? A LYS 41  CD  
17 1 Y 1 A LYS 653 ? CE  ? A LYS 41  CE  
18 1 Y 1 A LYS 653 ? NZ  ? A LYS 41  NZ  
19 1 Y 1 A GLN 654 ? CG  ? A GLN 42  CG  
20 1 Y 1 A GLN 654 ? CD  ? A GLN 42  CD  
21 1 Y 1 A GLN 654 ? OE1 ? A GLN 42  OE1 
22 1 Y 1 A GLN 654 ? NE2 ? A GLN 42  NE2 
23 1 Y 1 A ARG 657 ? CG  ? A ARG 45  CG  
24 1 Y 1 A ARG 657 ? CD  ? A ARG 45  CD  
25 1 Y 1 A ARG 657 ? NE  ? A ARG 45  NE  
26 1 Y 1 A ARG 657 ? CZ  ? A ARG 45  CZ  
27 1 Y 1 A ARG 657 ? NH1 ? A ARG 45  NH1 
28 1 Y 1 A ARG 657 ? NH2 ? A ARG 45  NH2 
29 1 Y 1 A LYS 668 ? CG  ? A LYS 56  CG  
30 1 Y 1 A LYS 668 ? CD  ? A LYS 56  CD  
31 1 Y 1 A LYS 668 ? CE  ? A LYS 56  CE  
32 1 Y 1 A LYS 668 ? NZ  ? A LYS 56  NZ  
33 1 Y 1 A GLU 673 ? CG  ? A GLU 61  CG  
34 1 Y 1 A GLU 673 ? CD  ? A GLU 61  CD  
35 1 Y 1 A GLU 673 ? OE1 ? A GLU 61  OE1 
36 1 Y 1 A GLU 673 ? OE2 ? A GLU 61  OE2 
37 1 Y 1 A ARG 674 ? CG  ? A ARG 62  CG  
38 1 Y 1 A ARG 674 ? CD  ? A ARG 62  CD  
39 1 Y 1 A ARG 674 ? NE  ? A ARG 62  NE  
40 1 Y 1 A ARG 674 ? CZ  ? A ARG 62  CZ  
41 1 Y 1 A ARG 674 ? NH1 ? A ARG 62  NH1 
42 1 Y 1 A ARG 674 ? NH2 ? A ARG 62  NH2 
43 1 Y 1 A LYS 703 ? CG  ? A LYS 91  CG  
44 1 Y 1 A LYS 703 ? CD  ? A LYS 91  CD  
45 1 Y 1 A LYS 703 ? CE  ? A LYS 91  CE  
46 1 Y 1 A LYS 703 ? NZ  ? A LYS 91  NZ  
47 1 Y 1 A ARG 705 ? CG  ? A ARG 93  CG  
48 1 Y 1 A ARG 705 ? CD  ? A ARG 93  CD  
49 1 Y 1 A ARG 705 ? NE  ? A ARG 93  NE  
50 1 Y 1 A ARG 705 ? CZ  ? A ARG 93  CZ  
51 1 Y 1 A ARG 705 ? NH1 ? A ARG 93  NH1 
52 1 Y 1 A ARG 705 ? NH2 ? A ARG 93  NH2 
53 1 Y 1 A ARG 781 ? CG  ? A ARG 169 CG  
54 1 Y 1 A ARG 781 ? CD  ? A ARG 169 CD  
55 1 Y 1 A ARG 781 ? NE  ? A ARG 169 NE  
56 1 Y 1 A ARG 781 ? CZ  ? A ARG 169 CZ  
57 1 Y 1 A ARG 781 ? NH1 ? A ARG 169 NH1 
58 1 Y 1 A ARG 781 ? NH2 ? A ARG 169 NH2 
59 1 Y 1 A LEU 796 ? CG  ? A LEU 184 CG  
60 1 Y 1 A LEU 796 ? CD1 ? A LEU 184 CD1 
61 1 Y 1 A LEU 796 ? CD2 ? A LEU 184 CD2 
62 1 Y 1 A LYS 799 ? CG  ? A LYS 187 CG  
63 1 Y 1 A LYS 799 ? CD  ? A LYS 187 CD  
64 1 Y 1 A LYS 799 ? CE  ? A LYS 187 CE  
65 1 Y 1 A LYS 799 ? NZ  ? A LYS 187 NZ  
66 1 Y 1 A ARG 813 ? NE  ? A ARG 201 NE  
67 1 Y 1 A ARG 813 ? CZ  ? A ARG 201 CZ  
68 1 Y 1 A ARG 813 ? NH1 ? A ARG 201 NH1 
69 1 Y 1 A ARG 813 ? NH2 ? A ARG 201 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 613 ? A GLY 1   
2  1 Y 1 A SER 614 ? A SER 2   
3  1 Y 1 A SER 615 ? A SER 3   
4  1 Y 1 A ASP 616 ? A ASP 4   
5  1 Y 1 A PRO 617 ? A PRO 5   
6  1 Y 1 A ASN 618 ? A ASN 6   
7  1 Y 1 A GLU 619 ? A GLU 7   
8  1 Y 1 A ALA 620 ? A ALA 8   
9  1 Y 1 A VAL 621 ? A VAL 9   
10 1 Y 1 A ARG 622 ? A ARG 10  
11 1 Y 1 A GLU 623 ? A GLU 11  
12 1 Y 1 A PHE 624 ? A PHE 12  
13 1 Y 1 A ALA 625 ? A ALA 13  
14 1 Y 1 A LYS 626 ? A LYS 14  
15 1 Y 1 A GLU 627 ? A GLU 15  
16 1 Y 1 A ILE 628 ? A ILE 16  
17 1 Y 1 A ASP 629 ? A ASP 17  
18 1 Y 1 A VAL 630 ? A VAL 18  
19 1 Y 1 A SER 631 ? A SER 19  
20 1 Y 1 A ALA 906 ? A ALA 294 
21 1 Y 1 A SER 907 ? A SER 295 
22 1 Y 1 A ALA 908 ? A ALA 296 
23 1 Y 1 A GLN 909 ? A GLN 297 
24 1 Y 1 A SER 910 ? A SER 298 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Science Foundation' 'United States' CHE-1455306   1 
'American Cancer Society'     'United States' IRG-58-007-51 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '~{N}-(4-phenylazanylquinazolin-7-yl)ethanamide' 6P8 
3 '1,4-DIETHYLENE DIOXIDE'                         DIO 
4 water                                            HOH 
#