data_5LK5
# 
_entry.id   5LK5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LK5         
WWPDB D_1200000866 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'Wild-type molecule, different space group' 
_pdbx_database_related.db_id          3poW 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LK5 
_pdbx_database_status.recvd_initial_deposition_date   2016-07-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gaboriaud, C.' 1 ? 
'Cioci, G.'     2 ? 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? UK ? ? primary IUCrJ      ? ? 2052-2525 ? ? 3 ? 408    419    
'Structures of parasite calreticulins provide insights into their flexibility and dual carbohydrate/peptide-binding properties.' 
2016 ? 10.1107/S2052252516012847    27840680 ? 
? ? ? ? ? ? ? US ? ? 1       'PLoS ONE' ? ? 1932-6203 ? ? 6 ? e17886 e17886 
'X-ray structure of the human calreticulin globular domain reveals a peptide-binding area and suggests a multi-molecular mechanism.' 
2011 ? 10.1371/journal.pone.0017886 21423620 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Moreau, C.'     1  ? 
primary 'Cioci, G.'      2  ? 
primary 'Iannello, M.'   3  ? 
primary 'Laffly, E.'     4  ? 
primary 'Chouquet, A.'   5  ? 
primary 'Ferreira, A.'   6  ? 
primary 'Thielens, N.M.' 7  ? 
primary 'Gaboriaud, C.'  8  ? 
1       'Chouquet, A.'   9  ? 
1       'Paidassi, H.'   10 ? 
1       'Ling, W.L.'     11 ? 
1       'Frachet, P.'    12 ? 
1       'Houen, G.'      13 ? 
1       'Arlaud, G.J.'   14 ? 
1       'Gaboriaud, C.'  15 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LK5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     196.976 
_cell.length_a_esd                 ? 
_cell.length_b                     196.976 
_cell.length_b_esd                 ? 
_cell.length_c                     67.806 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        40 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LK5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                77 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 42' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Calreticulin,Calreticulin 30160.361 10  ? D71K,D71K,D71K,D71K 
'UNP residues 18-204,UNP residues 303-368,UNP residues 18-204,UNP residues 303-368' ? 
2 non-polymer syn 'CALCIUM ION'             40.078    10  ? ?                   ? ? 
3 non-polymer syn 'CHLORIDE ION'            35.453    1   ? ?                   ? ? 
4 water       nat water                     18.015    961 ? ?                   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CRP55,Calregulin,Endoplasmic reticulum resident protein 60,ERp60,HACBP,grp60,CRP55,Calregulin,Endoplasmic reticulum resident protein 60,ERp60,HACBP,grp60
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NKGSIEGREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQKARFYALSASFEPFSNKGQ
TLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFT
HLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPGSGDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFG
NETWGVTKAAEKQMKDKQDEEQRLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NKGSIEGREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQKARFYALSASFEPFSNKGQ
TLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFT
HLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPGSGDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFG
NETWGVTKAAEKQMKDKQDEEQRLK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   LYS n 
1 3   GLY n 
1 4   SER n 
1 5   ILE n 
1 6   GLU n 
1 7   GLY n 
1 8   ARG n 
1 9   GLU n 
1 10  PRO n 
1 11  ALA n 
1 12  VAL n 
1 13  TYR n 
1 14  PHE n 
1 15  LYS n 
1 16  GLU n 
1 17  GLN n 
1 18  PHE n 
1 19  LEU n 
1 20  ASP n 
1 21  GLY n 
1 22  ASP n 
1 23  GLY n 
1 24  TRP n 
1 25  THR n 
1 26  SER n 
1 27  ARG n 
1 28  TRP n 
1 29  ILE n 
1 30  GLU n 
1 31  SER n 
1 32  LYS n 
1 33  HIS n 
1 34  LYS n 
1 35  SER n 
1 36  ASP n 
1 37  PHE n 
1 38  GLY n 
1 39  LYS n 
1 40  PHE n 
1 41  VAL n 
1 42  LEU n 
1 43  SER n 
1 44  SER n 
1 45  GLY n 
1 46  LYS n 
1 47  PHE n 
1 48  TYR n 
1 49  GLY n 
1 50  ASP n 
1 51  GLU n 
1 52  GLU n 
1 53  LYS n 
1 54  ASP n 
1 55  LYS n 
1 56  GLY n 
1 57  LEU n 
1 58  GLN n 
1 59  THR n 
1 60  SER n 
1 61  GLN n 
1 62  LYS n 
1 63  ALA n 
1 64  ARG n 
1 65  PHE n 
1 66  TYR n 
1 67  ALA n 
1 68  LEU n 
1 69  SER n 
1 70  ALA n 
1 71  SER n 
1 72  PHE n 
1 73  GLU n 
1 74  PRO n 
1 75  PHE n 
1 76  SER n 
1 77  ASN n 
1 78  LYS n 
1 79  GLY n 
1 80  GLN n 
1 81  THR n 
1 82  LEU n 
1 83  VAL n 
1 84  VAL n 
1 85  GLN n 
1 86  PHE n 
1 87  THR n 
1 88  VAL n 
1 89  LYS n 
1 90  HIS n 
1 91  GLU n 
1 92  GLN n 
1 93  ASN n 
1 94  ILE n 
1 95  ASP n 
1 96  CYS n 
1 97  GLY n 
1 98  GLY n 
1 99  GLY n 
1 100 TYR n 
1 101 VAL n 
1 102 LYS n 
1 103 LEU n 
1 104 PHE n 
1 105 PRO n 
1 106 ASN n 
1 107 SER n 
1 108 LEU n 
1 109 ASP n 
1 110 GLN n 
1 111 THR n 
1 112 ASP n 
1 113 MET n 
1 114 HIS n 
1 115 GLY n 
1 116 ASP n 
1 117 SER n 
1 118 GLU n 
1 119 TYR n 
1 120 ASN n 
1 121 ILE n 
1 122 MET n 
1 123 PHE n 
1 124 GLY n 
1 125 PRO n 
1 126 ASP n 
1 127 ILE n 
1 128 CYS n 
1 129 GLY n 
1 130 PRO n 
1 131 GLY n 
1 132 THR n 
1 133 LYS n 
1 134 LYS n 
1 135 VAL n 
1 136 HIS n 
1 137 VAL n 
1 138 ILE n 
1 139 PHE n 
1 140 ASN n 
1 141 TYR n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 ASN n 
1 146 VAL n 
1 147 LEU n 
1 148 ILE n 
1 149 ASN n 
1 150 LYS n 
1 151 ASP n 
1 152 ILE n 
1 153 ARG n 
1 154 CYS n 
1 155 LYS n 
1 156 ASP n 
1 157 ASP n 
1 158 GLU n 
1 159 PHE n 
1 160 THR n 
1 161 HIS n 
1 162 LEU n 
1 163 TYR n 
1 164 THR n 
1 165 LEU n 
1 166 ILE n 
1 167 VAL n 
1 168 ARG n 
1 169 PRO n 
1 170 ASP n 
1 171 ASN n 
1 172 THR n 
1 173 TYR n 
1 174 GLU n 
1 175 VAL n 
1 176 LYS n 
1 177 ILE n 
1 178 ASP n 
1 179 ASN n 
1 180 SER n 
1 181 GLN n 
1 182 VAL n 
1 183 GLU n 
1 184 SER n 
1 185 GLY n 
1 186 SER n 
1 187 LEU n 
1 188 GLU n 
1 189 ASP n 
1 190 ASP n 
1 191 TRP n 
1 192 ASP n 
1 193 PHE n 
1 194 LEU n 
1 195 PRO n 
1 196 GLY n 
1 197 SER n 
1 198 GLY n 
1 199 ASP n 
1 200 PRO n 
1 201 SER n 
1 202 ILE n 
1 203 TYR n 
1 204 ALA n 
1 205 TYR n 
1 206 ASP n 
1 207 ASN n 
1 208 PHE n 
1 209 GLY n 
1 210 VAL n 
1 211 LEU n 
1 212 GLY n 
1 213 LEU n 
1 214 ASP n 
1 215 LEU n 
1 216 TRP n 
1 217 GLN n 
1 218 VAL n 
1 219 LYS n 
1 220 SER n 
1 221 GLY n 
1 222 THR n 
1 223 ILE n 
1 224 PHE n 
1 225 ASP n 
1 226 ASN n 
1 227 PHE n 
1 228 LEU n 
1 229 ILE n 
1 230 THR n 
1 231 ASN n 
1 232 ASP n 
1 233 GLU n 
1 234 ALA n 
1 235 TYR n 
1 236 ALA n 
1 237 GLU n 
1 238 GLU n 
1 239 PHE n 
1 240 GLY n 
1 241 ASN n 
1 242 GLU n 
1 243 THR n 
1 244 TRP n 
1 245 GLY n 
1 246 VAL n 
1 247 THR n 
1 248 LYS n 
1 249 ALA n 
1 250 ALA n 
1 251 GLU n 
1 252 LYS n 
1 253 GLN n 
1 254 MET n 
1 255 LYS n 
1 256 ASP n 
1 257 LYS n 
1 258 GLN n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 GLN n 
1 263 ARG n 
1 264 LEU n 
1 265 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   195 Human ? 'CALR, CRTC' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia hermannii' 866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 200 265 Human ? 'CALR, CRTC' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia hermannii' 866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CALR_HUMAN P27797 ? 1 
;EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTV
KHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVR
PDNTYEVKIDNSQVESGSLEDDWDFLP
;
18  
2 UNP CALR_HUMAN P27797 ? 1 PSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLK 303 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5LK5 A 9   ? 195 ? P27797 18  ? 204 ? 18  204 
2  2 5LK5 A 200 ? 265 ? P27797 303 ? 368 ? 303 368 
3  1 5LK5 B 9   ? 195 ? P27797 18  ? 204 ? 18  298 
4  2 5LK5 B 200 ? 265 ? P27797 303 ? 368 ? 303 368 
5  1 5LK5 C 9   ? 195 ? P27797 18  ? 204 ? 18  204 
6  2 5LK5 C 200 ? 265 ? P27797 303 ? 368 ? 303 368 
7  1 5LK5 D 9   ? 195 ? P27797 18  ? 204 ? 18  204 
8  2 5LK5 D 200 ? 265 ? P27797 303 ? 368 ? 303 368 
9  1 5LK5 E 9   ? 195 ? P27797 18  ? 204 ? 18  298 
10 2 5LK5 E 200 ? 265 ? P27797 303 ? 368 ? 303 368 
11 1 5LK5 F 9   ? 195 ? P27797 18  ? 204 ? 18  204 
12 2 5LK5 F 200 ? 265 ? P27797 303 ? 368 ? 303 368 
13 1 5LK5 G 9   ? 195 ? P27797 18  ? 204 ? 18  204 
14 2 5LK5 G 200 ? 265 ? P27797 303 ? 368 ? 303 368 
15 1 5LK5 H 9   ? 195 ? P27797 18  ? 204 ? 18  204 
16 2 5LK5 H 200 ? 265 ? P27797 303 ? 368 ? 303 368 
17 1 5LK5 I 9   ? 195 ? P27797 18  ? 204 ? 18  298 
18 2 5LK5 I 200 ? 265 ? P27797 303 ? 368 ? 303 368 
19 1 5LK5 J 9   ? 195 ? P27797 18  ? 204 ? 18  204 
20 2 5LK5 J 200 ? 265 ? P27797 303 ? 368 ? 303 368 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5LK5 ASN A 1   ? UNP P27797 ?   ?  'expression tag'      10  1   
1  5LK5 LYS A 2   ? UNP P27797 ?   ?  'expression tag'      11  2   
1  5LK5 GLY A 3   ? UNP P27797 ?   ?  'expression tag'      12  3   
1  5LK5 SER A 4   ? UNP P27797 ?   ?  'expression tag'      13  4   
1  5LK5 ILE A 5   ? UNP P27797 ?   ?  'expression tag'      14  5   
1  5LK5 GLU A 6   ? UNP P27797 ?   ?  'expression tag'      15  6   
1  5LK5 GLY A 7   ? UNP P27797 ?   ?  'expression tag'      16  7   
1  5LK5 ARG A 8   ? UNP P27797 ?   ?  'expression tag'      17  8   
1  5LK5 LYS A 62  ? UNP P27797 ASP 71 'engineered mutation' 71  9   
1  5LK5 GLY A 196 ? UNP P27797 ?   ?  linker                205 10  
1  5LK5 SER A 197 ? UNP P27797 ?   ?  linker                206 11  
1  5LK5 GLY A 198 ? UNP P27797 ?   ?  linker                207 12  
1  5LK5 ASP A 199 ? UNP P27797 ?   ?  linker                302 13  
3  5LK5 ASN B 1   ? UNP P27797 ?   ?  'expression tag'      10  14  
3  5LK5 LYS B 2   ? UNP P27797 ?   ?  'expression tag'      11  15  
3  5LK5 GLY B 3   ? UNP P27797 ?   ?  'expression tag'      12  16  
3  5LK5 SER B 4   ? UNP P27797 ?   ?  'expression tag'      13  17  
3  5LK5 ILE B 5   ? UNP P27797 ?   ?  'expression tag'      14  18  
3  5LK5 GLU B 6   ? UNP P27797 ?   ?  'expression tag'      15  19  
3  5LK5 GLY B 7   ? UNP P27797 ?   ?  'expression tag'      16  20  
3  5LK5 ARG B 8   ? UNP P27797 ?   ?  'expression tag'      17  21  
3  5LK5 LYS B 62  ? UNP P27797 ASP 71 'engineered mutation' 71  22  
3  5LK5 GLY B 196 ? UNP P27797 ?   ?  linker                299 23  
3  5LK5 SER B 197 ? UNP P27797 ?   ?  linker                300 24  
3  5LK5 GLY B 198 ? UNP P27797 ?   ?  linker                301 25  
3  5LK5 ASP B 199 ? UNP P27797 ?   ?  linker                302 26  
5  5LK5 ASN C 1   ? UNP P27797 ?   ?  'expression tag'      10  27  
5  5LK5 LYS C 2   ? UNP P27797 ?   ?  'expression tag'      11  28  
5  5LK5 GLY C 3   ? UNP P27797 ?   ?  'expression tag'      12  29  
5  5LK5 SER C 4   ? UNP P27797 ?   ?  'expression tag'      13  30  
5  5LK5 ILE C 5   ? UNP P27797 ?   ?  'expression tag'      14  31  
5  5LK5 GLU C 6   ? UNP P27797 ?   ?  'expression tag'      15  32  
5  5LK5 GLY C 7   ? UNP P27797 ?   ?  'expression tag'      16  33  
5  5LK5 ARG C 8   ? UNP P27797 ?   ?  'expression tag'      17  34  
5  5LK5 LYS C 62  ? UNP P27797 ASP 71 'engineered mutation' 71  35  
5  5LK5 GLY C 196 ? UNP P27797 ?   ?  linker                205 36  
5  5LK5 SER C 197 ? UNP P27797 ?   ?  linker                206 37  
5  5LK5 GLY C 198 ? UNP P27797 ?   ?  linker                207 38  
5  5LK5 ASP C 199 ? UNP P27797 ?   ?  linker                302 39  
7  5LK5 ASN D 1   ? UNP P27797 ?   ?  'expression tag'      10  40  
7  5LK5 LYS D 2   ? UNP P27797 ?   ?  'expression tag'      11  41  
7  5LK5 GLY D 3   ? UNP P27797 ?   ?  'expression tag'      12  42  
7  5LK5 SER D 4   ? UNP P27797 ?   ?  'expression tag'      13  43  
7  5LK5 ILE D 5   ? UNP P27797 ?   ?  'expression tag'      14  44  
7  5LK5 GLU D 6   ? UNP P27797 ?   ?  'expression tag'      15  45  
7  5LK5 GLY D 7   ? UNP P27797 ?   ?  'expression tag'      16  46  
7  5LK5 ARG D 8   ? UNP P27797 ?   ?  'expression tag'      17  47  
7  5LK5 LYS D 62  ? UNP P27797 ASP 71 'engineered mutation' 71  48  
7  5LK5 GLY D 196 ? UNP P27797 ?   ?  linker                205 49  
7  5LK5 SER D 197 ? UNP P27797 ?   ?  linker                206 50  
7  5LK5 GLY D 198 ? UNP P27797 ?   ?  linker                207 51  
7  5LK5 ASP D 199 ? UNP P27797 ?   ?  linker                302 52  
9  5LK5 ASN E 1   ? UNP P27797 ?   ?  'expression tag'      10  53  
9  5LK5 LYS E 2   ? UNP P27797 ?   ?  'expression tag'      11  54  
9  5LK5 GLY E 3   ? UNP P27797 ?   ?  'expression tag'      12  55  
9  5LK5 SER E 4   ? UNP P27797 ?   ?  'expression tag'      13  56  
9  5LK5 ILE E 5   ? UNP P27797 ?   ?  'expression tag'      14  57  
9  5LK5 GLU E 6   ? UNP P27797 ?   ?  'expression tag'      15  58  
9  5LK5 GLY E 7   ? UNP P27797 ?   ?  'expression tag'      16  59  
9  5LK5 ARG E 8   ? UNP P27797 ?   ?  'expression tag'      17  60  
9  5LK5 LYS E 62  ? UNP P27797 ASP 71 'engineered mutation' 71  61  
9  5LK5 GLY E 196 ? UNP P27797 ?   ?  linker                299 62  
9  5LK5 SER E 197 ? UNP P27797 ?   ?  linker                300 63  
9  5LK5 GLY E 198 ? UNP P27797 ?   ?  linker                301 64  
9  5LK5 ASP E 199 ? UNP P27797 ?   ?  linker                302 65  
11 5LK5 ASN F 1   ? UNP P27797 ?   ?  'expression tag'      10  66  
11 5LK5 LYS F 2   ? UNP P27797 ?   ?  'expression tag'      11  67  
11 5LK5 GLY F 3   ? UNP P27797 ?   ?  'expression tag'      12  68  
11 5LK5 SER F 4   ? UNP P27797 ?   ?  'expression tag'      13  69  
11 5LK5 ILE F 5   ? UNP P27797 ?   ?  'expression tag'      14  70  
11 5LK5 GLU F 6   ? UNP P27797 ?   ?  'expression tag'      15  71  
11 5LK5 GLY F 7   ? UNP P27797 ?   ?  'expression tag'      16  72  
11 5LK5 ARG F 8   ? UNP P27797 ?   ?  'expression tag'      17  73  
11 5LK5 LYS F 62  ? UNP P27797 ASP 71 'engineered mutation' 71  74  
11 5LK5 GLY F 196 ? UNP P27797 ?   ?  linker                205 75  
11 5LK5 SER F 197 ? UNP P27797 ?   ?  linker                206 76  
11 5LK5 GLY F 198 ? UNP P27797 ?   ?  linker                207 77  
11 5LK5 ASP F 199 ? UNP P27797 ?   ?  linker                302 78  
13 5LK5 ASN G 1   ? UNP P27797 ?   ?  'expression tag'      10  79  
13 5LK5 LYS G 2   ? UNP P27797 ?   ?  'expression tag'      11  80  
13 5LK5 GLY G 3   ? UNP P27797 ?   ?  'expression tag'      12  81  
13 5LK5 SER G 4   ? UNP P27797 ?   ?  'expression tag'      13  82  
13 5LK5 ILE G 5   ? UNP P27797 ?   ?  'expression tag'      14  83  
13 5LK5 GLU G 6   ? UNP P27797 ?   ?  'expression tag'      15  84  
13 5LK5 GLY G 7   ? UNP P27797 ?   ?  'expression tag'      16  85  
13 5LK5 ARG G 8   ? UNP P27797 ?   ?  'expression tag'      17  86  
13 5LK5 LYS G 62  ? UNP P27797 ASP 71 'engineered mutation' 71  87  
13 5LK5 GLY G 196 ? UNP P27797 ?   ?  linker                205 88  
13 5LK5 SER G 197 ? UNP P27797 ?   ?  linker                206 89  
13 5LK5 GLY G 198 ? UNP P27797 ?   ?  linker                207 90  
13 5LK5 ASP G 199 ? UNP P27797 ?   ?  linker                302 91  
15 5LK5 ASN H 1   ? UNP P27797 ?   ?  'expression tag'      10  92  
15 5LK5 LYS H 2   ? UNP P27797 ?   ?  'expression tag'      11  93  
15 5LK5 GLY H 3   ? UNP P27797 ?   ?  'expression tag'      12  94  
15 5LK5 SER H 4   ? UNP P27797 ?   ?  'expression tag'      13  95  
15 5LK5 ILE H 5   ? UNP P27797 ?   ?  'expression tag'      14  96  
15 5LK5 GLU H 6   ? UNP P27797 ?   ?  'expression tag'      15  97  
15 5LK5 GLY H 7   ? UNP P27797 ?   ?  'expression tag'      16  98  
15 5LK5 ARG H 8   ? UNP P27797 ?   ?  'expression tag'      17  99  
15 5LK5 LYS H 62  ? UNP P27797 ASP 71 'engineered mutation' 71  100 
15 5LK5 GLY H 196 ? UNP P27797 ?   ?  linker                205 101 
15 5LK5 SER H 197 ? UNP P27797 ?   ?  linker                206 102 
15 5LK5 GLY H 198 ? UNP P27797 ?   ?  linker                207 103 
15 5LK5 ASP H 199 ? UNP P27797 ?   ?  linker                302 104 
17 5LK5 ASN I 1   ? UNP P27797 ?   ?  'expression tag'      10  105 
17 5LK5 LYS I 2   ? UNP P27797 ?   ?  'expression tag'      11  106 
17 5LK5 GLY I 3   ? UNP P27797 ?   ?  'expression tag'      12  107 
17 5LK5 SER I 4   ? UNP P27797 ?   ?  'expression tag'      13  108 
17 5LK5 ILE I 5   ? UNP P27797 ?   ?  'expression tag'      14  109 
17 5LK5 GLU I 6   ? UNP P27797 ?   ?  'expression tag'      15  110 
17 5LK5 GLY I 7   ? UNP P27797 ?   ?  'expression tag'      16  111 
17 5LK5 ARG I 8   ? UNP P27797 ?   ?  'expression tag'      17  112 
17 5LK5 LYS I 62  ? UNP P27797 ASP 71 'engineered mutation' 71  113 
17 5LK5 GLY I 196 ? UNP P27797 ?   ?  linker                299 114 
17 5LK5 SER I 197 ? UNP P27797 ?   ?  linker                300 115 
17 5LK5 GLY I 198 ? UNP P27797 ?   ?  linker                301 116 
17 5LK5 ASP I 199 ? UNP P27797 ?   ?  linker                302 117 
19 5LK5 ASN J 1   ? UNP P27797 ?   ?  'expression tag'      10  118 
19 5LK5 LYS J 2   ? UNP P27797 ?   ?  'expression tag'      11  119 
19 5LK5 GLY J 3   ? UNP P27797 ?   ?  'expression tag'      12  120 
19 5LK5 SER J 4   ? UNP P27797 ?   ?  'expression tag'      13  121 
19 5LK5 ILE J 5   ? UNP P27797 ?   ?  'expression tag'      14  122 
19 5LK5 GLU J 6   ? UNP P27797 ?   ?  'expression tag'      15  123 
19 5LK5 GLY J 7   ? UNP P27797 ?   ?  'expression tag'      16  124 
19 5LK5 ARG J 8   ? UNP P27797 ?   ?  'expression tag'      17  125 
19 5LK5 LYS J 62  ? UNP P27797 ASP 71 'engineered mutation' 71  126 
19 5LK5 GLY J 196 ? UNP P27797 ?   ?  linker                205 127 
19 5LK5 SER J 197 ? UNP P27797 ?   ?  linker                206 128 
19 5LK5 GLY J 198 ? UNP P27797 ?   ?  linker                207 129 
19 5LK5 ASP J 199 ? UNP P27797 ?   ?  linker                302 130 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LK5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.18 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.60 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;30% PEG4000
0.2 M MgCl2
0.1 M Tris-HCl
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-07-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5LK5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.28 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       114120 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.04 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.41 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            0.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.04 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -0.07 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               23.726 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5LK5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.30 
_refine.ls_d_res_low                             47.77 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     107101 
_refine.ls_number_reflns_R_free                  5630 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.10 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.21211 
_refine.ls_R_factor_R_free                       0.24685 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.21027 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.492 
_refine.pdbx_overall_ESU_R_Free                  0.260 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             7.387 
_refine.overall_SU_ML                            0.177 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        20353 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             961 
_refine_hist.number_atoms_total               21325 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        47.77 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.016  0.019  20931 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.010  0.020  18756 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.688  1.934  28172 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.664  3.001  43388 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.788  5.000  2520  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 34.553 25.709 1114  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.779 15.000 3525  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 11.780 15.000 44    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.094  0.200  2882  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.010  0.020  24080 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.008  0.020  4968  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.841  2.220  10161 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.840  2.219  10160 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.841  3.319  12631 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.841  3.320  12632 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.713  2.472  10770 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.713  2.472  10771 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.303  3.598  15541 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.964  18.020 23971 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.933  17.995 23742 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1  1  ? 0.07 0.05 ? ? A 15329 'interatomic distance' 
'X-RAY DIFFRACTION' 2 1  2  ? 0.07 0.05 ? ? B 15329 'interatomic distance' 
'X-RAY DIFFRACTION' 1 2  3  ? 0.11 0.05 ? ? A 14485 'interatomic distance' 
'X-RAY DIFFRACTION' 2 2  4  ? 0.11 0.05 ? ? C 14485 'interatomic distance' 
'X-RAY DIFFRACTION' 1 3  5  ? 0.10 0.05 ? ? A 15036 'interatomic distance' 
'X-RAY DIFFRACTION' 2 3  6  ? 0.10 0.05 ? ? D 15036 'interatomic distance' 
'X-RAY DIFFRACTION' 1 4  7  ? 0.12 0.05 ? ? A 14398 'interatomic distance' 
'X-RAY DIFFRACTION' 2 4  8  ? 0.12 0.05 ? ? E 14398 'interatomic distance' 
'X-RAY DIFFRACTION' 1 5  9  ? 0.10 0.05 ? ? A 14737 'interatomic distance' 
'X-RAY DIFFRACTION' 2 5  10 ? 0.10 0.05 ? ? F 14737 'interatomic distance' 
'X-RAY DIFFRACTION' 1 6  11 ? 0.11 0.05 ? ? A 14828 'interatomic distance' 
'X-RAY DIFFRACTION' 2 6  12 ? 0.11 0.05 ? ? G 14828 'interatomic distance' 
'X-RAY DIFFRACTION' 1 7  13 ? 0.11 0.05 ? ? A 14650 'interatomic distance' 
'X-RAY DIFFRACTION' 2 7  14 ? 0.11 0.05 ? ? H 14650 'interatomic distance' 
'X-RAY DIFFRACTION' 1 8  15 ? 0.12 0.05 ? ? A 14505 'interatomic distance' 
'X-RAY DIFFRACTION' 2 8  16 ? 0.12 0.05 ? ? I 14505 'interatomic distance' 
'X-RAY DIFFRACTION' 1 9  17 ? 0.12 0.05 ? ? A 14500 'interatomic distance' 
'X-RAY DIFFRACTION' 2 9  18 ? 0.12 0.05 ? ? J 14500 'interatomic distance' 
'X-RAY DIFFRACTION' 1 10 19 ? 0.11 0.05 ? ? B 14414 'interatomic distance' 
'X-RAY DIFFRACTION' 2 10 20 ? 0.11 0.05 ? ? C 14414 'interatomic distance' 
'X-RAY DIFFRACTION' 1 11 21 ? 0.10 0.05 ? ? B 14767 'interatomic distance' 
'X-RAY DIFFRACTION' 2 11 22 ? 0.10 0.05 ? ? D 14767 'interatomic distance' 
'X-RAY DIFFRACTION' 1 12 23 ? 0.12 0.05 ? ? B 14482 'interatomic distance' 
'X-RAY DIFFRACTION' 2 12 24 ? 0.12 0.05 ? ? E 14482 'interatomic distance' 
'X-RAY DIFFRACTION' 1 13 25 ? 0.10 0.05 ? ? B 14729 'interatomic distance' 
'X-RAY DIFFRACTION' 2 13 26 ? 0.10 0.05 ? ? F 14729 'interatomic distance' 
'X-RAY DIFFRACTION' 1 14 27 ? 0.10 0.05 ? ? B 14776 'interatomic distance' 
'X-RAY DIFFRACTION' 2 14 28 ? 0.10 0.05 ? ? G 14776 'interatomic distance' 
'X-RAY DIFFRACTION' 1 15 29 ? 0.11 0.05 ? ? B 14545 'interatomic distance' 
'X-RAY DIFFRACTION' 2 15 30 ? 0.11 0.05 ? ? H 14545 'interatomic distance' 
'X-RAY DIFFRACTION' 1 16 31 ? 0.11 0.05 ? ? B 14487 'interatomic distance' 
'X-RAY DIFFRACTION' 2 16 32 ? 0.11 0.05 ? ? I 14487 'interatomic distance' 
'X-RAY DIFFRACTION' 1 17 33 ? 0.12 0.05 ? ? B 14488 'interatomic distance' 
'X-RAY DIFFRACTION' 2 17 34 ? 0.12 0.05 ? ? J 14488 'interatomic distance' 
'X-RAY DIFFRACTION' 1 18 35 ? 0.11 0.05 ? ? C 14581 'interatomic distance' 
'X-RAY DIFFRACTION' 2 18 36 ? 0.11 0.05 ? ? D 14581 'interatomic distance' 
'X-RAY DIFFRACTION' 1 19 37 ? 0.11 0.05 ? ? C 14550 'interatomic distance' 
'X-RAY DIFFRACTION' 2 19 38 ? 0.11 0.05 ? ? E 14550 'interatomic distance' 
'X-RAY DIFFRACTION' 1 20 39 ? 0.10 0.05 ? ? C 14816 'interatomic distance' 
'X-RAY DIFFRACTION' 2 20 40 ? 0.10 0.05 ? ? F 14816 'interatomic distance' 
'X-RAY DIFFRACTION' 1 21 41 ? 0.10 0.05 ? ? C 14953 'interatomic distance' 
'X-RAY DIFFRACTION' 2 21 42 ? 0.10 0.05 ? ? G 14953 'interatomic distance' 
'X-RAY DIFFRACTION' 1 22 43 ? 0.11 0.05 ? ? C 14558 'interatomic distance' 
'X-RAY DIFFRACTION' 2 22 44 ? 0.11 0.05 ? ? H 14558 'interatomic distance' 
'X-RAY DIFFRACTION' 1 23 45 ? 0.11 0.05 ? ? C 14475 'interatomic distance' 
'X-RAY DIFFRACTION' 2 23 46 ? 0.11 0.05 ? ? I 14475 'interatomic distance' 
'X-RAY DIFFRACTION' 1 24 47 ? 0.10 0.05 ? ? C 14825 'interatomic distance' 
'X-RAY DIFFRACTION' 2 24 48 ? 0.10 0.05 ? ? J 14825 'interatomic distance' 
'X-RAY DIFFRACTION' 1 25 49 ? 0.11 0.05 ? ? D 14569 'interatomic distance' 
'X-RAY DIFFRACTION' 2 25 50 ? 0.11 0.05 ? ? E 14569 'interatomic distance' 
'X-RAY DIFFRACTION' 1 26 51 ? 0.10 0.05 ? ? D 14867 'interatomic distance' 
'X-RAY DIFFRACTION' 2 26 52 ? 0.10 0.05 ? ? F 14867 'interatomic distance' 
'X-RAY DIFFRACTION' 1 27 53 ? 0.10 0.05 ? ? D 14753 'interatomic distance' 
'X-RAY DIFFRACTION' 2 27 54 ? 0.10 0.05 ? ? G 14753 'interatomic distance' 
'X-RAY DIFFRACTION' 1 28 55 ? 0.10 0.05 ? ? D 14637 'interatomic distance' 
'X-RAY DIFFRACTION' 2 28 56 ? 0.10 0.05 ? ? H 14637 'interatomic distance' 
'X-RAY DIFFRACTION' 1 29 57 ? 0.11 0.05 ? ? D 14524 'interatomic distance' 
'X-RAY DIFFRACTION' 2 29 58 ? 0.11 0.05 ? ? I 14524 'interatomic distance' 
'X-RAY DIFFRACTION' 1 30 59 ? 0.11 0.05 ? ? D 14667 'interatomic distance' 
'X-RAY DIFFRACTION' 2 30 60 ? 0.11 0.05 ? ? J 14667 'interatomic distance' 
'X-RAY DIFFRACTION' 1 31 61 ? 0.11 0.05 ? ? E 14532 'interatomic distance' 
'X-RAY DIFFRACTION' 2 31 62 ? 0.11 0.05 ? ? F 14532 'interatomic distance' 
'X-RAY DIFFRACTION' 1 32 63 ? 0.12 0.05 ? ? E 14558 'interatomic distance' 
'X-RAY DIFFRACTION' 2 32 64 ? 0.12 0.05 ? ? G 14558 'interatomic distance' 
'X-RAY DIFFRACTION' 1 33 65 ? 0.12 0.05 ? ? E 14361 'interatomic distance' 
'X-RAY DIFFRACTION' 2 33 66 ? 0.12 0.05 ? ? H 14361 'interatomic distance' 
'X-RAY DIFFRACTION' 1 34 67 ? 0.12 0.05 ? ? E 14589 'interatomic distance' 
'X-RAY DIFFRACTION' 2 34 68 ? 0.12 0.05 ? ? I 14589 'interatomic distance' 
'X-RAY DIFFRACTION' 1 35 69 ? 0.12 0.05 ? ? E 14592 'interatomic distance' 
'X-RAY DIFFRACTION' 2 35 70 ? 0.12 0.05 ? ? J 14592 'interatomic distance' 
'X-RAY DIFFRACTION' 1 36 71 ? 0.10 0.05 ? ? F 14950 'interatomic distance' 
'X-RAY DIFFRACTION' 2 36 72 ? 0.10 0.05 ? ? G 14950 'interatomic distance' 
'X-RAY DIFFRACTION' 1 37 73 ? 0.11 0.05 ? ? F 14583 'interatomic distance' 
'X-RAY DIFFRACTION' 2 37 74 ? 0.11 0.05 ? ? H 14583 'interatomic distance' 
'X-RAY DIFFRACTION' 1 38 75 ? 0.11 0.05 ? ? F 14469 'interatomic distance' 
'X-RAY DIFFRACTION' 2 38 76 ? 0.11 0.05 ? ? I 14469 'interatomic distance' 
'X-RAY DIFFRACTION' 1 39 77 ? 0.10 0.05 ? ? F 14838 'interatomic distance' 
'X-RAY DIFFRACTION' 2 39 78 ? 0.10 0.05 ? ? J 14838 'interatomic distance' 
'X-RAY DIFFRACTION' 1 40 79 ? 0.11 0.05 ? ? G 14733 'interatomic distance' 
'X-RAY DIFFRACTION' 2 40 80 ? 0.11 0.05 ? ? H 14733 'interatomic distance' 
'X-RAY DIFFRACTION' 1 41 81 ? 0.11 0.05 ? ? G 14492 'interatomic distance' 
'X-RAY DIFFRACTION' 2 41 82 ? 0.11 0.05 ? ? I 14492 'interatomic distance' 
'X-RAY DIFFRACTION' 1 42 83 ? 0.10 0.05 ? ? G 14970 'interatomic distance' 
'X-RAY DIFFRACTION' 2 42 84 ? 0.10 0.05 ? ? J 14970 'interatomic distance' 
'X-RAY DIFFRACTION' 1 43 85 ? 0.12 0.05 ? ? H 14423 'interatomic distance' 
'X-RAY DIFFRACTION' 2 43 86 ? 0.12 0.05 ? ? I 14423 'interatomic distance' 
'X-RAY DIFFRACTION' 1 44 87 ? 0.11 0.05 ? ? H 14773 'interatomic distance' 
'X-RAY DIFFRACTION' 2 44 88 ? 0.11 0.05 ? ? J 14773 'interatomic distance' 
'X-RAY DIFFRACTION' 1 45 89 ? 0.11 0.05 ? ? I 14557 'interatomic distance' 
'X-RAY DIFFRACTION' 2 45 90 ? 0.11 0.05 ? ? J 14557 'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             377 
_refine_ls_shell.number_reflns_R_work             6540 
_refine_ls_shell.percent_reflns_obs               81.54 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.329 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.270 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1  
2 B 1  
1 A 2  
2 C 2  
1 A 3  
2 D 3  
1 A 4  
2 E 4  
1 A 5  
2 F 5  
1 A 6  
2 G 6  
1 A 7  
2 H 7  
1 A 8  
2 I 8  
1 A 9  
2 J 9  
1 B 10 
2 C 10 
1 B 11 
2 D 11 
1 B 12 
2 E 12 
1 B 13 
2 F 13 
1 B 14 
2 G 14 
1 B 15 
2 H 15 
1 B 16 
2 I 16 
1 B 17 
2 J 17 
1 C 18 
2 D 18 
1 C 19 
2 E 19 
1 C 20 
2 F 20 
1 C 21 
2 G 21 
1 C 22 
2 H 22 
1 C 23 
2 I 23 
1 C 24 
2 J 24 
1 D 25 
2 E 25 
1 D 26 
2 F 26 
1 D 27 
2 G 27 
1 D 28 
2 H 28 
1 D 29 
2 I 29 
1 D 30 
2 J 30 
1 E 31 
2 F 31 
1 E 32 
2 G 32 
1 E 33 
2 H 33 
1 E 34 
2 I 34 
1 E 35 
2 J 35 
1 F 36 
2 G 36 
1 F 37 
2 H 37 
1 F 38 
2 I 38 
1 F 39 
2 J 39 
1 G 40 
2 H 40 
1 G 41 
2 I 41 
1 G 42 
2 J 42 
1 H 43 
2 I 43 
1 H 44 
2 J 44 
1 I 45 
2 J 45 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 18 A 367 0 0 ? ? ? ? ? ? ? ? 1  ? 
2 B 18 B 367 0 0 ? ? ? ? ? ? ? ? 1  ? 
1 A 19 A 366 0 0 ? ? ? ? ? ? ? ? 2  ? 
2 C 19 C 366 0 0 ? ? ? ? ? ? ? ? 2  ? 
1 A 18 A 367 0 0 ? ? ? ? ? ? ? ? 3  ? 
2 D 18 D 367 0 0 ? ? ? ? ? ? ? ? 3  ? 
1 A 19 A 366 0 0 ? ? ? ? ? ? ? ? 4  ? 
2 E 19 E 366 0 0 ? ? ? ? ? ? ? ? 4  ? 
1 A 19 A 366 0 0 ? ? ? ? ? ? ? ? 5  ? 
2 F 19 F 366 0 0 ? ? ? ? ? ? ? ? 5  ? 
1 A 19 A 366 0 0 ? ? ? ? ? ? ? ? 6  ? 
2 G 19 G 366 0 0 ? ? ? ? ? ? ? ? 6  ? 
1 A 19 A 365 0 0 ? ? ? ? ? ? ? ? 7  ? 
2 H 19 H 365 0 0 ? ? ? ? ? ? ? ? 7  ? 
1 A 19 A 367 0 0 ? ? ? ? ? ? ? ? 8  ? 
2 I 19 I 367 0 0 ? ? ? ? ? ? ? ? 8  ? 
1 A 19 A 366 0 0 ? ? ? ? ? ? ? ? 9  ? 
2 J 19 J 366 0 0 ? ? ? ? ? ? ? ? 9  ? 
1 B 19 B 367 0 0 ? ? ? ? ? ? ? ? 10 ? 
2 C 19 C 367 0 0 ? ? ? ? ? ? ? ? 10 ? 
1 B 18 B 367 0 0 ? ? ? ? ? ? ? ? 11 ? 
2 D 18 D 367 0 0 ? ? ? ? ? ? ? ? 11 ? 
1 B 19 B 365 0 0 ? ? ? ? ? ? ? ? 12 ? 
2 E 19 E 365 0 0 ? ? ? ? ? ? ? ? 12 ? 
1 B 19 B 367 0 0 ? ? ? ? ? ? ? ? 13 ? 
2 F 19 F 367 0 0 ? ? ? ? ? ? ? ? 13 ? 
1 B 19 B 367 0 0 ? ? ? ? ? ? ? ? 14 ? 
2 G 19 G 367 0 0 ? ? ? ? ? ? ? ? 14 ? 
1 B 19 B 366 0 0 ? ? ? ? ? ? ? ? 15 ? 
2 H 19 H 366 0 0 ? ? ? ? ? ? ? ? 15 ? 
1 B 19 B 366 0 0 ? ? ? ? ? ? ? ? 16 ? 
2 I 19 I 366 0 0 ? ? ? ? ? ? ? ? 16 ? 
1 B 19 B 367 0 0 ? ? ? ? ? ? ? ? 17 ? 
2 J 19 J 367 0 0 ? ? ? ? ? ? ? ? 17 ? 
1 C 19 C 366 0 0 ? ? ? ? ? ? ? ? 18 ? 
2 D 19 D 366 0 0 ? ? ? ? ? ? ? ? 18 ? 
1 C 19 C 366 0 0 ? ? ? ? ? ? ? ? 19 ? 
2 E 19 E 366 0 0 ? ? ? ? ? ? ? ? 19 ? 
1 C 19 C 367 0 0 ? ? ? ? ? ? ? ? 20 ? 
2 F 19 F 367 0 0 ? ? ? ? ? ? ? ? 20 ? 
1 C 19 C 367 0 0 ? ? ? ? ? ? ? ? 21 ? 
2 G 19 G 367 0 0 ? ? ? ? ? ? ? ? 21 ? 
1 C 19 C 365 0 0 ? ? ? ? ? ? ? ? 22 ? 
2 H 19 H 365 0 0 ? ? ? ? ? ? ? ? 22 ? 
1 C 19 C 367 0 0 ? ? ? ? ? ? ? ? 23 ? 
2 I 19 I 367 0 0 ? ? ? ? ? ? ? ? 23 ? 
1 C 19 C 367 0 0 ? ? ? ? ? ? ? ? 24 ? 
2 J 19 J 367 0 0 ? ? ? ? ? ? ? ? 24 ? 
1 D 19 D 366 0 0 ? ? ? ? ? ? ? ? 25 ? 
2 E 19 E 366 0 0 ? ? ? ? ? ? ? ? 25 ? 
1 D 19 D 366 0 0 ? ? ? ? ? ? ? ? 26 ? 
2 F 19 F 366 0 0 ? ? ? ? ? ? ? ? 26 ? 
1 D 19 D 366 0 0 ? ? ? ? ? ? ? ? 27 ? 
2 G 19 G 366 0 0 ? ? ? ? ? ? ? ? 27 ? 
1 D 19 D 365 0 0 ? ? ? ? ? ? ? ? 28 ? 
2 H 19 H 365 0 0 ? ? ? ? ? ? ? ? 28 ? 
1 D 19 D 367 0 0 ? ? ? ? ? ? ? ? 29 ? 
2 I 19 I 367 0 0 ? ? ? ? ? ? ? ? 29 ? 
1 D 19 D 366 0 0 ? ? ? ? ? ? ? ? 30 ? 
2 J 19 J 366 0 0 ? ? ? ? ? ? ? ? 30 ? 
1 E 19 E 366 0 0 ? ? ? ? ? ? ? ? 31 ? 
2 F 19 F 366 0 0 ? ? ? ? ? ? ? ? 31 ? 
1 E 19 E 366 0 0 ? ? ? ? ? ? ? ? 32 ? 
2 G 19 G 366 0 0 ? ? ? ? ? ? ? ? 32 ? 
1 E 19 E 366 0 0 ? ? ? ? ? ? ? ? 33 ? 
2 H 19 H 366 0 0 ? ? ? ? ? ? ? ? 33 ? 
1 E 19 E 365 0 0 ? ? ? ? ? ? ? ? 34 ? 
2 I 19 I 365 0 0 ? ? ? ? ? ? ? ? 34 ? 
1 E 19 E 366 0 0 ? ? ? ? ? ? ? ? 35 ? 
2 J 19 J 366 0 0 ? ? ? ? ? ? ? ? 35 ? 
1 F 19 F 367 0 0 ? ? ? ? ? ? ? ? 36 ? 
2 G 19 G 367 0 0 ? ? ? ? ? ? ? ? 36 ? 
1 F 19 F 365 0 0 ? ? ? ? ? ? ? ? 37 ? 
2 H 19 H 365 0 0 ? ? ? ? ? ? ? ? 37 ? 
1 F 19 F 367 0 0 ? ? ? ? ? ? ? ? 38 ? 
2 I 19 I 367 0 0 ? ? ? ? ? ? ? ? 38 ? 
1 F 19 F 367 0 0 ? ? ? ? ? ? ? ? 39 ? 
2 J 19 J 367 0 0 ? ? ? ? ? ? ? ? 39 ? 
1 G 19 G 365 0 0 ? ? ? ? ? ? ? ? 40 ? 
2 H 19 H 365 0 0 ? ? ? ? ? ? ? ? 40 ? 
1 G 19 G 367 0 0 ? ? ? ? ? ? ? ? 41 ? 
2 I 19 I 367 0 0 ? ? ? ? ? ? ? ? 41 ? 
1 G 19 G 367 0 0 ? ? ? ? ? ? ? ? 42 ? 
2 J 19 J 367 0 0 ? ? ? ? ? ? ? ? 42 ? 
1 H 19 H 366 0 0 ? ? ? ? ? ? ? ? 43 ? 
2 I 19 I 366 0 0 ? ? ? ? ? ? ? ? 43 ? 
1 H 19 H 365 0 0 ? ? ? ? ? ? ? ? 44 ? 
2 J 19 J 365 0 0 ? ? ? ? ? ? ? ? 44 ? 
1 I 19 I 367 0 0 ? ? ? ? ? ? ? ? 45 ? 
2 J 19 J 367 0 0 ? ? ? ? ? ? ? ? 45 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
16 ? 
17 ? 
18 ? 
19 ? 
20 ? 
21 ? 
22 ? 
23 ? 
24 ? 
25 ? 
26 ? 
27 ? 
28 ? 
29 ? 
30 ? 
31 ? 
32 ? 
33 ? 
34 ? 
35 ? 
36 ? 
37 ? 
38 ? 
39 ? 
40 ? 
41 ? 
42 ? 
43 ? 
44 ? 
45 ? 
# 
_struct.entry_id                     5LK5 
_struct.title                        'Crystal structure of the globular domain of human calreticulin mutant D71K' 
_struct.pdbx_descriptor              Calreticulin,Calreticulin 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LK5 
_struct_keywords.text            'calcium-binding protein' 
_struct_keywords.pdbx_keywords   'calcium-binding protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 20  ? SER A 26  ? ASP A 29  SER A 35  5 ? 7  
HELX_P HELX_P2  AA2 ASP A 109 ? MET A 113 ? ASP A 118 MET A 122 5 ? 5  
HELX_P HELX_P3  AA3 LEU A 187 ? TRP A 191 ? LEU A 196 TRP A 200 1 ? 5  
HELX_P HELX_P4  AA4 ASP A 232 ? THR A 243 ? ASP A 335 THR A 346 1 ? 12 
HELX_P HELX_P5  AA5 THR A 243 ? LEU A 264 ? THR A 346 LEU A 367 1 ? 22 
HELX_P HELX_P6  AA6 ASP B 20  ? SER B 26  ? ASP B 29  SER B 35  5 ? 7  
HELX_P HELX_P7  AA7 ASP B 109 ? MET B 113 ? ASP B 118 MET B 122 5 ? 5  
HELX_P HELX_P8  AA8 LEU B 187 ? TRP B 191 ? LEU B 196 TRP B 200 1 ? 5  
HELX_P HELX_P9  AA9 ASP B 232 ? THR B 243 ? ASP B 335 THR B 346 1 ? 12 
HELX_P HELX_P10 AB1 THR B 243 ? LEU B 264 ? THR B 346 LEU B 367 1 ? 22 
HELX_P HELX_P11 AB2 ASP C 20  ? SER C 26  ? ASP C 29  SER C 35  5 ? 7  
HELX_P HELX_P12 AB3 ASP C 109 ? MET C 113 ? ASP C 118 MET C 122 5 ? 5  
HELX_P HELX_P13 AB4 LEU C 187 ? TRP C 191 ? LEU C 196 TRP C 200 1 ? 5  
HELX_P HELX_P14 AB5 ASP C 232 ? THR C 243 ? ASP C 335 THR C 346 1 ? 12 
HELX_P HELX_P15 AB6 THR C 243 ? LEU C 264 ? THR C 346 LEU C 367 1 ? 22 
HELX_P HELX_P16 AB7 ASP D 20  ? SER D 26  ? ASP D 29  SER D 35  5 ? 7  
HELX_P HELX_P17 AB8 ASP D 109 ? MET D 113 ? ASP D 118 MET D 122 5 ? 5  
HELX_P HELX_P18 AB9 LEU D 187 ? TRP D 191 ? LEU D 196 TRP D 200 1 ? 5  
HELX_P HELX_P19 AC1 ASP D 232 ? THR D 243 ? ASP D 335 THR D 346 1 ? 12 
HELX_P HELX_P20 AC2 THR D 243 ? LEU D 264 ? THR D 346 LEU D 367 1 ? 22 
HELX_P HELX_P21 AC3 ASP E 20  ? SER E 26  ? ASP E 29  SER E 35  5 ? 7  
HELX_P HELX_P22 AC4 ASP E 109 ? MET E 113 ? ASP E 118 MET E 122 5 ? 5  
HELX_P HELX_P23 AC5 LEU E 187 ? TRP E 191 ? LEU E 196 TRP E 200 1 ? 5  
HELX_P HELX_P24 AC6 ASP E 232 ? THR E 243 ? ASP E 335 THR E 346 1 ? 12 
HELX_P HELX_P25 AC7 THR E 243 ? ARG E 263 ? THR E 346 ARG E 366 1 ? 21 
HELX_P HELX_P26 AC8 ASP F 20  ? SER F 26  ? ASP F 29  SER F 35  5 ? 7  
HELX_P HELX_P27 AC9 ASP F 109 ? MET F 113 ? ASP F 118 MET F 122 5 ? 5  
HELX_P HELX_P28 AD1 LEU F 187 ? TRP F 191 ? LEU F 196 TRP F 200 1 ? 5  
HELX_P HELX_P29 AD2 ASP F 232 ? THR F 243 ? ASP F 335 THR F 346 1 ? 12 
HELX_P HELX_P30 AD3 THR F 243 ? LEU F 264 ? THR F 346 LEU F 367 1 ? 22 
HELX_P HELX_P31 AD4 ASP G 20  ? SER G 26  ? ASP G 29  SER G 35  5 ? 7  
HELX_P HELX_P32 AD5 ASP G 109 ? MET G 113 ? ASP G 118 MET G 122 5 ? 5  
HELX_P HELX_P33 AD6 LEU G 187 ? TRP G 191 ? LEU G 196 TRP G 200 1 ? 5  
HELX_P HELX_P34 AD7 ASP G 232 ? THR G 243 ? ASP G 335 THR G 346 1 ? 12 
HELX_P HELX_P35 AD8 THR G 243 ? LEU G 264 ? THR G 346 LEU G 367 1 ? 22 
HELX_P HELX_P36 AD9 ASP H 20  ? SER H 26  ? ASP H 29  SER H 35  5 ? 7  
HELX_P HELX_P37 AE1 ASP H 109 ? MET H 113 ? ASP H 118 MET H 122 5 ? 5  
HELX_P HELX_P38 AE2 LEU H 187 ? TRP H 191 ? LEU H 196 TRP H 200 1 ? 5  
HELX_P HELX_P39 AE3 ASP H 232 ? THR H 243 ? ASP H 335 THR H 346 1 ? 12 
HELX_P HELX_P40 AE4 THR H 243 ? ARG H 263 ? THR H 346 ARG H 366 1 ? 21 
HELX_P HELX_P41 AE5 ASP I 20  ? SER I 26  ? ASP I 29  SER I 35  5 ? 7  
HELX_P HELX_P42 AE6 ASP I 109 ? MET I 113 ? ASP I 118 MET I 122 5 ? 5  
HELX_P HELX_P43 AE7 LEU I 187 ? TRP I 191 ? LEU I 196 TRP I 200 1 ? 5  
HELX_P HELX_P44 AE8 ASP I 232 ? THR I 243 ? ASP I 335 THR I 346 1 ? 12 
HELX_P HELX_P45 AE9 THR I 243 ? LEU I 264 ? THR I 346 LEU I 367 1 ? 22 
HELX_P HELX_P46 AF1 ASP J 20  ? SER J 26  ? ASP J 29  SER J 35  5 ? 7  
HELX_P HELX_P47 AF2 ASP J 109 ? MET J 113 ? ASP J 118 MET J 122 5 ? 5  
HELX_P HELX_P48 AF3 LEU J 187 ? TRP J 191 ? LEU J 196 TRP J 200 1 ? 5  
HELX_P HELX_P49 AF4 ASP J 232 ? THR J 243 ? ASP J 335 THR J 346 1 ? 12 
HELX_P HELX_P50 AF5 THR J 243 ? LEU J 264 ? THR J 346 LEU J 367 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 96  SG  ? ? ? 1_555 A  CYS 128 SG ? ? A CYS 105 A CYS 137 1_555 ? ? ? ? ? ? ? 2.159 ? 
disulf2  disulf ? ? B CYS 96  SG  ? ? ? 1_555 B  CYS 128 SG ? ? B CYS 105 B CYS 137 1_555 ? ? ? ? ? ? ? 2.151 ? 
disulf3  disulf ? ? C CYS 96  SG  ? ? ? 1_555 C  CYS 128 SG ? ? C CYS 105 C CYS 137 1_555 ? ? ? ? ? ? ? 2.175 ? 
disulf4  disulf ? ? D CYS 96  SG  ? ? ? 1_555 D  CYS 128 SG ? ? D CYS 105 D CYS 137 1_555 ? ? ? ? ? ? ? 2.163 ? 
disulf5  disulf ? ? E CYS 96  SG  ? ? ? 1_555 E  CYS 128 SG ? ? E CYS 105 E CYS 137 1_555 ? ? ? ? ? ? ? 2.164 ? 
disulf6  disulf ? ? F CYS 96  SG  ? ? ? 1_555 F  CYS 128 SG ? ? F CYS 105 F CYS 137 1_555 ? ? ? ? ? ? ? 2.178 ? 
disulf7  disulf ? ? G CYS 96  SG  ? ? ? 1_555 G  CYS 128 SG ? ? G CYS 105 G CYS 137 1_555 ? ? ? ? ? ? ? 2.169 ? 
disulf8  disulf ? ? H CYS 96  SG  ? ? ? 1_555 H  CYS 128 SG ? ? H CYS 105 H CYS 137 1_555 ? ? ? ? ? ? ? 2.136 ? 
disulf9  disulf ? ? I CYS 96  SG  ? ? ? 1_555 I  CYS 128 SG ? ? I CYS 105 I CYS 137 1_555 ? ? ? ? ? ? ? 2.156 ? 
disulf10 disulf ? ? J CYS 96  SG  ? ? ? 1_555 J  CYS 128 SG ? ? J CYS 105 J CYS 137 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc1  metalc ? ? A GLN 17  O   ? ? ? 1_555 K  CA  .   CA ? ? A GLN 26  A CA  500 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc2  metalc ? ? A LYS 53  O   ? ? ? 1_555 K  CA  .   CA ? ? A LYS 62  A CA  500 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc3  metalc ? ? A LYS 55  O   ? ? ? 1_555 K  CA  .   CA ? ? A LYS 64  A CA  500 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc4  metalc ? ? A ASP 225 OD1 ? ? ? 1_555 K  CA  .   CA ? ? A ASP 328 A CA  500 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc5  metalc ? ? A ASP 225 OD2 ? ? ? 1_555 K  CA  .   CA ? ? A ASP 328 A CA  500 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc6  metalc ? ? B GLN 17  O   ? ? ? 1_555 L  CA  .   CA ? ? B GLN 26  B CA  500 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc7  metalc ? ? B LYS 53  O   ? ? ? 1_555 L  CA  .   CA ? ? B LYS 62  B CA  500 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc8  metalc ? ? B LYS 55  O   ? ? ? 1_555 L  CA  .   CA ? ? B LYS 64  B CA  500 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc9  metalc ? ? B ASP 225 OD1 ? ? ? 1_555 L  CA  .   CA ? ? B ASP 328 B CA  500 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc10 metalc ? ? B ASP 225 OD2 ? ? ? 1_555 L  CA  .   CA ? ? B ASP 328 B CA  500 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc11 metalc ? ? C GLN 17  O   ? ? ? 1_555 M  CA  .   CA ? ? C GLN 26  C CA  500 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc12 metalc ? ? C LYS 53  O   ? ? ? 1_555 M  CA  .   CA ? ? C LYS 62  C CA  500 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc13 metalc ? ? C LYS 55  O   ? ? ? 1_555 M  CA  .   CA ? ? C LYS 64  C CA  500 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc14 metalc ? ? C ASP 225 OD1 ? ? ? 1_555 M  CA  .   CA ? ? C ASP 328 C CA  500 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc15 metalc ? ? C ASP 225 OD2 ? ? ? 1_555 M  CA  .   CA ? ? C ASP 328 C CA  500 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc16 metalc ? ? D GLN 17  O   ? ? ? 1_555 N  CA  .   CA ? ? D GLN 26  D CA  500 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc17 metalc ? ? D LYS 53  O   ? ? ? 1_555 N  CA  .   CA ? ? D LYS 62  D CA  500 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc18 metalc ? ? D LYS 55  O   ? ? ? 1_555 N  CA  .   CA ? ? D LYS 64  D CA  500 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc19 metalc ? ? D ASP 225 OD1 ? ? ? 1_555 N  CA  .   CA ? ? D ASP 328 D CA  500 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc20 metalc ? ? D ASP 225 OD2 ? ? ? 1_555 N  CA  .   CA ? ? D ASP 328 D CA  500 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc21 metalc ? ? E GLN 17  O   ? ? ? 1_555 O  CA  .   CA ? ? E GLN 26  E CA  401 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc22 metalc ? ? E LYS 53  O   ? ? ? 1_555 O  CA  .   CA ? ? E LYS 62  E CA  401 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc23 metalc ? ? E LYS 55  O   ? ? ? 1_555 O  CA  .   CA ? ? E LYS 64  E CA  401 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc24 metalc ? ? E ASP 225 OD1 ? ? ? 1_555 O  CA  .   CA ? ? E ASP 328 E CA  401 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc25 metalc ? ? E ASP 225 OD2 ? ? ? 1_555 O  CA  .   CA ? ? E ASP 328 E CA  401 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc26 metalc ? ? F GLN 17  O   ? ? ? 1_555 Q  CA  .   CA ? ? F GLN 26  F CA  500 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc27 metalc ? ? F LYS 53  O   ? ? ? 1_555 Q  CA  .   CA ? ? F LYS 62  F CA  500 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc28 metalc ? ? F LYS 55  O   ? ? ? 1_555 Q  CA  .   CA ? ? F LYS 64  F CA  500 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc29 metalc ? ? F ASP 225 OD1 ? ? ? 1_555 Q  CA  .   CA ? ? F ASP 328 F CA  500 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc30 metalc ? ? F ASP 225 OD2 ? ? ? 1_555 Q  CA  .   CA ? ? F ASP 328 F CA  500 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc31 metalc ? ? G GLN 17  O   ? ? ? 1_555 R  CA  .   CA ? ? G GLN 26  G CA  401 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc32 metalc ? ? G LYS 53  O   ? ? ? 1_555 R  CA  .   CA ? ? G LYS 62  G CA  401 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc33 metalc ? ? G LYS 55  O   ? ? ? 1_555 R  CA  .   CA ? ? G LYS 64  G CA  401 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc34 metalc ? ? G ASP 225 OD1 ? ? ? 1_555 R  CA  .   CA ? ? G ASP 328 G CA  401 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc35 metalc ? ? G ASP 225 OD2 ? ? ? 1_555 R  CA  .   CA ? ? G ASP 328 G CA  401 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc36 metalc ? ? H GLN 17  O   ? ? ? 1_555 S  CA  .   CA ? ? H GLN 26  H CA  500 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc37 metalc ? ? H LYS 53  O   ? ? ? 1_555 S  CA  .   CA ? ? H LYS 62  H CA  500 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc38 metalc ? ? H LYS 55  O   ? ? ? 1_555 S  CA  .   CA ? ? H LYS 64  H CA  500 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc39 metalc ? ? H ASP 225 OD1 ? ? ? 1_555 S  CA  .   CA ? ? H ASP 328 H CA  500 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc40 metalc ? ? H ASP 225 OD2 ? ? ? 1_555 S  CA  .   CA ? ? H ASP 328 H CA  500 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc41 metalc ? ? I GLN 17  O   ? ? ? 1_555 T  CA  .   CA ? ? I GLN 26  I CA  500 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc42 metalc ? ? I LYS 53  O   ? ? ? 1_555 T  CA  .   CA ? ? I LYS 62  I CA  500 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc43 metalc ? ? I LYS 55  O   ? ? ? 1_555 T  CA  .   CA ? ? I LYS 64  I CA  500 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc44 metalc ? ? I ASP 225 OD1 ? ? ? 1_555 T  CA  .   CA ? ? I ASP 328 I CA  500 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc45 metalc ? ? I ASP 225 OD2 ? ? ? 1_555 T  CA  .   CA ? ? I ASP 328 I CA  500 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc46 metalc ? ? J GLN 17  O   ? ? ? 1_555 U  CA  .   CA ? ? J GLN 26  J CA  500 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc47 metalc ? ? J LYS 53  O   ? ? ? 1_555 U  CA  .   CA ? ? J LYS 62  J CA  500 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc48 metalc ? ? J LYS 55  O   ? ? ? 1_555 U  CA  .   CA ? ? J LYS 64  J CA  500 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc49 metalc ? ? J ASP 225 OD1 ? ? ? 1_555 U  CA  .   CA ? ? J ASP 328 J CA  500 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc50 metalc ? ? J ASP 225 OD2 ? ? ? 1_555 U  CA  .   CA ? ? J ASP 328 J CA  500 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc51 metalc ? ? K CA  .   CA  ? ? ? 1_555 V  HOH .   O  ? ? A CA  500 A HOH 636 1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc52 metalc ? ? K CA  .   CA  ? ? ? 1_555 V  HOH .   O  ? ? A CA  500 A HOH 618 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc53 metalc ? ? L CA  .   CA  ? ? ? 1_555 W  HOH .   O  ? ? B CA  500 B HOH 609 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc54 metalc ? ? L CA  .   CA  ? ? ? 1_555 W  HOH .   O  ? ? B CA  500 B HOH 629 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc55 metalc ? ? M CA  .   CA  ? ? ? 1_555 X  HOH .   O  ? ? C CA  500 C HOH 630 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc56 metalc ? ? M CA  .   CA  ? ? ? 1_555 X  HOH .   O  ? ? C CA  500 C HOH 621 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc57 metalc ? ? N CA  .   CA  ? ? ? 1_555 Y  HOH .   O  ? ? D CA  500 D HOH 636 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc58 metalc ? ? N CA  .   CA  ? ? ? 1_555 Y  HOH .   O  ? ? D CA  500 D HOH 647 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc59 metalc ? ? O CA  .   CA  ? ? ? 1_555 Z  HOH .   O  ? ? E CA  401 E HOH 529 1_555 ? ? ? ? ? ? ? 2.524 ? 
metalc60 metalc ? ? O CA  .   CA  ? ? ? 1_555 Z  HOH .   O  ? ? E CA  401 E HOH 533 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc61 metalc ? ? Q CA  .   CA  ? ? ? 1_555 AA HOH .   O  ? ? F CA  500 F HOH 634 1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc62 metalc ? ? Q CA  .   CA  ? ? ? 1_555 AA HOH .   O  ? ? F CA  500 F HOH 648 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc63 metalc ? ? R CA  .   CA  ? ? ? 1_555 BA HOH .   O  ? ? G CA  401 G HOH 524 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc64 metalc ? ? R CA  .   CA  ? ? ? 1_555 BA HOH .   O  ? ? G CA  401 G HOH 518 1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc65 metalc ? ? S CA  .   CA  ? ? ? 1_555 CA HOH .   O  ? ? H CA  500 H HOH 628 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc66 metalc ? ? S CA  .   CA  ? ? ? 1_555 CA HOH .   O  ? ? H CA  500 H HOH 630 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc67 metalc ? ? T CA  .   CA  ? ? ? 1_555 DA HOH .   O  ? ? I CA  500 I HOH 634 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc68 metalc ? ? T CA  .   CA  ? ? ? 1_555 DA HOH .   O  ? ? I CA  500 I HOH 637 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc69 metalc ? ? U CA  .   CA  ? ? ? 1_555 EA HOH .   O  ? ? J CA  500 J HOH 639 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc70 metalc ? ? U CA  .   CA  ? ? ? 1_555 EA HOH .   O  ? ? J CA  500 J HOH 636 1_555 ? ? ? ? ? ? ? 2.365 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 197 G . ? SER 206 G GLY 198 G ? GLY 207 G 1 -12.85 
2 SER 197 J . ? SER 206 J GLY 198 J ? GLY 207 J 1 -8.37  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 7 ? 
AA4 ? 7 ? 
AA5 ? 4 ? 
AA6 ? 6 ? 
AA7 ? 7 ? 
AA8 ? 7 ? 
AA9 ? 4 ? 
AB1 ? 6 ? 
AB2 ? 7 ? 
AB3 ? 7 ? 
AB4 ? 4 ? 
AB5 ? 6 ? 
AB6 ? 7 ? 
AB7 ? 7 ? 
AB8 ? 4 ? 
AB9 ? 6 ? 
AC1 ? 7 ? 
AC2 ? 7 ? 
AC3 ? 4 ? 
AC4 ? 6 ? 
AC5 ? 7 ? 
AC6 ? 7 ? 
AC7 ? 4 ? 
AC8 ? 6 ? 
AC9 ? 7 ? 
AD1 ? 7 ? 
AD2 ? 4 ? 
AD3 ? 6 ? 
AD4 ? 7 ? 
AD5 ? 7 ? 
AD6 ? 4 ? 
AD7 ? 6 ? 
AD8 ? 7 ? 
AD9 ? 7 ? 
AE1 ? 4 ? 
AE2 ? 6 ? 
AE3 ? 7 ? 
AE4 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA7 6 7 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA8 6 7 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB3 6 7 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB6 6 7 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB7 5 6 ? anti-parallel 
AB7 6 7 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC1 6 7 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC2 5 6 ? anti-parallel 
AC2 6 7 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC4 5 6 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC5 5 6 ? anti-parallel 
AC5 6 7 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC6 5 6 ? anti-parallel 
AC6 6 7 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC8 5 6 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AC9 5 6 ? anti-parallel 
AC9 6 7 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? anti-parallel 
AD1 6 7 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD3 5 6 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? anti-parallel 
AD4 5 6 ? anti-parallel 
AD4 6 7 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD5 4 5 ? anti-parallel 
AD5 5 6 ? anti-parallel 
AD5 6 7 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD7 5 6 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD8 4 5 ? anti-parallel 
AD8 5 6 ? anti-parallel 
AD8 6 7 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AD9 4 5 ? anti-parallel 
AD9 5 6 ? anti-parallel 
AD9 6 7 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE2 4 5 ? anti-parallel 
AE2 5 6 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE3 4 5 ? anti-parallel 
AE3 5 6 ? anti-parallel 
AE3 6 7 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE4 4 5 ? anti-parallel 
AE4 5 6 ? anti-parallel 
AE4 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 12  ? GLU A 16  ? VAL A 21  GLU A 25  
AA1 2 THR A 222 ? THR A 230 ? THR A 325 THR A 333 
AA1 3 GLY A 56  ? THR A 59  ? GLY A 65  THR A 68  
AA1 4 PHE A 40  ? SER A 43  ? PHE A 49  SER A 52  
AA2 1 VAL A 12  ? GLU A 16  ? VAL A 21  GLU A 25  
AA2 2 THR A 222 ? THR A 230 ? THR A 325 THR A 333 
AA2 3 LEU A 82  ? HIS A 90  ? LEU A 91  HIS A 99  
AA2 4 THR A 160 ? VAL A 167 ? THR A 169 VAL A 176 
AA2 5 THR A 172 ? ILE A 177 ? THR A 181 ILE A 186 
AA2 6 SER A 180 ? SER A 186 ? SER A 189 SER A 195 
AA3 1 TRP A 28  ? GLU A 30  ? TRP A 37  GLU A 39  
AA3 2 ARG A 64  ? PHE A 75  ? ARG A 73  PHE A 84  
AA3 3 PHE A 208 ? GLN A 217 ? PHE A 311 GLN A 320 
AA3 4 CYS A 96  ? GLY A 98  ? CYS A 105 GLY A 107 
AA3 5 ILE A 121 ? CYS A 128 ? ILE A 130 CYS A 137 
AA3 6 THR A 132 ? TYR A 141 ? THR A 141 TYR A 150 
AA3 7 LYS A 144 ? LEU A 147 ? LYS A 153 LEU A 156 
AA4 1 TRP A 28  ? GLU A 30  ? TRP A 37  GLU A 39  
AA4 2 ARG A 64  ? PHE A 75  ? ARG A 73  PHE A 84  
AA4 3 PHE A 208 ? GLN A 217 ? PHE A 311 GLN A 320 
AA4 4 VAL A 101 ? PHE A 104 ? VAL A 110 PHE A 113 
AA4 5 ILE A 121 ? CYS A 128 ? ILE A 130 CYS A 137 
AA4 6 THR A 132 ? TYR A 141 ? THR A 141 TYR A 150 
AA4 7 LYS A 144 ? LEU A 147 ? LYS A 153 LEU A 156 
AA5 1 VAL B 12  ? GLU B 16  ? VAL B 21  GLU B 25  
AA5 2 THR B 222 ? THR B 230 ? THR B 325 THR B 333 
AA5 3 GLY B 56  ? THR B 59  ? GLY B 65  THR B 68  
AA5 4 PHE B 40  ? SER B 43  ? PHE B 49  SER B 52  
AA6 1 VAL B 12  ? GLU B 16  ? VAL B 21  GLU B 25  
AA6 2 THR B 222 ? THR B 230 ? THR B 325 THR B 333 
AA6 3 LEU B 82  ? HIS B 90  ? LEU B 91  HIS B 99  
AA6 4 THR B 160 ? VAL B 167 ? THR B 169 VAL B 176 
AA6 5 THR B 172 ? ILE B 177 ? THR B 181 ILE B 186 
AA6 6 SER B 180 ? SER B 186 ? SER B 189 SER B 195 
AA7 1 TRP B 28  ? GLU B 30  ? TRP B 37  GLU B 39  
AA7 2 ARG B 64  ? PHE B 75  ? ARG B 73  PHE B 84  
AA7 3 PHE B 208 ? GLN B 217 ? PHE B 311 GLN B 320 
AA7 4 CYS B 96  ? GLY B 98  ? CYS B 105 GLY B 107 
AA7 5 ILE B 121 ? CYS B 128 ? ILE B 130 CYS B 137 
AA7 6 THR B 132 ? TYR B 141 ? THR B 141 TYR B 150 
AA7 7 LYS B 144 ? LEU B 147 ? LYS B 153 LEU B 156 
AA8 1 TRP B 28  ? GLU B 30  ? TRP B 37  GLU B 39  
AA8 2 ARG B 64  ? PHE B 75  ? ARG B 73  PHE B 84  
AA8 3 PHE B 208 ? GLN B 217 ? PHE B 311 GLN B 320 
AA8 4 VAL B 101 ? PHE B 104 ? VAL B 110 PHE B 113 
AA8 5 ILE B 121 ? CYS B 128 ? ILE B 130 CYS B 137 
AA8 6 THR B 132 ? TYR B 141 ? THR B 141 TYR B 150 
AA8 7 LYS B 144 ? LEU B 147 ? LYS B 153 LEU B 156 
AA9 1 VAL C 12  ? GLU C 16  ? VAL C 21  GLU C 25  
AA9 2 THR C 222 ? THR C 230 ? THR C 325 THR C 333 
AA9 3 GLY C 56  ? THR C 59  ? GLY C 65  THR C 68  
AA9 4 PHE C 40  ? SER C 43  ? PHE C 49  SER C 52  
AB1 1 VAL C 12  ? GLU C 16  ? VAL C 21  GLU C 25  
AB1 2 THR C 222 ? THR C 230 ? THR C 325 THR C 333 
AB1 3 LEU C 82  ? HIS C 90  ? LEU C 91  HIS C 99  
AB1 4 THR C 160 ? VAL C 167 ? THR C 169 VAL C 176 
AB1 5 THR C 172 ? ILE C 177 ? THR C 181 ILE C 186 
AB1 6 SER C 180 ? SER C 186 ? SER C 189 SER C 195 
AB2 1 TRP C 28  ? GLU C 30  ? TRP C 37  GLU C 39  
AB2 2 ARG C 64  ? PHE C 75  ? ARG C 73  PHE C 84  
AB2 3 PHE C 208 ? GLN C 217 ? PHE C 311 GLN C 320 
AB2 4 CYS C 96  ? GLY C 98  ? CYS C 105 GLY C 107 
AB2 5 ILE C 121 ? CYS C 128 ? ILE C 130 CYS C 137 
AB2 6 THR C 132 ? TYR C 141 ? THR C 141 TYR C 150 
AB2 7 LYS C 144 ? LEU C 147 ? LYS C 153 LEU C 156 
AB3 1 TRP C 28  ? GLU C 30  ? TRP C 37  GLU C 39  
AB3 2 ARG C 64  ? PHE C 75  ? ARG C 73  PHE C 84  
AB3 3 PHE C 208 ? GLN C 217 ? PHE C 311 GLN C 320 
AB3 4 VAL C 101 ? PHE C 104 ? VAL C 110 PHE C 113 
AB3 5 ILE C 121 ? CYS C 128 ? ILE C 130 CYS C 137 
AB3 6 THR C 132 ? TYR C 141 ? THR C 141 TYR C 150 
AB3 7 LYS C 144 ? LEU C 147 ? LYS C 153 LEU C 156 
AB4 1 VAL D 12  ? GLU D 16  ? VAL D 21  GLU D 25  
AB4 2 THR D 222 ? THR D 230 ? THR D 325 THR D 333 
AB4 3 GLY D 56  ? THR D 59  ? GLY D 65  THR D 68  
AB4 4 PHE D 40  ? SER D 43  ? PHE D 49  SER D 52  
AB5 1 VAL D 12  ? GLU D 16  ? VAL D 21  GLU D 25  
AB5 2 THR D 222 ? THR D 230 ? THR D 325 THR D 333 
AB5 3 LEU D 82  ? HIS D 90  ? LEU D 91  HIS D 99  
AB5 4 THR D 160 ? VAL D 167 ? THR D 169 VAL D 176 
AB5 5 THR D 172 ? ILE D 177 ? THR D 181 ILE D 186 
AB5 6 SER D 180 ? SER D 186 ? SER D 189 SER D 195 
AB6 1 TRP D 28  ? GLU D 30  ? TRP D 37  GLU D 39  
AB6 2 ARG D 64  ? PHE D 75  ? ARG D 73  PHE D 84  
AB6 3 PHE D 208 ? GLN D 217 ? PHE D 311 GLN D 320 
AB6 4 CYS D 96  ? GLY D 98  ? CYS D 105 GLY D 107 
AB6 5 ILE D 121 ? CYS D 128 ? ILE D 130 CYS D 137 
AB6 6 THR D 132 ? TYR D 141 ? THR D 141 TYR D 150 
AB6 7 LYS D 144 ? LEU D 147 ? LYS D 153 LEU D 156 
AB7 1 TRP D 28  ? GLU D 30  ? TRP D 37  GLU D 39  
AB7 2 ARG D 64  ? PHE D 75  ? ARG D 73  PHE D 84  
AB7 3 PHE D 208 ? GLN D 217 ? PHE D 311 GLN D 320 
AB7 4 VAL D 101 ? PHE D 104 ? VAL D 110 PHE D 113 
AB7 5 ILE D 121 ? CYS D 128 ? ILE D 130 CYS D 137 
AB7 6 THR D 132 ? TYR D 141 ? THR D 141 TYR D 150 
AB7 7 LYS D 144 ? LEU D 147 ? LYS D 153 LEU D 156 
AB8 1 VAL E 12  ? GLU E 16  ? VAL E 21  GLU E 25  
AB8 2 THR E 222 ? THR E 230 ? THR E 325 THR E 333 
AB8 3 GLY E 56  ? THR E 59  ? GLY E 65  THR E 68  
AB8 4 PHE E 40  ? SER E 43  ? PHE E 49  SER E 52  
AB9 1 VAL E 12  ? GLU E 16  ? VAL E 21  GLU E 25  
AB9 2 THR E 222 ? THR E 230 ? THR E 325 THR E 333 
AB9 3 LEU E 82  ? HIS E 90  ? LEU E 91  HIS E 99  
AB9 4 THR E 160 ? VAL E 167 ? THR E 169 VAL E 176 
AB9 5 THR E 172 ? ILE E 177 ? THR E 181 ILE E 186 
AB9 6 SER E 180 ? SER E 186 ? SER E 189 SER E 195 
AC1 1 TRP E 28  ? GLU E 30  ? TRP E 37  GLU E 39  
AC1 2 ARG E 64  ? PHE E 75  ? ARG E 73  PHE E 84  
AC1 3 PHE E 208 ? GLN E 217 ? PHE E 311 GLN E 320 
AC1 4 CYS E 96  ? GLY E 98  ? CYS E 105 GLY E 107 
AC1 5 ILE E 121 ? CYS E 128 ? ILE E 130 CYS E 137 
AC1 6 THR E 132 ? TYR E 141 ? THR E 141 TYR E 150 
AC1 7 LYS E 144 ? LEU E 147 ? LYS E 153 LEU E 156 
AC2 1 TRP E 28  ? GLU E 30  ? TRP E 37  GLU E 39  
AC2 2 ARG E 64  ? PHE E 75  ? ARG E 73  PHE E 84  
AC2 3 PHE E 208 ? GLN E 217 ? PHE E 311 GLN E 320 
AC2 4 VAL E 101 ? PHE E 104 ? VAL E 110 PHE E 113 
AC2 5 ILE E 121 ? CYS E 128 ? ILE E 130 CYS E 137 
AC2 6 THR E 132 ? TYR E 141 ? THR E 141 TYR E 150 
AC2 7 LYS E 144 ? LEU E 147 ? LYS E 153 LEU E 156 
AC3 1 VAL F 12  ? GLU F 16  ? VAL F 21  GLU F 25  
AC3 2 ILE F 223 ? THR F 230 ? ILE F 326 THR F 333 
AC3 3 GLY F 56  ? THR F 59  ? GLY F 65  THR F 68  
AC3 4 PHE F 40  ? SER F 43  ? PHE F 49  SER F 52  
AC4 1 VAL F 12  ? GLU F 16  ? VAL F 21  GLU F 25  
AC4 2 ILE F 223 ? THR F 230 ? ILE F 326 THR F 333 
AC4 3 LEU F 82  ? LYS F 89  ? LEU F 91  LYS F 98  
AC4 4 THR F 160 ? VAL F 167 ? THR F 169 VAL F 176 
AC4 5 THR F 172 ? ILE F 177 ? THR F 181 ILE F 186 
AC4 6 SER F 180 ? SER F 186 ? SER F 189 SER F 195 
AC5 1 TRP F 28  ? GLU F 30  ? TRP F 37  GLU F 39  
AC5 2 ARG F 64  ? PHE F 75  ? ARG F 73  PHE F 84  
AC5 3 PHE F 208 ? GLN F 217 ? PHE F 311 GLN F 320 
AC5 4 CYS F 96  ? GLY F 98  ? CYS F 105 GLY F 107 
AC5 5 ILE F 121 ? CYS F 128 ? ILE F 130 CYS F 137 
AC5 6 THR F 132 ? TYR F 141 ? THR F 141 TYR F 150 
AC5 7 LYS F 144 ? LEU F 147 ? LYS F 153 LEU F 156 
AC6 1 TRP F 28  ? GLU F 30  ? TRP F 37  GLU F 39  
AC6 2 ARG F 64  ? PHE F 75  ? ARG F 73  PHE F 84  
AC6 3 PHE F 208 ? GLN F 217 ? PHE F 311 GLN F 320 
AC6 4 VAL F 101 ? PHE F 104 ? VAL F 110 PHE F 113 
AC6 5 ILE F 121 ? CYS F 128 ? ILE F 130 CYS F 137 
AC6 6 THR F 132 ? TYR F 141 ? THR F 141 TYR F 150 
AC6 7 LYS F 144 ? LEU F 147 ? LYS F 153 LEU F 156 
AC7 1 VAL G 12  ? GLU G 16  ? VAL G 21  GLU G 25  
AC7 2 THR G 222 ? THR G 230 ? THR G 325 THR G 333 
AC7 3 GLY G 56  ? THR G 59  ? GLY G 65  THR G 68  
AC7 4 PHE G 40  ? SER G 43  ? PHE G 49  SER G 52  
AC8 1 VAL G 12  ? GLU G 16  ? VAL G 21  GLU G 25  
AC8 2 THR G 222 ? THR G 230 ? THR G 325 THR G 333 
AC8 3 LEU G 82  ? HIS G 90  ? LEU G 91  HIS G 99  
AC8 4 THR G 160 ? VAL G 167 ? THR G 169 VAL G 176 
AC8 5 THR G 172 ? ILE G 177 ? THR G 181 ILE G 186 
AC8 6 SER G 180 ? SER G 186 ? SER G 189 SER G 195 
AC9 1 TRP G 28  ? GLU G 30  ? TRP G 37  GLU G 39  
AC9 2 ARG G 64  ? PHE G 75  ? ARG G 73  PHE G 84  
AC9 3 PHE G 208 ? GLN G 217 ? PHE G 311 GLN G 320 
AC9 4 CYS G 96  ? GLY G 98  ? CYS G 105 GLY G 107 
AC9 5 ILE G 121 ? CYS G 128 ? ILE G 130 CYS G 137 
AC9 6 THR G 132 ? TYR G 141 ? THR G 141 TYR G 150 
AC9 7 LYS G 144 ? LEU G 147 ? LYS G 153 LEU G 156 
AD1 1 TRP G 28  ? GLU G 30  ? TRP G 37  GLU G 39  
AD1 2 ARG G 64  ? PHE G 75  ? ARG G 73  PHE G 84  
AD1 3 PHE G 208 ? GLN G 217 ? PHE G 311 GLN G 320 
AD1 4 VAL G 101 ? PHE G 104 ? VAL G 110 PHE G 113 
AD1 5 ILE G 121 ? CYS G 128 ? ILE G 130 CYS G 137 
AD1 6 THR G 132 ? TYR G 141 ? THR G 141 TYR G 150 
AD1 7 LYS G 144 ? LEU G 147 ? LYS G 153 LEU G 156 
AD2 1 VAL H 12  ? GLU H 16  ? VAL H 21  GLU H 25  
AD2 2 THR H 222 ? THR H 230 ? THR H 325 THR H 333 
AD2 3 GLY H 56  ? THR H 59  ? GLY H 65  THR H 68  
AD2 4 PHE H 40  ? SER H 43  ? PHE H 49  SER H 52  
AD3 1 VAL H 12  ? GLU H 16  ? VAL H 21  GLU H 25  
AD3 2 THR H 222 ? THR H 230 ? THR H 325 THR H 333 
AD3 3 LEU H 82  ? HIS H 90  ? LEU H 91  HIS H 99  
AD3 4 THR H 160 ? VAL H 167 ? THR H 169 VAL H 176 
AD3 5 THR H 172 ? ILE H 177 ? THR H 181 ILE H 186 
AD3 6 SER H 180 ? SER H 186 ? SER H 189 SER H 195 
AD4 1 TRP H 28  ? GLU H 30  ? TRP H 37  GLU H 39  
AD4 2 ARG H 64  ? PHE H 75  ? ARG H 73  PHE H 84  
AD4 3 PHE H 208 ? GLN H 217 ? PHE H 311 GLN H 320 
AD4 4 CYS H 96  ? GLY H 98  ? CYS H 105 GLY H 107 
AD4 5 ILE H 121 ? CYS H 128 ? ILE H 130 CYS H 137 
AD4 6 THR H 132 ? TYR H 141 ? THR H 141 TYR H 150 
AD4 7 LYS H 144 ? LEU H 147 ? LYS H 153 LEU H 156 
AD5 1 TRP H 28  ? GLU H 30  ? TRP H 37  GLU H 39  
AD5 2 ARG H 64  ? PHE H 75  ? ARG H 73  PHE H 84  
AD5 3 PHE H 208 ? GLN H 217 ? PHE H 311 GLN H 320 
AD5 4 VAL H 101 ? PHE H 104 ? VAL H 110 PHE H 113 
AD5 5 ILE H 121 ? CYS H 128 ? ILE H 130 CYS H 137 
AD5 6 THR H 132 ? TYR H 141 ? THR H 141 TYR H 150 
AD5 7 LYS H 144 ? LEU H 147 ? LYS H 153 LEU H 156 
AD6 1 VAL I 12  ? GLU I 16  ? VAL I 21  GLU I 25  
AD6 2 ILE I 223 ? THR I 230 ? ILE I 326 THR I 333 
AD6 3 GLY I 56  ? THR I 59  ? GLY I 65  THR I 68  
AD6 4 PHE I 40  ? SER I 43  ? PHE I 49  SER I 52  
AD7 1 VAL I 12  ? GLU I 16  ? VAL I 21  GLU I 25  
AD7 2 ILE I 223 ? THR I 230 ? ILE I 326 THR I 333 
AD7 3 LEU I 82  ? LYS I 89  ? LEU I 91  LYS I 98  
AD7 4 THR I 160 ? VAL I 167 ? THR I 169 VAL I 176 
AD7 5 THR I 172 ? ILE I 177 ? THR I 181 ILE I 186 
AD7 6 SER I 180 ? SER I 186 ? SER I 189 SER I 195 
AD8 1 TRP I 28  ? GLU I 30  ? TRP I 37  GLU I 39  
AD8 2 ARG I 64  ? PHE I 75  ? ARG I 73  PHE I 84  
AD8 3 PHE I 208 ? GLN I 217 ? PHE I 311 GLN I 320 
AD8 4 CYS I 96  ? GLY I 98  ? CYS I 105 GLY I 107 
AD8 5 ILE I 121 ? CYS I 128 ? ILE I 130 CYS I 137 
AD8 6 THR I 132 ? TYR I 141 ? THR I 141 TYR I 150 
AD8 7 LYS I 144 ? LEU I 147 ? LYS I 153 LEU I 156 
AD9 1 TRP I 28  ? GLU I 30  ? TRP I 37  GLU I 39  
AD9 2 ARG I 64  ? PHE I 75  ? ARG I 73  PHE I 84  
AD9 3 PHE I 208 ? GLN I 217 ? PHE I 311 GLN I 320 
AD9 4 VAL I 101 ? PHE I 104 ? VAL I 110 PHE I 113 
AD9 5 ILE I 121 ? CYS I 128 ? ILE I 130 CYS I 137 
AD9 6 THR I 132 ? TYR I 141 ? THR I 141 TYR I 150 
AD9 7 LYS I 144 ? LEU I 147 ? LYS I 153 LEU I 156 
AE1 1 VAL J 12  ? GLU J 16  ? VAL J 21  GLU J 25  
AE1 2 THR J 222 ? THR J 230 ? THR J 325 THR J 333 
AE1 3 GLY J 56  ? THR J 59  ? GLY J 65  THR J 68  
AE1 4 PHE J 40  ? SER J 43  ? PHE J 49  SER J 52  
AE2 1 VAL J 12  ? GLU J 16  ? VAL J 21  GLU J 25  
AE2 2 THR J 222 ? THR J 230 ? THR J 325 THR J 333 
AE2 3 LEU J 82  ? HIS J 90  ? LEU J 91  HIS J 99  
AE2 4 THR J 160 ? VAL J 167 ? THR J 169 VAL J 176 
AE2 5 THR J 172 ? ILE J 177 ? THR J 181 ILE J 186 
AE2 6 SER J 180 ? SER J 186 ? SER J 189 SER J 195 
AE3 1 TRP J 28  ? GLU J 30  ? TRP J 37  GLU J 39  
AE3 2 ARG J 64  ? PHE J 75  ? ARG J 73  PHE J 84  
AE3 3 PHE J 208 ? GLN J 217 ? PHE J 311 GLN J 320 
AE3 4 CYS J 96  ? GLY J 98  ? CYS J 105 GLY J 107 
AE3 5 ILE J 121 ? CYS J 128 ? ILE J 130 CYS J 137 
AE3 6 THR J 132 ? TYR J 141 ? THR J 141 TYR J 150 
AE3 7 LYS J 144 ? LEU J 147 ? LYS J 153 LEU J 156 
AE4 1 TRP J 28  ? GLU J 30  ? TRP J 37  GLU J 39  
AE4 2 ARG J 64  ? PHE J 75  ? ARG J 73  PHE J 84  
AE4 3 PHE J 208 ? GLN J 217 ? PHE J 311 GLN J 320 
AE4 4 VAL J 101 ? PHE J 104 ? VAL J 110 PHE J 113 
AE4 5 ILE J 121 ? CYS J 128 ? ILE J 130 CYS J 137 
AE4 6 THR J 132 ? TYR J 141 ? THR J 141 TYR J 150 
AE4 7 LYS J 144 ? LEU J 147 ? LYS J 153 LEU J 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 14  ? N PHE A 23  O ILE A 229 ? O ILE A 332 
AA1 2 3 O PHE A 224 ? O PHE A 327 N LEU A 57  ? N LEU A 66  
AA1 3 4 O GLN A 58  ? O GLN A 67  N VAL A 41  ? N VAL A 50  
AA2 1 2 N PHE A 14  ? N PHE A 23  O ILE A 229 ? O ILE A 332 
AA2 2 3 O THR A 230 ? O THR A 333 N VAL A 83  ? N VAL A 92  
AA2 3 4 N VAL A 84  ? N VAL A 93  O LEU A 165 ? O LEU A 174 
AA2 4 5 N ILE A 166 ? N ILE A 175 O GLU A 174 ? O GLU A 183 
AA2 5 6 N VAL A 175 ? N VAL A 184 O VAL A 182 ? O VAL A 191 
AA3 1 2 N ILE A 29  ? N ILE A 38  O SER A 69  ? O SER A 78  
AA3 2 3 N LEU A 68  ? N LEU A 77  O LEU A 213 ? O LEU A 316 
AA3 3 4 O TRP A 216 ? O TRP A 319 N GLY A 98  ? N GLY A 107 
AA3 4 5 N GLY A 97  ? N GLY A 106 O ILE A 127 ? O ILE A 136 
AA3 5 6 N MET A 122 ? N MET A 131 O ILE A 138 ? O ILE A 147 
AA3 6 7 N PHE A 139 ? N PHE A 148 O VAL A 146 ? O VAL A 155 
AA4 1 2 N ILE A 29  ? N ILE A 38  O SER A 69  ? O SER A 78  
AA4 2 3 N LEU A 68  ? N LEU A 77  O LEU A 213 ? O LEU A 316 
AA4 3 4 O VAL A 210 ? O VAL A 313 N PHE A 104 ? N PHE A 113 
AA4 4 5 N LEU A 103 ? N LEU A 112 O ILE A 121 ? O ILE A 130 
AA4 5 6 N MET A 122 ? N MET A 131 O ILE A 138 ? O ILE A 147 
AA4 6 7 N PHE A 139 ? N PHE A 148 O VAL A 146 ? O VAL A 155 
AA5 1 2 N PHE B 14  ? N PHE B 23  O ILE B 229 ? O ILE B 332 
AA5 2 3 O PHE B 224 ? O PHE B 327 N LEU B 57  ? N LEU B 66  
AA5 3 4 O GLN B 58  ? O GLN B 67  N VAL B 41  ? N VAL B 50  
AA6 1 2 N PHE B 14  ? N PHE B 23  O ILE B 229 ? O ILE B 332 
AA6 2 3 O THR B 230 ? O THR B 333 N VAL B 83  ? N VAL B 92  
AA6 3 4 N VAL B 88  ? N VAL B 97  O HIS B 161 ? O HIS B 170 
AA6 4 5 N ILE B 166 ? N ILE B 175 O GLU B 174 ? O GLU B 183 
AA6 5 6 N VAL B 175 ? N VAL B 184 O VAL B 182 ? O VAL B 191 
AA7 1 2 N ILE B 29  ? N ILE B 38  O SER B 69  ? O SER B 78  
AA7 2 3 N LEU B 68  ? N LEU B 77  O LEU B 213 ? O LEU B 316 
AA7 3 4 O TRP B 216 ? O TRP B 319 N GLY B 98  ? N GLY B 107 
AA7 4 5 N GLY B 97  ? N GLY B 106 O ILE B 127 ? O ILE B 136 
AA7 5 6 N MET B 122 ? N MET B 131 O ILE B 138 ? O ILE B 147 
AA7 6 7 N PHE B 139 ? N PHE B 148 O VAL B 146 ? O VAL B 155 
AA8 1 2 N ILE B 29  ? N ILE B 38  O SER B 69  ? O SER B 78  
AA8 2 3 N LEU B 68  ? N LEU B 77  O LEU B 213 ? O LEU B 316 
AA8 3 4 O VAL B 210 ? O VAL B 313 N PHE B 104 ? N PHE B 113 
AA8 4 5 N LEU B 103 ? N LEU B 112 O ILE B 121 ? O ILE B 130 
AA8 5 6 N MET B 122 ? N MET B 131 O ILE B 138 ? O ILE B 147 
AA8 6 7 N PHE B 139 ? N PHE B 148 O VAL B 146 ? O VAL B 155 
AA9 1 2 N PHE C 14  ? N PHE C 23  O ILE C 229 ? O ILE C 332 
AA9 2 3 O PHE C 224 ? O PHE C 327 N LEU C 57  ? N LEU C 66  
AA9 3 4 O GLN C 58  ? O GLN C 67  N VAL C 41  ? N VAL C 50  
AB1 1 2 N PHE C 14  ? N PHE C 23  O ILE C 229 ? O ILE C 332 
AB1 2 3 O THR C 230 ? O THR C 333 N VAL C 83  ? N VAL C 92  
AB1 3 4 N VAL C 84  ? N VAL C 93  O LEU C 165 ? O LEU C 174 
AB1 4 5 N ILE C 166 ? N ILE C 175 O GLU C 174 ? O GLU C 183 
AB1 5 6 N VAL C 175 ? N VAL C 184 O VAL C 182 ? O VAL C 191 
AB2 1 2 N ILE C 29  ? N ILE C 38  O SER C 69  ? O SER C 78  
AB2 2 3 N LEU C 68  ? N LEU C 77  O LEU C 213 ? O LEU C 316 
AB2 3 4 O TRP C 216 ? O TRP C 319 N GLY C 98  ? N GLY C 107 
AB2 4 5 N GLY C 97  ? N GLY C 106 O ILE C 127 ? O ILE C 136 
AB2 5 6 N MET C 122 ? N MET C 131 O ILE C 138 ? O ILE C 147 
AB2 6 7 N PHE C 139 ? N PHE C 148 O VAL C 146 ? O VAL C 155 
AB3 1 2 N ILE C 29  ? N ILE C 38  O SER C 69  ? O SER C 78  
AB3 2 3 N LEU C 68  ? N LEU C 77  O LEU C 213 ? O LEU C 316 
AB3 3 4 O VAL C 210 ? O VAL C 313 N PHE C 104 ? N PHE C 113 
AB3 4 5 N LEU C 103 ? N LEU C 112 O ILE C 121 ? O ILE C 130 
AB3 5 6 N MET C 122 ? N MET C 131 O ILE C 138 ? O ILE C 147 
AB3 6 7 N PHE C 139 ? N PHE C 148 O VAL C 146 ? O VAL C 155 
AB4 1 2 N PHE D 14  ? N PHE D 23  O ILE D 229 ? O ILE D 332 
AB4 2 3 O PHE D 224 ? O PHE D 327 N LEU D 57  ? N LEU D 66  
AB4 3 4 O GLN D 58  ? O GLN D 67  N VAL D 41  ? N VAL D 50  
AB5 1 2 N PHE D 14  ? N PHE D 23  O ILE D 229 ? O ILE D 332 
AB5 2 3 O THR D 230 ? O THR D 333 N VAL D 83  ? N VAL D 92  
AB5 3 4 N VAL D 84  ? N VAL D 93  O LEU D 165 ? O LEU D 174 
AB5 4 5 N ILE D 166 ? N ILE D 175 O GLU D 174 ? O GLU D 183 
AB5 5 6 N VAL D 175 ? N VAL D 184 O VAL D 182 ? O VAL D 191 
AB6 1 2 N ILE D 29  ? N ILE D 38  O SER D 69  ? O SER D 78  
AB6 2 3 N LEU D 68  ? N LEU D 77  O LEU D 213 ? O LEU D 316 
AB6 3 4 O TRP D 216 ? O TRP D 319 N GLY D 98  ? N GLY D 107 
AB6 4 5 N GLY D 97  ? N GLY D 106 O ILE D 127 ? O ILE D 136 
AB6 5 6 N MET D 122 ? N MET D 131 O ILE D 138 ? O ILE D 147 
AB6 6 7 N PHE D 139 ? N PHE D 148 O VAL D 146 ? O VAL D 155 
AB7 1 2 N ILE D 29  ? N ILE D 38  O SER D 69  ? O SER D 78  
AB7 2 3 N LEU D 68  ? N LEU D 77  O LEU D 213 ? O LEU D 316 
AB7 3 4 O VAL D 210 ? O VAL D 313 N PHE D 104 ? N PHE D 113 
AB7 4 5 N LEU D 103 ? N LEU D 112 O ILE D 121 ? O ILE D 130 
AB7 5 6 N MET D 122 ? N MET D 131 O ILE D 138 ? O ILE D 147 
AB7 6 7 N PHE D 139 ? N PHE D 148 O VAL D 146 ? O VAL D 155 
AB8 1 2 N PHE E 14  ? N PHE E 23  O ILE E 229 ? O ILE E 332 
AB8 2 3 O PHE E 224 ? O PHE E 327 N LEU E 57  ? N LEU E 66  
AB8 3 4 O GLN E 58  ? O GLN E 67  N VAL E 41  ? N VAL E 50  
AB9 1 2 N PHE E 14  ? N PHE E 23  O ILE E 229 ? O ILE E 332 
AB9 2 3 O THR E 230 ? O THR E 333 N VAL E 83  ? N VAL E 92  
AB9 3 4 N VAL E 84  ? N VAL E 93  O LEU E 165 ? O LEU E 174 
AB9 4 5 N ILE E 166 ? N ILE E 175 O GLU E 174 ? O GLU E 183 
AB9 5 6 N VAL E 175 ? N VAL E 184 O VAL E 182 ? O VAL E 191 
AC1 1 2 N ILE E 29  ? N ILE E 38  O SER E 69  ? O SER E 78  
AC1 2 3 N LEU E 68  ? N LEU E 77  O LEU E 213 ? O LEU E 316 
AC1 3 4 O TRP E 216 ? O TRP E 319 N GLY E 98  ? N GLY E 107 
AC1 4 5 N GLY E 97  ? N GLY E 106 O ILE E 127 ? O ILE E 136 
AC1 5 6 N MET E 122 ? N MET E 131 O ILE E 138 ? O ILE E 147 
AC1 6 7 N PHE E 139 ? N PHE E 148 O VAL E 146 ? O VAL E 155 
AC2 1 2 N ILE E 29  ? N ILE E 38  O SER E 69  ? O SER E 78  
AC2 2 3 N LEU E 68  ? N LEU E 77  O LEU E 213 ? O LEU E 316 
AC2 3 4 O VAL E 210 ? O VAL E 313 N PHE E 104 ? N PHE E 113 
AC2 4 5 N LEU E 103 ? N LEU E 112 O ILE E 121 ? O ILE E 130 
AC2 5 6 N MET E 122 ? N MET E 131 O ILE E 138 ? O ILE E 147 
AC2 6 7 N PHE E 139 ? N PHE E 148 O VAL E 146 ? O VAL E 155 
AC3 1 2 N PHE F 14  ? N PHE F 23  O ILE F 229 ? O ILE F 332 
AC3 2 3 O PHE F 224 ? O PHE F 327 N LEU F 57  ? N LEU F 66  
AC3 3 4 O GLN F 58  ? O GLN F 67  N VAL F 41  ? N VAL F 50  
AC4 1 2 N PHE F 14  ? N PHE F 23  O ILE F 229 ? O ILE F 332 
AC4 2 3 O THR F 230 ? O THR F 333 N VAL F 83  ? N VAL F 92  
AC4 3 4 N VAL F 84  ? N VAL F 93  O LEU F 165 ? O LEU F 174 
AC4 4 5 N ILE F 166 ? N ILE F 175 O GLU F 174 ? O GLU F 183 
AC4 5 6 N VAL F 175 ? N VAL F 184 O VAL F 182 ? O VAL F 191 
AC5 1 2 N ILE F 29  ? N ILE F 38  O SER F 69  ? O SER F 78  
AC5 2 3 N LEU F 68  ? N LEU F 77  O LEU F 213 ? O LEU F 316 
AC5 3 4 O TRP F 216 ? O TRP F 319 N GLY F 98  ? N GLY F 107 
AC5 4 5 N GLY F 97  ? N GLY F 106 O ILE F 127 ? O ILE F 136 
AC5 5 6 N MET F 122 ? N MET F 131 O ILE F 138 ? O ILE F 147 
AC5 6 7 N PHE F 139 ? N PHE F 148 O VAL F 146 ? O VAL F 155 
AC6 1 2 N ILE F 29  ? N ILE F 38  O SER F 69  ? O SER F 78  
AC6 2 3 N LEU F 68  ? N LEU F 77  O LEU F 213 ? O LEU F 316 
AC6 3 4 O VAL F 210 ? O VAL F 313 N PHE F 104 ? N PHE F 113 
AC6 4 5 N LEU F 103 ? N LEU F 112 O ILE F 121 ? O ILE F 130 
AC6 5 6 N MET F 122 ? N MET F 131 O ILE F 138 ? O ILE F 147 
AC6 6 7 N PHE F 139 ? N PHE F 148 O VAL F 146 ? O VAL F 155 
AC7 1 2 N PHE G 14  ? N PHE G 23  O ILE G 229 ? O ILE G 332 
AC7 2 3 O PHE G 224 ? O PHE G 327 N LEU G 57  ? N LEU G 66  
AC7 3 4 O GLN G 58  ? O GLN G 67  N VAL G 41  ? N VAL G 50  
AC8 1 2 N PHE G 14  ? N PHE G 23  O ILE G 229 ? O ILE G 332 
AC8 2 3 O THR G 230 ? O THR G 333 N VAL G 83  ? N VAL G 92  
AC8 3 4 N LEU G 82  ? N LEU G 91  O VAL G 167 ? O VAL G 176 
AC8 4 5 N ILE G 166 ? N ILE G 175 O GLU G 174 ? O GLU G 183 
AC8 5 6 N VAL G 175 ? N VAL G 184 O VAL G 182 ? O VAL G 191 
AC9 1 2 N ILE G 29  ? N ILE G 38  O SER G 69  ? O SER G 78  
AC9 2 3 N LEU G 68  ? N LEU G 77  O LEU G 213 ? O LEU G 316 
AC9 3 4 O TRP G 216 ? O TRP G 319 N GLY G 98  ? N GLY G 107 
AC9 4 5 N GLY G 97  ? N GLY G 106 O ILE G 127 ? O ILE G 136 
AC9 5 6 N MET G 122 ? N MET G 131 O ILE G 138 ? O ILE G 147 
AC9 6 7 N PHE G 139 ? N PHE G 148 O VAL G 146 ? O VAL G 155 
AD1 1 2 N ILE G 29  ? N ILE G 38  O SER G 69  ? O SER G 78  
AD1 2 3 N LEU G 68  ? N LEU G 77  O LEU G 213 ? O LEU G 316 
AD1 3 4 O VAL G 210 ? O VAL G 313 N PHE G 104 ? N PHE G 113 
AD1 4 5 N LEU G 103 ? N LEU G 112 O ILE G 121 ? O ILE G 130 
AD1 5 6 N MET G 122 ? N MET G 131 O ILE G 138 ? O ILE G 147 
AD1 6 7 N PHE G 139 ? N PHE G 148 O VAL G 146 ? O VAL G 155 
AD2 1 2 N PHE H 14  ? N PHE H 23  O ILE H 229 ? O ILE H 332 
AD2 2 3 O PHE H 224 ? O PHE H 327 N LEU H 57  ? N LEU H 66  
AD2 3 4 O GLN H 58  ? O GLN H 67  N VAL H 41  ? N VAL H 50  
AD3 1 2 N PHE H 14  ? N PHE H 23  O ILE H 229 ? O ILE H 332 
AD3 2 3 O THR H 230 ? O THR H 333 N VAL H 83  ? N VAL H 92  
AD3 3 4 N LEU H 82  ? N LEU H 91  O VAL H 167 ? O VAL H 176 
AD3 4 5 N ILE H 166 ? N ILE H 175 O GLU H 174 ? O GLU H 183 
AD3 5 6 N VAL H 175 ? N VAL H 184 O VAL H 182 ? O VAL H 191 
AD4 1 2 N ILE H 29  ? N ILE H 38  O SER H 69  ? O SER H 78  
AD4 2 3 N LEU H 68  ? N LEU H 77  O LEU H 213 ? O LEU H 316 
AD4 3 4 O TRP H 216 ? O TRP H 319 N GLY H 98  ? N GLY H 107 
AD4 4 5 N GLY H 97  ? N GLY H 106 O ILE H 127 ? O ILE H 136 
AD4 5 6 N MET H 122 ? N MET H 131 O ILE H 138 ? O ILE H 147 
AD4 6 7 N PHE H 139 ? N PHE H 148 O VAL H 146 ? O VAL H 155 
AD5 1 2 N ILE H 29  ? N ILE H 38  O SER H 69  ? O SER H 78  
AD5 2 3 N LEU H 68  ? N LEU H 77  O LEU H 213 ? O LEU H 316 
AD5 3 4 O VAL H 210 ? O VAL H 313 N PHE H 104 ? N PHE H 113 
AD5 4 5 N LEU H 103 ? N LEU H 112 O ILE H 121 ? O ILE H 130 
AD5 5 6 N MET H 122 ? N MET H 131 O ILE H 138 ? O ILE H 147 
AD5 6 7 N PHE H 139 ? N PHE H 148 O VAL H 146 ? O VAL H 155 
AD6 1 2 N PHE I 14  ? N PHE I 23  O ILE I 229 ? O ILE I 332 
AD6 2 3 O PHE I 224 ? O PHE I 327 N LEU I 57  ? N LEU I 66  
AD6 3 4 O GLN I 58  ? O GLN I 67  N VAL I 41  ? N VAL I 50  
AD7 1 2 N PHE I 14  ? N PHE I 23  O ILE I 229 ? O ILE I 332 
AD7 2 3 O THR I 230 ? O THR I 333 N VAL I 83  ? N VAL I 92  
AD7 3 4 N VAL I 88  ? N VAL I 97  O HIS I 161 ? O HIS I 170 
AD7 4 5 N ILE I 166 ? N ILE I 175 O GLU I 174 ? O GLU I 183 
AD7 5 6 N VAL I 175 ? N VAL I 184 O VAL I 182 ? O VAL I 191 
AD8 1 2 N ILE I 29  ? N ILE I 38  O SER I 69  ? O SER I 78  
AD8 2 3 N LEU I 68  ? N LEU I 77  O LEU I 213 ? O LEU I 316 
AD8 3 4 O TRP I 216 ? O TRP I 319 N GLY I 98  ? N GLY I 107 
AD8 4 5 N GLY I 97  ? N GLY I 106 O ILE I 127 ? O ILE I 136 
AD8 5 6 N MET I 122 ? N MET I 131 O ILE I 138 ? O ILE I 147 
AD8 6 7 N PHE I 139 ? N PHE I 148 O VAL I 146 ? O VAL I 155 
AD9 1 2 N ILE I 29  ? N ILE I 38  O SER I 69  ? O SER I 78  
AD9 2 3 N LEU I 68  ? N LEU I 77  O LEU I 213 ? O LEU I 316 
AD9 3 4 O VAL I 210 ? O VAL I 313 N PHE I 104 ? N PHE I 113 
AD9 4 5 N LEU I 103 ? N LEU I 112 O ILE I 121 ? O ILE I 130 
AD9 5 6 N MET I 122 ? N MET I 131 O ILE I 138 ? O ILE I 147 
AD9 6 7 N PHE I 139 ? N PHE I 148 O VAL I 146 ? O VAL I 155 
AE1 1 2 N PHE J 14  ? N PHE J 23  O ILE J 229 ? O ILE J 332 
AE1 2 3 O PHE J 224 ? O PHE J 327 N LEU J 57  ? N LEU J 66  
AE1 3 4 O GLN J 58  ? O GLN J 67  N VAL J 41  ? N VAL J 50  
AE2 1 2 N PHE J 14  ? N PHE J 23  O ILE J 229 ? O ILE J 332 
AE2 2 3 O THR J 230 ? O THR J 333 N VAL J 83  ? N VAL J 92  
AE2 3 4 N VAL J 84  ? N VAL J 93  O LEU J 165 ? O LEU J 174 
AE2 4 5 N ILE J 166 ? N ILE J 175 O GLU J 174 ? O GLU J 183 
AE2 5 6 N VAL J 175 ? N VAL J 184 O VAL J 182 ? O VAL J 191 
AE3 1 2 N ILE J 29  ? N ILE J 38  O SER J 69  ? O SER J 78  
AE3 2 3 N LEU J 68  ? N LEU J 77  O LEU J 213 ? O LEU J 316 
AE3 3 4 O TRP J 216 ? O TRP J 319 N GLY J 98  ? N GLY J 107 
AE3 4 5 N GLY J 97  ? N GLY J 106 O ILE J 127 ? O ILE J 136 
AE3 5 6 N MET J 122 ? N MET J 131 O ILE J 138 ? O ILE J 147 
AE3 6 7 N PHE J 139 ? N PHE J 148 O VAL J 146 ? O VAL J 155 
AE4 1 2 N ILE J 29  ? N ILE J 38  O SER J 69  ? O SER J 78  
AE4 2 3 N LEU J 68  ? N LEU J 77  O LEU J 213 ? O LEU J 316 
AE4 3 4 O VAL J 210 ? O VAL J 313 N PHE J 104 ? N PHE J 113 
AE4 4 5 N LEU J 103 ? N LEU J 112 O ILE J 121 ? O ILE J 130 
AE4 5 6 N MET J 122 ? N MET J 131 O ILE J 138 ? O ILE J 147 
AE4 6 7 N PHE J 139 ? N PHE J 148 O VAL J 146 ? O VAL J 155 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA 500 ? 6 'binding site for residue CA A 500' 
AC2 Software B CA 500 ? 6 'binding site for residue CA B 500' 
AC3 Software C CA 500 ? 6 'binding site for residue CA C 500' 
AC4 Software D CA 500 ? 6 'binding site for residue CA D 500' 
AC5 Software E CA 401 ? 6 'binding site for residue CA E 401' 
AC6 Software E CL 402 ? 3 'binding site for residue CL E 402' 
AC7 Software F CA 500 ? 6 'binding site for residue CA F 500' 
AC8 Software G CA 401 ? 6 'binding site for residue CA G 401' 
AC9 Software H CA 500 ? 6 'binding site for residue CA H 500' 
AD1 Software I CA 500 ? 6 'binding site for residue CA I 500' 
AD2 Software J CA 500 ? 6 'binding site for residue CA J 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLN A  17  ? GLN A 26  . ? 1_555 ? 
2  AC1 6 LYS A  53  ? LYS A 62  . ? 1_555 ? 
3  AC1 6 LYS A  55  ? LYS A 64  . ? 1_555 ? 
4  AC1 6 ASP A  225 ? ASP A 328 . ? 1_555 ? 
5  AC1 6 HOH V  .   ? HOH A 618 . ? 1_555 ? 
6  AC1 6 HOH V  .   ? HOH A 636 . ? 1_555 ? 
7  AC2 6 GLN B  17  ? GLN B 26  . ? 1_555 ? 
8  AC2 6 LYS B  53  ? LYS B 62  . ? 1_555 ? 
9  AC2 6 LYS B  55  ? LYS B 64  . ? 1_555 ? 
10 AC2 6 ASP B  225 ? ASP B 328 . ? 1_555 ? 
11 AC2 6 HOH W  .   ? HOH B 609 . ? 1_555 ? 
12 AC2 6 HOH W  .   ? HOH B 629 . ? 1_555 ? 
13 AC3 6 GLN C  17  ? GLN C 26  . ? 1_555 ? 
14 AC3 6 LYS C  53  ? LYS C 62  . ? 1_555 ? 
15 AC3 6 LYS C  55  ? LYS C 64  . ? 1_555 ? 
16 AC3 6 ASP C  225 ? ASP C 328 . ? 1_555 ? 
17 AC3 6 HOH X  .   ? HOH C 621 . ? 1_555 ? 
18 AC3 6 HOH X  .   ? HOH C 630 . ? 1_555 ? 
19 AC4 6 GLN D  17  ? GLN D 26  . ? 1_555 ? 
20 AC4 6 LYS D  53  ? LYS D 62  . ? 1_555 ? 
21 AC4 6 LYS D  55  ? LYS D 64  . ? 1_555 ? 
22 AC4 6 ASP D  225 ? ASP D 328 . ? 1_555 ? 
23 AC4 6 HOH Y  .   ? HOH D 636 . ? 1_555 ? 
24 AC4 6 HOH Y  .   ? HOH D 647 . ? 1_555 ? 
25 AC5 6 GLN E  17  ? GLN E 26  . ? 1_555 ? 
26 AC5 6 LYS E  53  ? LYS E 62  . ? 1_555 ? 
27 AC5 6 LYS E  55  ? LYS E 64  . ? 1_555 ? 
28 AC5 6 ASP E  225 ? ASP E 328 . ? 1_555 ? 
29 AC5 6 HOH Z  .   ? HOH E 529 . ? 1_555 ? 
30 AC5 6 HOH Z  .   ? HOH E 533 . ? 1_555 ? 
31 AC6 3 GLY D  196 ? GLY D 205 . ? 1_556 ? 
32 AC6 3 SER D  197 ? SER D 206 . ? 1_556 ? 
33 AC6 3 LEU E  42  ? LEU E 51  . ? 1_555 ? 
34 AC7 6 GLN F  17  ? GLN F 26  . ? 1_555 ? 
35 AC7 6 LYS F  53  ? LYS F 62  . ? 1_555 ? 
36 AC7 6 LYS F  55  ? LYS F 64  . ? 1_555 ? 
37 AC7 6 ASP F  225 ? ASP F 328 . ? 1_555 ? 
38 AC7 6 HOH AA .   ? HOH F 634 . ? 1_555 ? 
39 AC7 6 HOH AA .   ? HOH F 648 . ? 1_555 ? 
40 AC8 6 GLN G  17  ? GLN G 26  . ? 1_555 ? 
41 AC8 6 LYS G  53  ? LYS G 62  . ? 1_555 ? 
42 AC8 6 LYS G  55  ? LYS G 64  . ? 1_555 ? 
43 AC8 6 ASP G  225 ? ASP G 328 . ? 1_555 ? 
44 AC8 6 HOH BA .   ? HOH G 518 . ? 1_555 ? 
45 AC8 6 HOH BA .   ? HOH G 524 . ? 1_555 ? 
46 AC9 6 GLN H  17  ? GLN H 26  . ? 1_555 ? 
47 AC9 6 LYS H  53  ? LYS H 62  . ? 1_555 ? 
48 AC9 6 LYS H  55  ? LYS H 64  . ? 1_555 ? 
49 AC9 6 ASP H  225 ? ASP H 328 . ? 1_555 ? 
50 AC9 6 HOH CA .   ? HOH H 628 . ? 1_555 ? 
51 AC9 6 HOH CA .   ? HOH H 630 . ? 1_555 ? 
52 AD1 6 GLN I  17  ? GLN I 26  . ? 1_555 ? 
53 AD1 6 LYS I  53  ? LYS I 62  . ? 1_555 ? 
54 AD1 6 LYS I  55  ? LYS I 64  . ? 1_555 ? 
55 AD1 6 ASP I  225 ? ASP I 328 . ? 1_555 ? 
56 AD1 6 HOH DA .   ? HOH I 634 . ? 1_555 ? 
57 AD1 6 HOH DA .   ? HOH I 637 . ? 1_555 ? 
58 AD2 6 GLN J  17  ? GLN J 26  . ? 1_555 ? 
59 AD2 6 LYS J  53  ? LYS J 62  . ? 1_555 ? 
60 AD2 6 LYS J  55  ? LYS J 64  . ? 1_555 ? 
61 AD2 6 ASP J  225 ? ASP J 328 . ? 1_555 ? 
62 AD2 6 HOH EA .   ? HOH J 636 . ? 1_555 ? 
63 AD2 6 HOH EA .   ? HOH J 639 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5LK5 
_atom_sites.fract_transf_matrix[1][1]   0.005077 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005077 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014748 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLU A  1 9   ? 22.513   20.020  -12.310 1.00 51.52 ? 18  GLU A N   1 
ATOM   2     C  CA  . GLU A  1 9   ? 21.336   20.606  -11.569 1.00 49.03 ? 18  GLU A CA  1 
ATOM   3     C  C   . GLU A  1 9   ? 21.532   21.827  -10.682 1.00 44.62 ? 18  GLU A C   1 
ATOM   4     O  O   . GLU A  1 9   ? 20.586   22.573  -10.492 1.00 50.86 ? 18  GLU A O   1 
ATOM   5     C  CB  . GLU A  1 9   ? 20.569   19.541  -10.777 1.00 51.38 ? 18  GLU A CB  1 
ATOM   6     C  CG  . GLU A  1 9   ? 19.253   19.218  -11.461 1.00 56.40 ? 18  GLU A CG  1 
ATOM   7     C  CD  . GLU A  1 9   ? 18.310   18.394  -10.617 1.00 60.90 ? 18  GLU A CD  1 
ATOM   8     O  OE1 . GLU A  1 9   ? 18.351   18.515  -9.375  1.00 60.93 ? 18  GLU A OE1 1 
ATOM   9     O  OE2 . GLU A  1 9   ? 17.510   17.635  -11.214 1.00 65.89 ? 18  GLU A OE2 1 
ATOM   10    N  N   . PRO A  1 10  ? 22.718   22.037  -10.117 1.00 37.43 ? 19  PRO A N   1 
ATOM   11    C  CA  . PRO A  1 10  ? 22.892   23.222  -9.288  1.00 33.08 ? 19  PRO A CA  1 
ATOM   12    C  C   . PRO A  1 10  ? 22.839   24.466  -10.116 1.00 29.30 ? 19  PRO A C   1 
ATOM   13    O  O   . PRO A  1 10  ? 23.410   24.501  -11.183 1.00 27.54 ? 19  PRO A O   1 
ATOM   14    C  CB  . PRO A  1 10  ? 24.305   23.092  -8.742  1.00 34.16 ? 19  PRO A CB  1 
ATOM   15    C  CG  . PRO A  1 10  ? 24.890   21.854  -9.307  1.00 39.06 ? 19  PRO A CG  1 
ATOM   16    C  CD  . PRO A  1 10  ? 23.810   21.065  -9.981  1.00 40.21 ? 19  PRO A CD  1 
ATOM   17    N  N   . ALA A  1 11  ? 22.178   25.487  -9.613  1.00 24.76 ? 20  ALA A N   1 
ATOM   18    C  CA  . ALA A  1 11  ? 22.143   26.756  -10.306 1.00 25.84 ? 20  ALA A CA  1 
ATOM   19    C  C   . ALA A  1 11  ? 23.356   27.583  -9.880  1.00 25.81 ? 20  ALA A C   1 
ATOM   20    O  O   . ALA A  1 11  ? 23.657   27.703  -8.692  1.00 28.99 ? 20  ALA A O   1 
ATOM   21    C  CB  . ALA A  1 11  ? 20.865   27.511  -9.987  1.00 26.34 ? 20  ALA A CB  1 
ATOM   22    N  N   . VAL A  1 12  ? 24.049   28.130  -10.858 1.00 24.14 ? 21  VAL A N   1 
ATOM   23    C  CA  . VAL A  1 12  ? 25.168   28.997  -10.609 1.00 23.22 ? 21  VAL A CA  1 
ATOM   24    C  C   . VAL A  1 12  ? 24.750   30.362  -11.058 1.00 20.97 ? 21  VAL A C   1 
ATOM   25    O  O   . VAL A  1 12  ? 24.730   30.623  -12.233 1.00 23.24 ? 21  VAL A O   1 
ATOM   26    C  CB  . VAL A  1 12  ? 26.428   28.536  -11.369 1.00 24.15 ? 21  VAL A CB  1 
ATOM   27    C  CG1 . VAL A  1 12  ? 27.606   29.444  -11.060 1.00 26.40 ? 21  VAL A CG1 1 
ATOM   28    C  CG2 . VAL A  1 12  ? 26.791   27.101  -10.969 1.00 25.08 ? 21  VAL A CG2 1 
ATOM   29    N  N   . TYR A  1 13  ? 24.426   31.241  -10.132 1.00 19.59 ? 22  TYR A N   1 
ATOM   30    C  CA  . TYR A  1 13  ? 23.998   32.598  -10.497 1.00 20.20 ? 22  TYR A CA  1 
ATOM   31    C  C   . TYR A  1 13  ? 25.150   33.562  -10.768 1.00 19.59 ? 22  TYR A C   1 
ATOM   32    O  O   . TYR A  1 13  ? 24.979   34.580  -11.441 1.00 19.45 ? 22  TYR A O   1 
ATOM   33    C  CB  . TYR A  1 13  ? 23.159   33.193  -9.399  1.00 20.56 ? 22  TYR A CB  1 
ATOM   34    C  CG  . TYR A  1 13  ? 22.015   32.306  -9.003  1.00 23.40 ? 22  TYR A CG  1 
ATOM   35    C  CD1 . TYR A  1 13  ? 20.983   32.006  -9.905  1.00 26.26 ? 22  TYR A CD1 1 
ATOM   36    C  CD2 . TYR A  1 13  ? 21.943   31.770  -7.727  1.00 24.15 ? 22  TYR A CD2 1 
ATOM   37    C  CE1 . TYR A  1 13  ? 19.924   31.178  -9.534  1.00 27.10 ? 22  TYR A CE1 1 
ATOM   38    C  CE2 . TYR A  1 13  ? 20.892   30.968  -7.350  1.00 26.44 ? 22  TYR A CE2 1 
ATOM   39    C  CZ  . TYR A  1 13  ? 19.891   30.671  -8.250  1.00 27.59 ? 22  TYR A CZ  1 
ATOM   40    O  OH  . TYR A  1 13  ? 18.842   29.882  -7.813  1.00 28.05 ? 22  TYR A OH  1 
ATOM   41    N  N   . PHE A  1 14  ? 26.307   33.260  -10.202 1.00 19.44 ? 23  PHE A N   1 
ATOM   42    C  CA  . PHE A  1 14  ? 27.492   34.093  -10.347 1.00 18.64 ? 23  PHE A CA  1 
ATOM   43    C  C   . PHE A  1 14  ? 28.722   33.303  -9.972  1.00 19.08 ? 23  PHE A C   1 
ATOM   44    O  O   . PHE A  1 14  ? 28.738   32.591  -8.957  1.00 21.33 ? 23  PHE A O   1 
ATOM   45    C  CB  . PHE A  1 14  ? 27.410   35.343  -9.501  1.00 20.19 ? 23  PHE A CB  1 
ATOM   46    C  CG  . PHE A  1 14  ? 28.511   36.354  -9.771  1.00 22.95 ? 23  PHE A CG  1 
ATOM   47    C  CD1 . PHE A  1 14  ? 28.643   36.963  -11.020 1.00 23.55 ? 23  PHE A CD1 1 
ATOM   48    C  CD2 . PHE A  1 14  ? 29.432   36.702  -8.772  1.00 24.90 ? 23  PHE A CD2 1 
ATOM   49    C  CE1 . PHE A  1 14  ? 29.661   37.879  -11.287 1.00 22.25 ? 23  PHE A CE1 1 
ATOM   50    C  CE2 . PHE A  1 14  ? 30.444   37.633  -9.038  1.00 25.53 ? 23  PHE A CE2 1 
ATOM   51    C  CZ  . PHE A  1 14  ? 30.546   38.224  -10.290 1.00 23.46 ? 23  PHE A CZ  1 
ATOM   52    N  N   . LYS A  1 15  ? 29.736   33.395  -10.835 1.00 17.66 ? 24  LYS A N   1 
ATOM   53    C  CA  . LYS A  1 15  ? 31.037   32.833  -10.575 1.00 17.24 ? 24  LYS A CA  1 
ATOM   54    C  C   . LYS A  1 15  ? 32.103   33.808  -11.079 1.00 18.38 ? 24  LYS A C   1 
ATOM   55    O  O   . LYS A  1 15  ? 32.005   34.312  -12.189 1.00 16.94 ? 24  LYS A O   1 
ATOM   56    C  CB  . LYS A  1 15  ? 31.186   31.502  -11.244 1.00 16.47 ? 24  LYS A CB  1 
ATOM   57    C  CG  . LYS A  1 15  ? 32.365   30.719  -10.700 1.00 17.30 ? 24  LYS A CG  1 
ATOM   58    C  CD  . LYS A  1 15  ? 32.630   29.432  -11.451 1.00 16.42 ? 24  LYS A CD  1 
ATOM   59    C  CE  . LYS A  1 15  ? 31.531   28.442  -11.210 1.00 17.48 ? 24  LYS A CE  1 
ATOM   60    N  NZ  . LYS A  1 15  ? 32.030   27.077  -10.988 1.00 19.42 ? 24  LYS A NZ  1 
ATOM   61    N  N   . GLU A  1 16  ? 33.096   34.125  -10.242 1.00 18.43 ? 25  GLU A N   1 
ATOM   62    C  CA  . GLU A  1 16  ? 34.230   34.979  -10.695 1.00 17.44 ? 25  GLU A CA  1 
ATOM   63    C  C   . GLU A  1 16  ? 35.541   34.491  -10.101 1.00 18.47 ? 25  GLU A C   1 
ATOM   64    O  O   . GLU A  1 16  ? 35.754   34.508  -8.877  1.00 17.60 ? 25  GLU A O   1 
ATOM   65    C  CB  . GLU A  1 16  ? 34.000   36.447  -10.346 1.00 18.13 ? 25  GLU A CB  1 
ATOM   66    C  CG  . GLU A  1 16  ? 35.111   37.404  -10.782 1.00 19.37 ? 25  GLU A CG  1 
ATOM   67    C  CD  . GLU A  1 16  ? 35.249   37.552  -12.299 1.00 18.16 ? 25  GLU A CD  1 
ATOM   68    O  OE1 . GLU A  1 16  ? 34.687   38.532  -12.823 1.00 17.29 ? 25  GLU A OE1 1 
ATOM   69    O  OE2 . GLU A  1 16  ? 35.937   36.696  -12.927 1.00 17.93 ? 25  GLU A OE2 1 
ATOM   70    N  N   . GLN A  1 17  ? 36.427   34.031  -10.981 1.00 19.00 ? 26  GLN A N   1 
ATOM   71    C  CA  . GLN A  1 17  ? 37.761   33.632  -10.555 1.00 18.27 ? 26  GLN A CA  1 
ATOM   72    C  C   . GLN A  1 17  ? 38.891   34.482  -11.116 1.00 17.27 ? 26  GLN A C   1 
ATOM   73    O  O   . GLN A  1 17  ? 40.051   34.242  -10.788 1.00 16.58 ? 26  GLN A O   1 
ATOM   74    C  CB  . GLN A  1 17  ? 37.984   32.146  -10.815 1.00 17.75 ? 26  GLN A CB  1 
ATOM   75    C  CG  . GLN A  1 17  ? 36.768   31.302  -10.459 1.00 17.78 ? 26  GLN A CG  1 
ATOM   76    C  CD  . GLN A  1 17  ? 36.935   29.871  -10.781 1.00 17.12 ? 26  GLN A CD  1 
ATOM   77    O  OE1 . GLN A  1 17  ? 37.750   29.172  -10.194 1.00 22.28 ? 26  GLN A OE1 1 
ATOM   78    N  NE2 . GLN A  1 17  ? 36.205   29.420  -11.747 1.00 17.07 ? 26  GLN A NE2 1 
ATOM   79    N  N   . PHE A  1 18  ? 38.546   35.436  -11.964 1.00 17.11 ? 27  PHE A N   1 
ATOM   80    C  CA  . PHE A  1 18  ? 39.518   36.255  -12.615 1.00 17.50 ? 27  PHE A CA  1 
ATOM   81    C  C   . PHE A  1 18  ? 40.620   35.407  -13.265 1.00 19.59 ? 27  PHE A C   1 
ATOM   82    O  O   . PHE A  1 18  ? 41.804   35.658  -13.057 1.00 18.08 ? 27  PHE A O   1 
ATOM   83    C  CB  . PHE A  1 18  ? 40.158   37.176  -11.589 1.00 17.78 ? 27  PHE A CB  1 
ATOM   84    C  CG  . PHE A  1 18  ? 39.164   37.926  -10.736 1.00 16.27 ? 27  PHE A CG  1 
ATOM   85    C  CD1 . PHE A  1 18  ? 38.616   39.082  -11.188 1.00 16.42 ? 27  PHE A CD1 1 
ATOM   86    C  CD2 . PHE A  1 18  ? 38.797   37.455  -9.525  1.00 16.08 ? 27  PHE A CD2 1 
ATOM   87    C  CE1 . PHE A  1 18  ? 37.730   39.789  -10.428 1.00 16.98 ? 27  PHE A CE1 1 
ATOM   88    C  CE2 . PHE A  1 18  ? 37.887   38.139  -8.756  1.00 16.58 ? 27  PHE A CE2 1 
ATOM   89    C  CZ  . PHE A  1 18  ? 37.345   39.303  -9.206  1.00 16.45 ? 27  PHE A CZ  1 
ATOM   90    N  N   . LEU A  1 19  ? 40.233   34.398  -14.048 1.00 21.33 ? 28  LEU A N   1 
ATOM   91    C  CA  . LEU A  1 19  ? 41.195   33.514  -14.745 1.00 21.22 ? 28  LEU A CA  1 
ATOM   92    C  C   . LEU A  1 19  ? 41.577   34.004  -16.159 1.00 21.39 ? 28  LEU A C   1 
ATOM   93    O  O   . LEU A  1 19  ? 42.492   33.485  -16.748 1.00 20.55 ? 28  LEU A O   1 
ATOM   94    C  CB  . LEU A  1 19  ? 40.608   32.119  -14.871 1.00 21.84 ? 28  LEU A CB  1 
ATOM   95    C  CG  . LEU A  1 19  ? 40.453   31.336  -13.555 1.00 23.98 ? 28  LEU A CG  1 
ATOM   96    C  CD1 . LEU A  1 19  ? 39.459   30.204  -13.747 1.00 23.83 ? 28  LEU A CD1 1 
ATOM   97    C  CD2 . LEU A  1 19  ? 41.800   30.826  -13.061 1.00 24.95 ? 28  LEU A CD2 1 
ATOM   98    N  N   . ASP A  1 20  ? 40.820   34.953  -16.724 1.00 23.15 ? 29  ASP A N   1 
ATOM   99    C  CA  . ASP A  1 20  ? 40.907   35.309  -18.177 1.00 23.55 ? 29  ASP A CA  1 
ATOM   100   C  C   . ASP A  1 20  ? 41.525   36.704  -18.381 1.00 21.65 ? 29  ASP A C   1 
ATOM   101   O  O   . ASP A  1 20  ? 40.977   37.585  -19.044 1.00 23.10 ? 29  ASP A O   1 
ATOM   102   C  CB  . ASP A  1 20  ? 39.513   35.189  -18.830 1.00 25.33 ? 29  ASP A CB  1 
ATOM   103   C  CG  . ASP A  1 20  ? 38.502   36.165  -18.243 1.00 29.00 ? 29  ASP A CG  1 
ATOM   104   O  OD1 . ASP A  1 20  ? 38.696   36.638  -17.094 1.00 31.12 ? 29  ASP A OD1 1 
ATOM   105   O  OD2 . ASP A  1 20  ? 37.547   36.517  -18.945 1.00 29.07 ? 29  ASP A OD2 1 
ATOM   106   N  N   . GLY A  1 21  ? 42.693   36.878  -17.807 1.00 21.20 ? 30  GLY A N   1 
ATOM   107   C  CA  . GLY A  1 21  ? 43.443   38.094  -17.934 1.00 22.77 ? 30  GLY A CA  1 
ATOM   108   C  C   . GLY A  1 21  ? 42.691   39.301  -17.446 1.00 24.95 ? 30  GLY A C   1 
ATOM   109   O  O   . GLY A  1 21  ? 42.200   39.312  -16.328 1.00 25.70 ? 30  GLY A O   1 
ATOM   110   N  N   . ASP A  1 22  ? 42.611   40.319  -18.308 1.00 27.14 ? 31  ASP A N   1 
ATOM   111   C  CA  . ASP A  1 22  ? 41.922   41.577  -18.008 1.00 28.51 ? 31  ASP A CA  1 
ATOM   112   C  C   . ASP A  1 22  ? 40.393   41.486  -18.305 1.00 28.60 ? 31  ASP A C   1 
ATOM   113   O  O   . ASP A  1 22  ? 39.678   42.478  -18.150 1.00 31.16 ? 31  ASP A O   1 
ATOM   114   C  CB  . ASP A  1 22  ? 42.617   42.807  -18.698 1.00 32.66 ? 31  ASP A CB  1 
ATOM   115   C  CG  . ASP A  1 22  ? 42.566   42.765  -20.226 1.00 39.60 ? 31  ASP A CG  1 
ATOM   116   O  OD1 . ASP A  1 22  ? 41.828   41.959  -20.805 1.00 44.48 ? 31  ASP A OD1 1 
ATOM   117   O  OD2 . ASP A  1 22  ? 43.296   43.550  -20.882 1.00 45.90 ? 31  ASP A OD2 1 
ATOM   118   N  N   . GLY A  1 23  ? 39.889   40.289  -18.666 1.00 22.91 ? 32  GLY A N   1 
ATOM   119   C  CA  . GLY A  1 23  ? 38.469   40.076  -18.915 1.00 21.50 ? 32  GLY A CA  1 
ATOM   120   C  C   . GLY A  1 23  ? 37.554   40.695  -17.862 1.00 20.23 ? 32  GLY A C   1 
ATOM   121   O  O   . GLY A  1 23  ? 36.490   41.232  -18.183 1.00 19.62 ? 32  GLY A O   1 
ATOM   122   N  N   . TRP A  1 24  ? 37.960   40.618  -16.603 1.00 17.74 ? 33  TRP A N   1 
ATOM   123   C  CA  . TRP A  1 24  ? 37.129   41.117  -15.514 1.00 17.48 ? 33  TRP A CA  1 
ATOM   124   C  C   . TRP A  1 24  ? 36.756   42.589  -15.663 1.00 19.07 ? 33  TRP A C   1 
ATOM   125   O  O   . TRP A  1 24  ? 35.767   42.991  -15.065 1.00 20.10 ? 33  TRP A O   1 
ATOM   126   C  CB  . TRP A  1 24  ? 37.832   40.934  -14.148 1.00 15.80 ? 33  TRP A CB  1 
ATOM   127   C  CG  . TRP A  1 24  ? 38.959   41.853  -13.904 1.00 13.48 ? 33  TRP A CG  1 
ATOM   128   C  CD1 . TRP A  1 24  ? 40.264   41.653  -14.271 1.00 13.56 ? 33  TRP A CD1 1 
ATOM   129   C  CD2 . TRP A  1 24  ? 38.923   43.107  -13.255 1.00 12.38 ? 33  TRP A CD2 1 
ATOM   130   N  NE1 . TRP A  1 24  ? 41.030   42.723  -13.895 1.00 12.62 ? 33  TRP A NE1 1 
ATOM   131   C  CE2 . TRP A  1 24  ? 40.227   43.636  -13.286 1.00 11.83 ? 33  TRP A CE2 1 
ATOM   132   C  CE3 . TRP A  1 24  ? 37.913   43.851  -12.660 1.00 12.37 ? 33  TRP A CE3 1 
ATOM   133   C  CZ2 . TRP A  1 24  ? 40.555   44.849  -12.722 1.00 13.00 ? 33  TRP A CZ2 1 
ATOM   134   C  CZ3 . TRP A  1 24  ? 38.233   45.071  -12.071 1.00 12.23 ? 33  TRP A CZ3 1 
ATOM   135   C  CH2 . TRP A  1 24  ? 39.545   45.574  -12.116 1.00 12.47 ? 33  TRP A CH2 1 
ATOM   136   N  N   . THR A  1 25  ? 37.586   43.388  -16.358 1.00 18.46 ? 34  THR A N   1 
ATOM   137   C  CA  . THR A  1 25  ? 37.350   44.839  -16.472 1.00 21.06 ? 34  THR A CA  1 
ATOM   138   C  C   . THR A  1 25  ? 36.095   45.141  -17.268 1.00 20.49 ? 34  THR A C   1 
ATOM   139   O  O   . THR A  1 25  ? 35.578   46.246  -17.194 1.00 21.11 ? 34  THR A O   1 
ATOM   140   C  CB  . THR A  1 25  ? 38.513   45.609  -17.138 1.00 23.03 ? 34  THR A CB  1 
ATOM   141   O  OG1 . THR A  1 25  ? 38.837   44.978  -18.365 1.00 23.79 ? 34  THR A OG1 1 
ATOM   142   C  CG2 . THR A  1 25  ? 39.778   45.577  -16.247 1.00 24.42 ? 34  THR A CG2 1 
ATOM   143   N  N   . SER A  1 26  ? 35.590   44.156  -18.005 1.00 19.69 ? 35  SER A N   1 
ATOM   144   C  CA  . SER A  1 26  ? 34.303   44.310  -18.679 1.00 22.07 ? 35  SER A CA  1 
ATOM   145   C  C   . SER A  1 26  ? 33.129   43.705  -17.874 1.00 23.30 ? 35  SER A C   1 
ATOM   146   O  O   . SER A  1 26  ? 31.985   43.798  -18.310 1.00 24.72 ? 35  SER A O   1 
ATOM   147   C  CB  . SER A  1 26  ? 34.355   43.728  -20.088 1.00 22.06 ? 35  SER A CB  1 
ATOM   148   O  OG  . SER A  1 26  ? 34.431   42.318  -20.000 1.00 22.48 ? 35  SER A OG  1 
ATOM   149   N  N   . ARG A  1 27  ? 33.395   43.101  -16.713 1.00 23.68 ? 36  ARG A N   1 
ATOM   150   C  CA  . ARG A  1 27  ? 32.330   42.520  -15.844 1.00 21.85 ? 36  ARG A CA  1 
ATOM   151   C  C   . ARG A  1 27  ? 32.090   43.302  -14.557 1.00 20.25 ? 36  ARG A C   1 
ATOM   152   O  O   . ARG A  1 27  ? 31.072   43.098  -13.897 1.00 22.60 ? 36  ARG A O   1 
ATOM   153   C  CB  . ARG A  1 27  ? 32.666   41.087  -15.493 1.00 22.33 ? 36  ARG A CB  1 
ATOM   154   C  CG  . ARG A  1 27  ? 32.773   40.208  -16.716 1.00 22.41 ? 36  ARG A CG  1 
ATOM   155   C  CD  . ARG A  1 27  ? 32.835   38.731  -16.376 1.00 21.94 ? 36  ARG A CD  1 
ATOM   156   N  NE  . ARG A  1 27  ? 34.110   38.353  -15.751 1.00 24.20 ? 36  ARG A NE  1 
ATOM   157   C  CZ  . ARG A  1 27  ? 35.223   37.946  -16.378 1.00 25.31 ? 36  ARG A CZ  1 
ATOM   158   N  NH1 . ARG A  1 27  ? 35.292   37.869  -17.717 1.00 24.69 ? 36  ARG A NH1 1 
ATOM   159   N  NH2 . ARG A  1 27  ? 36.304   37.596  -15.655 1.00 24.79 ? 36  ARG A NH2 1 
ATOM   160   N  N   . TRP A  1 28  ? 32.973   44.232  -14.223 1.00 16.30 ? 37  TRP A N   1 
ATOM   161   C  CA  . TRP A  1 28  ? 32.835   44.976  -13.000 1.00 16.29 ? 37  TRP A CA  1 
ATOM   162   C  C   . TRP A  1 28  ? 32.817   46.463  -13.286 1.00 18.69 ? 37  TRP A C   1 
ATOM   163   O  O   . TRP A  1 28  ? 33.454   46.909  -14.224 1.00 20.77 ? 37  TRP A O   1 
ATOM   164   C  CB  . TRP A  1 28  ? 33.977   44.627  -11.998 1.00 16.08 ? 37  TRP A CB  1 
ATOM   165   C  CG  . TRP A  1 28  ? 33.997   43.163  -11.503 1.00 14.48 ? 37  TRP A CG  1 
ATOM   166   C  CD1 . TRP A  1 28  ? 34.283   42.068  -12.237 1.00 14.20 ? 37  TRP A CD1 1 
ATOM   167   C  CD2 . TRP A  1 28  ? 33.661   42.695  -10.185 1.00 14.21 ? 37  TRP A CD2 1 
ATOM   168   N  NE1 . TRP A  1 28  ? 34.180   40.919  -11.448 1.00 14.48 ? 37  TRP A NE1 1 
ATOM   169   C  CE2 . TRP A  1 28  ? 33.781   41.284  -10.191 1.00 13.96 ? 37  TRP A CE2 1 
ATOM   170   C  CE3 . TRP A  1 28  ? 33.259   43.333  -9.009  1.00 13.96 ? 37  TRP A CE3 1 
ATOM   171   C  CZ2 . TRP A  1 28  ? 33.525   40.511  -9.070  1.00 13.55 ? 37  TRP A CZ2 1 
ATOM   172   C  CZ3 . TRP A  1 28  ? 33.006   42.581  -7.913  1.00 14.00 ? 37  TRP A CZ3 1 
ATOM   173   C  CH2 . TRP A  1 28  ? 33.153   41.174  -7.933  1.00 14.26 ? 37  TRP A CH2 1 
ATOM   174   N  N   . ILE A  1 29  ? 32.121   47.227  -12.454 1.00 18.69 ? 38  ILE A N   1 
ATOM   175   C  CA  . ILE A  1 29  ? 31.864   48.619  -12.709 1.00 20.03 ? 38  ILE A CA  1 
ATOM   176   C  C   . ILE A  1 29  ? 32.214   49.409  -11.455 1.00 22.87 ? 38  ILE A C   1 
ATOM   177   O  O   . ILE A  1 29  ? 31.804   49.042  -10.356 1.00 23.59 ? 38  ILE A O   1 
ATOM   178   C  CB  . ILE A  1 29  ? 30.347   48.890  -12.990 1.00 21.88 ? 38  ILE A CB  1 
ATOM   179   C  CG1 . ILE A  1 29  ? 29.805   48.112  -14.192 1.00 24.32 ? 38  ILE A CG1 1 
ATOM   180   C  CG2 . ILE A  1 29  ? 30.060   50.373  -13.093 1.00 22.12 ? 38  ILE A CG2 1 
ATOM   181   C  CD1 . ILE A  1 29  ? 30.345   48.554  -15.510 1.00 25.24 ? 38  ILE A CD1 1 
ATOM   182   N  N   . GLU A  1 30  ? 32.936   50.504  -11.637 1.00 23.62 ? 39  GLU A N   1 
ATOM   183   C  CA  . GLU A  1 30  ? 33.335   51.358  -10.567 1.00 24.96 ? 39  GLU A CA  1 
ATOM   184   C  C   . GLU A  1 30  ? 32.253   52.358  -10.322 1.00 24.40 ? 39  GLU A C   1 
ATOM   185   O  O   . GLU A  1 30  ? 31.751   52.936  -11.233 1.00 26.48 ? 39  GLU A O   1 
ATOM   186   C  CB  . GLU A  1 30  ? 34.616   52.113  -10.918 1.00 30.23 ? 39  GLU A CB  1 
ATOM   187   C  CG  . GLU A  1 30  ? 35.895   51.331  -10.649 1.00 36.56 ? 39  GLU A CG  1 
ATOM   188   C  CD  . GLU A  1 30  ? 37.188   52.120  -10.993 1.00 44.88 ? 39  GLU A CD  1 
ATOM   189   O  OE1 . GLU A  1 30  ? 37.141   53.243  -11.574 1.00 48.18 ? 39  GLU A OE1 1 
ATOM   190   O  OE2 . GLU A  1 30  ? 38.285   51.586  -10.696 1.00 50.84 ? 39  GLU A OE2 1 
ATOM   191   N  N   . SER A  1 31  ? 31.878   52.544  -9.082  1.00 22.57 ? 40  SER A N   1 
ATOM   192   C  CA  . SER A  1 31  ? 30.971   53.610  -8.735  1.00 23.18 ? 40  SER A CA  1 
ATOM   193   C  C   . SER A  1 31  ? 31.645   54.964  -8.922  1.00 23.67 ? 40  SER A C   1 
ATOM   194   O  O   . SER A  1 31  ? 32.817   55.106  -8.629  1.00 24.58 ? 40  SER A O   1 
ATOM   195   C  CB  . SER A  1 31  ? 30.537   53.496  -7.285  1.00 21.97 ? 40  SER A CB  1 
ATOM   196   O  OG  . SER A  1 31  ? 29.851   54.666  -6.872  1.00 23.26 ? 40  SER A OG  1 
ATOM   197   N  N   . LYS A  1 32  ? 30.904   55.942  -9.423  1.00 24.76 ? 41  LYS A N   1 
ATOM   198   C  CA  . LYS A  1 32  ? 31.383   57.339  -9.501  1.00 25.35 ? 41  LYS A CA  1 
ATOM   199   C  C   . LYS A  1 32  ? 30.706   58.213  -8.469  1.00 29.73 ? 41  LYS A C   1 
ATOM   200   O  O   . LYS A  1 32  ? 30.733   59.430  -8.568  1.00 34.39 ? 41  LYS A O   1 
ATOM   201   C  CB  . LYS A  1 32  ? 31.177   57.916  -10.894 1.00 25.98 ? 41  LYS A CB  1 
ATOM   202   C  CG  . LYS A  1 32  ? 31.913   57.110  -12.006 1.00 25.72 ? 41  LYS A CG  1 
ATOM   203   N  N   . HIS A  1 33  ? 30.087   57.606  -7.464  1.00 28.60 ? 42  HIS A N   1 
ATOM   204   C  CA  . HIS A  1 33  ? 29.358   58.385  -6.455  1.00 27.61 ? 42  HIS A CA  1 
ATOM   205   C  C   . HIS A  1 33  ? 30.267   59.439  -5.814  1.00 27.77 ? 42  HIS A C   1 
ATOM   206   O  O   . HIS A  1 33  ? 29.832   60.516  -5.467  1.00 24.26 ? 42  HIS A O   1 
ATOM   207   C  CB  . HIS A  1 33  ? 28.774   57.469  -5.356  1.00 26.90 ? 42  HIS A CB  1 
ATOM   208   C  CG  . HIS A  1 33  ? 28.062   58.215  -4.275  1.00 28.15 ? 42  HIS A CG  1 
ATOM   209   N  ND1 . HIS A  1 33  ? 26.823   58.790  -4.466  1.00 26.84 ? 42  HIS A ND1 1 
ATOM   210   C  CD2 . HIS A  1 33  ? 28.441   58.541  -3.011  1.00 27.52 ? 42  HIS A CD2 1 
ATOM   211   C  CE1 . HIS A  1 33  ? 26.451   59.403  -3.355  1.00 26.25 ? 42  HIS A CE1 1 
ATOM   212   N  NE2 . HIS A  1 33  ? 27.410   59.262  -2.457  1.00 27.74 ? 42  HIS A NE2 1 
ATOM   213   N  N   . LYS A  1 34  ? 31.525   59.067  -5.640  1.00 31.01 ? 43  LYS A N   1 
ATOM   214   C  CA  . LYS A  1 34  ? 32.565   59.955  -5.167  1.00 32.53 ? 43  LYS A CA  1 
ATOM   215   C  C   . LYS A  1 34  ? 33.695   59.969  -6.166  1.00 29.88 ? 43  LYS A C   1 
ATOM   216   O  O   . LYS A  1 34  ? 33.825   59.030  -6.984  1.00 29.37 ? 43  LYS A O   1 
ATOM   217   C  CB  . LYS A  1 34  ? 33.109   59.498  -3.818  1.00 37.53 ? 43  LYS A CB  1 
ATOM   218   C  CG  . LYS A  1 34  ? 32.255   59.839  -2.626  1.00 43.03 ? 43  LYS A CG  1 
ATOM   219   C  CD  . LYS A  1 34  ? 32.981   59.172  -1.467  1.00 49.15 ? 43  LYS A CD  1 
ATOM   220   C  CE  . LYS A  1 34  ? 32.099   58.599  -0.394  1.00 51.09 ? 43  LYS A CE  1 
ATOM   221   N  NZ  . LYS A  1 34  ? 32.826   58.320  0.867   1.00 49.68 ? 43  LYS A NZ  1 
ATOM   222   N  N   . SER A  1 35  ? 34.533   61.017  -6.074  1.00 26.83 ? 44  SER A N   1 
ATOM   223   C  CA  . SER A  1 35  ? 35.682   61.185  -6.991  1.00 29.23 ? 44  SER A CA  1 
ATOM   224   C  C   . SER A  1 35  ? 36.975   60.504  -6.499  1.00 27.33 ? 44  SER A C   1 
ATOM   225   O  O   . SER A  1 35  ? 37.872   60.298  -7.284  1.00 27.31 ? 44  SER A O   1 
ATOM   226   C  CB  . SER A  1 35  ? 35.970   62.678  -7.239  1.00 30.78 ? 44  SER A CB  1 
ATOM   227   O  OG  . SER A  1 35  ? 36.487   63.299  -6.073  1.00 27.70 ? 44  SER A OG  1 
ATOM   228   N  N   . ASP A  1 36  ? 37.029   60.144  -5.206  1.00 27.20 ? 45  ASP A N   1 
ATOM   229   C  CA  . ASP A  1 36  ? 38.257   59.663  -4.527  1.00 26.37 ? 45  ASP A CA  1 
ATOM   230   C  C   . ASP A  1 36  ? 38.157   58.250  -3.947  1.00 24.45 ? 45  ASP A C   1 
ATOM   231   O  O   . ASP A  1 36  ? 38.846   57.913  -2.962  1.00 23.61 ? 45  ASP A O   1 
ATOM   232   C  CB  . ASP A  1 36  ? 38.646   60.629  -3.408  1.00 28.95 ? 45  ASP A CB  1 
ATOM   233   C  CG  . ASP A  1 36  ? 37.591   60.692  -2.293  1.00 32.53 ? 45  ASP A CG  1 
ATOM   234   O  OD1 . ASP A  1 36  ? 36.431   60.250  -2.515  1.00 39.70 ? 45  ASP A OD1 1 
ATOM   235   O  OD2 . ASP A  1 36  ? 37.922   61.173  -1.186  1.00 35.26 ? 45  ASP A OD2 1 
ATOM   236   N  N   . PHE A  1 37  ? 37.326   57.407  -4.559  1.00 22.78 ? 46  PHE A N   1 
ATOM   237   C  CA  . PHE A  1 37  ? 37.351   55.969  -4.249  1.00 21.95 ? 46  PHE A CA  1 
ATOM   238   C  C   . PHE A  1 37  ? 38.727   55.380  -4.552  1.00 21.07 ? 46  PHE A C   1 
ATOM   239   O  O   . PHE A  1 37  ? 39.343   55.709  -5.542  1.00 20.70 ? 46  PHE A O   1 
ATOM   240   C  CB  . PHE A  1 37  ? 36.302   55.171  -5.043  1.00 22.29 ? 46  PHE A CB  1 
ATOM   241   C  CG  . PHE A  1 37  ? 34.865   55.349  -4.574  1.00 22.11 ? 46  PHE A CG  1 
ATOM   242   C  CD1 . PHE A  1 37  ? 34.519   55.222  -3.220  1.00 22.38 ? 46  PHE A CD1 1 
ATOM   243   C  CD2 . PHE A  1 37  ? 33.851   55.575  -5.494  1.00 22.23 ? 46  PHE A CD2 1 
ATOM   244   C  CE1 . PHE A  1 37  ? 33.204   55.359  -2.799  1.00 21.59 ? 46  PHE A CE1 1 
ATOM   245   C  CE2 . PHE A  1 37  ? 32.528   55.707  -5.076  1.00 22.66 ? 46  PHE A CE2 1 
ATOM   246   C  CZ  . PHE A  1 37  ? 32.208   55.607  -3.730  1.00 21.08 ? 46  PHE A CZ  1 
ATOM   247   N  N   . GLY A  1 38  ? 39.182   54.458  -3.715  1.00 20.76 ? 47  GLY A N   1 
ATOM   248   C  CA  . GLY A  1 38  ? 40.363   53.655  -4.010  1.00 19.76 ? 47  GLY A CA  1 
ATOM   249   C  C   . GLY A  1 38  ? 40.139   52.757  -5.190  1.00 20.97 ? 47  GLY A C   1 
ATOM   250   O  O   . GLY A  1 38  ? 39.022   52.502  -5.563  1.00 22.23 ? 47  GLY A O   1 
ATOM   251   N  N   . LYS A  1 39  ? 41.207   52.271  -5.788  1.00 23.88 ? 48  LYS A N   1 
ATOM   252   C  CA  . LYS A  1 39  ? 41.129   51.428  -6.957  1.00 26.91 ? 48  LYS A CA  1 
ATOM   253   C  C   . LYS A  1 39  ? 41.492   50.001  -6.629  1.00 24.88 ? 48  LYS A C   1 
ATOM   254   O  O   . LYS A  1 39  ? 42.477   49.741  -5.936  1.00 23.00 ? 48  LYS A O   1 
ATOM   255   C  CB  . LYS A  1 39  ? 42.185   51.826  -8.004  1.00 33.80 ? 48  LYS A CB  1 
ATOM   256   C  CG  . LYS A  1 39  ? 41.974   53.056  -8.821  1.00 40.25 ? 48  LYS A CG  1 
ATOM   257   C  CD  . LYS A  1 39  ? 43.355   53.440  -9.366  1.00 45.60 ? 48  LYS A CD  1 
ATOM   258   C  CE  . LYS A  1 39  ? 43.489   54.856  -9.847  1.00 47.06 ? 48  LYS A CE  1 
ATOM   259   N  NZ  . LYS A  1 39  ? 44.447   55.060  -10.983 1.00 47.84 ? 48  LYS A NZ  1 
ATOM   260   N  N   . PHE A  1 40  ? 40.755   49.072  -7.203  1.00 23.39 ? 49  PHE A N   1 
ATOM   261   C  CA  . PHE A  1 40  ? 41.145   47.667  -7.194  1.00 21.99 ? 49  PHE A CA  1 
ATOM   262   C  C   . PHE A  1 40  ? 42.076   47.429  -8.334  1.00 21.53 ? 49  PHE A C   1 
ATOM   263   O  O   . PHE A  1 40  ? 41.904   47.982  -9.404  1.00 23.20 ? 49  PHE A O   1 
ATOM   264   C  CB  . PHE A  1 40  ? 39.931   46.698  -7.324  1.00 21.10 ? 49  PHE A CB  1 
ATOM   265   C  CG  . PHE A  1 40  ? 39.098   46.603  -6.094  1.00 21.04 ? 49  PHE A CG  1 
ATOM   266   C  CD1 . PHE A  1 40  ? 39.409   45.669  -5.081  1.00 20.49 ? 49  PHE A CD1 1 
ATOM   267   C  CD2 . PHE A  1 40  ? 38.015   47.441  -5.921  1.00 20.69 ? 49  PHE A CD2 1 
ATOM   268   C  CE1 . PHE A  1 40  ? 38.625   45.588  -3.925  1.00 21.14 ? 49  PHE A CE1 1 
ATOM   269   C  CE2 . PHE A  1 40  ? 37.220   47.351  -4.790  1.00 21.33 ? 49  PHE A CE2 1 
ATOM   270   C  CZ  . PHE A  1 40  ? 37.519   46.417  -3.791  1.00 21.27 ? 49  PHE A CZ  1 
ATOM   271   N  N   . VAL A  1 41  ? 43.041   46.535  -8.117  1.00 21.93 ? 50  VAL A N   1 
ATOM   272   C  CA  . VAL A  1 41  ? 43.906   46.043  -9.182  1.00 20.54 ? 50  VAL A CA  1 
ATOM   273   C  C   . VAL A  1 41  ? 43.885   44.535  -9.198  1.00 19.14 ? 50  VAL A C   1 
ATOM   274   O  O   . VAL A  1 41  ? 43.751   43.914  -8.172  1.00 20.47 ? 50  VAL A O   1 
ATOM   275   C  CB  . VAL A  1 41  ? 45.366   46.594  -9.091  1.00 21.40 ? 50  VAL A CB  1 
ATOM   276   C  CG1 . VAL A  1 41  ? 45.329   48.116  -9.154  1.00 21.44 ? 50  VAL A CG1 1 
ATOM   277   C  CG2 . VAL A  1 41  ? 46.113   46.122  -7.837  1.00 21.15 ? 50  VAL A CG2 1 
ATOM   278   N  N   . LEU A  1 42  ? 44.155   43.952  -10.349 1.00 18.73 ? 51  LEU A N   1 
ATOM   279   C  CA  . LEU A  1 42  ? 44.310   42.514  -10.442 1.00 17.30 ? 51  LEU A CA  1 
ATOM   280   C  C   . LEU A  1 42  ? 45.685   42.123  -9.951  1.00 17.33 ? 51  LEU A C   1 
ATOM   281   O  O   . LEU A  1 42  ? 46.689   42.591  -10.469 1.00 16.20 ? 51  LEU A O   1 
ATOM   282   C  CB  . LEU A  1 42  ? 44.106   42.051  -11.873 1.00 17.01 ? 51  LEU A CB  1 
ATOM   283   C  CG  . LEU A  1 42  ? 43.979   40.538  -12.015 1.00 19.11 ? 51  LEU A CG  1 
ATOM   284   C  CD1 . LEU A  1 42  ? 42.670   40.036  -11.421 1.00 19.16 ? 51  LEU A CD1 1 
ATOM   285   C  CD2 . LEU A  1 42  ? 44.077   40.129  -13.482 1.00 20.95 ? 51  LEU A CD2 1 
ATOM   286   N  N   . SER A  1 43  ? 45.732   41.180  -9.001  1.00 18.19 ? 52  SER A N   1 
ATOM   287   C  CA  . SER A  1 43  ? 47.004   40.715  -8.394  1.00 16.85 ? 52  SER A CA  1 
ATOM   288   C  C   . SER A  1 43  ? 46.885   39.405  -7.665  1.00 15.83 ? 52  SER A C   1 
ATOM   289   O  O   . SER A  1 43  ? 45.842   39.106  -7.072  1.00 16.25 ? 52  SER A O   1 
ATOM   290   C  CB  . SER A  1 43  ? 47.503   41.787  -7.407  1.00 17.67 ? 52  SER A CB  1 
ATOM   291   O  OG  . SER A  1 43  ? 48.806   41.489  -6.953  1.00 17.53 ? 52  SER A OG  1 
ATOM   292   N  N   . SER A  1 44  ? 47.962   38.627  -7.675  1.00 16.88 ? 53  SER A N   1 
ATOM   293   C  CA  . SER A  1 44  ? 48.108   37.429  -6.805  1.00 17.23 ? 53  SER A CA  1 
ATOM   294   C  C   . SER A  1 44  ? 49.070   37.694  -5.620  1.00 17.24 ? 53  SER A C   1 
ATOM   295   O  O   . SER A  1 44  ? 49.323   36.824  -4.817  1.00 17.38 ? 53  SER A O   1 
ATOM   296   C  CB  . SER A  1 44  ? 48.530   36.160  -7.544  1.00 16.61 ? 53  SER A CB  1 
ATOM   297   O  OG  . SER A  1 44  ? 49.642   36.357  -8.405  1.00 19.31 ? 53  SER A OG  1 
ATOM   298   N  N   . GLY A  1 45  ? 49.545   38.924  -5.500  1.00 18.40 ? 54  GLY A N   1 
ATOM   299   C  CA  . GLY A  1 45  ? 50.377   39.364  -4.349  1.00 17.46 ? 54  GLY A CA  1 
ATOM   300   C  C   . GLY A  1 45  ? 51.744   38.718  -4.307  1.00 18.99 ? 54  GLY A C   1 
ATOM   301   O  O   . GLY A  1 45  ? 52.203   38.128  -5.293  1.00 18.63 ? 54  GLY A O   1 
ATOM   302   N  N   . LYS A  1 46  ? 52.412   38.847  -3.169  1.00 21.18 ? 55  LYS A N   1 
ATOM   303   C  CA  . LYS A  1 46  ? 53.827   38.416  -3.033  1.00 22.68 ? 55  LYS A CA  1 
ATOM   304   C  C   . LYS A  1 46  ? 54.019   36.930  -2.873  1.00 20.19 ? 55  LYS A C   1 
ATOM   305   O  O   . LYS A  1 46  ? 55.034   36.394  -3.248  1.00 22.69 ? 55  LYS A O   1 
ATOM   306   C  CB  . LYS A  1 46  ? 54.486   39.034  -1.800  1.00 27.01 ? 55  LYS A CB  1 
ATOM   307   C  CG  . LYS A  1 46  ? 55.038   40.398  -2.002  1.00 30.21 ? 55  LYS A CG  1 
ATOM   308   C  CD  . LYS A  1 46  ? 56.365   40.518  -1.321  1.00 35.59 ? 55  LYS A CD  1 
ATOM   309   C  CE  . LYS A  1 46  ? 56.842   41.942  -1.115  1.00 38.81 ? 55  LYS A CE  1 
ATOM   310   N  NZ  . LYS A  1 46  ? 56.122   42.847  -2.026  1.00 39.93 ? 55  LYS A NZ  1 
ATOM   311   N  N   . PHE A  1 47  ? 53.065   36.284  -2.227  1.00 18.21 ? 56  PHE A N   1 
ATOM   312   C  CA  . PHE A  1 47  ? 53.037   34.824  -2.140  1.00 15.43 ? 56  PHE A CA  1 
ATOM   313   C  C   . PHE A  1 47  ? 51.656   34.294  -2.471  1.00 15.01 ? 56  PHE A C   1 
ATOM   314   O  O   . PHE A  1 47  ? 50.658   34.990  -2.365  1.00 15.99 ? 56  PHE A O   1 
ATOM   315   C  CB  . PHE A  1 47  ? 53.443   34.343  -0.759  1.00 15.33 ? 56  PHE A CB  1 
ATOM   316   C  CG  . PHE A  1 47  ? 52.562   34.844  0.348   1.00 14.62 ? 56  PHE A CG  1 
ATOM   317   C  CD1 . PHE A  1 47  ? 52.711   36.136  0.828   1.00 14.85 ? 56  PHE A CD1 1 
ATOM   318   C  CD2 . PHE A  1 47  ? 51.590   34.043  0.867   1.00 13.89 ? 56  PHE A CD2 1 
ATOM   319   C  CE1 . PHE A  1 47  ? 51.897   36.637  1.829   1.00 14.79 ? 56  PHE A CE1 1 
ATOM   320   C  CE2 . PHE A  1 47  ? 50.758   34.521  1.841   1.00 14.70 ? 56  PHE A CE2 1 
ATOM   321   C  CZ  . PHE A  1 47  ? 50.898   35.818  2.322   1.00 14.84 ? 56  PHE A CZ  1 
ATOM   322   N  N   . TYR A  1 48  ? 51.620   33.040  -2.890  1.00 15.47 ? 57  TYR A N   1 
ATOM   323   C  CA  . TYR A  1 48  ? 50.443   32.445  -3.508  1.00 14.94 ? 57  TYR A CA  1 
ATOM   324   C  C   . TYR A  1 48  ? 50.684   30.973  -3.693  1.00 14.69 ? 57  TYR A C   1 
ATOM   325   O  O   . TYR A  1 48  ? 51.782   30.488  -3.623  1.00 12.70 ? 57  TYR A O   1 
ATOM   326   C  CB  . TYR A  1 48  ? 50.168   33.063  -4.883  1.00 16.33 ? 57  TYR A CB  1 
ATOM   327   C  CG  . TYR A  1 48  ? 51.456   33.281  -5.696  1.00 16.41 ? 57  TYR A CG  1 
ATOM   328   C  CD1 . TYR A  1 48  ? 52.133   32.220  -6.285  1.00 17.17 ? 57  TYR A CD1 1 
ATOM   329   C  CD2 . TYR A  1 48  ? 51.995   34.560  -5.812  1.00 17.66 ? 57  TYR A CD2 1 
ATOM   330   C  CE1 . TYR A  1 48  ? 53.301   32.428  -6.986  1.00 17.21 ? 57  TYR A CE1 1 
ATOM   331   C  CE2 . TYR A  1 48  ? 53.132   34.781  -6.508  1.00 17.14 ? 57  TYR A CE2 1 
ATOM   332   C  CZ  . TYR A  1 48  ? 53.775   33.709  -7.077  1.00 17.19 ? 57  TYR A CZ  1 
ATOM   333   O  OH  . TYR A  1 48  ? 54.908   33.961  -7.728  1.00 23.19 ? 57  TYR A OH  1 
ATOM   334   N  N   . GLY A  1 49  ? 49.603   30.251  -3.904  1.00 14.93 ? 58  GLY A N   1 
ATOM   335   C  CA  . GLY A  1 49  ? 49.688   28.859  -4.273  1.00 14.97 ? 58  GLY A CA  1 
ATOM   336   C  C   . GLY A  1 49  ? 49.997   28.682  -5.737  1.00 15.26 ? 58  GLY A C   1 
ATOM   337   O  O   . GLY A  1 49  ? 50.743   27.807  -6.101  1.00 16.40 ? 58  GLY A O   1 
ATOM   338   N  N   . ASP A  1 50  ? 49.390   29.491  -6.575  1.00 16.86 ? 59  ASP A N   1 
ATOM   339   C  CA  . ASP A  1 50  ? 49.615   29.452  -8.041  1.00 17.72 ? 59  ASP A CA  1 
ATOM   340   C  C   . ASP A  1 50  ? 49.503   30.874  -8.558  1.00 17.52 ? 59  ASP A C   1 
ATOM   341   O  O   . ASP A  1 50  ? 48.490   31.547  -8.300  1.00 18.66 ? 59  ASP A O   1 
ATOM   342   C  CB  . ASP A  1 50  ? 48.587   28.613  -8.720  1.00 19.23 ? 59  ASP A CB  1 
ATOM   343   C  CG  . ASP A  1 50  ? 48.776   28.570  -10.252 1.00 21.48 ? 59  ASP A CG  1 
ATOM   344   O  OD1 . ASP A  1 50  ? 48.418   29.492  -11.047 1.00 19.85 ? 59  ASP A OD1 1 
ATOM   345   O  OD2 . ASP A  1 50  ? 49.301   27.552  -10.652 1.00 23.75 ? 59  ASP A OD2 1 
ATOM   346   N  N   . GLU A  1 51  ? 50.545   31.361  -9.225  1.00 17.04 ? 60  GLU A N   1 
ATOM   347   C  CA  . GLU A  1 51  ? 50.640   32.777  -9.577  1.00 17.77 ? 60  GLU A CA  1 
ATOM   348   C  C   . GLU A  1 51  ? 49.439   33.283  -10.374 1.00 17.72 ? 60  GLU A C   1 
ATOM   349   O  O   . GLU A  1 51  ? 49.033   34.457  -10.235 1.00 15.97 ? 60  GLU A O   1 
ATOM   350   C  CB  . GLU A  1 51  ? 51.926   33.060  -10.354 1.00 19.69 ? 60  GLU A CB  1 
ATOM   351   C  CG  . GLU A  1 51  ? 52.255   34.554  -10.461 1.00 22.62 ? 60  GLU A CG  1 
ATOM   352   C  CD  . GLU A  1 51  ? 53.605   34.874  -11.119 1.00 25.13 ? 60  GLU A CD  1 
ATOM   353   O  OE1 . GLU A  1 51  ? 54.278   33.941  -11.578 1.00 29.04 ? 60  GLU A OE1 1 
ATOM   354   O  OE2 . GLU A  1 51  ? 54.011   36.056  -11.134 1.00 27.06 ? 60  GLU A OE2 1 
ATOM   355   N  N   . GLU A  1 52  ? 48.896   32.410  -11.210 1.00 16.46 ? 61  GLU A N   1 
ATOM   356   C  CA  . GLU A  1 52  ? 47.768   32.778  -12.101 1.00 17.55 ? 61  GLU A CA  1 
ATOM   357   C  C   . GLU A  1 52  ? 46.407   32.505  -11.460 1.00 16.94 ? 61  GLU A C   1 
ATOM   358   O  O   . GLU A  1 52  ? 45.557   33.397  -11.415 1.00 16.72 ? 61  GLU A O   1 
ATOM   359   C  CB  . GLU A  1 52  ? 47.844   32.027  -13.466 1.00 20.37 ? 61  GLU A CB  1 
ATOM   360   C  CG  . GLU A  1 52  ? 48.990   32.475  -14.358 1.00 23.35 ? 61  GLU A CG  1 
ATOM   361   C  CD  . GLU A  1 52  ? 49.255   33.989  -14.402 1.00 26.20 ? 61  GLU A CD  1 
ATOM   362   O  OE1 . GLU A  1 52  ? 48.318   34.821  -14.530 1.00 25.30 ? 61  GLU A OE1 1 
ATOM   363   O  OE2 . GLU A  1 52  ? 50.460   34.368  -14.275 1.00 34.00 ? 61  GLU A OE2 1 
ATOM   364   N  N   . LYS A  1 53  ? 46.214   31.308  -10.908 1.00 16.69 ? 62  LYS A N   1 
ATOM   365   C  CA  . LYS A  1 53  ? 44.932   30.975  -10.277 1.00 18.35 ? 62  LYS A CA  1 
ATOM   366   C  C   . LYS A  1 53  ? 44.551   31.946  -9.181  1.00 17.48 ? 62  LYS A C   1 
ATOM   367   O  O   . LYS A  1 53  ? 43.383   32.341  -9.061  1.00 16.89 ? 62  LYS A O   1 
ATOM   368   C  CB  . LYS A  1 53  ? 44.933   29.572  -9.722  1.00 17.86 ? 62  LYS A CB  1 
ATOM   369   C  CG  . LYS A  1 53  ? 45.004   28.494  -10.771 1.00 19.44 ? 62  LYS A CG  1 
ATOM   370   C  CD  . LYS A  1 53  ? 45.003   27.128  -10.103 1.00 19.66 ? 62  LYS A CD  1 
ATOM   371   C  CE  . LYS A  1 53  ? 45.271   26.059  -11.123 1.00 21.17 ? 62  LYS A CE  1 
ATOM   372   N  NZ  . LYS A  1 53  ? 45.538   24.783  -10.349 1.00 21.76 ? 62  LYS A NZ  1 
ATOM   373   N  N   . ASP A  1 54  ? 45.548   32.372  -8.416  1.00 16.42 ? 63  ASP A N   1 
ATOM   374   C  CA  . ASP A  1 54  ? 45.305   33.130  -7.205  1.00 16.31 ? 63  ASP A CA  1 
ATOM   375   C  C   . ASP A  1 54  ? 45.249   34.609  -7.431  1.00 17.81 ? 63  ASP A C   1 
ATOM   376   O  O   . ASP A  1 54  ? 45.235   35.416  -6.485  1.00 18.31 ? 63  ASP A O   1 
ATOM   377   C  CB  . ASP A  1 54  ? 46.285   32.712  -6.109  1.00 16.52 ? 63  ASP A CB  1 
ATOM   378   C  CG  . ASP A  1 54  ? 46.027   31.264  -5.639  1.00 17.83 ? 63  ASP A CG  1 
ATOM   379   O  OD1 . ASP A  1 54  ? 44.825   30.943  -5.348  1.00 18.92 ? 63  ASP A OD1 1 
ATOM   380   O  OD2 . ASP A  1 54  ? 46.992   30.449  -5.524  1.00 20.03 ? 63  ASP A OD2 1 
ATOM   381   N  N   . LYS A  1 55  ? 45.142   35.002  -8.690  1.00 19.54 ? 64  LYS A N   1 
ATOM   382   C  CA  . LYS A  1 55  ? 44.804   36.386  -8.981  1.00 20.50 ? 64  LYS A CA  1 
ATOM   383   C  C   . LYS A  1 55  ? 43.367   36.712  -8.549  1.00 18.24 ? 64  LYS A C   1 
ATOM   384   O  O   . LYS A  1 55  ? 42.438   35.968  -8.815  1.00 14.83 ? 64  LYS A O   1 
ATOM   385   C  CB  . LYS A  1 55  ? 44.960   36.698  -10.465 1.00 24.59 ? 64  LYS A CB  1 
ATOM   386   C  CG  . LYS A  1 55  ? 46.360   36.536  -11.001 1.00 27.87 ? 64  LYS A CG  1 
ATOM   387   C  CD  . LYS A  1 55  ? 46.730   37.663  -11.926 1.00 31.14 ? 64  LYS A CD  1 
ATOM   388   C  CE  . LYS A  1 55  ? 48.161   37.512  -12.409 1.00 33.30 ? 64  LYS A CE  1 
ATOM   389   N  NZ  . LYS A  1 55  ? 48.334   37.086  -13.809 1.00 37.53 ? 64  LYS A NZ  1 
ATOM   390   N  N   . GLY A  1 56  ? 43.227   37.887  -7.945  1.00 16.26 ? 65  GLY A N   1 
ATOM   391   C  CA  . GLY A  1 56  ? 41.936   38.429  -7.576  1.00 15.16 ? 65  GLY A CA  1 
ATOM   392   C  C   . GLY A  1 56  ? 41.985   39.932  -7.471  1.00 13.89 ? 65  GLY A C   1 
ATOM   393   O  O   . GLY A  1 56  ? 42.941   40.564  -7.852  1.00 14.15 ? 65  GLY A O   1 
ATOM   394   N  N   . LEU A  1 57  ? 40.958   40.513  -6.920  1.00 14.23 ? 66  LEU A N   1 
ATOM   395   C  CA  . LEU A  1 57  ? 40.877   41.953  -6.821  1.00 14.77 ? 66  LEU A CA  1 
ATOM   396   C  C   . LEU A  1 57  ? 41.524   42.434  -5.559  1.00 14.42 ? 66  LEU A C   1 
ATOM   397   O  O   . LEU A  1 57  ? 41.164   41.980  -4.484  1.00 14.47 ? 66  LEU A O   1 
ATOM   398   C  CB  . LEU A  1 57  ? 39.450   42.442  -6.796  1.00 15.32 ? 66  LEU A CB  1 
ATOM   399   C  CG  . LEU A  1 57  ? 38.650   42.168  -8.028  1.00 16.16 ? 66  LEU A CG  1 
ATOM   400   C  CD1 . LEU A  1 57  ? 37.161   42.405  -7.748  1.00 16.94 ? 66  LEU A CD1 1 
ATOM   401   C  CD2 . LEU A  1 57  ? 39.110   43.078  -9.158  1.00 18.70 ? 66  LEU A CD2 1 
ATOM   402   N  N   . GLN A  1 58  ? 42.498   43.330  -5.704  1.00 14.22 ? 67  GLN A N   1 
ATOM   403   C  CA  . GLN A  1 58  ? 43.299   43.751  -4.600  1.00 14.84 ? 67  GLN A CA  1 
ATOM   404   C  C   . GLN A  1 58  ? 43.080   45.204  -4.362  1.00 14.10 ? 67  GLN A C   1 
ATOM   405   O  O   . GLN A  1 58  ? 43.222   45.995  -5.262  1.00 15.05 ? 67  GLN A O   1 
ATOM   406   C  CB  . GLN A  1 58  ? 44.794   43.451  -4.854  1.00 18.06 ? 67  GLN A CB  1 
ATOM   407   C  CG  . GLN A  1 58  ? 45.726   43.855  -3.670  1.00 20.20 ? 67  GLN A CG  1 
ATOM   408   C  CD  . GLN A  1 58  ? 47.172   43.530  -3.900  1.00 20.36 ? 67  GLN A CD  1 
ATOM   409   O  OE1 . GLN A  1 58  ? 47.733   43.854  -4.951  1.00 26.82 ? 67  GLN A OE1 1 
ATOM   410   N  NE2 . GLN A  1 58  ? 47.794   42.903  -2.937  1.00 21.33 ? 67  GLN A NE2 1 
ATOM   411   N  N   . THR A  1 59  ? 42.774   45.567  -3.128  1.00 13.20 ? 68  THR A N   1 
ATOM   412   C  CA  . THR A  1 59  ? 42.762   46.967  -2.753  1.00 14.28 ? 68  THR A CA  1 
ATOM   413   C  C   . THR A  1 59  ? 44.200   47.578  -2.831  1.00 14.83 ? 68  THR A C   1 
ATOM   414   O  O   . THR A  1 59  ? 45.151   46.988  -2.291  1.00 14.38 ? 68  THR A O   1 
ATOM   415   C  CB  . THR A  1 59  ? 42.208   47.185  -1.340  1.00 14.71 ? 68  THR A CB  1 
ATOM   416   O  OG1 . THR A  1 59  ? 42.945   46.407  -0.404  1.00 15.40 ? 68  THR A OG1 1 
ATOM   417   C  CG2 . THR A  1 59  ? 40.743   46.789  -1.281  1.00 14.88 ? 68  THR A CG2 1 
ATOM   418   N  N   . SER A  1 60  ? 44.341   48.714  -3.541  1.00 13.89 ? 69  SER A N   1 
ATOM   419   C  CA  . SER A  1 60  ? 45.653   49.243  -3.916  1.00 14.18 ? 69  SER A CA  1 
ATOM   420   C  C   . SER A  1 60  ? 46.017   50.539  -3.238  1.00 14.58 ? 69  SER A C   1 
ATOM   421   O  O   . SER A  1 60  ? 47.091   51.049  -3.469  1.00 16.66 ? 69  SER A O   1 
ATOM   422   C  CB  . SER A  1 60  ? 45.735   49.452  -5.435  1.00 14.93 ? 69  SER A CB  1 
ATOM   423   O  OG  . SER A  1 60  ? 45.068   50.685  -5.754  1.00 16.10 ? 69  SER A OG  1 
ATOM   424   N  N   . GLN A  1 61  ? 45.147   51.088  -2.409  1.00 15.31 ? 70  GLN A N   1 
ATOM   425   C  CA  . GLN A  1 61  ? 45.401   52.375  -1.773  1.00 16.21 ? 70  GLN A CA  1 
ATOM   426   C  C   . GLN A  1 61  ? 44.936   52.433  -0.331  1.00 17.08 ? 70  GLN A C   1 
ATOM   427   O  O   . GLN A  1 61  ? 43.840   51.988  0.010   1.00 17.07 ? 70  GLN A O   1 
ATOM   428   C  CB  . GLN A  1 61  ? 44.687   53.532  -2.497  1.00 15.70 ? 70  GLN A CB  1 
ATOM   429   C  CG  . GLN A  1 61  ? 45.078   53.693  -3.953  1.00 17.55 ? 70  GLN A CG  1 
ATOM   430   C  CD  . GLN A  1 61  ? 44.240   54.730  -4.685  1.00 17.17 ? 70  GLN A CD  1 
ATOM   431   O  OE1 . GLN A  1 61  ? 44.338   55.932  -4.422  1.00 20.81 ? 70  GLN A OE1 1 
ATOM   432   N  NE2 . GLN A  1 61  ? 43.420   54.268  -5.589  1.00 16.49 ? 70  GLN A NE2 1 
ATOM   433   N  N   . LYS A  1 62  ? 45.733   53.112  0.457   1.00 16.30 ? 71  LYS A N   1 
ATOM   434   C  CA  . LYS A  1 62  ? 45.557   53.180  1.865   1.00 18.75 ? 71  LYS A CA  1 
ATOM   435   C  C   . LYS A  1 62  ? 44.526   54.227  2.249   1.00 17.97 ? 71  LYS A C   1 
ATOM   436   O  O   . LYS A  1 62  ? 44.414   55.245  1.592   1.00 17.82 ? 71  LYS A O   1 
ATOM   437   C  CB  . LYS A  1 62  ? 46.925   53.459  2.521   1.00 20.79 ? 71  LYS A CB  1 
ATOM   438   C  CG  . LYS A  1 62  ? 46.875   53.590  4.022   1.00 22.99 ? 71  LYS A CG  1 
ATOM   439   C  CD  . LYS A  1 62  ? 48.261   53.538  4.647   1.00 25.49 ? 71  LYS A CD  1 
ATOM   440   C  CE  . LYS A  1 62  ? 48.116   53.715  6.165   1.00 28.72 ? 71  LYS A CE  1 
ATOM   441   N  NZ  . LYS A  1 62  ? 49.379   54.097  6.845   1.00 30.38 ? 71  LYS A NZ  1 
ATOM   442   N  N   . ALA A  1 63  ? 43.794   53.950  3.314   1.00 17.07 ? 72  ALA A N   1 
ATOM   443   C  CA  . ALA A  1 63  ? 42.816   54.861  3.859   1.00 18.80 ? 72  ALA A CA  1 
ATOM   444   C  C   . ALA A  1 63  ? 41.875   55.347  2.768   1.00 21.40 ? 72  ALA A C   1 
ATOM   445   O  O   . ALA A  1 63  ? 41.800   56.532  2.470   1.00 20.11 ? 72  ALA A O   1 
ATOM   446   C  CB  . ALA A  1 63  ? 43.473   56.044  4.583   1.00 18.78 ? 72  ALA A CB  1 
ATOM   447   N  N   . ARG A  1 64  ? 41.114   54.414  2.214   1.00 22.49 ? 73  ARG A N   1 
ATOM   448   C  CA  . ARG A  1 64  ? 40.143   54.730  1.182   1.00 23.40 ? 73  ARG A CA  1 
ATOM   449   C  C   . ARG A  1 64  ? 38.868   53.910  1.297   1.00 22.39 ? 73  ARG A C   1 
ATOM   450   O  O   . ARG A  1 64  ? 38.871   52.777  1.790   1.00 20.18 ? 73  ARG A O   1 
ATOM   451   C  CB  . ARG A  1 64  ? 40.763   54.468  -0.211  1.00 26.27 ? 73  ARG A CB  1 
ATOM   452   C  CG  . ARG A  1 64  ? 41.903   55.409  -0.548  1.00 27.85 ? 73  ARG A CG  1 
ATOM   453   C  CD  . ARG A  1 64  ? 41.356   56.798  -0.841  1.00 29.02 ? 73  ARG A CD  1 
ATOM   454   N  NE  . ARG A  1 64  ? 42.413   57.773  -0.776  1.00 34.99 ? 73  ARG A NE  1 
ATOM   455   C  CZ  . ARG A  1 64  ? 43.104   58.191  -1.810  1.00 37.59 ? 73  ARG A CZ  1 
ATOM   456   N  NH1 . ARG A  1 64  ? 42.805   57.758  -3.026  1.00 42.06 ? 73  ARG A NH1 1 
ATOM   457   N  NH2 . ARG A  1 64  ? 44.067   59.078  -1.629  1.00 39.37 ? 73  ARG A NH2 1 
ATOM   458   N  N   . PHE A  1 65  ? 37.805   54.497  0.758   1.00 21.73 ? 74  PHE A N   1 
ATOM   459   C  CA  . PHE A  1 65  ? 36.591   53.779  0.443   1.00 20.19 ? 74  PHE A CA  1 
ATOM   460   C  C   . PHE A  1 65  ? 36.717   53.126  -0.899  1.00 17.62 ? 74  PHE A C   1 
ATOM   461   O  O   . PHE A  1 65  ? 37.313   53.672  -1.819  1.00 19.47 ? 74  PHE A O   1 
ATOM   462   C  CB  . PHE A  1 65  ? 35.373   54.684  0.458   1.00 20.58 ? 74  PHE A CB  1 
ATOM   463   C  CG  . PHE A  1 65  ? 35.018   55.160  1.815   1.00 22.66 ? 74  PHE A CG  1 
ATOM   464   C  CD1 . PHE A  1 65  ? 34.301   54.355  2.690   1.00 22.94 ? 74  PHE A CD1 1 
ATOM   465   C  CD2 . PHE A  1 65  ? 35.379   56.444  2.222   1.00 22.86 ? 74  PHE A CD2 1 
ATOM   466   C  CE1 . PHE A  1 65  ? 33.971   54.806  3.968   1.00 24.78 ? 74  PHE A CE1 1 
ATOM   467   C  CE2 . PHE A  1 65  ? 35.039   56.913  3.484   1.00 25.42 ? 74  PHE A CE2 1 
ATOM   468   C  CZ  . PHE A  1 65  ? 34.341   56.094  4.371   1.00 25.75 ? 74  PHE A CZ  1 
ATOM   469   N  N   . TYR A  1 66  ? 36.123   51.955  -1.012  1.00 15.18 ? 75  TYR A N   1 
ATOM   470   C  CA  . TYR A  1 66  ? 36.089   51.208  -2.268  1.00 15.18 ? 75  TYR A CA  1 
ATOM   471   C  C   . TYR A  1 66  ? 34.617   50.900  -2.651  1.00 14.77 ? 75  TYR A C   1 
ATOM   472   O  O   . TYR A  1 66  ? 33.743   50.827  -1.823  1.00 11.98 ? 75  TYR A O   1 
ATOM   473   C  CB  . TYR A  1 66  ? 36.848   49.906  -2.122  1.00 15.23 ? 75  TYR A CB  1 
ATOM   474   C  CG  . TYR A  1 66  ? 38.318   50.111  -1.947  1.00 14.84 ? 75  TYR A CG  1 
ATOM   475   C  CD1 . TYR A  1 66  ? 38.848   50.477  -0.720  1.00 15.36 ? 75  TYR A CD1 1 
ATOM   476   C  CD2 . TYR A  1 66  ? 39.171   49.936  -3.000  1.00 14.65 ? 75  TYR A CD2 1 
ATOM   477   C  CE1 . TYR A  1 66  ? 40.211   50.704  -0.569  1.00 15.07 ? 75  TYR A CE1 1 
ATOM   478   C  CE2 . TYR A  1 66  ? 40.528   50.136  -2.858  1.00 15.48 ? 75  TYR A CE2 1 
ATOM   479   C  CZ  . TYR A  1 66  ? 41.047   50.492  -1.644  1.00 14.86 ? 75  TYR A CZ  1 
ATOM   480   O  OH  . TYR A  1 66  ? 42.409   50.704  -1.556  1.00 16.13 ? 75  TYR A OH  1 
ATOM   481   N  N   . ALA A  1 67  ? 34.382   50.787  -3.950  1.00 15.95 ? 76  ALA A N   1 
ATOM   482   C  CA  . ALA A  1 67  ? 33.048   50.641  -4.478  1.00 15.23 ? 76  ALA A CA  1 
ATOM   483   C  C   . ALA A  1 67  ? 33.133   50.130  -5.885  1.00 15.66 ? 76  ALA A C   1 
ATOM   484   O  O   . ALA A  1 67  ? 33.151   50.884  -6.839  1.00 14.69 ? 76  ALA A O   1 
ATOM   485   C  CB  . ALA A  1 67  ? 32.298   51.952  -4.412  1.00 15.73 ? 76  ALA A CB  1 
ATOM   486   N  N   . LEU A  1 68  ? 33.200   48.809  -6.004  1.00 15.78 ? 77  LEU A N   1 
ATOM   487   C  CA  . LEU A  1 68  ? 33.220   48.140  -7.280  1.00 15.28 ? 77  LEU A CA  1 
ATOM   488   C  C   . LEU A  1 68  ? 32.142   47.026  -7.244  1.00 15.67 ? 77  LEU A C   1 
ATOM   489   O  O   . LEU A  1 68  ? 31.995   46.348  -6.253  1.00 15.70 ? 77  LEU A O   1 
ATOM   490   C  CB  . LEU A  1 68  ? 34.598   47.539  -7.481  1.00 16.73 ? 77  LEU A CB  1 
ATOM   491   C  CG  . LEU A  1 68  ? 34.890   46.895  -8.831  1.00 18.09 ? 77  LEU A CG  1 
ATOM   492   C  CD1 . LEU A  1 68  ? 35.225   47.952  -9.880  1.00 18.39 ? 77  LEU A CD1 1 
ATOM   493   C  CD2 . LEU A  1 68  ? 36.001   45.894  -8.741  1.00 19.02 ? 77  LEU A CD2 1 
ATOM   494   N  N   . SER A  1 69  ? 31.461   46.773  -8.353  1.00 16.45 ? 78  SER A N   1 
ATOM   495   C  CA  . SER A  1 69  ? 30.396   45.779  -8.381  1.00 16.70 ? 78  SER A CA  1 
ATOM   496   C  C   . SER A  1 69  ? 30.248   45.061  -9.681  1.00 17.93 ? 78  SER A C   1 
ATOM   497   O  O   . SER A  1 69  ? 30.682   45.525  -10.742 1.00 19.67 ? 78  SER A O   1 
ATOM   498   C  CB  . SER A  1 69  ? 29.053   46.383  -7.959  1.00 17.17 ? 78  SER A CB  1 
ATOM   499   O  OG  . SER A  1 69  ? 28.628   47.418  -8.816  1.00 17.26 ? 78  SER A OG  1 
ATOM   500   N  N   . ALA A  1 70  ? 29.642   43.889  -9.595  1.00 19.23 ? 79  ALA A N   1 
ATOM   501   C  CA  . ALA A  1 70  ? 29.387   43.033  -10.744 1.00 18.85 ? 79  ALA A CA  1 
ATOM   502   C  C   . ALA A  1 70  ? 27.917   42.622  -10.790 1.00 20.59 ? 79  ALA A C   1 
ATOM   503   O  O   . ALA A  1 70  ? 27.340   42.107  -9.807  1.00 19.52 ? 79  ALA A O   1 
ATOM   504   C  CB  . ALA A  1 70  ? 30.251   41.784  -10.686 1.00 19.01 ? 79  ALA A CB  1 
ATOM   505   N  N   . SER A  1 71  ? 27.337   42.768  -11.980 1.00 21.24 ? 80  SER A N   1 
ATOM   506   C  CA  . SER A  1 71  ? 25.994   42.266  -12.298 1.00 21.08 ? 80  SER A CA  1 
ATOM   507   C  C   . SER A  1 71  ? 25.946   40.894  -12.768 1.00 21.27 ? 80  SER A C   1 
ATOM   508   O  O   . SER A  1 71  ? 26.856   40.426  -13.377 1.00 20.90 ? 80  SER A O   1 
ATOM   509   C  CB  . SER A  1 71  ? 25.511   42.931  -13.570 1.00 22.19 ? 80  SER A CB  1 
ATOM   510   O  OG  . SER A  1 71  ? 25.219   44.200  -13.260 1.00 24.97 ? 80  SER A OG  1 
ATOM   511   N  N   . PHE A  1 72  ? 24.778   40.303  -12.599 1.00 22.37 ? 81  PHE A N   1 
ATOM   512   C  CA  . PHE A  1 72  ? 24.502   38.984  -13.118 1.00 21.28 ? 81  PHE A CA  1 
ATOM   513   C  C   . PHE A  1 72  ? 23.017   38.943  -13.460 1.00 21.66 ? 81  PHE A C   1 
ATOM   514   O  O   . PHE A  1 72  ? 22.233   39.767  -12.993 1.00 20.05 ? 81  PHE A O   1 
ATOM   515   C  CB  . PHE A  1 72  ? 24.911   37.906  -12.092 1.00 20.84 ? 81  PHE A CB  1 
ATOM   516   C  CG  . PHE A  1 72  ? 24.487   38.213  -10.683 1.00 22.10 ? 81  PHE A CG  1 
ATOM   517   C  CD1 . PHE A  1 72  ? 23.192   37.927  -10.234 1.00 22.66 ? 81  PHE A CD1 1 
ATOM   518   C  CD2 . PHE A  1 72  ? 25.384   38.779  -9.785  1.00 22.96 ? 81  PHE A CD2 1 
ATOM   519   C  CE1 . PHE A  1 72  ? 22.811   38.196  -8.931  1.00 23.03 ? 81  PHE A CE1 1 
ATOM   520   C  CE2 . PHE A  1 72  ? 25.008   39.059  -8.480  1.00 23.12 ? 81  PHE A CE2 1 
ATOM   521   C  CZ  . PHE A  1 72  ? 23.717   38.759  -8.052  1.00 24.52 ? 81  PHE A CZ  1 
ATOM   522   N  N   . GLU A  1 73  ? 22.650   37.937  -14.226 1.00 26.30 ? 82  GLU A N   1 
ATOM   523   C  CA  . GLU A  1 73  ? 21.252   37.615  -14.509 1.00 29.60 ? 82  GLU A CA  1 
ATOM   524   C  C   . GLU A  1 73  ? 20.451   37.538  -13.188 1.00 26.89 ? 82  GLU A C   1 
ATOM   525   O  O   . GLU A  1 73  ? 20.732   36.693  -12.337 1.00 25.97 ? 82  GLU A O   1 
ATOM   526   C  CB  . GLU A  1 73  ? 21.175   36.283  -15.293 1.00 31.95 ? 82  GLU A CB  1 
ATOM   527   C  CG  . GLU A  1 73  ? 19.797   35.887  -15.811 1.00 37.64 ? 82  GLU A CG  1 
ATOM   528   C  CD  . GLU A  1 73  ? 19.150   36.888  -16.771 1.00 44.57 ? 82  GLU A CD  1 
ATOM   529   O  OE1 . GLU A  1 73  ? 19.856   37.654  -17.481 1.00 56.29 ? 82  GLU A OE1 1 
ATOM   530   O  OE2 . GLU A  1 73  ? 17.902   36.945  -16.780 1.00 43.91 ? 82  GLU A OE2 1 
ATOM   531   N  N   . PRO A  1 74  ? 19.484   38.446  -13.018 1.00 24.31 ? 83  PRO A N   1 
ATOM   532   C  CA  . PRO A  1 74  ? 18.744   38.468  -11.758 1.00 25.37 ? 83  PRO A CA  1 
ATOM   533   C  C   . PRO A  1 74  ? 18.047   37.165  -11.386 1.00 25.53 ? 83  PRO A C   1 
ATOM   534   O  O   . PRO A  1 74  ? 17.731   36.348  -12.234 1.00 29.49 ? 83  PRO A O   1 
ATOM   535   C  CB  . PRO A  1 74  ? 17.710   39.572  -11.964 1.00 25.29 ? 83  PRO A CB  1 
ATOM   536   C  CG  . PRO A  1 74  ? 18.275   40.438  -13.043 1.00 24.86 ? 83  PRO A CG  1 
ATOM   537   C  CD  . PRO A  1 74  ? 19.118   39.562  -13.905 1.00 23.37 ? 83  PRO A CD  1 
ATOM   538   N  N   . PHE A  1 75  ? 17.868   36.959  -10.097 1.00 24.88 ? 84  PHE A N   1 
ATOM   539   C  CA  . PHE A  1 75  ? 17.204   35.778  -9.586  1.00 22.29 ? 84  PHE A CA  1 
ATOM   540   C  C   . PHE A  1 75  ? 16.588   36.113  -8.236  1.00 22.03 ? 84  PHE A C   1 
ATOM   541   O  O   . PHE A  1 75  ? 16.894   37.134  -7.616  1.00 21.36 ? 84  PHE A O   1 
ATOM   542   C  CB  . PHE A  1 75  ? 18.176   34.594  -9.478  1.00 23.42 ? 84  PHE A CB  1 
ATOM   543   C  CG  . PHE A  1 75  ? 19.105   34.659  -8.263  1.00 25.84 ? 84  PHE A CG  1 
ATOM   544   C  CD1 . PHE A  1 75  ? 20.291   35.406  -8.304  1.00 26.41 ? 84  PHE A CD1 1 
ATOM   545   C  CD2 . PHE A  1 75  ? 18.826   33.941  -7.117  1.00 25.15 ? 84  PHE A CD2 1 
ATOM   546   C  CE1 . PHE A  1 75  ? 21.139   35.449  -7.209  1.00 26.33 ? 84  PHE A CE1 1 
ATOM   547   C  CE2 . PHE A  1 75  ? 19.671   33.991  -6.017  1.00 27.44 ? 84  PHE A CE2 1 
ATOM   548   C  CZ  . PHE A  1 75  ? 20.823   34.751  -6.061  1.00 27.24 ? 84  PHE A CZ  1 
ATOM   549   N  N   . SER A  1 76  ? 15.734   35.208  -7.788  1.00 22.50 ? 85  SER A N   1 
ATOM   550   C  CA  . SER A  1 76  ? 15.147   35.244  -6.457  1.00 21.79 ? 85  SER A CA  1 
ATOM   551   C  C   . SER A  1 76  ? 15.489   33.955  -5.735  1.00 19.15 ? 85  SER A C   1 
ATOM   552   O  O   . SER A  1 76  ? 15.617   32.913  -6.344  1.00 19.41 ? 85  SER A O   1 
ATOM   553   C  CB  . SER A  1 76  ? 13.631   35.379  -6.570  1.00 22.69 ? 85  SER A CB  1 
ATOM   554   O  OG  . SER A  1 76  ? 13.034   35.401  -5.287  1.00 21.63 ? 85  SER A OG  1 
ATOM   555   N  N   . ASN A  1 77  ? 15.679   34.024  -4.427  1.00 19.56 ? 86  ASN A N   1 
ATOM   556   C  CA  . ASN A  1 77  ? 15.944   32.811  -3.622  1.00 18.52 ? 86  ASN A CA  1 
ATOM   557   C  C   . ASN A  1 77  ? 14.678   32.191  -3.050  1.00 20.46 ? 86  ASN A C   1 
ATOM   558   O  O   . ASN A  1 77  ? 14.735   31.252  -2.218  1.00 19.67 ? 86  ASN A O   1 
ATOM   559   C  CB  . ASN A  1 77  ? 16.951   33.099  -2.475  1.00 18.29 ? 86  ASN A CB  1 
ATOM   560   C  CG  . ASN A  1 77  ? 16.467   34.138  -1.522  1.00 16.40 ? 86  ASN A CG  1 
ATOM   561   O  OD1 . ASN A  1 77  ? 15.843   35.099  -1.945  1.00 18.81 ? 86  ASN A OD1 1 
ATOM   562   N  ND2 . ASN A  1 77  ? 16.803   34.005  -0.233  1.00 16.39 ? 86  ASN A ND2 1 
ATOM   563   N  N   . LYS A  1 78  ? 13.543   32.798  -3.398  1.00 22.18 ? 87  LYS A N   1 
ATOM   564   C  CA  . LYS A  1 78  ? 12.247   32.372  -2.885  1.00 23.66 ? 87  LYS A CA  1 
ATOM   565   C  C   . LYS A  1 78  ? 12.040   30.876  -3.116  1.00 21.20 ? 87  LYS A C   1 
ATOM   566   O  O   . LYS A  1 78  ? 12.213   30.400  -4.197  1.00 18.25 ? 87  LYS A O   1 
ATOM   567   C  CB  . LYS A  1 78  ? 11.162   33.190  -3.546  1.00 27.31 ? 87  LYS A CB  1 
ATOM   568   C  CG  . LYS A  1 78  ? 9.705    32.743  -3.356  1.00 33.60 ? 87  LYS A CG  1 
ATOM   569   C  CD  . LYS A  1 78  ? 8.918    34.038  -3.322  1.00 37.60 ? 87  LYS A CD  1 
ATOM   570   C  CE  . LYS A  1 78  ? 7.430    33.896  -3.389  1.00 38.28 ? 87  LYS A CE  1 
ATOM   571   N  NZ  . LYS A  1 78  ? 6.872    32.995  -2.362  1.00 41.37 ? 87  LYS A NZ  1 
ATOM   572   N  N   . GLY A  1 79  ? 11.746   30.146  -2.051  1.00 19.15 ? 88  GLY A N   1 
ATOM   573   C  CA  . GLY A  1 79  ? 11.577   28.706  -2.168  1.00 19.69 ? 88  GLY A CA  1 
ATOM   574   C  C   . GLY A  1 79  ? 12.851   27.893  -2.371  1.00 20.61 ? 88  GLY A C   1 
ATOM   575   O  O   . GLY A  1 79  ? 12.787   26.673  -2.513  1.00 21.94 ? 88  GLY A O   1 
ATOM   576   N  N   . GLN A  1 80  ? 14.006   28.543  -2.229  1.00 20.45 ? 89  GLN A N   1 
ATOM   577   C  CA  . GLN A  1 80  ? 15.318   27.934  -2.465  1.00 20.69 ? 89  GLN A CA  1 
ATOM   578   C  C   . GLN A  1 80  ? 16.395   28.257  -1.423  1.00 19.45 ? 89  GLN A C   1 
ATOM   579   O  O   . GLN A  1 80  ? 16.305   29.214  -0.669  1.00 17.90 ? 89  GLN A O   1 
ATOM   580   C  CB  . GLN A  1 80  ? 15.879   28.460  -3.787  1.00 22.65 ? 89  GLN A CB  1 
ATOM   581   C  CG  . GLN A  1 80  ? 15.404   27.714  -4.993  1.00 26.29 ? 89  GLN A CG  1 
ATOM   582   C  CD  . GLN A  1 80  ? 16.073   28.156  -6.290  1.00 27.04 ? 89  GLN A CD  1 
ATOM   583   O  OE1 . GLN A  1 80  ? 16.602   27.327  -7.001  1.00 25.99 ? 89  GLN A OE1 1 
ATOM   584   N  NE2 . GLN A  1 80  ? 16.092   29.459  -6.562  1.00 28.55 ? 89  GLN A NE2 1 
ATOM   585   N  N   . THR A  1 81  ? 17.434   27.431  -1.427  1.00 19.41 ? 90  THR A N   1 
ATOM   586   C  CA  . THR A  1 81  ? 18.667   27.704  -0.692  1.00 18.89 ? 90  THR A CA  1 
ATOM   587   C  C   . THR A  1 81  ? 19.485   28.737  -1.457  1.00 17.66 ? 90  THR A C   1 
ATOM   588   O  O   . THR A  1 81  ? 19.545   28.742  -2.705  1.00 19.00 ? 90  THR A O   1 
ATOM   589   C  CB  . THR A  1 81  ? 19.492   26.444  -0.439  1.00 18.61 ? 90  THR A CB  1 
ATOM   590   O  OG1 . THR A  1 81  ? 18.758   25.580  0.425   1.00 19.04 ? 90  THR A OG1 1 
ATOM   591   C  CG2 . THR A  1 81  ? 20.773   26.795  0.278   1.00 18.96 ? 90  THR A CG2 1 
ATOM   592   N  N   . LEU A  1 82  ? 20.001   29.699  -0.706  1.00 16.82 ? 91  LEU A N   1 
ATOM   593   C  CA  . LEU A  1 82  ? 20.955   30.675  -1.215  1.00 16.77 ? 91  LEU A CA  1 
ATOM   594   C  C   . LEU A  1 82  ? 22.308   30.457  -0.533  1.00 16.54 ? 91  LEU A C   1 
ATOM   595   O  O   . LEU A  1 82  ? 22.405   30.513  0.663   1.00 15.24 ? 91  LEU A O   1 
ATOM   596   C  CB  . LEU A  1 82  ? 20.505   32.106  -0.962  1.00 18.24 ? 91  LEU A CB  1 
ATOM   597   C  CG  . LEU A  1 82  ? 21.507   33.202  -1.384  1.00 19.73 ? 91  LEU A CG  1 
ATOM   598   C  CD1 . LEU A  1 82  ? 21.727   33.229  -2.879  1.00 20.46 ? 91  LEU A CD1 1 
ATOM   599   C  CD2 . LEU A  1 82  ? 21.048   34.550  -0.918  1.00 21.51 ? 91  LEU A CD2 1 
ATOM   600   N  N   . VAL A  1 83  ? 23.344   30.287  -1.351  1.00 17.01 ? 92  VAL A N   1 
ATOM   601   C  CA  . VAL A  1 83  ? 24.728   30.237  -0.894  1.00 16.28 ? 92  VAL A CA  1 
ATOM   602   C  C   . VAL A  1 83  ? 25.565   31.353  -1.549  1.00 16.42 ? 92  VAL A C   1 
ATOM   603   O  O   . VAL A  1 83  ? 25.643   31.468  -2.786  1.00 15.46 ? 92  VAL A O   1 
ATOM   604   C  CB  . VAL A  1 83  ? 25.398   28.911  -1.218  1.00 16.81 ? 92  VAL A CB  1 
ATOM   605   C  CG1 . VAL A  1 83  ? 26.719   28.834  -0.507  1.00 16.89 ? 92  VAL A CG1 1 
ATOM   606   C  CG2 . VAL A  1 83  ? 24.509   27.724  -0.817  1.00 17.51 ? 92  VAL A CG2 1 
ATOM   607   N  N   . VAL A  1 84  ? 26.202   32.129  -0.674  1.00 14.83 ? 93  VAL A N   1 
ATOM   608   C  CA  . VAL A  1 84  ? 27.160   33.180  -1.013  1.00 14.62 ? 93  VAL A CA  1 
ATOM   609   C  C   . VAL A  1 84  ? 28.562   32.815  -0.462  1.00 13.35 ? 93  VAL A C   1 
ATOM   610   O  O   . VAL A  1 84  ? 28.729   32.557  0.721   1.00 11.70 ? 93  VAL A O   1 
ATOM   611   C  CB  . VAL A  1 84  ? 26.802   34.501  -0.345  1.00 16.37 ? 93  VAL A CB  1 
ATOM   612   C  CG1 . VAL A  1 84  ? 27.712   35.570  -0.872  1.00 18.01 ? 93  VAL A CG1 1 
ATOM   613   C  CG2 . VAL A  1 84  ? 25.379   34.882  -0.678  1.00 17.50 ? 93  VAL A CG2 1 
ATOM   614   N  N   . GLN A  1 85  ? 29.530   32.741  -1.351  1.00 12.47 ? 94  GLN A N   1 
ATOM   615   C  CA  . GLN A  1 85  ? 30.848   32.242  -1.004  1.00 12.80 ? 94  GLN A CA  1 
ATOM   616   C  C   . GLN A  1 85  ? 31.972   33.004  -1.747  1.00 11.82 ? 94  GLN A C   1 
ATOM   617   O  O   . GLN A  1 85  ? 31.799   33.388  -2.907  1.00 12.54 ? 94  GLN A O   1 
ATOM   618   C  CB  . GLN A  1 85  ? 30.907   30.759  -1.274  1.00 12.97 ? 94  GLN A CB  1 
ATOM   619   C  CG  . GLN A  1 85  ? 32.268   30.139  -1.068  1.00 14.06 ? 94  GLN A CG  1 
ATOM   620   C  CD  . GLN A  1 85  ? 32.193   28.642  -1.145  1.00 14.29 ? 94  GLN A CD  1 
ATOM   621   O  OE1 . GLN A  1 85  ? 31.646   27.987  -0.237  1.00 16.07 ? 94  GLN A OE1 1 
ATOM   622   N  NE2 . GLN A  1 85  ? 32.761   28.071  -2.189  1.00 14.61 ? 94  GLN A NE2 1 
ATOM   623   N  N   . PHE A  1 86  ? 33.080   33.239  -1.068  1.00 11.01 ? 95  PHE A N   1 
ATOM   624   C  CA  . PHE A  1 86  ? 34.251   33.893  -1.678  1.00 11.60 ? 95  PHE A CA  1 
ATOM   625   C  C   . PHE A  1 86  ? 35.495   33.719  -0.793  1.00 11.21 ? 95  PHE A C   1 
ATOM   626   O  O   . PHE A  1 86  ? 35.376   33.317  0.376   1.00 10.90 ? 95  PHE A O   1 
ATOM   627   C  CB  . PHE A  1 86  ? 33.993   35.371  -1.912  1.00 11.30 ? 95  PHE A CB  1 
ATOM   628   C  CG  . PHE A  1 86  ? 33.620   36.104  -0.677  1.00 11.76 ? 95  PHE A CG  1 
ATOM   629   C  CD1 . PHE A  1 86  ? 32.363   36.047  -0.199  1.00 12.77 ? 95  PHE A CD1 1 
ATOM   630   C  CD2 . PHE A  1 86  ? 34.543   36.891  0.001   1.00 12.73 ? 95  PHE A CD2 1 
ATOM   631   C  CE1 . PHE A  1 86  ? 32.009   36.724  0.977   1.00 13.01 ? 95  PHE A CE1 1 
ATOM   632   C  CE2 . PHE A  1 86  ? 34.201   37.595  1.134   1.00 12.46 ? 95  PHE A CE2 1 
ATOM   633   C  CZ  . PHE A  1 86  ? 32.928   37.493  1.631   1.00 12.91 ? 95  PHE A CZ  1 
ATOM   634   N  N   . THR A  1 87  ? 36.678   33.964  -1.362  1.00 11.01 ? 96  THR A N   1 
ATOM   635   C  CA  . THR A  1 87  ? 37.915   33.945  -0.589  1.00 11.33 ? 96  THR A CA  1 
ATOM   636   C  C   . THR A  1 87  ? 38.383   35.360  -0.303  1.00 11.97 ? 96  THR A C   1 
ATOM   637   O  O   . THR A  1 87  ? 38.197   36.279  -1.087  1.00 11.10 ? 96  THR A O   1 
ATOM   638   C  CB  . THR A  1 87  ? 39.048   33.112  -1.209  1.00 11.86 ? 96  THR A CB  1 
ATOM   639   O  OG1 . THR A  1 87  ? 39.391   33.631  -2.499  1.00 13.43 ? 96  THR A OG1 1 
ATOM   640   C  CG2 . THR A  1 87  ? 38.678   31.647  -1.335  1.00 11.41 ? 96  THR A CG2 1 
ATOM   641   N  N   . VAL A  1 88  ? 38.967   35.515  0.880   1.00 14.08 ? 97  VAL A N   1 
ATOM   642   C  CA  . VAL A  1 88  ? 39.573   36.787  1.347   1.00 13.63 ? 97  VAL A CA  1 
ATOM   643   C  C   . VAL A  1 88  ? 40.970   36.502  1.912   1.00 14.38 ? 97  VAL A C   1 
ATOM   644   O  O   . VAL A  1 88  ? 41.187   35.573  2.714   1.00 13.22 ? 97  VAL A O   1 
ATOM   645   C  CB  . VAL A  1 88  ? 38.752   37.425  2.446   1.00 14.15 ? 97  VAL A CB  1 
ATOM   646   C  CG1 . VAL A  1 88  ? 39.319   38.774  2.833   1.00 15.55 ? 97  VAL A CG1 1 
ATOM   647   C  CG2 . VAL A  1 88  ? 37.337   37.640  1.989   1.00 14.86 ? 97  VAL A CG2 1 
ATOM   648   N  N   . LYS A  1 89  ? 41.911   37.340  1.496   1.00 15.83 ? 98  LYS A N   1 
ATOM   649   C  CA  . LYS A  1 89  ? 43.339   37.242  1.902   1.00 16.25 ? 98  LYS A CA  1 
ATOM   650   C  C   . LYS A  1 89  ? 43.891   38.604  2.289   1.00 15.48 ? 98  LYS A C   1 
ATOM   651   O  O   . LYS A  1 89  ? 44.105   39.466  1.455   1.00 15.47 ? 98  LYS A O   1 
ATOM   652   C  CB  . LYS A  1 89  ? 44.126   36.675  0.754   1.00 16.36 ? 98  LYS A CB  1 
ATOM   653   C  CG  . LYS A  1 89  ? 45.599   36.649  0.975   1.00 18.24 ? 98  LYS A CG  1 
ATOM   654   C  CD  . LYS A  1 89  ? 46.221   36.004  -0.246  1.00 19.26 ? 98  LYS A CD  1 
ATOM   655   C  CE  . LYS A  1 89  ? 47.711   36.034  -0.308  1.00 21.44 ? 98  LYS A CE  1 
ATOM   656   N  NZ  . LYS A  1 89  ? 48.157   35.805  -1.720  1.00 25.22 ? 98  LYS A NZ  1 
ATOM   657   N  N   . HIS A  1 90  ? 44.049   38.822  3.575   1.00 16.99 ? 99  HIS A N   1 
ATOM   658   C  CA  . HIS A  1 90  ? 44.588   40.083  4.077   1.00 17.92 ? 99  HIS A CA  1 
ATOM   659   C  C   . HIS A  1 90  ? 46.123   39.941  4.162   1.00 19.36 ? 99  HIS A C   1 
ATOM   660   O  O   . HIS A  1 90  ? 46.691   39.846  5.237   1.00 17.91 ? 99  HIS A O   1 
ATOM   661   C  CB  . HIS A  1 90  ? 44.038   40.396  5.443   1.00 18.16 ? 99  HIS A CB  1 
ATOM   662   C  CG  . HIS A  1 90  ? 42.568   40.646  5.480   1.00 19.24 ? 99  HIS A CG  1 
ATOM   663   N  ND1 . HIS A  1 90  ? 41.956   41.627  4.718   1.00 21.03 ? 99  HIS A ND1 1 
ATOM   664   C  CD2 . HIS A  1 90  ? 41.588   40.068  6.212   1.00 19.74 ? 99  HIS A CD2 1 
ATOM   665   C  CE1 . HIS A  1 90  ? 40.669   41.665  5.013   1.00 21.50 ? 99  HIS A CE1 1 
ATOM   666   N  NE2 . HIS A  1 90  ? 40.418   40.724  5.915   1.00 21.49 ? 99  HIS A NE2 1 
ATOM   667   N  N   . GLU A  1 91  ? 46.752   39.829  2.996   1.00 21.53 ? 100 GLU A N   1 
ATOM   668   C  CA  . GLU A  1 91  ? 48.234   39.767  2.866   1.00 22.84 ? 100 GLU A CA  1 
ATOM   669   C  C   . GLU A  1 91  ? 49.012   40.748  3.683   1.00 20.16 ? 100 GLU A C   1 
ATOM   670   O  O   . GLU A  1 91  ? 50.095   40.465  4.090   1.00 21.02 ? 100 GLU A O   1 
ATOM   671   C  CB  . GLU A  1 91  ? 48.697   40.197  1.487   1.00 25.48 ? 100 GLU A CB  1 
ATOM   672   C  CG  . GLU A  1 91  ? 49.029   39.012  0.667   1.00 29.15 ? 100 GLU A CG  1 
ATOM   673   C  CD  . GLU A  1 91  ? 49.868   39.272  -0.585  1.00 33.06 ? 100 GLU A CD  1 
ATOM   674   O  OE1 . GLU A  1 91  ? 50.430   40.379  -0.784  1.00 32.25 ? 100 GLU A OE1 1 
ATOM   675   O  OE2 . GLU A  1 91  ? 49.957   38.303  -1.376  1.00 35.41 ? 100 GLU A OE2 1 
ATOM   676   N  N   . GLN A  1 92  ? 48.467   41.941  3.806   1.00 18.27 ? 101 GLN A N   1 
ATOM   677   C  CA  . GLN A  1 92  ? 49.149   43.056  4.401   1.00 17.23 ? 101 GLN A CA  1 
ATOM   678   C  C   . GLN A  1 92  ? 49.153   43.036  5.939   1.00 19.35 ? 101 GLN A C   1 
ATOM   679   O  O   . GLN A  1 92  ? 49.592   43.993  6.563   1.00 17.99 ? 101 GLN A O   1 
ATOM   680   C  CB  . GLN A  1 92  ? 48.485   44.361  3.945   1.00 16.42 ? 101 GLN A CB  1 
ATOM   681   C  CG  . GLN A  1 92  ? 47.113   44.654  4.610   1.00 17.71 ? 101 GLN A CG  1 
ATOM   682   C  CD  . GLN A  1 92  ? 45.924   44.024  3.852   1.00 17.17 ? 101 GLN A CD  1 
ATOM   683   O  OE1 . GLN A  1 92  ? 45.986   42.869  3.468   1.00 16.13 ? 101 GLN A OE1 1 
ATOM   684   N  NE2 . GLN A  1 92  ? 44.842   44.778  3.705   1.00 16.82 ? 101 GLN A NE2 1 
ATOM   685   N  N   . ASN A  1 93  ? 48.576   42.010  6.539   1.00 20.92 ? 102 ASN A N   1 
ATOM   686   C  CA  . ASN A  1 93  ? 48.308   42.016  7.991   1.00 22.56 ? 102 ASN A CA  1 
ATOM   687   C  C   . ASN A  1 93  ? 47.494   43.249  8.389   1.00 22.58 ? 102 ASN A C   1 
ATOM   688   O  O   . ASN A  1 93  ? 48.041   44.242  8.903   1.00 26.94 ? 102 ASN A O   1 
ATOM   689   C  CB  . ASN A  1 93  ? 49.631   41.942  8.778   1.00 22.12 ? 102 ASN A CB  1 
ATOM   690   C  CG  . ASN A  1 93  ? 50.272   40.539  8.713   1.00 23.65 ? 102 ASN A CG  1 
ATOM   691   O  OD1 . ASN A  1 93  ? 49.645   39.467  9.003   1.00 26.21 ? 102 ASN A OD1 1 
ATOM   692   N  ND2 . ASN A  1 93  ? 51.512   40.529  8.291   1.00 22.39 ? 102 ASN A ND2 1 
ATOM   693   N  N   . ILE A  1 94  ? 46.209   43.197  8.111   1.00 19.96 ? 103 ILE A N   1 
ATOM   694   C  CA  . ILE A  1 94  ? 45.394   44.385  8.142   1.00 20.11 ? 103 ILE A CA  1 
ATOM   695   C  C   . ILE A  1 94  ? 45.230   44.893  9.571   1.00 20.86 ? 103 ILE A C   1 
ATOM   696   O  O   . ILE A  1 94  ? 45.145   44.105  10.496  1.00 20.66 ? 103 ILE A O   1 
ATOM   697   C  CB  . ILE A  1 94  ? 44.035   44.151  7.427   1.00 21.56 ? 103 ILE A CB  1 
ATOM   698   C  CG1 . ILE A  1 94  ? 43.241   45.455  7.276   1.00 22.79 ? 103 ILE A CG1 1 
ATOM   699   C  CG2 . ILE A  1 94  ? 43.178   43.138  8.163   1.00 21.19 ? 103 ILE A CG2 1 
ATOM   700   C  CD1 . ILE A  1 94  ? 42.182   45.402  6.167   1.00 24.09 ? 103 ILE A CD1 1 
ATOM   701   N  N   . ASP A  1 95  ? 45.157   46.207  9.730   1.00 21.41 ? 104 ASP A N   1 
ATOM   702   C  CA  . ASP A  1 95  ? 44.891   46.839  11.034  1.00 23.99 ? 104 ASP A CA  1 
ATOM   703   C  C   . ASP A  1 95  ? 43.391   47.123  11.209  1.00 22.71 ? 104 ASP A C   1 
ATOM   704   O  O   . ASP A  1 95  ? 42.793   46.811  12.235  1.00 24.23 ? 104 ASP A O   1 
ATOM   705   C  CB  . ASP A  1 95  ? 45.736   48.139  11.236  1.00 24.64 ? 104 ASP A CB  1 
ATOM   706   C  CG  . ASP A  1 95  ? 45.703   49.121  10.004  1.00 28.18 ? 104 ASP A CG  1 
ATOM   707   O  OD1 . ASP A  1 95  ? 45.023   48.856  8.980   1.00 29.12 ? 104 ASP A OD1 1 
ATOM   708   O  OD2 . ASP A  1 95  ? 46.393   50.166  10.063  1.00 30.37 ? 104 ASP A OD2 1 
ATOM   709   N  N   . CYS A  1 96  ? 42.815   47.735  10.180  1.00 21.19 ? 105 CYS A N   1 
ATOM   710   C  CA  . CYS A  1 96  ? 41.429   48.122  10.181  1.00 22.03 ? 105 CYS A CA  1 
ATOM   711   C  C   . CYS A  1 96  ? 40.910   48.206  8.736   1.00 21.08 ? 105 CYS A C   1 
ATOM   712   O  O   . CYS A  1 96  ? 41.511   48.861  7.904   1.00 24.47 ? 105 CYS A O   1 
ATOM   713   C  CB  . CYS A  1 96  ? 41.215   49.436  10.919  1.00 25.07 ? 105 CYS A CB  1 
ATOM   714   S  SG  . CYS A  1 96  ? 39.482   49.976  10.987  1.00 31.20 ? 105 CYS A SG  1 
ATOM   715   N  N   . GLY A  1 97  ? 39.860   47.444  8.449   1.00 18.25 ? 106 GLY A N   1 
ATOM   716   C  CA  . GLY A  1 97  ? 39.258   47.376  7.159   1.00 16.68 ? 106 GLY A CA  1 
ATOM   717   C  C   . GLY A  1 97  ? 38.290   46.214  6.981   1.00 17.58 ? 106 GLY A C   1 
ATOM   718   O  O   . GLY A  1 97  ? 38.448   45.138  7.560   1.00 17.76 ? 106 GLY A O   1 
ATOM   719   N  N   . GLY A  1 98  ? 37.306   46.425  6.102   1.00 17.74 ? 107 GLY A N   1 
ATOM   720   C  CA  . GLY A  1 98  ? 36.326   45.411  5.727   1.00 18.07 ? 107 GLY A CA  1 
ATOM   721   C  C   . GLY A  1 98  ? 36.808   44.414  4.654   1.00 16.71 ? 107 GLY A C   1 
ATOM   722   O  O   . GLY A  1 98  ? 37.736   44.670  3.935   1.00 15.32 ? 107 GLY A O   1 
ATOM   723   N  N   . GLY A  1 99  ? 36.191   43.241  4.659   1.00 16.77 ? 108 GLY A N   1 
ATOM   724   C  CA  . GLY A  1 99  ? 36.451   42.177  3.696   1.00 16.83 ? 108 GLY A CA  1 
ATOM   725   C  C   . GLY A  1 99  ? 35.158   41.492  3.260   1.00 16.88 ? 108 GLY A C   1 
ATOM   726   O  O   . GLY A  1 99  ? 35.147   40.326  2.910   1.00 15.60 ? 108 GLY A O   1 
ATOM   727   N  N   . TYR A  1 100 ? 34.071   42.248  3.291   1.00 16.93 ? 109 TYR A N   1 
ATOM   728   C  CA  . TYR A  1 100 ? 32.747   41.676  3.122   1.00 18.41 ? 109 TYR A CA  1 
ATOM   729   C  C   . TYR A  1 100 ? 32.113   42.083  1.815   1.00 19.05 ? 109 TYR A C   1 
ATOM   730   O  O   . TYR A  1 100 ? 32.500   43.078  1.210   1.00 21.65 ? 109 TYR A O   1 
ATOM   731   C  CB  . TYR A  1 100 ? 31.814   42.091  4.259   1.00 17.79 ? 109 TYR A CB  1 
ATOM   732   C  CG  . TYR A  1 100 ? 31.896   43.541  4.586   1.00 18.23 ? 109 TYR A CG  1 
ATOM   733   C  CD1 . TYR A  1 100 ? 31.241   44.479  3.815   1.00 19.24 ? 109 TYR A CD1 1 
ATOM   734   C  CD2 . TYR A  1 100 ? 32.604   43.985  5.703   1.00 18.63 ? 109 TYR A CD2 1 
ATOM   735   C  CE1 . TYR A  1 100 ? 31.272   45.834  4.152   1.00 19.20 ? 109 TYR A CE1 1 
ATOM   736   C  CE2 . TYR A  1 100 ? 32.663   45.325  6.031   1.00 17.94 ? 109 TYR A CE2 1 
ATOM   737   C  CZ  . TYR A  1 100 ? 32.003   46.242  5.252   1.00 19.41 ? 109 TYR A CZ  1 
ATOM   738   O  OH  . TYR A  1 100 ? 32.053   47.577  5.570   1.00 19.77 ? 109 TYR A OH  1 
ATOM   739   N  N   . VAL A  1 101 ? 31.145   41.281  1.397   1.00 18.30 ? 110 VAL A N   1 
ATOM   740   C  CA  . VAL A  1 101 ? 30.377   41.529  0.171   1.00 18.85 ? 110 VAL A CA  1 
ATOM   741   C  C   . VAL A  1 101 ? 28.969   41.973  0.469   1.00 18.90 ? 110 VAL A C   1 
ATOM   742   O  O   . VAL A  1 101 ? 28.486   41.819  1.573   1.00 20.34 ? 110 VAL A O   1 
ATOM   743   C  CB  . VAL A  1 101 ? 30.345   40.324  -0.809  1.00 17.46 ? 110 VAL A CB  1 
ATOM   744   C  CG1 . VAL A  1 101 ? 31.749   39.883  -1.175  1.00 17.11 ? 110 VAL A CG1 1 
ATOM   745   C  CG2 . VAL A  1 101 ? 29.559   39.161  -0.244  1.00 18.73 ? 110 VAL A CG2 1 
ATOM   746   N  N   . LYS A  1 102 ? 28.335   42.547  -0.542  1.00 18.89 ? 111 LYS A N   1 
ATOM   747   C  CA  . LYS A  1 102 ? 26.948   42.905  -0.485  1.00 18.27 ? 111 LYS A CA  1 
ATOM   748   C  C   . LYS A  1 102 ? 26.214   42.464  -1.702  1.00 17.84 ? 111 LYS A C   1 
ATOM   749   O  O   . LYS A  1 102 ? 26.718   42.586  -2.803  1.00 18.47 ? 111 LYS A O   1 
ATOM   750   C  CB  . LYS A  1 102 ? 26.776   44.377  -0.417  1.00 19.01 ? 111 LYS A CB  1 
ATOM   751   C  CG  . LYS A  1 102 ? 27.366   44.979  0.805   1.00 20.05 ? 111 LYS A CG  1 
ATOM   752   C  CD  . LYS A  1 102 ? 27.021   46.453  0.879   1.00 21.18 ? 111 LYS A CD  1 
ATOM   753   C  CE  . LYS A  1 102 ? 28.015   47.161  1.751   1.00 20.96 ? 111 LYS A CE  1 
ATOM   754   N  NZ  . LYS A  1 102 ? 27.345   48.160  2.576   1.00 23.49 ? 111 LYS A NZ  1 
ATOM   755   N  N   . LEU A  1 103 ? 25.031   41.907  -1.473  1.00 18.96 ? 112 LEU A N   1 
ATOM   756   C  CA  . LEU A  1 103 ? 24.126   41.475  -2.552  1.00 19.28 ? 112 LEU A CA  1 
ATOM   757   C  C   . LEU A  1 103 ? 23.011   42.474  -2.631  1.00 17.65 ? 112 LEU A C   1 
ATOM   758   O  O   . LEU A  1 103 ? 22.327   42.731  -1.649  1.00 16.49 ? 112 LEU A O   1 
ATOM   759   C  CB  . LEU A  1 103 ? 23.532   40.098  -2.312  1.00 20.89 ? 112 LEU A CB  1 
ATOM   760   C  CG  . LEU A  1 103 ? 24.252   38.827  -2.686  1.00 22.85 ? 112 LEU A CG  1 
ATOM   761   C  CD1 . LEU A  1 103 ? 25.645   39.043  -2.217  1.00 24.32 ? 112 LEU A CD1 1 
ATOM   762   C  CD2 . LEU A  1 103 ? 23.746   37.468  -2.157  1.00 25.35 ? 112 LEU A CD2 1 
ATOM   763   N  N   . PHE A  1 104 ? 22.844   43.007  -3.840  1.00 18.11 ? 113 PHE A N   1 
ATOM   764   C  CA  . PHE A  1 104 ? 21.926   44.102  -4.130  1.00 17.03 ? 113 PHE A CA  1 
ATOM   765   C  C   . PHE A  1 104 ? 20.815   43.674  -5.058  1.00 18.69 ? 113 PHE A C   1 
ATOM   766   O  O   . PHE A  1 104 ? 21.015   42.794  -5.928  1.00 20.74 ? 113 PHE A O   1 
ATOM   767   C  CB  . PHE A  1 104 ? 22.657   45.251  -4.838  1.00 16.92 ? 113 PHE A CB  1 
ATOM   768   C  CG  . PHE A  1 104 ? 23.628   46.018  -3.973  1.00 16.39 ? 113 PHE A CG  1 
ATOM   769   C  CD1 . PHE A  1 104 ? 23.186   47.070  -3.183  1.00 16.19 ? 113 PHE A CD1 1 
ATOM   770   C  CD2 . PHE A  1 104 ? 24.980   45.691  -3.953  1.00 16.04 ? 113 PHE A CD2 1 
ATOM   771   C  CE1 . PHE A  1 104 ? 24.067   47.793  -2.408  1.00 15.80 ? 113 PHE A CE1 1 
ATOM   772   C  CE2 . PHE A  1 104 ? 25.865   46.400  -3.163  1.00 15.91 ? 113 PHE A CE2 1 
ATOM   773   C  CZ  . PHE A  1 104 ? 25.412   47.454  -2.399  1.00 15.74 ? 113 PHE A CZ  1 
ATOM   774   N  N   . PRO A  1 105 ? 19.659   44.343  -4.954  1.00 19.45 ? 114 PRO A N   1 
ATOM   775   C  CA  . PRO A  1 105 ? 18.622   44.195  -5.947  1.00 21.22 ? 114 PRO A CA  1 
ATOM   776   C  C   . PRO A  1 105 ? 19.106   44.738  -7.269  1.00 22.99 ? 114 PRO A C   1 
ATOM   777   O  O   . PRO A  1 105 ? 19.975   45.632  -7.297  1.00 23.38 ? 114 PRO A O   1 
ATOM   778   C  CB  . PRO A  1 105 ? 17.466   45.069  -5.442  1.00 20.54 ? 114 PRO A CB  1 
ATOM   779   C  CG  . PRO A  1 105 ? 17.974   45.833  -4.309  1.00 21.45 ? 114 PRO A CG  1 
ATOM   780   C  CD  . PRO A  1 105 ? 19.319   45.305  -3.908  1.00 21.83 ? 114 PRO A CD  1 
ATOM   781   N  N   . ASN A  1 106 ? 18.533   44.233  -8.347  1.00 23.84 ? 115 ASN A N   1 
ATOM   782   C  CA  . ASN A  1 106 ? 18.853   44.720  -9.696  1.00 26.23 ? 115 ASN A CA  1 
ATOM   783   C  C   . ASN A  1 106 ? 18.506   46.172  -9.958  1.00 26.55 ? 115 ASN A C   1 
ATOM   784   O  O   . ASN A  1 106 ? 18.941   46.743  -10.936 1.00 25.93 ? 115 ASN A O   1 
ATOM   785   C  CB  . ASN A  1 106 ? 18.164   43.899  -10.739 1.00 29.27 ? 115 ASN A CB  1 
ATOM   786   C  CG  . ASN A  1 106 ? 18.914   43.898  -12.052 1.00 36.58 ? 115 ASN A CG  1 
ATOM   787   O  OD1 . ASN A  1 106 ? 20.162   43.814  -12.104 1.00 44.17 ? 115 ASN A OD1 1 
ATOM   788   N  ND2 . ASN A  1 106 ? 18.160   43.961  -13.136 1.00 37.61 ? 115 ASN A ND2 1 
ATOM   789   N  N   . SER A  1 107 ? 17.743   46.791  -9.072  1.00 26.23 ? 116 SER A N   1 
ATOM   790   C  CA  . SER A  1 107 ? 17.448   48.212  -9.192  1.00 25.22 ? 116 SER A CA  1 
ATOM   791   C  C   . SER A  1 107 ? 18.613   49.136  -8.799  1.00 25.88 ? 116 SER A C   1 
ATOM   792   O  O   . SER A  1 107 ? 18.526   50.350  -8.942  1.00 26.72 ? 116 SER A O   1 
ATOM   793   C  CB  . SER A  1 107 ? 16.271   48.554  -8.312  1.00 23.92 ? 116 SER A CB  1 
ATOM   794   O  OG  . SER A  1 107 ? 16.609   48.271  -6.980  1.00 23.47 ? 116 SER A OG  1 
ATOM   795   N  N   . LEU A  1 108 ? 19.691   48.576  -8.292  1.00 26.33 ? 117 LEU A N   1 
ATOM   796   C  CA  . LEU A  1 108 ? 20.870   49.387  -7.981  1.00 26.61 ? 117 LEU A CA  1 
ATOM   797   C  C   . LEU A  1 108 ? 21.528   49.953  -9.254  1.00 23.89 ? 117 LEU A C   1 
ATOM   798   O  O   . LEU A  1 108 ? 21.854   49.236  -10.180 1.00 21.47 ? 117 LEU A O   1 
ATOM   799   C  CB  . LEU A  1 108 ? 21.918   48.567  -7.215  1.00 26.44 ? 117 LEU A CB  1 
ATOM   800   C  CG  . LEU A  1 108 ? 23.234   49.313  -6.926  1.00 26.93 ? 117 LEU A CG  1 
ATOM   801   C  CD1 . LEU A  1 108 ? 23.098   50.238  -5.713  1.00 28.04 ? 117 LEU A CD1 1 
ATOM   802   C  CD2 . LEU A  1 108 ? 24.374   48.347  -6.721  1.00 25.52 ? 117 LEU A CD2 1 
ATOM   803   N  N   . ASP A  1 109 ? 21.754   51.253  -9.236  1.00 24.07 ? 118 ASP A N   1 
ATOM   804   C  CA  . ASP A  1 109 ? 22.628   51.917  -10.216 1.00 25.19 ? 118 ASP A CA  1 
ATOM   805   C  C   . ASP A  1 109 ? 24.095   51.729  -9.772  1.00 24.11 ? 118 ASP A C   1 
ATOM   806   O  O   . ASP A  1 109 ? 24.566   52.354  -8.801  1.00 24.10 ? 118 ASP A O   1 
ATOM   807   C  CB  . ASP A  1 109 ? 22.273   53.413  -10.277 1.00 27.30 ? 118 ASP A CB  1 
ATOM   808   C  CG  . ASP A  1 109 ? 23.117   54.194  -11.280 1.00 27.90 ? 118 ASP A CG  1 
ATOM   809   O  OD1 . ASP A  1 109 ? 23.965   53.613  -12.006 1.00 30.86 ? 118 ASP A OD1 1 
ATOM   810   O  OD2 . ASP A  1 109 ? 22.955   55.428  -11.296 1.00 31.08 ? 118 ASP A OD2 1 
ATOM   811   N  N   . GLN A  1 110 ? 24.778   50.844  -10.464 1.00 23.04 ? 119 GLN A N   1 
ATOM   812   C  CA  . GLN A  1 110 ? 26.175   50.479  -10.138 1.00 23.94 ? 119 GLN A CA  1 
ATOM   813   C  C   . GLN A  1 110 ? 27.135   51.675  -10.135 1.00 24.79 ? 119 GLN A C   1 
ATOM   814   O  O   . GLN A  1 110 ? 28.116   51.694  -9.392  1.00 26.40 ? 119 GLN A O   1 
ATOM   815   C  CB  . GLN A  1 110 ? 26.695   49.434  -11.121 1.00 22.51 ? 119 GLN A CB  1 
ATOM   816   C  CG  . GLN A  1 110 ? 26.075   48.073  -10.943 1.00 21.83 ? 119 GLN A CG  1 
ATOM   817   C  CD  . GLN A  1 110 ? 26.678   47.085  -11.915 1.00 23.39 ? 119 GLN A CD  1 
ATOM   818   O  OE1 . GLN A  1 110 ? 26.117   46.834  -12.984 1.00 25.64 ? 119 GLN A OE1 1 
ATOM   819   N  NE2 . GLN A  1 110 ? 27.794   46.470  -11.545 1.00 24.26 ? 119 GLN A NE2 1 
ATOM   820   N  N   . THR A  1 111 ? 26.872   52.643  -11.009 1.00 24.43 ? 120 THR A N   1 
ATOM   821   C  CA  . THR A  1 111 ? 27.722   53.839  -11.099 1.00 23.18 ? 120 THR A CA  1 
ATOM   822   C  C   . THR A  1 111 ? 27.431   54.826  -9.968  1.00 23.21 ? 120 THR A C   1 
ATOM   823   O  O   . THR A  1 111 ? 28.104   55.835  -9.856  1.00 22.49 ? 120 THR A O   1 
ATOM   824   C  CB  . THR A  1 111 ? 27.567   54.580  -12.449 1.00 24.87 ? 120 THR A CB  1 
ATOM   825   O  OG1 . THR A  1 111 ? 26.297   55.243  -12.503 1.00 23.07 ? 120 THR A OG1 1 
ATOM   826   C  CG2 . THR A  1 111 ? 27.732   53.628  -13.657 1.00 24.22 ? 120 THR A CG2 1 
ATOM   827   N  N   . ASP A  1 112 ? 26.443   54.538  -9.122  1.00 21.99 ? 121 ASP A N   1 
ATOM   828   C  CA  . ASP A  1 112 ? 26.182   55.384  -7.946  1.00 25.37 ? 121 ASP A CA  1 
ATOM   829   C  C   . ASP A  1 112 ? 26.265   54.606  -6.609  1.00 26.05 ? 121 ASP A C   1 
ATOM   830   O  O   . ASP A  1 112 ? 25.915   55.135  -5.540  1.00 27.62 ? 121 ASP A O   1 
ATOM   831   C  CB  . ASP A  1 112 ? 24.826   56.073  -8.041  1.00 23.88 ? 121 ASP A CB  1 
ATOM   832   C  CG  . ASP A  1 112 ? 24.683   57.211  -7.036  1.00 28.40 ? 121 ASP A CG  1 
ATOM   833   O  OD1 . ASP A  1 112 ? 25.671   57.973  -6.805  1.00 32.95 ? 121 ASP A OD1 1 
ATOM   834   O  OD2 . ASP A  1 112 ? 23.615   57.317  -6.391  1.00 29.80 ? 121 ASP A OD2 1 
ATOM   835   N  N   . MET A  1 113 ? 26.759   53.377  -6.667  1.00 25.68 ? 122 MET A N   1 
ATOM   836   C  CA  . MET A  1 113 ? 26.882   52.569  -5.454  1.00 28.27 ? 122 MET A CA  1 
ATOM   837   C  C   . MET A  1 113 ? 27.701   53.287  -4.397  1.00 27.40 ? 122 MET A C   1 
ATOM   838   O  O   . MET A  1 113 ? 28.785   53.825  -4.682  1.00 28.09 ? 122 MET A O   1 
ATOM   839   C  CB  . MET A  1 113 ? 27.529   51.202  -5.741  1.00 28.04 ? 122 MET A CB  1 
ATOM   840   C  CG  . MET A  1 113 ? 27.594   50.276  -4.523  1.00 27.96 ? 122 MET A CG  1 
ATOM   841   S  SD  . MET A  1 113 ? 28.398   48.700  -4.855  1.00 27.22 ? 122 MET A SD  1 
ATOM   842   C  CE  . MET A  1 113 ? 27.196   47.821  -5.835  1.00 33.51 ? 122 MET A CE  1 
ATOM   843   N  N   . HIS A  1 114 ? 27.201   53.238  -3.166  1.00 25.90 ? 123 HIS A N   1 
ATOM   844   C  CA  . HIS A  1 114 ? 27.972   53.702  -2.010  1.00 26.64 ? 123 HIS A CA  1 
ATOM   845   C  C   . HIS A  1 114 ? 27.479   53.106  -0.683  1.00 25.00 ? 123 HIS A C   1 
ATOM   846   O  O   . HIS A  1 114 ? 26.543   52.328  -0.644  1.00 24.01 ? 123 HIS A O   1 
ATOM   847   C  CB  . HIS A  1 114 ? 27.971   55.230  -1.958  1.00 26.99 ? 123 HIS A CB  1 
ATOM   848   C  CG  . HIS A  1 114 ? 26.617   55.824  -1.819  1.00 27.78 ? 123 HIS A CG  1 
ATOM   849   N  ND1 . HIS A  1 114 ? 25.703   55.835  -2.855  1.00 28.91 ? 123 HIS A ND1 1 
ATOM   850   C  CD2 . HIS A  1 114 ? 26.023   56.452  -0.780  1.00 28.23 ? 123 HIS A CD2 1 
ATOM   851   C  CE1 . HIS A  1 114 ? 24.593   56.427  -2.451  1.00 29.40 ? 123 HIS A CE1 1 
ATOM   852   N  NE2 . HIS A  1 114 ? 24.759   56.807  -1.194  1.00 29.21 ? 123 HIS A NE2 1 
ATOM   853   N  N   . GLY A  1 115 ? 28.136   53.485  0.394   1.00 25.74 ? 124 GLY A N   1 
ATOM   854   C  CA  . GLY A  1 115 ? 27.861   52.979  1.717   1.00 27.88 ? 124 GLY A CA  1 
ATOM   855   C  C   . GLY A  1 115 ? 26.392   53.012  2.106   1.00 30.26 ? 124 GLY A C   1 
ATOM   856   O  O   . GLY A  1 115 ? 25.958   52.184  2.889   1.00 29.11 ? 124 GLY A O   1 
ATOM   857   N  N   . ASP A  1 116 ? 25.613   53.941  1.558   1.00 30.73 ? 125 ASP A N   1 
ATOM   858   C  CA  . ASP A  1 116 ? 24.199   54.024  1.925   1.00 32.14 ? 125 ASP A CA  1 
ATOM   859   C  C   . ASP A  1 116 ? 23.256   53.485  0.888   1.00 27.63 ? 125 ASP A C   1 
ATOM   860   O  O   . ASP A  1 116 ? 22.066   53.620  1.037   1.00 27.20 ? 125 ASP A O   1 
ATOM   861   C  CB  . ASP A  1 116 ? 23.826   55.460  2.244   1.00 39.31 ? 125 ASP A CB  1 
ATOM   862   C  CG  . ASP A  1 116 ? 24.463   55.942  3.514   1.00 46.54 ? 125 ASP A CG  1 
ATOM   863   O  OD1 . ASP A  1 116 ? 25.273   55.174  4.124   1.00 54.87 ? 125 ASP A OD1 1 
ATOM   864   O  OD2 . ASP A  1 116 ? 24.141   57.084  3.909   1.00 60.03 ? 125 ASP A OD2 1 
ATOM   865   N  N   . SER A  1 117 ? 23.776   52.868  -0.155  1.00 25.15 ? 126 SER A N   1 
ATOM   866   C  CA  . SER A  1 117 ? 22.915   52.199  -1.101  1.00 26.78 ? 126 SER A CA  1 
ATOM   867   C  C   . SER A  1 117 ? 22.190   51.020  -0.406  1.00 26.10 ? 126 SER A C   1 
ATOM   868   O  O   . SER A  1 117 ? 22.745   50.364  0.484   1.00 27.14 ? 126 SER A O   1 
ATOM   869   C  CB  . SER A  1 117 ? 23.703   51.714  -2.339  1.00 25.35 ? 126 SER A CB  1 
ATOM   870   O  OG  . SER A  1 117 ? 24.422   52.777  -2.959  1.00 25.95 ? 126 SER A OG  1 
ATOM   871   N  N   . GLU A  1 118 ? 20.964   50.756  -0.847  1.00 26.46 ? 127 GLU A N   1 
ATOM   872   C  CA  . GLU A  1 118 ? 20.130   49.723  -0.261  1.00 27.84 ? 127 GLU A CA  1 
ATOM   873   C  C   . GLU A  1 118 ? 20.499   48.334  -0.794  1.00 24.56 ? 127 GLU A C   1 
ATOM   874   O  O   . GLU A  1 118 ? 20.288   48.021  -1.968  1.00 25.56 ? 127 GLU A O   1 
ATOM   875   C  CB  . GLU A  1 118 ? 18.646   50.026  -0.512  1.00 33.10 ? 127 GLU A CB  1 
ATOM   876   C  CG  . GLU A  1 118 ? 17.706   49.108  0.259   1.00 40.88 ? 127 GLU A CG  1 
ATOM   877   C  CD  . GLU A  1 118 ? 16.260   49.218  -0.188  1.00 48.79 ? 127 GLU A CD  1 
ATOM   878   O  OE1 . GLU A  1 118 ? 15.528   49.838  0.588   1.00 53.03 ? 127 GLU A OE1 1 
ATOM   879   O  OE2 . GLU A  1 118 ? 15.848   48.717  -1.278  1.00 50.66 ? 127 GLU A OE2 1 
ATOM   880   N  N   . TYR A  1 119 ? 21.058   47.500  0.076   1.00 21.31 ? 128 TYR A N   1 
ATOM   881   C  CA  . TYR A  1 119 ? 21.362   46.125  -0.277  1.00 19.88 ? 128 TYR A CA  1 
ATOM   882   C  C   . TYR A  1 119 ? 20.361   45.154  0.375   1.00 17.77 ? 128 TYR A C   1 
ATOM   883   O  O   . TYR A  1 119 ? 19.592   45.547  1.238   1.00 17.85 ? 128 TYR A O   1 
ATOM   884   C  CB  . TYR A  1 119 ? 22.797   45.760  0.118   1.00 20.70 ? 128 TYR A CB  1 
ATOM   885   C  CG  . TYR A  1 119 ? 23.080   45.987  1.572   1.00 19.80 ? 128 TYR A CG  1 
ATOM   886   C  CD1 . TYR A  1 119 ? 22.704   45.052  2.497   1.00 19.14 ? 128 TYR A CD1 1 
ATOM   887   C  CD2 . TYR A  1 119 ? 23.689   47.158  2.019   1.00 19.92 ? 128 TYR A CD2 1 
ATOM   888   C  CE1 . TYR A  1 119 ? 22.912   45.265  3.832   1.00 19.23 ? 128 TYR A CE1 1 
ATOM   889   C  CE2 . TYR A  1 119 ? 23.915   47.385  3.356   1.00 18.27 ? 128 TYR A CE2 1 
ATOM   890   C  CZ  . TYR A  1 119 ? 23.526   46.407  4.257   1.00 19.96 ? 128 TYR A CZ  1 
ATOM   891   O  OH  . TYR A  1 119 ? 23.697   46.540  5.599   1.00 18.09 ? 128 TYR A OH  1 
ATOM   892   N  N   . ASN A  1 120 ? 20.369   43.902  -0.075  1.00 16.07 ? 129 ASN A N   1 
ATOM   893   C  CA  . ASN A  1 120 ? 19.522   42.832  0.523   1.00 15.83 ? 129 ASN A CA  1 
ATOM   894   C  C   . ASN A  1 120 ? 20.234   42.139  1.683   1.00 15.64 ? 129 ASN A C   1 
ATOM   895   O  O   . ASN A  1 120 ? 19.691   42.006  2.763   1.00 15.20 ? 129 ASN A O   1 
ATOM   896   C  CB  . ASN A  1 120 ? 19.138   41.784  -0.531  1.00 15.03 ? 129 ASN A CB  1 
ATOM   897   C  CG  . ASN A  1 120 ? 18.122   42.313  -1.537  1.00 14.54 ? 129 ASN A CG  1 
ATOM   898   O  OD1 . ASN A  1 120 ? 17.442   43.302  -1.282  1.00 14.43 ? 129 ASN A OD1 1 
ATOM   899   N  ND2 . ASN A  1 120 ? 18.079   41.697  -2.706  1.00 14.35 ? 129 ASN A ND2 1 
ATOM   900   N  N   . ILE A  1 121 ? 21.460   41.740  1.413   1.00 15.29 ? 130 ILE A N   1 
ATOM   901   C  CA  . ILE A  1 121 ? 22.300   41.031  2.354   1.00 16.44 ? 130 ILE A CA  1 
ATOM   902   C  C   . ILE A  1 121 ? 23.747   41.528  2.308   1.00 15.90 ? 130 ILE A C   1 
ATOM   903   O  O   . ILE A  1 121 ? 24.281   41.758  1.240   1.00 15.37 ? 130 ILE A O   1 
ATOM   904   C  CB  . ILE A  1 121 ? 22.338   39.519  2.029   1.00 16.21 ? 130 ILE A CB  1 
ATOM   905   C  CG1 . ILE A  1 121 ? 20.929   38.920  2.173   1.00 16.92 ? 130 ILE A CG1 1 
ATOM   906   C  CG2 . ILE A  1 121 ? 23.263   38.772  2.952   1.00 16.11 ? 130 ILE A CG2 1 
ATOM   907   C  CD1 . ILE A  1 121 ? 20.814   37.541  1.579   1.00 17.43 ? 130 ILE A CD1 1 
ATOM   908   N  N   . MET A  1 122 ? 24.364   41.657  3.486   1.00 16.55 ? 131 MET A N   1 
ATOM   909   C  CA  . MET A  1 122 ? 25.795   41.867  3.617   1.00 16.44 ? 131 MET A CA  1 
ATOM   910   C  C   . MET A  1 122 ? 26.449   40.734  4.399   1.00 15.08 ? 131 MET A C   1 
ATOM   911   O  O   . MET A  1 122 ? 25.968   40.339  5.445   1.00 15.56 ? 131 MET A O   1 
ATOM   912   C  CB  . MET A  1 122 ? 26.087   43.190  4.307   1.00 19.50 ? 131 MET A CB  1 
ATOM   913   C  CG  . MET A  1 122 ? 27.562   43.399  4.631   1.00 21.95 ? 131 MET A CG  1 
ATOM   914   S  SD  . MET A  1 122 ? 27.751   45.022  5.346   1.00 32.36 ? 131 MET A SD  1 
ATOM   915   C  CE  . MET A  1 122 ? 28.921   44.697  6.665   1.00 27.65 ? 131 MET A CE  1 
ATOM   916   N  N   . PHE A  1 123 ? 27.588   40.264  3.917   1.00 14.01 ? 132 PHE A N   1 
ATOM   917   C  CA  . PHE A  1 123 ? 28.237   39.123  4.535   1.00 12.55 ? 132 PHE A CA  1 
ATOM   918   C  C   . PHE A  1 123 ? 29.757   39.132  4.434   1.00 11.84 ? 132 PHE A C   1 
ATOM   919   O  O   . PHE A  1 123 ? 30.288   39.305  3.358   1.00 11.70 ? 132 PHE A O   1 
ATOM   920   C  CB  . PHE A  1 123 ? 27.767   37.842  3.876   1.00 11.87 ? 132 PHE A CB  1 
ATOM   921   C  CG  . PHE A  1 123 ? 28.525   36.628  4.321   1.00 11.51 ? 132 PHE A CG  1 
ATOM   922   C  CD1 . PHE A  1 123 ? 28.542   36.265  5.657   1.00 10.78 ? 132 PHE A CD1 1 
ATOM   923   C  CD2 . PHE A  1 123 ? 29.247   35.860  3.389   1.00 10.95 ? 132 PHE A CD2 1 
ATOM   924   C  CE1 . PHE A  1 123 ? 29.221   35.153  6.073   1.00 10.75 ? 132 PHE A CE1 1 
ATOM   925   C  CE2 . PHE A  1 123 ? 29.916   34.737  3.791   1.00 10.39 ? 132 PHE A CE2 1 
ATOM   926   C  CZ  . PHE A  1 123 ? 29.942   34.398  5.147   1.00 10.97 ? 132 PHE A CZ  1 
ATOM   927   N  N   . GLY A  1 124 ? 30.432   38.965  5.571   1.00 11.00 ? 133 GLY A N   1 
ATOM   928   C  CA  . GLY A  1 124 ? 31.849   38.699  5.566   1.00 11.19 ? 133 GLY A CA  1 
ATOM   929   C  C   . GLY A  1 124 ? 32.676   39.362  6.662   1.00 10.98 ? 133 GLY A C   1 
ATOM   930   O  O   . GLY A  1 124 ? 32.137   40.038  7.508   1.00 10.53 ? 133 GLY A O   1 
ATOM   931   N  N   . PRO A  1 125 ? 34.011   39.172  6.626   1.00 11.51 ? 134 PRO A N   1 
ATOM   932   C  CA  . PRO A  1 125 ? 34.913   39.594  7.720   1.00 12.24 ? 134 PRO A CA  1 
ATOM   933   C  C   . PRO A  1 125 ? 35.125   41.115  7.816   1.00 12.97 ? 134 PRO A C   1 
ATOM   934   O  O   . PRO A  1 125 ? 35.082   41.814  6.811   1.00 12.24 ? 134 PRO A O   1 
ATOM   935   C  CB  . PRO A  1 125 ? 36.217   38.918  7.399   1.00 12.04 ? 134 PRO A CB  1 
ATOM   936   C  CG  . PRO A  1 125 ? 36.176   38.651  5.940   1.00 12.63 ? 134 PRO A CG  1 
ATOM   937   C  CD  . PRO A  1 125 ? 34.718   38.394  5.608   1.00 12.13 ? 134 PRO A CD  1 
ATOM   938   N  N   . ASP A  1 126 ? 35.155   41.602  9.053   1.00 14.03 ? 135 ASP A N   1 
ATOM   939   C  CA  . ASP A  1 126 ? 35.406   42.988  9.360   1.00 16.27 ? 135 ASP A CA  1 
ATOM   940   C  C   . ASP A  1 126 ? 36.395   43.080  10.527  1.00 17.41 ? 135 ASP A C   1 
ATOM   941   O  O   . ASP A  1 126 ? 36.170   42.513  11.614  1.00 15.68 ? 135 ASP A O   1 
ATOM   942   C  CB  . ASP A  1 126 ? 34.137   43.726  9.699   1.00 18.79 ? 135 ASP A CB  1 
ATOM   943   C  CG  . ASP A  1 126 ? 34.296   45.254  9.643   1.00 22.32 ? 135 ASP A CG  1 
ATOM   944   O  OD1 . ASP A  1 126 ? 35.312   45.770  9.112   1.00 25.45 ? 135 ASP A OD1 1 
ATOM   945   O  OD2 . ASP A  1 126 ? 33.380   45.961  10.141  1.00 25.23 ? 135 ASP A OD2 1 
ATOM   946   N  N   . ILE A  1 127 ? 37.475   43.815  10.284  1.00 18.14 ? 136 ILE A N   1 
ATOM   947   C  CA  . ILE A  1 127 ? 38.577   43.937  11.226  1.00 20.35 ? 136 ILE A CA  1 
ATOM   948   C  C   . ILE A  1 127 ? 38.792   45.374  11.536  1.00 23.17 ? 136 ILE A C   1 
ATOM   949   O  O   . ILE A  1 127 ? 38.806   46.215  10.648  1.00 22.43 ? 136 ILE A O   1 
ATOM   950   C  CB  . ILE A  1 127 ? 39.875   43.351  10.677  1.00 20.72 ? 136 ILE A CB  1 
ATOM   951   C  CG1 . ILE A  1 127 ? 39.605   41.888  10.270  1.00 23.44 ? 136 ILE A CG1 1 
ATOM   952   C  CG2 . ILE A  1 127 ? 40.957   43.478  11.705  1.00 20.95 ? 136 ILE A CG2 1 
ATOM   953   C  CD1 . ILE A  1 127 ? 40.756   40.936  10.058  1.00 23.46 ? 136 ILE A CD1 1 
ATOM   954   N  N   . CYS A  1 128 ? 38.870   45.678  12.820  1.00 27.09 ? 137 CYS A N   1 
ATOM   955   C  CA  . CYS A  1 128 ? 39.247   47.020  13.239  1.00 30.16 ? 137 CYS A CA  1 
ATOM   956   C  C   . CYS A  1 128 ? 39.909   46.990  14.586  1.00 31.77 ? 137 CYS A C   1 
ATOM   957   O  O   . CYS A  1 128 ? 39.267   46.886  15.617  1.00 30.63 ? 137 CYS A O   1 
ATOM   958   C  CB  . CYS A  1 128 ? 38.090   48.016  13.193  1.00 30.87 ? 137 CYS A CB  1 
ATOM   959   S  SG  . CYS A  1 128 ? 38.766   49.687  13.003  1.00 39.73 ? 137 CYS A SG  1 
ATOM   960   N  N   . GLY A  1 129 ? 41.230   47.004  14.529  1.00 35.87 ? 138 GLY A N   1 
ATOM   961   C  CA  . GLY A  1 129 ? 42.051   47.025  15.702  1.00 39.39 ? 138 GLY A CA  1 
ATOM   962   C  C   . GLY A  1 129 ? 41.972   45.734  16.474  1.00 47.70 ? 138 GLY A C   1 
ATOM   963   O  O   . GLY A  1 129 ? 41.386   44.705  15.977  1.00 52.16 ? 138 GLY A O   1 
ATOM   964   N  N   . PRO A  1 130 ? 42.487   45.790  17.727  1.00 49.76 ? 139 PRO A N   1 
ATOM   965   C  CA  . PRO A  1 130 ? 42.602   44.602  18.559  1.00 47.27 ? 139 PRO A CA  1 
ATOM   966   C  C   . PRO A  1 130 ? 41.231   44.018  18.911  1.00 42.93 ? 139 PRO A C   1 
ATOM   967   O  O   . PRO A  1 130 ? 41.081   42.808  18.932  1.00 46.89 ? 139 PRO A O   1 
ATOM   968   C  CB  . PRO A  1 130 ? 43.341   45.101  19.813  1.00 51.64 ? 139 PRO A CB  1 
ATOM   969   C  CG  . PRO A  1 130 ? 43.370   46.601  19.735  1.00 49.73 ? 139 PRO A CG  1 
ATOM   970   C  CD  . PRO A  1 130 ? 42.639   47.039  18.508  1.00 50.55 ? 139 PRO A CD  1 
ATOM   971   N  N   . GLY A  1 131 ? 40.248   44.885  19.148  1.00 40.12 ? 140 GLY A N   1 
ATOM   972   C  CA  . GLY A  1 131 ? 38.918   44.484  19.610  1.00 38.21 ? 140 GLY A CA  1 
ATOM   973   C  C   . GLY A  1 131 ? 37.960   43.829  18.630  1.00 41.38 ? 140 GLY A C   1 
ATOM   974   O  O   . GLY A  1 131 ? 37.108   43.072  19.053  1.00 48.01 ? 140 GLY A O   1 
ATOM   975   N  N   . THR A  1 132 ? 38.064   44.132  17.336  1.00 36.50 ? 141 THR A N   1 
ATOM   976   C  CA  . THR A  1 132 ? 37.090   43.686  16.351  1.00 31.86 ? 141 THR A CA  1 
ATOM   977   C  C   . THR A  1 132 ? 37.678   42.742  15.295  1.00 29.93 ? 141 THR A C   1 
ATOM   978   O  O   . THR A  1 132 ? 38.470   43.152  14.472  1.00 26.72 ? 141 THR A O   1 
ATOM   979   C  CB  . THR A  1 132 ? 36.443   44.875  15.628  1.00 33.54 ? 141 THR A CB  1 
ATOM   980   O  OG1 . THR A  1 132 ? 35.927   45.757  16.608  1.00 32.33 ? 141 THR A OG1 1 
ATOM   981   C  CG2 . THR A  1 132 ? 35.262   44.439  14.718  1.00 31.49 ? 141 THR A CG2 1 
ATOM   982   N  N   . LYS A  1 133 ? 37.273   41.482  15.371  1.00 25.60 ? 142 LYS A N   1 
ATOM   983   C  CA  . LYS A  1 133 ? 37.572   40.479  14.399  1.00 25.14 ? 142 LYS A CA  1 
ATOM   984   C  C   . LYS A  1 133 ? 36.287   39.671  14.207  1.00 22.55 ? 142 LYS A C   1 
ATOM   985   O  O   . LYS A  1 133 ? 36.091   38.623  14.808  1.00 20.74 ? 142 LYS A O   1 
ATOM   986   C  CB  . LYS A  1 133 ? 38.636   39.521  14.909  1.00 27.87 ? 142 LYS A CB  1 
ATOM   987   C  CG  . LYS A  1 133 ? 39.881   40.163  15.624  1.00 31.05 ? 142 LYS A CG  1 
ATOM   988   C  CD  . LYS A  1 133 ? 40.769   40.904  14.647  1.00 35.79 ? 142 LYS A CD  1 
ATOM   989   C  CE  . LYS A  1 133 ? 42.083   41.539  15.274  1.00 37.05 ? 142 LYS A CE  1 
ATOM   990   N  NZ  . LYS A  1 133 ? 43.280   40.650  15.386  1.00 38.61 ? 142 LYS A NZ  1 
ATOM   991   N  N   . LYS A  1 134 ? 35.429   40.149  13.344  1.00 21.44 ? 143 LYS A N   1 
ATOM   992   C  CA  . LYS A  1 134 ? 34.058   39.740  13.378  1.00 22.58 ? 143 LYS A CA  1 
ATOM   993   C  C   . LYS A  1 134 ? 33.558   39.407  11.963  1.00 19.71 ? 143 LYS A C   1 
ATOM   994   O  O   . LYS A  1 134 ? 33.999   39.992  10.998  1.00 19.43 ? 143 LYS A O   1 
ATOM   995   C  CB  . LYS A  1 134 ? 33.267   40.878  14.077  1.00 25.59 ? 143 LYS A CB  1 
ATOM   996   C  CG  . LYS A  1 134 ? 32.156   41.511  13.297  1.00 27.15 ? 143 LYS A CG  1 
ATOM   997   C  CD  . LYS A  1 134 ? 31.244   42.288  14.245  1.00 29.37 ? 143 LYS A CD  1 
ATOM   998   C  CE  . LYS A  1 134 ? 29.948   41.509  14.493  1.00 33.69 ? 143 LYS A CE  1 
ATOM   999   N  NZ  . LYS A  1 134 ? 28.715   42.231  14.124  1.00 37.47 ? 143 LYS A NZ  1 
ATOM   1000  N  N   . VAL A  1 135 ? 32.650   38.439  11.864  1.00 18.23 ? 144 VAL A N   1 
ATOM   1001  C  CA  . VAL A  1 135 ? 31.929   38.158  10.623  1.00 16.98 ? 144 VAL A CA  1 
ATOM   1002  C  C   . VAL A  1 135 ? 30.520   38.764  10.650  1.00 17.72 ? 144 VAL A C   1 
ATOM   1003  O  O   . VAL A  1 135 ? 29.647   38.372  11.458  1.00 19.72 ? 144 VAL A O   1 
ATOM   1004  C  CB  . VAL A  1 135 ? 31.824   36.668  10.311  1.00 16.37 ? 144 VAL A CB  1 
ATOM   1005  C  CG1 . VAL A  1 135 ? 31.213   36.449  8.931   1.00 17.33 ? 144 VAL A CG1 1 
ATOM   1006  C  CG2 . VAL A  1 135 ? 33.187   36.004  10.370  1.00 16.22 ? 144 VAL A CG2 1 
ATOM   1007  N  N   . HIS A  1 136 ? 30.299   39.704  9.754   1.00 15.28 ? 145 HIS A N   1 
ATOM   1008  C  CA  . HIS A  1 136 ? 29.002   40.305  9.617   1.00 16.86 ? 145 HIS A CA  1 
ATOM   1009  C  C   . HIS A  1 136 ? 28.065   39.402  8.861   1.00 15.48 ? 145 HIS A C   1 
ATOM   1010  O  O   . HIS A  1 136 ? 28.416   38.869  7.821   1.00 15.29 ? 145 HIS A O   1 
ATOM   1011  C  CB  . HIS A  1 136 ? 29.081   41.609  8.842   1.00 17.79 ? 145 HIS A CB  1 
ATOM   1012  C  CG  . HIS A  1 136 ? 29.574   42.765  9.637   1.00 20.91 ? 145 HIS A CG  1 
ATOM   1013  N  ND1 . HIS A  1 136 ? 28.859   43.302  10.683  1.00 23.80 ? 145 HIS A ND1 1 
ATOM   1014  C  CD2 . HIS A  1 136 ? 30.688   43.526  9.512   1.00 22.00 ? 145 HIS A CD2 1 
ATOM   1015  C  CE1 . HIS A  1 136 ? 29.534   44.319  11.199  1.00 22.91 ? 145 HIS A CE1 1 
ATOM   1016  N  NE2 . HIS A  1 136 ? 30.644   44.475  10.503  1.00 22.13 ? 145 HIS A NE2 1 
ATOM   1017  N  N   . VAL A  1 137 ? 26.830   39.329  9.334   1.00 14.95 ? 146 VAL A N   1 
ATOM   1018  C  CA  . VAL A  1 137 ? 25.738   38.798  8.559   1.00 14.91 ? 146 VAL A CA  1 
ATOM   1019  C  C   . VAL A  1 137 ? 24.616   39.784  8.791   1.00 15.98 ? 146 VAL A C   1 
ATOM   1020  O  O   . VAL A  1 137 ? 24.020   39.827  9.863   1.00 18.71 ? 146 VAL A O   1 
ATOM   1021  C  CB  . VAL A  1 137 ? 25.337   37.374  8.986   1.00 14.82 ? 146 VAL A CB  1 
ATOM   1022  C  CG1 . VAL A  1 137 ? 24.409   36.770  7.974   1.00 14.36 ? 146 VAL A CG1 1 
ATOM   1023  C  CG2 . VAL A  1 137 ? 26.559   36.501  9.135   1.00 14.91 ? 146 VAL A CG2 1 
ATOM   1024  N  N   . ILE A  1 138 ? 24.288   40.549  7.758   1.00 15.68 ? 147 ILE A N   1 
ATOM   1025  C  CA  . ILE A  1 138 ? 23.240   41.531  7.833   1.00 14.55 ? 147 ILE A CA  1 
ATOM   1026  C  C   . ILE A  1 138 ? 22.135   41.261  6.821   1.00 15.03 ? 147 ILE A C   1 
ATOM   1027  O  O   . ILE A  1 138 ? 22.381   41.054  5.619   1.00 14.77 ? 147 ILE A O   1 
ATOM   1028  C  CB  . ILE A  1 138 ? 23.806   42.952  7.597   1.00 15.82 ? 147 ILE A CB  1 
ATOM   1029  C  CG1 . ILE A  1 138 ? 24.965   43.207  8.555   1.00 16.34 ? 147 ILE A CG1 1 
ATOM   1030  C  CG2 . ILE A  1 138 ? 22.749   44.022  7.799   1.00 15.61 ? 147 ILE A CG2 1 
ATOM   1031  C  CD1 . ILE A  1 138 ? 25.634   44.554  8.403   1.00 16.30 ? 147 ILE A CD1 1 
ATOM   1032  N  N   . PHE A  1 139 ? 20.905   41.335  7.296   1.00 14.82 ? 148 PHE A N   1 
ATOM   1033  C  CA  . PHE A  1 139 ? 19.744   41.199  6.445   1.00 15.14 ? 148 PHE A CA  1 
ATOM   1034  C  C   . PHE A  1 139 ? 19.011   42.527  6.427   1.00 15.65 ? 148 PHE A C   1 
ATOM   1035  O  O   . PHE A  1 139 ? 18.750   43.122  7.485   1.00 16.21 ? 148 PHE A O   1 
ATOM   1036  C  CB  . PHE A  1 139 ? 18.781   40.109  6.961   1.00 15.51 ? 148 PHE A CB  1 
ATOM   1037  C  CG  . PHE A  1 139 ? 19.198   38.714  6.636   1.00 15.84 ? 148 PHE A CG  1 
ATOM   1038  C  CD1 . PHE A  1 139 ? 20.045   38.014  7.473   1.00 15.75 ? 148 PHE A CD1 1 
ATOM   1039  C  CD2 . PHE A  1 139 ? 18.753   38.111  5.506   1.00 16.68 ? 148 PHE A CD2 1 
ATOM   1040  C  CE1 . PHE A  1 139 ? 20.449   36.738  7.150   1.00 16.60 ? 148 PHE A CE1 1 
ATOM   1041  C  CE2 . PHE A  1 139 ? 19.147   36.823  5.171   1.00 16.33 ? 148 PHE A CE2 1 
ATOM   1042  C  CZ  . PHE A  1 139 ? 19.987   36.131  5.983   1.00 16.29 ? 148 PHE A CZ  1 
ATOM   1043  N  N   . ASN A  1 140 ? 18.638   42.954  5.228   1.00 16.49 ? 149 ASN A N   1 
ATOM   1044  C  CA  . ASN A  1 140 ? 17.726   44.078  5.087   1.00 17.77 ? 149 ASN A CA  1 
ATOM   1045  C  C   . ASN A  1 140 ? 16.255   43.642  5.174   1.00 18.26 ? 149 ASN A C   1 
ATOM   1046  O  O   . ASN A  1 140 ? 15.790   42.811  4.394   1.00 17.62 ? 149 ASN A O   1 
ATOM   1047  C  CB  . ASN A  1 140 ? 17.945   44.799  3.770   1.00 18.10 ? 149 ASN A CB  1 
ATOM   1048  C  CG  . ASN A  1 140 ? 17.059   46.019  3.637   1.00 17.97 ? 149 ASN A CG  1 
ATOM   1049  O  OD1 . ASN A  1 140 ? 16.186   46.056  2.811   1.00 18.04 ? 149 ASN A OD1 1 
ATOM   1050  N  ND2 . ASN A  1 140 ? 17.279   47.009  4.484   1.00 18.86 ? 149 ASN A ND2 1 
ATOM   1051  N  N   . TYR A  1 141 ? 15.546   44.227  6.123   1.00 19.46 ? 150 TYR A N   1 
ATOM   1052  C  CA  . TYR A  1 141 ? 14.155   43.887  6.374   1.00 22.75 ? 150 TYR A CA  1 
ATOM   1053  C  C   . TYR A  1 141 ? 13.385   45.107  6.858   1.00 23.63 ? 150 TYR A C   1 
ATOM   1054  O  O   . TYR A  1 141 ? 13.801   45.786  7.798   1.00 21.99 ? 150 TYR A O   1 
ATOM   1055  C  CB  . TYR A  1 141 ? 14.097   42.784  7.434   1.00 24.71 ? 150 TYR A CB  1 
ATOM   1056  C  CG  . TYR A  1 141 ? 12.702   42.285  7.781   1.00 26.80 ? 150 TYR A CG  1 
ATOM   1057  C  CD1 . TYR A  1 141 ? 11.969   41.500  6.885   1.00 28.29 ? 150 TYR A CD1 1 
ATOM   1058  C  CD2 . TYR A  1 141 ? 12.132   42.567  9.020   1.00 27.37 ? 150 TYR A CD2 1 
ATOM   1059  C  CE1 . TYR A  1 141 ? 10.698   41.020  7.222   1.00 31.10 ? 150 TYR A CE1 1 
ATOM   1060  C  CE2 . TYR A  1 141 ? 10.872   42.095  9.361   1.00 28.79 ? 150 TYR A CE2 1 
ATOM   1061  C  CZ  . TYR A  1 141 ? 10.158   41.328  8.472   1.00 30.99 ? 150 TYR A CZ  1 
ATOM   1062  O  OH  . TYR A  1 141 ? 8.915    40.857  8.836   1.00 35.03 ? 150 TYR A OH  1 
ATOM   1063  N  N   . LYS A  1 142 ? 12.260   45.374  6.212   1.00 28.32 ? 151 LYS A N   1 
ATOM   1064  C  CA  . LYS A  1 142 ? 11.410   46.533  6.535   1.00 34.86 ? 151 LYS A CA  1 
ATOM   1065  C  C   . LYS A  1 142 ? 12.229   47.802  6.640   1.00 36.08 ? 151 LYS A C   1 
ATOM   1066  O  O   . LYS A  1 142 ? 12.132   48.520  7.647   1.00 37.26 ? 151 LYS A O   1 
ATOM   1067  C  CB  . LYS A  1 142 ? 10.645   46.326  7.856   1.00 36.53 ? 151 LYS A CB  1 
ATOM   1068  C  CG  . LYS A  1 142 ? 9.696    45.142  7.860   1.00 40.66 ? 151 LYS A CG  1 
ATOM   1069  C  CD  . LYS A  1 142 ? 8.700    45.160  6.696   1.00 47.26 ? 151 LYS A CD  1 
ATOM   1070  C  CE  . LYS A  1 142 ? 7.856    43.878  6.532   1.00 53.57 ? 151 LYS A CE  1 
ATOM   1071  N  NZ  . LYS A  1 142 ? 6.363    43.851  6.381   1.00 60.58 ? 151 LYS A NZ  1 
ATOM   1072  N  N   . GLY A  1 143 ? 13.069   48.039  5.629   1.00 35.89 ? 152 GLY A N   1 
ATOM   1073  C  CA  . GLY A  1 143 ? 13.896   49.252  5.562   1.00 33.96 ? 152 GLY A CA  1 
ATOM   1074  C  C   . GLY A  1 143 ? 14.939   49.417  6.653   1.00 32.48 ? 152 GLY A C   1 
ATOM   1075  O  O   . GLY A  1 143 ? 15.421   50.525  6.888   1.00 33.77 ? 152 GLY A O   1 
ATOM   1076  N  N   . LYS A  1 144 ? 15.213   48.347  7.390   1.00 31.18 ? 153 LYS A N   1 
ATOM   1077  C  CA  . LYS A  1 144 ? 16.290   48.347  8.391   1.00 30.60 ? 153 LYS A CA  1 
ATOM   1078  C  C   . LYS A  1 144 ? 17.325   47.301  7.984   1.00 26.15 ? 153 LYS A C   1 
ATOM   1079  O  O   . LYS A  1 144 ? 17.003   46.256  7.443   1.00 25.83 ? 153 LYS A O   1 
ATOM   1080  C  CB  . LYS A  1 144 ? 15.809   47.994  9.805   1.00 34.43 ? 153 LYS A CB  1 
ATOM   1081  C  CG  . LYS A  1 144 ? 15.408   49.108  10.787  1.00 38.34 ? 153 LYS A CG  1 
ATOM   1082  C  CD  . LYS A  1 144 ? 14.415   50.083  10.217  1.00 45.36 ? 153 LYS A CD  1 
ATOM   1083  C  CE  . LYS A  1 144 ? 14.259   51.331  11.068  1.00 51.78 ? 153 LYS A CE  1 
ATOM   1084  N  NZ  . LYS A  1 144 ? 13.429   52.356  10.378  1.00 55.14 ? 153 LYS A NZ  1 
ATOM   1085  N  N   . ASN A  1 145 ? 18.566   47.595  8.300   1.00 24.64 ? 154 ASN A N   1 
ATOM   1086  C  CA  . ASN A  1 145 ? 19.671   46.674  8.136   1.00 23.99 ? 154 ASN A CA  1 
ATOM   1087  C  C   . ASN A  1 145 ? 19.896   46.009  9.468   1.00 24.46 ? 154 ASN A C   1 
ATOM   1088  O  O   . ASN A  1 145 ? 20.424   46.611  10.391  1.00 26.35 ? 154 ASN A O   1 
ATOM   1089  C  CB  . ASN A  1 145 ? 20.924   47.397  7.679   1.00 22.43 ? 154 ASN A CB  1 
ATOM   1090  C  CG  . ASN A  1 145 ? 20.848   47.804  6.224   1.00 22.81 ? 154 ASN A CG  1 
ATOM   1091  O  OD1 . ASN A  1 145 ? 20.228   47.148  5.399   1.00 23.56 ? 154 ASN A OD1 1 
ATOM   1092  N  ND2 . ASN A  1 145 ? 21.464   48.905  5.912   1.00 24.55 ? 154 ASN A ND2 1 
ATOM   1093  N  N   . VAL A  1 146 ? 19.515   44.753  9.561   1.00 21.44 ? 155 VAL A N   1 
ATOM   1094  C  CA  . VAL A  1 146 ? 19.539   44.068  10.846  1.00 20.61 ? 155 VAL A CA  1 
ATOM   1095  C  C   . VAL A  1 146 ? 20.792   43.193  10.981  1.00 18.57 ? 155 VAL A C   1 
ATOM   1096  O  O   . VAL A  1 146 ? 21.084   42.366  10.107  1.00 15.94 ? 155 VAL A O   1 
ATOM   1097  C  CB  . VAL A  1 146 ? 18.263   43.225  11.039  1.00 22.07 ? 155 VAL A CB  1 
ATOM   1098  C  CG1 . VAL A  1 146 ? 18.125   42.794  12.492  1.00 21.21 ? 155 VAL A CG1 1 
ATOM   1099  C  CG2 . VAL A  1 146 ? 17.025   44.025  10.615  1.00 22.93 ? 155 VAL A CG2 1 
ATOM   1100  N  N   . LEU A  1 147 ? 21.496   43.382  12.091  1.00 18.87 ? 156 LEU A N   1 
ATOM   1101  C  CA  . LEU A  1 147 ? 22.792   42.761  12.334  1.00 21.38 ? 156 LEU A CA  1 
ATOM   1102  C  C   . LEU A  1 147 ? 22.648   41.487  13.134  1.00 21.29 ? 156 LEU A C   1 
ATOM   1103  O  O   . LEU A  1 147 ? 21.854   41.432  14.053  1.00 19.76 ? 156 LEU A O   1 
ATOM   1104  C  CB  . LEU A  1 147 ? 23.730   43.703  13.097  1.00 23.57 ? 156 LEU A CB  1 
ATOM   1105  C  CG  . LEU A  1 147 ? 24.467   44.763  12.232  1.00 25.18 ? 156 LEU A CG  1 
ATOM   1106  C  CD1 . LEU A  1 147 ? 23.517   45.836  11.759  1.00 25.09 ? 156 LEU A CD1 1 
ATOM   1107  C  CD2 . LEU A  1 147 ? 25.627   45.360  13.028  1.00 26.05 ? 156 LEU A CD2 1 
ATOM   1108  N  N   . ILE A  1 148 ? 23.429   40.465  12.789  1.00 20.77 ? 157 ILE A N   1 
ATOM   1109  C  CA  . ILE A  1 148 ? 23.319   39.208  13.490  1.00 19.95 ? 157 ILE A CA  1 
ATOM   1110  C  C   . ILE A  1 148 ? 23.739   39.446  14.944  1.00 21.41 ? 157 ILE A C   1 
ATOM   1111  O  O   . ILE A  1 148 ? 24.565   40.272  15.215  1.00 17.97 ? 157 ILE A O   1 
ATOM   1112  C  CB  . ILE A  1 148 ? 24.151   38.110  12.871  1.00 18.87 ? 157 ILE A CB  1 
ATOM   1113  C  CG1 . ILE A  1 148 ? 23.711   36.745  13.412  1.00 18.80 ? 157 ILE A CG1 1 
ATOM   1114  C  CG2 . ILE A  1 148 ? 25.638   38.385  13.084  1.00 19.89 ? 157 ILE A CG2 1 
ATOM   1115  C  CD1 . ILE A  1 148 ? 24.470   35.563  12.818  1.00 19.13 ? 157 ILE A CD1 1 
ATOM   1116  N  N   . ASN A  1 149 ? 23.062   38.761  15.866  1.00 23.89 ? 158 ASN A N   1 
ATOM   1117  C  CA  . ASN A  1 149 ? 23.271   38.959  17.323  1.00 26.21 ? 158 ASN A CA  1 
ATOM   1118  C  C   . ASN A  1 149 ? 24.281   37.958  17.865  1.00 25.65 ? 158 ASN A C   1 
ATOM   1119  O  O   . ASN A  1 149 ? 24.693   38.054  19.000  1.00 27.48 ? 158 ASN A O   1 
ATOM   1120  C  CB  . ASN A  1 149 ? 21.878   38.981  18.018  1.00 27.08 ? 158 ASN A CB  1 
ATOM   1121  C  CG  . ASN A  1 149 ? 21.238   37.610  18.110  1.00 29.18 ? 158 ASN A CG  1 
ATOM   1122  O  OD1 . ASN A  1 149 ? 21.886   36.581  17.871  1.00 29.72 ? 158 ASN A OD1 1 
ATOM   1123  N  ND2 . ASN A  1 149 ? 19.958   37.578  18.482  1.00 29.26 ? 158 ASN A ND2 1 
ATOM   1124  N  N   . LYS A  1 150 ? 24.716   37.010  17.045  1.00 24.20 ? 159 LYS A N   1 
ATOM   1125  C  CA  . LYS A  1 150 ? 25.786   36.093  17.459  1.00 25.80 ? 159 LYS A CA  1 
ATOM   1126  C  C   . LYS A  1 150 ? 27.137   36.683  17.134  1.00 27.35 ? 159 LYS A C   1 
ATOM   1127  O  O   . LYS A  1 150 ? 27.315   37.365  16.129  1.00 28.06 ? 159 LYS A O   1 
ATOM   1128  C  CB  . LYS A  1 150 ? 25.666   34.723  16.772  1.00 27.08 ? 159 LYS A CB  1 
ATOM   1129  C  CG  . LYS A  1 150 ? 24.433   33.939  17.214  1.00 28.01 ? 159 LYS A CG  1 
ATOM   1130  C  CD  . LYS A  1 150 ? 24.807   32.546  17.668  1.00 27.46 ? 159 LYS A CD  1 
ATOM   1131  C  CE  . LYS A  1 150 ? 23.591   31.673  18.016  1.00 26.82 ? 159 LYS A CE  1 
ATOM   1132  N  NZ  . LYS A  1 150 ? 23.229   30.714  16.948  1.00 25.65 ? 159 LYS A NZ  1 
ATOM   1133  N  N   . ASP A  1 151 ? 28.108   36.364  17.962  1.00 27.90 ? 160 ASP A N   1 
ATOM   1134  C  CA  . ASP A  1 151 ? 29.451   36.835  17.750  1.00 31.16 ? 160 ASP A CA  1 
ATOM   1135  C  C   . ASP A  1 151 ? 30.320   35.782  17.034  1.00 27.47 ? 160 ASP A C   1 
ATOM   1136  O  O   . ASP A  1 151 ? 30.655   34.765  17.588  1.00 27.30 ? 160 ASP A O   1 
ATOM   1137  C  CB  . ASP A  1 151 ? 30.060   37.229  19.089  1.00 35.28 ? 160 ASP A CB  1 
ATOM   1138  C  CG  . ASP A  1 151 ? 31.457   37.716  18.932  1.00 41.50 ? 160 ASP A CG  1 
ATOM   1139  O  OD1 . ASP A  1 151 ? 31.678   38.633  18.117  1.00 41.83 ? 160 ASP A OD1 1 
ATOM   1140  O  OD2 . ASP A  1 151 ? 32.336   37.129  19.579  1.00 49.37 ? 160 ASP A OD2 1 
ATOM   1141  N  N   . ILE A  1 152 ? 30.677   36.053  15.789  1.00 24.01 ? 161 ILE A N   1 
ATOM   1142  C  CA  . ILE A  1 152 ? 31.453   35.137  14.969  1.00 19.47 ? 161 ILE A CA  1 
ATOM   1143  C  C   . ILE A  1 152 ? 32.819   35.743  14.729  1.00 19.28 ? 161 ILE A C   1 
ATOM   1144  O  O   . ILE A  1 152 ? 32.944   36.820  14.196  1.00 19.07 ? 161 ILE A O   1 
ATOM   1145  C  CB  . ILE A  1 152 ? 30.767   34.873  13.607  1.00 18.62 ? 161 ILE A CB  1 
ATOM   1146  C  CG1 . ILE A  1 152 ? 29.322   34.429  13.812  1.00 18.61 ? 161 ILE A CG1 1 
ATOM   1147  C  CG2 . ILE A  1 152 ? 31.524   33.835  12.812  1.00 17.40 ? 161 ILE A CG2 1 
ATOM   1148  C  CD1 . ILE A  1 152 ? 28.510   34.395  12.538  1.00 18.62 ? 161 ILE A CD1 1 
ATOM   1149  N  N   . ARG A  1 153 ? 33.849   35.028  15.117  1.00 18.86 ? 162 ARG A N   1 
ATOM   1150  C  CA  . ARG A  1 153 ? 35.190   35.490  14.958  1.00 19.86 ? 162 ARG A CA  1 
ATOM   1151  C  C   . ARG A  1 153 ? 35.675   35.240  13.545  1.00 18.24 ? 162 ARG A C   1 
ATOM   1152  O  O   . ARG A  1 153 ? 35.456   34.178  12.992  1.00 14.65 ? 162 ARG A O   1 
ATOM   1153  C  CB  . ARG A  1 153 ? 36.125   34.838  16.001  1.00 25.22 ? 162 ARG A CB  1 
ATOM   1154  C  CG  . ARG A  1 153 ? 37.627   34.795  15.628  1.00 30.98 ? 162 ARG A CG  1 
ATOM   1155  C  CD  . ARG A  1 153 ? 38.663   35.572  16.467  1.00 40.34 ? 162 ARG A CD  1 
ATOM   1156  N  NE  . ARG A  1 153 ? 38.293   35.978  17.819  1.00 49.43 ? 162 ARG A NE  1 
ATOM   1157  C  CZ  . ARG A  1 153 ? 39.013   36.868  18.499  1.00 48.97 ? 162 ARG A CZ  1 
ATOM   1158  N  NH1 . ARG A  1 153 ? 40.108   37.384  17.946  1.00 42.20 ? 162 ARG A NH1 1 
ATOM   1159  N  NH2 . ARG A  1 153 ? 38.645   37.226  19.730  1.00 54.58 ? 162 ARG A NH2 1 
ATOM   1160  N  N   . CYS A  1 154 ? 36.316   36.244  12.938  1.00 17.47 ? 163 CYS A N   1 
ATOM   1161  C  CA  . CYS A  1 154 ? 36.832   36.050  11.593  1.00 18.75 ? 163 CYS A CA  1 
ATOM   1162  C  C   . CYS A  1 154 ? 38.304   35.659  11.684  1.00 20.59 ? 163 CYS A C   1 
ATOM   1163  O  O   . CYS A  1 154 ? 38.862   35.682  12.751  1.00 22.66 ? 163 CYS A O   1 
ATOM   1164  C  CB  . CYS A  1 154 ? 36.627   37.283  10.754  1.00 18.32 ? 163 CYS A CB  1 
ATOM   1165  S  SG  . CYS A  1 154 ? 37.693   38.686  11.165  1.00 18.67 ? 163 CYS A SG  1 
ATOM   1166  N  N   . LYS A  1 155 ? 38.914   35.271  10.573  1.00 21.75 ? 164 LYS A N   1 
ATOM   1167  C  CA  . LYS A  1 155 ? 40.360   35.066  10.535  1.00 21.80 ? 164 LYS A CA  1 
ATOM   1168  C  C   . LYS A  1 155 ? 41.087   36.396  10.369  1.00 22.97 ? 164 LYS A C   1 
ATOM   1169  O  O   . LYS A  1 155 ? 40.554   37.349  9.784   1.00 23.92 ? 164 LYS A O   1 
ATOM   1170  C  CB  . LYS A  1 155 ? 40.738   34.192  9.377   1.00 24.66 ? 164 LYS A CB  1 
ATOM   1171  C  CG  . LYS A  1 155 ? 40.057   32.834  9.416   1.00 25.69 ? 164 LYS A CG  1 
ATOM   1172  C  CD  . LYS A  1 155 ? 40.616   31.968  10.524  1.00 25.18 ? 164 LYS A CD  1 
ATOM   1173  C  CE  . LYS A  1 155 ? 40.363   30.529  10.170  1.00 26.62 ? 164 LYS A CE  1 
ATOM   1174  N  NZ  . LYS A  1 155 ? 40.712   29.615  11.275  1.00 28.30 ? 164 LYS A NZ  1 
ATOM   1175  N  N   . ASP A  1 156 ? 42.304   36.472  10.879  1.00 23.12 ? 165 ASP A N   1 
ATOM   1176  C  CA  . ASP A  1 156 ? 43.071   37.720  10.782  1.00 27.16 ? 165 ASP A CA  1 
ATOM   1177  C  C   . ASP A  1 156 ? 44.532   37.567  10.328  1.00 24.64 ? 165 ASP A C   1 
ATOM   1178  O  O   . ASP A  1 156 ? 45.231   38.562  10.233  1.00 30.50 ? 165 ASP A O   1 
ATOM   1179  C  CB  . ASP A  1 156 ? 43.067   38.456  12.122  1.00 31.69 ? 165 ASP A CB  1 
ATOM   1180  C  CG  . ASP A  1 156 ? 43.794   37.667  13.198  1.00 34.36 ? 165 ASP A CG  1 
ATOM   1181  O  OD1 . ASP A  1 156 ? 44.180   36.506  12.902  1.00 32.59 ? 165 ASP A OD1 1 
ATOM   1182  O  OD2 . ASP A  1 156 ? 43.994   38.194  14.320  1.00 43.58 ? 165 ASP A OD2 1 
ATOM   1183  N  N   . ASP A  1 157 ? 45.010   36.355  10.067  1.00 20.53 ? 166 ASP A N   1 
ATOM   1184  C  CA  . ASP A  1 157 ? 46.378   36.172  9.566   1.00 18.12 ? 166 ASP A CA  1 
ATOM   1185  C  C   . ASP A  1 157 ? 46.532   36.618  8.105   1.00 16.30 ? 166 ASP A C   1 
ATOM   1186  O  O   . ASP A  1 157 ? 45.656   37.302  7.558   1.00 16.54 ? 166 ASP A O   1 
ATOM   1187  C  CB  . ASP A  1 157 ? 46.812   34.713  9.775   1.00 18.44 ? 166 ASP A CB  1 
ATOM   1188  C  CG  . ASP A  1 157 ? 46.046   33.743  8.913   1.00 19.31 ? 166 ASP A CG  1 
ATOM   1189  O  OD1 . ASP A  1 157 ? 45.311   34.173  7.977   1.00 19.52 ? 166 ASP A OD1 1 
ATOM   1190  O  OD2 . ASP A  1 157 ? 46.204   32.515  9.117   1.00 19.98 ? 166 ASP A OD2 1 
ATOM   1191  N  N   . GLU A  1 158 ? 47.633   36.254  7.454   1.00 15.37 ? 167 GLU A N   1 
ATOM   1192  C  CA  . GLU A  1 158 ? 47.911   36.759  6.107   1.00 15.87 ? 167 GLU A CA  1 
ATOM   1193  C  C   . GLU A  1 158 ? 47.470   35.844  4.973   1.00 13.78 ? 167 GLU A C   1 
ATOM   1194  O  O   . GLU A  1 158 ? 47.641   36.159  3.833   1.00 13.27 ? 167 GLU A O   1 
ATOM   1195  C  CB  . GLU A  1 158 ? 49.410   37.065  5.956   1.00 18.62 ? 167 GLU A CB  1 
ATOM   1196  C  CG  . GLU A  1 158 ? 50.372   35.870  5.897   1.00 19.74 ? 167 GLU A CG  1 
ATOM   1197  C  CD  . GLU A  1 158 ? 50.898   35.415  7.275   1.00 23.09 ? 167 GLU A CD  1 
ATOM   1198  O  OE1 . GLU A  1 158 ? 50.073   35.283  8.215   1.00 24.78 ? 167 GLU A OE1 1 
ATOM   1199  O  OE2 . GLU A  1 158 ? 52.130   35.162  7.405   1.00 25.04 ? 167 GLU A OE2 1 
ATOM   1200  N  N   . PHE A  1 159 ? 46.877   34.714  5.309   1.00 14.03 ? 168 PHE A N   1 
ATOM   1201  C  CA  . PHE A  1 159 ? 46.576   33.666  4.354   1.00 13.77 ? 168 PHE A CA  1 
ATOM   1202  C  C   . PHE A  1 159 ? 45.173   33.779  3.768   1.00 13.16 ? 168 PHE A C   1 
ATOM   1203  O  O   . PHE A  1 159 ? 44.390   34.606  4.198   1.00 12.07 ? 168 PHE A O   1 
ATOM   1204  C  CB  . PHE A  1 159 ? 46.865   32.293  4.961   1.00 14.14 ? 168 PHE A CB  1 
ATOM   1205  C  CG  . PHE A  1 159 ? 48.313   32.118  5.364   1.00 14.22 ? 168 PHE A CG  1 
ATOM   1206  C  CD1 . PHE A  1 159 ? 49.289   31.831  4.417   1.00 14.14 ? 168 PHE A CD1 1 
ATOM   1207  C  CD2 . PHE A  1 159 ? 48.694   32.262  6.689   1.00 15.20 ? 168 PHE A CD2 1 
ATOM   1208  C  CE1 . PHE A  1 159 ? 50.637   31.658  4.777   1.00 15.06 ? 168 PHE A CE1 1 
ATOM   1209  C  CE2 . PHE A  1 159 ? 50.045   32.090  7.069   1.00 15.92 ? 168 PHE A CE2 1 
ATOM   1210  C  CZ  . PHE A  1 159 ? 51.018   31.791  6.105   1.00 15.23 ? 168 PHE A CZ  1 
ATOM   1211  N  N   . THR A  1 160 ? 44.909   32.981  2.731   1.00 12.65 ? 169 THR A N   1 
ATOM   1212  C  CA  . THR A  1 160 ? 43.623   32.977  2.065   1.00 12.53 ? 169 THR A CA  1 
ATOM   1213  C  C   . THR A  1 160 ? 42.574   32.197  2.886   1.00 11.82 ? 169 THR A C   1 
ATOM   1214  O  O   . THR A  1 160 ? 42.781   31.031  3.214   1.00 13.23 ? 169 THR A O   1 
ATOM   1215  C  CB  . THR A  1 160 ? 43.751   32.325  0.666   1.00 13.37 ? 169 THR A CB  1 
ATOM   1216  O  OG1 . THR A  1 160 ? 44.632   33.112  -0.139  1.00 13.80 ? 169 THR A OG1 1 
ATOM   1217  C  CG2 . THR A  1 160 ? 42.417   32.300  -0.082  1.00 13.12 ? 169 THR A CG2 1 
ATOM   1218  N  N   . HIS A  1 161 ? 41.445   32.802  3.166   1.00 10.75 ? 170 HIS A N   1 
ATOM   1219  C  CA  . HIS A  1 161 ? 40.363   32.089  3.874   1.00 11.08 ? 170 HIS A CA  1 
ATOM   1220  C  C   . HIS A  1 161 ? 39.025   32.139  3.141   1.00 10.23 ? 170 HIS A C   1 
ATOM   1221  O  O   . HIS A  1 161 ? 38.710   33.132  2.476   1.00 9.71  ? 170 HIS A O   1 
ATOM   1222  C  CB  . HIS A  1 161 ? 40.207   32.604  5.297   1.00 11.27 ? 170 HIS A CB  1 
ATOM   1223  C  CG  . HIS A  1 161 ? 41.447   32.378  6.105   1.00 12.82 ? 170 HIS A CG  1 
ATOM   1224  N  ND1 . HIS A  1 161 ? 41.888   31.113  6.449   1.00 13.96 ? 170 HIS A ND1 1 
ATOM   1225  C  CD2 . HIS A  1 161 ? 42.409   33.229  6.518   1.00 12.54 ? 170 HIS A CD2 1 
ATOM   1226  C  CE1 . HIS A  1 161 ? 43.034   31.209  7.102   1.00 13.47 ? 170 HIS A CE1 1 
ATOM   1227  N  NE2 . HIS A  1 161 ? 43.346   32.483  7.193   1.00 13.06 ? 170 HIS A NE2 1 
ATOM   1228  N  N   . LEU A  1 162 ? 38.328   31.003  3.208   1.00 9.63  ? 171 LEU A N   1 
ATOM   1229  C  CA  . LEU A  1 162 ? 37.035   30.781  2.538   1.00 9.96  ? 171 LEU A CA  1 
ATOM   1230  C  C   . LEU A  1 162 ? 35.887   31.149  3.450   1.00 9.83  ? 171 LEU A C   1 
ATOM   1231  O  O   . LEU A  1 162 ? 35.832   30.696  4.566   1.00 9.07  ? 171 LEU A O   1 
ATOM   1232  C  CB  . LEU A  1 162 ? 36.888   29.326  2.097   1.00 9.92  ? 171 LEU A CB  1 
ATOM   1233  C  CG  . LEU A  1 162 ? 35.652   29.018  1.245   1.00 9.73  ? 171 LEU A CG  1 
ATOM   1234  C  CD1 . LEU A  1 162 ? 35.766   29.548  -0.160  1.00 9.67  ? 171 LEU A CD1 1 
ATOM   1235  C  CD2 . LEU A  1 162 ? 35.416   27.523  1.189   1.00 10.32 ? 171 LEU A CD2 1 
ATOM   1236  N  N   . TYR A  1 163 ? 35.045   32.073  2.979   1.00 10.17 ? 172 TYR A N   1 
ATOM   1237  C  CA  . TYR A  1 163 ? 33.840   32.494  3.705   1.00 10.40 ? 172 TYR A CA  1 
ATOM   1238  C  C   . TYR A  1 163 ? 32.566   32.058  2.968   1.00 11.24 ? 172 TYR A C   1 
ATOM   1239  O  O   . TYR A  1 163 ? 32.395   32.326  1.788   1.00 12.26 ? 172 TYR A O   1 
ATOM   1240  C  CB  . TYR A  1 163 ? 33.835   33.986  3.935   1.00 9.88  ? 172 TYR A CB  1 
ATOM   1241  C  CG  . TYR A  1 163 ? 34.857   34.385  5.003   1.00 10.19 ? 172 TYR A CG  1 
ATOM   1242  C  CD1 . TYR A  1 163 ? 34.514   34.409  6.352   1.00 9.79  ? 172 TYR A CD1 1 
ATOM   1243  C  CD2 . TYR A  1 163 ? 36.143   34.708  4.664   1.00 10.04 ? 172 TYR A CD2 1 
ATOM   1244  C  CE1 . TYR A  1 163 ? 35.435   34.762  7.305   1.00 10.08 ? 172 TYR A CE1 1 
ATOM   1245  C  CE2 . TYR A  1 163 ? 37.070   35.074  5.611   1.00 10.01 ? 172 TYR A CE2 1 
ATOM   1246  C  CZ  . TYR A  1 163 ? 36.733   35.102  6.924   1.00 10.31 ? 172 TYR A CZ  1 
ATOM   1247  O  OH  . TYR A  1 163 ? 37.653   35.517  7.876   1.00 10.25 ? 172 TYR A OH  1 
ATOM   1248  N  N   . THR A  1 164 ? 31.676   31.411  3.691   1.00 11.31 ? 173 THR A N   1 
ATOM   1249  C  CA  . THR A  1 164 ? 30.462   30.838  3.092   1.00 11.97 ? 173 THR A CA  1 
ATOM   1250  C  C   . THR A  1 164 ? 29.251   31.157  3.964   1.00 11.67 ? 173 THR A C   1 
ATOM   1251  O  O   . THR A  1 164 ? 29.260   30.903  5.190   1.00 11.89 ? 173 THR A O   1 
ATOM   1252  C  CB  . THR A  1 164 ? 30.536   29.299  3.001   1.00 12.65 ? 173 THR A CB  1 
ATOM   1253  O  OG1 . THR A  1 164 ? 31.758   28.894  2.369   1.00 13.27 ? 173 THR A OG1 1 
ATOM   1254  C  CG2 . THR A  1 164 ? 29.339   28.716  2.248   1.00 12.87 ? 173 THR A CG2 1 
ATOM   1255  N  N   . LEU A  1 165 ? 28.241   31.729  3.336   1.00 10.97 ? 174 LEU A N   1 
ATOM   1256  C  CA  . LEU A  1 165 ? 26.961   31.934  3.989   1.00 11.22 ? 174 LEU A CA  1 
ATOM   1257  C  C   . LEU A  1 165 ? 25.905   31.102  3.279   1.00 10.96 ? 174 LEU A C   1 
ATOM   1258  O  O   . LEU A  1 165 ? 25.715   31.210  2.065   1.00 11.30 ? 174 LEU A O   1 
ATOM   1259  C  CB  . LEU A  1 165 ? 26.549   33.400  3.971   1.00 11.35 ? 174 LEU A CB  1 
ATOM   1260  C  CG  . LEU A  1 165 ? 25.100   33.679  4.424   1.00 11.46 ? 174 LEU A CG  1 
ATOM   1261  C  CD1 . LEU A  1 165 ? 24.962   33.514  5.911   1.00 11.83 ? 174 LEU A CD1 1 
ATOM   1262  C  CD2 . LEU A  1 165 ? 24.700   35.099  4.054   1.00 12.01 ? 174 LEU A CD2 1 
ATOM   1263  N  N   . ILE A  1 166 ? 25.198   30.319  4.064   1.00 11.37 ? 175 ILE A N   1 
ATOM   1264  C  CA  . ILE A  1 166 ? 24.068   29.490  3.607   1.00 11.48 ? 175 ILE A CA  1 
ATOM   1265  C  C   . ILE A  1 166 ? 22.771   29.961  4.246   1.00 11.52 ? 175 ILE A C   1 
ATOM   1266  O  O   . ILE A  1 166 ? 22.674   30.065  5.476   1.00 10.22 ? 175 ILE A O   1 
ATOM   1267  C  CB  . ILE A  1 166 ? 24.257   28.031  4.022   1.00 12.22 ? 175 ILE A CB  1 
ATOM   1268  C  CG1 . ILE A  1 166 ? 25.512   27.561  3.341   1.00 12.29 ? 175 ILE A CG1 1 
ATOM   1269  C  CG2 . ILE A  1 166 ? 23.108   27.159  3.523   1.00 12.41 ? 175 ILE A CG2 1 
ATOM   1270  C  CD1 . ILE A  1 166 ? 26.013   26.202  3.632   1.00 12.28 ? 175 ILE A CD1 1 
ATOM   1271  N  N   . VAL A  1 167 ? 21.800   30.269  3.395   1.00 12.80 ? 176 VAL A N   1 
ATOM   1272  C  CA  . VAL A  1 167 ? 20.443   30.683  3.832   1.00 13.93 ? 176 VAL A CA  1 
ATOM   1273  C  C   . VAL A  1 167 ? 19.400   29.770  3.218   1.00 14.49 ? 176 VAL A C   1 
ATOM   1274  O  O   . VAL A  1 167 ? 19.303   29.661  1.996   1.00 16.39 ? 176 VAL A O   1 
ATOM   1275  C  CB  . VAL A  1 167 ? 20.128   32.119  3.404   1.00 14.03 ? 176 VAL A CB  1 
ATOM   1276  C  CG1 . VAL A  1 167 ? 18.745   32.540  3.890   1.00 14.81 ? 176 VAL A CG1 1 
ATOM   1277  C  CG2 . VAL A  1 167 ? 21.177   33.087  3.943   1.00 14.17 ? 176 VAL A CG2 1 
ATOM   1278  N  N   . ARG A  1 168 ? 18.579   29.159  4.051   1.00 14.62 ? 177 ARG A N   1 
ATOM   1279  C  CA  . ARG A  1 168 ? 17.601   28.161  3.584   1.00 14.76 ? 177 ARG A CA  1 
ATOM   1280  C  C   . ARG A  1 168 ? 16.134   28.609  3.727   1.00 15.72 ? 177 ARG A C   1 
ATOM   1281  O  O   . ARG A  1 168 ? 15.825   29.394  4.623   1.00 15.22 ? 177 ARG A O   1 
ATOM   1282  C  CB  . ARG A  1 168 ? 17.781   26.872  4.359   1.00 14.76 ? 177 ARG A CB  1 
ATOM   1283  C  CG  . ARG A  1 168 ? 19.144   26.283  4.244   1.00 14.78 ? 177 ARG A CG  1 
ATOM   1284  C  CD  . ARG A  1 168 ? 19.207   24.931  4.926   1.00 15.80 ? 177 ARG A CD  1 
ATOM   1285  N  NE  . ARG A  1 168 ? 20.592   24.446  5.117   1.00 16.00 ? 177 ARG A NE  1 
ATOM   1286  C  CZ  . ARG A  1 168 ? 21.290   24.619  6.232   1.00 15.75 ? 177 ARG A CZ  1 
ATOM   1287  N  NH1 . ARG A  1 168 ? 20.783   25.316  7.241   1.00 14.98 ? 177 ARG A NH1 1 
ATOM   1288  N  NH2 . ARG A  1 168 ? 22.511   24.165  6.299   1.00 15.89 ? 177 ARG A NH2 1 
ATOM   1289  N  N   . PRO A  1 169 ? 15.228   28.079  2.869   1.00 16.54 ? 178 PRO A N   1 
ATOM   1290  C  CA  . PRO A  1 169 ? 13.829   28.500  2.862   1.00 17.99 ? 178 PRO A CA  1 
ATOM   1291  C  C   . PRO A  1 169 ? 13.014   28.115  4.100   1.00 18.92 ? 178 PRO A C   1 
ATOM   1292  O  O   . PRO A  1 169 ? 11.890   28.538  4.203   1.00 21.80 ? 178 PRO A O   1 
ATOM   1293  C  CB  . PRO A  1 169 ? 13.258   27.885  1.589   1.00 17.62 ? 178 PRO A CB  1 
ATOM   1294  C  CG  . PRO A  1 169 ? 14.205   26.843  1.169   1.00 17.13 ? 178 PRO A CG  1 
ATOM   1295  C  CD  . PRO A  1 169 ? 15.462   26.954  1.959   1.00 17.10 ? 178 PRO A CD  1 
ATOM   1296  N  N   . ASP A  1 170 ? 13.584   27.392  5.048   1.00 19.04 ? 179 ASP A N   1 
ATOM   1297  C  CA  . ASP A  1 170 ? 12.968   27.249  6.374   1.00 19.23 ? 179 ASP A CA  1 
ATOM   1298  C  C   . ASP A  1 170 ? 13.486   28.256  7.362   1.00 18.91 ? 179 ASP A C   1 
ATOM   1299  O  O   . ASP A  1 170 ? 13.294   28.130  8.553   1.00 15.39 ? 179 ASP A O   1 
ATOM   1300  C  CB  . ASP A  1 170 ? 13.150   25.822  6.930   1.00 21.79 ? 179 ASP A CB  1 
ATOM   1301  C  CG  . ASP A  1 170 ? 14.609   25.383  7.012   1.00 23.47 ? 179 ASP A CG  1 
ATOM   1302  O  OD1 . ASP A  1 170 ? 15.497   26.216  6.823   1.00 27.06 ? 179 ASP A OD1 1 
ATOM   1303  O  OD2 . ASP A  1 170 ? 14.873   24.197  7.283   1.00 26.55 ? 179 ASP A OD2 1 
ATOM   1304  N  N   . ASN A  1 171 ? 14.140   29.304  6.847   1.00 20.24 ? 180 ASN A N   1 
ATOM   1305  C  CA  . ASN A  1 171 ? 14.726   30.368  7.674   1.00 18.78 ? 180 ASN A CA  1 
ATOM   1306  C  C   . ASN A  1 171 ? 15.813   29.883  8.606   1.00 16.66 ? 180 ASN A C   1 
ATOM   1307  O  O   . ASN A  1 171 ? 16.067   30.473  9.629   1.00 15.52 ? 180 ASN A O   1 
ATOM   1308  C  CB  . ASN A  1 171 ? 13.663   31.069  8.523   1.00 21.49 ? 180 ASN A CB  1 
ATOM   1309  C  CG  . ASN A  1 171 ? 12.836   32.094  7.740   1.00 23.83 ? 180 ASN A CG  1 
ATOM   1310  O  OD1 . ASN A  1 171 ? 13.343   32.872  6.934   1.00 22.86 ? 180 ASN A OD1 1 
ATOM   1311  N  ND2 . ASN A  1 171 ? 11.576   32.185  8.087   1.00 27.67 ? 180 ASN A ND2 1 
ATOM   1312  N  N   . THR A  1 172 ? 16.472   28.809  8.244   1.00 16.76 ? 181 THR A N   1 
ATOM   1313  C  CA  . THR A  1 172 ? 17.735   28.455  8.898   1.00 16.44 ? 181 THR A CA  1 
ATOM   1314  C  C   . THR A  1 172 ? 18.933   29.050  8.106   1.00 15.57 ? 181 THR A C   1 
ATOM   1315  O  O   . THR A  1 172 ? 18.837   29.335  6.916   1.00 15.41 ? 181 THR A O   1 
ATOM   1316  C  CB  . THR A  1 172 ? 17.941   26.947  9.021   1.00 16.68 ? 181 THR A CB  1 
ATOM   1317  O  OG1 . THR A  1 172 ? 17.858   26.341  7.733   1.00 16.77 ? 181 THR A OG1 1 
ATOM   1318  C  CG2 . THR A  1 172 ? 16.886   26.344  9.934   1.00 17.61 ? 181 THR A CG2 1 
ATOM   1319  N  N   . TYR A  1 173 ? 20.062   29.227  8.788   1.00 13.78 ? 182 TYR A N   1 
ATOM   1320  C  CA  . TYR A  1 173 ? 21.275   29.676  8.115   1.00 12.63 ? 182 TYR A CA  1 
ATOM   1321  C  C   . TYR A  1 173 ? 22.474   28.942  8.719   1.00 13.10 ? 182 TYR A C   1 
ATOM   1322  O  O   . TYR A  1 173 ? 22.452   28.467  9.842   1.00 11.90 ? 182 TYR A O   1 
ATOM   1323  C  CB  . TYR A  1 173 ? 21.447   31.209  8.275   1.00 12.11 ? 182 TYR A CB  1 
ATOM   1324  C  CG  . TYR A  1 173 ? 21.984   31.556  9.648   1.00 11.37 ? 182 TYR A CG  1 
ATOM   1325  C  CD1 . TYR A  1 173 ? 21.134   31.568  10.740  1.00 11.30 ? 182 TYR A CD1 1 
ATOM   1326  C  CD2 . TYR A  1 173 ? 23.343   31.756  9.876   1.00 11.15 ? 182 TYR A CD2 1 
ATOM   1327  C  CE1 . TYR A  1 173 ? 21.612   31.804  12.013  1.00 10.94 ? 182 TYR A CE1 1 
ATOM   1328  C  CE2 . TYR A  1 173 ? 23.831   32.015  11.170  1.00 10.84 ? 182 TYR A CE2 1 
ATOM   1329  C  CZ  . TYR A  1 173 ? 22.951   32.017  12.225  1.00 10.78 ? 182 TYR A CZ  1 
ATOM   1330  O  OH  . TYR A  1 173 ? 23.367   32.283  13.504  1.00 11.46 ? 182 TYR A OH  1 
ATOM   1331  N  N   . GLU A  1 174 ? 23.557   28.977  7.985   1.00 13.76 ? 183 GLU A N   1 
ATOM   1332  C  CA  . GLU A  1 174 ? 24.814   28.455  8.452   1.00 15.04 ? 183 GLU A CA  1 
ATOM   1333  C  C   . GLU A  1 174 ? 25.940   29.348  7.927   1.00 14.50 ? 183 GLU A C   1 
ATOM   1334  O  O   . GLU A  1 174 ? 25.885   29.831  6.784   1.00 14.07 ? 183 GLU A O   1 
ATOM   1335  C  CB  . GLU A  1 174 ? 24.949   27.023  7.924   1.00 16.78 ? 183 GLU A CB  1 
ATOM   1336  C  CG  . GLU A  1 174 ? 26.136   26.269  8.410   1.00 19.65 ? 183 GLU A CG  1 
ATOM   1337  C  CD  . GLU A  1 174 ? 26.085   24.792  7.991   1.00 23.64 ? 183 GLU A CD  1 
ATOM   1338  O  OE1 . GLU A  1 174 ? 24.988   24.236  7.737   1.00 28.06 ? 183 GLU A OE1 1 
ATOM   1339  O  OE2 . GLU A  1 174 ? 27.165   24.166  7.974   1.00 25.56 ? 183 GLU A OE2 1 
ATOM   1340  N  N   . VAL A  1 175 ? 26.943   29.565  8.762   1.00 13.82 ? 184 VAL A N   1 
ATOM   1341  C  CA  . VAL A  1 175 ? 28.152   30.266  8.353   1.00 13.05 ? 184 VAL A CA  1 
ATOM   1342  C  C   . VAL A  1 175 ? 29.344   29.330  8.475   1.00 12.91 ? 184 VAL A C   1 
ATOM   1343  O  O   . VAL A  1 175 ? 29.562   28.682  9.499   1.00 12.11 ? 184 VAL A O   1 
ATOM   1344  C  CB  . VAL A  1 175 ? 28.415   31.537  9.171   1.00 12.94 ? 184 VAL A CB  1 
ATOM   1345  C  CG1 . VAL A  1 175 ? 29.740   32.198  8.749   1.00 13.05 ? 184 VAL A CG1 1 
ATOM   1346  C  CG2 . VAL A  1 175 ? 27.300   32.522  8.993   1.00 12.98 ? 184 VAL A CG2 1 
ATOM   1347  N  N   . LYS A  1 176 ? 30.114   29.277  7.394   1.00 12.73 ? 185 LYS A N   1 
ATOM   1348  C  CA  . LYS A  1 176 ? 31.354   28.497  7.356   1.00 12.67 ? 185 LYS A CA  1 
ATOM   1349  C  C   . LYS A  1 176 ? 32.589   29.355  7.071   1.00 11.33 ? 185 LYS A C   1 
ATOM   1350  O  O   . LYS A  1 176 ? 32.552   30.277  6.277   1.00 10.71 ? 185 LYS A O   1 
ATOM   1351  C  CB  . LYS A  1 176 ? 31.295   27.483  6.260   1.00 13.05 ? 185 LYS A CB  1 
ATOM   1352  C  CG  . LYS A  1 176 ? 30.221   26.448  6.407   1.00 15.26 ? 185 LYS A CG  1 
ATOM   1353  C  CD  . LYS A  1 176 ? 30.452   25.399  5.343   1.00 14.87 ? 185 LYS A CD  1 
ATOM   1354  C  CE  . LYS A  1 176 ? 29.201   24.692  5.059   1.00 17.96 ? 185 LYS A CE  1 
ATOM   1355  N  NZ  . LYS A  1 176 ? 29.384   23.277  4.623   1.00 19.79 ? 185 LYS A NZ  1 
ATOM   1356  N  N   . ILE A  1 177 ? 33.679   28.974  7.711   1.00 11.36 ? 186 ILE A N   1 
ATOM   1357  C  CA  . ILE A  1 177 ? 35.014   29.483  7.421   1.00 11.61 ? 186 ILE A CA  1 
ATOM   1358  C  C   . ILE A  1 177 ? 35.909   28.317  7.066   1.00 11.26 ? 186 ILE A C   1 
ATOM   1359  O  O   . ILE A  1 177 ? 35.918   27.303  7.778   1.00 11.31 ? 186 ILE A O   1 
ATOM   1360  C  CB  . ILE A  1 177 ? 35.609   30.278  8.580   1.00 10.71 ? 186 ILE A CB  1 
ATOM   1361  C  CG1 . ILE A  1 177 ? 34.687   31.440  8.876   1.00 11.12 ? 186 ILE A CG1 1 
ATOM   1362  C  CG2 . ILE A  1 177 ? 36.948   30.844  8.188   1.00 10.72 ? 186 ILE A CG2 1 
ATOM   1363  C  CD1 . ILE A  1 177 ? 35.041   32.259  10.125  1.00 10.88 ? 186 ILE A CD1 1 
ATOM   1364  N  N   . ASP A  1 178 ? 36.617   28.451  5.945   1.00 11.18 ? 187 ASP A N   1 
ATOM   1365  C  CA  . ASP A  1 178 ? 37.476   27.353  5.439   1.00 11.24 ? 187 ASP A CA  1 
ATOM   1366  C  C   . ASP A  1 178 ? 36.727   26.027  5.388   1.00 11.75 ? 187 ASP A C   1 
ATOM   1367  O  O   . ASP A  1 178 ? 37.236   25.010  5.788   1.00 11.16 ? 187 ASP A O   1 
ATOM   1368  C  CB  . ASP A  1 178 ? 38.753   27.248  6.303   1.00 11.20 ? 187 ASP A CB  1 
ATOM   1369  C  CG  . ASP A  1 178 ? 39.622   28.513  6.177   1.00 10.99 ? 187 ASP A CG  1 
ATOM   1370  O  OD1 . ASP A  1 178 ? 39.366   29.281  5.223   1.00 9.78  ? 187 ASP A OD1 1 
ATOM   1371  O  OD2 . ASP A  1 178 ? 40.506   28.752  7.015   1.00 10.96 ? 187 ASP A OD2 1 
ATOM   1372  N  N   . ASN A  1 179 ? 35.508   26.099  4.856   1.00 12.65 ? 188 ASN A N   1 
ATOM   1373  C  CA  . ASN A  1 179 ? 34.615   24.944  4.613   1.00 13.77 ? 188 ASN A CA  1 
ATOM   1374  C  C   . ASN A  1 179 ? 34.231   24.197  5.856   1.00 14.37 ? 188 ASN A C   1 
ATOM   1375  O  O   . ASN A  1 179 ? 33.975   23.005  5.802   1.00 16.18 ? 188 ASN A O   1 
ATOM   1376  C  CB  . ASN A  1 179 ? 35.183   23.968  3.573   1.00 13.90 ? 188 ASN A CB  1 
ATOM   1377  C  CG  . ASN A  1 179 ? 34.399   23.982  2.250   1.00 14.98 ? 188 ASN A CG  1 
ATOM   1378  O  OD1 . ASN A  1 179 ? 33.278   24.477  2.167   1.00 15.89 ? 188 ASN A OD1 1 
ATOM   1379  N  ND2 . ASN A  1 179 ? 35.037   23.507  1.188   1.00 15.73 ? 188 ASN A ND2 1 
ATOM   1380  N  N   . SER A  1 180 ? 34.212   24.871  6.970   1.00 14.13 ? 189 SER A N   1 
ATOM   1381  C  CA  . SER A  1 180 ? 33.898   24.203  8.214   1.00 15.78 ? 189 SER A CA  1 
ATOM   1382  C  C   . SER A  1 180 ? 33.030   25.117  9.039   1.00 16.60 ? 189 SER A C   1 
ATOM   1383  O  O   . SER A  1 180 ? 33.283   26.324  9.104   1.00 15.50 ? 189 SER A O   1 
ATOM   1384  C  CB  . SER A  1 180 ? 35.164   23.849  8.931   1.00 16.40 ? 189 SER A CB  1 
ATOM   1385  O  OG  . SER A  1 180 ? 34.849   23.473  10.226  1.00 17.90 ? 189 SER A OG  1 
ATOM   1386  N  N   . GLN A  1 181 ? 31.926   24.568  9.533   1.00 16.92 ? 190 GLN A N   1 
ATOM   1387  C  CA  . GLN A  1 181 ? 30.865   25.359  10.150  1.00 18.06 ? 190 GLN A CA  1 
ATOM   1388  C  C   . GLN A  1 181 ? 31.407   26.073  11.351  1.00 17.52 ? 190 GLN A C   1 
ATOM   1389  O  O   . GLN A  1 181 ? 32.096   25.463  12.145  1.00 19.46 ? 190 GLN A O   1 
ATOM   1390  C  CB  . GLN A  1 181 ? 29.723   24.463  10.617  1.00 19.92 ? 190 GLN A CB  1 
ATOM   1391  C  CG  . GLN A  1 181 ? 28.628   25.225  11.365  1.00 22.51 ? 190 GLN A CG  1 
ATOM   1392  C  CD  . GLN A  1 181 ? 27.445   24.353  11.784  1.00 24.50 ? 190 GLN A CD  1 
ATOM   1393  O  OE1 . GLN A  1 181 ? 27.007   24.424  12.910  1.00 27.41 ? 190 GLN A OE1 1 
ATOM   1394  N  NE2 . GLN A  1 181 ? 26.907   23.568  10.865  1.00 26.51 ? 190 GLN A NE2 1 
ATOM   1395  N  N   . VAL A  1 182 ? 31.078   27.340  11.493  1.00 16.14 ? 191 VAL A N   1 
ATOM   1396  C  CA  . VAL A  1 182 ? 31.454   28.102  12.703  1.00 15.62 ? 191 VAL A CA  1 
ATOM   1397  C  C   . VAL A  1 182 ? 30.230   28.681  13.394  1.00 15.02 ? 191 VAL A C   1 
ATOM   1398  O  O   . VAL A  1 182 ? 30.295   29.027  14.555  1.00 14.05 ? 191 VAL A O   1 
ATOM   1399  C  CB  . VAL A  1 182 ? 32.453   29.252  12.419  1.00 14.80 ? 191 VAL A CB  1 
ATOM   1400  C  CG1 . VAL A  1 182 ? 33.775   28.693  11.944  1.00 14.58 ? 191 VAL A CG1 1 
ATOM   1401  C  CG2 . VAL A  1 182 ? 31.889   30.200  11.385  1.00 15.82 ? 191 VAL A CG2 1 
ATOM   1402  N  N   . GLU A  1 183 ? 29.110   28.758  12.690  1.00 15.57 ? 192 GLU A N   1 
ATOM   1403  C  CA  . GLU A  1 183 ? 27.878   29.246  13.297  1.00 17.05 ? 192 GLU A CA  1 
ATOM   1404  C  C   . GLU A  1 183 ? 26.638   28.721  12.575  1.00 15.38 ? 192 GLU A C   1 
ATOM   1405  O  O   . GLU A  1 183 ? 26.635   28.502  11.368  1.00 14.85 ? 192 GLU A O   1 
ATOM   1406  C  CB  . GLU A  1 183 ? 27.886   30.777  13.320  1.00 19.37 ? 192 GLU A CB  1 
ATOM   1407  C  CG  . GLU A  1 183 ? 26.949   31.453  14.346  1.00 22.06 ? 192 GLU A CG  1 
ATOM   1408  C  CD  . GLU A  1 183 ? 26.880   30.703  15.689  1.00 24.14 ? 192 GLU A CD  1 
ATOM   1409  O  OE1 . GLU A  1 183 ? 27.864   30.810  16.463  1.00 27.77 ? 192 GLU A OE1 1 
ATOM   1410  O  OE2 . GLU A  1 183 ? 25.910   29.919  15.931  1.00 24.80 ? 192 GLU A OE2 1 
ATOM   1411  N  N   . SER A  1 184 ? 25.546   28.560  13.316  1.00 15.02 ? 193 SER A N   1 
ATOM   1412  C  CA  . SER A  1 184 ? 24.267   28.186  12.693  1.00 14.32 ? 193 SER A CA  1 
ATOM   1413  C  C   . SER A  1 184 ? 23.067   28.548  13.561  1.00 13.79 ? 193 SER A C   1 
ATOM   1414  O  O   . SER A  1 184 ? 23.202   28.765  14.746  1.00 12.59 ? 193 SER A O   1 
ATOM   1415  C  CB  . SER A  1 184 ? 24.233   26.689  12.352  1.00 15.28 ? 193 SER A CB  1 
ATOM   1416  O  OG  . SER A  1 184 ? 24.445   25.879  13.500  1.00 15.90 ? 193 SER A OG  1 
ATOM   1417  N  N   . GLY A  1 185 ? 21.888   28.575  12.947  1.00 13.66 ? 194 GLY A N   1 
ATOM   1418  C  CA  . GLY A  1 185 ? 20.669   28.789  13.683  1.00 13.73 ? 194 GLY A CA  1 
ATOM   1419  C  C   . GLY A  1 185 ? 19.551   29.205  12.799  1.00 13.33 ? 194 GLY A C   1 
ATOM   1420  O  O   . GLY A  1 185 ? 19.497   28.858  11.623  1.00 13.84 ? 194 GLY A O   1 
ATOM   1421  N  N   . SER A  1 186 ? 18.622   29.942  13.377  1.00 14.88 ? 195 SER A N   1 
ATOM   1422  C  CA  . SER A  1 186 ? 17.421   30.421  12.668  1.00 16.88 ? 195 SER A CA  1 
ATOM   1423  C  C   . SER A  1 186 ? 17.371   31.926  12.691  1.00 17.68 ? 195 SER A C   1 
ATOM   1424  O  O   . SER A  1 186 ? 17.778   32.555  13.665  1.00 15.45 ? 195 SER A O   1 
ATOM   1425  C  CB  . SER A  1 186 ? 16.124   29.881  13.293  1.00 16.26 ? 195 SER A CB  1 
ATOM   1426  O  OG  . SER A  1 186 ? 16.083   28.484  13.106  1.00 18.22 ? 195 SER A OG  1 
ATOM   1427  N  N   . LEU A  1 187 ? 16.871   32.472  11.582  1.00 18.78 ? 196 LEU A N   1 
ATOM   1428  C  CA  . LEU A  1 187 ? 16.801   33.886  11.396  1.00 20.98 ? 196 LEU A CA  1 
ATOM   1429  C  C   . LEU A  1 187 ? 15.990   34.511  12.528  1.00 22.97 ? 196 LEU A C   1 
ATOM   1430  O  O   . LEU A  1 187 ? 16.356   35.553  13.039  1.00 21.31 ? 196 LEU A O   1 
ATOM   1431  C  CB  . LEU A  1 187 ? 16.169   34.208  10.059  1.00 22.64 ? 196 LEU A CB  1 
ATOM   1432  C  CG  . LEU A  1 187 ? 16.864   33.931  8.736   1.00 27.14 ? 196 LEU A CG  1 
ATOM   1433  C  CD1 . LEU A  1 187 ? 16.529   34.931  7.628   1.00 28.40 ? 196 LEU A CD1 1 
ATOM   1434  C  CD2 . LEU A  1 187 ? 18.350   33.918  8.922   1.00 28.75 ? 196 LEU A CD2 1 
ATOM   1435  N  N   . GLU A  1 188 ? 14.895   33.862  12.933  1.00 26.26 ? 197 GLU A N   1 
ATOM   1436  C  CA  . GLU A  1 188 ? 14.004   34.471  13.934  1.00 28.57 ? 197 GLU A CA  1 
ATOM   1437  C  C   . GLU A  1 188 ? 14.690   34.603  15.264  1.00 25.83 ? 197 GLU A C   1 
ATOM   1438  O  O   . GLU A  1 188 ? 14.394   35.517  15.989  1.00 27.90 ? 197 GLU A O   1 
ATOM   1439  C  CB  . GLU A  1 188 ? 12.705   33.709  14.153  1.00 30.30 ? 197 GLU A CB  1 
ATOM   1440  C  CG  . GLU A  1 188 ? 12.023   33.211  12.891  1.00 33.05 ? 197 GLU A CG  1 
ATOM   1441  C  CD  . GLU A  1 188 ? 12.730   31.913  12.363  1.00 34.12 ? 197 GLU A CD  1 
ATOM   1442  O  OE1 . GLU A  1 188 ? 12.791   30.877  13.060  1.00 35.44 ? 197 GLU A OE1 1 
ATOM   1443  O  OE2 . GLU A  1 188 ? 13.270   31.885  11.236  1.00 34.91 ? 197 GLU A OE2 1 
ATOM   1444  N  N   . ASP A  1 189 ? 15.624   33.703  15.575  1.00 26.72 ? 198 ASP A N   1 
ATOM   1445  C  CA  . ASP A  1 189 ? 16.295   33.722  16.884  1.00 26.71 ? 198 ASP A CA  1 
ATOM   1446  C  C   . ASP A  1 189 ? 17.534   34.595  16.870  1.00 27.13 ? 198 ASP A C   1 
ATOM   1447  O  O   . ASP A  1 189 ? 17.853   35.228  17.863  1.00 28.39 ? 198 ASP A O   1 
ATOM   1448  C  CB  . ASP A  1 189 ? 16.705   32.309  17.364  1.00 29.57 ? 198 ASP A CB  1 
ATOM   1449  C  CG  . ASP A  1 189 ? 15.546   31.276  17.313  1.00 31.59 ? 198 ASP A CG  1 
ATOM   1450  O  OD1 . ASP A  1 189 ? 14.452   31.562  17.814  1.00 31.66 ? 198 ASP A OD1 1 
ATOM   1451  O  OD2 . ASP A  1 189 ? 15.756   30.147  16.804  1.00 35.84 ? 198 ASP A OD2 1 
ATOM   1452  N  N   . ASP A  1 190 ? 18.279   34.581  15.773  1.00 25.65 ? 199 ASP A N   1 
ATOM   1453  C  CA  . ASP A  1 190 ? 19.632   35.157  15.783  1.00 25.28 ? 199 ASP A CA  1 
ATOM   1454  C  C   . ASP A  1 190 ? 19.686   36.610  15.265  1.00 23.84 ? 199 ASP A C   1 
ATOM   1455  O  O   . ASP A  1 190 ? 20.740   37.258  15.294  1.00 24.55 ? 199 ASP A O   1 
ATOM   1456  C  CB  . ASP A  1 190 ? 20.592   34.241  15.023  1.00 25.05 ? 199 ASP A CB  1 
ATOM   1457  C  CG  . ASP A  1 190 ? 20.830   32.919  15.738  1.00 25.29 ? 199 ASP A CG  1 
ATOM   1458  O  OD1 . ASP A  1 190 ? 20.397   32.772  16.903  1.00 28.54 ? 199 ASP A OD1 1 
ATOM   1459  O  OD2 . ASP A  1 190 ? 21.485   32.031  15.181  1.00 23.89 ? 199 ASP A OD2 1 
ATOM   1460  N  N   . TRP A  1 191 ? 18.532   37.132  14.870  1.00 23.30 ? 200 TRP A N   1 
ATOM   1461  C  CA  . TRP A  1 191 ? 18.358   38.578  14.576  1.00 24.10 ? 200 TRP A CA  1 
ATOM   1462  C  C   . TRP A  1 191 ? 17.066   39.070  15.245  1.00 26.14 ? 200 TRP A C   1 
ATOM   1463  O  O   . TRP A  1 191 ? 16.111   38.301  15.398  1.00 27.17 ? 200 TRP A O   1 
ATOM   1464  C  CB  . TRP A  1 191 ? 18.174   38.808  13.075  1.00 22.41 ? 200 TRP A CB  1 
ATOM   1465  C  CG  . TRP A  1 191 ? 19.391   38.594  12.221  1.00 23.07 ? 200 TRP A CG  1 
ATOM   1466  C  CD1 . TRP A  1 191 ? 20.182   39.561  11.655  1.00 22.75 ? 200 TRP A CD1 1 
ATOM   1467  C  CD2 . TRP A  1 191 ? 19.922   37.340  11.766  1.00 20.82 ? 200 TRP A CD2 1 
ATOM   1468  N  NE1 . TRP A  1 191 ? 21.187   38.977  10.892  1.00 21.31 ? 200 TRP A NE1 1 
ATOM   1469  C  CE2 . TRP A  1 191 ? 21.060   37.622  10.969  1.00 19.87 ? 200 TRP A CE2 1 
ATOM   1470  C  CE3 . TRP A  1 191 ? 19.564   36.008  11.977  1.00 20.92 ? 200 TRP A CE3 1 
ATOM   1471  C  CZ2 . TRP A  1 191 ? 21.810   36.634  10.378  1.00 20.56 ? 200 TRP A CZ2 1 
ATOM   1472  C  CZ3 . TRP A  1 191 ? 20.327   35.014  11.395  1.00 20.54 ? 200 TRP A CZ3 1 
ATOM   1473  C  CH2 . TRP A  1 191 ? 21.429   35.330  10.589  1.00 20.42 ? 200 TRP A CH2 1 
ATOM   1474  N  N   . ASP A  1 192 ? 17.015   40.352  15.570  1.00 27.39 ? 201 ASP A N   1 
ATOM   1475  C  CA  . ASP A  1 192 ? 15.796   41.009  16.063  1.00 28.35 ? 201 ASP A CA  1 
ATOM   1476  C  C   . ASP A  1 192 ? 14.999   41.588  14.925  1.00 27.77 ? 201 ASP A C   1 
ATOM   1477  O  O   . ASP A  1 192 ? 15.021   42.779  14.704  1.00 29.63 ? 201 ASP A O   1 
ATOM   1478  C  CB  . ASP A  1 192 ? 16.132   42.170  16.994  1.00 31.42 ? 201 ASP A CB  1 
ATOM   1479  C  CG  . ASP A  1 192 ? 16.871   41.741  18.238  1.00 41.36 ? 201 ASP A CG  1 
ATOM   1480  O  OD1 . ASP A  1 192 ? 16.792   40.545  18.620  1.00 45.89 ? 201 ASP A OD1 1 
ATOM   1481  O  OD2 . ASP A  1 192 ? 17.500   42.630  18.884  1.00 48.86 ? 201 ASP A OD2 1 
ATOM   1482  N  N   . PHE A  1 193 ? 14.316   40.758  14.169  1.00 27.52 ? 202 PHE A N   1 
ATOM   1483  C  CA  . PHE A  1 193 ? 13.451   41.264  13.090  1.00 28.47 ? 202 PHE A CA  1 
ATOM   1484  C  C   . PHE A  1 193 ? 12.097   41.799  13.621  1.00 28.41 ? 202 PHE A C   1 
ATOM   1485  O  O   . PHE A  1 193 ? 11.654   42.899  13.272  1.00 26.63 ? 202 PHE A O   1 
ATOM   1486  C  CB  . PHE A  1 193 ? 13.146   40.146  12.106  1.00 27.08 ? 202 PHE A CB  1 
ATOM   1487  C  CG  . PHE A  1 193 ? 14.327   39.702  11.322  1.00 28.25 ? 202 PHE A CG  1 
ATOM   1488  C  CD1 . PHE A  1 193 ? 14.923   40.565  10.385  1.00 27.96 ? 202 PHE A CD1 1 
ATOM   1489  C  CD2 . PHE A  1 193 ? 14.869   38.439  11.513  1.00 26.65 ? 202 PHE A CD2 1 
ATOM   1490  C  CE1 . PHE A  1 193 ? 16.035   40.165  9.665   1.00 27.40 ? 202 PHE A CE1 1 
ATOM   1491  C  CE2 . PHE A  1 193 ? 15.969   38.029  10.778  1.00 28.36 ? 202 PHE A CE2 1 
ATOM   1492  C  CZ  . PHE A  1 193 ? 16.566   38.904  9.861   1.00 27.34 ? 202 PHE A CZ  1 
ATOM   1493  N  N   . LEU A  1 194 ? 11.470   41.026  14.495  1.00 26.42 ? 203 LEU A N   1 
ATOM   1494  C  CA  . LEU A  1 194 ? 10.063   41.319  14.882  1.00 28.64 ? 203 LEU A CA  1 
ATOM   1495  C  C   . LEU A  1 194 ? 9.589    40.384  15.983  1.00 29.32 ? 203 LEU A C   1 
ATOM   1496  O  O   . LEU A  1 194 ? 10.201   39.330  16.178  1.00 30.61 ? 203 LEU A O   1 
ATOM   1497  C  CB  . LEU A  1 194 ? 9.059    41.307  13.681  1.00 31.27 ? 203 LEU A CB  1 
ATOM   1498  C  CG  . LEU A  1 194 ? 8.318    40.038  13.187  1.00 32.53 ? 203 LEU A CG  1 
ATOM   1499  C  CD1 . LEU A  1 194 ? 7.201    40.435  12.227  1.00 31.94 ? 203 LEU A CD1 1 
ATOM   1500  C  CD2 . LEU A  1 194 ? 9.239    39.005  12.535  1.00 33.08 ? 203 LEU A CD2 1 
ATOM   1501  N  N   . PRO A  1 195 ? 8.527    40.789  16.737  1.00 31.72 ? 204 PRO A N   1 
ATOM   1502  C  CA  . PRO A  1 195 ? 7.908    39.984  17.832  1.00 29.72 ? 204 PRO A CA  1 
ATOM   1503  C  C   . PRO A  1 195 ? 7.150    38.709  17.390  1.00 31.84 ? 204 PRO A C   1 
ATOM   1504  O  O   . PRO A  1 195 ? 6.630    38.646  16.284  1.00 29.95 ? 204 PRO A O   1 
ATOM   1505  C  CB  . PRO A  1 195 ? 6.919    40.969  18.489  1.00 28.85 ? 204 PRO A CB  1 
ATOM   1506  C  CG  . PRO A  1 195 ? 6.848    42.175  17.628  1.00 29.24 ? 204 PRO A CG  1 
ATOM   1507  C  CD  . PRO A  1 195 ? 8.081    42.205  16.784  1.00 30.40 ? 204 PRO A CD  1 
ATOM   1508  N  N   . GLY A  1 196 ? 7.051    37.725  18.286  1.00 34.90 ? 205 GLY A N   1 
ATOM   1509  C  CA  . GLY A  1 196 ? 6.355    36.479  18.026  1.00 36.88 ? 205 GLY A CA  1 
ATOM   1510  C  C   . GLY A  1 196 ? 7.103    35.416  17.265  1.00 39.22 ? 205 GLY A C   1 
ATOM   1511  O  O   . GLY A  1 196 ? 8.328    35.348  17.225  1.00 37.53 ? 205 GLY A O   1 
ATOM   1512  N  N   . SER A  1 197 ? 6.316    34.554  16.653  1.00 45.06 ? 206 SER A N   1 
ATOM   1513  C  CA  . SER A  1 197 ? 6.883    33.424  15.918  1.00 46.64 ? 206 SER A CA  1 
ATOM   1514  C  C   . SER A  1 197 ? 7.923    33.840  14.901  1.00 49.48 ? 206 SER A C   1 
ATOM   1515  O  O   . SER A  1 197 ? 8.929    33.149  14.718  1.00 51.35 ? 206 SER A O   1 
ATOM   1516  C  CB  . SER A  1 197 ? 5.787    32.647  15.179  1.00 48.12 ? 206 SER A CB  1 
ATOM   1517  O  OG  . SER A  1 197 ? 5.601    31.380  15.774  1.00 54.19 ? 206 SER A OG  1 
ATOM   1518  N  N   . GLY A  1 198 ? 7.679    34.977  14.257  1.00 50.52 ? 207 GLY A N   1 
ATOM   1519  C  CA  . GLY A  1 198 ? 8.454    35.402  13.128  1.00 52.75 ? 207 GLY A CA  1 
ATOM   1520  C  C   . GLY A  1 198 ? 7.464    35.213  12.009  1.00 53.39 ? 207 GLY A C   1 
ATOM   1521  O  O   . GLY A  1 198 ? 6.324    35.697  12.073  1.00 58.27 ? 207 GLY A O   1 
ATOM   1522  N  N   . ASP A  1 199 ? 7.742    35.328  10.656  1.00 29.20 ? 302 ASP A N   1 
ATOM   1523  C  CA  . ASP A  1 199 ? 7.382    35.797  9.328   1.00 32.71 ? 302 ASP A CA  1 
ATOM   1524  C  C   . ASP A  1 199 ? 8.188    34.804  8.554   1.00 32.76 ? 302 ASP A C   1 
ATOM   1525  O  O   . ASP A  1 199 ? 9.414    34.817  8.665   1.00 30.07 ? 302 ASP A O   1 
ATOM   1526  C  CB  . ASP A  1 199 ? 7.814    37.256  9.168   1.00 33.26 ? 302 ASP A CB  1 
ATOM   1527  C  CG  . ASP A  1 199 ? 7.682    37.779  7.745   1.00 34.35 ? 302 ASP A CG  1 
ATOM   1528  O  OD1 . ASP A  1 199 ? 7.390    37.026  6.802   1.00 32.54 ? 302 ASP A OD1 1 
ATOM   1529  O  OD2 . ASP A  1 199 ? 7.917    38.982  7.547   1.00 38.96 ? 302 ASP A OD2 1 
ATOM   1530  N  N   . PRO A  1 200 ? 7.501    33.885  7.861   1.00 30.84 ? 303 PRO A N   1 
ATOM   1531  C  CA  . PRO A  1 200 ? 8.236    32.839  7.191   1.00 31.33 ? 303 PRO A CA  1 
ATOM   1532  C  C   . PRO A  1 200 ? 8.958    33.314  5.931   1.00 29.63 ? 303 PRO A C   1 
ATOM   1533  O  O   . PRO A  1 200 ? 9.821    32.602  5.437   1.00 31.38 ? 303 PRO A O   1 
ATOM   1534  C  CB  . PRO A  1 200 ? 7.146    31.837  6.804   1.00 29.85 ? 303 PRO A CB  1 
ATOM   1535  C  CG  . PRO A  1 200 ? 5.912    32.665  6.624   1.00 31.77 ? 303 PRO A CG  1 
ATOM   1536  C  CD  . PRO A  1 200 ? 6.096    33.946  7.403   1.00 32.62 ? 303 PRO A CD  1 
ATOM   1537  N  N   . SER A  1 201 ? 8.667    34.521  5.465   1.00 28.85 ? 304 SER A N   1 
ATOM   1538  C  CA  . SER A  1 201 ? 9.337    35.073  4.292   1.00 29.89 ? 304 SER A CA  1 
ATOM   1539  C  C   . SER A  1 201 ? 10.629   35.909  4.564   1.00 28.22 ? 304 SER A C   1 
ATOM   1540  O  O   . SER A  1 201 ? 11.212   36.389  3.619   1.00 27.84 ? 304 SER A O   1 
ATOM   1541  C  CB  . SER A  1 201 ? 8.332    35.952  3.514   1.00 31.45 ? 304 SER A CB  1 
ATOM   1542  O  OG  . SER A  1 201 ? 8.301    37.291  4.077   1.00 31.19 ? 304 SER A OG  1 
ATOM   1543  N  N   . ILE A  1 202 ? 11.116   36.009  5.798   1.00 26.20 ? 305 ILE A N   1 
ATOM   1544  C  CA  . ILE A  1 202 ? 12.253   36.880  6.104   1.00 27.67 ? 305 ILE A CA  1 
ATOM   1545  C  C   . ILE A  1 202 ? 13.489   36.607  5.202   1.00 22.58 ? 305 ILE A C   1 
ATOM   1546  O  O   . ILE A  1 202 ? 14.173   37.514  4.744   1.00 20.56 ? 305 ILE A O   1 
ATOM   1547  C  CB  . ILE A  1 202 ? 12.747   36.748  7.591   1.00 32.04 ? 305 ILE A CB  1 
ATOM   1548  C  CG1 . ILE A  1 202 ? 11.671   36.682  8.690   1.00 35.42 ? 305 ILE A CG1 1 
ATOM   1549  C  CG2 . ILE A  1 202 ? 13.903   37.732  7.851   1.00 35.67 ? 305 ILE A CG2 1 
ATOM   1550  C  CD1 . ILE A  1 202 ? 11.285   37.987  9.300   1.00 38.36 ? 305 ILE A CD1 1 
ATOM   1551  N  N   . TYR A  1 203 ? 13.782   35.340  4.991   1.00 19.41 ? 306 TYR A N   1 
ATOM   1552  C  CA  . TYR A  1 203 ? 14.963   34.920  4.231   1.00 19.62 ? 306 TYR A CA  1 
ATOM   1553  C  C   . TYR A  1 203 ? 14.948   35.369  2.772   1.00 21.00 ? 306 TYR A C   1 
ATOM   1554  O  O   . TYR A  1 203 ? 15.977   35.353  2.106   1.00 21.11 ? 306 TYR A O   1 
ATOM   1555  C  CB  . TYR A  1 203 ? 15.065   33.393  4.267   1.00 18.65 ? 306 TYR A CB  1 
ATOM   1556  C  CG  . TYR A  1 203 ? 14.147   32.741  3.288   1.00 18.05 ? 306 TYR A CG  1 
ATOM   1557  C  CD1 . TYR A  1 203 ? 12.803   32.458  3.604   1.00 17.94 ? 306 TYR A CD1 1 
ATOM   1558  C  CD2 . TYR A  1 203 ? 14.617   32.376  2.043   1.00 19.41 ? 306 TYR A CD2 1 
ATOM   1559  C  CE1 . TYR A  1 203 ? 11.937   31.875  2.661   1.00 17.37 ? 306 TYR A CE1 1 
ATOM   1560  C  CE2 . TYR A  1 203 ? 13.788   31.778  1.102   1.00 19.61 ? 306 TYR A CE2 1 
ATOM   1561  C  CZ  . TYR A  1 203 ? 12.436   31.554  1.404   1.00 18.78 ? 306 TYR A CZ  1 
ATOM   1562  O  OH  . TYR A  1 203 ? 11.690   30.988  0.430   1.00 17.33 ? 306 TYR A OH  1 
ATOM   1563  N  N   . ALA A  1 204 ? 13.772   35.730  2.263   1.00 21.51 ? 307 ALA A N   1 
ATOM   1564  C  CA  . ALA A  1 204 ? 13.546   35.774  0.802   1.00 21.28 ? 307 ALA A CA  1 
ATOM   1565  C  C   . ALA A  1 204 ? 13.582   37.163  0.228   1.00 18.41 ? 307 ALA A C   1 
ATOM   1566  O  O   . ALA A  1 204 ? 13.132   38.113  0.840   1.00 18.43 ? 307 ALA A O   1 
ATOM   1567  C  CB  . ALA A  1 204 ? 12.214   35.098  0.435   1.00 22.11 ? 307 ALA A CB  1 
ATOM   1568  N  N   . TYR A  1 205 ? 14.168   37.272  -0.954  1.00 17.27 ? 308 TYR A N   1 
ATOM   1569  C  CA  . TYR A  1 205 ? 14.302   38.551  -1.654  1.00 17.40 ? 308 TYR A CA  1 
ATOM   1570  C  C   . TYR A  1 205 ? 13.827   38.340  -3.083  1.00 20.18 ? 308 TYR A C   1 
ATOM   1571  O  O   . TYR A  1 205 ? 14.121   37.326  -3.723  1.00 20.00 ? 308 TYR A O   1 
ATOM   1572  C  CB  . TYR A  1 205 ? 15.750   39.139  -1.604  1.00 15.22 ? 308 TYR A CB  1 
ATOM   1573  C  CG  . TYR A  1 205 ? 16.130   39.551  -0.216  1.00 13.30 ? 308 TYR A CG  1 
ATOM   1574  C  CD1 . TYR A  1 205 ? 15.727   40.783  0.292   1.00 12.75 ? 308 TYR A CD1 1 
ATOM   1575  C  CD2 . TYR A  1 205 ? 16.794   38.677  0.644   1.00 12.51 ? 308 TYR A CD2 1 
ATOM   1576  C  CE1 . TYR A  1 205 ? 16.031   41.156  1.594   1.00 12.28 ? 308 TYR A CE1 1 
ATOM   1577  C  CE2 . TYR A  1 205 ? 17.090   39.043  1.947   1.00 12.13 ? 308 TYR A CE2 1 
ATOM   1578  C  CZ  . TYR A  1 205 ? 16.716   40.265  2.411   1.00 12.23 ? 308 TYR A CZ  1 
ATOM   1579  O  OH  . TYR A  1 205 ? 16.961   40.629  3.686   1.00 12.34 ? 308 TYR A OH  1 
ATOM   1580  N  N   . ASP A  1 206 ? 13.058   39.305  -3.555  1.00 25.21 ? 309 ASP A N   1 
ATOM   1581  C  CA  . ASP A  1 206 ? 12.435   39.192  -4.880  1.00 31.10 ? 309 ASP A CA  1 
ATOM   1582  C  C   . ASP A  1 206 ? 13.483   39.145  -5.944  1.00 29.62 ? 309 ASP A C   1 
ATOM   1583  O  O   . ASP A  1 206 ? 13.326   38.535  -6.984  1.00 25.97 ? 309 ASP A O   1 
ATOM   1584  C  CB  . ASP A  1 206 ? 11.490   40.372  -5.112  1.00 36.82 ? 309 ASP A CB  1 
ATOM   1585  C  CG  . ASP A  1 206 ? 10.201   40.238  -4.316  1.00 45.03 ? 309 ASP A CG  1 
ATOM   1586  O  OD1 . ASP A  1 206 ? 9.694    39.090  -4.221  1.00 52.99 ? 309 ASP A OD1 1 
ATOM   1587  O  OD2 . ASP A  1 206 ? 9.719    41.260  -3.766  1.00 43.26 ? 309 ASP A OD2 1 
ATOM   1588  N  N   . ASN A  1 207 ? 14.580   39.822  -5.676  1.00 31.30 ? 310 ASN A N   1 
ATOM   1589  C  CA  . ASN A  1 207 ? 15.596   39.837  -6.655  1.00 30.52 ? 310 ASN A CA  1 
ATOM   1590  C  C   . ASN A  1 207 ? 16.992   40.286  -6.207  1.00 30.53 ? 310 ASN A C   1 
ATOM   1591  O  O   . ASN A  1 207 ? 17.222   41.160  -5.343  1.00 28.61 ? 310 ASN A O   1 
ATOM   1592  C  CB  . ASN A  1 207 ? 15.074   40.681  -7.816  1.00 34.75 ? 310 ASN A CB  1 
ATOM   1593  C  CG  . ASN A  1 207 ? 15.965   41.807  -8.185  1.00 38.49 ? 310 ASN A CG  1 
ATOM   1594  O  OD1 . ASN A  1 207 ? 17.130   41.630  -8.574  1.00 40.34 ? 310 ASN A OD1 1 
ATOM   1595  N  ND2 . ASN A  1 207 ? 15.397   42.992  -8.127  1.00 41.06 ? 310 ASN A ND2 1 
ATOM   1596  N  N   . PHE A  1 208 ? 17.913   39.566  -6.797  1.00 28.95 ? 311 PHE A N   1 
ATOM   1597  C  CA  . PHE A  1 208 ? 19.310   39.765  -6.628  1.00 25.76 ? 311 PHE A CA  1 
ATOM   1598  C  C   . PHE A  1 208 ? 19.832   40.002  -8.030  1.00 27.69 ? 311 PHE A C   1 
ATOM   1599  O  O   . PHE A  1 208 ? 19.531   39.221  -8.933  1.00 25.97 ? 311 PHE A O   1 
ATOM   1600  C  CB  . PHE A  1 208 ? 19.938   38.519  -6.068  1.00 24.31 ? 311 PHE A CB  1 
ATOM   1601  C  CG  . PHE A  1 208 ? 19.607   38.262  -4.627  1.00 21.27 ? 311 PHE A CG  1 
ATOM   1602  C  CD1 . PHE A  1 208 ? 20.146   39.060  -3.637  1.00 22.75 ? 311 PHE A CD1 1 
ATOM   1603  C  CD2 . PHE A  1 208 ? 18.839   37.186  -4.261  1.00 20.83 ? 311 PHE A CD2 1 
ATOM   1604  C  CE1 . PHE A  1 208 ? 19.886   38.830  -2.289  1.00 21.12 ? 311 PHE A CE1 1 
ATOM   1605  C  CE2 . PHE A  1 208 ? 18.569   36.934  -2.924  1.00 20.79 ? 311 PHE A CE2 1 
ATOM   1606  C  CZ  . PHE A  1 208 ? 19.102   37.755  -1.935  1.00 21.52 ? 311 PHE A CZ  1 
ATOM   1607  N  N   . GLY A  1 209 ? 20.577   41.089  -8.207  1.00 26.74 ? 312 GLY A N   1 
ATOM   1608  C  CA  . GLY A  1 209 ? 21.173   41.416  -9.505  1.00 25.90 ? 312 GLY A CA  1 
ATOM   1609  C  C   . GLY A  1 209 ? 22.639   41.863  -9.488  1.00 25.04 ? 312 GLY A C   1 
ATOM   1610  O  O   . GLY A  1 209 ? 23.294   41.827  -10.520 1.00 24.24 ? 312 GLY A O   1 
ATOM   1611  N  N   . VAL A  1 210 ? 23.135   42.324  -8.342  1.00 23.64 ? 313 VAL A N   1 
ATOM   1612  C  CA  . VAL A  1 210 ? 24.495   42.827  -8.233  1.00 22.55 ? 313 VAL A CA  1 
ATOM   1613  C  C   . VAL A  1 210 ? 25.169   42.382  -6.951  1.00 22.30 ? 313 VAL A C   1 
ATOM   1614  O  O   . VAL A  1 210 ? 24.582   42.427  -5.864  1.00 21.01 ? 313 VAL A O   1 
ATOM   1615  C  CB  . VAL A  1 210 ? 24.559   44.366  -8.262  1.00 25.29 ? 313 VAL A CB  1 
ATOM   1616  C  CG1 . VAL A  1 210 ? 25.994   44.872  -8.174  1.00 25.80 ? 313 VAL A CG1 1 
ATOM   1617  C  CG2 . VAL A  1 210 ? 23.935   44.907  -9.524  1.00 25.84 ? 313 VAL A CG2 1 
ATOM   1618  N  N   . LEU A  1 211 ? 26.417   41.941  -7.104  1.00 21.06 ? 314 LEU A N   1 
ATOM   1619  C  CA  . LEU A  1 211 ? 27.344   41.746  -5.977  1.00 21.72 ? 314 LEU A CA  1 
ATOM   1620  C  C   . LEU A  1 211 ? 28.359   42.918  -5.892  1.00 20.48 ? 314 LEU A C   1 
ATOM   1621  O  O   . LEU A  1 211 ? 29.107   43.157  -6.830  1.00 20.40 ? 314 LEU A O   1 
ATOM   1622  C  CB  . LEU A  1 211 ? 28.101   40.434  -6.112  1.00 20.45 ? 314 LEU A CB  1 
ATOM   1623  C  CG  . LEU A  1 211 ? 28.945   40.128  -4.856  1.00 21.74 ? 314 LEU A CG  1 
ATOM   1624  C  CD1 . LEU A  1 211 ? 28.998   38.642  -4.555  1.00 20.18 ? 314 LEU A CD1 1 
ATOM   1625  C  CD2 . LEU A  1 211 ? 30.369   40.672  -4.976  1.00 22.35 ? 314 LEU A CD2 1 
ATOM   1626  N  N   . GLY A  1 212 ? 28.404   43.598  -4.761  1.00 20.39 ? 315 GLY A N   1 
ATOM   1627  C  CA  . GLY A  1 212 ? 29.327   44.732  -4.563  1.00 21.82 ? 315 GLY A CA  1 
ATOM   1628  C  C   . GLY A  1 212 ? 30.350   44.577  -3.461  1.00 22.08 ? 315 GLY A C   1 
ATOM   1629  O  O   . GLY A  1 212 ? 30.092   43.971  -2.414  1.00 21.45 ? 315 GLY A O   1 
ATOM   1630  N  N   . LEU A  1 213 ? 31.548   45.077  -3.758  1.00 23.11 ? 316 LEU A N   1 
ATOM   1631  C  CA  . LEU A  1 213 ? 32.593   45.279  -2.775  1.00 22.52 ? 316 LEU A CA  1 
ATOM   1632  C  C   . LEU A  1 213 ? 32.549   46.764  -2.442  1.00 22.81 ? 316 LEU A C   1 
ATOM   1633  O  O   . LEU A  1 213 ? 32.943   47.613  -3.233  1.00 23.39 ? 316 LEU A O   1 
ATOM   1634  C  CB  . LEU A  1 213 ? 33.946   44.891  -3.321  1.00 23.95 ? 316 LEU A CB  1 
ATOM   1635  C  CG  . LEU A  1 213 ? 34.053   43.460  -3.808  1.00 24.61 ? 316 LEU A CG  1 
ATOM   1636  C  CD1 . LEU A  1 213 ? 35.309   43.229  -4.619  1.00 25.70 ? 316 LEU A CD1 1 
ATOM   1637  C  CD2 . LEU A  1 213 ? 34.047   42.506  -2.622  1.00 26.84 ? 316 LEU A CD2 1 
ATOM   1638  N  N   . ASP A  1 214 ? 31.994   47.065  -1.295  1.00 22.61 ? 317 ASP A N   1 
ATOM   1639  C  CA  . ASP A  1 214 ? 31.701   48.430  -0.893  1.00 27.54 ? 317 ASP A CA  1 
ATOM   1640  C  C   . ASP A  1 214 ? 32.130   48.535  0.558   1.00 26.11 ? 317 ASP A C   1 
ATOM   1641  O  O   . ASP A  1 214 ? 31.433   48.022  1.434   1.00 26.82 ? 317 ASP A O   1 
ATOM   1642  C  CB  . ASP A  1 214 ? 30.202   48.714  -1.053  1.00 32.89 ? 317 ASP A CB  1 
ATOM   1643  C  CG  . ASP A  1 214 ? 29.799   50.115  -0.597  1.00 40.83 ? 317 ASP A CG  1 
ATOM   1644  O  OD1 . ASP A  1 214 ? 29.982   50.514  0.585   1.00 52.80 ? 317 ASP A OD1 1 
ATOM   1645  O  OD2 . ASP A  1 214 ? 29.266   50.835  -1.456  1.00 49.36 ? 317 ASP A OD2 1 
ATOM   1646  N  N   . LEU A  1 215 ? 33.275   49.161  0.796   1.00 21.96 ? 318 LEU A N   1 
ATOM   1647  C  CA  . LEU A  1 215 ? 33.960   49.020  2.053   1.00 22.40 ? 318 LEU A CA  1 
ATOM   1648  C  C   . LEU A  1 215 ? 35.076   50.029  2.278   1.00 21.87 ? 318 LEU A C   1 
ATOM   1649  O  O   . LEU A  1 215 ? 35.450   50.781  1.377   1.00 19.78 ? 318 LEU A O   1 
ATOM   1650  C  CB  . LEU A  1 215 ? 34.515   47.597  2.196   1.00 22.55 ? 318 LEU A CB  1 
ATOM   1651  C  CG  . LEU A  1 215 ? 35.360   47.021  1.079   1.00 22.47 ? 318 LEU A CG  1 
ATOM   1652  C  CD1 . LEU A  1 215 ? 36.824   47.328  1.318   1.00 24.03 ? 318 LEU A CD1 1 
ATOM   1653  C  CD2 . LEU A  1 215 ? 35.201   45.503  0.982   1.00 20.59 ? 318 LEU A CD2 1 
ATOM   1654  N  N   . TRP A  1 216 ? 35.587   50.038  3.513   1.00 20.48 ? 319 TRP A N   1 
ATOM   1655  C  CA  . TRP A  1 216 ? 36.601   50.970  3.938   1.00 19.45 ? 319 TRP A CA  1 
ATOM   1656  C  C   . TRP A  1 216 ? 37.845   50.212  4.336   1.00 19.86 ? 319 TRP A C   1 
ATOM   1657  O  O   . TRP A  1 216 ? 37.761   49.108  4.870   1.00 17.97 ? 319 TRP A O   1 
ATOM   1658  C  CB  . TRP A  1 216 ? 36.103   51.789  5.119   1.00 18.96 ? 319 TRP A CB  1 
ATOM   1659  C  CG  . TRP A  1 216 ? 37.200   52.507  5.866   1.00 21.17 ? 319 TRP A CG  1 
ATOM   1660  C  CD1 . TRP A  1 216 ? 37.780   52.117  7.038   1.00 22.08 ? 319 TRP A CD1 1 
ATOM   1661  C  CD2 . TRP A  1 216 ? 37.905   53.696  5.454   1.00 21.19 ? 319 TRP A CD2 1 
ATOM   1662  N  NE1 . TRP A  1 216 ? 38.760   53.007  7.401   1.00 22.32 ? 319 TRP A NE1 1 
ATOM   1663  C  CE2 . TRP A  1 216 ? 38.859   53.985  6.457   1.00 22.12 ? 319 TRP A CE2 1 
ATOM   1664  C  CE3 . TRP A  1 216 ? 37.793   54.564  4.353   1.00 21.87 ? 319 TRP A CE3 1 
ATOM   1665  C  CZ2 . TRP A  1 216 ? 39.713   55.100  6.395   1.00 22.65 ? 319 TRP A CZ2 1 
ATOM   1666  C  CZ3 . TRP A  1 216 ? 38.637   55.684  4.286   1.00 21.53 ? 319 TRP A CZ3 1 
ATOM   1667  C  CH2 . TRP A  1 216 ? 39.588   55.927  5.295   1.00 23.35 ? 319 TRP A CH2 1 
ATOM   1668  N  N   . GLN A  1 217 ? 39.014   50.800  4.064   1.00 19.45 ? 320 GLN A N   1 
ATOM   1669  C  CA  . GLN A  1 217 ? 40.284   50.146  4.391   1.00 19.90 ? 320 GLN A CA  1 
ATOM   1670  C  C   . GLN A  1 217 ? 41.389   51.155  4.769   1.00 19.79 ? 320 GLN A C   1 
ATOM   1671  O  O   . GLN A  1 217 ? 41.529   52.166  4.130   1.00 22.02 ? 320 GLN A O   1 
ATOM   1672  C  CB  . GLN A  1 217 ? 40.656   49.204  3.218   1.00 19.61 ? 320 GLN A CB  1 
ATOM   1673  C  CG  . GLN A  1 217 ? 41.089   47.865  3.708   1.00 22.22 ? 320 GLN A CG  1 
ATOM   1674  C  CD  . GLN A  1 217 ? 41.152   46.805  2.680   1.00 20.18 ? 320 GLN A CD  1 
ATOM   1675  O  OE1 . GLN A  1 217 ? 41.993   46.934  1.888   1.00 21.27 ? 320 GLN A OE1 1 
ATOM   1676  N  NE2 . GLN A  1 217 ? 40.482   45.659  2.845   1.00 21.20 ? 320 GLN A NE2 1 
ATOM   1677  N  N   . VAL A  1 218 ? 42.079   50.913  5.869   1.00 18.67 ? 321 VAL A N   1 
ATOM   1678  C  CA  . VAL A  1 218 ? 43.226   51.699  6.257   1.00 16.53 ? 321 VAL A CA  1 
ATOM   1679  C  C   . VAL A  1 218 ? 44.363   51.050  5.497   1.00 16.19 ? 321 VAL A C   1 
ATOM   1680  O  O   . VAL A  1 218 ? 44.557   51.381  4.318   1.00 15.37 ? 321 VAL A O   1 
ATOM   1681  C  CB  . VAL A  1 218 ? 43.440   51.765  7.796   1.00 18.32 ? 321 VAL A CB  1 
ATOM   1682  C  CG1 . VAL A  1 218 ? 44.692   52.604  8.144   1.00 17.42 ? 321 VAL A CG1 1 
ATOM   1683  C  CG2 . VAL A  1 218 ? 42.233   52.410  8.467   1.00 18.93 ? 321 VAL A CG2 1 
ATOM   1684  N  N   . LYS A  1 219 ? 45.059   50.071  6.081   1.00 15.07 ? 322 LYS A N   1 
ATOM   1685  C  CA  . LYS A  1 219 ? 46.125   49.379  5.338   1.00 16.00 ? 322 LYS A CA  1 
ATOM   1686  C  C   . LYS A  1 219 ? 45.563   48.503  4.263   1.00 15.93 ? 322 LYS A C   1 
ATOM   1687  O  O   . LYS A  1 219 ? 44.767   47.605  4.529   1.00 19.65 ? 322 LYS A O   1 
ATOM   1688  C  CB  . LYS A  1 219 ? 46.974   48.507  6.227   1.00 17.23 ? 322 LYS A CB  1 
ATOM   1689  C  CG  . LYS A  1 219 ? 47.998   49.230  7.068   1.00 18.59 ? 322 LYS A CG  1 
ATOM   1690  C  CD  . LYS A  1 219 ? 48.728   48.260  8.020   1.00 20.31 ? 322 LYS A CD  1 
ATOM   1691  C  CE  . LYS A  1 219 ? 49.532   47.235  7.245   1.00 20.28 ? 322 LYS A CE  1 
ATOM   1692  N  NZ  . LYS A  1 219 ? 50.184   46.280  8.182   1.00 22.30 ? 322 LYS A NZ  1 
ATOM   1693  N  N   . SER A  1 220 ? 45.993   48.742  3.045   1.00 16.06 ? 323 SER A N   1 
ATOM   1694  C  CA  . SER A  1 220 ? 45.421   48.121  1.835   1.00 15.48 ? 323 SER A CA  1 
ATOM   1695  C  C   . SER A  1 220 ? 46.219   46.909  1.442   1.00 14.18 ? 323 SER A C   1 
ATOM   1696  O  O   . SER A  1 220 ? 47.186   46.589  2.094   1.00 14.91 ? 323 SER A O   1 
ATOM   1697  C  CB  . SER A  1 220 ? 45.437   49.132  0.679   1.00 17.26 ? 323 SER A CB  1 
ATOM   1698  O  OG  . SER A  1 220 ? 46.769   49.508  0.311   1.00 16.55 ? 323 SER A OG  1 
ATOM   1699  N  N   . GLY A  1 221 ? 45.781   46.184  0.419   1.00 12.49 ? 324 GLY A N   1 
ATOM   1700  C  CA  . GLY A  1 221 ? 46.426   44.906  0.024   1.00 11.94 ? 324 GLY A CA  1 
ATOM   1701  C  C   . GLY A  1 221 ? 45.569   43.627  0.107   1.00 12.34 ? 324 GLY A C   1 
ATOM   1702  O  O   . GLY A  1 221 ? 45.994   42.531  -0.272  1.00 11.17 ? 324 GLY A O   1 
ATOM   1703  N  N   . THR A  1 222 ? 44.333   43.761  0.562   1.00 12.43 ? 325 THR A N   1 
ATOM   1704  C  CA  . THR A  1 222 ? 43.421   42.602  0.623   1.00 12.59 ? 325 THR A CA  1 
ATOM   1705  C  C   . THR A  1 222 ? 43.091   42.107  -0.776  1.00 12.95 ? 325 THR A C   1 
ATOM   1706  O  O   . THR A  1 222 ? 42.772   42.896  -1.645  1.00 13.64 ? 325 THR A O   1 
ATOM   1707  C  CB  . THR A  1 222 ? 42.119   42.983  1.316   1.00 12.37 ? 325 THR A CB  1 
ATOM   1708  O  OG1 . THR A  1 222 ? 42.392   43.397  2.669   1.00 12.01 ? 325 THR A OG1 1 
ATOM   1709  C  CG2 . THR A  1 222 ? 41.159   41.808  1.331   1.00 12.78 ? 325 THR A CG2 1 
ATOM   1710  N  N   . ILE A  1 223 ? 43.139   40.798  -0.958  1.00 13.44 ? 326 ILE A N   1 
ATOM   1711  C  CA  . ILE A  1 223 ? 42.759   40.179  -2.203  1.00 14.37 ? 326 ILE A CA  1 
ATOM   1712  C  C   . ILE A  1 223 ? 41.464   39.326  -2.047  1.00 15.51 ? 326 ILE A C   1 
ATOM   1713  O  O   . ILE A  1 223 ? 41.426   38.348  -1.285  1.00 16.25 ? 326 ILE A O   1 
ATOM   1714  C  CB  . ILE A  1 223 ? 43.871   39.268  -2.749  1.00 13.94 ? 326 ILE A CB  1 
ATOM   1715  C  CG1 . ILE A  1 223 ? 45.191   40.053  -2.889  1.00 13.39 ? 326 ILE A CG1 1 
ATOM   1716  C  CG2 . ILE A  1 223 ? 43.457   38.647  -4.081  1.00 14.49 ? 326 ILE A CG2 1 
ATOM   1717  C  CD1 . ILE A  1 223 ? 46.304   39.295  -3.554  1.00 13.41 ? 326 ILE A CD1 1 
ATOM   1718  N  N   . PHE A  1 224 ? 40.478   39.650  -2.885  1.00 15.35 ? 327 PHE A N   1 
ATOM   1719  C  CA  . PHE A  1 224 ? 39.228   38.885  -3.034  1.00 15.31 ? 327 PHE A CA  1 
ATOM   1720  C  C   . PHE A  1 224 ? 39.242   37.993  -4.311  1.00 16.04 ? 327 PHE A C   1 
ATOM   1721  O  O   . PHE A  1 224 ? 39.586   38.455  -5.387  1.00 15.81 ? 327 PHE A O   1 
ATOM   1722  C  CB  . PHE A  1 224 ? 38.060   39.830  -3.144  1.00 14.88 ? 327 PHE A CB  1 
ATOM   1723  C  CG  . PHE A  1 224 ? 37.929   40.774  -2.001  1.00 15.28 ? 327 PHE A CG  1 
ATOM   1724  C  CD1 . PHE A  1 224 ? 37.160   40.455  -0.907  1.00 16.50 ? 327 PHE A CD1 1 
ATOM   1725  C  CD2 . PHE A  1 224 ? 38.542   42.005  -2.035  1.00 15.67 ? 327 PHE A CD2 1 
ATOM   1726  C  CE1 . PHE A  1 224 ? 37.016   41.345  0.135   1.00 16.95 ? 327 PHE A CE1 1 
ATOM   1727  C  CE2 . PHE A  1 224 ? 38.423   42.898  -0.990  1.00 15.57 ? 327 PHE A CE2 1 
ATOM   1728  C  CZ  . PHE A  1 224 ? 37.656   42.576  0.088   1.00 16.66 ? 327 PHE A CZ  1 
ATOM   1729  N  N   . ASP A  1 225 ? 38.894   36.718  -4.194  1.00 15.17 ? 328 ASP A N   1 
ATOM   1730  C  CA  . ASP A  1 225 ? 38.912   35.800  -5.342  1.00 14.41 ? 328 ASP A CA  1 
ATOM   1731  C  C   . ASP A  1 225 ? 37.715   34.803  -5.148  1.00 15.40 ? 328 ASP A C   1 
ATOM   1732  O  O   . ASP A  1 225 ? 37.032   34.771  -4.121  1.00 14.03 ? 328 ASP A O   1 
ATOM   1733  C  CB  . ASP A  1 225 ? 40.257   35.043  -5.422  1.00 14.68 ? 328 ASP A CB  1 
ATOM   1734  C  CG  . ASP A  1 225 ? 40.638   34.377  -6.886  1.00 15.09 ? 328 ASP A CG  1 
ATOM   1735  O  OD1 . ASP A  1 225 ? 39.823   34.485  -7.791  1.00 15.44 ? 328 ASP A OD1 1 
ATOM   1736  O  OD2 . ASP A  1 225 ? 41.685   33.712  -6.802  1.00 16.16 ? 328 ASP A OD2 1 
ATOM   1737  N  N   . ASN A  1 226 ? 37.507   34.025  -6.176  1.00 14.35 ? 329 ASN A N   1 
ATOM   1738  C  CA  . ASN A  1 226 ? 36.673   32.841  -6.171  1.00 15.61 ? 329 ASN A CA  1 
ATOM   1739  C  C   . ASN A  1 226 ? 35.245   33.033  -5.640  1.00 14.57 ? 329 ASN A C   1 
ATOM   1740  O  O   . ASN A  1 226 ? 34.779   32.292  -4.798  1.00 14.94 ? 329 ASN A O   1 
ATOM   1741  C  CB  . ASN A  1 226 ? 37.368   31.738  -5.434  1.00 16.61 ? 329 ASN A CB  1 
ATOM   1742  C  CG  . ASN A  1 226 ? 38.700   31.430  -6.028  1.00 19.07 ? 329 ASN A CG  1 
ATOM   1743  O  OD1 . ASN A  1 226 ? 39.684   31.688  -5.372  1.00 22.59 ? 329 ASN A OD1 1 
ATOM   1744  N  ND2 . ASN A  1 226 ? 38.772   30.899  -7.251  1.00 20.07 ? 329 ASN A ND2 1 
ATOM   1745  N  N   . PHE A  1 227 ? 34.600   34.061  -6.151  1.00 13.31 ? 330 PHE A N   1 
ATOM   1746  C  CA  . PHE A  1 227 ? 33.260   34.384  -5.787  1.00 13.86 ? 330 PHE A CA  1 
ATOM   1747  C  C   . PHE A  1 227 ? 32.313   33.324  -6.386  1.00 14.44 ? 330 PHE A C   1 
ATOM   1748  O  O   . PHE A  1 227 ? 32.476   32.925  -7.525  1.00 15.55 ? 330 PHE A O   1 
ATOM   1749  C  CB  . PHE A  1 227 ? 32.847   35.754  -6.341  1.00 12.75 ? 330 PHE A CB  1 
ATOM   1750  C  CG  . PHE A  1 227 ? 33.602   36.920  -5.776  1.00 12.52 ? 330 PHE A CG  1 
ATOM   1751  C  CD1 . PHE A  1 227 ? 34.797   37.351  -6.355  1.00 12.13 ? 330 PHE A CD1 1 
ATOM   1752  C  CD2 . PHE A  1 227 ? 33.071   37.657  -4.730  1.00 11.65 ? 330 PHE A CD2 1 
ATOM   1753  C  CE1 . PHE A  1 227 ? 35.464   38.468  -5.848  1.00 11.78 ? 330 PHE A CE1 1 
ATOM   1754  C  CE2 . PHE A  1 227 ? 33.727   38.751  -4.233  1.00 11.75 ? 330 PHE A CE2 1 
ATOM   1755  C  CZ  . PHE A  1 227 ? 34.931   39.158  -4.772  1.00 11.32 ? 330 PHE A CZ  1 
ATOM   1756  N  N   . LEU A  1 228 ? 31.337   32.904  -5.593  1.00 14.78 ? 331 LEU A N   1 
ATOM   1757  C  CA  . LEU A  1 228 ? 30.301   31.987  -6.045  1.00 15.74 ? 331 LEU A CA  1 
ATOM   1758  C  C   . LEU A  1 228 ? 28.953   32.327  -5.412  1.00 16.47 ? 331 LEU A C   1 
ATOM   1759  O  O   . LEU A  1 228 ? 28.852   32.495  -4.176  1.00 15.64 ? 331 LEU A O   1 
ATOM   1760  C  CB  . LEU A  1 228 ? 30.666   30.563  -5.713  1.00 15.57 ? 331 LEU A CB  1 
ATOM   1761  C  CG  . LEU A  1 228 ? 29.584   29.514  -6.012  1.00 15.92 ? 331 LEU A CG  1 
ATOM   1762  C  CD1 . LEU A  1 228 ? 29.493   29.296  -7.519  1.00 16.54 ? 331 LEU A CD1 1 
ATOM   1763  C  CD2 . LEU A  1 228 ? 29.894   28.209  -5.309  1.00 14.33 ? 331 LEU A CD2 1 
ATOM   1764  N  N   . ILE A  1 229 ? 27.939   32.461  -6.254  1.00 16.24 ? 332 ILE A N   1 
ATOM   1765  C  CA  . ILE A  1 229 ? 26.550   32.485  -5.783  1.00 18.83 ? 332 ILE A CA  1 
ATOM   1766  C  C   . ILE A  1 229 ? 25.802   31.340  -6.429  1.00 19.31 ? 332 ILE A C   1 
ATOM   1767  O  O   . ILE A  1 229 ? 25.767   31.226  -7.648  1.00 21.42 ? 332 ILE A O   1 
ATOM   1768  C  CB  . ILE A  1 229 ? 25.862   33.784  -6.076  1.00 20.37 ? 332 ILE A CB  1 
ATOM   1769  C  CG1 . ILE A  1 229 ? 26.809   34.897  -5.692  1.00 20.21 ? 332 ILE A CG1 1 
ATOM   1770  C  CG2 . ILE A  1 229 ? 24.533   33.861  -5.335  1.00 21.67 ? 332 ILE A CG2 1 
ATOM   1771  C  CD1 . ILE A  1 229 ? 26.184   36.199  -5.354  1.00 22.64 ? 332 ILE A CD1 1 
ATOM   1772  N  N   . THR A  1 230 ? 25.266   30.469  -5.576  1.00 19.09 ? 333 THR A N   1 
ATOM   1773  C  CA  . THR A  1 230 ? 24.645   29.235  -5.993  1.00 18.47 ? 333 THR A CA  1 
ATOM   1774  C  C   . THR A  1 230 ? 23.432   28.893  -5.090  1.00 20.22 ? 333 THR A C   1 
ATOM   1775  O  O   . THR A  1 230 ? 23.146   29.561  -4.081  1.00 20.51 ? 333 THR A O   1 
ATOM   1776  C  CB  . THR A  1 230 ? 25.678   28.088  -6.029  1.00 18.13 ? 333 THR A CB  1 
ATOM   1777  O  OG1 . THR A  1 230 ? 25.125   26.902  -6.641  1.00 17.88 ? 333 THR A OG1 1 
ATOM   1778  C  CG2 . THR A  1 230 ? 26.175   27.739  -4.656  1.00 17.37 ? 333 THR A CG2 1 
ATOM   1779  N  N   . ASN A  1 231 ? 22.735   27.820  -5.459  1.00 21.57 ? 334 ASN A N   1 
ATOM   1780  C  CA  . ASN A  1 231 ? 21.587   27.323  -4.665  1.00 21.61 ? 334 ASN A CA  1 
ATOM   1781  C  C   . ASN A  1 231 ? 21.836   25.959  -4.117  1.00 21.00 ? 334 ASN A C   1 
ATOM   1782  O  O   . ASN A  1 231 ? 20.962   25.353  -3.543  1.00 22.04 ? 334 ASN A O   1 
ATOM   1783  C  CB  . ASN A  1 231 ? 20.290   27.323  -5.494  1.00 21.59 ? 334 ASN A CB  1 
ATOM   1784  C  CG  . ASN A  1 231 ? 20.281   26.264  -6.576  1.00 21.66 ? 334 ASN A CG  1 
ATOM   1785  O  OD1 . ASN A  1 231 ? 21.283   25.614  -6.860  1.00 19.99 ? 334 ASN A OD1 1 
ATOM   1786  N  ND2 . ASN A  1 231 ? 19.142   26.101  -7.197  1.00 23.95 ? 334 ASN A ND2 1 
ATOM   1787  N  N   . ASP A  1 232 ? 23.083   25.513  -4.215  1.00 22.42 ? 335 ASP A N   1 
ATOM   1788  C  CA  . ASP A  1 232 ? 23.463   24.182  -3.797  1.00 22.48 ? 335 ASP A CA  1 
ATOM   1789  C  C   . ASP A  1 232 ? 24.645   24.231  -2.799  1.00 21.46 ? 335 ASP A C   1 
ATOM   1790  O  O   . ASP A  1 232 ? 25.787   24.556  -3.182  1.00 19.92 ? 335 ASP A O   1 
ATOM   1791  C  CB  . ASP A  1 232 ? 23.799   23.384  -5.072  1.00 26.89 ? 335 ASP A CB  1 
ATOM   1792  C  CG  . ASP A  1 232 ? 23.968   21.903  -4.835  1.00 30.01 ? 335 ASP A CG  1 
ATOM   1793  O  OD1 . ASP A  1 232 ? 24.441   21.468  -3.775  1.00 35.24 ? 335 ASP A OD1 1 
ATOM   1794  O  OD2 . ASP A  1 232 ? 23.695   21.154  -5.774  1.00 42.28 ? 335 ASP A OD2 1 
ATOM   1795  N  N   . GLU A  1 233 ? 24.392   23.800  -1.564  1.00 19.68 ? 336 GLU A N   1 
ATOM   1796  C  CA  . GLU A  1 233 ? 25.403   23.739  -0.500  1.00 20.27 ? 336 GLU A CA  1 
ATOM   1797  C  C   . GLU A  1 233 ? 26.540   22.814  -0.832  1.00 18.17 ? 336 GLU A C   1 
ATOM   1798  O  O   . GLU A  1 233 ? 27.688   23.112  -0.563  1.00 16.86 ? 336 GLU A O   1 
ATOM   1799  C  CB  . GLU A  1 233 ? 24.850   23.236  0.836   1.00 22.37 ? 336 GLU A CB  1 
ATOM   1800  C  CG  . GLU A  1 233 ? 23.661   24.020  1.369   1.00 25.49 ? 336 GLU A CG  1 
ATOM   1801  C  CD  . GLU A  1 233 ? 23.185   23.535  2.748   1.00 26.37 ? 336 GLU A CD  1 
ATOM   1802  O  OE1 . GLU A  1 233 ? 24.018   23.128  3.589   1.00 28.24 ? 336 GLU A OE1 1 
ATOM   1803  O  OE2 . GLU A  1 233 ? 21.970   23.568  2.996   1.00 28.93 ? 336 GLU A OE2 1 
ATOM   1804  N  N   . ALA A  1 234 ? 26.198   21.654  -1.348  1.00 17.66 ? 337 ALA A N   1 
ATOM   1805  C  CA  . ALA A  1 234 ? 27.194   20.668  -1.678  1.00 17.60 ? 337 ALA A CA  1 
ATOM   1806  C  C   . ALA A  1 234 ? 28.122   21.218  -2.770  1.00 17.07 ? 337 ALA A C   1 
ATOM   1807  O  O   . ALA A  1 234 ? 29.321   21.045  -2.712  1.00 17.28 ? 337 ALA A O   1 
ATOM   1808  C  CB  . ALA A  1 234 ? 26.526   19.385  -2.129  1.00 17.86 ? 337 ALA A CB  1 
ATOM   1809  N  N   . TYR A  1 235 ? 27.553   21.833  -3.789  1.00 16.54 ? 338 TYR A N   1 
ATOM   1810  C  CA  . TYR A  1 235 ? 28.349   22.399  -4.845  1.00 17.11 ? 338 TYR A CA  1 
ATOM   1811  C  C   . TYR A  1 235 ? 29.280   23.512  -4.306  1.00 18.75 ? 338 TYR A C   1 
ATOM   1812  O  O   . TYR A  1 235 ? 30.460   23.578  -4.671  1.00 17.49 ? 338 TYR A O   1 
ATOM   1813  C  CB  . TYR A  1 235 ? 27.507   22.945  -5.985  1.00 17.14 ? 338 TYR A CB  1 
ATOM   1814  C  CG  . TYR A  1 235 ? 28.392   23.453  -7.105  1.00 19.20 ? 338 TYR A CG  1 
ATOM   1815  C  CD1 . TYR A  1 235 ? 29.243   22.574  -7.792  1.00 19.86 ? 338 TYR A CD1 1 
ATOM   1816  C  CD2 . TYR A  1 235 ? 28.431   24.798  -7.437  1.00 20.13 ? 338 TYR A CD2 1 
ATOM   1817  C  CE1 . TYR A  1 235 ? 30.082   23.039  -8.765  1.00 22.25 ? 338 TYR A CE1 1 
ATOM   1818  C  CE2 . TYR A  1 235 ? 29.265   25.275  -8.433  1.00 21.60 ? 338 TYR A CE2 1 
ATOM   1819  C  CZ  . TYR A  1 235 ? 30.102   24.405  -9.068  1.00 23.01 ? 338 TYR A CZ  1 
ATOM   1820  O  OH  . TYR A  1 235 ? 30.907   24.872  -10.071 1.00 27.83 ? 338 TYR A OH  1 
ATOM   1821  N  N   . ALA A  1 236 ? 28.747   24.374  -3.445  1.00 18.73 ? 339 ALA A N   1 
ATOM   1822  C  CA  . ALA A  1 236 ? 29.577   25.377  -2.799  1.00 19.08 ? 339 ALA A CA  1 
ATOM   1823  C  C   . ALA A  1 236 ? 30.772   24.765  -2.082  1.00 19.40 ? 339 ALA A C   1 
ATOM   1824  O  O   . ALA A  1 236 ? 31.887   25.261  -2.200  1.00 17.41 ? 339 ALA A O   1 
ATOM   1825  C  CB  . ALA A  1 236 ? 28.781   26.158  -1.821  1.00 19.99 ? 339 ALA A CB  1 
ATOM   1826  N  N   . GLU A  1 237 ? 30.541   23.657  -1.386  1.00 18.91 ? 340 GLU A N   1 
ATOM   1827  C  CA  . GLU A  1 237 ? 31.600   22.986  -0.692  1.00 19.90 ? 340 GLU A CA  1 
ATOM   1828  C  C   . GLU A  1 237 ? 32.651   22.413  -1.679  1.00 21.88 ? 340 GLU A C   1 
ATOM   1829  O  O   . GLU A  1 237 ? 33.857   22.479  -1.433  1.00 21.09 ? 340 GLU A O   1 
ATOM   1830  C  CB  . GLU A  1 237 ? 31.059   21.873  0.185   1.00 21.00 ? 340 GLU A CB  1 
ATOM   1831  C  CG  . GLU A  1 237 ? 32.149   21.263  1.048   1.00 23.86 ? 340 GLU A CG  1 
ATOM   1832  C  CD  . GLU A  1 237 ? 31.682   20.395  2.211   1.00 26.34 ? 340 GLU A CD  1 
ATOM   1833  O  OE1 . GLU A  1 237 ? 30.448   20.406  2.447   1.00 27.57 ? 340 GLU A OE1 1 
ATOM   1834  O  OE2 . GLU A  1 237 ? 32.544   19.722  2.903   1.00 26.41 ? 340 GLU A OE2 1 
ATOM   1835  N  N   . GLU A  1 238 ? 32.178   21.806  -2.765  1.00 21.60 ? 341 GLU A N   1 
ATOM   1836  C  CA  . GLU A  1 238 ? 33.073   21.283  -3.804  1.00 22.29 ? 341 GLU A CA  1 
ATOM   1837  C  C   . GLU A  1 238 ? 33.946   22.374  -4.383  1.00 19.95 ? 341 GLU A C   1 
ATOM   1838  O  O   . GLU A  1 238 ? 35.146   22.204  -4.515  1.00 21.23 ? 341 GLU A O   1 
ATOM   1839  C  CB  . GLU A  1 238 ? 32.292   20.709  -4.980  1.00 22.95 ? 341 GLU A CB  1 
ATOM   1840  C  CG  . GLU A  1 238 ? 31.557   19.433  -4.669  1.00 25.73 ? 341 GLU A CG  1 
ATOM   1841  C  CD  . GLU A  1 238 ? 30.512   19.034  -5.728  1.00 26.58 ? 341 GLU A CD  1 
ATOM   1842  O  OE1 . GLU A  1 238 ? 30.702   19.402  -6.920  1.00 31.52 ? 341 GLU A OE1 1 
ATOM   1843  O  OE2 . GLU A  1 238 ? 29.547   18.288  -5.377  1.00 27.68 ? 341 GLU A OE2 1 
ATOM   1844  N  N   . PHE A  1 239 ? 33.313   23.458  -4.784  1.00 16.37 ? 342 PHE A N   1 
ATOM   1845  C  CA  . PHE A  1 239 ? 33.999   24.589  -5.399  1.00 17.21 ? 342 PHE A CA  1 
ATOM   1846  C  C   . PHE A  1 239 ? 35.029   25.192  -4.412  1.00 16.38 ? 342 PHE A C   1 
ATOM   1847  O  O   . PHE A  1 239 ? 36.107   25.629  -4.795  1.00 15.08 ? 342 PHE A O   1 
ATOM   1848  C  CB  . PHE A  1 239 ? 32.989   25.640  -5.811  1.00 16.70 ? 342 PHE A CB  1 
ATOM   1849  C  CG  . PHE A  1 239 ? 33.558   26.750  -6.644  1.00 17.16 ? 342 PHE A CG  1 
ATOM   1850  C  CD1 . PHE A  1 239 ? 34.133   26.487  -7.852  1.00 16.07 ? 342 PHE A CD1 1 
ATOM   1851  C  CD2 . PHE A  1 239 ? 33.485   28.079  -6.214  1.00 16.96 ? 342 PHE A CD2 1 
ATOM   1852  C  CE1 . PHE A  1 239 ? 34.638   27.512  -8.622  1.00 17.38 ? 342 PHE A CE1 1 
ATOM   1853  C  CE2 . PHE A  1 239 ? 33.995   29.113  -6.995  1.00 17.62 ? 342 PHE A CE2 1 
ATOM   1854  C  CZ  . PHE A  1 239 ? 34.561   28.836  -8.217  1.00 16.65 ? 342 PHE A CZ  1 
ATOM   1855  N  N   . GLY A  1 240 ? 34.676   25.182  -3.141  1.00 16.49 ? 343 GLY A N   1 
ATOM   1856  C  CA  . GLY A  1 240 ? 35.549   25.661  -2.072  1.00 18.29 ? 343 GLY A CA  1 
ATOM   1857  C  C   . GLY A  1 240 ? 36.799   24.806  -1.998  1.00 18.54 ? 343 GLY A C   1 
ATOM   1858  O  O   . GLY A  1 240 ? 37.898   25.343  -1.933  1.00 19.22 ? 343 GLY A O   1 
ATOM   1859  N  N   . ASN A  1 241 ? 36.633   23.488  -2.093  1.00 18.30 ? 344 ASN A N   1 
ATOM   1860  C  CA  . ASN A  1 241 ? 37.767   22.567  -2.098  1.00 18.28 ? 344 ASN A CA  1 
ATOM   1861  C  C   . ASN A  1 241 ? 38.602   22.585  -3.375  1.00 18.75 ? 344 ASN A C   1 
ATOM   1862  O  O   . ASN A  1 241 ? 39.792   22.287  -3.333  1.00 24.67 ? 344 ASN A O   1 
ATOM   1863  C  CB  . ASN A  1 241 ? 37.333   21.145  -1.747  1.00 16.27 ? 344 ASN A CB  1 
ATOM   1864  C  CG  . ASN A  1 241 ? 36.962   21.025  -0.284  1.00 17.11 ? 344 ASN A CG  1 
ATOM   1865  O  OD1 . ASN A  1 241 ? 37.385   21.845  0.524   1.00 17.83 ? 344 ASN A OD1 1 
ATOM   1866  N  ND2 . ASN A  1 241 ? 36.155   20.047  0.068   1.00 16.39 ? 344 ASN A ND2 1 
ATOM   1867  N  N   . GLU A  1 242 ? 37.993   22.967  -4.486  1.00 18.69 ? 345 GLU A N   1 
ATOM   1868  C  CA  . GLU A  1 242 ? 38.672   23.120  -5.782  1.00 19.61 ? 345 GLU A CA  1 
ATOM   1869  C  C   . GLU A  1 242 ? 39.339   24.478  -5.914  1.00 19.25 ? 345 GLU A C   1 
ATOM   1870  O  O   . GLU A  1 242 ? 40.149   24.669  -6.820  1.00 21.41 ? 345 GLU A O   1 
ATOM   1871  C  CB  . GLU A  1 242 ? 37.678   22.986  -6.951  1.00 21.75 ? 345 GLU A CB  1 
ATOM   1872  C  CG  . GLU A  1 242 ? 37.383   21.535  -7.374  1.00 24.40 ? 345 GLU A CG  1 
ATOM   1873  C  CD  . GLU A  1 242 ? 36.061   21.345  -8.162  1.00 27.00 ? 345 GLU A CD  1 
ATOM   1874  O  OE1 . GLU A  1 242 ? 35.207   22.290  -8.209  1.00 32.28 ? 345 GLU A OE1 1 
ATOM   1875  O  OE2 . GLU A  1 242 ? 35.856   20.228  -8.719  1.00 29.06 ? 345 GLU A OE2 1 
ATOM   1876  N  N   . THR A  1 243 ? 39.006   25.433  -5.049  1.00 17.59 ? 346 THR A N   1 
ATOM   1877  C  CA  . THR A  1 243 ? 39.624   26.770  -5.098  1.00 18.24 ? 346 THR A CA  1 
ATOM   1878  C  C   . THR A  1 243 ? 40.530   27.024  -3.862  1.00 17.40 ? 346 THR A C   1 
ATOM   1879  O  O   . THR A  1 243 ? 41.729   26.812  -3.923  1.00 16.26 ? 346 THR A O   1 
ATOM   1880  C  CB  . THR A  1 243 ? 38.570   27.881  -5.259  1.00 18.84 ? 346 THR A CB  1 
ATOM   1881  O  OG1 . THR A  1 243 ? 37.611   27.792  -4.193  1.00 18.83 ? 346 THR A OG1 1 
ATOM   1882  C  CG2 . THR A  1 243 ? 37.866   27.737  -6.602  1.00 19.36 ? 346 THR A CG2 1 
ATOM   1883  N  N   . TRP A  1 244 ? 39.938   27.456  -2.742  1.00 16.51 ? 347 TRP A N   1 
ATOM   1884  C  CA  . TRP A  1 244 ? 40.660   27.597  -1.466  1.00 14.88 ? 347 TRP A CA  1 
ATOM   1885  C  C   . TRP A  1 244 ? 41.469   26.339  -1.129  1.00 14.28 ? 347 TRP A C   1 
ATOM   1886  O  O   . TRP A  1 244 ? 42.629   26.412  -0.718  1.00 13.79 ? 347 TRP A O   1 
ATOM   1887  C  CB  . TRP A  1 244 ? 39.710   27.942  -0.314  1.00 13.46 ? 347 TRP A CB  1 
ATOM   1888  C  CG  . TRP A  1 244 ? 40.318   27.735  1.039   1.00 13.04 ? 347 TRP A CG  1 
ATOM   1889  C  CD1 . TRP A  1 244 ? 41.156   28.576  1.697   1.00 13.50 ? 347 TRP A CD1 1 
ATOM   1890  C  CD2 . TRP A  1 244 ? 40.137   26.609  1.890   1.00 13.35 ? 347 TRP A CD2 1 
ATOM   1891  N  NE1 . TRP A  1 244 ? 41.516   28.032  2.916   1.00 14.09 ? 347 TRP A NE1 1 
ATOM   1892  C  CE2 . TRP A  1 244 ? 40.892   26.824  3.054   1.00 13.93 ? 347 TRP A CE2 1 
ATOM   1893  C  CE3 . TRP A  1 244 ? 39.383   25.425  1.785   1.00 14.85 ? 347 TRP A CE3 1 
ATOM   1894  C  CZ2 . TRP A  1 244 ? 40.933   25.902  4.102   1.00 14.09 ? 347 TRP A CZ2 1 
ATOM   1895  C  CZ3 . TRP A  1 244 ? 39.427   24.501  2.824   1.00 14.20 ? 347 TRP A CZ3 1 
ATOM   1896  C  CH2 . TRP A  1 244 ? 40.194   24.753  3.974   1.00 14.24 ? 347 TRP A CH2 1 
ATOM   1897  N  N   . GLY A  1 245 ? 40.842   25.192  -1.297  1.00 14.40 ? 348 GLY A N   1 
ATOM   1898  C  CA  . GLY A  1 245 ? 41.456   23.935  -0.940  1.00 14.06 ? 348 GLY A CA  1 
ATOM   1899  C  C   . GLY A  1 245 ? 42.640   23.540  -1.785  1.00 14.61 ? 348 GLY A C   1 
ATOM   1900  O  O   . GLY A  1 245 ? 43.444   22.731  -1.390  1.00 16.13 ? 348 GLY A O   1 
ATOM   1901  N  N   . VAL A  1 246 ? 42.764   24.144  -2.940  1.00 16.75 ? 349 VAL A N   1 
ATOM   1902  C  CA  . VAL A  1 246 ? 43.899   23.939  -3.837  1.00 17.41 ? 349 VAL A CA  1 
ATOM   1903  C  C   . VAL A  1 246 ? 44.973   25.024  -3.613  1.00 18.07 ? 349 VAL A C   1 
ATOM   1904  O  O   . VAL A  1 246 ? 46.137   24.783  -3.853  1.00 19.58 ? 349 VAL A O   1 
ATOM   1905  C  CB  . VAL A  1 246 ? 43.402   23.944  -5.315  1.00 19.29 ? 349 VAL A CB  1 
ATOM   1906  C  CG1 . VAL A  1 246 ? 44.561   24.077  -6.332  1.00 19.07 ? 349 VAL A CG1 1 
ATOM   1907  C  CG2 . VAL A  1 246 ? 42.635   22.673  -5.591  1.00 18.92 ? 349 VAL A CG2 1 
ATOM   1908  N  N   . THR A  1 247 ? 44.563   26.220  -3.211  1.00 16.85 ? 350 THR A N   1 
ATOM   1909  C  CA  . THR A  1 247 ? 45.463   27.308  -2.882  1.00 19.34 ? 350 THR A CA  1 
ATOM   1910  C  C   . THR A  1 247 ? 46.291   27.052  -1.630  1.00 18.91 ? 350 THR A C   1 
ATOM   1911  O  O   . THR A  1 247 ? 47.495   27.274  -1.589  1.00 18.25 ? 350 THR A O   1 
ATOM   1912  C  CB  . THR A  1 247 ? 44.644   28.589  -2.587  1.00 20.08 ? 350 THR A CB  1 
ATOM   1913  O  OG1 . THR A  1 247 ? 43.921   28.963  -3.759  1.00 20.68 ? 350 THR A OG1 1 
ATOM   1914  C  CG2 . THR A  1 247 ? 45.533   29.757  -2.159  1.00 20.92 ? 350 THR A CG2 1 
ATOM   1915  N  N   . LYS A  1 248 ? 45.592   26.574  -0.625  1.00 19.10 ? 351 LYS A N   1 
ATOM   1916  C  CA  . LYS A  1 248 ? 46.019   26.516  0.772   1.00 20.32 ? 351 LYS A CA  1 
ATOM   1917  C  C   . LYS A  1 248 ? 47.470   26.086  1.088   1.00 18.49 ? 351 LYS A C   1 
ATOM   1918  O  O   . LYS A  1 248 ? 48.232   26.852  1.674   1.00 16.30 ? 351 LYS A O   1 
ATOM   1919  C  CB  . LYS A  1 248 ? 44.996   25.604  1.467   1.00 22.41 ? 351 LYS A CB  1 
ATOM   1920  C  CG  . LYS A  1 248 ? 45.155   25.196  2.906   1.00 27.06 ? 351 LYS A CG  1 
ATOM   1921  C  CD  . LYS A  1 248 ? 43.985   24.252  3.204   1.00 29.60 ? 351 LYS A CD  1 
ATOM   1922  C  CE  . LYS A  1 248 ? 44.027   23.550  4.555   1.00 31.14 ? 351 LYS A CE  1 
ATOM   1923  N  NZ  . LYS A  1 248 ? 45.381   23.061  4.899   1.00 32.63 ? 351 LYS A NZ  1 
ATOM   1924  N  N   . ALA A  1 249 ? 47.812   24.857  0.749   1.00 19.27 ? 352 ALA A N   1 
ATOM   1925  C  CA  . ALA A  1 249 ? 49.074   24.229  1.185   1.00 19.33 ? 352 ALA A CA  1 
ATOM   1926  C  C   . ALA A  1 249 ? 50.302   24.829  0.494   1.00 21.00 ? 352 ALA A C   1 
ATOM   1927  O  O   . ALA A  1 249 ? 51.304   25.138  1.143   1.00 22.50 ? 352 ALA A O   1 
ATOM   1928  C  CB  . ALA A  1 249 ? 49.039   22.720  0.959   1.00 17.99 ? 352 ALA A CB  1 
ATOM   1929  N  N   . ALA A  1 250 ? 50.194   25.053  -0.816  1.00 20.67 ? 353 ALA A N   1 
ATOM   1930  C  CA  . ALA A  1 250 ? 51.259   25.684  -1.586  1.00 18.69 ? 353 ALA A CA  1 
ATOM   1931  C  C   . ALA A  1 250 ? 51.460   27.121  -1.149  1.00 18.38 ? 353 ALA A C   1 
ATOM   1932  O  O   . ALA A  1 250 ? 52.587   27.581  -1.062  1.00 19.87 ? 353 ALA A O   1 
ATOM   1933  C  CB  . ALA A  1 250 ? 50.978   25.587  -3.078  1.00 17.75 ? 353 ALA A CB  1 
ATOM   1934  N  N   . GLU A  1 251 ? 50.380   27.855  -0.895  1.00 18.09 ? 354 GLU A N   1 
ATOM   1935  C  CA  . GLU A  1 251 ? 50.479   29.246  -0.414  1.00 18.07 ? 354 GLU A CA  1 
ATOM   1936  C  C   . GLU A  1 251 ? 51.302   29.308  0.893   1.00 17.79 ? 354 GLU A C   1 
ATOM   1937  O  O   . GLU A  1 251 ? 52.181   30.146  1.070   1.00 15.99 ? 354 GLU A O   1 
ATOM   1938  C  CB  . GLU A  1 251 ? 49.071   29.837  -0.198  1.00 18.59 ? 354 GLU A CB  1 
ATOM   1939  C  CG  . GLU A  1 251 ? 49.014   31.244  0.380   1.00 19.15 ? 354 GLU A CG  1 
ATOM   1940  C  CD  . GLU A  1 251 ? 47.595   31.758  0.594   1.00 20.18 ? 354 GLU A CD  1 
ATOM   1941  O  OE1 . GLU A  1 251 ? 46.948   31.372  1.605   1.00 22.46 ? 354 GLU A OE1 1 
ATOM   1942  O  OE2 . GLU A  1 251 ? 47.102   32.588  -0.241  1.00 21.48 ? 354 GLU A OE2 1 
ATOM   1943  N  N   . LYS A  1 252 ? 50.962   28.427  1.814   1.00 19.42 ? 355 LYS A N   1 
ATOM   1944  C  CA  . LYS A  1 252 ? 51.592   28.357  3.120   1.00 20.55 ? 355 LYS A CA  1 
ATOM   1945  C  C   . LYS A  1 252 ? 53.085   27.975  2.983   1.00 20.58 ? 355 LYS A C   1 
ATOM   1946  O  O   . LYS A  1 252 ? 53.947   28.532  3.641   1.00 19.48 ? 355 LYS A O   1 
ATOM   1947  C  CB  . LYS A  1 252 ? 50.831   27.327  3.959   1.00 22.62 ? 355 LYS A CB  1 
ATOM   1948  C  CG  . LYS A  1 252 ? 51.424   26.962  5.309   1.00 24.15 ? 355 LYS A CG  1 
ATOM   1949  C  CD  . LYS A  1 252 ? 51.238   28.095  6.291   1.00 28.61 ? 355 LYS A CD  1 
ATOM   1950  C  CE  . LYS A  1 252 ? 51.977   27.745  7.594   1.00 31.73 ? 355 LYS A CE  1 
ATOM   1951  N  NZ  . LYS A  1 252 ? 51.753   28.763  8.639   1.00 34.43 ? 355 LYS A NZ  1 
ATOM   1952  N  N   . GLN A  1 253 ? 53.369   27.031  2.111   1.00 21.42 ? 356 GLN A N   1 
ATOM   1953  C  CA  . GLN A  1 253 ? 54.727   26.620  1.836   1.00 24.31 ? 356 GLN A CA  1 
ATOM   1954  C  C   . GLN A  1 253 ? 55.598   27.765  1.238   1.00 26.00 ? 356 GLN A C   1 
ATOM   1955  O  O   . GLN A  1 253 ? 56.715   28.023  1.681   1.00 23.18 ? 356 GLN A O   1 
ATOM   1956  C  CB  . GLN A  1 253 ? 54.670   25.450  0.905   1.00 26.95 ? 356 GLN A CB  1 
ATOM   1957  C  CG  . GLN A  1 253 ? 55.950   24.672  0.746   1.00 33.38 ? 356 GLN A CG  1 
ATOM   1958  C  CD  . GLN A  1 253 ? 55.749   23.516  -0.236  1.00 35.48 ? 356 GLN A CD  1 
ATOM   1959  O  OE1 . GLN A  1 253 ? 54.953   22.612  -0.020  1.00 41.01 ? 356 GLN A OE1 1 
ATOM   1960  N  NE2 . GLN A  1 253 ? 56.443   23.572  -1.321  1.00 36.15 ? 356 GLN A NE2 1 
ATOM   1961  N  N   . MET A  1 254 ? 55.075   28.457  0.245   1.00 22.31 ? 357 MET A N   1 
ATOM   1962  C  CA  . MET A  1 254 ? 55.805   29.583  -0.317  1.00 23.40 ? 357 MET A CA  1 
ATOM   1963  C  C   . MET A  1 254 ? 56.048   30.687  0.727   1.00 22.38 ? 357 MET A C   1 
ATOM   1964  O  O   . MET A  1 254 ? 57.093   31.307  0.745   1.00 22.04 ? 357 MET A O   1 
ATOM   1965  C  CB  . MET A  1 254 ? 55.044   30.166  -1.509  1.00 22.32 ? 357 MET A CB  1 
ATOM   1966  C  CG  . MET A  1 254 ? 55.709   31.385  -2.114  1.00 21.79 ? 357 MET A CG  1 
ATOM   1967  S  SD  . MET A  1 254 ? 54.975   31.801  -3.694  1.00 20.58 ? 357 MET A SD  1 
ATOM   1968  C  CE  . MET A  1 254 ? 56.022   33.175  -4.214  1.00 23.88 ? 357 MET A CE  1 
ATOM   1969  N  N   . LYS A  1 255 ? 55.064   30.947  1.580   1.00 20.34 ? 358 LYS A N   1 
ATOM   1970  C  CA  . LYS A  1 255 ? 55.217   31.989  2.594   1.00 18.36 ? 358 LYS A CA  1 
ATOM   1971  C  C   . LYS A  1 255 ? 56.221   31.599  3.687   1.00 18.88 ? 358 LYS A C   1 
ATOM   1972  O  O   . LYS A  1 255 ? 56.991   32.423  4.133   1.00 18.55 ? 358 LYS A O   1 
ATOM   1973  C  CB  . LYS A  1 255 ? 53.868   32.332  3.172   1.00 18.01 ? 358 LYS A CB  1 
ATOM   1974  C  CG  . LYS A  1 255 ? 53.894   33.280  4.346   1.00 17.98 ? 358 LYS A CG  1 
ATOM   1975  C  CD  . LYS A  1 255 ? 54.342   34.673  3.987   1.00 19.00 ? 358 LYS A CD  1 
ATOM   1976  C  CE  . LYS A  1 255 ? 54.250   35.461  5.280   1.00 21.03 ? 358 LYS A CE  1 
ATOM   1977  N  NZ  . LYS A  1 255 ? 54.283   36.906  5.089   1.00 23.79 ? 358 LYS A NZ  1 
ATOM   1978  N  N   . ASP A  1 256 ? 56.206   30.345  4.115   1.00 19.86 ? 359 ASP A N   1 
ATOM   1979  C  CA  . ASP A  1 256 ? 57.197   29.867  5.065   1.00 23.01 ? 359 ASP A CA  1 
ATOM   1980  C  C   . ASP A  1 256 ? 58.632   30.056  4.529   1.00 24.76 ? 359 ASP A C   1 
ATOM   1981  O  O   . ASP A  1 256 ? 59.524   30.442  5.266   1.00 24.81 ? 359 ASP A O   1 
ATOM   1982  C  CB  . ASP A  1 256 ? 56.977   28.388  5.397   1.00 23.74 ? 359 ASP A CB  1 
ATOM   1983  C  CG  . ASP A  1 256 ? 55.681   28.135  6.193   1.00 26.43 ? 359 ASP A CG  1 
ATOM   1984  O  OD1 . ASP A  1 256 ? 55.055   29.108  6.761   1.00 27.84 ? 359 ASP A OD1 1 
ATOM   1985  O  OD2 . ASP A  1 256 ? 55.281   26.945  6.229   1.00 26.72 ? 359 ASP A OD2 1 
ATOM   1986  N  N   . LYS A  1 257 ? 58.806   29.823  3.233   1.00 24.00 ? 360 LYS A N   1 
ATOM   1987  C  CA  . LYS A  1 257 ? 60.098   29.910  2.600   1.00 24.96 ? 360 LYS A CA  1 
ATOM   1988  C  C   . LYS A  1 257 ? 60.537   31.359  2.626   1.00 23.35 ? 360 LYS A C   1 
ATOM   1989  O  O   . LYS A  1 257 ? 61.660   31.637  2.961   1.00 22.94 ? 360 LYS A O   1 
ATOM   1990  C  CB  . LYS A  1 257 ? 60.057   29.347  1.193   1.00 28.89 ? 360 LYS A CB  1 
ATOM   1991  C  CG  . LYS A  1 257 ? 61.402   29.312  0.464   1.00 32.95 ? 360 LYS A CG  1 
ATOM   1992  C  CD  . LYS A  1 257 ? 61.405   29.132  -1.086  1.00 38.28 ? 360 LYS A CD  1 
ATOM   1993  C  CE  . LYS A  1 257 ? 60.289   28.273  -1.649  1.00 42.45 ? 360 LYS A CE  1 
ATOM   1994  N  NZ  . LYS A  1 257 ? 60.258   26.861  -1.177  1.00 48.15 ? 360 LYS A NZ  1 
ATOM   1995  N  N   . GLN A  1 258 ? 59.636   32.277  2.306   1.00 22.56 ? 361 GLN A N   1 
ATOM   1996  C  CA  . GLN A  1 258 ? 59.957   33.706  2.295   1.00 21.56 ? 361 GLN A CA  1 
ATOM   1997  C  C   . GLN A  1 258 ? 60.248   34.253  3.676   1.00 21.34 ? 361 GLN A C   1 
ATOM   1998  O  O   . GLN A  1 258 ? 61.099   35.104  3.836   1.00 20.83 ? 361 GLN A O   1 
ATOM   1999  C  CB  . GLN A  1 258 ? 58.837   34.541  1.677   1.00 21.84 ? 361 GLN A CB  1 
ATOM   2000  C  CG  . GLN A  1 258 ? 58.528   34.241  0.222   1.00 20.67 ? 361 GLN A CG  1 
ATOM   2001  C  CD  . GLN A  1 258 ? 57.360   35.070  -0.322  1.00 20.55 ? 361 GLN A CD  1 
ATOM   2002  O  OE1 . GLN A  1 258 ? 56.626   35.738  0.430   1.00 20.27 ? 361 GLN A OE1 1 
ATOM   2003  N  NE2 . GLN A  1 258 ? 57.204   35.056  -1.632  1.00 18.99 ? 361 GLN A NE2 1 
ATOM   2004  N  N   . ASP A  1 259 ? 59.527   33.753  4.674   1.00 23.76 ? 362 ASP A N   1 
ATOM   2005  C  CA  . ASP A  1 259 ? 59.776   34.119  6.075   1.00 23.63 ? 362 ASP A CA  1 
ATOM   2006  C  C   . ASP A  1 259 ? 61.184   33.659  6.535   1.00 24.22 ? 362 ASP A C   1 
ATOM   2007  O  O   . ASP A  1 259 ? 61.909   34.420  7.143   1.00 24.42 ? 362 ASP A O   1 
ATOM   2008  C  CB  . ASP A  1 259 ? 58.733   33.502  7.004   1.00 22.66 ? 362 ASP A CB  1 
ATOM   2009  C  CG  . ASP A  1 259 ? 57.352   34.162  6.896   1.00 23.67 ? 362 ASP A CG  1 
ATOM   2010  O  OD1 . ASP A  1 259 ? 57.207   35.219  6.219   1.00 23.67 ? 362 ASP A OD1 1 
ATOM   2011  O  OD2 . ASP A  1 259 ? 56.400   33.642  7.542   1.00 22.92 ? 362 ASP A OD2 1 
ATOM   2012  N  N   . GLU A  1 260 ? 61.548   32.427  6.221   1.00 27.65 ? 363 GLU A N   1 
ATOM   2013  C  CA  . GLU A  1 260 ? 62.908   31.912  6.473   1.00 33.38 ? 363 GLU A CA  1 
ATOM   2014  C  C   . GLU A  1 260 ? 64.006   32.739  5.800   1.00 36.26 ? 363 GLU A C   1 
ATOM   2015  O  O   . GLU A  1 260 ? 64.966   33.116  6.443   1.00 36.05 ? 363 GLU A O   1 
ATOM   2016  C  CB  . GLU A  1 260 ? 63.036   30.467  6.023   1.00 36.79 ? 363 GLU A CB  1 
ATOM   2017  C  CG  . GLU A  1 260 ? 62.313   29.473  6.937   1.00 44.20 ? 363 GLU A CG  1 
ATOM   2018  C  CD  . GLU A  1 260 ? 63.134   28.191  7.145   1.00 51.22 ? 363 GLU A CD  1 
ATOM   2019  O  OE1 . GLU A  1 260 ? 64.321   28.328  7.536   1.00 57.89 ? 363 GLU A OE1 1 
ATOM   2020  O  OE2 . GLU A  1 260 ? 62.622   27.052  6.906   1.00 54.03 ? 363 GLU A OE2 1 
ATOM   2021  N  N   . GLU A  1 261 ? 63.847   33.060  4.524   1.00 38.99 ? 364 GLU A N   1 
ATOM   2022  C  CA  . GLU A  1 261 ? 64.838   33.916  3.846   1.00 42.94 ? 364 GLU A CA  1 
ATOM   2023  C  C   . GLU A  1 261 ? 64.951   35.305  4.502   1.00 41.86 ? 364 GLU A C   1 
ATOM   2024  O  O   . GLU A  1 261 ? 66.029   35.861  4.628   1.00 42.88 ? 364 GLU A O   1 
ATOM   2025  C  CB  . GLU A  1 261 ? 64.563   34.091  2.345   1.00 45.60 ? 364 GLU A CB  1 
ATOM   2026  C  CG  . GLU A  1 261 ? 64.212   32.801  1.577   1.00 51.14 ? 364 GLU A CG  1 
ATOM   2027  C  CD  . GLU A  1 261 ? 65.350   31.801  1.484   1.00 56.44 ? 364 GLU A CD  1 
ATOM   2028  O  OE1 . GLU A  1 261 ? 66.500   32.160  1.788   1.00 60.60 ? 364 GLU A OE1 1 
ATOM   2029  O  OE2 . GLU A  1 261 ? 65.095   30.644  1.090   1.00 60.86 ? 364 GLU A OE2 1 
ATOM   2030  N  N   . GLN A  1 262 ? 63.822   35.861  4.890   1.00 40.27 ? 365 GLN A N   1 
ATOM   2031  C  CA  . GLN A  1 262 ? 63.801   37.131  5.564   1.00 43.20 ? 365 GLN A CA  1 
ATOM   2032  C  C   . GLN A  1 262 ? 64.650   37.086  6.827   1.00 44.73 ? 365 GLN A C   1 
ATOM   2033  O  O   . GLN A  1 262 ? 65.412   38.003  7.088   1.00 47.12 ? 365 GLN A O   1 
ATOM   2034  C  CB  . GLN A  1 262 ? 62.360   37.503  5.911   1.00 43.44 ? 365 GLN A CB  1 
ATOM   2035  C  CG  . GLN A  1 262 ? 62.170   38.921  6.407   1.00 44.88 ? 365 GLN A CG  1 
ATOM   2036  C  CD  . GLN A  1 262 ? 62.703   39.983  5.446   1.00 47.99 ? 365 GLN A CD  1 
ATOM   2037  O  OE1 . GLN A  1 262 ? 63.200   41.009  5.889   1.00 49.90 ? 365 GLN A OE1 1 
ATOM   2038  N  NE2 . GLN A  1 262 ? 62.615   39.741  4.140   1.00 53.79 ? 365 GLN A NE2 1 
ATOM   2039  N  N   . ARG A  1 263 ? 64.515   36.014  7.600   1.00 46.18 ? 366 ARG A N   1 
ATOM   2040  C  CA  . ARG A  1 263 ? 65.314   35.810  8.837   1.00 46.62 ? 366 ARG A CA  1 
ATOM   2041  C  C   . ARG A  1 263 ? 66.845   35.761  8.598   1.00 47.20 ? 366 ARG A C   1 
ATOM   2042  O  O   . ARG A  1 263 ? 67.594   36.028  9.500   1.00 51.66 ? 366 ARG A O   1 
ATOM   2043  C  CB  . ARG A  1 263 ? 64.880   34.517  9.570   1.00 42.68 ? 366 ARG A CB  1 
ATOM   2044  N  N   . LEU A  1 264 ? 67.293   35.408  7.390   1.00 49.01 ? 367 LEU A N   1 
ATOM   2045  C  CA  . LEU A  1 264 ? 68.736   35.264  7.068   1.00 45.05 ? 367 LEU A CA  1 
ATOM   2046  C  C   . LEU A  1 264 ? 69.308   36.403  6.219   1.00 45.24 ? 367 LEU A C   1 
ATOM   2047  O  O   . LEU A  1 264 ? 68.753   37.494  6.170   1.00 43.14 ? 367 LEU A O   1 
ATOM   2048  C  CB  . LEU A  1 264 ? 68.979   33.987  6.283   1.00 43.95 ? 367 LEU A CB  1 
ATOM   2049  C  CG  . LEU A  1 264 ? 68.467   32.690  6.911   1.00 45.90 ? 367 LEU A CG  1 
ATOM   2050  C  CD1 . LEU A  1 264 ? 68.167   31.615  5.875   1.00 47.17 ? 367 LEU A CD1 1 
ATOM   2051  C  CD2 . LEU A  1 264 ? 69.456   32.181  7.945   1.00 45.50 ? 367 LEU A CD2 1 
ATOM   2052  N  N   . GLU B  1 9   ? 17.105   99.373  -11.156 1.00 51.78 ? 18  GLU B N   1 
ATOM   2053  C  CA  . GLU B  1 9   ? 18.245   98.690  -10.458 1.00 50.80 ? 18  GLU B CA  1 
ATOM   2054  C  C   . GLU B  1 9   ? 17.995   97.418  -9.646  1.00 45.86 ? 18  GLU B C   1 
ATOM   2055  O  O   . GLU B  1 9   ? 18.912   96.628  -9.503  1.00 46.41 ? 18  GLU B O   1 
ATOM   2056  C  CB  . GLU B  1 9   ? 19.054   99.663  -9.587  1.00 54.52 ? 18  GLU B CB  1 
ATOM   2057  C  CG  . GLU B  1 9   ? 20.396   99.946  -10.236 1.00 60.07 ? 18  GLU B CG  1 
ATOM   2058  C  CD  . GLU B  1 9   ? 21.406   100.582 -9.316  1.00 65.37 ? 18  GLU B CD  1 
ATOM   2059  O  OE1 . GLU B  1 9   ? 21.373   100.321 -8.101  1.00 58.82 ? 18  GLU B OE1 1 
ATOM   2060  O  OE2 . GLU B  1 9   ? 22.252   101.339 -9.834  1.00 77.73 ? 18  GLU B OE2 1 
ATOM   2061  N  N   . PRO B  1 10  ? 16.802   97.230  -9.083  1.00 38.66 ? 19  PRO B N   1 
ATOM   2062  C  CA  . PRO B  1 10  ? 16.572   95.981  -8.357  1.00 35.05 ? 19  PRO B CA  1 
ATOM   2063  C  C   . PRO B  1 10  ? 16.627   94.801  -9.262  1.00 30.78 ? 19  PRO B C   1 
ATOM   2064  O  O   . PRO B  1 10  ? 16.086   94.845  -10.337 1.00 29.52 ? 19  PRO B O   1 
ATOM   2065  C  CB  . PRO B  1 10  ? 15.160   96.112  -7.833  1.00 36.65 ? 19  PRO B CB  1 
ATOM   2066  C  CG  . PRO B  1 10  ? 14.614   97.417  -8.337  1.00 39.12 ? 19  PRO B CG  1 
ATOM   2067  C  CD  . PRO B  1 10  ? 15.720   98.215  -8.926  1.00 40.07 ? 19  PRO B CD  1 
ATOM   2068  N  N   . ALA B  1 11  ? 17.298   93.745  -8.822  1.00 27.97 ? 20  ALA B N   1 
ATOM   2069  C  CA  . ALA B  1 11  ? 17.338   92.518  -9.580  1.00 26.33 ? 20  ALA B CA  1 
ATOM   2070  C  C   . ALA B  1 11  ? 16.101   91.702  -9.225  1.00 27.87 ? 20  ALA B C   1 
ATOM   2071  O  O   . ALA B  1 11  ? 15.769   91.508  -8.052  1.00 30.34 ? 20  ALA B O   1 
ATOM   2072  C  CB  . ALA B  1 11  ? 18.585   91.725  -9.258  1.00 26.91 ? 20  ALA B CB  1 
ATOM   2073  N  N   . VAL B  1 12  ? 15.440   91.196  -10.247 1.00 27.79 ? 21  VAL B N   1 
ATOM   2074  C  CA  . VAL B  1 12  ? 14.289   90.321  -10.075 1.00 26.17 ? 21  VAL B CA  1 
ATOM   2075  C  C   . VAL B  1 12  ? 14.712   88.978  -10.609 1.00 25.38 ? 21  VAL B C   1 
ATOM   2076  O  O   . VAL B  1 12  ? 14.743   88.799  -11.787 1.00 26.77 ? 21  VAL B O   1 
ATOM   2077  C  CB  . VAL B  1 12  ? 13.040   90.839  -10.831 1.00 24.31 ? 21  VAL B CB  1 
ATOM   2078  C  CG1 . VAL B  1 12  ? 11.861   89.931  -10.587 1.00 25.61 ? 21  VAL B CG1 1 
ATOM   2079  C  CG2 . VAL B  1 12  ? 12.686   92.247  -10.361 1.00 24.37 ? 21  VAL B CG2 1 
ATOM   2080  N  N   . TYR B  1 13  ? 15.031   88.044  -9.733  1.00 23.24 ? 22  TYR B N   1 
ATOM   2081  C  CA  . TYR B  1 13  ? 15.453   86.720  -10.165 1.00 22.90 ? 22  TYR B CA  1 
ATOM   2082  C  C   . TYR B  1 13  ? 14.294   85.798  -10.516 1.00 24.05 ? 22  TYR B C   1 
ATOM   2083  O  O   . TYR B  1 13  ? 14.465   84.821  -11.215 1.00 22.62 ? 22  TYR B O   1 
ATOM   2084  C  CB  . TYR B  1 13  ? 16.254   86.044  -9.062  1.00 23.93 ? 22  TYR B CB  1 
ATOM   2085  C  CG  . TYR B  1 13  ? 17.419   86.877  -8.596  1.00 26.04 ? 22  TYR B CG  1 
ATOM   2086  C  CD1 . TYR B  1 13  ? 18.473   87.227  -9.472  1.00 25.90 ? 22  TYR B CD1 1 
ATOM   2087  C  CD2 . TYR B  1 13  ? 17.466   87.352  -7.282  1.00 27.65 ? 22  TYR B CD2 1 
ATOM   2088  C  CE1 . TYR B  1 13  ? 19.538   88.010  -9.025  1.00 28.16 ? 22  TYR B CE1 1 
ATOM   2089  C  CE2 . TYR B  1 13  ? 18.509   88.140  -6.844  1.00 28.45 ? 22  TYR B CE2 1 
ATOM   2090  C  CZ  . TYR B  1 13  ? 19.544   88.457  -7.705  1.00 28.55 ? 22  TYR B CZ  1 
ATOM   2091  O  OH  . TYR B  1 13  ? 20.565   89.215  -7.197  1.00 31.09 ? 22  TYR B OH  1 
ATOM   2092  N  N   . PHE B  1 14  ? 13.131   86.067  -9.936  1.00 24.67 ? 23  PHE B N   1 
ATOM   2093  C  CA  . PHE B  1 14  ? 11.945   85.241  -10.138 1.00 23.86 ? 23  PHE B CA  1 
ATOM   2094  C  C   . PHE B  1 14  ? 10.688   86.003  -9.725  1.00 24.83 ? 23  PHE B C   1 
ATOM   2095  O  O   . PHE B  1 14  ? 10.665   86.679  -8.681  1.00 21.98 ? 23  PHE B O   1 
ATOM   2096  C  CB  . PHE B  1 14  ? 11.995   83.948  -9.355  1.00 22.97 ? 23  PHE B CB  1 
ATOM   2097  C  CG  . PHE B  1 14  ? 10.889   82.989  -9.711  1.00 25.48 ? 23  PHE B CG  1 
ATOM   2098  C  CD1 . PHE B  1 14  ? 10.763   82.478  -11.019 1.00 24.77 ? 23  PHE B CD1 1 
ATOM   2099  C  CD2 . PHE B  1 14  ? 9.942    82.573  -8.745  1.00 26.26 ? 23  PHE B CD2 1 
ATOM   2100  C  CE1 . PHE B  1 14  ? 9.742    81.589  -11.350 1.00 23.48 ? 23  PHE B CE1 1 
ATOM   2101  C  CE2 . PHE B  1 14  ? 8.900    81.701  -9.099  1.00 24.38 ? 23  PHE B CE2 1 
ATOM   2102  C  CZ  . PHE B  1 14  ? 8.807    81.214  -10.398 1.00 23.79 ? 23  PHE B CZ  1 
ATOM   2103  N  N   . LYS B  1 15  ? 9.681    85.949  -10.600 1.00 22.69 ? 24  LYS B N   1 
ATOM   2104  C  CA  . LYS B  1 15  ? 8.387    86.536  -10.334 1.00 21.66 ? 24  LYS B CA  1 
ATOM   2105  C  C   . LYS B  1 15  ? 7.331    85.604  -10.927 1.00 21.95 ? 24  LYS B C   1 
ATOM   2106  O  O   . LYS B  1 15  ? 7.443    85.193  -12.073 1.00 18.10 ? 24  LYS B O   1 
ATOM   2107  C  CB  . LYS B  1 15  ? 8.262    87.927  -10.925 1.00 20.45 ? 24  LYS B CB  1 
ATOM   2108  C  CG  . LYS B  1 15  ? 7.077    88.686  -10.377 1.00 21.15 ? 24  LYS B CG  1 
ATOM   2109  C  CD  . LYS B  1 15  ? 6.840    90.000  -11.081 1.00 20.96 ? 24  LYS B CD  1 
ATOM   2110  C  CE  . LYS B  1 15  ? 7.928    90.974  -10.743 1.00 22.32 ? 24  LYS B CE  1 
ATOM   2111  N  NZ  . LYS B  1 15  ? 7.434    92.342  -10.464 1.00 23.02 ? 24  LYS B NZ  1 
ATOM   2112  N  N   . GLU B  1 16  ? 6.305    85.283  -10.134 1.00 21.85 ? 25  GLU B N   1 
ATOM   2113  C  CA  . GLU B  1 16  ? 5.170    84.493  -10.646 1.00 23.01 ? 25  GLU B CA  1 
ATOM   2114  C  C   . GLU B  1 16  ? 3.854    84.973  -10.054 1.00 23.46 ? 25  GLU B C   1 
ATOM   2115  O  O   . GLU B  1 16  ? 3.609    84.856  -8.832  1.00 20.56 ? 25  GLU B O   1 
ATOM   2116  C  CB  . GLU B  1 16  ? 5.369    83.007  -10.375 1.00 23.18 ? 25  GLU B CB  1 
ATOM   2117  C  CG  . GLU B  1 16  ? 4.265    82.109  -10.887 1.00 25.76 ? 25  GLU B CG  1 
ATOM   2118  C  CD  . GLU B  1 16  ? 4.138    82.072  -12.415 1.00 26.28 ? 25  GLU B CD  1 
ATOM   2119  O  OE1 . GLU B  1 16  ? 4.684    81.128  -13.004 1.00 25.18 ? 25  GLU B OE1 1 
ATOM   2120  O  OE2 . GLU B  1 16  ? 3.459    82.958  -13.004 1.00 27.20 ? 25  GLU B OE2 1 
ATOM   2121  N  N   . GLN B  1 17  ? 2.996    85.503  -10.921 1.00 22.96 ? 26  GLN B N   1 
ATOM   2122  C  CA  . GLN B  1 17  ? 1.644    85.891  -10.478 1.00 22.80 ? 26  GLN B CA  1 
ATOM   2123  C  C   . GLN B  1 17  ? 0.500    85.116  -11.152 1.00 23.09 ? 26  GLN B C   1 
ATOM   2124  O  O   . GLN B  1 17  ? -0.673   85.301  -10.809 1.00 24.16 ? 26  GLN B O   1 
ATOM   2125  C  CB  . GLN B  1 17  ? 1.449    87.361  -10.660 1.00 22.71 ? 26  GLN B CB  1 
ATOM   2126  C  CG  . GLN B  1 17  ? 2.647    88.156  -10.231 1.00 23.04 ? 26  GLN B CG  1 
ATOM   2127  C  CD  . GLN B  1 17  ? 2.480    89.619  -10.512 1.00 24.20 ? 26  GLN B CD  1 
ATOM   2128  O  OE1 . GLN B  1 17  ? 1.672    90.300  -9.889  1.00 28.30 ? 26  GLN B OE1 1 
ATOM   2129  N  NE2 . GLN B  1 17  ? 3.241    90.108  -11.441 1.00 22.08 ? 26  GLN B NE2 1 
ATOM   2130  N  N   . PHE B  1 18  ? 0.845    84.216  -12.068 1.00 22.74 ? 27  PHE B N   1 
ATOM   2131  C  CA  . PHE B  1 18  ? -0.154   83.401  -12.782 1.00 21.85 ? 27  PHE B CA  1 
ATOM   2132  C  C   . PHE B  1 18  ? -1.235   84.262  -13.426 1.00 22.79 ? 27  PHE B C   1 
ATOM   2133  O  O   . PHE B  1 18  ? -2.393   84.029  -13.203 1.00 24.23 ? 27  PHE B O   1 
ATOM   2134  C  CB  . PHE B  1 18  ? -0.800   82.428  -11.815 1.00 18.57 ? 27  PHE B CB  1 
ATOM   2135  C  CG  . PHE B  1 18  ? 0.170    81.632  -11.001 1.00 17.32 ? 27  PHE B CG  1 
ATOM   2136  C  CD1 . PHE B  1 18  ? 0.710    80.475  -11.491 1.00 16.42 ? 27  PHE B CD1 1 
ATOM   2137  C  CD2 . PHE B  1 18  ? 0.517    82.020  -9.722  1.00 17.49 ? 27  PHE B CD2 1 
ATOM   2138  C  CE1 . PHE B  1 18  ? 1.603    79.716  -10.759 1.00 15.31 ? 27  PHE B CE1 1 
ATOM   2139  C  CE2 . PHE B  1 18  ? 1.394    81.263  -8.962  1.00 16.25 ? 27  PHE B CE2 1 
ATOM   2140  C  CZ  . PHE B  1 18  ? 1.947    80.107  -9.489  1.00 16.42 ? 27  PHE B CZ  1 
ATOM   2141  N  N   . LEU B  1 19  ? -0.823   85.286  -14.161 1.00 25.39 ? 28  LEU B N   1 
ATOM   2142  C  CA  . LEU B  1 19  ? -1.718   86.258  -14.784 1.00 26.42 ? 28  LEU B CA  1 
ATOM   2143  C  C   . LEU B  1 19  ? -2.043   85.950  -16.248 1.00 29.89 ? 28  LEU B C   1 
ATOM   2144  O  O   . LEU B  1 19  ? -2.954   86.533  -16.804 1.00 32.32 ? 28  LEU B O   1 
ATOM   2145  C  CB  . LEU B  1 19  ? -1.108   87.670  -14.751 1.00 25.15 ? 28  LEU B CB  1 
ATOM   2146  C  CG  . LEU B  1 19  ? -0.997   88.364  -13.392 1.00 25.63 ? 28  LEU B CG  1 
ATOM   2147  C  CD1 . LEU B  1 19  ? -0.002   89.523  -13.484 1.00 25.60 ? 28  LEU B CD1 1 
ATOM   2148  C  CD2 . LEU B  1 19  ? -2.359   88.843  -12.900 1.00 25.87 ? 28  LEU B CD2 1 
ATOM   2149  N  N   . ASP B  1 20  ? -1.309   85.027  -16.856 1.00 31.59 ? 29  ASP B N   1 
ATOM   2150  C  CA  . ASP B  1 20  ? -1.375   84.790  -18.324 1.00 32.16 ? 29  ASP B CA  1 
ATOM   2151  C  C   . ASP B  1 20  ? -2.017   83.418  -18.639 1.00 33.25 ? 29  ASP B C   1 
ATOM   2152  O  O   . ASP B  1 20  ? -1.451   82.540  -19.302 1.00 35.40 ? 29  ASP B O   1 
ATOM   2153  C  CB  . ASP B  1 20  ? 0.037    84.913  -18.930 1.00 28.70 ? 29  ASP B CB  1 
ATOM   2154  C  CG  . ASP B  1 20  ? 1.006    83.879  -18.366 1.00 25.77 ? 29  ASP B CG  1 
ATOM   2155  O  OD1 . ASP B  1 20  ? 0.799    83.353  -17.258 1.00 25.01 ? 29  ASP B OD1 1 
ATOM   2156  O  OD2 . ASP B  1 20  ? 1.979    83.571  -19.054 1.00 30.50 ? 29  ASP B OD2 1 
ATOM   2157  N  N   . GLY B  1 21  ? -3.222   83.236  -18.123 1.00 35.59 ? 30  GLY B N   1 
ATOM   2158  C  CA  . GLY B  1 21  ? -3.954   81.989  -18.286 1.00 33.05 ? 30  GLY B CA  1 
ATOM   2159  C  C   . GLY B  1 21  ? -3.193   80.760  -17.828 1.00 32.66 ? 30  GLY B C   1 
ATOM   2160  O  O   . GLY B  1 21  ? -2.745   80.658  -16.694 1.00 34.42 ? 30  GLY B O   1 
ATOM   2161  N  N   . ASP B  1 22  ? -3.090   79.806  -18.730 1.00 33.81 ? 31  ASP B N   1 
ATOM   2162  C  CA  . ASP B  1 22  ? -2.429   78.546  -18.473 1.00 34.46 ? 31  ASP B CA  1 
ATOM   2163  C  C   . ASP B  1 22  ? -0.890   78.620  -18.734 1.00 30.49 ? 31  ASP B C   1 
ATOM   2164  O  O   . ASP B  1 22  ? -0.184   77.591  -18.676 1.00 27.40 ? 31  ASP B O   1 
ATOM   2165  C  CB  . ASP B  1 22  ? -3.083   77.479  -19.356 1.00 36.86 ? 31  ASP B CB  1 
ATOM   2166  C  CG  . ASP B  1 22  ? -3.182   76.141  -18.694 1.00 42.53 ? 31  ASP B CG  1 
ATOM   2167  O  OD1 . ASP B  1 22  ? -3.038   76.043  -17.451 1.00 59.08 ? 31  ASP B OD1 1 
ATOM   2168  O  OD2 . ASP B  1 22  ? -3.438   75.158  -19.414 1.00 46.79 ? 31  ASP B OD2 1 
ATOM   2169  N  N   . GLY B  1 23  ? -0.390   79.821  -19.047 1.00 29.12 ? 32  GLY B N   1 
ATOM   2170  C  CA  . GLY B  1 23  ? 1.064    80.043  -19.282 1.00 29.81 ? 32  GLY B CA  1 
ATOM   2171  C  C   . GLY B  1 23  ? 1.963    79.391  -18.250 1.00 27.82 ? 32  GLY B C   1 
ATOM   2172  O  O   . GLY B  1 23  ? 3.010    78.830  -18.575 1.00 26.46 ? 32  GLY B O   1 
ATOM   2173  N  N   . TRP B  1 24  ? 1.516    79.397  -16.990 1.00 26.65 ? 33  TRP B N   1 
ATOM   2174  C  CA  . TRP B  1 24  ? 2.285    78.771  -15.908 1.00 26.10 ? 33  TRP B CA  1 
ATOM   2175  C  C   . TRP B  1 24  ? 2.675    77.317  -16.117 1.00 23.51 ? 33  TRP B C   1 
ATOM   2176  O  O   . TRP B  1 24  ? 3.666    76.869  -15.542 1.00 24.60 ? 33  TRP B O   1 
ATOM   2177  C  CB  . TRP B  1 24  ? 1.544    78.873  -14.575 1.00 25.75 ? 33  TRP B CB  1 
ATOM   2178  C  CG  . TRP B  1 24  ? 0.403    77.924  -14.430 1.00 24.62 ? 33  TRP B CG  1 
ATOM   2179  C  CD1 . TRP B  1 24  ? -0.885   78.139  -14.822 1.00 23.40 ? 33  TRP B CD1 1 
ATOM   2180  C  CD2 . TRP B  1 24  ? 0.441    76.618  -13.821 1.00 20.74 ? 33  TRP B CD2 1 
ATOM   2181  N  NE1 . TRP B  1 24  ? -1.647   77.050  -14.482 1.00 24.44 ? 33  TRP B NE1 1 
ATOM   2182  C  CE2 . TRP B  1 24  ? -0.866   76.112  -13.855 1.00 20.62 ? 33  TRP B CE2 1 
ATOM   2183  C  CE3 . TRP B  1 24  ? 1.444    75.855  -13.245 1.00 19.35 ? 33  TRP B CE3 1 
ATOM   2184  C  CZ2 . TRP B  1 24  ? -1.201   74.862  -13.357 1.00 19.14 ? 33  TRP B CZ2 1 
ATOM   2185  C  CZ3 . TRP B  1 24  ? 1.116    74.608  -12.730 1.00 18.76 ? 33  TRP B CZ3 1 
ATOM   2186  C  CH2 . TRP B  1 24  ? -0.206   74.122  -12.802 1.00 18.84 ? 33  TRP B CH2 1 
ATOM   2187  N  N   . THR B  1 25  ? 1.892    76.576  -16.896 1.00 24.48 ? 34  THR B N   1 
ATOM   2188  C  CA  . THR B  1 25  ? 2.150    75.124  -17.072 1.00 24.54 ? 34  THR B CA  1 
ATOM   2189  C  C   . THR B  1 25  ? 3.453    74.872  -17.820 1.00 24.17 ? 34  THR B C   1 
ATOM   2190  O  O   . THR B  1 25  ? 3.935    73.767  -17.858 1.00 25.20 ? 34  THR B O   1 
ATOM   2191  C  CB  . THR B  1 25  ? 0.993    74.406  -17.808 1.00 25.38 ? 34  THR B CB  1 
ATOM   2192  O  OG1 . THR B  1 25  ? 0.695    75.109  -19.013 1.00 26.32 ? 34  THR B OG1 1 
ATOM   2193  C  CG2 . THR B  1 25  ? -0.273   74.379  -16.953 1.00 27.27 ? 34  THR B CG2 1 
ATOM   2194  N  N   . SER B  1 26  ? 3.951    75.889  -18.511 1.00 25.75 ? 35  SER B N   1 
ATOM   2195  C  CA  . SER B  1 26  ? 5.243    75.777  -19.189 1.00 25.53 ? 35  SER B CA  1 
ATOM   2196  C  C   . SER B  1 26  ? 6.389    76.359  -18.342 1.00 24.61 ? 35  SER B C   1 
ATOM   2197  O  O   . SER B  1 26  ? 7.528    76.285  -18.755 1.00 28.17 ? 35  SER B O   1 
ATOM   2198  C  CB  . SER B  1 26  ? 5.200    76.431  -20.564 1.00 25.93 ? 35  SER B CB  1 
ATOM   2199  O  OG  . SER B  1 26  ? 5.108    77.843  -20.409 1.00 31.73 ? 35  SER B OG  1 
ATOM   2200  N  N   . ARG B  1 27  ? 6.098    76.876  -17.148 1.00 21.93 ? 36  ARG B N   1 
ATOM   2201  C  CA  . ARG B  1 27  ? 7.138    77.384  -16.227 1.00 21.40 ? 36  ARG B CA  1 
ATOM   2202  C  C   . ARG B  1 27  ? 7.383    76.495  -15.004 1.00 20.38 ? 36  ARG B C   1 
ATOM   2203  O  O   . ARG B  1 27  ? 8.354    76.656  -14.302 1.00 22.83 ? 36  ARG B O   1 
ATOM   2204  C  CB  . ARG B  1 27  ? 6.778    78.801  -15.770 1.00 22.93 ? 36  ARG B CB  1 
ATOM   2205  C  CG  . ARG B  1 27  ? 6.658    79.778  -16.944 1.00 23.37 ? 36  ARG B CG  1 
ATOM   2206  C  CD  . ARG B  1 27  ? 6.596    81.234  -16.511 1.00 24.56 ? 36  ARG B CD  1 
ATOM   2207  N  NE  . ARG B  1 27  ? 5.331    81.593  -15.884 1.00 25.10 ? 36  ARG B NE  1 
ATOM   2208  C  CZ  . ARG B  1 27  ? 4.240    82.039  -16.521 1.00 25.89 ? 36  ARG B CZ  1 
ATOM   2209  N  NH1 . ARG B  1 27  ? 4.221    82.227  -17.859 1.00 24.82 ? 36  ARG B NH1 1 
ATOM   2210  N  NH2 . ARG B  1 27  ? 3.141    82.298  -15.817 1.00 25.04 ? 36  ARG B NH2 1 
ATOM   2211  N  N   . TRP B  1 28  ? 6.475    75.574  -14.721 1.00 20.37 ? 37  TRP B N   1 
ATOM   2212  C  CA  . TRP B  1 28  ? 6.577    74.753  -13.529 1.00 19.45 ? 37  TRP B CA  1 
ATOM   2213  C  C   . TRP B  1 28  ? 6.584    73.297  -13.941 1.00 20.16 ? 37  TRP B C   1 
ATOM   2214  O  O   . TRP B  1 28  ? 5.956    72.911  -14.894 1.00 21.98 ? 37  TRP B O   1 
ATOM   2215  C  CB  . TRP B  1 28  ? 5.390    75.033  -12.539 1.00 19.67 ? 37  TRP B CB  1 
ATOM   2216  C  CG  . TRP B  1 28  ? 5.351    76.394  -11.966 1.00 17.17 ? 37  TRP B CG  1 
ATOM   2217  C  CD1 . TRP B  1 28  ? 5.040    77.567  -12.640 1.00 18.00 ? 37  TRP B CD1 1 
ATOM   2218  C  CD2 . TRP B  1 28  ? 5.676    76.768  -10.632 1.00 15.78 ? 37  TRP B CD2 1 
ATOM   2219  N  NE1 . TRP B  1 28  ? 5.156    78.636  -11.781 1.00 17.45 ? 37  TRP B NE1 1 
ATOM   2220  C  CE2 . TRP B  1 28  ? 5.537    78.155  -10.543 1.00 16.89 ? 37  TRP B CE2 1 
ATOM   2221  C  CE3 . TRP B  1 28  ? 6.069    76.061  -9.492  1.00 15.79 ? 37  TRP B CE3 1 
ATOM   2222  C  CZ2 . TRP B  1 28  ? 5.779    78.849  -9.344  1.00 17.56 ? 37  TRP B CZ2 1 
ATOM   2223  C  CZ3 . TRP B  1 28  ? 6.285    76.754  -8.297  1.00 15.81 ? 37  TRP B CZ3 1 
ATOM   2224  C  CH2 . TRP B  1 28  ? 6.186    78.118  -8.236  1.00 15.72 ? 37  TRP B CH2 1 
ATOM   2225  N  N   . ILE B  1 29  ? 7.260    72.478  -13.174 1.00 23.98 ? 38  ILE B N   1 
ATOM   2226  C  CA  . ILE B  1 29  ? 7.486    71.091  -13.491 1.00 23.93 ? 38  ILE B CA  1 
ATOM   2227  C  C   . ILE B  1 29  ? 7.064    70.259  -12.298 1.00 23.62 ? 38  ILE B C   1 
ATOM   2228  O  O   . ILE B  1 29  ? 7.482    70.496  -11.168 1.00 21.47 ? 38  ILE B O   1 
ATOM   2229  C  CB  . ILE B  1 29  ? 9.003    70.788  -13.731 1.00 25.58 ? 38  ILE B CB  1 
ATOM   2230  C  CG1 . ILE B  1 29  ? 9.590    71.638  -14.868 1.00 28.79 ? 38  ILE B CG1 1 
ATOM   2231  C  CG2 . ILE B  1 29  ? 9.255    69.297  -13.939 1.00 24.00 ? 38  ILE B CG2 1 
ATOM   2232  C  CD1 . ILE B  1 29  ? 9.082    71.294  -16.238 1.00 32.28 ? 38  ILE B CD1 1 
ATOM   2233  N  N   . GLU B  1 30  ? 6.327    69.194  -12.585 1.00 26.35 ? 39  GLU B N   1 
ATOM   2234  C  CA  . GLU B  1 30  ? 5.878    68.237  -11.586 1.00 27.92 ? 39  GLU B CA  1 
ATOM   2235  C  C   . GLU B  1 30  ? 6.955    67.235  -11.342 1.00 25.54 ? 39  GLU B C   1 
ATOM   2236  O  O   . GLU B  1 30  ? 7.493    66.674  -12.278 1.00 31.26 ? 39  GLU B O   1 
ATOM   2237  C  CB  . GLU B  1 30  ? 4.580    67.530  -12.059 1.00 31.69 ? 39  GLU B CB  1 
ATOM   2238  C  CG  . GLU B  1 30  ? 3.281    68.372  -11.954 1.00 34.03 ? 39  GLU B CG  1 
ATOM   2239  C  CD  . GLU B  1 30  ? 2.109    67.973  -12.952 1.00 38.09 ? 39  GLU B CD  1 
ATOM   2240  O  OE1 . GLU B  1 30  ? 1.091    67.398  -12.486 1.00 42.57 ? 39  GLU B OE1 1 
ATOM   2241  O  OE2 . GLU B  1 30  ? 2.152    68.184  -14.220 1.00 39.86 ? 39  GLU B OE2 1 
ATOM   2242  N  N   . SER B  1 31  ? 7.271    66.961  -10.089 1.00 24.89 ? 40  SER B N   1 
ATOM   2243  C  CA  . SER B  1 31  ? 8.175    65.846  -9.803  1.00 23.87 ? 40  SER B CA  1 
ATOM   2244  C  C   . SER B  1 31  ? 7.480    64.549  -10.135 1.00 24.97 ? 40  SER B C   1 
ATOM   2245  O  O   . SER B  1 31  ? 6.316    64.385  -9.833  1.00 25.19 ? 40  SER B O   1 
ATOM   2246  C  CB  . SER B  1 31  ? 8.603    65.828  -8.345  1.00 21.47 ? 40  SER B CB  1 
ATOM   2247  O  OG  . SER B  1 31  ? 9.262    64.635  -7.984  1.00 20.95 ? 40  SER B OG  1 
ATOM   2248  N  N   . LYS B  1 32  ? 8.222    63.595  -10.702 1.00 28.23 ? 41  LYS B N   1 
ATOM   2249  C  CA  . LYS B  1 32  ? 7.734    62.206  -10.883 1.00 25.98 ? 41  LYS B CA  1 
ATOM   2250  C  C   . LYS B  1 32  ? 8.389    61.251  -9.873  1.00 26.19 ? 41  LYS B C   1 
ATOM   2251  O  O   . LYS B  1 32  ? 8.352    60.028  -10.044 1.00 27.77 ? 41  LYS B O   1 
ATOM   2252  C  CB  . LYS B  1 32  ? 7.954    61.756  -12.332 1.00 25.01 ? 41  LYS B CB  1 
ATOM   2253  N  N   . HIS B  1 33  ? 8.983    61.779  -8.803  1.00 24.44 ? 42  HIS B N   1 
ATOM   2254  C  CA  . HIS B  1 33  ? 9.690    60.893  -7.839  1.00 26.79 ? 42  HIS B CA  1 
ATOM   2255  C  C   . HIS B  1 33  ? 8.762    59.799  -7.312  1.00 26.80 ? 42  HIS B C   1 
ATOM   2256  O  O   . HIS B  1 33  ? 9.181    58.702  -7.014  1.00 27.49 ? 42  HIS B O   1 
ATOM   2257  C  CB  . HIS B  1 33  ? 10.276   61.715  -6.651  1.00 26.46 ? 42  HIS B CB  1 
ATOM   2258  C  CG  . HIS B  1 33  ? 10.961   60.877  -5.598  1.00 24.24 ? 42  HIS B CG  1 
ATOM   2259  N  ND1 . HIS B  1 33  ? 12.229   60.351  -5.771  1.00 24.02 ? 42  HIS B ND1 1 
ATOM   2260  C  CD2 . HIS B  1 33  ? 10.553   60.481  -4.367  1.00 22.58 ? 42  HIS B CD2 1 
ATOM   2261  C  CE1 . HIS B  1 33  ? 12.560   59.637  -4.703  1.00 24.71 ? 42  HIS B CE1 1 
ATOM   2262  N  NE2 . HIS B  1 33  ? 11.569   59.720  -3.825  1.00 24.88 ? 42  HIS B NE2 1 
ATOM   2263  N  N   . LYS B  1 34  ? 7.510    60.175  -7.120  1.00 29.64 ? 43  LYS B N   1 
ATOM   2264  C  CA  . LYS B  1 34  ? 6.442    59.259  -6.735  1.00 34.49 ? 43  LYS B CA  1 
ATOM   2265  C  C   . LYS B  1 34  ? 5.314    59.387  -7.751  1.00 40.79 ? 43  LYS B C   1 
ATOM   2266  O  O   . LYS B  1 34  ? 5.234    60.376  -8.495  1.00 40.62 ? 43  LYS B O   1 
ATOM   2267  C  CB  . LYS B  1 34  ? 5.903    59.598  -5.370  1.00 38.10 ? 43  LYS B CB  1 
ATOM   2268  C  CG  . LYS B  1 34  ? 6.734    59.160  -4.183  1.00 37.11 ? 43  LYS B CG  1 
ATOM   2269  C  CD  . LYS B  1 34  ? 5.998    59.749  -2.981  1.00 40.43 ? 43  LYS B CD  1 
ATOM   2270  C  CE  . LYS B  1 34  ? 6.875    60.202  -1.850  1.00 45.41 ? 43  LYS B CE  1 
ATOM   2271  N  NZ  . LYS B  1 34  ? 6.152    60.423  -0.572  1.00 47.41 ? 43  LYS B NZ  1 
ATOM   2272  N  N   . SER B  1 35  ? 4.454    58.370  -7.786  1.00 47.49 ? 44  SER B N   1 
ATOM   2273  C  CA  . SER B  1 35  ? 3.334    58.308  -8.749  1.00 45.48 ? 44  SER B CA  1 
ATOM   2274  C  C   . SER B  1 35  ? 2.051    58.930  -8.192  1.00 42.09 ? 44  SER B C   1 
ATOM   2275  O  O   . SER B  1 35  ? 1.154    59.235  -8.962  1.00 37.77 ? 44  SER B O   1 
ATOM   2276  C  CB  . SER B  1 35  ? 3.054    56.864  -9.152  1.00 48.51 ? 44  SER B CB  1 
ATOM   2277  O  OG  . SER B  1 35  ? 2.511    56.124  -8.060  1.00 54.38 ? 44  SER B OG  1 
ATOM   2278  N  N   . ASP B  1 36  ? 1.991    59.142  -6.874  1.00 40.19 ? 45  ASP B N   1 
ATOM   2279  C  CA  . ASP B  1 36  ? 0.757    59.587  -6.163  1.00 41.78 ? 45  ASP B CA  1 
ATOM   2280  C  C   . ASP B  1 36  ? 0.850    60.969  -5.462  1.00 39.71 ? 45  ASP B C   1 
ATOM   2281  O  O   . ASP B  1 36  ? 0.194    61.213  -4.445  1.00 38.79 ? 45  ASP B O   1 
ATOM   2282  C  CB  . ASP B  1 36  ? 0.355    58.534  -5.123  1.00 40.10 ? 45  ASP B CB  1 
ATOM   2283  C  CG  . ASP B  1 36  ? 1.394    58.376  -4.006  1.00 40.00 ? 45  ASP B CG  1 
ATOM   2284  O  OD1 . ASP B  1 36  ? 2.558    58.808  -4.182  1.00 39.84 ? 45  ASP B OD1 1 
ATOM   2285  O  OD2 . ASP B  1 36  ? 1.041    57.795  -2.952  1.00 37.50 ? 45  ASP B OD2 1 
ATOM   2286  N  N   . PHE B  1 37  ? 1.700    61.839  -5.981  1.00 35.85 ? 46  PHE B N   1 
ATOM   2287  C  CA  . PHE B  1 37  ? 1.733    63.222  -5.528  1.00 34.15 ? 46  PHE B CA  1 
ATOM   2288  C  C   . PHE B  1 37  ? 0.369    63.864  -5.817  1.00 34.42 ? 46  PHE B C   1 
ATOM   2289  O  O   . PHE B  1 37  ? -0.227   63.606  -6.861  1.00 32.30 ? 46  PHE B O   1 
ATOM   2290  C  CB  . PHE B  1 37  ? 2.814    64.062  -6.267  1.00 31.24 ? 46  PHE B CB  1 
ATOM   2291  C  CG  . PHE B  1 37  ? 4.242    63.827  -5.793  1.00 32.02 ? 46  PHE B CG  1 
ATOM   2292  C  CD1 . PHE B  1 37  ? 4.566    63.813  -4.438  1.00 30.98 ? 46  PHE B CD1 1 
ATOM   2293  C  CD2 . PHE B  1 37  ? 5.270    63.664  -6.727  1.00 30.38 ? 46  PHE B CD2 1 
ATOM   2294  C  CE1 . PHE B  1 37  ? 5.869    63.625  -4.011  1.00 31.26 ? 46  PHE B CE1 1 
ATOM   2295  C  CE2 . PHE B  1 37  ? 6.567    63.483  -6.313  1.00 31.34 ? 46  PHE B CE2 1 
ATOM   2296  C  CZ  . PHE B  1 37  ? 6.871    63.455  -4.954  1.00 31.55 ? 46  PHE B CZ  1 
ATOM   2297  N  N   . GLY B  1 38  ? -0.079   64.736  -4.924  1.00 28.48 ? 47  GLY B N   1 
ATOM   2298  C  CA  . GLY B  1 38  ? -1.246   65.527  -5.177  1.00 25.66 ? 47  GLY B CA  1 
ATOM   2299  C  C   . GLY B  1 38  ? -0.990   66.471  -6.311  1.00 26.98 ? 47  GLY B C   1 
ATOM   2300  O  O   . GLY B  1 38  ? 0.130    66.758  -6.647  1.00 26.37 ? 47  GLY B O   1 
ATOM   2301  N  N   . LYS B  1 39  ? -2.049   66.989  -6.895  1.00 28.24 ? 48  LYS B N   1 
ATOM   2302  C  CA  . LYS B  1 39  ? -1.940   67.855  -8.046  1.00 29.92 ? 48  LYS B CA  1 
ATOM   2303  C  C   . LYS B  1 39  ? -2.325   69.313  -7.671  1.00 27.82 ? 48  LYS B C   1 
ATOM   2304  O  O   . LYS B  1 39  ? -3.268   69.549  -6.915  1.00 30.17 ? 48  LYS B O   1 
ATOM   2305  C  CB  . LYS B  1 39  ? -2.770   67.235  -9.207  1.00 32.69 ? 48  LYS B CB  1 
ATOM   2306  C  CG  . LYS B  1 39  ? -1.963   67.312  -10.564 1.00 38.33 ? 48  LYS B CG  1 
ATOM   2307  C  CD  . LYS B  1 39  ? -2.148   68.699  -11.330 1.00 42.12 ? 48  LYS B CD  1 
ATOM   2308  C  CE  . LYS B  1 39  ? -2.540   68.729  -12.881 1.00 44.47 ? 48  LYS B CE  1 
ATOM   2309  N  NZ  . LYS B  1 39  ? -3.909   68.151  -13.107 1.00 46.38 ? 48  LYS B NZ  1 
ATOM   2310  N  N   . PHE B  1 40  ? -1.520   70.269  -8.106  1.00 24.39 ? 49  PHE B N   1 
ATOM   2311  C  CA  . PHE B  1 40  ? -1.884   71.668  -8.012  1.00 22.38 ? 49  PHE B CA  1 
ATOM   2312  C  C   . PHE B  1 40  ? -2.793   72.013  -9.188  1.00 22.07 ? 49  PHE B C   1 
ATOM   2313  O  O   . PHE B  1 40  ? -2.591   71.513  -10.280 1.00 20.10 ? 49  PHE B O   1 
ATOM   2314  C  CB  . PHE B  1 40  ? -0.652   72.637  -8.053  1.00 21.09 ? 49  PHE B CB  1 
ATOM   2315  C  CG  . PHE B  1 40  ? 0.151    72.656  -6.806  1.00 20.80 ? 49  PHE B CG  1 
ATOM   2316  C  CD1 . PHE B  1 40  ? -0.172   73.514  -5.752  1.00 20.50 ? 49  PHE B CD1 1 
ATOM   2317  C  CD2 . PHE B  1 40  ? 1.229    71.810  -6.670  1.00 20.86 ? 49  PHE B CD2 1 
ATOM   2318  C  CE1 . PHE B  1 40  ? 0.587    73.514  -4.587  1.00 21.74 ? 49  PHE B CE1 1 
ATOM   2319  C  CE2 . PHE B  1 40  ? 1.986    71.803  -5.518  1.00 20.19 ? 49  PHE B CE2 1 
ATOM   2320  C  CZ  . PHE B  1 40  ? 1.672    72.659  -4.468  1.00 20.95 ? 49  PHE B CZ  1 
ATOM   2321  N  N   . VAL B  1 41  ? -3.749   72.915  -8.946  1.00 20.77 ? 50  VAL B N   1 
ATOM   2322  C  CA  . VAL B  1 41  ? -4.600   73.434  -9.982  1.00 20.89 ? 50  VAL B CA  1 
ATOM   2323  C  C   . VAL B  1 41  ? -4.633   74.930  -9.906  1.00 21.47 ? 50  VAL B C   1 
ATOM   2324  O  O   . VAL B  1 41  ? -4.452   75.478  -8.840  1.00 23.23 ? 50  VAL B O   1 
ATOM   2325  C  CB  . VAL B  1 41  ? -6.039   72.864  -9.953  1.00 21.71 ? 50  VAL B CB  1 
ATOM   2326  C  CG1 . VAL B  1 41  ? -5.981   71.365  -10.080 1.00 21.22 ? 50  VAL B CG1 1 
ATOM   2327  C  CG2 . VAL B  1 41  ? -6.818   73.265  -8.705  1.00 24.36 ? 50  VAL B CG2 1 
ATOM   2328  N  N   . LEU B  1 42  ? -4.836   75.583  -11.032 1.00 20.54 ? 51  LEU B N   1 
ATOM   2329  C  CA  . LEU B  1 42  ? -4.951   77.038  -11.059 1.00 22.35 ? 51  LEU B CA  1 
ATOM   2330  C  C   . LEU B  1 42  ? -6.341   77.458  -10.610 1.00 25.24 ? 51  LEU B C   1 
ATOM   2331  O  O   . LEU B  1 42  ? -7.333   76.955  -11.129 1.00 29.81 ? 51  LEU B O   1 
ATOM   2332  C  CB  . LEU B  1 42  ? -4.690   77.566  -12.445 1.00 21.31 ? 51  LEU B CB  1 
ATOM   2333  C  CG  . LEU B  1 42  ? -4.560   79.071  -12.483 1.00 22.95 ? 51  LEU B CG  1 
ATOM   2334  C  CD1 . LEU B  1 42  ? -3.263   79.521  -11.825 1.00 22.23 ? 51  LEU B CD1 1 
ATOM   2335  C  CD2 . LEU B  1 42  ? -4.650   79.590  -13.917 1.00 25.24 ? 51  LEU B CD2 1 
ATOM   2336  N  N   . SER B  1 43  ? -6.416   78.320  -9.602  1.00 25.15 ? 52  SER B N   1 
ATOM   2337  C  CA  . SER B  1 43  ? -7.684   78.691  -8.972  1.00 23.01 ? 52  SER B CA  1 
ATOM   2338  C  C   . SER B  1 43  ? -7.578   79.951  -8.128  1.00 22.24 ? 52  SER B C   1 
ATOM   2339  O  O   . SER B  1 43  ? -6.544   80.191  -7.486  1.00 24.15 ? 52  SER B O   1 
ATOM   2340  C  CB  . SER B  1 43  ? -8.180   77.563  -8.058  1.00 24.64 ? 52  SER B CB  1 
ATOM   2341  O  OG  . SER B  1 43  ? -9.514   77.814  -7.591  1.00 24.18 ? 52  SER B OG  1 
ATOM   2342  N  N   . SER B  1 44  ? -8.659   80.731  -8.108  1.00 20.45 ? 53  SER B N   1 
ATOM   2343  C  CA  . SER B  1 44  ? -8.814   81.835  -7.151  1.00 20.23 ? 53  SER B CA  1 
ATOM   2344  C  C   . SER B  1 44  ? -9.776   81.478  -5.997  1.00 19.85 ? 53  SER B C   1 
ATOM   2345  O  O   . SER B  1 44  ? -10.056  82.306  -5.159  1.00 20.94 ? 53  SER B O   1 
ATOM   2346  C  CB  . SER B  1 44  ? -9.218   83.145  -7.821  1.00 19.39 ? 53  SER B CB  1 
ATOM   2347  O  OG  . SER B  1 44  ? -10.301  83.013  -8.711  1.00 20.00 ? 53  SER B OG  1 
ATOM   2348  N  N   . GLY B  1 45  ? -10.243  80.239  -5.962  1.00 19.28 ? 54  GLY B N   1 
ATOM   2349  C  CA  . GLY B  1 45  ? -11.098  79.727  -4.883  1.00 20.42 ? 54  GLY B CA  1 
ATOM   2350  C  C   . GLY B  1 45  ? -12.495  80.313  -4.838  1.00 20.85 ? 54  GLY B C   1 
ATOM   2351  O  O   . GLY B  1 45  ? -12.928  80.994  -5.757  1.00 20.17 ? 54  GLY B O   1 
ATOM   2352  N  N   . LYS B  1 46  ? -13.169  80.111  -3.713  1.00 23.43 ? 55  LYS B N   1 
ATOM   2353  C  CA  . LYS B  1 46  ? -14.578  80.567  -3.550  1.00 25.46 ? 55  LYS B CA  1 
ATOM   2354  C  C   . LYS B  1 46  ? -14.760  82.043  -3.325  1.00 20.82 ? 55  LYS B C   1 
ATOM   2355  O  O   . LYS B  1 46  ? -15.778  82.604  -3.653  1.00 19.89 ? 55  LYS B O   1 
ATOM   2356  C  CB  . LYS B  1 46  ? -15.236  79.904  -2.352  1.00 30.96 ? 55  LYS B CB  1 
ATOM   2357  C  CG  . LYS B  1 46  ? -15.772  78.524  -2.627  1.00 38.16 ? 55  LYS B CG  1 
ATOM   2358  C  CD  . LYS B  1 46  ? -17.086  78.342  -1.909  1.00 44.32 ? 55  LYS B CD  1 
ATOM   2359  C  CE  . LYS B  1 46  ? -17.544  76.920  -1.781  1.00 46.69 ? 55  LYS B CE  1 
ATOM   2360  N  NZ  . LYS B  1 46  ? -16.855  76.089  -2.778  1.00 48.89 ? 55  LYS B NZ  1 
ATOM   2361  N  N   . PHE B  1 47  ? -13.813  82.640  -2.632  1.00 19.44 ? 56  PHE B N   1 
ATOM   2362  C  CA  . PHE B  1 47  ? -13.781  84.090  -2.442  1.00 17.73 ? 56  PHE B CA  1 
ATOM   2363  C  C   . PHE B  1 47  ? -12.386  84.653  -2.723  1.00 17.73 ? 56  PHE B C   1 
ATOM   2364  O  O   . PHE B  1 47  ? -11.403  83.967  -2.621  1.00 16.73 ? 56  PHE B O   1 
ATOM   2365  C  CB  . PHE B  1 47  ? -14.211  84.478  -1.030  1.00 17.31 ? 56  PHE B CB  1 
ATOM   2366  C  CG  . PHE B  1 47  ? -13.340  83.917  0.041   1.00 15.75 ? 56  PHE B CG  1 
ATOM   2367  C  CD1 . PHE B  1 47  ? -13.501  82.615  0.461   1.00 15.15 ? 56  PHE B CD1 1 
ATOM   2368  C  CD2 . PHE B  1 47  ? -12.362  84.705  0.624   1.00 15.84 ? 56  PHE B CD2 1 
ATOM   2369  C  CE1 . PHE B  1 47  ? -12.692  82.076  1.433   1.00 14.73 ? 56  PHE B CE1 1 
ATOM   2370  C  CE2 . PHE B  1 47  ? -11.536  84.190  1.590   1.00 15.81 ? 56  PHE B CE2 1 
ATOM   2371  C  CZ  . PHE B  1 47  ? -11.699  82.877  2.000   1.00 15.92 ? 56  PHE B CZ  1 
ATOM   2372  N  N   . TYR B  1 48  ? -12.342  85.940  -3.032  1.00 18.11 ? 57  TYR B N   1 
ATOM   2373  C  CA  . TYR B  1 48  ? -11.158  86.569  -3.589  1.00 17.40 ? 57  TYR B CA  1 
ATOM   2374  C  C   . TYR B  1 48  ? -11.393  88.063  -3.681  1.00 17.43 ? 57  TYR B C   1 
ATOM   2375  O  O   . TYR B  1 48  ? -12.518  88.540  -3.612  1.00 16.90 ? 57  TYR B O   1 
ATOM   2376  C  CB  . TYR B  1 48  ? -10.870  86.035  -4.998  1.00 17.91 ? 57  TYR B CB  1 
ATOM   2377  C  CG  . TYR B  1 48  ? -12.133  85.841  -5.843  1.00 18.71 ? 57  TYR B CG  1 
ATOM   2378  C  CD1 . TYR B  1 48  ? -12.827  86.932  -6.359  1.00 19.75 ? 57  TYR B CD1 1 
ATOM   2379  C  CD2 . TYR B  1 48  ? -12.656  84.575  -6.059  1.00 19.21 ? 57  TYR B CD2 1 
ATOM   2380  C  CE1 . TYR B  1 48  ? -13.976  86.740  -7.097  1.00 19.87 ? 57  TYR B CE1 1 
ATOM   2381  C  CE2 . TYR B  1 48  ? -13.821  84.378  -6.772  1.00 19.09 ? 57  TYR B CE2 1 
ATOM   2382  C  CZ  . TYR B  1 48  ? -14.459  85.449  -7.283  1.00 18.46 ? 57  TYR B CZ  1 
ATOM   2383  O  OH  . TYR B  1 48  ? -15.582  85.253  -7.991  1.00 20.82 ? 57  TYR B OH  1 
ATOM   2384  N  N   . GLY B  1 49  ? -10.315  88.801  -3.855  1.00 16.45 ? 58  GLY B N   1 
ATOM   2385  C  CA  . GLY B  1 49  ? -10.410  90.210  -4.141  1.00 16.96 ? 58  GLY B CA  1 
ATOM   2386  C  C   . GLY B  1 49  ? -10.726  90.455  -5.581  1.00 16.80 ? 58  GLY B C   1 
ATOM   2387  O  O   . GLY B  1 49  ? -11.460  91.366  -5.906  1.00 16.41 ? 58  GLY B O   1 
ATOM   2388  N  N   . ASP B  1 50  ? -10.104  89.670  -6.451  1.00 19.24 ? 59  ASP B N   1 
ATOM   2389  C  CA  . ASP B  1 50  ? -10.299  89.801  -7.895  1.00 20.99 ? 59  ASP B CA  1 
ATOM   2390  C  C   . ASP B  1 50  ? -10.174  88.435  -8.474  1.00 21.17 ? 59  ASP B C   1 
ATOM   2391  O  O   . ASP B  1 50  ? -9.159   87.783  -8.291  1.00 23.42 ? 59  ASP B O   1 
ATOM   2392  C  CB  . ASP B  1 50  ? -9.259   90.721  -8.534  1.00 22.58 ? 59  ASP B CB  1 
ATOM   2393  C  CG  . ASP B  1 50  ? -9.450   90.864  -10.051 1.00 23.48 ? 59  ASP B CG  1 
ATOM   2394  O  OD1 . ASP B  1 50  ? -9.064   90.002  -10.894 1.00 23.94 ? 59  ASP B OD1 1 
ATOM   2395  O  OD2 . ASP B  1 50  ? -9.975   91.903  -10.397 1.00 26.65 ? 59  ASP B OD2 1 
ATOM   2396  N  N   . GLU B  1 51  ? -11.201  88.002  -9.190  1.00 23.19 ? 60  GLU B N   1 
ATOM   2397  C  CA  . GLU B  1 51  ? -11.280  86.619  -9.655  1.00 23.73 ? 60  GLU B CA  1 
ATOM   2398  C  C   . GLU B  1 51  ? -10.074  86.179  -10.474 1.00 23.29 ? 60  GLU B C   1 
ATOM   2399  O  O   . GLU B  1 51  ? -9.670   85.013  -10.413 1.00 21.16 ? 60  GLU B O   1 
ATOM   2400  C  CB  . GLU B  1 51  ? -12.565  86.379  -10.475 1.00 27.08 ? 60  GLU B CB  1 
ATOM   2401  C  CG  . GLU B  1 51  ? -12.884  84.889  -10.698 1.00 28.43 ? 60  GLU B CG  1 
ATOM   2402  C  CD  . GLU B  1 51  ? -14.206  84.621  -11.429 1.00 30.78 ? 60  GLU B CD  1 
ATOM   2403  O  OE1 . GLU B  1 51  ? -14.895  85.591  -11.809 1.00 32.65 ? 60  GLU B OE1 1 
ATOM   2404  O  OE2 . GLU B  1 51  ? -14.589  83.438  -11.563 1.00 31.27 ? 60  GLU B OE2 1 
ATOM   2405  N  N   . GLU B  1 52  ? -9.542   87.103  -11.269 1.00 25.03 ? 61  GLU B N   1 
ATOM   2406  C  CA  . GLU B  1 52  ? -8.395   86.822  -12.156 1.00 26.98 ? 61  GLU B CA  1 
ATOM   2407  C  C   . GLU B  1 52  ? -7.035   87.040  -11.460 1.00 24.28 ? 61  GLU B C   1 
ATOM   2408  O  O   . GLU B  1 52  ? -6.183   86.160  -11.482 1.00 21.78 ? 61  GLU B O   1 
ATOM   2409  C  CB  . GLU B  1 52  ? -8.468   87.668  -13.456 1.00 30.62 ? 61  GLU B CB  1 
ATOM   2410  C  CG  . GLU B  1 52  ? -9.614   87.270  -14.390 1.00 36.15 ? 61  GLU B CG  1 
ATOM   2411  C  CD  . GLU B  1 52  ? -9.861   85.743  -14.507 1.00 43.44 ? 61  GLU B CD  1 
ATOM   2412  O  OE1 . GLU B  1 52  ? -8.911   84.931  -14.707 1.00 43.28 ? 61  GLU B OE1 1 
ATOM   2413  O  OE2 . GLU B  1 52  ? -11.056  85.339  -14.439 1.00 53.00 ? 61  GLU B OE2 1 
ATOM   2414  N  N   . LYS B  1 53  ? -6.846   88.200  -10.834 1.00 21.67 ? 62  LYS B N   1 
ATOM   2415  C  CA  . LYS B  1 53  ? -5.552   88.504  -10.195 1.00 21.32 ? 62  LYS B CA  1 
ATOM   2416  C  C   . LYS B  1 53  ? -5.187   87.469  -9.135  1.00 20.34 ? 62  LYS B C   1 
ATOM   2417  O  O   . LYS B  1 53  ? -4.039   87.038  -9.040  1.00 17.80 ? 62  LYS B O   1 
ATOM   2418  C  CB  . LYS B  1 53  ? -5.571   89.877  -9.567  1.00 21.77 ? 62  LYS B CB  1 
ATOM   2419  C  CG  . LYS B  1 53  ? -5.632   91.004  -10.561 1.00 22.37 ? 62  LYS B CG  1 
ATOM   2420  C  CD  . LYS B  1 53  ? -5.655   92.318  -9.819  1.00 23.76 ? 62  LYS B CD  1 
ATOM   2421  C  CE  . LYS B  1 53  ? -5.939   93.438  -10.768 1.00 24.68 ? 62  LYS B CE  1 
ATOM   2422  N  NZ  . LYS B  1 53  ? -6.219   94.647  -9.935  1.00 25.60 ? 62  LYS B NZ  1 
ATOM   2423  N  N   . ASP B  1 54  ? -6.206   87.010  -8.398  1.00 20.25 ? 63  ASP B N   1 
ATOM   2424  C  CA  . ASP B  1 54  ? -5.979   86.148  -7.227  1.00 18.82 ? 63  ASP B CA  1 
ATOM   2425  C  C   . ASP B  1 54  ? -5.954   84.685  -7.552  1.00 18.52 ? 63  ASP B C   1 
ATOM   2426  O  O   . ASP B  1 54  ? -5.937   83.826  -6.673  1.00 19.54 ? 63  ASP B O   1 
ATOM   2427  C  CB  . ASP B  1 54  ? -6.971   86.493  -6.128  1.00 19.95 ? 63  ASP B CB  1 
ATOM   2428  C  CG  . ASP B  1 54  ? -6.729   87.898  -5.562  1.00 21.56 ? 63  ASP B CG  1 
ATOM   2429  O  OD1 . ASP B  1 54  ? -5.520   88.195  -5.262  1.00 21.79 ? 63  ASP B OD1 1 
ATOM   2430  O  OD2 . ASP B  1 54  ? -7.712   88.707  -5.436  1.00 19.64 ? 63  ASP B OD2 1 
ATOM   2431  N  N   . LYS B  1 55  ? -5.846   84.367  -8.833  1.00 20.44 ? 64  LYS B N   1 
ATOM   2432  C  CA  . LYS B  1 55  ? -5.477   83.009  -9.210  1.00 20.34 ? 64  LYS B CA  1 
ATOM   2433  C  C   . LYS B  1 55  ? -4.065   82.660  -8.787  1.00 18.08 ? 64  LYS B C   1 
ATOM   2434  O  O   . LYS B  1 55  ? -3.108   83.426  -8.986  1.00 17.48 ? 64  LYS B O   1 
ATOM   2435  C  CB  . LYS B  1 55  ? -5.590   82.808  -10.712 1.00 24.46 ? 64  LYS B CB  1 
ATOM   2436  C  CG  . LYS B  1 55  ? -6.980   83.012  -11.271 1.00 27.85 ? 64  LYS B CG  1 
ATOM   2437  C  CD  . LYS B  1 55  ? -7.335   81.933  -12.286 1.00 29.19 ? 64  LYS B CD  1 
ATOM   2438  C  CE  . LYS B  1 55  ? -8.758   82.116  -12.786 1.00 30.39 ? 64  LYS B CE  1 
ATOM   2439  N  NZ  . LYS B  1 55  ? -8.912   82.635  -14.160 1.00 30.91 ? 64  LYS B NZ  1 
ATOM   2440  N  N   . GLY B  1 56  ? -3.926   81.463  -8.256  1.00 17.19 ? 65  GLY B N   1 
ATOM   2441  C  CA  . GLY B  1 56  ? -2.638   80.913  -7.885  1.00 16.44 ? 65  GLY B CA  1 
ATOM   2442  C  C   . GLY B  1 56  ? -2.688   79.400  -7.866  1.00 16.78 ? 65  GLY B C   1 
ATOM   2443  O  O   . GLY B  1 56  ? -3.633   78.793  -8.306  1.00 16.28 ? 65  GLY B O   1 
ATOM   2444  N  N   . LEU B  1 57  ? -1.669   78.780  -7.339  1.00 18.66 ? 66  LEU B N   1 
ATOM   2445  C  CA  . LEU B  1 57  ? -1.610   77.329  -7.316  1.00 20.00 ? 66  LEU B CA  1 
ATOM   2446  C  C   . LEU B  1 57  ? -2.273   76.819  -6.098  1.00 20.51 ? 66  LEU B C   1 
ATOM   2447  O  O   . LEU B  1 57  ? -1.917   77.173  -4.987  1.00 21.70 ? 66  LEU B O   1 
ATOM   2448  C  CB  . LEU B  1 57  ? -0.183   76.834  -7.293  1.00 20.85 ? 66  LEU B CB  1 
ATOM   2449  C  CG  . LEU B  1 57  ? 0.661    77.201  -8.500  1.00 22.76 ? 66  LEU B CG  1 
ATOM   2450  C  CD1 . LEU B  1 57  ? 2.144    76.949  -8.201  1.00 24.60 ? 66  LEU B CD1 1 
ATOM   2451  C  CD2 . LEU B  1 57  ? 0.215    76.383  -9.692  1.00 24.22 ? 66  LEU B CD2 1 
ATOM   2452  N  N   . GLN B  1 58  ? -3.250   75.955  -6.311  1.00 22.12 ? 67  GLN B N   1 
ATOM   2453  C  CA  . GLN B  1 58  ? -4.069   75.440  -5.234  1.00 21.11 ? 67  GLN B CA  1 
ATOM   2454  C  C   . GLN B  1 58  ? -3.865   73.959  -5.083  1.00 19.31 ? 67  GLN B C   1 
ATOM   2455  O  O   . GLN B  1 58  ? -3.987   73.226  -6.044  1.00 20.83 ? 67  GLN B O   1 
ATOM   2456  C  CB  . GLN B  1 58  ? -5.557   75.744  -5.500  1.00 22.49 ? 67  GLN B CB  1 
ATOM   2457  C  CG  . GLN B  1 58  ? -6.503   75.248  -4.373  1.00 25.56 ? 67  GLN B CG  1 
ATOM   2458  C  CD  . GLN B  1 58  ? -7.957   75.571  -4.622  1.00 28.90 ? 67  GLN B CD  1 
ATOM   2459  O  OE1 . GLN B  1 58  ? -8.481   75.343  -5.698  1.00 33.20 ? 67  GLN B OE1 1 
ATOM   2460  N  NE2 . GLN B  1 58  ? -8.601   76.151  -3.630  1.00 32.51 ? 67  GLN B NE2 1 
ATOM   2461  N  N   . THR B  1 59  ? -3.590   73.511  -3.876  1.00 18.32 ? 68  THR B N   1 
ATOM   2462  C  CA  . THR B  1 59  ? -3.580   72.112  -3.587  1.00 19.21 ? 68  THR B CA  1 
ATOM   2463  C  C   . THR B  1 59  ? -5.029   71.542  -3.734  1.00 23.69 ? 68  THR B C   1 
ATOM   2464  O  O   . THR B  1 59  ? -5.980   72.067  -3.150  1.00 24.47 ? 68  THR B O   1 
ATOM   2465  C  CB  . THR B  1 59  ? -3.054   71.798  -2.176  1.00 18.95 ? 68  THR B CB  1 
ATOM   2466  O  OG1 . THR B  1 59  ? -3.800   72.521  -1.200  1.00 18.17 ? 68  THR B OG1 1 
ATOM   2467  C  CG2 . THR B  1 59  ? -1.590   72.161  -2.058  1.00 19.32 ? 68  THR B CG2 1 
ATOM   2468  N  N   . SER B  1 60  ? -5.163   70.454  -4.496  1.00 23.81 ? 69  SER B N   1 
ATOM   2469  C  CA  . SER B  1 60  ? -6.473   69.921  -4.914  1.00 23.03 ? 69  SER B CA  1 
ATOM   2470  C  C   . SER B  1 60  ? -6.849   68.576  -4.323  1.00 21.05 ? 69  SER B C   1 
ATOM   2471  O  O   . SER B  1 60  ? -7.932   68.113  -4.583  1.00 23.88 ? 69  SER B O   1 
ATOM   2472  C  CB  . SER B  1 60  ? -6.532   69.794  -6.445  1.00 22.41 ? 69  SER B CB  1 
ATOM   2473  O  OG  . SER B  1 60  ? -5.881   68.599  -6.820  1.00 23.08 ? 69  SER B OG  1 
ATOM   2474  N  N   . GLN B  1 61  ? -5.996   67.975  -3.522  1.00 20.38 ? 70  GLN B N   1 
ATOM   2475  C  CA  . GLN B  1 61  ? -6.288   66.694  -2.939  1.00 21.80 ? 70  GLN B CA  1 
ATOM   2476  C  C   . GLN B  1 61  ? -5.868   66.574  -1.510  1.00 23.63 ? 70  GLN B C   1 
ATOM   2477  O  O   . GLN B  1 61  ? -4.743   66.945  -1.122  1.00 23.55 ? 70  GLN B O   1 
ATOM   2478  C  CB  . GLN B  1 61  ? -5.562   65.567  -3.718  1.00 23.24 ? 70  GLN B CB  1 
ATOM   2479  C  CG  . GLN B  1 61  ? -5.938   65.490  -5.197  1.00 24.93 ? 70  GLN B CG  1 
ATOM   2480  C  CD  . GLN B  1 61  ? -5.090   64.475  -5.967  1.00 28.43 ? 70  GLN B CD  1 
ATOM   2481  O  OE1 . GLN B  1 61  ? -5.185   63.248  -5.761  1.00 29.17 ? 70  GLN B OE1 1 
ATOM   2482  N  NE2 . GLN B  1 61  ? -4.256   64.990  -6.862  1.00 27.25 ? 70  GLN B NE2 1 
ATOM   2483  N  N   . LYS B  1 62  ? -6.690   65.855  -0.763  1.00 24.93 ? 71  LYS B N   1 
ATOM   2484  C  CA  . LYS B  1 62  ? -6.505   65.659  0.645   1.00 25.23 ? 71  LYS B CA  1 
ATOM   2485  C  C   . LYS B  1 62  ? -5.479   64.583  0.978   1.00 26.00 ? 71  LYS B C   1 
ATOM   2486  O  O   . LYS B  1 62  ? -5.350   63.605  0.261   1.00 26.08 ? 71  LYS B O   1 
ATOM   2487  C  CB  . LYS B  1 62  ? -7.860   65.340  1.269   1.00 29.40 ? 71  LYS B CB  1 
ATOM   2488  C  CG  . LYS B  1 62  ? -7.818   65.120  2.762   1.00 34.79 ? 71  LYS B CG  1 
ATOM   2489  C  CD  . LYS B  1 62  ? -9.198   65.119  3.403   1.00 40.45 ? 71  LYS B CD  1 
ATOM   2490  C  CE  . LYS B  1 62  ? -9.072   64.865  4.900   1.00 37.51 ? 71  LYS B CE  1 
ATOM   2491  N  NZ  . LYS B  1 62  ? -10.337  64.434  5.514   1.00 43.15 ? 71  LYS B NZ  1 
ATOM   2492  N  N   . ALA B  1 63  ? -4.760   64.776  2.080   1.00 23.95 ? 72  ALA B N   1 
ATOM   2493  C  CA  . ALA B  1 63  ? -3.774   63.823  2.577   1.00 25.99 ? 72  ALA B CA  1 
ATOM   2494  C  C   . ALA B  1 63  ? -2.801   63.395  1.479   1.00 27.73 ? 72  ALA B C   1 
ATOM   2495  O  O   . ALA B  1 63  ? -2.752   62.253  1.092   1.00 26.68 ? 72  ALA B O   1 
ATOM   2496  C  CB  . ALA B  1 63  ? -4.440   62.622  3.201   1.00 25.56 ? 72  ALA B CB  1 
ATOM   2497  N  N   . ARG B  1 64  ? -2.025   64.355  0.995   1.00 29.79 ? 73  ARG B N   1 
ATOM   2498  C  CA  . ARG B  1 64  ? -1.067   64.126  -0.091  1.00 30.61 ? 73  ARG B CA  1 
ATOM   2499  C  C   . ARG B  1 64  ? 0.191    64.957  0.045   1.00 27.50 ? 73  ARG B C   1 
ATOM   2500  O  O   . ARG B  1 64  ? 0.193    66.029  0.671   1.00 29.86 ? 73  ARG B O   1 
ATOM   2501  C  CB  . ARG B  1 64  ? -1.683   64.468  -1.454  1.00 33.34 ? 73  ARG B CB  1 
ATOM   2502  C  CG  . ARG B  1 64  ? -2.812   63.547  -1.855  1.00 38.36 ? 73  ARG B CG  1 
ATOM   2503  C  CD  . ARG B  1 64  ? -2.276   62.166  -2.217  1.00 40.02 ? 73  ARG B CD  1 
ATOM   2504  N  NE  . ARG B  1 64  ? -3.333   61.177  -2.230  1.00 43.32 ? 73  ARG B NE  1 
ATOM   2505  C  CZ  . ARG B  1 64  ? -3.943   60.757  -3.314  1.00 48.40 ? 73  ARG B CZ  1 
ATOM   2506  N  NH1 . ARG B  1 64  ? -3.590   61.213  -4.515  1.00 50.45 ? 73  ARG B NH1 1 
ATOM   2507  N  NH2 . ARG B  1 64  ? -4.911   59.872  -3.200  1.00 50.46 ? 73  ARG B NH2 1 
ATOM   2508  N  N   . PHE B  1 65  ? 1.262    64.397  -0.497  1.00 23.17 ? 74  PHE B N   1 
ATOM   2509  C  CA  . PHE B  1 65  ? 2.486    65.089  -0.710  1.00 20.66 ? 74  PHE B CA  1 
ATOM   2510  C  C   . PHE B  1 65  ? 2.399    65.820  -2.009  1.00 20.92 ? 74  PHE B C   1 
ATOM   2511  O  O   . PHE B  1 65  ? 1.790    65.352  -2.966  1.00 19.92 ? 74  PHE B O   1 
ATOM   2512  C  CB  . PHE B  1 65  ? 3.689    64.152  -0.730  1.00 20.73 ? 74  PHE B CB  1 
ATOM   2513  C  CG  . PHE B  1 65  ? 4.027    63.592  0.620   1.00 21.30 ? 74  PHE B CG  1 
ATOM   2514  C  CD1 . PHE B  1 65  ? 4.703    64.356  1.573   1.00 21.27 ? 74  PHE B CD1 1 
ATOM   2515  C  CD2 . PHE B  1 65  ? 3.669    62.292  0.939   1.00 22.18 ? 74  PHE B CD2 1 
ATOM   2516  C  CE1 . PHE B  1 65  ? 5.026    63.821  2.808   1.00 21.53 ? 74  PHE B CE1 1 
ATOM   2517  C  CE2 . PHE B  1 65  ? 3.961    61.755  2.179   1.00 21.29 ? 74  PHE B CE2 1 
ATOM   2518  C  CZ  . PHE B  1 65  ? 4.641    62.517  3.114   1.00 22.64 ? 74  PHE B CZ  1 
ATOM   2519  N  N   . TYR B  1 66  ? 3.011    67.002  -2.036  1.00 21.00 ? 75  TYR B N   1 
ATOM   2520  C  CA  . TYR B  1 66  ? 3.061    67.825  -3.251  1.00 20.35 ? 75  TYR B CA  1 
ATOM   2521  C  C   . TYR B  1 66  ? 4.516    68.112  -3.609  1.00 19.79 ? 75  TYR B C   1 
ATOM   2522  O  O   . TYR B  1 66  ? 5.386    68.141  -2.740  1.00 19.63 ? 75  TYR B O   1 
ATOM   2523  C  CB  . TYR B  1 66  ? 2.310    69.121  -3.033  1.00 20.81 ? 75  TYR B CB  1 
ATOM   2524  C  CG  . TYR B  1 66  ? 0.825    68.910  -2.880  1.00 22.06 ? 75  TYR B CG  1 
ATOM   2525  C  CD1 . TYR B  1 66  ? 0.271    68.448  -1.682  1.00 22.30 ? 75  TYR B CD1 1 
ATOM   2526  C  CD2 . TYR B  1 66  ? -0.029   69.149  -3.954  1.00 22.42 ? 75  TYR B CD2 1 
ATOM   2527  C  CE1 . TYR B  1 66  ? -1.107   68.209  -1.568  1.00 22.57 ? 75  TYR B CE1 1 
ATOM   2528  C  CE2 . TYR B  1 66  ? -1.394   68.926  -3.844  1.00 24.00 ? 75  TYR B CE2 1 
ATOM   2529  C  CZ  . TYR B  1 66  ? -1.928   68.464  -2.646  1.00 23.68 ? 75  TYR B CZ  1 
ATOM   2530  O  OH  . TYR B  1 66  ? -3.281   68.308  -2.593  1.00 25.87 ? 75  TYR B OH  1 
ATOM   2531  N  N   . ALA B  1 67  ? 4.762    68.326  -4.894  1.00 17.68 ? 76  ALA B N   1 
ATOM   2532  C  CA  . ALA B  1 67  ? 6.090    68.514  -5.392  1.00 16.39 ? 76  ALA B CA  1 
ATOM   2533  C  C   . ALA B  1 67  ? 6.019    69.118  -6.770  1.00 16.18 ? 76  ALA B C   1 
ATOM   2534  O  O   . ALA B  1 67  ? 6.003    68.429  -7.774  1.00 17.21 ? 76  ALA B O   1 
ATOM   2535  C  CB  . ALA B  1 67  ? 6.832    67.205  -5.407  1.00 15.37 ? 76  ALA B CB  1 
ATOM   2536  N  N   . LEU B  1 68  ? 6.017    70.428  -6.802  1.00 16.72 ? 77  LEU B N   1 
ATOM   2537  C  CA  . LEU B  1 68  ? 6.016    71.202  -8.029  1.00 17.80 ? 77  LEU B CA  1 
ATOM   2538  C  C   . LEU B  1 68  ? 7.078    72.303  -7.930  1.00 17.88 ? 77  LEU B C   1 
ATOM   2539  O  O   . LEU B  1 68  ? 7.242    72.884  -6.868  1.00 18.64 ? 77  LEU B O   1 
ATOM   2540  C  CB  . LEU B  1 68  ? 4.637    71.803  -8.211  1.00 16.99 ? 77  LEU B CB  1 
ATOM   2541  C  CG  . LEU B  1 68  ? 4.393    72.547  -9.524  1.00 18.96 ? 77  LEU B CG  1 
ATOM   2542  C  CD1 . LEU B  1 68  ? 4.074    71.582  -10.669 1.00 17.73 ? 77  LEU B CD1 1 
ATOM   2543  C  CD2 . LEU B  1 68  ? 3.283    73.574  -9.383  1.00 18.55 ? 77  LEU B CD2 1 
ATOM   2544  N  N   . SER B  1 69  ? 7.768    72.610  -9.024  1.00 18.50 ? 78  SER B N   1 
ATOM   2545  C  CA  . SER B  1 69  ? 8.852    73.582  -9.009  1.00 19.32 ? 78  SER B CA  1 
ATOM   2546  C  C   . SER B  1 69  ? 9.001    74.429  -10.221 1.00 21.21 ? 78  SER B C   1 
ATOM   2547  O  O   . SER B  1 69  ? 8.654    74.005  -11.302 1.00 18.37 ? 78  SER B O   1 
ATOM   2548  C  CB  . SER B  1 69  ? 10.117   72.853  -9.087  1.00 19.78 ? 78  SER B CB  1 
ATOM   2549  O  OG  . SER B  1 69  ? 10.174   71.927  -8.131  1.00 25.28 ? 78  SER B OG  1 
ATOM   2550  N  N   . ALA B  1 70  ? 9.665    75.558  -10.028 1.00 20.25 ? 79  ALA B N   1 
ATOM   2551  C  CA  . ALA B  1 70  ? 9.959    76.468  -11.106 1.00 20.59 ? 79  ALA B CA  1 
ATOM   2552  C  C   . ALA B  1 70  ? 11.445   76.891  -11.101 1.00 21.66 ? 79  ALA B C   1 
ATOM   2553  O  O   . ALA B  1 70  ? 12.003   77.272  -10.061 1.00 21.24 ? 79  ALA B O   1 
ATOM   2554  C  CB  . ALA B  1 70  ? 9.095    77.698  -10.981 1.00 21.98 ? 79  ALA B CB  1 
ATOM   2555  N  N   . SER B  1 71  ? 12.054   76.807  -12.280 1.00 20.51 ? 80  SER B N   1 
ATOM   2556  C  CA  . SER B  1 71  ? 13.393   77.258  -12.517 1.00 20.87 ? 80  SER B CA  1 
ATOM   2557  C  C   . SER B  1 71  ? 13.469   78.664  -12.884 1.00 21.83 ? 80  SER B C   1 
ATOM   2558  O  O   . SER B  1 71  ? 12.581   79.174  -13.509 1.00 21.77 ? 80  SER B O   1 
ATOM   2559  C  CB  . SER B  1 71  ? 13.861   76.671  -13.840 1.00 22.29 ? 80  SER B CB  1 
ATOM   2560  O  OG  . SER B  1 71  ? 14.180   75.362  -13.590 1.00 27.89 ? 80  SER B OG  1 
ATOM   2561  N  N   . PHE B  1 72  ? 14.635   79.215  -12.664 1.00 21.45 ? 81  PHE B N   1 
ATOM   2562  C  CA  . PHE B  1 72  ? 14.936   80.535  -13.111 1.00 20.64 ? 81  PHE B CA  1 
ATOM   2563  C  C   . PHE B  1 72  ? 16.432   80.578  -13.392 1.00 21.41 ? 81  PHE B C   1 
ATOM   2564  O  O   . PHE B  1 72  ? 17.196   79.709  -12.972 1.00 19.05 ? 81  PHE B O   1 
ATOM   2565  C  CB  . PHE B  1 72  ? 14.517   81.562  -12.044 1.00 20.20 ? 81  PHE B CB  1 
ATOM   2566  C  CG  . PHE B  1 72  ? 14.904   81.165  -10.624 1.00 20.86 ? 81  PHE B CG  1 
ATOM   2567  C  CD1 . PHE B  1 72  ? 16.191   81.402  -10.137 1.00 19.78 ? 81  PHE B CD1 1 
ATOM   2568  C  CD2 . PHE B  1 72  ? 13.982   80.569  -9.778  1.00 18.46 ? 81  PHE B CD2 1 
ATOM   2569  C  CE1 . PHE B  1 72  ? 16.547   81.005  -8.861  1.00 18.11 ? 81  PHE B CE1 1 
ATOM   2570  C  CE2 . PHE B  1 72  ? 14.343   80.188  -8.512  1.00 17.82 ? 81  PHE B CE2 1 
ATOM   2571  C  CZ  . PHE B  1 72  ? 15.625   80.417  -8.046  1.00 17.76 ? 81  PHE B CZ  1 
ATOM   2572  N  N   . GLU B  1 73  ? 16.832   81.606  -14.125 1.00 24.83 ? 82  GLU B N   1 
ATOM   2573  C  CA  . GLU B  1 73  ? 18.245   81.899  -14.365 1.00 27.92 ? 82  GLU B CA  1 
ATOM   2574  C  C   . GLU B  1 73  ? 19.000   81.885  -13.022 1.00 26.34 ? 82  GLU B C   1 
ATOM   2575  O  O   . GLU B  1 73  ? 18.719   82.700  -12.128 1.00 25.53 ? 82  GLU B O   1 
ATOM   2576  C  CB  . GLU B  1 73  ? 18.374   83.274  -15.072 1.00 30.96 ? 82  GLU B CB  1 
ATOM   2577  C  CG  . GLU B  1 73  ? 19.771   83.659  -15.516 1.00 36.24 ? 82  GLU B CG  1 
ATOM   2578  C  CD  . GLU B  1 73  ? 20.418   82.678  -16.495 1.00 42.86 ? 82  GLU B CD  1 
ATOM   2579  O  OE1 . GLU B  1 73  ? 19.723   81.996  -17.289 1.00 47.51 ? 82  GLU B OE1 1 
ATOM   2580  O  OE2 . GLU B  1 73  ? 21.662   82.617  -16.498 1.00 53.80 ? 82  GLU B OE2 1 
ATOM   2581  N  N   . PRO B  1 74  ? 19.930   80.954  -12.867 1.00 24.93 ? 83  PRO B N   1 
ATOM   2582  C  CA  . PRO B  1 74  ? 20.651   80.851  -11.585 1.00 25.41 ? 83  PRO B CA  1 
ATOM   2583  C  C   . PRO B  1 74  ? 21.366   82.132  -11.130 1.00 24.89 ? 83  PRO B C   1 
ATOM   2584  O  O   . PRO B  1 74  ? 21.725   82.987  -11.935 1.00 23.49 ? 83  PRO B O   1 
ATOM   2585  C  CB  . PRO B  1 74  ? 21.686   79.742  -11.829 1.00 24.90 ? 83  PRO B CB  1 
ATOM   2586  C  CG  . PRO B  1 74  ? 21.140   78.956  -12.962 1.00 25.25 ? 83  PRO B CG  1 
ATOM   2587  C  CD  . PRO B  1 74  ? 20.311   79.896  -13.805 1.00 24.98 ? 83  PRO B CD  1 
ATOM   2588  N  N   . PHE B  1 75  ? 21.511   82.265  -9.821  1.00 23.65 ? 84  PHE B N   1 
ATOM   2589  C  CA  . PHE B  1 75  ? 22.170   83.396  -9.243  1.00 21.78 ? 84  PHE B CA  1 
ATOM   2590  C  C   . PHE B  1 75  ? 22.764   82.982  -7.903  1.00 20.09 ? 84  PHE B C   1 
ATOM   2591  O  O   . PHE B  1 75  ? 22.440   81.945  -7.355  1.00 18.85 ? 84  PHE B O   1 
ATOM   2592  C  CB  . PHE B  1 75  ? 21.197   84.602  -9.112  1.00 22.45 ? 84  PHE B CB  1 
ATOM   2593  C  CG  . PHE B  1 75  ? 20.240   84.497  -7.944  1.00 23.15 ? 84  PHE B CG  1 
ATOM   2594  C  CD1 . PHE B  1 75  ? 19.065   83.781  -8.048  1.00 22.46 ? 84  PHE B CD1 1 
ATOM   2595  C  CD2 . PHE B  1 75  ? 20.538   85.117  -6.716  1.00 22.22 ? 84  PHE B CD2 1 
ATOM   2596  C  CE1 . PHE B  1 75  ? 18.210   83.664  -6.954  1.00 20.96 ? 84  PHE B CE1 1 
ATOM   2597  C  CE2 . PHE B  1 75  ? 19.684   85.002  -5.628  1.00 22.01 ? 84  PHE B CE2 1 
ATOM   2598  C  CZ  . PHE B  1 75  ? 18.515   84.266  -5.751  1.00 20.72 ? 84  PHE B CZ  1 
ATOM   2599  N  N   . SER B  1 76  ? 23.623   83.844  -7.390  1.00 19.99 ? 85  SER B N   1 
ATOM   2600  C  CA  . SER B  1 76  ? 24.185   83.724  -6.059  1.00 18.45 ? 85  SER B CA  1 
ATOM   2601  C  C   . SER B  1 76  ? 23.830   84.986  -5.264  1.00 16.94 ? 85  SER B C   1 
ATOM   2602  O  O   . SER B  1 76  ? 23.735   86.073  -5.832  1.00 16.98 ? 85  SER B O   1 
ATOM   2603  C  CB  . SER B  1 76  ? 25.704   83.610  -6.155  1.00 19.44 ? 85  SER B CB  1 
ATOM   2604  O  OG  . SER B  1 76  ? 26.281   83.520  -4.861  1.00 19.80 ? 85  SER B OG  1 
ATOM   2605  N  N   . ASN B  1 77  ? 23.616   84.843  -3.960  1.00 16.34 ? 86  ASN B N   1 
ATOM   2606  C  CA  . ASN B  1 77  ? 23.336   85.998  -3.097  1.00 17.40 ? 86  ASN B CA  1 
ATOM   2607  C  C   . ASN B  1 77  ? 24.616   86.590  -2.461  1.00 18.24 ? 86  ASN B C   1 
ATOM   2608  O  O   . ASN B  1 77  ? 24.550   87.501  -1.611  1.00 17.28 ? 86  ASN B O   1 
ATOM   2609  C  CB  . ASN B  1 77  ? 22.318   85.663  -2.012  1.00 16.79 ? 86  ASN B CB  1 
ATOM   2610  C  CG  . ASN B  1 77  ? 22.788   84.574  -1.106  1.00 16.16 ? 86  ASN B CG  1 
ATOM   2611  O  OD1 . ASN B  1 77  ? 23.411   83.649  -1.555  1.00 16.38 ? 86  ASN B OD1 1 
ATOM   2612  N  ND2 . ASN B  1 77  ? 22.421   84.644  0.193   1.00 17.85 ? 86  ASN B ND2 1 
ATOM   2613  N  N   . LYS B  1 78  ? 25.755   85.996  -2.819  1.00 19.61 ? 87  LYS B N   1 
ATOM   2614  C  CA  . LYS B  1 78  ? 27.048   86.393  -2.278  1.00 21.34 ? 87  LYS B CA  1 
ATOM   2615  C  C   . LYS B  1 78  ? 27.264   87.881  -2.421  1.00 18.62 ? 87  LYS B C   1 
ATOM   2616  O  O   . LYS B  1 78  ? 27.116   88.430  -3.488  1.00 17.50 ? 87  LYS B O   1 
ATOM   2617  C  CB  . LYS B  1 78  ? 28.161   85.578  -2.911  1.00 24.99 ? 87  LYS B CB  1 
ATOM   2618  C  CG  . LYS B  1 78  ? 29.572   85.901  -2.361  1.00 30.57 ? 87  LYS B CG  1 
ATOM   2619  C  CD  . LYS B  1 78  ? 29.863   85.262  -0.968  1.00 37.19 ? 87  LYS B CD  1 
ATOM   2620  C  CE  . LYS B  1 78  ? 31.281   84.665  -0.809  1.00 38.36 ? 87  LYS B CE  1 
ATOM   2621  N  NZ  . LYS B  1 78  ? 32.279   85.199  -1.780  1.00 40.00 ? 87  LYS B NZ  1 
ATOM   2622  N  N   . GLY B  1 79  ? 27.546   88.553  -1.311  1.00 16.65 ? 88  GLY B N   1 
ATOM   2623  C  CA  . GLY B  1 79  ? 27.731   89.991  -1.351  1.00 15.91 ? 88  GLY B CA  1 
ATOM   2624  C  C   . GLY B  1 79  ? 26.465   90.836  -1.505  1.00 16.31 ? 88  GLY B C   1 
ATOM   2625  O  O   . GLY B  1 79  ? 26.537   92.067  -1.604  1.00 14.66 ? 88  GLY B O   1 
ATOM   2626  N  N   . GLN B  1 80  ? 25.305   90.186  -1.426  1.00 16.90 ? 89  GLN B N   1 
ATOM   2627  C  CA  . GLN B  1 80  ? 23.994   90.820  -1.662  1.00 17.65 ? 89  GLN B CA  1 
ATOM   2628  C  C   . GLN B  1 80  ? 22.899   90.462  -0.666  1.00 15.41 ? 89  GLN B C   1 
ATOM   2629  O  O   . GLN B  1 80  ? 22.956   89.455  0.018   1.00 13.65 ? 89  GLN B O   1 
ATOM   2630  C  CB  . GLN B  1 80  ? 23.459   90.380  -3.032  1.00 20.68 ? 89  GLN B CB  1 
ATOM   2631  C  CG  . GLN B  1 80  ? 23.965   91.184  -4.177  1.00 25.15 ? 89  GLN B CG  1 
ATOM   2632  C  CD  . GLN B  1 80  ? 23.324   90.829  -5.513  1.00 28.53 ? 89  GLN B CD  1 
ATOM   2633  O  OE1 . GLN B  1 80  ? 22.793   91.701  -6.181  1.00 30.21 ? 89  GLN B OE1 1 
ATOM   2634  N  NE2 . GLN B  1 80  ? 23.335   89.550  -5.875  1.00 31.77 ? 89  GLN B NE2 1 
ATOM   2635  N  N   . THR B  1 81  ? 21.876   91.310  -0.647  1.00 15.26 ? 90  THR B N   1 
ATOM   2636  C  CA  . THR B  1 81  ? 20.615   90.986  0.028   1.00 14.65 ? 90  THR B CA  1 
ATOM   2637  C  C   . THR B  1 81  ? 19.792   90.000  -0.825  1.00 14.27 ? 90  THR B C   1 
ATOM   2638  O  O   . THR B  1 81  ? 19.762   90.072  -2.052  1.00 14.00 ? 90  THR B O   1 
ATOM   2639  C  CB  . THR B  1 81  ? 19.811   92.241  0.334   1.00 15.93 ? 90  THR B CB  1 
ATOM   2640  O  OG1 . THR B  1 81  ? 20.523   93.056  1.265   1.00 14.71 ? 90  THR B OG1 1 
ATOM   2641  C  CG2 . THR B  1 81  ? 18.474   91.874  1.012   1.00 15.95 ? 90  THR B CG2 1 
ATOM   2642  N  N   . LEU B  1 82  ? 19.242   89.010  -0.147  1.00 14.43 ? 91  LEU B N   1 
ATOM   2643  C  CA  . LEU B  1 82  ? 18.292   88.067  -0.721  1.00 13.72 ? 91  LEU B CA  1 
ATOM   2644  C  C   . LEU B  1 82  ? 16.949   88.226  -0.054  1.00 13.86 ? 91  LEU B C   1 
ATOM   2645  O  O   . LEU B  1 82  ? 16.831   88.151  1.153   1.00 13.81 ? 91  LEU B O   1 
ATOM   2646  C  CB  . LEU B  1 82  ? 18.740   86.632  -0.518  1.00 14.68 ? 91  LEU B CB  1 
ATOM   2647  C  CG  . LEU B  1 82  ? 17.758   85.575  -1.013  1.00 15.82 ? 91  LEU B CG  1 
ATOM   2648  C  CD1 . LEU B  1 82  ? 17.570   85.636  -2.527  1.00 16.05 ? 91  LEU B CD1 1 
ATOM   2649  C  CD2 . LEU B  1 82  ? 18.185   84.193  -0.614  1.00 16.15 ? 91  LEU B CD2 1 
ATOM   2650  N  N   . VAL B  1 83  ? 15.938   88.453  -0.869  1.00 14.37 ? 92  VAL B N   1 
ATOM   2651  C  CA  . VAL B  1 83  ? 14.561   88.525  -0.426  1.00 14.74 ? 92  VAL B CA  1 
ATOM   2652  C  C   . VAL B  1 83  ? 13.719   87.456  -1.150  1.00 15.62 ? 92  VAL B C   1 
ATOM   2653  O  O   . VAL B  1 83  ? 13.644   87.423  -2.402  1.00 14.45 ? 92  VAL B O   1 
ATOM   2654  C  CB  . VAL B  1 83  ? 13.901   89.897  -0.698  1.00 15.70 ? 92  VAL B CB  1 
ATOM   2655  C  CG1 . VAL B  1 83  ? 12.548   89.940  -0.013  1.00 15.68 ? 92  VAL B CG1 1 
ATOM   2656  C  CG2 . VAL B  1 83  ? 14.779   91.055  -0.209  1.00 14.93 ? 92  VAL B CG2 1 
ATOM   2657  N  N   . VAL B  1 84  ? 13.059   86.634  -0.323  1.00 15.32 ? 93  VAL B N   1 
ATOM   2658  C  CA  . VAL B  1 84  ? 12.105   85.619  -0.751  1.00 15.50 ? 93  VAL B CA  1 
ATOM   2659  C  C   . VAL B  1 84  ? 10.686   85.950  -0.206  1.00 14.59 ? 93  VAL B C   1 
ATOM   2660  O  O   . VAL B  1 84  ? 10.497   86.159  0.979   1.00 12.42 ? 93  VAL B O   1 
ATOM   2661  C  CB  . VAL B  1 84  ? 12.431   84.266  -0.166  1.00 17.36 ? 93  VAL B CB  1 
ATOM   2662  C  CG1 . VAL B  1 84  ? 11.521   83.236  -0.766  1.00 17.49 ? 93  VAL B CG1 1 
ATOM   2663  C  CG2 . VAL B  1 84  ? 13.846   83.904  -0.492  1.00 19.84 ? 93  VAL B CG2 1 
ATOM   2664  N  N   . GLN B  1 85  ? 9.730    86.065  -1.110  1.00 13.15 ? 94  GLN B N   1 
ATOM   2665  C  CA  . GLN B  1 85  ? 8.409    86.551  -0.744  1.00 13.85 ? 94  GLN B CA  1 
ATOM   2666  C  C   . GLN B  1 85  ? 7.297    85.820  -1.570  1.00 13.74 ? 94  GLN B C   1 
ATOM   2667  O  O   . GLN B  1 85  ? 7.485    85.547  -2.746  1.00 13.07 ? 94  GLN B O   1 
ATOM   2668  C  CB  . GLN B  1 85  ? 8.351    88.061  -0.942  1.00 13.17 ? 94  GLN B CB  1 
ATOM   2669  C  CG  . GLN B  1 85  ? 6.993    88.689  -0.732  1.00 13.00 ? 94  GLN B CG  1 
ATOM   2670  C  CD  . GLN B  1 85  ? 7.062    90.188  -0.722  1.00 13.43 ? 94  GLN B CD  1 
ATOM   2671  O  OE1 . GLN B  1 85  ? 7.611    90.795  0.220   1.00 15.25 ? 94  GLN B OE1 1 
ATOM   2672  N  NE2 . GLN B  1 85  ? 6.498    90.814  -1.731  1.00 13.92 ? 94  GLN B NE2 1 
ATOM   2673  N  N   . PHE B  1 86  ? 6.168    85.567  -0.938  1.00 12.58 ? 95  PHE B N   1 
ATOM   2674  C  CA  . PHE B  1 86  ? 5.000    84.966  -1.613  1.00 13.14 ? 95  PHE B CA  1 
ATOM   2675  C  C   . PHE B  1 86  ? 3.742    85.089  -0.732  1.00 13.20 ? 95  PHE B C   1 
ATOM   2676  O  O   . PHE B  1 86  ? 3.846    85.452  0.468   1.00 11.15 ? 95  PHE B O   1 
ATOM   2677  C  CB  . PHE B  1 86  ? 5.251    83.498  -1.931  1.00 13.18 ? 95  PHE B CB  1 
ATOM   2678  C  CG  . PHE B  1 86  ? 5.590    82.680  -0.722  1.00 13.87 ? 95  PHE B CG  1 
ATOM   2679  C  CD1 . PHE B  1 86  ? 6.825    82.748  -0.182  1.00 14.45 ? 95  PHE B CD1 1 
ATOM   2680  C  CD2 . PHE B  1 86  ? 4.655    81.864  -0.123  1.00 14.72 ? 95  PHE B CD2 1 
ATOM   2681  C  CE1 . PHE B  1 86  ? 7.160    82.026  0.946   1.00 15.11 ? 95  PHE B CE1 1 
ATOM   2682  C  CE2 . PHE B  1 86  ? 4.972    81.124  0.984   1.00 14.33 ? 95  PHE B CE2 1 
ATOM   2683  C  CZ  . PHE B  1 86  ? 6.226    81.211  1.530   1.00 15.22 ? 95  PHE B CZ  1 
ATOM   2684  N  N   . THR B  1 87  ? 2.564    84.899  -1.349  1.00 13.46 ? 96  THR B N   1 
ATOM   2685  C  CA  . THR B  1 87  ? 1.317    84.900  -0.584  1.00 14.43 ? 96  THR B CA  1 
ATOM   2686  C  C   . THR B  1 87  ? 0.834    83.494  -0.369  1.00 15.52 ? 96  THR B C   1 
ATOM   2687  O  O   . THR B  1 87  ? 1.029    82.618  -1.208  1.00 15.15 ? 96  THR B O   1 
ATOM   2688  C  CB  . THR B  1 87  ? 0.212    85.772  -1.173  1.00 14.41 ? 96  THR B CB  1 
ATOM   2689  O  OG1 . THR B  1 87  ? -0.116   85.343  -2.490  1.00 17.12 ? 96  THR B OG1 1 
ATOM   2690  C  CG2 . THR B  1 87  ? 0.604    87.233  -1.205  1.00 13.68 ? 96  THR B CG2 1 
ATOM   2691  N  N   . VAL B  1 88  ? 0.250    83.284  0.801   1.00 16.87 ? 97  VAL B N   1 
ATOM   2692  C  CA  . VAL B  1 88  ? -0.375   81.989  1.205   1.00 17.77 ? 97  VAL B CA  1 
ATOM   2693  C  C   . VAL B  1 88  ? -1.779   82.220  1.766   1.00 18.04 ? 97  VAL B C   1 
ATOM   2694  O  O   . VAL B  1 88  ? -2.015   83.120  2.580   1.00 18.47 ? 97  VAL B O   1 
ATOM   2695  C  CB  . VAL B  1 88  ? 0.412    81.268  2.286   1.00 17.80 ? 97  VAL B CB  1 
ATOM   2696  C  CG1 . VAL B  1 88  ? -0.162   79.918  2.554   1.00 20.60 ? 97  VAL B CG1 1 
ATOM   2697  C  CG2 . VAL B  1 88  ? 1.819    81.064  1.831   1.00 19.31 ? 97  VAL B CG2 1 
ATOM   2698  N  N   . LYS B  1 89  ? -2.714   81.406  1.268   1.00 18.78 ? 98  LYS B N   1 
ATOM   2699  C  CA  . LYS B  1 89  ? -4.121   81.485  1.631   1.00 18.45 ? 98  LYS B CA  1 
ATOM   2700  C  C   . LYS B  1 89  ? -4.654   80.097  1.936   1.00 16.90 ? 98  LYS B C   1 
ATOM   2701  O  O   . LYS B  1 89  ? -4.932   79.315  1.047   1.00 14.15 ? 98  LYS B O   1 
ATOM   2702  C  CB  . LYS B  1 89  ? -4.909   82.119  0.507   1.00 18.86 ? 98  LYS B CB  1 
ATOM   2703  C  CG  . LYS B  1 89  ? -6.411   82.147  0.707   1.00 20.23 ? 98  LYS B CG  1 
ATOM   2704  C  CD  . LYS B  1 89  ? -7.013   82.855  -0.481  1.00 21.81 ? 98  LYS B CD  1 
ATOM   2705  C  CE  . LYS B  1 89  ? -8.499   82.823  -0.576  1.00 24.43 ? 98  LYS B CE  1 
ATOM   2706  N  NZ  . LYS B  1 89  ? -8.923   83.129  -1.975  1.00 28.62 ? 98  LYS B NZ  1 
ATOM   2707  N  N   . HIS B  1 90  ? -4.836   79.821  3.213   1.00 17.21 ? 99  HIS B N   1 
ATOM   2708  C  CA  . HIS B  1 90  ? -5.431   78.560  3.635   1.00 17.92 ? 99  HIS B CA  1 
ATOM   2709  C  C   . HIS B  1 90  ? -6.971   78.708  3.696   1.00 18.77 ? 99  HIS B C   1 
ATOM   2710  O  O   . HIS B  1 90  ? -7.557   78.739  4.770   1.00 17.23 ? 99  HIS B O   1 
ATOM   2711  C  CB  . HIS B  1 90  ? -4.930   78.171  4.980   1.00 18.02 ? 99  HIS B CB  1 
ATOM   2712  C  CG  . HIS B  1 90  ? -3.471   77.909  5.030   1.00 18.54 ? 99  HIS B CG  1 
ATOM   2713  N  ND1 . HIS B  1 90  ? -2.856   76.964  4.243   1.00 18.83 ? 99  HIS B ND1 1 
ATOM   2714  C  CD2 . HIS B  1 90  ? -2.505   78.428  5.824   1.00 19.21 ? 99  HIS B CD2 1 
ATOM   2715  C  CE1 . HIS B  1 90  ? -1.575   76.905  4.553   1.00 18.89 ? 99  HIS B CE1 1 
ATOM   2716  N  NE2 . HIS B  1 90  ? -1.338   77.774  5.519   1.00 20.15 ? 99  HIS B NE2 1 
ATOM   2717  N  N   . GLU B  1 91  ? -7.580   78.866  2.525   1.00 20.85 ? 100 GLU B N   1 
ATOM   2718  C  CA  . GLU B  1 91  ? -9.057   78.938  2.369   1.00 24.72 ? 100 GLU B CA  1 
ATOM   2719  C  C   . GLU B  1 91  ? -9.855   77.923  3.136   1.00 21.02 ? 100 GLU B C   1 
ATOM   2720  O  O   . GLU B  1 91  ? -10.938  78.188  3.538   1.00 25.22 ? 100 GLU B O   1 
ATOM   2721  C  CB  . GLU B  1 91  ? -9.510   78.595  0.942   1.00 28.29 ? 100 GLU B CB  1 
ATOM   2722  C  CG  . GLU B  1 91  ? -9.835   79.817  0.188   1.00 35.20 ? 100 GLU B CG  1 
ATOM   2723  C  CD  . GLU B  1 91  ? -10.656  79.632  -1.074  1.00 40.14 ? 100 GLU B CD  1 
ATOM   2724  O  OE1 . GLU B  1 91  ? -11.215  78.561  -1.345  1.00 45.13 ? 100 GLU B OE1 1 
ATOM   2725  O  OE2 . GLU B  1 91  ? -10.726  80.608  -1.818  1.00 43.91 ? 100 GLU B OE2 1 
ATOM   2726  N  N   . GLN B  1 92  ? -9.331   76.724  3.185   1.00 20.06 ? 101 GLN B N   1 
ATOM   2727  C  CA  . GLN B  1 92  ? -10.022  75.581  3.713   1.00 20.69 ? 101 GLN B CA  1 
ATOM   2728  C  C   . GLN B  1 92  ? -10.011  75.522  5.234   1.00 22.97 ? 101 GLN B C   1 
ATOM   2729  O  O   . GLN B  1 92  ? -10.514  74.545  5.809   1.00 22.99 ? 101 GLN B O   1 
ATOM   2730  C  CB  . GLN B  1 92  ? -9.358   74.313  3.220   1.00 20.28 ? 101 GLN B CB  1 
ATOM   2731  C  CG  . GLN B  1 92  ? -8.004   73.985  3.896   1.00 22.83 ? 101 GLN B CG  1 
ATOM   2732  C  CD  . GLN B  1 92  ? -6.794   74.663  3.243   1.00 21.93 ? 101 GLN B CD  1 
ATOM   2733  O  OE1 . GLN B  1 92  ? -6.859   75.824  2.846   1.00 20.35 ? 101 GLN B OE1 1 
ATOM   2734  N  NE2 . GLN B  1 92  ? -5.711   73.914  3.081   1.00 22.87 ? 101 GLN B NE2 1 
ATOM   2735  N  N   . ASN B  1 93  ? -9.447   76.528  5.905   1.00 21.70 ? 102 ASN B N   1 
ATOM   2736  C  CA  . ASN B  1 93  ? -9.237   76.429  7.363   1.00 24.46 ? 102 ASN B CA  1 
ATOM   2737  C  C   . ASN B  1 93  ? -8.455   75.172  7.713   1.00 25.61 ? 102 ASN B C   1 
ATOM   2738  O  O   . ASN B  1 93  ? -9.011   74.156  8.161   1.00 28.73 ? 102 ASN B O   1 
ATOM   2739  C  CB  . ASN B  1 93  ? -10.558  76.463  8.133   1.00 24.45 ? 102 ASN B CB  1 
ATOM   2740  C  CG  . ASN B  1 93  ? -11.170  77.871  8.149   1.00 26.93 ? 102 ASN B CG  1 
ATOM   2741  O  OD1 . ASN B  1 93  ? -10.547  78.900  8.546   1.00 27.52 ? 102 ASN B OD1 1 
ATOM   2742  N  ND2 . ASN B  1 93  ? -12.398  77.933  7.696   1.00 26.88 ? 102 ASN B ND2 1 
ATOM   2743  N  N   . ILE B  1 94  ? -7.152   75.241  7.489   1.00 24.75 ? 103 ILE B N   1 
ATOM   2744  C  CA  . ILE B  1 94  ? -6.330   74.053  7.461   1.00 24.38 ? 103 ILE B CA  1 
ATOM   2745  C  C   . ILE B  1 94  ? -6.178   73.480  8.848   1.00 24.85 ? 103 ILE B C   1 
ATOM   2746  O  O   . ILE B  1 94  ? -6.140   74.215  9.812   1.00 24.81 ? 103 ILE B O   1 
ATOM   2747  C  CB  . ILE B  1 94  ? -4.963   74.328  6.777   1.00 25.95 ? 103 ILE B CB  1 
ATOM   2748  C  CG1 . ILE B  1 94  ? -4.184   73.035  6.563   1.00 26.74 ? 103 ILE B CG1 1 
ATOM   2749  C  CG2 . ILE B  1 94  ? -4.114   75.304  7.581   1.00 25.89 ? 103 ILE B CG2 1 
ATOM   2750  C  CD1 . ILE B  1 94  ? -3.107   73.146  5.471   1.00 28.69 ? 103 ILE B CD1 1 
ATOM   2751  N  N   . ASP B  1 95  ? -6.137   72.156  8.940   1.00 24.44 ? 104 ASP B N   1 
ATOM   2752  C  CA  . ASP B  1 95  ? -5.913   71.472  10.209  1.00 25.71 ? 104 ASP B CA  1 
ATOM   2753  C  C   . ASP B  1 95  ? -4.410   71.172  10.391  1.00 25.20 ? 104 ASP B C   1 
ATOM   2754  O  O   . ASP B  1 95  ? -3.828   71.397  11.455  1.00 21.59 ? 104 ASP B O   1 
ATOM   2755  C  CB  . ASP B  1 95  ? -6.760   70.163  10.330  1.00 29.32 ? 104 ASP B CB  1 
ATOM   2756  C  CG  . ASP B  1 95  ? -6.701   69.236  9.047   1.00 35.66 ? 104 ASP B CG  1 
ATOM   2757  O  OD1 . ASP B  1 95  ? -6.007   69.547  8.037   1.00 32.66 ? 104 ASP B OD1 1 
ATOM   2758  O  OD2 . ASP B  1 95  ? -7.397   68.182  9.033   1.00 38.04 ? 104 ASP B OD2 1 
ATOM   2759  N  N   . CYS B  1 96  ? -3.816   70.636  9.331   1.00 25.51 ? 105 CYS B N   1 
ATOM   2760  C  CA  . CYS B  1 96  ? -2.431   70.229  9.340   1.00 27.03 ? 105 CYS B CA  1 
ATOM   2761  C  C   . CYS B  1 96  ? -1.905   70.230  7.922   1.00 26.10 ? 105 CYS B C   1 
ATOM   2762  O  O   . CYS B  1 96  ? -2.482   69.592  7.024   1.00 25.96 ? 105 CYS B O   1 
ATOM   2763  C  CB  . CYS B  1 96  ? -2.245   68.856  10.007  1.00 32.17 ? 105 CYS B CB  1 
ATOM   2764  S  SG  . CYS B  1 96  ? -0.527   68.303  10.090  1.00 40.15 ? 105 CYS B SG  1 
ATOM   2765  N  N   . GLY B  1 97  ? -0.832   70.995  7.710   1.00 22.91 ? 106 GLY B N   1 
ATOM   2766  C  CA  . GLY B  1 97  ? -0.207   71.119  6.402   1.00 22.52 ? 106 GLY B CA  1 
ATOM   2767  C  C   . GLY B  1 97  ? 0.742    72.299  6.276   1.00 22.16 ? 106 GLY B C   1 
ATOM   2768  O  O   . GLY B  1 97  ? 0.594    73.317  6.952   1.00 22.18 ? 106 GLY B O   1 
ATOM   2769  N  N   . GLY B  1 98  ? 1.705    72.146  5.381   1.00 20.50 ? 107 GLY B N   1 
ATOM   2770  C  CA  . GLY B  1 98  ? 2.711    73.144  5.135   1.00 20.92 ? 107 GLY B CA  1 
ATOM   2771  C  C   . GLY B  1 98  ? 2.259    74.189  4.158   1.00 20.04 ? 107 GLY B C   1 
ATOM   2772  O  O   . GLY B  1 98  ? 1.354    73.963  3.354   1.00 22.40 ? 107 GLY B O   1 
ATOM   2773  N  N   . GLY B  1 99  ? 2.890    75.360  4.256   1.00 19.76 ? 108 GLY B N   1 
ATOM   2774  C  CA  . GLY B  1 99  ? 2.668    76.464  3.327   1.00 18.85 ? 108 GLY B CA  1 
ATOM   2775  C  C   . GLY B  1 99  ? 3.970    77.162  2.975   1.00 17.92 ? 108 GLY B C   1 
ATOM   2776  O  O   . GLY B  1 99  ? 3.982    78.338  2.634   1.00 16.30 ? 108 GLY B O   1 
ATOM   2777  N  N   . TYR B  1 100 ? 5.049    76.396  2.978   1.00 17.75 ? 109 TYR B N   1 
ATOM   2778  C  CA  . TYR B  1 100 ? 6.371    76.954  2.821   1.00 19.22 ? 109 TYR B CA  1 
ATOM   2779  C  C   . TYR B  1 100 ? 7.002    76.641  1.475   1.00 19.64 ? 109 TYR B C   1 
ATOM   2780  O  O   . TYR B  1 100 ? 6.636    75.680  0.811   1.00 21.49 ? 109 TYR B O   1 
ATOM   2781  C  CB  . TYR B  1 100 ? 7.299    76.472  3.940   1.00 19.33 ? 109 TYR B CB  1 
ATOM   2782  C  CG  . TYR B  1 100 ? 7.221    75.027  4.197   1.00 19.75 ? 109 TYR B CG  1 
ATOM   2783  C  CD1 . TYR B  1 100 ? 7.855    74.124  3.368   1.00 20.64 ? 109 TYR B CD1 1 
ATOM   2784  C  CD2 . TYR B  1 100 ? 6.502    74.531  5.296   1.00 20.89 ? 109 TYR B CD2 1 
ATOM   2785  C  CE1 . TYR B  1 100 ? 7.784    72.751  3.605   1.00 19.82 ? 109 TYR B CE1 1 
ATOM   2786  C  CE2 . TYR B  1 100 ? 6.416    73.181  5.536   1.00 21.26 ? 109 TYR B CE2 1 
ATOM   2787  C  CZ  . TYR B  1 100 ? 7.058    72.293  4.676   1.00 21.50 ? 109 TYR B CZ  1 
ATOM   2788  O  OH  . TYR B  1 100 ? 6.972    70.932  4.909   1.00 23.08 ? 109 TYR B OH  1 
ATOM   2789  N  N   . VAL B  1 101 ? 7.969    77.469  1.105   1.00 17.75 ? 110 VAL B N   1 
ATOM   2790  C  CA  . VAL B  1 101 ? 8.759    77.282  -0.095  1.00 16.01 ? 110 VAL B CA  1 
ATOM   2791  C  C   . VAL B  1 101 ? 10.166   76.793  0.210   1.00 16.44 ? 110 VAL B C   1 
ATOM   2792  O  O   . VAL B  1 101 ? 10.642   76.866  1.328   1.00 17.86 ? 110 VAL B O   1 
ATOM   2793  C  CB  . VAL B  1 101 ? 8.823    78.526  -0.985  1.00 15.66 ? 110 VAL B CB  1 
ATOM   2794  C  CG1 . VAL B  1 101 ? 7.429    78.997  -1.373  1.00 15.07 ? 110 VAL B CG1 1 
ATOM   2795  C  CG2 . VAL B  1 101 ? 9.617    79.653  -0.348  1.00 16.20 ? 110 VAL B CG2 1 
ATOM   2796  N  N   . LYS B  1 102 ? 10.817   76.272  -0.816  1.00 17.39 ? 111 LYS B N   1 
ATOM   2797  C  CA  . LYS B  1 102 ? 12.211   75.898  -0.752  1.00 17.20 ? 111 LYS B CA  1 
ATOM   2798  C  C   . LYS B  1 102 ? 12.949   76.433  -1.919  1.00 17.96 ? 111 LYS B C   1 
ATOM   2799  O  O   . LYS B  1 102 ? 12.476   76.351  -3.063  1.00 16.68 ? 111 LYS B O   1 
ATOM   2800  C  CB  . LYS B  1 102 ? 12.368   74.427  -0.776  1.00 18.11 ? 111 LYS B CB  1 
ATOM   2801  C  CG  . LYS B  1 102 ? 11.746   73.760  0.402   1.00 19.61 ? 111 LYS B CG  1 
ATOM   2802  C  CD  . LYS B  1 102 ? 12.080   72.282  0.380   1.00 21.48 ? 111 LYS B CD  1 
ATOM   2803  C  CE  . LYS B  1 102 ? 11.057   71.515  1.173   1.00 21.60 ? 111 LYS B CE  1 
ATOM   2804  N  NZ  . LYS B  1 102 ? 11.709   70.474  1.970   1.00 23.62 ? 111 LYS B NZ  1 
ATOM   2805  N  N   . LEU B  1 103 ? 14.134   76.972  -1.630  1.00 19.17 ? 112 LEU B N   1 
ATOM   2806  C  CA  . LEU B  1 103 ? 15.052   77.429  -2.685  1.00 19.11 ? 112 LEU B CA  1 
ATOM   2807  C  C   . LEU B  1 103 ? 16.158   76.420  -2.817  1.00 17.58 ? 112 LEU B C   1 
ATOM   2808  O  O   . LEU B  1 103 ? 16.847   76.084  -1.827  1.00 18.18 ? 112 LEU B O   1 
ATOM   2809  C  CB  . LEU B  1 103 ? 15.667   78.770  -2.364  1.00 22.07 ? 112 LEU B CB  1 
ATOM   2810  C  CG  . LEU B  1 103 ? 14.987   80.078  -2.684  1.00 24.67 ? 112 LEU B CG  1 
ATOM   2811  C  CD1 . LEU B  1 103 ? 13.581   79.840  -2.253  1.00 28.12 ? 112 LEU B CD1 1 
ATOM   2812  C  CD2 . LEU B  1 103 ? 15.496   81.398  -2.066  1.00 24.71 ? 112 LEU B CD2 1 
ATOM   2813  N  N   . PHE B  1 104 ? 16.339   75.964  -4.045  1.00 17.30 ? 113 PHE B N   1 
ATOM   2814  C  CA  . PHE B  1 104 ? 17.259   74.859  -4.372  1.00 16.88 ? 113 PHE B CA  1 
ATOM   2815  C  C   . PHE B  1 104 ? 18.407   75.324  -5.251  1.00 17.18 ? 113 PHE B C   1 
ATOM   2816  O  O   . PHE B  1 104 ? 18.235   76.251  -6.087  1.00 18.52 ? 113 PHE B O   1 
ATOM   2817  C  CB  . PHE B  1 104 ? 16.539   73.756  -5.173  1.00 15.94 ? 113 PHE B CB  1 
ATOM   2818  C  CG  . PHE B  1 104 ? 15.560   72.945  -4.362  1.00 15.44 ? 113 PHE B CG  1 
ATOM   2819  C  CD1 . PHE B  1 104 ? 15.975   71.842  -3.658  1.00 15.19 ? 113 PHE B CD1 1 
ATOM   2820  C  CD2 . PHE B  1 104 ? 14.221   73.274  -4.363  1.00 15.82 ? 113 PHE B CD2 1 
ATOM   2821  C  CE1 . PHE B  1 104 ? 15.072   71.093  -2.938  1.00 16.53 ? 113 PHE B CE1 1 
ATOM   2822  C  CE2 . PHE B  1 104 ? 13.314   72.533  -3.642  1.00 15.99 ? 113 PHE B CE2 1 
ATOM   2823  C  CZ  . PHE B  1 104 ? 13.732   71.449  -2.922  1.00 16.20 ? 113 PHE B CZ  1 
ATOM   2824  N  N   . PRO B  1 105 ? 19.551   74.625  -5.150  1.00 17.00 ? 114 PRO B N   1 
ATOM   2825  C  CA  . PRO B  1 105 ? 20.607   74.820  -6.132  1.00 18.68 ? 114 PRO B CA  1 
ATOM   2826  C  C   . PRO B  1 105 ? 20.141   74.377  -7.500  1.00 21.36 ? 114 PRO B C   1 
ATOM   2827  O  O   . PRO B  1 105 ? 19.276   73.489  -7.600  1.00 23.09 ? 114 PRO B O   1 
ATOM   2828  C  CB  . PRO B  1 105 ? 21.747   73.890  -5.656  1.00 17.21 ? 114 PRO B CB  1 
ATOM   2829  C  CG  . PRO B  1 105 ? 21.212   73.078  -4.582  1.00 16.45 ? 114 PRO B CG  1 
ATOM   2830  C  CD  . PRO B  1 105 ? 19.870   73.593  -4.161  1.00 16.44 ? 114 PRO B CD  1 
ATOM   2831  N  N   . ASN B  1 106 ? 20.749   74.937  -8.543  1.00 23.27 ? 115 ASN B N   1 
ATOM   2832  C  CA  . ASN B  1 106 ? 20.465   74.523  -9.914  1.00 25.59 ? 115 ASN B CA  1 
ATOM   2833  C  C   . ASN B  1 106 ? 20.810   73.079  -10.247 1.00 25.19 ? 115 ASN B C   1 
ATOM   2834  O  O   . ASN B  1 106 ? 20.394   72.573  -11.268 1.00 26.67 ? 115 ASN B O   1 
ATOM   2835  C  CB  . ASN B  1 106 ? 21.182   75.401  -10.906 1.00 28.88 ? 115 ASN B CB  1 
ATOM   2836  C  CG  . ASN B  1 106 ? 20.456   75.472  -12.233 1.00 32.23 ? 115 ASN B CG  1 
ATOM   2837  O  OD1 . ASN B  1 106 ? 19.205   75.570  -12.299 1.00 35.84 ? 115 ASN B OD1 1 
ATOM   2838  N  ND2 . ASN B  1 106 ? 21.224   75.434  -13.300 1.00 32.16 ? 115 ASN B ND2 1 
ATOM   2839  N  N   . SER B  1 107 ? 21.546   72.401  -9.389  1.00 25.07 ? 116 SER B N   1 
ATOM   2840  C  CA  . SER B  1 107 ? 21.825   70.993  -9.595  1.00 27.69 ? 116 SER B CA  1 
ATOM   2841  C  C   . SER B  1 107 ? 20.631   70.070  -9.298  1.00 29.38 ? 116 SER B C   1 
ATOM   2842  O  O   . SER B  1 107 ? 20.710   68.857  -9.493  1.00 33.78 ? 116 SER B O   1 
ATOM   2843  C  CB  . SER B  1 107 ? 22.969   70.581  -8.699  1.00 27.47 ? 116 SER B CB  1 
ATOM   2844  O  OG  . SER B  1 107 ? 22.585   70.783  -7.353  1.00 28.17 ? 116 SER B OG  1 
ATOM   2845  N  N   . LEU B  1 108 ? 19.542   70.613  -8.776  1.00 29.22 ? 117 LEU B N   1 
ATOM   2846  C  CA  . LEU B  1 108 ? 18.346   69.801  -8.527  1.00 28.81 ? 117 LEU B CA  1 
ATOM   2847  C  C   . LEU B  1 108 ? 17.702   69.317  -9.835  1.00 26.50 ? 117 LEU B C   1 
ATOM   2848  O  O   . LEU B  1 108 ? 17.422   70.099  -10.745 1.00 25.92 ? 117 LEU B O   1 
ATOM   2849  C  CB  . LEU B  1 108 ? 17.298   70.590  -7.740  1.00 27.55 ? 117 LEU B CB  1 
ATOM   2850  C  CG  . LEU B  1 108 ? 15.962   69.841  -7.525  1.00 27.52 ? 117 LEU B CG  1 
ATOM   2851  C  CD1 . LEU B  1 108 ? 16.058   68.846  -6.375  1.00 25.35 ? 117 LEU B CD1 1 
ATOM   2852  C  CD2 . LEU B  1 108 ? 14.827   70.818  -7.287  1.00 26.84 ? 117 LEU B CD2 1 
ATOM   2853  N  N   . ASP B  1 109 ? 17.453   68.027  -9.903  1.00 26.13 ? 118 ASP B N   1 
ATOM   2854  C  CA  . ASP B  1 109 ? 16.599   67.449  -10.954 1.00 26.28 ? 118 ASP B CA  1 
ATOM   2855  C  C   . ASP B  1 109 ? 15.119   67.638  -10.541 1.00 24.21 ? 118 ASP B C   1 
ATOM   2856  O  O   . ASP B  1 109 ? 14.617   66.966  -9.635  1.00 19.50 ? 118 ASP B O   1 
ATOM   2857  C  CB  . ASP B  1 109 ? 16.927   65.957  -11.107 1.00 31.42 ? 118 ASP B CB  1 
ATOM   2858  C  CG  . ASP B  1 109 ? 16.067   65.252  -12.168 1.00 35.20 ? 118 ASP B CG  1 
ATOM   2859  O  OD1 . ASP B  1 109 ? 15.265   65.895  -12.891 1.00 34.89 ? 118 ASP B OD1 1 
ATOM   2860  O  OD2 . ASP B  1 109 ? 16.225   64.022  -12.283 1.00 39.40 ? 118 ASP B OD2 1 
ATOM   2861  N  N   . GLN B  1 110 ? 14.457   68.590  -11.202 1.00 24.83 ? 119 GLN B N   1 
ATOM   2862  C  CA  . GLN B  1 110 ? 13.077   68.982  -10.899 1.00 23.85 ? 119 GLN B CA  1 
ATOM   2863  C  C   . GLN B  1 110 ? 12.080   67.810  -11.028 1.00 27.63 ? 119 GLN B C   1 
ATOM   2864  O  O   . GLN B  1 110 ? 11.087   67.738  -10.277 1.00 27.93 ? 119 GLN B O   1 
ATOM   2865  C  CB  . GLN B  1 110 ? 12.614   70.082  -11.836 1.00 22.33 ? 119 GLN B CB  1 
ATOM   2866  C  CG  . GLN B  1 110 ? 13.233   71.414  -11.541 1.00 21.64 ? 119 GLN B CG  1 
ATOM   2867  C  CD  . GLN B  1 110 ? 12.691   72.507  -12.453 1.00 21.96 ? 119 GLN B CD  1 
ATOM   2868  O  OE1 . GLN B  1 110 ? 13.262   72.777  -13.498 1.00 21.65 ? 119 GLN B OE1 1 
ATOM   2869  N  NE2 . GLN B  1 110 ? 11.581   73.121  -12.074 1.00 21.68 ? 119 GLN B NE2 1 
ATOM   2870  N  N   . THR B  1 111 ? 12.366   66.879  -11.943 1.00 27.47 ? 120 THR B N   1 
ATOM   2871  C  CA  . THR B  1 111 ? 11.506   65.683  -12.123 1.00 26.91 ? 120 THR B CA  1 
ATOM   2872  C  C   . THR B  1 111 ? 11.736   64.626  -11.029 1.00 26.68 ? 120 THR B C   1 
ATOM   2873  O  O   . THR B  1 111 ? 11.040   63.628  -11.002 1.00 26.23 ? 120 THR B O   1 
ATOM   2874  C  CB  . THR B  1 111 ? 11.660   65.018  -13.510 1.00 25.21 ? 120 THR B CB  1 
ATOM   2875  O  OG1 . THR B  1 111 ? 12.919   64.343  -13.558 1.00 25.57 ? 120 THR B OG1 1 
ATOM   2876  C  CG2 . THR B  1 111 ? 11.549   66.053  -14.651 1.00 24.71 ? 120 THR B CG2 1 
ATOM   2877  N  N   . ASP B  1 112 ? 12.699   64.844  -10.130 1.00 26.79 ? 121 ASP B N   1 
ATOM   2878  C  CA  . ASP B  1 112 ? 12.909   63.924  -9.001  1.00 25.74 ? 121 ASP B CA  1 
ATOM   2879  C  C   . ASP B  1 112 ? 12.819   64.607  -7.655  1.00 23.96 ? 121 ASP B C   1 
ATOM   2880  O  O   . ASP B  1 112 ? 13.164   64.007  -6.599  1.00 27.21 ? 121 ASP B O   1 
ATOM   2881  C  CB  . ASP B  1 112 ? 14.252   63.212  -9.114  1.00 29.04 ? 121 ASP B CB  1 
ATOM   2882  C  CG  . ASP B  1 112 ? 14.370   62.018  -8.161  1.00 29.96 ? 121 ASP B CG  1 
ATOM   2883  O  OD1 . ASP B  1 112 ? 13.392   61.251  -8.034  1.00 33.17 ? 121 ASP B OD1 1 
ATOM   2884  O  OD2 . ASP B  1 112 ? 15.435   61.842  -7.546  1.00 31.71 ? 121 ASP B OD2 1 
ATOM   2885  N  N   . MET B  1 113 ? 12.340   65.847  -7.646  1.00 23.49 ? 122 MET B N   1 
ATOM   2886  C  CA  . MET B  1 113 ? 12.227   66.583  -6.371  1.00 26.87 ? 122 MET B CA  1 
ATOM   2887  C  C   . MET B  1 113 ? 11.371   65.827  -5.376  1.00 26.20 ? 122 MET B C   1 
ATOM   2888  O  O   . MET B  1 113 ? 10.303   65.301  -5.717  1.00 27.40 ? 122 MET B O   1 
ATOM   2889  C  CB  . MET B  1 113 ? 11.613   67.973  -6.573  1.00 29.58 ? 122 MET B CB  1 
ATOM   2890  C  CG  . MET B  1 113 ? 11.543   68.822  -5.288  1.00 30.40 ? 122 MET B CG  1 
ATOM   2891  S  SD  . MET B  1 113 ? 10.765   70.421  -5.534  1.00 32.01 ? 122 MET B SD  1 
ATOM   2892  C  CE  . MET B  1 113 ? 12.000   71.338  -6.445  1.00 39.68 ? 122 MET B CE  1 
ATOM   2893  N  N   . HIS B  1 114 ? 11.855   65.763  -4.143  1.00 28.80 ? 123 HIS B N   1 
ATOM   2894  C  CA  . HIS B  1 114 ? 11.062   65.214  -3.032  1.00 29.49 ? 123 HIS B CA  1 
ATOM   2895  C  C   . HIS B  1 114 ? 11.557   65.696  -1.652  1.00 29.19 ? 123 HIS B C   1 
ATOM   2896  O  O   . HIS B  1 114 ? 12.480   66.482  -1.548  1.00 33.38 ? 123 HIS B O   1 
ATOM   2897  C  CB  . HIS B  1 114 ? 11.037   63.691  -3.097  1.00 29.03 ? 123 HIS B CB  1 
ATOM   2898  C  CG  . HIS B  1 114 ? 12.386   63.068  -2.968  1.00 31.56 ? 123 HIS B CG  1 
ATOM   2899  N  ND1 . HIS B  1 114 ? 13.320   63.103  -3.990  1.00 32.28 ? 123 HIS B ND1 1 
ATOM   2900  C  CD2 . HIS B  1 114 ? 12.958   62.388  -1.943  1.00 28.83 ? 123 HIS B CD2 1 
ATOM   2901  C  CE1 . HIS B  1 114 ? 14.416   62.477  -3.589  1.00 31.17 ? 123 HIS B CE1 1 
ATOM   2902  N  NE2 . HIS B  1 114 ? 14.220   62.038  -2.354  1.00 31.56 ? 123 HIS B NE2 1 
ATOM   2903  N  N   . GLY B  1 115 ? 10.881   65.258  -0.605  1.00 30.64 ? 124 GLY B N   1 
ATOM   2904  C  CA  . GLY B  1 115 ? 11.109   65.719  0.750   1.00 30.10 ? 124 GLY B CA  1 
ATOM   2905  C  C   . GLY B  1 115 ? 12.558   65.666  1.138   1.00 31.14 ? 124 GLY B C   1 
ATOM   2906  O  O   . GLY B  1 115 ? 12.986   66.408  1.998   1.00 33.53 ? 124 GLY B O   1 
ATOM   2907  N  N   . ASP B  1 116 ? 13.331   64.783  0.544   1.00 31.58 ? 125 ASP B N   1 
ATOM   2908  C  CA  . ASP B  1 116 ? 14.742   64.642  0.957   1.00 34.02 ? 125 ASP B CA  1 
ATOM   2909  C  C   . ASP B  1 116 ? 15.718   65.230  -0.019  1.00 29.63 ? 125 ASP B C   1 
ATOM   2910  O  O   . ASP B  1 116 ? 16.906   65.040  0.140   1.00 29.44 ? 125 ASP B O   1 
ATOM   2911  C  CB  . ASP B  1 116 ? 15.092   63.182  1.211   1.00 39.39 ? 125 ASP B CB  1 
ATOM   2912  C  CG  . ASP B  1 116 ? 14.426   62.641  2.453   1.00 46.64 ? 125 ASP B CG  1 
ATOM   2913  O  OD1 . ASP B  1 116 ? 13.624   63.369  3.084   1.00 54.98 ? 125 ASP B OD1 1 
ATOM   2914  O  OD2 . ASP B  1 116 ? 14.693   61.467  2.790   1.00 57.74 ? 125 ASP B OD2 1 
ATOM   2915  N  N   . SER B  1 117 ? 15.224   65.908  -1.038  1.00 25.70 ? 126 SER B N   1 
ATOM   2916  C  CA  . SER B  1 117 ? 16.118   66.613  -1.908  1.00 28.58 ? 126 SER B CA  1 
ATOM   2917  C  C   . SER B  1 117 ? 16.847   67.744  -1.111  1.00 27.96 ? 126 SER B C   1 
ATOM   2918  O  O   . SER B  1 117 ? 16.281   68.345  -0.182  1.00 23.88 ? 126 SER B O   1 
ATOM   2919  C  CB  . SER B  1 117 ? 15.369   67.172  -3.129  1.00 31.18 ? 126 SER B CB  1 
ATOM   2920  O  OG  . SER B  1 117 ? 14.652   66.150  -3.834  1.00 28.39 ? 126 SER B OG  1 
ATOM   2921  N  N   . GLU B  1 118 ? 18.096   68.010  -1.489  1.00 27.19 ? 127 GLU B N   1 
ATOM   2922  C  CA  . GLU B  1 118 ? 18.936   68.986  -0.800  1.00 27.49 ? 127 GLU B CA  1 
ATOM   2923  C  C   . GLU B  1 118 ? 18.604   70.414  -1.258  1.00 23.05 ? 127 GLU B C   1 
ATOM   2924  O  O   . GLU B  1 118 ? 18.842   70.797  -2.404  1.00 24.86 ? 127 GLU B O   1 
ATOM   2925  C  CB  . GLU B  1 118 ? 20.422   68.675  -1.007  1.00 31.93 ? 127 GLU B CB  1 
ATOM   2926  C  CG  . GLU B  1 118 ? 21.345   69.517  -0.125  1.00 38.53 ? 127 GLU B CG  1 
ATOM   2927  C  CD  . GLU B  1 118 ? 22.813   69.417  -0.513  1.00 41.19 ? 127 GLU B CD  1 
ATOM   2928  O  OE1 . GLU B  1 118 ? 23.497   68.733  0.237   1.00 40.06 ? 127 GLU B OE1 1 
ATOM   2929  O  OE2 . GLU B  1 118 ? 23.268   70.007  -1.544  1.00 44.47 ? 127 GLU B OE2 1 
ATOM   2930  N  N   . TYR B  1 119 ? 18.032   71.198  -0.359  1.00 19.24 ? 128 TYR B N   1 
ATOM   2931  C  CA  . TYR B  1 119 ? 17.769   72.608  -0.649  1.00 17.84 ? 128 TYR B CA  1 
ATOM   2932  C  C   . TYR B  1 119 ? 18.778   73.531  0.077   1.00 15.93 ? 128 TYR B C   1 
ATOM   2933  O  O   . TYR B  1 119 ? 19.504   73.078  0.957   1.00 14.76 ? 128 TYR B O   1 
ATOM   2934  C  CB  . TYR B  1 119 ? 16.329   72.972  -0.256  1.00 18.89 ? 128 TYR B CB  1 
ATOM   2935  C  CG  . TYR B  1 119 ? 16.031   72.663  1.189   1.00 17.95 ? 128 TYR B CG  1 
ATOM   2936  C  CD1 . TYR B  1 119 ? 16.393   73.534  2.168   1.00 17.82 ? 128 TYR B CD1 1 
ATOM   2937  C  CD2 . TYR B  1 119 ? 15.428   71.443  1.563   1.00 18.78 ? 128 TYR B CD2 1 
ATOM   2938  C  CE1 . TYR B  1 119 ? 16.151   73.247  3.508   1.00 19.06 ? 128 TYR B CE1 1 
ATOM   2939  C  CE2 . TYR B  1 119 ? 15.138   71.161  2.896   1.00 18.44 ? 128 TYR B CE2 1 
ATOM   2940  C  CZ  . TYR B  1 119 ? 15.527   72.079  3.865   1.00 18.75 ? 128 TYR B CZ  1 
ATOM   2941  O  OH  . TYR B  1 119 ? 15.319   71.898  5.193   1.00 19.58 ? 128 TYR B OH  1 
ATOM   2942  N  N   . ASN B  1 120 ? 18.794   74.812  -0.303  1.00 14.65 ? 129 ASN B N   1 
ATOM   2943  C  CA  . ASN B  1 120 ? 19.624   75.826  0.384   1.00 14.63 ? 129 ASN B CA  1 
ATOM   2944  C  C   . ASN B  1 120 ? 18.887   76.419  1.579   1.00 13.88 ? 129 ASN B C   1 
ATOM   2945  O  O   . ASN B  1 120 ? 19.418   76.532  2.666   1.00 13.08 ? 129 ASN B O   1 
ATOM   2946  C  CB  . ASN B  1 120 ? 20.037   76.929  -0.593  1.00 14.81 ? 129 ASN B CB  1 
ATOM   2947  C  CG  . ASN B  1 120 ? 21.042   76.439  -1.623  1.00 15.14 ? 129 ASN B CG  1 
ATOM   2948  O  OD1 . ASN B  1 120 ? 21.721   75.434  -1.403  1.00 16.11 ? 129 ASN B OD1 1 
ATOM   2949  N  ND2 . ASN B  1 120 ? 21.126   77.123  -2.745  1.00 15.32 ? 129 ASN B ND2 1 
ATOM   2950  N  N   . ILE B  1 121 ? 17.660   76.838  1.314   1.00 14.41 ? 130 ILE B N   1 
ATOM   2951  C  CA  . ILE B  1 121 ? 16.823   77.520  2.276   1.00 15.62 ? 130 ILE B CA  1 
ATOM   2952  C  C   . ILE B  1 121 ? 15.376   77.018  2.183   1.00 16.74 ? 130 ILE B C   1 
ATOM   2953  O  O   . ILE B  1 121 ? 14.850   76.902  1.077   1.00 17.20 ? 130 ILE B O   1 
ATOM   2954  C  CB  . ILE B  1 121 ? 16.816   79.078  2.020   1.00 15.37 ? 130 ILE B CB  1 
ATOM   2955  C  CG1 . ILE B  1 121 ? 18.214   79.672  2.220   1.00 14.80 ? 130 ILE B CG1 1 
ATOM   2956  C  CG2 . ILE B  1 121 ? 15.868   79.787  2.959   1.00 15.72 ? 130 ILE B CG2 1 
ATOM   2957  C  CD1 . ILE B  1 121 ? 18.334   81.089  1.698   1.00 15.72 ? 130 ILE B CD1 1 
ATOM   2958  N  N   . MET B  1 122 ? 14.735   76.855  3.335   1.00 17.53 ? 131 MET B N   1 
ATOM   2959  C  CA  . MET B  1 122 ? 13.301   76.659  3.424   1.00 18.46 ? 131 MET B CA  1 
ATOM   2960  C  C   . MET B  1 122 ? 12.627   77.743  4.265   1.00 16.49 ? 131 MET B C   1 
ATOM   2961  O  O   . MET B  1 122 ? 13.106   78.116  5.332   1.00 15.68 ? 131 MET B O   1 
ATOM   2962  C  CB  . MET B  1 122 ? 13.000   75.324  4.043   1.00 21.79 ? 131 MET B CB  1 
ATOM   2963  C  CG  . MET B  1 122 ? 11.522   75.114  4.314   1.00 26.64 ? 131 MET B CG  1 
ATOM   2964  S  SD  . MET B  1 122 ? 11.251   73.475  4.955   1.00 33.63 ? 131 MET B SD  1 
ATOM   2965  C  CE  . MET B  1 122 ? 12.425   72.397  4.222   1.00 35.07 ? 131 MET B CE  1 
ATOM   2966  N  N   . PHE B  1 123 ? 11.513   78.260  3.777   1.00 14.35 ? 132 PHE B N   1 
ATOM   2967  C  CA  . PHE B  1 123 ? 10.867   79.385  4.461   1.00 13.00 ? 132 PHE B CA  1 
ATOM   2968  C  C   . PHE B  1 123 ? 9.352    79.367  4.320   1.00 12.26 ? 132 PHE B C   1 
ATOM   2969  O  O   . PHE B  1 123 ? 8.842    79.302  3.219   1.00 12.39 ? 132 PHE B O   1 
ATOM   2970  C  CB  . PHE B  1 123 ? 11.362   80.704  3.886   1.00 11.87 ? 132 PHE B CB  1 
ATOM   2971  C  CG  . PHE B  1 123 ? 10.594   81.877  4.362   1.00 10.71 ? 132 PHE B CG  1 
ATOM   2972  C  CD1 . PHE B  1 123 ? 10.602   82.215  5.700   1.00 9.93  ? 132 PHE B CD1 1 
ATOM   2973  C  CD2 . PHE B  1 123 ? 9.925    82.705  3.460   1.00 10.05 ? 132 PHE B CD2 1 
ATOM   2974  C  CE1 . PHE B  1 123 ? 9.930    83.309  6.148   1.00 9.50  ? 132 PHE B CE1 1 
ATOM   2975  C  CE2 . PHE B  1 123 ? 9.237    83.797  3.919   1.00 9.84  ? 132 PHE B CE2 1 
ATOM   2976  C  CZ  . PHE B  1 123 ? 9.208    84.077  5.273   1.00 9.39  ? 132 PHE B CZ  1 
ATOM   2977  N  N   . GLY B  1 124 ? 8.658    79.471  5.436   1.00 11.37 ? 133 GLY B N   1 
ATOM   2978  C  CA  . GLY B  1 124 ? 7.244    79.778  5.405   1.00 11.59 ? 133 GLY B CA  1 
ATOM   2979  C  C   . GLY B  1 124 ? 6.398    79.069  6.468   1.00 11.20 ? 133 GLY B C   1 
ATOM   2980  O  O   . GLY B  1 124 ? 6.925    78.373  7.298   1.00 10.62 ? 133 GLY B O   1 
ATOM   2981  N  N   . PRO B  1 125 ? 5.079    79.291  6.448   1.00 11.31 ? 134 PRO B N   1 
ATOM   2982  C  CA  . PRO B  1 125 ? 4.170    78.815  7.488   1.00 12.30 ? 134 PRO B CA  1 
ATOM   2983  C  C   . PRO B  1 125 ? 3.980    77.301  7.511   1.00 13.14 ? 134 PRO B C   1 
ATOM   2984  O  O   . PRO B  1 125 ? 3.993    76.647  6.454   1.00 13.91 ? 134 PRO B O   1 
ATOM   2985  C  CB  . PRO B  1 125 ? 2.846    79.521  7.165   1.00 12.28 ? 134 PRO B CB  1 
ATOM   2986  C  CG  . PRO B  1 125 ? 2.900    79.853  5.742   1.00 12.15 ? 134 PRO B CG  1 
ATOM   2987  C  CD  . PRO B  1 125 ? 4.376    80.128  5.460   1.00 12.51 ? 134 PRO B CD  1 
ATOM   2988  N  N   . ASP B  1 126 ? 3.898    76.761  8.711   1.00 15.62 ? 135 ASP B N   1 
ATOM   2989  C  CA  . ASP B  1 126 ? 3.614    75.360  8.938   1.00 18.46 ? 135 ASP B CA  1 
ATOM   2990  C  C   . ASP B  1 126 ? 2.601    75.234  10.071  1.00 20.93 ? 135 ASP B C   1 
ATOM   2991  O  O   . ASP B  1 126 ? 2.814    75.719  11.190  1.00 21.58 ? 135 ASP B O   1 
ATOM   2992  C  CB  . ASP B  1 126 ? 4.865    74.595  9.279   1.00 21.43 ? 135 ASP B CB  1 
ATOM   2993  C  CG  . ASP B  1 126 ? 4.703    73.067  9.130   1.00 26.73 ? 135 ASP B CG  1 
ATOM   2994  O  OD1 . ASP B  1 126 ? 3.698    72.589  8.519   1.00 29.99 ? 135 ASP B OD1 1 
ATOM   2995  O  OD2 . ASP B  1 126 ? 5.614    72.333  9.602   1.00 28.77 ? 135 ASP B OD2 1 
ATOM   2996  N  N   . ILE B  1 127 ? 1.521    74.540  9.766   1.00 20.91 ? 136 ILE B N   1 
ATOM   2997  C  CA  . ILE B  1 127 ? 0.429    74.351  10.689  1.00 22.34 ? 136 ILE B CA  1 
ATOM   2998  C  C   . ILE B  1 127 ? 0.209    72.874  10.911  1.00 24.74 ? 136 ILE B C   1 
ATOM   2999  O  O   . ILE B  1 127 ? 0.189    72.078  9.968   1.00 21.82 ? 136 ILE B O   1 
ATOM   3000  C  CB  . ILE B  1 127 ? -0.875   74.963  10.149  1.00 21.59 ? 136 ILE B CB  1 
ATOM   3001  C  CG1 . ILE B  1 127 ? -0.589   76.436  9.813   1.00 22.95 ? 136 ILE B CG1 1 
ATOM   3002  C  CG2 . ILE B  1 127 ? -1.980   74.771  11.151  1.00 20.29 ? 136 ILE B CG2 1 
ATOM   3003  C  CD1 . ILE B  1 127 ? -1.739   77.386  9.634   1.00 22.33 ? 136 ILE B CD1 1 
ATOM   3004  N  N   . CYS B  1 128 ? 0.085    72.506  12.170  1.00 27.55 ? 137 CYS B N   1 
ATOM   3005  C  CA  . CYS B  1 128 ? -0.310   71.149  12.498  1.00 33.73 ? 137 CYS B CA  1 
ATOM   3006  C  C   . CYS B  1 128 ? -0.984   71.117  13.831  1.00 36.19 ? 137 CYS B C   1 
ATOM   3007  O  O   . CYS B  1 128 ? -0.351   71.148  14.881  1.00 35.04 ? 137 CYS B O   1 
ATOM   3008  C  CB  . CYS B  1 128 ? 0.842    70.134  12.422  1.00 36.17 ? 137 CYS B CB  1 
ATOM   3009  S  SG  . CYS B  1 128 ? 0.133    68.456  12.132  1.00 40.31 ? 137 CYS B SG  1 
ATOM   3010  N  N   . GLY B  1 129 ? -2.298   71.102  13.756  1.00 43.74 ? 138 GLY B N   1 
ATOM   3011  C  CA  . GLY B  1 129 ? -3.125   71.023  14.928  1.00 49.11 ? 138 GLY B CA  1 
ATOM   3012  C  C   . GLY B  1 129 ? -3.016   72.254  15.802  1.00 53.92 ? 138 GLY B C   1 
ATOM   3013  O  O   . GLY B  1 129 ? -2.464   73.308  15.363  1.00 53.39 ? 138 GLY B O   1 
ATOM   3014  N  N   . PRO B  1 130 ? -3.501   72.107  17.066  1.00 55.23 ? 139 PRO B N   1 
ATOM   3015  C  CA  . PRO B  1 130 ? -3.674   73.240  17.983  1.00 49.31 ? 139 PRO B CA  1 
ATOM   3016  C  C   . PRO B  1 130 ? -2.323   73.803  18.376  1.00 45.16 ? 139 PRO B C   1 
ATOM   3017  O  O   . PRO B  1 130 ? -2.184   74.999  18.468  1.00 44.96 ? 139 PRO B O   1 
ATOM   3018  C  CB  . PRO B  1 130 ? -4.417   72.642  19.195  1.00 48.96 ? 139 PRO B CB  1 
ATOM   3019  C  CG  . PRO B  1 130 ? -4.444   71.152  19.000  1.00 51.94 ? 139 PRO B CG  1 
ATOM   3020  C  CD  . PRO B  1 130 ? -3.711   70.802  17.737  1.00 52.49 ? 139 PRO B CD  1 
ATOM   3021  N  N   . GLY B  1 131 ? -1.336   72.924  18.535  1.00 42.38 ? 140 GLY B N   1 
ATOM   3022  C  CA  . GLY B  1 131 ? -0.017   73.289  19.020  1.00 43.02 ? 140 GLY B CA  1 
ATOM   3023  C  C   . GLY B  1 131 ? 0.936    74.020  18.087  1.00 44.81 ? 140 GLY B C   1 
ATOM   3024  O  O   . GLY B  1 131 ? 1.781    74.759  18.568  1.00 46.05 ? 140 GLY B O   1 
ATOM   3025  N  N   . THR B  1 132 ? 0.834    73.798  16.774  1.00 41.08 ? 141 THR B N   1 
ATOM   3026  C  CA  . THR B  1 132 ? 1.833    74.296  15.810  1.00 37.80 ? 141 THR B CA  1 
ATOM   3027  C  C   . THR B  1 132 ? 1.279    75.291  14.815  1.00 33.85 ? 141 THR B C   1 
ATOM   3028  O  O   . THR B  1 132 ? 0.463    74.940  13.974  1.00 32.04 ? 141 THR B O   1 
ATOM   3029  C  CB  . THR B  1 132 ? 2.487    73.143  15.041  1.00 37.40 ? 141 THR B CB  1 
ATOM   3030  O  OG1 . THR B  1 132 ? 2.974    72.203  15.991  1.00 34.87 ? 141 THR B OG1 1 
ATOM   3031  C  CG2 . THR B  1 132 ? 3.659    73.616  14.200  1.00 37.70 ? 141 THR B CG2 1 
ATOM   3032  N  N   . LYS B  1 133 ? 1.695    76.544  14.980  1.00 31.16 ? 142 LYS B N   1 
ATOM   3033  C  CA  . LYS B  1 133 ? 1.418    77.619  14.027  1.00 32.07 ? 142 LYS B CA  1 
ATOM   3034  C  C   . LYS B  1 133 ? 2.675    78.429  13.921  1.00 27.61 ? 142 LYS B C   1 
ATOM   3035  O  O   . LYS B  1 133 ? 2.849    79.440  14.602  1.00 26.04 ? 142 LYS B O   1 
ATOM   3036  C  CB  . LYS B  1 133 ? 0.365    78.575  14.532  1.00 35.92 ? 142 LYS B CB  1 
ATOM   3037  C  CG  . LYS B  1 133 ? -0.918   77.944  14.786  1.00 43.24 ? 142 LYS B CG  1 
ATOM   3038  C  CD  . LYS B  1 133 ? -1.905   78.797  15.517  1.00 51.67 ? 142 LYS B CD  1 
ATOM   3039  C  CE  . LYS B  1 133 ? -2.953   77.854  16.026  1.00 62.47 ? 142 LYS B CE  1 
ATOM   3040  N  NZ  . LYS B  1 133 ? -4.209   78.183  15.361  1.00 65.59 ? 142 LYS B NZ  1 
ATOM   3041  N  N   . LYS B  1 134 ? 3.547    77.989  13.063  1.00 24.67 ? 143 LYS B N   1 
ATOM   3042  C  CA  . LYS B  1 134 ? 4.927    78.389  13.146  1.00 24.14 ? 143 LYS B CA  1 
ATOM   3043  C  C   . LYS B  1 134 ? 5.440    78.790  11.754  1.00 20.09 ? 143 LYS B C   1 
ATOM   3044  O  O   . LYS B  1 134 ? 5.008    78.252  10.753  1.00 17.58 ? 143 LYS B O   1 
ATOM   3045  C  CB  . LYS B  1 134 ? 5.685    77.225  13.790  1.00 27.36 ? 143 LYS B CB  1 
ATOM   3046  C  CG  . LYS B  1 134 ? 6.789    76.628  12.988  1.00 31.44 ? 143 LYS B CG  1 
ATOM   3047  C  CD  . LYS B  1 134 ? 7.688    75.796  13.930  1.00 37.94 ? 143 LYS B CD  1 
ATOM   3048  C  CE  . LYS B  1 134 ? 8.984    76.563  14.237  1.00 42.19 ? 143 LYS B CE  1 
ATOM   3049  N  NZ  . LYS B  1 134 ? 10.213   75.852  13.855  1.00 47.99 ? 143 LYS B NZ  1 
ATOM   3050  N  N   . VAL B  1 135 ? 6.334    79.768  11.718  1.00 18.78 ? 144 VAL B N   1 
ATOM   3051  C  CA  . VAL B  1 135 ? 7.071    80.111  10.505  1.00 18.55 ? 144 VAL B CA  1 
ATOM   3052  C  C   . VAL B  1 135 ? 8.488    79.485  10.543  1.00 18.82 ? 144 VAL B C   1 
ATOM   3053  O  O   . VAL B  1 135 ? 9.344    79.832  11.380  1.00 19.48 ? 144 VAL B O   1 
ATOM   3054  C  CB  . VAL B  1 135 ? 7.200    81.614  10.278  1.00 18.31 ? 144 VAL B CB  1 
ATOM   3055  C  CG1 . VAL B  1 135 ? 7.822    81.882  8.919   1.00 19.20 ? 144 VAL B CG1 1 
ATOM   3056  C  CG2 . VAL B  1 135 ? 5.846    82.278  10.359  1.00 19.93 ? 144 VAL B CG2 1 
ATOM   3057  N  N   . HIS B  1 136 ? 8.713    78.581  9.615   1.00 17.39 ? 145 HIS B N   1 
ATOM   3058  C  CA  . HIS B  1 136 ? 10.010   77.977  9.451   1.00 20.38 ? 145 HIS B CA  1 
ATOM   3059  C  C   . HIS B  1 136 ? 10.964   78.906  8.744   1.00 17.85 ? 145 HIS B C   1 
ATOM   3060  O  O   . HIS B  1 136 ? 10.639   79.494  7.738   1.00 16.76 ? 145 HIS B O   1 
ATOM   3061  C  CB  . HIS B  1 136 ? 9.929    76.716  8.608   1.00 21.75 ? 145 HIS B CB  1 
ATOM   3062  C  CG  . HIS B  1 136 ? 9.420    75.532  9.344   1.00 23.60 ? 145 HIS B CG  1 
ATOM   3063  N  ND1 . HIS B  1 136 ? 10.094   74.965  10.401  1.00 27.83 ? 145 HIS B ND1 1 
ATOM   3064  C  CD2 . HIS B  1 136 ? 8.324    74.772  9.146   1.00 25.44 ? 145 HIS B CD2 1 
ATOM   3065  C  CE1 . HIS B  1 136 ? 9.417    73.919  10.845  1.00 27.27 ? 145 HIS B CE1 1 
ATOM   3066  N  NE2 . HIS B  1 136 ? 8.345    73.774  10.090  1.00 26.87 ? 145 HIS B NE2 1 
ATOM   3067  N  N   . VAL B  1 137 ? 12.174   78.964  9.259   1.00 17.40 ? 146 VAL B N   1 
ATOM   3068  C  CA  . VAL B  1 137 ? 13.296   79.534  8.523   1.00 16.35 ? 146 VAL B CA  1 
ATOM   3069  C  C   . VAL B  1 137 ? 14.411   78.536  8.731   1.00 16.45 ? 146 VAL B C   1 
ATOM   3070  O  O   . VAL B  1 137 ? 14.973   78.406  9.822   1.00 15.54 ? 146 VAL B O   1 
ATOM   3071  C  CB  . VAL B  1 137 ? 13.694   80.916  9.043   1.00 16.99 ? 146 VAL B CB  1 
ATOM   3072  C  CG1 . VAL B  1 137 ? 14.650   81.569  8.084   1.00 17.10 ? 146 VAL B CG1 1 
ATOM   3073  C  CG2 . VAL B  1 137 ? 12.475   81.787  9.214   1.00 17.08 ? 146 VAL B CG2 1 
ATOM   3074  N  N   . ILE B  1 138 ? 14.736   77.819  7.666   1.00 18.40 ? 147 ILE B N   1 
ATOM   3075  C  CA  . ILE B  1 138 ? 15.762   76.796  7.707   1.00 17.91 ? 147 ILE B CA  1 
ATOM   3076  C  C   . ILE B  1 138 ? 16.888   77.116  6.739   1.00 17.49 ? 147 ILE B C   1 
ATOM   3077  O  O   . ILE B  1 138 ? 16.676   77.366  5.532   1.00 16.05 ? 147 ILE B O   1 
ATOM   3078  C  CB  . ILE B  1 138 ? 15.192   75.389  7.377   1.00 19.42 ? 147 ILE B CB  1 
ATOM   3079  C  CG1 . ILE B  1 138 ? 14.026   75.092  8.313   1.00 20.40 ? 147 ILE B CG1 1 
ATOM   3080  C  CG2 . ILE B  1 138 ? 16.258   74.303  7.540   1.00 19.30 ? 147 ILE B CG2 1 
ATOM   3081  C  CD1 . ILE B  1 138 ? 13.345   73.762  8.069   1.00 21.29 ? 147 ILE B CD1 1 
ATOM   3082  N  N   . PHE B  1 139 ? 18.107   77.014  7.255   1.00 15.74 ? 148 PHE B N   1 
ATOM   3083  C  CA  . PHE B  1 139 ? 19.285   77.177  6.412   1.00 16.91 ? 148 PHE B CA  1 
ATOM   3084  C  C   . PHE B  1 139 ? 20.018   75.840  6.337   1.00 16.82 ? 148 PHE B C   1 
ATOM   3085  O  O   . PHE B  1 139 ? 20.254   75.195  7.368   1.00 16.19 ? 148 PHE B O   1 
ATOM   3086  C  CB  . PHE B  1 139 ? 20.249   78.241  7.008   1.00 17.83 ? 148 PHE B CB  1 
ATOM   3087  C  CG  . PHE B  1 139 ? 19.875   79.641  6.715   1.00 17.01 ? 148 PHE B CG  1 
ATOM   3088  C  CD1 . PHE B  1 139 ? 20.336   80.269  5.581   1.00 18.42 ? 148 PHE B CD1 1 
ATOM   3089  C  CD2 . PHE B  1 139 ? 19.057   80.321  7.558   1.00 17.90 ? 148 PHE B CD2 1 
ATOM   3090  C  CE1 . PHE B  1 139 ? 19.953   81.569  5.291   1.00 18.54 ? 148 PHE B CE1 1 
ATOM   3091  C  CE2 . PHE B  1 139 ? 18.668   81.616  7.304   1.00 17.30 ? 148 PHE B CE2 1 
ATOM   3092  C  CZ  . PHE B  1 139 ? 19.121   82.249  6.170   1.00 18.26 ? 148 PHE B CZ  1 
ATOM   3093  N  N   . ASN B  1 140 ? 20.389   75.451  5.125   1.00 17.73 ? 149 ASN B N   1 
ATOM   3094  C  CA  . ASN B  1 140 ? 21.298   74.318  4.938   1.00 20.59 ? 149 ASN B CA  1 
ATOM   3095  C  C   . ASN B  1 140 ? 22.784   74.744  5.078   1.00 21.03 ? 149 ASN B C   1 
ATOM   3096  O  O   . ASN B  1 140 ? 23.268   75.617  4.341   1.00 22.15 ? 149 ASN B O   1 
ATOM   3097  C  CB  . ASN B  1 140 ? 21.110   73.673  3.574   1.00 21.06 ? 149 ASN B CB  1 
ATOM   3098  C  CG  . ASN B  1 140 ? 21.995   72.440  3.398   1.00 22.72 ? 149 ASN B CG  1 
ATOM   3099  O  OD1 . ASN B  1 140 ? 22.878   72.435  2.588   1.00 21.85 ? 149 ASN B OD1 1 
ATOM   3100  N  ND2 . ASN B  1 140 ? 21.769   71.414  4.214   1.00 24.28 ? 149 ASN B ND2 1 
ATOM   3101  N  N   . TYR B  1 141 ? 23.468   74.134  6.023   1.00 21.30 ? 150 TYR B N   1 
ATOM   3102  C  CA  . TYR B  1 141 ? 24.842   74.476  6.319   1.00 23.19 ? 150 TYR B CA  1 
ATOM   3103  C  C   . TYR B  1 141 ? 25.600   73.230  6.757   1.00 23.23 ? 150 TYR B C   1 
ATOM   3104  O  O   . TYR B  1 141 ? 25.171   72.508  7.663   1.00 22.13 ? 150 TYR B O   1 
ATOM   3105  C  CB  . TYR B  1 141 ? 24.880   75.544  7.413   1.00 23.68 ? 150 TYR B CB  1 
ATOM   3106  C  CG  . TYR B  1 141 ? 26.248   76.042  7.802   1.00 24.25 ? 150 TYR B CG  1 
ATOM   3107  C  CD1 . TYR B  1 141 ? 27.001   76.834  6.944   1.00 28.98 ? 150 TYR B CD1 1 
ATOM   3108  C  CD2 . TYR B  1 141 ? 26.788   75.739  9.044   1.00 26.09 ? 150 TYR B CD2 1 
ATOM   3109  C  CE1 . TYR B  1 141 ? 28.289   77.283  7.309   1.00 31.19 ? 150 TYR B CE1 1 
ATOM   3110  C  CE2 . TYR B  1 141 ? 28.066   76.170  9.419   1.00 28.63 ? 150 TYR B CE2 1 
ATOM   3111  C  CZ  . TYR B  1 141 ? 28.807   76.947  8.550   1.00 30.96 ? 150 TYR B CZ  1 
ATOM   3112  O  OH  . TYR B  1 141 ? 30.075   77.346  8.914   1.00 37.45 ? 150 TYR B OH  1 
ATOM   3113  N  N   . LYS B  1 142 ? 26.742   72.980  6.115   1.00 26.30 ? 151 LYS B N   1 
ATOM   3114  C  CA  . LYS B  1 142 ? 27.594   71.804  6.420   1.00 27.96 ? 151 LYS B CA  1 
ATOM   3115  C  C   . LYS B  1 142 ? 26.785   70.535  6.459   1.00 28.34 ? 151 LYS B C   1 
ATOM   3116  O  O   . LYS B  1 142 ? 26.846   69.788  7.432   1.00 26.37 ? 151 LYS B O   1 
ATOM   3117  C  CB  . LYS B  1 142 ? 28.306   71.948  7.755   1.00 32.34 ? 151 LYS B CB  1 
ATOM   3118  C  CG  . LYS B  1 142 ? 29.242   73.109  7.848   1.00 36.36 ? 151 LYS B CG  1 
ATOM   3119  C  CD  . LYS B  1 142 ? 30.273   73.148  6.750   1.00 40.18 ? 151 LYS B CD  1 
ATOM   3120  C  CE  . LYS B  1 142 ? 31.091   74.392  7.081   1.00 45.47 ? 151 LYS B CE  1 
ATOM   3121  N  NZ  . LYS B  1 142 ? 32.535   74.668  6.829   1.00 50.98 ? 151 LYS B NZ  1 
ATOM   3122  N  N   . GLY B  1 143 ? 25.962   70.343  5.424   1.00 28.89 ? 152 GLY B N   1 
ATOM   3123  C  CA  . GLY B  1 143 ? 25.169   69.125  5.274   1.00 28.31 ? 152 GLY B CA  1 
ATOM   3124  C  C   . GLY B  1 143 ? 24.124   68.894  6.345   1.00 28.08 ? 152 GLY B C   1 
ATOM   3125  O  O   . GLY B  1 143 ? 23.611   67.787  6.501   1.00 26.67 ? 152 GLY B O   1 
ATOM   3126  N  N   . LYS B  1 144 ? 23.790   69.943  7.068   1.00 26.03 ? 153 LYS B N   1 
ATOM   3127  C  CA  . LYS B  1 144 ? 22.706   69.892  8.026   1.00 26.68 ? 153 LYS B CA  1 
ATOM   3128  C  C   . LYS B  1 144 ? 21.662   70.985  7.690   1.00 22.48 ? 153 LYS B C   1 
ATOM   3129  O  O   . LYS B  1 144 ? 21.980   72.054  7.206   1.00 20.73 ? 153 LYS B O   1 
ATOM   3130  C  CB  . LYS B  1 144 ? 23.335   70.174  9.370   1.00 29.25 ? 153 LYS B CB  1 
ATOM   3131  C  CG  . LYS B  1 144 ? 22.683   69.603  10.611  1.00 35.60 ? 153 LYS B CG  1 
ATOM   3132  C  CD  . LYS B  1 144 ? 23.378   68.357  11.140  1.00 39.38 ? 153 LYS B CD  1 
ATOM   3133  C  CE  . LYS B  1 144 ? 22.412   67.438  11.925  1.00 42.47 ? 153 LYS B CE  1 
ATOM   3134  N  NZ  . LYS B  1 144 ? 22.916   66.699  13.143  1.00 40.85 ? 153 LYS B NZ  1 
ATOM   3135  N  N   . ASN B  1 145 ? 20.412   70.683  7.943   1.00 22.62 ? 154 ASN B N   1 
ATOM   3136  C  CA  . ASN B  1 145 ? 19.303   71.625  7.805   1.00 22.47 ? 154 ASN B CA  1 
ATOM   3137  C  C   . ASN B  1 145 ? 19.021   72.229  9.168   1.00 22.05 ? 154 ASN B C   1 
ATOM   3138  O  O   . ASN B  1 145 ? 18.494   71.573  10.043  1.00 22.64 ? 154 ASN B O   1 
ATOM   3139  C  CB  . ASN B  1 145 ? 18.065   70.925  7.283   1.00 22.14 ? 154 ASN B CB  1 
ATOM   3140  C  CG  . ASN B  1 145 ? 18.181   70.582  5.825   1.00 23.61 ? 154 ASN B CG  1 
ATOM   3141  O  OD1 . ASN B  1 145 ? 18.794   71.282  5.041   1.00 24.91 ? 154 ASN B OD1 1 
ATOM   3142  N  ND2 . ASN B  1 145 ? 17.556   69.485  5.440   1.00 26.03 ? 154 ASN B ND2 1 
ATOM   3143  N  N   . VAL B  1 146 ? 19.403   73.482  9.346   1.00 21.82 ? 155 VAL B N   1 
ATOM   3144  C  CA  . VAL B  1 146 ? 19.392   74.090  10.666  1.00 21.36 ? 155 VAL B CA  1 
ATOM   3145  C  C   . VAL B  1 146 ? 18.168   74.979  10.830  1.00 21.09 ? 155 VAL B C   1 
ATOM   3146  O  O   . VAL B  1 146 ? 17.872   75.830  9.977   1.00 18.53 ? 155 VAL B O   1 
ATOM   3147  C  CB  . VAL B  1 146 ? 20.668   74.905  10.916  1.00 22.07 ? 155 VAL B CB  1 
ATOM   3148  C  CG1 . VAL B  1 146 ? 20.775   75.265  12.389  1.00 21.69 ? 155 VAL B CG1 1 
ATOM   3149  C  CG2 . VAL B  1 146 ? 21.895   74.116  10.485  1.00 21.91 ? 155 VAL B CG2 1 
ATOM   3150  N  N   . LEU B  1 147 ? 17.456   74.748  11.918  1.00 22.21 ? 156 LEU B N   1 
ATOM   3151  C  CA  . LEU B  1 147 ? 16.140   75.347  12.153  1.00 24.21 ? 156 LEU B CA  1 
ATOM   3152  C  C   . LEU B  1 147 ? 16.266   76.567  13.021  1.00 22.19 ? 156 LEU B C   1 
ATOM   3153  O  O   . LEU B  1 147 ? 17.028   76.563  13.966  1.00 22.42 ? 156 LEU B O   1 
ATOM   3154  C  CB  . LEU B  1 147 ? 15.179   74.351  12.839  1.00 26.39 ? 156 LEU B CB  1 
ATOM   3155  C  CG  . LEU B  1 147 ? 14.448   73.358  11.924  1.00 30.19 ? 156 LEU B CG  1 
ATOM   3156  C  CD1 . LEU B  1 147 ? 15.399   72.296  11.414  1.00 30.95 ? 156 LEU B CD1 1 
ATOM   3157  C  CD2 . LEU B  1 147 ? 13.264   72.726  12.666  1.00 31.15 ? 156 LEU B CD2 1 
ATOM   3158  N  N   . ILE B  1 148 ? 15.520   77.616  12.710  1.00 21.06 ? 157 ILE B N   1 
ATOM   3159  C  CA  . ILE B  1 148 ? 15.617   78.831  13.511  1.00 21.12 ? 157 ILE B CA  1 
ATOM   3160  C  C   . ILE B  1 148 ? 15.197   78.494  14.935  1.00 22.06 ? 157 ILE B C   1 
ATOM   3161  O  O   . ILE B  1 148 ? 14.335   77.690  15.142  1.00 23.61 ? 157 ILE B O   1 
ATOM   3162  C  CB  . ILE B  1 148 ? 14.797   79.976  12.929  1.00 21.35 ? 157 ILE B CB  1 
ATOM   3163  C  CG1 . ILE B  1 148 ? 15.217   81.316  13.551  1.00 21.88 ? 157 ILE B CG1 1 
ATOM   3164  C  CG2 . ILE B  1 148 ? 13.303   79.699  13.086  1.00 22.57 ? 157 ILE B CG2 1 
ATOM   3165  C  CD1 . ILE B  1 148 ? 14.494   82.527  13.007  1.00 20.58 ? 157 ILE B CD1 1 
ATOM   3166  N  N   . ASN B  1 149 ? 15.837   79.115  15.903  1.00 24.72 ? 158 ASN B N   1 
ATOM   3167  C  CA  . ASN B  1 149 ? 15.580   78.883  17.332  1.00 29.18 ? 158 ASN B CA  1 
ATOM   3168  C  C   . ASN B  1 149 ? 14.567   79.879  17.924  1.00 29.01 ? 158 ASN B C   1 
ATOM   3169  O  O   . ASN B  1 149 ? 14.137   79.737  19.052  1.00 34.11 ? 158 ASN B O   1 
ATOM   3170  C  CB  . ASN B  1 149 ? 16.951   78.812  18.076  1.00 32.43 ? 158 ASN B CB  1 
ATOM   3171  C  CG  . ASN B  1 149 ? 17.596   80.174  18.268  1.00 40.37 ? 158 ASN B CG  1 
ATOM   3172  O  OD1 . ASN B  1 149 ? 16.966   81.220  18.046  1.00 42.16 ? 158 ASN B OD1 1 
ATOM   3173  N  ND2 . ASN B  1 149 ? 18.880   80.179  18.665  1.00 42.03 ? 158 ASN B ND2 1 
ATOM   3174  N  N   . LYS B  1 150 ? 14.156   80.872  17.154  1.00 29.76 ? 159 LYS B N   1 
ATOM   3175  C  CA  . LYS B  1 150 ? 13.076   81.784  17.580  1.00 29.38 ? 159 LYS B CA  1 
ATOM   3176  C  C   . LYS B  1 150 ? 11.727   81.215  17.177  1.00 29.40 ? 159 LYS B C   1 
ATOM   3177  O  O   . LYS B  1 150 ? 11.578   80.571  16.153  1.00 33.60 ? 159 LYS B O   1 
ATOM   3178  C  CB  . LYS B  1 150 ? 13.235   83.175  16.977  1.00 28.36 ? 159 LYS B CB  1 
ATOM   3179  C  CG  . LYS B  1 150 ? 14.456   83.917  17.475  1.00 28.14 ? 159 LYS B CG  1 
ATOM   3180  C  CD  . LYS B  1 150 ? 14.083   85.288  17.987  1.00 27.98 ? 159 LYS B CD  1 
ATOM   3181  C  CE  . LYS B  1 150 ? 15.297   86.120  18.412  1.00 27.57 ? 159 LYS B CE  1 
ATOM   3182  N  NZ  . LYS B  1 150 ? 15.696   87.139  17.392  1.00 25.12 ? 159 LYS B NZ  1 
ATOM   3183  N  N   . ASP B  1 151 ? 10.739   81.496  17.985  1.00 30.15 ? 160 ASP B N   1 
ATOM   3184  C  CA  . ASP B  1 151 ? 9.391    81.035  17.737  1.00 30.53 ? 160 ASP B CA  1 
ATOM   3185  C  C   . ASP B  1 151 ? 8.536    82.128  17.073  1.00 26.89 ? 160 ASP B C   1 
ATOM   3186  O  O   . ASP B  1 151 ? 8.233    83.142  17.664  1.00 27.33 ? 160 ASP B O   1 
ATOM   3187  C  CB  . ASP B  1 151 ? 8.752    80.590  19.049  1.00 34.10 ? 160 ASP B CB  1 
ATOM   3188  C  CG  . ASP B  1 151 ? 7.352    80.164  18.850  1.00 40.95 ? 160 ASP B CG  1 
ATOM   3189  O  OD1 . ASP B  1 151 ? 7.118    79.290  17.973  1.00 41.19 ? 160 ASP B OD1 1 
ATOM   3190  O  OD2 . ASP B  1 151 ? 6.478    80.755  19.520  1.00 46.79 ? 160 ASP B OD2 1 
ATOM   3191  N  N   . ILE B  1 152 ? 8.212    81.926  15.808  1.00 24.28 ? 161 ILE B N   1 
ATOM   3192  C  CA  . ILE B  1 152 ? 7.493    82.908  15.020  1.00 19.86 ? 161 ILE B CA  1 
ATOM   3193  C  C   . ILE B  1 152 ? 6.119    82.318  14.717  1.00 19.55 ? 161 ILE B C   1 
ATOM   3194  O  O   . ILE B  1 152 ? 6.006    81.266  14.129  1.00 18.68 ? 161 ILE B O   1 
ATOM   3195  C  CB  . ILE B  1 152 ? 8.209    83.233  13.708  1.00 19.66 ? 161 ILE B CB  1 
ATOM   3196  C  CG1 . ILE B  1 152 ? 9.639    83.666  13.956  1.00 19.60 ? 161 ILE B CG1 1 
ATOM   3197  C  CG2 . ILE B  1 152 ? 7.473    84.330  12.942  1.00 20.06 ? 161 ILE B CG2 1 
ATOM   3198  C  CD1 . ILE B  1 152 ? 10.465   83.756  12.694  1.00 19.21 ? 161 ILE B CD1 1 
ATOM   3199  N  N   . ARG B  1 153 ? 5.083    83.000  15.147  1.00 19.00 ? 162 ARG B N   1 
ATOM   3200  C  CA  . ARG B  1 153 ? 3.769    82.553  14.933  1.00 19.90 ? 162 ARG B CA  1 
ATOM   3201  C  C   . ARG B  1 153 ? 3.294    82.891  13.518  1.00 18.17 ? 162 ARG B C   1 
ATOM   3202  O  O   . ARG B  1 153 ? 3.530    83.974  13.035  1.00 16.46 ? 162 ARG B O   1 
ATOM   3203  C  CB  . ARG B  1 153 ? 2.832    83.124  15.985  1.00 23.38 ? 162 ARG B CB  1 
ATOM   3204  C  CG  . ARG B  1 153 ? 1.363    83.109  15.604  1.00 28.33 ? 162 ARG B CG  1 
ATOM   3205  C  CD  . ARG B  1 153 ? 0.506    83.381  16.827  1.00 34.83 ? 162 ARG B CD  1 
ATOM   3206  N  NE  . ARG B  1 153 ? -0.871   82.894  16.668  1.00 39.81 ? 162 ARG B NE  1 
ATOM   3207  C  CZ  . ARG B  1 153 ? -1.425   81.800  17.212  1.00 47.90 ? 162 ARG B CZ  1 
ATOM   3208  N  NH1 . ARG B  1 153 ? -0.740   80.969  18.006  1.00 45.97 ? 162 ARG B NH1 1 
ATOM   3209  N  NH2 . ARG B  1 153 ? -2.723   81.531  16.970  1.00 56.25 ? 162 ARG B NH2 1 
ATOM   3210  N  N   . CYS B  1 154 ? 2.665    81.929  12.844  1.00 16.74 ? 163 CYS B N   1 
ATOM   3211  C  CA  . CYS B  1 154 ? 2.180    82.190  11.521  1.00 18.45 ? 163 CYS B CA  1 
ATOM   3212  C  C   . CYS B  1 154 ? 0.723    82.561  11.597  1.00 21.44 ? 163 CYS B C   1 
ATOM   3213  O  O   . CYS B  1 154 ? 0.132    82.489  12.649  1.00 24.75 ? 163 CYS B O   1 
ATOM   3214  C  CB  . CYS B  1 154 ? 2.391    80.993  10.616  1.00 20.06 ? 163 CYS B CB  1 
ATOM   3215  S  SG  . CYS B  1 154 ? 1.323    79.571  10.926  1.00 20.60 ? 163 CYS B SG  1 
ATOM   3216  N  N   . LYS B  1 155 ? 0.135    82.984  10.490  1.00 22.39 ? 164 LYS B N   1 
ATOM   3217  C  CA  . LYS B  1 155 ? -1.301   83.201  10.446  1.00 23.52 ? 164 LYS B CA  1 
ATOM   3218  C  C   . LYS B  1 155 ? -2.032   81.883  10.212  1.00 24.14 ? 164 LYS B C   1 
ATOM   3219  O  O   . LYS B  1 155 ? -1.507   80.981  9.567   1.00 23.71 ? 164 LYS B O   1 
ATOM   3220  C  CB  . LYS B  1 155 ? -1.668   84.153  9.312   1.00 24.07 ? 164 LYS B CB  1 
ATOM   3221  C  CG  . LYS B  1 155 ? -0.995   85.512  9.434   1.00 26.13 ? 164 LYS B CG  1 
ATOM   3222  C  CD  . LYS B  1 155 ? -1.559   86.327  10.581  1.00 24.46 ? 164 LYS B CD  1 
ATOM   3223  C  CE  . LYS B  1 155 ? -1.286   87.779  10.309  1.00 27.36 ? 164 LYS B CE  1 
ATOM   3224  N  NZ  . LYS B  1 155 ? -1.647   88.636  11.455  1.00 28.72 ? 164 LYS B NZ  1 
ATOM   3225  N  N   . ASP B  1 156 ? -3.270   81.808  10.664  1.00 24.46 ? 165 ASP B N   1 
ATOM   3226  C  CA  . ASP B  1 156 ? -4.038   80.576  10.503  1.00 30.40 ? 165 ASP B CA  1 
ATOM   3227  C  C   . ASP B  1 156 ? -5.497   80.749  10.042  1.00 29.03 ? 165 ASP B C   1 
ATOM   3228  O  O   . ASP B  1 156 ? -6.195   79.756  9.898   1.00 33.22 ? 165 ASP B O   1 
ATOM   3229  C  CB  . ASP B  1 156 ? -4.047   79.793  11.816  1.00 34.95 ? 165 ASP B CB  1 
ATOM   3230  C  CG  . ASP B  1 156 ? -4.755   80.555  12.923  1.00 39.55 ? 165 ASP B CG  1 
ATOM   3231  O  OD1 . ASP B  1 156 ? -5.159   81.703  12.667  1.00 43.03 ? 165 ASP B OD1 1 
ATOM   3232  O  OD2 . ASP B  1 156 ? -4.955   80.012  14.035  1.00 54.88 ? 165 ASP B OD2 1 
ATOM   3233  N  N   . ASP B  1 157 ? -5.974   81.969  9.853   1.00 24.32 ? 166 ASP B N   1 
ATOM   3234  C  CA  . ASP B  1 157 ? -7.330   82.177  9.316   1.00 20.54 ? 166 ASP B CA  1 
ATOM   3235  C  C   . ASP B  1 157 ? -7.451   81.759  7.830   1.00 19.46 ? 166 ASP B C   1 
ATOM   3236  O  O   . ASP B  1 157 ? -6.554   81.140  7.264   1.00 18.06 ? 166 ASP B O   1 
ATOM   3237  C  CB  . ASP B  1 157 ? -7.766   83.629  9.576   1.00 19.62 ? 166 ASP B CB  1 
ATOM   3238  C  CG  . ASP B  1 157 ? -6.967   84.641  8.796   1.00 20.60 ? 166 ASP B CG  1 
ATOM   3239  O  OD1 . ASP B  1 157 ? -6.217   84.258  7.852   1.00 20.69 ? 166 ASP B OD1 1 
ATOM   3240  O  OD2 . ASP B  1 157 ? -7.138   85.851  9.049   1.00 21.67 ? 166 ASP B OD2 1 
ATOM   3241  N  N   . GLU B  1 158 ? -8.539   82.148  7.175   1.00 18.44 ? 167 GLU B N   1 
ATOM   3242  C  CA  . GLU B  1 158 ? -8.764   81.754  5.803   1.00 17.41 ? 167 GLU B CA  1 
ATOM   3243  C  C   . GLU B  1 158 ? -8.278   82.729  4.742   1.00 15.14 ? 167 GLU B C   1 
ATOM   3244  O  O   . GLU B  1 158 ? -8.468   82.494  3.564   1.00 15.91 ? 167 GLU B O   1 
ATOM   3245  C  CB  . GLU B  1 158 ? -10.264  81.458  5.599   1.00 19.54 ? 167 GLU B CB  1 
ATOM   3246  C  CG  . GLU B  1 158 ? -11.226  82.644  5.592   1.00 20.13 ? 167 GLU B CG  1 
ATOM   3247  C  CD  . GLU B  1 158 ? -11.779  83.026  6.985   1.00 21.78 ? 167 GLU B CD  1 
ATOM   3248  O  OE1 . GLU B  1 158 ? -10.981  83.117  7.946   1.00 23.79 ? 167 GLU B OE1 1 
ATOM   3249  O  OE2 . GLU B  1 158 ? -13.017  83.258  7.114   1.00 23.57 ? 167 GLU B OE2 1 
ATOM   3250  N  N   . PHE B  1 159 ? -7.721   83.854  5.151   1.00 14.40 ? 168 PHE B N   1 
ATOM   3251  C  CA  . PHE B  1 159 ? -7.442   84.953  4.240   1.00 13.71 ? 168 PHE B CA  1 
ATOM   3252  C  C   . PHE B  1 159 ? -6.014   84.870  3.669   1.00 12.55 ? 168 PHE B C   1 
ATOM   3253  O  O   . PHE B  1 159 ? -5.230   84.025  4.063   1.00 11.88 ? 168 PHE B O   1 
ATOM   3254  C  CB  . PHE B  1 159 ? -7.741   86.297  4.898   1.00 14.22 ? 168 PHE B CB  1 
ATOM   3255  C  CG  . PHE B  1 159 ? -9.182   86.458  5.294   1.00 14.32 ? 168 PHE B CG  1 
ATOM   3256  C  CD1 . PHE B  1 159 ? -10.138  86.803  4.353   1.00 15.50 ? 168 PHE B CD1 1 
ATOM   3257  C  CD2 . PHE B  1 159 ? -9.587   86.228  6.595   1.00 15.21 ? 168 PHE B CD2 1 
ATOM   3258  C  CE1 . PHE B  1 159 ? -11.494  86.884  4.692   1.00 15.67 ? 168 PHE B CE1 1 
ATOM   3259  C  CE2 . PHE B  1 159 ? -10.943  86.343  6.963   1.00 14.70 ? 168 PHE B CE2 1 
ATOM   3260  C  CZ  . PHE B  1 159 ? -11.890  86.676  6.013   1.00 15.03 ? 168 PHE B CZ  1 
ATOM   3261  N  N   . THR B  1 160 ? -5.741   85.696  2.683   1.00 13.11 ? 169 THR B N   1 
ATOM   3262  C  CA  . THR B  1 160 ? -4.420   85.738  2.034   1.00 13.69 ? 169 THR B CA  1 
ATOM   3263  C  C   . THR B  1 160 ? -3.415   86.458  2.941   1.00 13.45 ? 169 THR B C   1 
ATOM   3264  O  O   . THR B  1 160 ? -3.605   87.631  3.298   1.00 14.03 ? 169 THR B O   1 
ATOM   3265  C  CB  . THR B  1 160 ? -4.515   86.453  0.680   1.00 13.86 ? 169 THR B CB  1 
ATOM   3266  O  OG1 . THR B  1 160 ? -5.396   85.740  -0.177  1.00 13.97 ? 169 THR B OG1 1 
ATOM   3267  C  CG2 . THR B  1 160 ? -3.185   86.522  -0.049  1.00 14.72 ? 169 THR B CG2 1 
ATOM   3268  N  N   . HIS B  1 161 ? -2.300   85.805  3.232   1.00 12.66 ? 170 HIS B N   1 
ATOM   3269  C  CA  . HIS B  1 161 ? -1.206   86.485  3.939   1.00 13.34 ? 170 HIS B CA  1 
ATOM   3270  C  C   . HIS B  1 161 ? 0.142    86.502  3.195   1.00 12.69 ? 170 HIS B C   1 
ATOM   3271  O  O   . HIS B  1 161 ? 0.475    85.559  2.511   1.00 12.70 ? 170 HIS B O   1 
ATOM   3272  C  CB  . HIS B  1 161 ? -1.067   85.926  5.333   1.00 12.85 ? 170 HIS B CB  1 
ATOM   3273  C  CG  . HIS B  1 161 ? -2.307   86.122  6.128   1.00 12.89 ? 170 HIS B CG  1 
ATOM   3274  N  ND1 . HIS B  1 161 ? -2.738   87.365  6.538   1.00 13.52 ? 170 HIS B ND1 1 
ATOM   3275  C  CD2 . HIS B  1 161 ? -3.274   85.257  6.498   1.00 12.73 ? 170 HIS B CD2 1 
ATOM   3276  C  CE1 . HIS B  1 161 ? -3.878   87.244  7.201   1.00 12.62 ? 170 HIS B CE1 1 
ATOM   3277  N  NE2 . HIS B  1 161 ? -4.230   85.981  7.178   1.00 12.29 ? 170 HIS B NE2 1 
ATOM   3278  N  N   . LEU B  1 162 ? 0.862    87.622  3.351   1.00 12.74 ? 171 LEU B N   1 
ATOM   3279  C  CA  . LEU B  1 162 ? 2.169    87.872  2.713   1.00 10.93 ? 171 LEU B CA  1 
ATOM   3280  C  C   . LEU B  1 162 ? 3.265    87.433  3.646   1.00 9.84  ? 171 LEU B C   1 
ATOM   3281  O  O   . LEU B  1 162 ? 3.342    87.859  4.778   1.00 8.12  ? 171 LEU B O   1 
ATOM   3282  C  CB  . LEU B  1 162 ? 2.309    89.354  2.377   1.00 11.91 ? 171 LEU B CB  1 
ATOM   3283  C  CG  . LEU B  1 162 ? 3.568    89.714  1.563   1.00 12.82 ? 171 LEU B CG  1 
ATOM   3284  C  CD1 . LEU B  1 162 ? 3.476    89.252  0.115   1.00 13.12 ? 171 LEU B CD1 1 
ATOM   3285  C  CD2 . LEU B  1 162 ? 3.811    91.197  1.580   1.00 13.64 ? 171 LEU B CD2 1 
ATOM   3286  N  N   . TYR B  1 163 ? 4.106    86.536  3.153   1.00 9.97  ? 172 TYR B N   1 
ATOM   3287  C  CA  . TYR B  1 163 ? 5.298    86.081  3.875   1.00 9.70  ? 172 TYR B CA  1 
ATOM   3288  C  C   . TYR B  1 163 ? 6.606    86.516  3.190   1.00 9.73  ? 172 TYR B C   1 
ATOM   3289  O  O   . TYR B  1 163 ? 6.805    86.351  1.992   1.00 9.85  ? 172 TYR B O   1 
ATOM   3290  C  CB  . TYR B  1 163 ? 5.303    84.577  4.015   1.00 9.35  ? 172 TYR B CB  1 
ATOM   3291  C  CG  . TYR B  1 163 ? 4.298    84.122  5.015   1.00 9.57  ? 172 TYR B CG  1 
ATOM   3292  C  CD1 . TYR B  1 163 ? 4.612    84.049  6.375   1.00 9.95  ? 172 TYR B CD1 1 
ATOM   3293  C  CD2 . TYR B  1 163 ? 2.997    83.842  4.643   1.00 9.42  ? 172 TYR B CD2 1 
ATOM   3294  C  CE1 . TYR B  1 163 ? 3.662    83.660  7.326   1.00 9.39  ? 172 TYR B CE1 1 
ATOM   3295  C  CE2 . TYR B  1 163 ? 2.066    83.431  5.556   1.00 9.05  ? 172 TYR B CE2 1 
ATOM   3296  C  CZ  . TYR B  1 163 ? 2.389    83.349  6.891   1.00 9.84  ? 172 TYR B CZ  1 
ATOM   3297  O  OH  . TYR B  1 163 ? 1.437    82.899  7.813   1.00 9.74  ? 172 TYR B OH  1 
ATOM   3298  N  N   . THR B  1 164 ? 7.486    87.111  3.963   1.00 9.96  ? 173 THR B N   1 
ATOM   3299  C  CA  . THR B  1 164 ? 8.720    87.736  3.406   1.00 10.08 ? 173 THR B CA  1 
ATOM   3300  C  C   . THR B  1 164 ? 9.901    87.336  4.282   1.00 10.61 ? 173 THR B C   1 
ATOM   3301  O  O   . THR B  1 164 ? 9.900    87.578  5.521   1.00 11.16 ? 173 THR B O   1 
ATOM   3302  C  CB  . THR B  1 164 ? 8.649    89.268  3.416   1.00 9.83  ? 173 THR B CB  1 
ATOM   3303  O  OG1 . THR B  1 164 ? 7.457    89.739  2.766   1.00 9.62  ? 173 THR B OG1 1 
ATOM   3304  C  CG2 . THR B  1 164 ? 9.903    89.921  2.680   1.00 10.09 ? 173 THR B CG2 1 
ATOM   3305  N  N   . LEU B  1 165 ? 10.927   86.799  3.646   1.00 10.43 ? 174 LEU B N   1 
ATOM   3306  C  CA  . LEU B  1 165 ? 12.207   86.579  4.286   1.00 10.50 ? 174 LEU B CA  1 
ATOM   3307  C  C   . LEU B  1 165 ? 13.290   87.434  3.640   1.00 10.58 ? 174 LEU B C   1 
ATOM   3308  O  O   . LEU B  1 165 ? 13.484   87.422  2.443   1.00 10.12 ? 174 LEU B O   1 
ATOM   3309  C  CB  . LEU B  1 165 ? 12.628   85.129  4.200   1.00 10.74 ? 174 LEU B CB  1 
ATOM   3310  C  CG  . LEU B  1 165 ? 14.051   84.800  4.680   1.00 11.11 ? 174 LEU B CG  1 
ATOM   3311  C  CD1 . LEU B  1 165 ? 14.172   84.900  6.183   1.00 11.17 ? 174 LEU B CD1 1 
ATOM   3312  C  CD2 . LEU B  1 165 ? 14.456   83.402  4.262   1.00 11.53 ? 174 LEU B CD2 1 
ATOM   3313  N  N   . ILE B  1 166 ? 14.026   88.129  4.492   1.00 10.86 ? 175 ILE B N   1 
ATOM   3314  C  CA  . ILE B  1 166 ? 15.134   88.980  4.094   1.00 10.85 ? 175 ILE B CA  1 
ATOM   3315  C  C   . ILE B  1 166 ? 16.389   88.464  4.731   1.00 10.49 ? 175 ILE B C   1 
ATOM   3316  O  O   . ILE B  1 166 ? 16.485   88.354  5.973   1.00 9.85  ? 175 ILE B O   1 
ATOM   3317  C  CB  . ILE B  1 166 ? 14.936   90.434  4.596   1.00 11.85 ? 175 ILE B CB  1 
ATOM   3318  C  CG1 . ILE B  1 166 ? 13.702   90.965  3.897   1.00 11.59 ? 175 ILE B CG1 1 
ATOM   3319  C  CG2 . ILE B  1 166 ? 16.103   91.362  4.166   1.00 12.19 ? 175 ILE B CG2 1 
ATOM   3320  C  CD1 . ILE B  1 166 ? 13.195   92.332  4.245   1.00 12.51 ? 175 ILE B CD1 1 
ATOM   3321  N  N   . VAL B  1 167 ? 17.374   88.226  3.892   1.00 10.40 ? 176 VAL B N   1 
ATOM   3322  C  CA  . VAL B  1 167 ? 18.728   87.796  4.354   1.00 11.16 ? 176 VAL B CA  1 
ATOM   3323  C  C   . VAL B  1 167 ? 19.814   88.735  3.811   1.00 10.53 ? 176 VAL B C   1 
ATOM   3324  O  O   . VAL B  1 167 ? 19.918   88.908  2.595   1.00 10.55 ? 176 VAL B O   1 
ATOM   3325  C  CB  . VAL B  1 167 ? 19.047   86.375  3.863   1.00 11.50 ? 176 VAL B CB  1 
ATOM   3326  C  CG1 . VAL B  1 167 ? 20.413   85.939  4.354   1.00 11.66 ? 176 VAL B CG1 1 
ATOM   3327  C  CG2 . VAL B  1 167 ? 17.964   85.399  4.314   1.00 11.70 ? 176 VAL B CG2 1 
ATOM   3328  N  N   . ARG B  1 168 ? 20.647   89.265  4.690   1.00 10.88 ? 177 ARG B N   1 
ATOM   3329  C  CA  . ARG B  1 168 ? 21.622   90.291  4.307   1.00 12.23 ? 177 ARG B CA  1 
ATOM   3330  C  C   . ARG B  1 168 ? 23.074   89.816  4.454   1.00 12.77 ? 177 ARG B C   1 
ATOM   3331  O  O   . ARG B  1 168 ? 23.340   89.004  5.311   1.00 13.24 ? 177 ARG B O   1 
ATOM   3332  C  CB  . ARG B  1 168 ? 21.433   91.552  5.152   1.00 12.62 ? 177 ARG B CB  1 
ATOM   3333  C  CG  . ARG B  1 168 ? 20.063   92.173  5.006   1.00 13.00 ? 177 ARG B CG  1 
ATOM   3334  C  CD  . ARG B  1 168 ? 20.010   93.495  5.744   1.00 13.83 ? 177 ARG B CD  1 
ATOM   3335  N  NE  . ARG B  1 168 ? 18.636   93.970  5.933   1.00 13.70 ? 177 ARG B NE  1 
ATOM   3336  C  CZ  . ARG B  1 168 ? 17.910   93.734  7.009   1.00 13.27 ? 177 ARG B CZ  1 
ATOM   3337  N  NH1 . ARG B  1 168 ? 18.395   93.013  8.002   1.00 13.36 ? 177 ARG B NH1 1 
ATOM   3338  N  NH2 . ARG B  1 168 ? 16.694   94.237  7.094   1.00 13.57 ? 177 ARG B NH2 1 
ATOM   3339  N  N   . PRO B  1 169 ? 24.005   90.379  3.664   1.00 13.15 ? 178 PRO B N   1 
ATOM   3340  C  CA  . PRO B  1 169 ? 25.387   89.944  3.657   1.00 14.79 ? 178 PRO B CA  1 
ATOM   3341  C  C   . PRO B  1 169 ? 26.196   90.253  4.923   1.00 15.44 ? 178 PRO B C   1 
ATOM   3342  O  O   . PRO B  1 169 ? 27.295   89.810  5.017   1.00 15.66 ? 178 PRO B O   1 
ATOM   3343  C  CB  . PRO B  1 169 ? 25.988   90.616  2.431   1.00 15.21 ? 178 PRO B CB  1 
ATOM   3344  C  CG  . PRO B  1 169 ? 25.043   91.693  2.024   1.00 14.66 ? 178 PRO B CG  1 
ATOM   3345  C  CD  . PRO B  1 169 ? 23.785   91.552  2.803   1.00 14.44 ? 178 PRO B CD  1 
ATOM   3346  N  N   . ASP B  1 170 ? 25.651   90.980  5.894   1.00 15.99 ? 179 ASP B N   1 
ATOM   3347  C  CA  . ASP B  1 170 ? 26.236   91.010  7.234   1.00 16.21 ? 179 ASP B CA  1 
ATOM   3348  C  C   . ASP B  1 170 ? 25.681   89.940  8.156   1.00 15.24 ? 179 ASP B C   1 
ATOM   3349  O  O   . ASP B  1 170 ? 25.809   90.024  9.345   1.00 13.72 ? 179 ASP B O   1 
ATOM   3350  C  CB  . ASP B  1 170 ? 26.059   92.399  7.893   1.00 19.27 ? 179 ASP B CB  1 
ATOM   3351  C  CG  . ASP B  1 170 ? 24.593   92.854  7.998   1.00 21.35 ? 179 ASP B CG  1 
ATOM   3352  O  OD1 . ASP B  1 170 ? 23.674   92.072  7.684   1.00 24.42 ? 179 ASP B OD1 1 
ATOM   3353  O  OD2 . ASP B  1 170 ? 24.353   94.044  8.299   1.00 25.61 ? 179 ASP B OD2 1 
ATOM   3354  N  N   . ASN B  1 171 ? 24.974   88.975  7.586   1.00 17.00 ? 180 ASN B N   1 
ATOM   3355  C  CA  . ASN B  1 171 ? 24.354   87.871  8.341   1.00 16.71 ? 180 ASN B CA  1 
ATOM   3356  C  C   . ASN B  1 171 ? 23.243   88.317  9.243   1.00 16.15 ? 180 ASN B C   1 
ATOM   3357  O  O   . ASN B  1 171 ? 22.982   87.680  10.246  1.00 16.77 ? 180 ASN B O   1 
ATOM   3358  C  CB  . ASN B  1 171 ? 25.401   87.112  9.164   1.00 17.20 ? 180 ASN B CB  1 
ATOM   3359  C  CG  . ASN B  1 171 ? 26.250   86.174  8.300   1.00 20.15 ? 180 ASN B CG  1 
ATOM   3360  O  OD1 . ASN B  1 171 ? 25.741   85.402  7.488   1.00 22.19 ? 180 ASN B OD1 1 
ATOM   3361  N  ND2 . ASN B  1 171 ? 27.531   86.171  8.529   1.00 23.11 ? 180 ASN B ND2 1 
ATOM   3362  N  N   . THR B  1 172 ? 22.605   89.428  8.920   1.00 15.18 ? 181 THR B N   1 
ATOM   3363  C  CA  . THR B  1 172 ? 21.361   89.756  9.573   1.00 15.51 ? 181 THR B CA  1 
ATOM   3364  C  C   . THR B  1 172 ? 20.166   89.245  8.733   1.00 14.22 ? 181 THR B C   1 
ATOM   3365  O  O   . THR B  1 172 ? 20.286   88.990  7.544   1.00 14.57 ? 181 THR B O   1 
ATOM   3366  C  CB  . THR B  1 172 ? 21.185   91.266  9.780   1.00 16.76 ? 181 THR B CB  1 
ATOM   3367  O  OG1 . THR B  1 172 ? 21.293   91.943  8.534   1.00 18.27 ? 181 THR B OG1 1 
ATOM   3368  C  CG2 . THR B  1 172 ? 22.217   91.800  10.751  1.00 17.33 ? 181 THR B CG2 1 
ATOM   3369  N  N   . TYR B  1 173 ? 19.033   89.056  9.382   1.00 12.39 ? 182 TYR B N   1 
ATOM   3370  C  CA  . TYR B  1 173 ? 17.855   88.630  8.682   1.00 12.42 ? 182 TYR B CA  1 
ATOM   3371  C  C   . TYR B  1 173 ? 16.653   89.322  9.280   1.00 12.39 ? 182 TYR B C   1 
ATOM   3372  O  O   . TYR B  1 173 ? 16.643   89.737  10.437  1.00 12.31 ? 182 TYR B O   1 
ATOM   3373  C  CB  . TYR B  1 173 ? 17.661   87.077  8.766   1.00 11.81 ? 182 TYR B CB  1 
ATOM   3374  C  CG  . TYR B  1 173 ? 17.097   86.662  10.095  1.00 11.40 ? 182 TYR B CG  1 
ATOM   3375  C  CD1 . TYR B  1 173 ? 17.911   86.613  11.196  1.00 11.98 ? 182 TYR B CD1 1 
ATOM   3376  C  CD2 . TYR B  1 173 ? 15.725   86.426  10.276  1.00 11.35 ? 182 TYR B CD2 1 
ATOM   3377  C  CE1 . TYR B  1 173 ? 17.409   86.292  12.468  1.00 12.13 ? 182 TYR B CE1 1 
ATOM   3378  C  CE2 . TYR B  1 173 ? 15.204   86.131  11.550  1.00 11.02 ? 182 TYR B CE2 1 
ATOM   3379  C  CZ  . TYR B  1 173 ? 16.066   86.030  12.632  1.00 11.29 ? 182 TYR B CZ  1 
ATOM   3380  O  OH  . TYR B  1 173 ? 15.630   85.756  13.883  1.00 10.16 ? 182 TYR B OH  1 
ATOM   3381  N  N   . GLU B  1 174 ? 15.588   89.300  8.532   1.00 12.71 ? 183 GLU B N   1 
ATOM   3382  C  CA  . GLU B  1 174 ? 14.320   89.828  9.002   1.00 14.40 ? 183 GLU B CA  1 
ATOM   3383  C  C   . GLU B  1 174 ? 13.200   88.963  8.395   1.00 13.44 ? 183 GLU B C   1 
ATOM   3384  O  O   . GLU B  1 174 ? 13.260   88.550  7.238   1.00 13.51 ? 183 GLU B O   1 
ATOM   3385  C  CB  . GLU B  1 174 ? 14.203   91.281  8.551   1.00 15.83 ? 183 GLU B CB  1 
ATOM   3386  C  CG  . GLU B  1 174 ? 13.008   92.027  9.024   1.00 19.55 ? 183 GLU B CG  1 
ATOM   3387  C  CD  . GLU B  1 174 ? 13.073   93.527  8.666   1.00 22.74 ? 183 GLU B CD  1 
ATOM   3388  O  OE1 . GLU B  1 174 ? 14.178   94.090  8.458   1.00 26.45 ? 183 GLU B OE1 1 
ATOM   3389  O  OE2 . GLU B  1 174 ? 12.007   94.166  8.659   1.00 24.93 ? 183 GLU B OE2 1 
ATOM   3390  N  N   . VAL B  1 175 ? 12.172   88.718  9.187   1.00 13.53 ? 184 VAL B N   1 
ATOM   3391  C  CA  . VAL B  1 175 ? 10.953   88.056  8.708   1.00 11.69 ? 184 VAL B CA  1 
ATOM   3392  C  C   . VAL B  1 175 ? 9.782    88.997  8.864   1.00 10.82 ? 184 VAL B C   1 
ATOM   3393  O  O   . VAL B  1 175 ? 9.555    89.606  9.919   1.00 10.06 ? 184 VAL B O   1 
ATOM   3394  C  CB  . VAL B  1 175 ? 10.677   86.760  9.460   1.00 12.28 ? 184 VAL B CB  1 
ATOM   3395  C  CG1 . VAL B  1 175 ? 9.348    86.121  8.986   1.00 12.44 ? 184 VAL B CG1 1 
ATOM   3396  C  CG2 . VAL B  1 175 ? 11.796   85.771  9.272   1.00 12.82 ? 184 VAL B CG2 1 
ATOM   3397  N  N   . LYS B  1 176 ? 9.047    89.131  7.777   1.00 11.14 ? 185 LYS B N   1 
ATOM   3398  C  CA  . LYS B  1 176 ? 7.802    89.901  7.747   1.00 11.58 ? 185 LYS B CA  1 
ATOM   3399  C  C   . LYS B  1 176 ? 6.555    89.063  7.401   1.00 11.22 ? 185 LYS B C   1 
ATOM   3400  O  O   . LYS B  1 176 ? 6.595    88.179  6.576   1.00 11.16 ? 185 LYS B O   1 
ATOM   3401  C  CB  . LYS B  1 176 ? 7.885    90.967  6.715   1.00 11.74 ? 185 LYS B CB  1 
ATOM   3402  C  CG  . LYS B  1 176 ? 8.959    91.978  6.955   1.00 13.15 ? 185 LYS B CG  1 
ATOM   3403  C  CD  . LYS B  1 176 ? 8.764    93.085  5.936   1.00 14.45 ? 185 LYS B CD  1 
ATOM   3404  C  CE  . LYS B  1 176 ? 10.031   93.802  5.706   1.00 16.38 ? 185 LYS B CE  1 
ATOM   3405  N  NZ  . LYS B  1 176 ? 9.847    95.220  5.322   1.00 18.66 ? 185 LYS B NZ  1 
ATOM   3406  N  N   . ILE B  1 177 ? 5.465    89.397  8.056   1.00 11.38 ? 186 ILE B N   1 
ATOM   3407  C  CA  . ILE B  1 177 ? 4.115    88.904  7.706   1.00 11.33 ? 186 ILE B CA  1 
ATOM   3408  C  C   . ILE B  1 177 ? 3.237    90.090  7.401   1.00 11.38 ? 186 ILE B C   1 
ATOM   3409  O  O   . ILE B  1 177 ? 3.231    91.094  8.157   1.00 10.89 ? 186 ILE B O   1 
ATOM   3410  C  CB  . ILE B  1 177 ? 3.491    88.072  8.805   1.00 11.23 ? 186 ILE B CB  1 
ATOM   3411  C  CG1 . ILE B  1 177 ? 4.413    86.902  9.083   1.00 11.55 ? 186 ILE B CG1 1 
ATOM   3412  C  CG2 . ILE B  1 177 ? 2.155    87.538  8.346   1.00 11.38 ? 186 ILE B CG2 1 
ATOM   3413  C  CD1 . ILE B  1 177 ? 4.036    86.029  10.276  1.00 11.31 ? 186 ILE B CD1 1 
ATOM   3414  N  N   . ASP B  1 178 ? 2.555    90.019  6.256   1.00 11.83 ? 187 ASP B N   1 
ATOM   3415  C  CA  . ASP B  1 178 ? 1.708    91.134  5.795   1.00 12.48 ? 187 ASP B CA  1 
ATOM   3416  C  C   . ASP B  1 178 ? 2.469    92.465  5.820   1.00 13.11 ? 187 ASP B C   1 
ATOM   3417  O  O   . ASP B  1 178 ? 1.945    93.476  6.263   1.00 12.76 ? 187 ASP B O   1 
ATOM   3418  C  CB  . ASP B  1 178 ? 0.417    91.201  6.647   1.00 12.79 ? 187 ASP B CB  1 
ATOM   3419  C  CG  . ASP B  1 178 ? -0.464   89.978  6.442   1.00 13.02 ? 187 ASP B CG  1 
ATOM   3420  O  OD1 . ASP B  1 178 ? -0.202   89.255  5.457   1.00 14.52 ? 187 ASP B OD1 1 
ATOM   3421  O  OD2 . ASP B  1 178 ? -1.371   89.703  7.244   1.00 12.85 ? 187 ASP B OD2 1 
ATOM   3422  N  N   . ASN B  1 179 ? 3.707    92.415  5.320   1.00 13.10 ? 188 ASN B N   1 
ATOM   3423  C  CA  . ASN B  1 179 ? 4.590    93.576  5.139   1.00 13.36 ? 188 ASN B CA  1 
ATOM   3424  C  C   . ASN B  1 179 ? 4.963    94.276  6.395   1.00 12.88 ? 188 ASN B C   1 
ATOM   3425  O  O   . ASN B  1 179 ? 5.226    95.458  6.409   1.00 13.08 ? 188 ASN B O   1 
ATOM   3426  C  CB  . ASN B  1 179 ? 4.025    94.592  4.137   1.00 13.82 ? 188 ASN B CB  1 
ATOM   3427  C  CG  . ASN B  1 179 ? 4.829    94.668  2.841   1.00 14.59 ? 188 ASN B CG  1 
ATOM   3428  O  OD1 . ASN B  1 179 ? 5.963    94.187  2.749   1.00 15.69 ? 188 ASN B OD1 1 
ATOM   3429  N  ND2 . ASN B  1 179 ? 4.217    95.213  1.817   1.00 15.62 ? 188 ASN B ND2 1 
ATOM   3430  N  N   . SER B  1 180 ? 4.992    93.550  7.471   1.00 14.27 ? 189 SER B N   1 
ATOM   3431  C  CA  . SER B  1 180 ? 5.293    94.160  8.736   1.00 15.60 ? 189 SER B CA  1 
ATOM   3432  C  C   . SER B  1 180 ? 6.147    93.194  9.508   1.00 16.21 ? 189 SER B C   1 
ATOM   3433  O  O   . SER B  1 180 ? 5.846    92.006  9.566   1.00 15.17 ? 189 SER B O   1 
ATOM   3434  C  CB  . SER B  1 180 ? 4.002    94.509  9.458   1.00 16.71 ? 189 SER B CB  1 
ATOM   3435  O  OG  . SER B  1 180 ? 4.291    94.851  10.780  1.00 19.58 ? 189 SER B OG  1 
ATOM   3436  N  N   . GLN B  1 181 ? 7.235    93.719  10.071  1.00 16.79 ? 190 GLN B N   1 
ATOM   3437  C  CA  . GLN B  1 181 ? 8.262    92.906  10.697  1.00 17.77 ? 190 GLN B CA  1 
ATOM   3438  C  C   . GLN B  1 181 ? 7.710    92.159  11.869  1.00 17.49 ? 190 GLN B C   1 
ATOM   3439  O  O   . GLN B  1 181 ? 6.989    92.723  12.663  1.00 18.89 ? 190 GLN B O   1 
ATOM   3440  C  CB  . GLN B  1 181 ? 9.400    93.781  11.218  1.00 19.94 ? 190 GLN B CB  1 
ATOM   3441  C  CG  . GLN B  1 181 ? 10.478   92.984  11.943  1.00 23.40 ? 190 GLN B CG  1 
ATOM   3442  C  CD  . GLN B  1 181 ? 11.661   93.822  12.424  1.00 26.11 ? 190 GLN B CD  1 
ATOM   3443  O  OE1 . GLN B  1 181 ? 12.080   93.683  13.578  1.00 30.73 ? 190 GLN B OE1 1 
ATOM   3444  N  NE2 . GLN B  1 181 ? 12.219   94.637  11.566  1.00 24.18 ? 190 GLN B NE2 1 
ATOM   3445  N  N   . VAL B  1 182 ? 8.053    90.892  11.984  1.00 16.75 ? 191 VAL B N   1 
ATOM   3446  C  CA  . VAL B  1 182 ? 7.639    90.100  13.142  1.00 16.56 ? 191 VAL B CA  1 
ATOM   3447  C  C   . VAL B  1 182 ? 8.836    89.532  13.852  1.00 16.50 ? 191 VAL B C   1 
ATOM   3448  O  O   . VAL B  1 182 ? 8.721    89.045  14.938  1.00 16.75 ? 191 VAL B O   1 
ATOM   3449  C  CB  . VAL B  1 182 ? 6.634    88.954  12.769  1.00 16.60 ? 191 VAL B CB  1 
ATOM   3450  C  CG1 . VAL B  1 182 ? 5.294    89.524  12.292  1.00 17.23 ? 191 VAL B CG1 1 
ATOM   3451  C  CG2 . VAL B  1 182 ? 7.195    88.042  11.696  1.00 17.27 ? 191 VAL B CG2 1 
ATOM   3452  N  N   . GLU B  1 183 ? 9.964    89.456  13.161  1.00 17.40 ? 192 GLU B N   1 
ATOM   3453  C  CA  . GLU B  1 183 ? 11.159   88.884  13.757  1.00 17.35 ? 192 GLU B CA  1 
ATOM   3454  C  C   . GLU B  1 183 ? 12.416   89.447  13.077  1.00 15.80 ? 192 GLU B C   1 
ATOM   3455  O  O   . GLU B  1 183 ? 12.443   89.676  11.866  1.00 16.46 ? 192 GLU B O   1 
ATOM   3456  C  CB  . GLU B  1 183 ? 11.125   87.342  13.677  1.00 19.73 ? 192 GLU B CB  1 
ATOM   3457  C  CG  . GLU B  1 183 ? 12.026   86.589  14.678  1.00 21.58 ? 192 GLU B CG  1 
ATOM   3458  C  CD  . GLU B  1 183 ? 12.066   87.273  16.056  1.00 24.39 ? 192 GLU B CD  1 
ATOM   3459  O  OE1 . GLU B  1 183 ? 11.068   87.127  16.807  1.00 23.85 ? 192 GLU B OE1 1 
ATOM   3460  O  OE2 . GLU B  1 183 ? 13.048   88.027  16.369  1.00 22.77 ? 192 GLU B OE2 1 
ATOM   3461  N  N   . SER B  1 184 ? 13.489   89.539  13.831  1.00 15.19 ? 193 SER B N   1 
ATOM   3462  C  CA  . SER B  1 184 ? 14.771   89.925  13.265  1.00 15.06 ? 193 SER B CA  1 
ATOM   3463  C  C   . SER B  1 184 ? 15.957   89.532  14.161  1.00 14.86 ? 193 SER B C   1 
ATOM   3464  O  O   . SER B  1 184 ? 15.794   89.219  15.312  1.00 13.70 ? 193 SER B O   1 
ATOM   3465  C  CB  . SER B  1 184 ? 14.821   91.430  12.993  1.00 16.35 ? 193 SER B CB  1 
ATOM   3466  O  OG  . SER B  1 184 ? 14.624   92.176  14.186  1.00 15.68 ? 193 SER B OG  1 
ATOM   3467  N  N   . GLY B  1 185 ? 17.144   89.539  13.580  1.00 14.95 ? 194 GLY B N   1 
ATOM   3468  C  CA  . GLY B  1 185 ? 18.343   89.240  14.325  1.00 15.60 ? 194 GLY B CA  1 
ATOM   3469  C  C   . GLY B  1 185 ? 19.515   88.886  13.443  1.00 14.82 ? 194 GLY B C   1 
ATOM   3470  O  O   . GLY B  1 185 ? 19.558   89.248  12.268  1.00 19.15 ? 194 GLY B O   1 
ATOM   3471  N  N   . SER B  1 186 ? 20.433   88.121  13.994  1.00 15.09 ? 195 SER B N   1 
ATOM   3472  C  CA  . SER B  1 186 ? 21.616   87.622  13.268  1.00 15.69 ? 195 SER B CA  1 
ATOM   3473  C  C   . SER B  1 186 ? 21.628   86.111  13.205  1.00 15.88 ? 195 SER B C   1 
ATOM   3474  O  O   . SER B  1 186 ? 21.197   85.424  14.144  1.00 15.72 ? 195 SER B O   1 
ATOM   3475  C  CB  . SER B  1 186 ? 22.906   88.098  13.946  1.00 15.65 ? 195 SER B CB  1 
ATOM   3476  O  OG  . SER B  1 186 ? 22.953   89.506  13.825  1.00 15.78 ? 195 SER B OG  1 
ATOM   3477  N  N   . LEU B  1 187 ? 22.116   85.611  12.082  1.00 16.56 ? 196 LEU B N   1 
ATOM   3478  C  CA  . LEU B  1 187 ? 22.191   84.205  11.844  1.00 18.18 ? 196 LEU B CA  1 
ATOM   3479  C  C   . LEU B  1 187 ? 22.957   83.516  12.949  1.00 19.37 ? 196 LEU B C   1 
ATOM   3480  O  O   . LEU B  1 187 ? 22.586   82.440  13.392  1.00 20.61 ? 196 LEU B O   1 
ATOM   3481  C  CB  . LEU B  1 187 ? 22.836   83.946  10.487  1.00 20.60 ? 196 LEU B CB  1 
ATOM   3482  C  CG  . LEU B  1 187 ? 22.163   84.301  9.158   1.00 22.14 ? 196 LEU B CG  1 
ATOM   3483  C  CD1 . LEU B  1 187 ? 22.508   83.353  8.045   1.00 24.77 ? 196 LEU B CD1 1 
ATOM   3484  C  CD2 . LEU B  1 187 ? 20.680   84.307  9.307   1.00 22.93 ? 196 LEU B CD2 1 
ATOM   3485  N  N   . GLU B  1 188 ? 24.047   84.120  13.402  1.00 22.34 ? 197 GLU B N   1 
ATOM   3486  C  CA  . GLU B  1 188 ? 24.925   83.438  14.363  1.00 25.30 ? 197 GLU B CA  1 
ATOM   3487  C  C   . GLU B  1 188 ? 24.215   83.255  15.685  1.00 23.15 ? 197 GLU B C   1 
ATOM   3488  O  O   . GLU B  1 188 ? 24.495   82.296  16.371  1.00 23.68 ? 197 GLU B O   1 
ATOM   3489  C  CB  . GLU B  1 188 ? 26.240   84.168  14.631  1.00 28.48 ? 197 GLU B CB  1 
ATOM   3490  C  CG  . GLU B  1 188 ? 26.962   84.718  13.385  1.00 32.12 ? 197 GLU B CG  1 
ATOM   3491  C  CD  . GLU B  1 188 ? 26.299   86.054  12.902  1.00 34.01 ? 197 GLU B CD  1 
ATOM   3492  O  OE1 . GLU B  1 188 ? 26.215   87.049  13.648  1.00 40.81 ? 197 GLU B OE1 1 
ATOM   3493  O  OE2 . GLU B  1 188 ? 25.760   86.145  11.793  1.00 36.89 ? 197 GLU B OE2 1 
ATOM   3494  N  N   . ASP B  1 189 ? 23.308   84.164  16.035  1.00 21.29 ? 198 ASP B N   1 
ATOM   3495  C  CA  . ASP B  1 189 ? 22.615   84.095  17.335  1.00 22.73 ? 198 ASP B CA  1 
ATOM   3496  C  C   . ASP B  1 189 ? 21.349   83.247  17.281  1.00 22.63 ? 198 ASP B C   1 
ATOM   3497  O  O   . ASP B  1 189 ? 21.018   82.555  18.217  1.00 18.98 ? 198 ASP B O   1 
ATOM   3498  C  CB  . ASP B  1 189 ? 22.213   85.497  17.874  1.00 23.20 ? 198 ASP B CB  1 
ATOM   3499  C  CG  . ASP B  1 189 ? 23.376   86.514  17.892  1.00 24.00 ? 198 ASP B CG  1 
ATOM   3500  O  OD1 . ASP B  1 189 ? 24.467   86.188  18.368  1.00 26.79 ? 198 ASP B OD1 1 
ATOM   3501  O  OD2 . ASP B  1 189 ? 23.202   87.648  17.438  1.00 27.45 ? 198 ASP B OD2 1 
ATOM   3502  N  N   . ASP B  1 190 ? 20.627   83.310  16.166  1.00 25.23 ? 199 ASP B N   1 
ATOM   3503  C  CA  . ASP B  1 190 ? 19.273   82.722  16.111  1.00 24.59 ? 199 ASP B CA  1 
ATOM   3504  C  C   . ASP B  1 190 ? 19.222   81.291  15.538  1.00 25.93 ? 199 ASP B C   1 
ATOM   3505  O  O   . ASP B  1 190 ? 18.160   80.665  15.469  1.00 25.35 ? 199 ASP B O   1 
ATOM   3506  C  CB  . ASP B  1 190 ? 18.340   83.676  15.376  1.00 24.64 ? 199 ASP B CB  1 
ATOM   3507  C  CG  . ASP B  1 190 ? 18.093   84.979  16.165  1.00 24.98 ? 199 ASP B CG  1 
ATOM   3508  O  OD1 . ASP B  1 190 ? 18.519   85.070  17.322  1.00 23.42 ? 199 ASP B OD1 1 
ATOM   3509  O  OD2 . ASP B  1 190 ? 17.469   85.911  15.616  1.00 26.41 ? 199 ASP B OD2 1 
ATOM   3510  N  N   . TRP B  1 191 ? 20.383   80.778  15.133  1.00 27.41 ? 200 TRP B N   1 
ATOM   3511  C  CA  . TRP B  1 191 ? 20.542   79.361  14.750  1.00 26.47 ? 200 TRP B CA  1 
ATOM   3512  C  C   . TRP B  1 191 ? 21.793   78.818  15.410  1.00 28.32 ? 200 TRP B C   1 
ATOM   3513  O  O   . TRP B  1 191 ? 22.750   79.561  15.621  1.00 32.54 ? 200 TRP B O   1 
ATOM   3514  C  CB  . TRP B  1 191 ? 20.739   79.214  13.232  1.00 24.56 ? 200 TRP B CB  1 
ATOM   3515  C  CG  . TRP B  1 191 ? 19.524   79.483  12.364  1.00 23.10 ? 200 TRP B CG  1 
ATOM   3516  C  CD1 . TRP B  1 191 ? 18.761   78.555  11.710  1.00 21.11 ? 200 TRP B CD1 1 
ATOM   3517  C  CD2 . TRP B  1 191 ? 19.001   80.762  11.996  1.00 20.51 ? 200 TRP B CD2 1 
ATOM   3518  N  NE1 . TRP B  1 191 ? 17.789   79.182  10.960  1.00 20.62 ? 200 TRP B NE1 1 
ATOM   3519  C  CE2 . TRP B  1 191 ? 17.910   80.534  11.124  1.00 20.08 ? 200 TRP B CE2 1 
ATOM   3520  C  CE3 . TRP B  1 191 ? 19.377   82.085  12.279  1.00 19.80 ? 200 TRP B CE3 1 
ATOM   3521  C  CZ2 . TRP B  1 191 ? 17.168   81.572  10.573  1.00 19.36 ? 200 TRP B CZ2 1 
ATOM   3522  C  CZ3 . TRP B  1 191 ? 18.626   83.134  11.735  1.00 18.49 ? 200 TRP B CZ3 1 
ATOM   3523  C  CH2 . TRP B  1 191 ? 17.526   82.868  10.904  1.00 19.07 ? 200 TRP B CH2 1 
ATOM   3524  N  N   . ASP B  1 192 ? 21.810   77.517  15.654  1.00 29.64 ? 201 ASP B N   1 
ATOM   3525  C  CA  . ASP B  1 192 ? 23.010   76.807  16.118  1.00 30.42 ? 201 ASP B CA  1 
ATOM   3526  C  C   . ASP B  1 192 ? 23.821   76.286  14.951  1.00 29.62 ? 201 ASP B C   1 
ATOM   3527  O  O   . ASP B  1 192 ? 23.805   75.110  14.678  1.00 27.97 ? 201 ASP B O   1 
ATOM   3528  C  CB  . ASP B  1 192 ? 22.637   75.585  16.977  1.00 32.15 ? 201 ASP B CB  1 
ATOM   3529  C  CG  . ASP B  1 192 ? 21.892   75.956  18.243  1.00 36.03 ? 201 ASP B CG  1 
ATOM   3530  O  OD1 . ASP B  1 192 ? 21.970   77.121  18.683  1.00 37.99 ? 201 ASP B OD1 1 
ATOM   3531  O  OD2 . ASP B  1 192 ? 21.248   75.054  18.824  1.00 39.54 ? 201 ASP B OD2 1 
ATOM   3532  N  N   . PHE B  1 193 ? 24.534   77.143  14.257  1.00 30.73 ? 202 PHE B N   1 
ATOM   3533  C  CA  . PHE B  1 193 ? 25.387   76.673  13.160  1.00 32.51 ? 202 PHE B CA  1 
ATOM   3534  C  C   . PHE B  1 193 ? 26.651   75.942  13.593  1.00 35.61 ? 202 PHE B C   1 
ATOM   3535  O  O   . PHE B  1 193 ? 27.249   76.364  14.545  1.00 38.75 ? 202 PHE B O   1 
ATOM   3536  C  CB  . PHE B  1 193 ? 25.748   77.859  12.284  1.00 29.89 ? 202 PHE B CB  1 
ATOM   3537  C  CG  . PHE B  1 193 ? 24.597   78.366  11.494  1.00 29.93 ? 202 PHE B CG  1 
ATOM   3538  C  CD1 . PHE B  1 193 ? 24.012   77.571  10.509  1.00 28.20 ? 202 PHE B CD1 1 
ATOM   3539  C  CD2 . PHE B  1 193 ? 24.062   79.613  11.753  1.00 30.04 ? 202 PHE B CD2 1 
ATOM   3540  C  CE1 . PHE B  1 193 ? 22.945   78.023  9.778   1.00 27.14 ? 202 PHE B CE1 1 
ATOM   3541  C  CE2 . PHE B  1 193 ? 22.982   80.071  11.014  1.00 30.00 ? 202 PHE B CE2 1 
ATOM   3542  C  CZ  . PHE B  1 193 ? 22.423   79.272  10.029  1.00 26.93 ? 202 PHE B CZ  1 
ATOM   3543  N  N   . LEU B  1 194 ? 27.094   74.914  12.857  1.00 39.96 ? 203 LEU B N   1 
ATOM   3544  C  CA  . LEU B  1 194 ? 28.371   74.234  13.188  1.00 44.79 ? 203 LEU B CA  1 
ATOM   3545  C  C   . LEU B  1 194 ? 29.568   75.188  12.967  1.00 41.44 ? 203 LEU B C   1 
ATOM   3546  O  O   . LEU B  1 194 ? 30.313   75.525  13.902  1.00 39.60 ? 203 LEU B O   1 
ATOM   3547  C  CB  . LEU B  1 194 ? 28.579   72.957  12.338  1.00 50.82 ? 203 LEU B CB  1 
ATOM   3548  C  CG  . LEU B  1 194 ? 27.530   71.835  12.455  1.00 55.35 ? 203 LEU B CG  1 
ATOM   3549  C  CD1 . LEU B  1 194 ? 27.753   70.795  11.358  1.00 54.60 ? 203 LEU B CD1 1 
ATOM   3550  C  CD2 . LEU B  1 194 ? 27.520   71.176  13.834  1.00 52.51 ? 203 LEU B CD2 1 
ATOM   3551  N  N   . PRO B  1 200 ? 32.791   83.632  7.451   1.00 32.04 ? 303 PRO B N   1 
ATOM   3552  C  CA  . PRO B  1 200 ? 31.616   84.189  8.146   1.00 32.90 ? 303 PRO B CA  1 
ATOM   3553  C  C   . PRO B  1 200 ? 30.365   84.183  7.269   1.00 32.22 ? 303 PRO B C   1 
ATOM   3554  O  O   . PRO B  1 200 ? 29.277   84.447  7.758   1.00 37.06 ? 303 PRO B O   1 
ATOM   3555  C  CB  . PRO B  1 200 ? 32.035   85.640  8.412   1.00 32.84 ? 303 PRO B CB  1 
ATOM   3556  C  CG  . PRO B  1 200 ? 33.004   85.980  7.320   1.00 29.54 ? 303 PRO B CG  1 
ATOM   3557  C  CD  . PRO B  1 200 ? 33.583   84.689  6.784   1.00 28.68 ? 303 PRO B CD  1 
ATOM   3558  N  N   . SER B  1 201 ? 30.512   83.901  5.972   1.00 30.50 ? 304 SER B N   1 
ATOM   3559  C  CA  . SER B  1 201 ? 29.363   83.889  5.035   1.00 31.58 ? 304 SER B CA  1 
ATOM   3560  C  C   . SER B  1 201 ? 28.361   82.680  5.067   1.00 26.98 ? 304 SER B C   1 
ATOM   3561  O  O   . SER B  1 201 ? 27.953   82.106  4.047   1.00 22.92 ? 304 SER B O   1 
ATOM   3562  C  CB  . SER B  1 201 ? 29.860   84.316  3.623   1.00 34.83 ? 304 SER B CB  1 
ATOM   3563  O  OG  . SER B  1 201 ? 30.545   83.311  2.897   1.00 41.20 ? 304 SER B OG  1 
ATOM   3564  N  N   . ILE B  1 202 ? 27.889   82.402  6.271   1.00 23.59 ? 305 ILE B N   1 
ATOM   3565  C  CA  . ILE B  1 202 ? 26.795   81.466  6.492   1.00 24.62 ? 305 ILE B CA  1 
ATOM   3566  C  C   . ILE B  1 202 ? 25.587   81.774  5.571   1.00 20.08 ? 305 ILE B C   1 
ATOM   3567  O  O   . ILE B  1 202 ? 24.945   80.904  5.036   1.00 18.51 ? 305 ILE B O   1 
ATOM   3568  C  CB  . ILE B  1 202 ? 26.285   81.502  7.967   1.00 26.79 ? 305 ILE B CB  1 
ATOM   3569  C  CG1 . ILE B  1 202 ? 27.357   81.483  9.086   1.00 30.35 ? 305 ILE B CG1 1 
ATOM   3570  C  CG2 . ILE B  1 202 ? 25.122   80.517  8.137   1.00 27.50 ? 305 ILE B CG2 1 
ATOM   3571  C  CD1 . ILE B  1 202 ? 27.720   80.127  9.611   1.00 34.59 ? 305 ILE B CD1 1 
ATOM   3572  N  N   . TYR B  1 203 ? 25.308   83.045  5.398   1.00 18.59 ? 306 TYR B N   1 
ATOM   3573  C  CA  . TYR B  1 203 ? 24.163   83.501  4.650   1.00 17.62 ? 306 TYR B CA  1 
ATOM   3574  C  C   . TYR B  1 203 ? 24.216   83.147  3.171   1.00 18.20 ? 306 TYR B C   1 
ATOM   3575  O  O   . TYR B  1 203 ? 23.184   83.192  2.476   1.00 15.70 ? 306 TYR B O   1 
ATOM   3576  C  CB  . TYR B  1 203 ? 24.069   85.022  4.760   1.00 17.54 ? 306 TYR B CB  1 
ATOM   3577  C  CG  . TYR B  1 203 ? 25.009   85.736  3.825   1.00 16.44 ? 306 TYR B CG  1 
ATOM   3578  C  CD1 . TYR B  1 203 ? 26.352   85.969  4.174   1.00 16.82 ? 306 TYR B CD1 1 
ATOM   3579  C  CD2 . TYR B  1 203 ? 24.577   86.144  2.587   1.00 16.59 ? 306 TYR B CD2 1 
ATOM   3580  C  CE1 . TYR B  1 203 ? 27.231   86.573  3.281   1.00 15.45 ? 306 TYR B CE1 1 
ATOM   3581  C  CE2 . TYR B  1 203 ? 25.430   86.734  1.679   1.00 17.22 ? 306 TYR B CE2 1 
ATOM   3582  C  CZ  . TYR B  1 203 ? 26.759   86.966  2.038   1.00 16.88 ? 306 TYR B CZ  1 
ATOM   3583  O  OH  . TYR B  1 203 ? 27.553   87.592  1.108   1.00 16.76 ? 306 TYR B OH  1 
ATOM   3584  N  N   . ALA B  1 204 ? 25.414   82.839  2.674   1.00 17.26 ? 307 ALA B N   1 
ATOM   3585  C  CA  . ALA B  1 204 ? 25.659   82.856  1.206   1.00 17.18 ? 307 ALA B CA  1 
ATOM   3586  C  C   . ALA B  1 204 ? 25.623   81.457  0.549   1.00 16.18 ? 307 ALA B C   1 
ATOM   3587  O  O   . ALA B  1 204 ? 26.053   80.477  1.123   1.00 15.95 ? 307 ALA B O   1 
ATOM   3588  C  CB  . ALA B  1 204 ? 26.988   83.519  0.907   1.00 17.03 ? 307 ALA B CB  1 
ATOM   3589  N  N   . TYR B  1 205 ? 25.061   81.404  -0.645  1.00 16.48 ? 308 TYR B N   1 
ATOM   3590  C  CA  . TYR B  1 205 ? 24.942   80.163  -1.437  1.00 16.69 ? 308 TYR B CA  1 
ATOM   3591  C  C   . TYR B  1 205 ? 25.447   80.455  -2.824  1.00 18.26 ? 308 TYR B C   1 
ATOM   3592  O  O   . TYR B  1 205 ? 25.166   81.517  -3.411  1.00 17.03 ? 308 TYR B O   1 
ATOM   3593  C  CB  . TYR B  1 205 ? 23.466   79.603  -1.468  1.00 15.43 ? 308 TYR B CB  1 
ATOM   3594  C  CG  . TYR B  1 205 ? 23.035   79.118  -0.097  1.00 14.15 ? 308 TYR B CG  1 
ATOM   3595  C  CD1 . TYR B  1 205 ? 23.431   77.863  0.358   1.00 13.64 ? 308 TYR B CD1 1 
ATOM   3596  C  CD2 . TYR B  1 205 ? 22.367   79.945  0.778   1.00 13.62 ? 308 TYR B CD2 1 
ATOM   3597  C  CE1 . TYR B  1 205 ? 23.156   77.451  1.630   1.00 13.76 ? 308 TYR B CE1 1 
ATOM   3598  C  CE2 . TYR B  1 205 ? 22.066   79.528  2.066   1.00 13.61 ? 308 TYR B CE2 1 
ATOM   3599  C  CZ  . TYR B  1 205 ? 22.438   78.290  2.476   1.00 13.67 ? 308 TYR B CZ  1 
ATOM   3600  O  OH  . TYR B  1 205 ? 22.144   77.840  3.741   1.00 13.25 ? 308 TYR B OH  1 
ATOM   3601  N  N   . ASP B  1 206 ? 26.198   79.501  -3.358  1.00 23.15 ? 309 ASP B N   1 
ATOM   3602  C  CA  . ASP B  1 206 ? 26.837   79.675  -4.673  1.00 28.82 ? 309 ASP B CA  1 
ATOM   3603  C  C   . ASP B  1 206 ? 25.813   79.781  -5.751  1.00 29.49 ? 309 ASP B C   1 
ATOM   3604  O  O   . ASP B  1 206 ? 25.973   80.483  -6.736  1.00 26.23 ? 309 ASP B O   1 
ATOM   3605  C  CB  . ASP B  1 206 ? 27.757   78.506  -4.973  1.00 33.99 ? 309 ASP B CB  1 
ATOM   3606  C  CG  . ASP B  1 206 ? 29.039   78.571  -4.171  1.00 42.11 ? 309 ASP B CG  1 
ATOM   3607  O  OD1 . ASP B  1 206 ? 29.561   79.705  -3.983  1.00 46.67 ? 309 ASP B OD1 1 
ATOM   3608  O  OD2 . ASP B  1 206 ? 29.505   77.503  -3.689  1.00 47.93 ? 309 ASP B OD2 1 
ATOM   3609  N  N   . ASN B  1 207 ? 24.709   79.098  -5.544  1.00 31.85 ? 310 ASN B N   1 
ATOM   3610  C  CA  . ASN B  1 207 ? 23.702   79.170  -6.538  1.00 31.98 ? 310 ASN B CA  1 
ATOM   3611  C  C   . ASN B  1 207 ? 22.291   78.731  -6.129  1.00 33.15 ? 310 ASN B C   1 
ATOM   3612  O  O   . ASN B  1 207 ? 22.034   77.799  -5.327  1.00 31.44 ? 310 ASN B O   1 
ATOM   3613  C  CB  . ASN B  1 207 ? 24.232   78.401  -7.745  1.00 34.82 ? 310 ASN B CB  1 
ATOM   3614  C  CG  . ASN B  1 207 ? 23.348   77.316  -8.200  1.00 38.88 ? 310 ASN B CG  1 
ATOM   3615  O  OD1 . ASN B  1 207 ? 22.188   77.523  -8.582  1.00 33.81 ? 310 ASN B OD1 1 
ATOM   3616  N  ND2 . ASN B  1 207 ? 23.901   76.108  -8.185  1.00 42.53 ? 310 ASN B ND2 1 
ATOM   3617  N  N   . PHE B  1 208 ? 21.390   79.502  -6.698  1.00 29.35 ? 311 PHE B N   1 
ATOM   3618  C  CA  . PHE B  1 208 ? 20.000   79.303  -6.588  1.00 24.73 ? 311 PHE B CA  1 
ATOM   3619  C  C   . PHE B  1 208 ? 19.511   79.133  -8.005  1.00 23.65 ? 311 PHE B C   1 
ATOM   3620  O  O   . PHE B  1 208 ? 19.810   79.968  -8.845  1.00 23.97 ? 311 PHE B O   1 
ATOM   3621  C  CB  . PHE B  1 208 ? 19.355   80.522  -5.972  1.00 23.10 ? 311 PHE B CB  1 
ATOM   3622  C  CG  . PHE B  1 208 ? 19.645   80.687  -4.500  1.00 21.26 ? 311 PHE B CG  1 
ATOM   3623  C  CD1 . PHE B  1 208 ? 19.123   79.808  -3.582  1.00 20.45 ? 311 PHE B CD1 1 
ATOM   3624  C  CD2 . PHE B  1 208 ? 20.423   81.744  -4.051  1.00 20.96 ? 311 PHE B CD2 1 
ATOM   3625  C  CE1 . PHE B  1 208 ? 19.364   79.964  -2.232  1.00 21.47 ? 311 PHE B CE1 1 
ATOM   3626  C  CE2 . PHE B  1 208 ? 20.687   81.907  -2.707  1.00 21.69 ? 311 PHE B CE2 1 
ATOM   3627  C  CZ  . PHE B  1 208 ? 20.139   81.033  -1.785  1.00 21.41 ? 311 PHE B CZ  1 
ATOM   3628  N  N   . GLY B  1 209 ? 18.754   78.065  -8.256  1.00 22.05 ? 312 GLY B N   1 
ATOM   3629  C  CA  . GLY B  1 209 ? 18.177   77.829  -9.577  1.00 21.79 ? 312 GLY B CA  1 
ATOM   3630  C  C   . GLY B  1 209 ? 16.709   77.395  -9.628  1.00 21.91 ? 312 GLY B C   1 
ATOM   3631  O  O   . GLY B  1 209 ? 16.070   77.530  -10.667 1.00 19.55 ? 312 GLY B O   1 
ATOM   3632  N  N   . VAL B  1 210 ? 16.188   76.885  -8.520  1.00 19.93 ? 313 VAL B N   1 
ATOM   3633  C  CA  . VAL B  1 210 ? 14.810   76.427  -8.472  1.00 21.67 ? 313 VAL B CA  1 
ATOM   3634  C  C   . VAL B  1 210 ? 14.097   76.803  -7.165  1.00 22.58 ? 313 VAL B C   1 
ATOM   3635  O  O   . VAL B  1 210 ? 14.671   76.668  -6.068  1.00 19.74 ? 313 VAL B O   1 
ATOM   3636  C  CB  . VAL B  1 210 ? 14.730   74.883  -8.587  1.00 23.34 ? 313 VAL B CB  1 
ATOM   3637  C  CG1 . VAL B  1 210 ? 13.293   74.398  -8.565  1.00 23.84 ? 313 VAL B CG1 1 
ATOM   3638  C  CG2 . VAL B  1 210 ? 15.375   74.413  -9.894  1.00 24.82 ? 313 VAL B CG2 1 
ATOM   3639  N  N   . LEU B  1 211 ? 12.839   77.229  -7.318  1.00 21.74 ? 314 LEU B N   1 
ATOM   3640  C  CA  . LEU B  1 211 ? 11.905   77.354  -6.207  1.00 22.71 ? 314 LEU B CA  1 
ATOM   3641  C  C   . LEU B  1 211 ? 10.909   76.215  -6.224  1.00 25.01 ? 314 LEU B C   1 
ATOM   3642  O  O   . LEU B  1 211 ? 10.165   76.061  -7.186  1.00 29.15 ? 314 LEU B O   1 
ATOM   3643  C  CB  . LEU B  1 211 ? 11.158   78.677  -6.273  1.00 22.44 ? 314 LEU B CB  1 
ATOM   3644  C  CG  . LEU B  1 211 ? 10.301   78.946  -5.018  1.00 21.64 ? 314 LEU B CG  1 
ATOM   3645  C  CD1 . LEU B  1 211 ? 10.259   80.395  -4.634  1.00 21.30 ? 314 LEU B CD1 1 
ATOM   3646  C  CD2 . LEU B  1 211 ? 8.885    78.450  -5.204  1.00 24.08 ? 314 LEU B CD2 1 
ATOM   3647  N  N   . GLY B  1 212 ? 10.845   75.460  -5.140  1.00 23.25 ? 315 GLY B N   1 
ATOM   3648  C  CA  . GLY B  1 212 ? 9.900    74.368  -5.031  1.00 23.75 ? 315 GLY B CA  1 
ATOM   3649  C  C   . GLY B  1 212 ? 8.839    74.475  -3.938  1.00 24.53 ? 315 GLY B C   1 
ATOM   3650  O  O   . GLY B  1 212 ? 9.090    74.978  -2.824  1.00 26.36 ? 315 GLY B O   1 
ATOM   3651  N  N   . LEU B  1 213 ? 7.652    74.003  -4.283  1.00 21.62 ? 316 LEU B N   1 
ATOM   3652  C  CA  . LEU B  1 213 ? 6.604    73.725  -3.324  1.00 21.73 ? 316 LEU B CA  1 
ATOM   3653  C  C   . LEU B  1 213 ? 6.641    72.232  -3.095  1.00 23.14 ? 316 LEU B C   1 
ATOM   3654  O  O   . LEU B  1 213 ? 6.236    71.436  -3.941  1.00 25.95 ? 316 LEU B O   1 
ATOM   3655  C  CB  . LEU B  1 213 ? 5.252    74.139  -3.865  1.00 22.31 ? 316 LEU B CB  1 
ATOM   3656  C  CG  . LEU B  1 213 ? 5.158    75.592  -4.268  1.00 21.98 ? 316 LEU B CG  1 
ATOM   3657  C  CD1 . LEU B  1 213 ? 3.918    75.883  -5.082  1.00 22.10 ? 316 LEU B CD1 1 
ATOM   3658  C  CD2 . LEU B  1 213 ? 5.161    76.475  -3.024  1.00 24.32 ? 316 LEU B CD2 1 
ATOM   3659  N  N   . ASP B  1 214 ? 7.156    71.853  -1.951  1.00 23.95 ? 317 ASP B N   1 
ATOM   3660  C  CA  . ASP B  1 214 ? 7.418    70.475  -1.627  1.00 27.36 ? 317 ASP B CA  1 
ATOM   3661  C  C   . ASP B  1 214 ? 6.970    70.293  -0.175  1.00 26.51 ? 317 ASP B C   1 
ATOM   3662  O  O   . ASP B  1 214 ? 7.660    70.718  0.741   1.00 26.15 ? 317 ASP B O   1 
ATOM   3663  C  CB  . ASP B  1 214 ? 8.913    70.188  -1.767  1.00 33.54 ? 317 ASP B CB  1 
ATOM   3664  C  CG  . ASP B  1 214 ? 9.282    68.749  -1.397  1.00 41.20 ? 317 ASP B CG  1 
ATOM   3665  O  OD1 . ASP B  1 214 ? 9.082    68.282  -0.239  1.00 47.31 ? 317 ASP B OD1 1 
ATOM   3666  O  OD2 . ASP B  1 214 ? 9.803    68.074  -2.312  1.00 51.84 ? 317 ASP B OD2 1 
ATOM   3667  N  N   . LEU B  1 215 ? 5.823    69.655  0.017   1.00 24.64 ? 318 LEU B N   1 
ATOM   3668  C  CA  . LEU B  1 215 ? 5.132    69.712  1.269   1.00 24.63 ? 318 LEU B CA  1 
ATOM   3669  C  C   . LEU B  1 215 ? 4.005    68.701  1.392   1.00 24.94 ? 318 LEU B C   1 
ATOM   3670  O  O   . LEU B  1 215 ? 3.637    68.013  0.441   1.00 26.65 ? 318 LEU B O   1 
ATOM   3671  C  CB  . LEU B  1 215 ? 4.584    71.129  1.489   1.00 24.95 ? 318 LEU B CB  1 
ATOM   3672  C  CG  . LEU B  1 215 ? 3.756    71.791  0.394   1.00 25.01 ? 318 LEU B CG  1 
ATOM   3673  C  CD1 . LEU B  1 215 ? 2.286    71.486  0.576   1.00 26.32 ? 318 LEU B CD1 1 
ATOM   3674  C  CD2 . LEU B  1 215 ? 3.931    73.293  0.390   1.00 23.37 ? 318 LEU B CD2 1 
ATOM   3675  N  N   . TRP B  1 216 ? 3.484    68.616  2.601   1.00 25.41 ? 319 TRP B N   1 
ATOM   3676  C  CA  . TRP B  1 216 ? 2.451    67.682  2.943   1.00 26.36 ? 319 TRP B CA  1 
ATOM   3677  C  C   . TRP B  1 216 ? 1.198    68.458  3.332   1.00 26.79 ? 319 TRP B C   1 
ATOM   3678  O  O   . TRP B  1 216 ? 1.285    69.501  4.006   1.00 29.86 ? 319 TRP B O   1 
ATOM   3679  C  CB  . TRP B  1 216 ? 2.912    66.800  4.109   1.00 25.52 ? 319 TRP B CB  1 
ATOM   3680  C  CG  . TRP B  1 216 ? 1.815    66.053  4.791   1.00 29.60 ? 319 TRP B CG  1 
ATOM   3681  C  CD1 . TRP B  1 216 ? 1.231    66.368  5.989   1.00 30.47 ? 319 TRP B CD1 1 
ATOM   3682  C  CD2 . TRP B  1 216 ? 1.134    64.867  4.313   1.00 29.78 ? 319 TRP B CD2 1 
ATOM   3683  N  NE1 . TRP B  1 216 ? 0.272    65.443  6.303   1.00 29.02 ? 319 TRP B NE1 1 
ATOM   3684  C  CE2 . TRP B  1 216 ? 0.178    64.521  5.290   1.00 28.94 ? 319 TRP B CE2 1 
ATOM   3685  C  CE3 . TRP B  1 216 ? 1.240    64.077  3.151   1.00 31.43 ? 319 TRP B CE3 1 
ATOM   3686  C  CZ2 . TRP B  1 216 ? -0.667   63.417  5.151   1.00 29.03 ? 319 TRP B CZ2 1 
ATOM   3687  C  CZ3 . TRP B  1 216 ? 0.405    62.975  3.013   1.00 31.70 ? 319 TRP B CZ3 1 
ATOM   3688  C  CH2 . TRP B  1 216 ? -0.543   62.659  4.005   1.00 31.46 ? 319 TRP B CH2 1 
ATOM   3689  N  N   . GLN B  1 217 ? 0.033    67.904  3.012   1.00 23.02 ? 320 GLN B N   1 
ATOM   3690  C  CA  . GLN B  1 217 ? -1.235   68.533  3.419   1.00 22.65 ? 320 GLN B CA  1 
ATOM   3691  C  C   . GLN B  1 217 ? -2.327   67.496  3.741   1.00 22.79 ? 320 GLN B C   1 
ATOM   3692  O  O   . GLN B  1 217 ? -2.477   66.527  3.030   1.00 24.25 ? 320 GLN B O   1 
ATOM   3693  C  CB  . GLN B  1 217 ? -1.598   69.539  2.332   1.00 22.86 ? 320 GLN B CB  1 
ATOM   3694  C  CG  . GLN B  1 217 ? -2.010   70.837  2.909   1.00 23.06 ? 320 GLN B CG  1 
ATOM   3695  C  CD  . GLN B  1 217 ? -2.088   71.950  1.955   1.00 22.31 ? 320 GLN B CD  1 
ATOM   3696  O  OE1 . GLN B  1 217 ? -2.882   71.844  1.084   1.00 20.40 ? 320 GLN B OE1 1 
ATOM   3697  N  NE2 . GLN B  1 217 ? -1.405   73.080  2.185   1.00 23.42 ? 320 GLN B NE2 1 
ATOM   3698  N  N   . VAL B  1 218 ? -2.999   67.646  4.880   1.00 22.31 ? 321 VAL B N   1 
ATOM   3699  C  CA  . VAL B  1 218 ? -4.181   66.864  5.196   1.00 21.48 ? 321 VAL B CA  1 
ATOM   3700  C  C   . VAL B  1 218 ? -5.322   67.531  4.435   1.00 21.18 ? 321 VAL B C   1 
ATOM   3701  O  O   . VAL B  1 218 ? -5.494   67.289  3.235   1.00 21.42 ? 321 VAL B O   1 
ATOM   3702  C  CB  . VAL B  1 218 ? -4.424   66.706  6.713   1.00 21.60 ? 321 VAL B CB  1 
ATOM   3703  C  CG1 . VAL B  1 218 ? -5.669   65.856  6.977   1.00 21.68 ? 321 VAL B CG1 1 
ATOM   3704  C  CG2 . VAL B  1 218 ? -3.236   66.013  7.356   1.00 21.73 ? 321 VAL B CG2 1 
ATOM   3705  N  N   . LYS B  1 219 ? -6.028   68.467  5.055   1.00 22.62 ? 322 LYS B N   1 
ATOM   3706  C  CA  . LYS B  1 219 ? -7.060   69.218  4.327   1.00 21.77 ? 322 LYS B CA  1 
ATOM   3707  C  C   . LYS B  1 219 ? -6.444   70.147  3.312   1.00 21.43 ? 322 LYS B C   1 
ATOM   3708  O  O   . LYS B  1 219 ? -5.676   71.040  3.660   1.00 25.78 ? 322 LYS B O   1 
ATOM   3709  C  CB  . LYS B  1 219 ? -7.907   70.055  5.264   1.00 24.99 ? 322 LYS B CB  1 
ATOM   3710  C  CG  . LYS B  1 219 ? -8.946   69.293  6.064   1.00 27.76 ? 322 LYS B CG  1 
ATOM   3711  C  CD  . LYS B  1 219 ? -9.686   70.211  7.054   1.00 29.87 ? 322 LYS B CD  1 
ATOM   3712  C  CE  . LYS B  1 219 ? -10.491  71.277  6.308   1.00 30.23 ? 322 LYS B CE  1 
ATOM   3713  N  NZ  . LYS B  1 219 ? -11.158  72.173  7.290   1.00 32.88 ? 322 LYS B NZ  1 
ATOM   3714  N  N   . SER B  1 220 ? -6.846   69.976  2.069   1.00 20.73 ? 323 SER B N   1 
ATOM   3715  C  CA  . SER B  1 220 ? -6.295   70.680  0.920   1.00 19.63 ? 323 SER B CA  1 
ATOM   3716  C  C   . SER B  1 220 ? -7.089   71.927  0.582   1.00 17.72 ? 323 SER B C   1 
ATOM   3717  O  O   . SER B  1 220 ? -8.060   72.214  1.246   1.00 18.53 ? 323 SER B O   1 
ATOM   3718  C  CB  . SER B  1 220 ? -6.308   69.755  -0.302  1.00 22.33 ? 323 SER B CB  1 
ATOM   3719  O  OG  . SER B  1 220 ? -7.645   69.422  -0.707  1.00 23.93 ? 323 SER B OG  1 
ATOM   3720  N  N   . GLY B  1 221 ? -6.636   72.712  -0.391  1.00 15.33 ? 324 GLY B N   1 
ATOM   3721  C  CA  . GLY B  1 221 ? -7.272   74.013  -0.728  1.00 14.32 ? 324 GLY B CA  1 
ATOM   3722  C  C   . GLY B  1 221 ? -6.412   75.292  -0.547  1.00 14.26 ? 324 GLY B C   1 
ATOM   3723  O  O   . GLY B  1 221 ? -6.825   76.383  -0.891  1.00 13.25 ? 324 GLY B O   1 
ATOM   3724  N  N   . THR B  1 222 ? -5.190   75.141  -0.053  1.00 14.66 ? 325 THR B N   1 
ATOM   3725  C  CA  . THR B  1 222 ? -4.248   76.252  0.059   1.00 13.54 ? 325 THR B CA  1 
ATOM   3726  C  C   . THR B  1 222 ? -3.869   76.830  -1.309  1.00 14.61 ? 325 THR B C   1 
ATOM   3727  O  O   . THR B  1 222 ? -3.578   76.089  -2.234  1.00 14.07 ? 325 THR B O   1 
ATOM   3728  C  CB  . THR B  1 222 ? -2.967   75.813  0.760   1.00 13.40 ? 325 THR B CB  1 
ATOM   3729  O  OG1 . THR B  1 222 ? -3.263   75.328  2.076   1.00 11.92 ? 325 THR B OG1 1 
ATOM   3730  C  CG2 . THR B  1 222 ? -2.000   76.963  0.871   1.00 13.55 ? 325 THR B CG2 1 
ATOM   3731  N  N   . ILE B  1 223 ? -3.903   78.164  -1.417  1.00 14.68 ? 326 ILE B N   1 
ATOM   3732  C  CA  . ILE B  1 223 ? -3.528   78.875  -2.644  1.00 14.89 ? 326 ILE B CA  1 
ATOM   3733  C  C   . ILE B  1 223 ? -2.254   79.706  -2.431  1.00 15.87 ? 326 ILE B C   1 
ATOM   3734  O  O   . ILE B  1 223 ? -2.203   80.586  -1.576  1.00 15.86 ? 326 ILE B O   1 
ATOM   3735  C  CB  . ILE B  1 223 ? -4.629   79.788  -3.157  1.00 14.30 ? 326 ILE B CB  1 
ATOM   3736  C  CG1 . ILE B  1 223 ? -5.964   79.000  -3.358  1.00 13.94 ? 326 ILE B CG1 1 
ATOM   3737  C  CG2 . ILE B  1 223 ? -4.210   80.475  -4.443  1.00 14.61 ? 326 ILE B CG2 1 
ATOM   3738  C  CD1 . ILE B  1 223 ? -7.059   79.789  -4.010  1.00 12.80 ? 326 ILE B CD1 1 
ATOM   3739  N  N   . PHE B  1 224 ? -1.257   79.424  -3.267  1.00 15.39 ? 327 PHE B N   1 
ATOM   3740  C  CA  . PHE B  1 224 ? -0.002   80.166  -3.346  1.00 14.60 ? 327 PHE B CA  1 
ATOM   3741  C  C   . PHE B  1 224 ? 0.006    81.121  -4.545  1.00 14.99 ? 327 PHE B C   1 
ATOM   3742  O  O   . PHE B  1 224 ? -0.315   80.735  -5.648  1.00 15.95 ? 327 PHE B O   1 
ATOM   3743  C  CB  . PHE B  1 224 ? 1.160    79.216  -3.483  1.00 14.32 ? 327 PHE B CB  1 
ATOM   3744  C  CG  . PHE B  1 224 ? 1.265    78.207  -2.379  1.00 14.49 ? 327 PHE B CG  1 
ATOM   3745  C  CD1 . PHE B  1 224 ? 2.008    78.454  -1.248  1.00 15.03 ? 327 PHE B CD1 1 
ATOM   3746  C  CD2 . PHE B  1 224 ? 0.676    76.967  -2.505  1.00 15.31 ? 327 PHE B CD2 1 
ATOM   3747  C  CE1 . PHE B  1 224 ? 2.134    77.495  -0.229  1.00 15.60 ? 327 PHE B CE1 1 
ATOM   3748  C  CE2 . PHE B  1 224 ? 0.761    76.003  -1.491  1.00 14.64 ? 327 PHE B CE2 1 
ATOM   3749  C  CZ  . PHE B  1 224 ? 1.493    76.265  -0.355  1.00 15.95 ? 327 PHE B CZ  1 
ATOM   3750  N  N   . ASP B  1 225 ? 0.367    82.369  -4.334  1.00 14.63 ? 328 ASP B N   1 
ATOM   3751  C  CA  . ASP B  1 225 ? 0.395    83.351  -5.432  1.00 15.39 ? 328 ASP B CA  1 
ATOM   3752  C  C   . ASP B  1 225 ? 1.608    84.300  -5.183  1.00 14.92 ? 328 ASP B C   1 
ATOM   3753  O  O   . ASP B  1 225 ? 2.261    84.281  -4.143  1.00 13.96 ? 328 ASP B O   1 
ATOM   3754  C  CB  . ASP B  1 225 ? -0.965   84.126  -5.491  1.00 15.25 ? 328 ASP B CB  1 
ATOM   3755  C  CG  . ASP B  1 225 ? -1.321   84.855  -6.902  1.00 16.06 ? 328 ASP B CG  1 
ATOM   3756  O  OD1 . ASP B  1 225 ? -0.478   84.830  -7.820  1.00 16.44 ? 328 ASP B OD1 1 
ATOM   3757  O  OD2 . ASP B  1 225 ? -2.373   85.537  -6.790  1.00 16.76 ? 328 ASP B OD2 1 
ATOM   3758  N  N   . ASN B  1 226 ? 1.830    85.123  -6.161  1.00 15.53 ? 329 ASN B N   1 
ATOM   3759  C  CA  . ASN B  1 226 ? 2.682    86.314  -6.083  1.00 16.77 ? 329 ASN B CA  1 
ATOM   3760  C  C   . ASN B  1 226 ? 4.089    86.072  -5.517  1.00 16.32 ? 329 ASN B C   1 
ATOM   3761  O  O   . ASN B  1 226 ? 4.543    86.777  -4.620  1.00 16.64 ? 329 ASN B O   1 
ATOM   3762  C  CB  . ASN B  1 226 ? 1.970    87.369  -5.294  1.00 17.28 ? 329 ASN B CB  1 
ATOM   3763  C  CG  . ASN B  1 226 ? 0.626    87.710  -5.894  1.00 19.61 ? 329 ASN B CG  1 
ATOM   3764  O  OD1 . ASN B  1 226 ? -0.362   87.457  -5.241  1.00 21.20 ? 329 ASN B OD1 1 
ATOM   3765  N  ND2 . ASN B  1 226 ? 0.564    88.332  -7.077  1.00 20.87 ? 329 ASN B ND2 1 
ATOM   3766  N  N   . PHE B  1 227 ? 4.743    85.078  -6.075  1.00 15.61 ? 330 PHE B N   1 
ATOM   3767  C  CA  . PHE B  1 227 ? 6.094    84.720  -5.707  1.00 16.21 ? 330 PHE B CA  1 
ATOM   3768  C  C   . PHE B  1 227 ? 7.063    85.774  -6.241  1.00 16.59 ? 330 PHE B C   1 
ATOM   3769  O  O   . PHE B  1 227 ? 6.893    86.291  -7.344  1.00 18.19 ? 330 PHE B O   1 
ATOM   3770  C  CB  . PHE B  1 227 ? 6.504    83.397  -6.308  1.00 15.79 ? 330 PHE B CB  1 
ATOM   3771  C  CG  . PHE B  1 227 ? 5.742    82.228  -5.819  1.00 16.91 ? 330 PHE B CG  1 
ATOM   3772  C  CD1 . PHE B  1 227 ? 4.556    81.833  -6.451  1.00 18.13 ? 330 PHE B CD1 1 
ATOM   3773  C  CD2 . PHE B  1 227 ? 6.207    81.466  -4.774  1.00 17.75 ? 330 PHE B CD2 1 
ATOM   3774  C  CE1 . PHE B  1 227 ? 3.870    80.701  -6.029  1.00 18.41 ? 330 PHE B CE1 1 
ATOM   3775  C  CE2 . PHE B  1 227 ? 5.525    80.335  -4.349  1.00 18.06 ? 330 PHE B CE2 1 
ATOM   3776  C  CZ  . PHE B  1 227 ? 4.352    79.954  -4.969  1.00 17.63 ? 330 PHE B CZ  1 
ATOM   3777  N  N   . LEU B  1 228 ? 8.033    86.133  -5.414  1.00 16.92 ? 331 LEU B N   1 
ATOM   3778  C  CA  . LEU B  1 228 ? 9.063    87.097  -5.777  1.00 17.68 ? 331 LEU B CA  1 
ATOM   3779  C  C   . LEU B  1 228 ? 10.386   86.733  -5.131  1.00 17.84 ? 331 LEU B C   1 
ATOM   3780  O  O   . LEU B  1 228 ? 10.460   86.492  -3.918  1.00 17.82 ? 331 LEU B O   1 
ATOM   3781  C  CB  . LEU B  1 228 ? 8.688    88.506  -5.359  1.00 18.12 ? 331 LEU B CB  1 
ATOM   3782  C  CG  . LEU B  1 228 ? 9.766    89.572  -5.592  1.00 17.51 ? 331 LEU B CG  1 
ATOM   3783  C  CD1 . LEU B  1 228 ? 9.886    89.878  -7.095  1.00 17.70 ? 331 LEU B CD1 1 
ATOM   3784  C  CD2 . LEU B  1 228 ? 9.454    90.829  -4.830  1.00 16.34 ? 331 LEU B CD2 1 
ATOM   3785  N  N   . ILE B  1 229 ? 11.420   86.667  -5.955  1.00 18.69 ? 332 ILE B N   1 
ATOM   3786  C  CA  . ILE B  1 229 ? 12.804   86.593  -5.461  1.00 19.83 ? 332 ILE B CA  1 
ATOM   3787  C  C   . ILE B  1 229 ? 13.572   87.764  -6.023  1.00 19.71 ? 332 ILE B C   1 
ATOM   3788  O  O   . ILE B  1 229 ? 13.625   87.942  -7.248  1.00 22.22 ? 332 ILE B O   1 
ATOM   3789  C  CB  . ILE B  1 229 ? 13.486   85.300  -5.829  1.00 19.53 ? 332 ILE B CB  1 
ATOM   3790  C  CG1 . ILE B  1 229 ? 12.517   84.184  -5.517  1.00 19.46 ? 332 ILE B CG1 1 
ATOM   3791  C  CG2 . ILE B  1 229 ? 14.793   85.167  -5.070  1.00 20.39 ? 332 ILE B CG2 1 
ATOM   3792  C  CD1 . ILE B  1 229 ? 13.118   82.850  -5.244  1.00 20.06 ? 332 ILE B CD1 1 
ATOM   3793  N  N   . THR B  1 230 ? 14.127   88.561  -5.117  1.00 17.16 ? 333 THR B N   1 
ATOM   3794  C  CA  . THR B  1 230 ? 14.752   89.815  -5.462  1.00 16.06 ? 333 THR B CA  1 
ATOM   3795  C  C   . THR B  1 230 ? 15.916   90.098  -4.510  1.00 16.18 ? 333 THR B C   1 
ATOM   3796  O  O   . THR B  1 230 ? 16.177   89.372  -3.534  1.00 13.63 ? 333 THR B O   1 
ATOM   3797  C  CB  . THR B  1 230 ? 13.711   90.969  -5.454  1.00 17.01 ? 333 THR B CB  1 
ATOM   3798  O  OG1 . THR B  1 230 ? 14.266   92.182  -5.990  1.00 17.35 ? 333 THR B OG1 1 
ATOM   3799  C  CG2 . THR B  1 230 ? 13.178   91.260  -4.070  1.00 17.56 ? 333 THR B CG2 1 
ATOM   3800  N  N   . ASN B  1 231 ? 16.629   91.163  -4.803  1.00 17.43 ? 334 ASN B N   1 
ATOM   3801  C  CA  . ASN B  1 231 ? 17.753   91.594  -3.957  1.00 19.50 ? 334 ASN B CA  1 
ATOM   3802  C  C   . ASN B  1 231 ? 17.488   92.947  -3.324  1.00 20.30 ? 334 ASN B C   1 
ATOM   3803  O  O   . ASN B  1 231 ? 18.381   93.529  -2.723  1.00 18.77 ? 334 ASN B O   1 
ATOM   3804  C  CB  . ASN B  1 231 ? 19.064   91.635  -4.750  1.00 20.83 ? 334 ASN B CB  1 
ATOM   3805  C  CG  . ASN B  1 231 ? 19.104   92.755  -5.773  1.00 20.77 ? 334 ASN B CG  1 
ATOM   3806  O  OD1 . ASN B  1 231 ? 18.120   93.438  -6.044  1.00 22.54 ? 334 ASN B OD1 1 
ATOM   3807  N  ND2 . ASN B  1 231 ? 20.276   92.965  -6.335  1.00 22.17 ? 334 ASN B ND2 1 
ATOM   3808  N  N   . ASP B  1 232 ? 16.241   93.417  -3.435  1.00 21.29 ? 335 ASP B N   1 
ATOM   3809  C  CA  . ASP B  1 232 ? 15.853   94.748  -2.977  1.00 22.77 ? 335 ASP B CA  1 
ATOM   3810  C  C   . ASP B  1 232 ? 14.645   94.681  -2.015  1.00 21.01 ? 335 ASP B C   1 
ATOM   3811  O  O   . ASP B  1 232 ? 13.543   94.354  -2.422  1.00 19.29 ? 335 ASP B O   1 
ATOM   3812  C  CB  . ASP B  1 232 ? 15.558   95.601  -4.209  1.00 24.20 ? 335 ASP B CB  1 
ATOM   3813  C  CG  . ASP B  1 232 ? 15.383   97.063  -3.895  1.00 29.07 ? 335 ASP B CG  1 
ATOM   3814  O  OD1 . ASP B  1 232 ? 14.912   97.451  -2.821  1.00 28.62 ? 335 ASP B OD1 1 
ATOM   3815  O  OD2 . ASP B  1 232 ? 15.704   97.870  -4.776  1.00 41.10 ? 335 ASP B OD2 1 
ATOM   3816  N  N   . GLU B  1 233 ? 14.891   95.024  -0.755  1.00 21.22 ? 336 GLU B N   1 
ATOM   3817  C  CA  . GLU B  1 233 ? 13.879   95.017  0.300   1.00 23.10 ? 336 GLU B CA  1 
ATOM   3818  C  C   . GLU B  1 233 ? 12.758   95.973  0.003   1.00 21.24 ? 336 GLU B C   1 
ATOM   3819  O  O   . GLU B  1 233 ? 11.593   95.672  0.223   1.00 19.75 ? 336 GLU B O   1 
ATOM   3820  C  CB  . GLU B  1 233 ? 14.432   95.437  1.660   1.00 25.96 ? 336 GLU B CB  1 
ATOM   3821  C  CG  . GLU B  1 233 ? 15.602   94.610  2.164   1.00 27.43 ? 336 GLU B CG  1 
ATOM   3822  C  CD  . GLU B  1 233 ? 16.069   95.027  3.571   1.00 30.37 ? 336 GLU B CD  1 
ATOM   3823  O  OE1 . GLU B  1 233 ? 15.220   95.394  4.428   1.00 30.05 ? 336 GLU B OE1 1 
ATOM   3824  O  OE2 . GLU B  1 233 ? 17.287   94.964  3.839   1.00 27.49 ? 336 GLU B OE2 1 
ATOM   3825  N  N   . ALA B  1 234 ? 13.116   97.150  -0.452  1.00 20.20 ? 337 ALA B N   1 
ATOM   3826  C  CA  . ALA B  1 234 ? 12.119   98.163  -0.765  1.00 19.62 ? 337 ALA B CA  1 
ATOM   3827  C  C   . ALA B  1 234 ? 11.213   97.674  -1.896  1.00 18.62 ? 337 ALA B C   1 
ATOM   3828  O  O   . ALA B  1 234 ? 10.011   97.863  -1.860  1.00 17.86 ? 337 ALA B O   1 
ATOM   3829  C  CB  . ALA B  1 234 ? 12.790   99.471  -1.135  1.00 19.56 ? 337 ALA B CB  1 
ATOM   3830  N  N   . TYR B  1 235 ? 11.793   97.081  -2.927  1.00 17.78 ? 338 TYR B N   1 
ATOM   3831  C  CA  . TYR B  1 235 ? 11.006   96.585  -4.037  1.00 17.55 ? 338 TYR B CA  1 
ATOM   3832  C  C   . TYR B  1 235 ? 10.060   95.448  -3.589  1.00 17.60 ? 338 TYR B C   1 
ATOM   3833  O  O   . TYR B  1 235 ? 8.898    95.427  -3.954  1.00 15.37 ? 338 TYR B O   1 
ATOM   3834  C  CB  . TYR B  1 235 ? 11.885   96.102  -5.182  1.00 18.64 ? 338 TYR B CB  1 
ATOM   3835  C  CG  . TYR B  1 235 ? 11.038   95.666  -6.321  1.00 19.45 ? 338 TYR B CG  1 
ATOM   3836  C  CD1 . TYR B  1 235 ? 10.227   96.572  -6.974  1.00 21.94 ? 338 TYR B CD1 1 
ATOM   3837  C  CD2 . TYR B  1 235 ? 11.002   94.351  -6.726  1.00 21.90 ? 338 TYR B CD2 1 
ATOM   3838  C  CE1 . TYR B  1 235 ? 9.402    96.177  -8.028  1.00 25.34 ? 338 TYR B CE1 1 
ATOM   3839  C  CE2 . TYR B  1 235 ? 10.200   93.939  -7.783  1.00 22.51 ? 338 TYR B CE2 1 
ATOM   3840  C  CZ  . TYR B  1 235 ? 9.396    94.844  -8.402  1.00 25.31 ? 338 TYR B CZ  1 
ATOM   3841  O  OH  . TYR B  1 235 ? 8.573    94.461  -9.416  1.00 34.89 ? 338 TYR B OH  1 
ATOM   3842  N  N   . ALA B  1 236 ? 10.569   94.553  -2.756  1.00 17.92 ? 339 ALA B N   1 
ATOM   3843  C  CA  . ALA B  1 236 ? 9.732    93.528  -2.180  1.00 17.76 ? 339 ALA B CA  1 
ATOM   3844  C  C   . ALA B  1 236 ? 8.527    94.136  -1.480  1.00 18.41 ? 339 ALA B C   1 
ATOM   3845  O  O   . ALA B  1 236 ? 7.417    93.628  -1.594  1.00 17.69 ? 339 ALA B O   1 
ATOM   3846  C  CB  . ALA B  1 236 ? 10.516   92.696  -1.211  1.00 18.78 ? 339 ALA B CB  1 
ATOM   3847  N  N   . GLU B  1 237 ? 8.743    95.209  -0.734  1.00 17.54 ? 340 GLU B N   1 
ATOM   3848  C  CA  . GLU B  1 237 ? 7.667    95.848  0.006   1.00 18.70 ? 340 GLU B CA  1 
ATOM   3849  C  C   . GLU B  1 237 ? 6.631    96.484  -0.953  1.00 18.14 ? 340 GLU B C   1 
ATOM   3850  O  O   . GLU B  1 237 ? 5.437    96.385  -0.737  1.00 16.25 ? 340 GLU B O   1 
ATOM   3851  C  CB  . GLU B  1 237 ? 8.206    96.919  0.964   1.00 20.53 ? 340 GLU B CB  1 
ATOM   3852  C  CG  . GLU B  1 237 ? 7.101    97.499  1.837   1.00 24.01 ? 340 GLU B CG  1 
ATOM   3853  C  CD  . GLU B  1 237 ? 7.565    98.363  3.010   1.00 28.11 ? 340 GLU B CD  1 
ATOM   3854  O  OE1 . GLU B  1 237 ? 8.764    98.257  3.342   1.00 33.50 ? 340 GLU B OE1 1 
ATOM   3855  O  OE2 . GLU B  1 237 ? 6.745    99.098  3.637   1.00 32.09 ? 340 GLU B OE2 1 
ATOM   3856  N  N   . GLU B  1 238 ? 7.115    97.131  -2.003  1.00 18.01 ? 341 GLU B N   1 
ATOM   3857  C  CA  . GLU B  1 238 ? 6.264    97.670  -3.041  1.00 18.56 ? 341 GLU B CA  1 
ATOM   3858  C  C   . GLU B  1 238 ? 5.385    96.608  -3.662  1.00 17.13 ? 341 GLU B C   1 
ATOM   3859  O  O   . GLU B  1 238 ? 4.205    96.813  -3.823  1.00 15.69 ? 341 GLU B O   1 
ATOM   3860  C  CB  . GLU B  1 238 ? 7.074    98.288  -4.177  1.00 20.77 ? 341 GLU B CB  1 
ATOM   3861  C  CG  . GLU B  1 238 ? 7.796    99.574  -3.790  1.00 25.50 ? 341 GLU B CG  1 
ATOM   3862  C  CD  . GLU B  1 238 ? 8.870    100.035 -4.814  1.00 29.27 ? 341 GLU B CD  1 
ATOM   3863  O  OE1 . GLU B  1 238 ? 8.690    99.708  -6.028  1.00 29.85 ? 341 GLU B OE1 1 
ATOM   3864  O  OE2 . GLU B  1 238 ? 9.858    100.745 -4.393  1.00 25.77 ? 341 GLU B OE2 1 
ATOM   3865  N  N   . PHE B  1 239 ? 6.016    95.535  -4.096  1.00 14.20 ? 342 PHE B N   1 
ATOM   3866  C  CA  . PHE B  1 239 ? 5.343    94.470  -4.788  1.00 13.70 ? 342 PHE B CA  1 
ATOM   3867  C  C   . PHE B  1 239 ? 4.306    93.793  -3.866  1.00 14.09 ? 342 PHE B C   1 
ATOM   3868  O  O   . PHE B  1 239 ? 3.247    93.409  -4.286  1.00 14.74 ? 342 PHE B O   1 
ATOM   3869  C  CB  . PHE B  1 239 ? 6.392    93.432  -5.231  1.00 12.93 ? 342 PHE B CB  1 
ATOM   3870  C  CG  . PHE B  1 239 ? 5.858    92.354  -6.138  1.00 12.22 ? 342 PHE B CG  1 
ATOM   3871  C  CD1 . PHE B  1 239 ? 5.282    92.697  -7.342  1.00 12.43 ? 342 PHE B CD1 1 
ATOM   3872  C  CD2 . PHE B  1 239 ? 5.913    91.012  -5.786  1.00 11.64 ? 342 PHE B CD2 1 
ATOM   3873  C  CE1 . PHE B  1 239 ? 4.786    91.725  -8.190  1.00 12.02 ? 342 PHE B CE1 1 
ATOM   3874  C  CE2 . PHE B  1 239 ? 5.384    90.036  -6.623  1.00 12.17 ? 342 PHE B CE2 1 
ATOM   3875  C  CZ  . PHE B  1 239 ? 4.849    90.391  -7.849  1.00 11.80 ? 342 PHE B CZ  1 
ATOM   3876  N  N   . GLY B  1 240 ? 4.628    93.722  -2.594  1.00 14.70 ? 343 GLY B N   1 
ATOM   3877  C  CA  . GLY B  1 240 ? 3.742    93.228  -1.575  1.00 15.50 ? 343 GLY B CA  1 
ATOM   3878  C  C   . GLY B  1 240 ? 2.485    94.092  -1.515  1.00 17.48 ? 343 GLY B C   1 
ATOM   3879  O  O   . GLY B  1 240 ? 1.392    93.563  -1.457  1.00 17.89 ? 343 GLY B O   1 
ATOM   3880  N  N   . ASN B  1 241 ? 2.652    95.409  -1.570  1.00 17.52 ? 344 ASN B N   1 
ATOM   3881  C  CA  . ASN B  1 241 ? 1.528    96.322  -1.501  1.00 17.96 ? 344 ASN B CA  1 
ATOM   3882  C  C   . ASN B  1 241 ? 0.732    96.381  -2.778  1.00 19.89 ? 344 ASN B C   1 
ATOM   3883  O  O   . ASN B  1 241 ? -0.473   96.689  -2.723  1.00 21.24 ? 344 ASN B O   1 
ATOM   3884  C  CB  . ASN B  1 241 ? 1.958    97.732  -1.058  1.00 16.79 ? 344 ASN B CB  1 
ATOM   3885  C  CG  . ASN B  1 241 ? 2.306    97.776  0.429   1.00 16.58 ? 344 ASN B CG  1 
ATOM   3886  O  OD1 . ASN B  1 241 ? 1.879    96.927  1.186   1.00 17.20 ? 344 ASN B OD1 1 
ATOM   3887  N  ND2 . ASN B  1 241 ? 3.099    98.729  0.831   1.00 16.01 ? 344 ASN B ND2 1 
ATOM   3888  N  N   . GLU B  1 242 ? 1.371    96.033  -3.896  1.00 19.85 ? 345 GLU B N   1 
ATOM   3889  C  CA  . GLU B  1 242 ? 0.712    95.964  -5.201  1.00 20.74 ? 345 GLU B CA  1 
ATOM   3890  C  C   . GLU B  1 242 ? 0.001    94.634  -5.400  1.00 18.87 ? 345 GLU B C   1 
ATOM   3891  O  O   . GLU B  1 242 ? -0.781   94.497  -6.322  1.00 17.70 ? 345 GLU B O   1 
ATOM   3892  C  CB  . GLU B  1 242 ? 1.719    96.146  -6.347  1.00 24.69 ? 345 GLU B CB  1 
ATOM   3893  C  CG  . GLU B  1 242 ? 2.039    97.610  -6.714  1.00 29.51 ? 345 GLU B CG  1 
ATOM   3894  C  CD  . GLU B  1 242 ? 3.370    97.815  -7.486  1.00 32.92 ? 345 GLU B CD  1 
ATOM   3895  O  OE1 . GLU B  1 242 ? 4.223    96.902  -7.518  1.00 32.06 ? 345 GLU B OE1 1 
ATOM   3896  O  OE2 . GLU B  1 242 ? 3.588    98.921  -8.051  1.00 35.93 ? 345 GLU B OE2 1 
ATOM   3897  N  N   . THR B  1 243 ? 0.305    93.639  -4.571  1.00 17.88 ? 346 THR B N   1 
ATOM   3898  C  CA  . THR B  1 243 ? -0.298   92.289  -4.719  1.00 16.28 ? 346 THR B CA  1 
ATOM   3899  C  C   . THR B  1 243 ? -1.225   91.950  -3.515  1.00 16.47 ? 346 THR B C   1 
ATOM   3900  O  O   . THR B  1 243 ? -2.424   92.196  -3.578  1.00 15.08 ? 346 THR B O   1 
ATOM   3901  C  CB  . THR B  1 243 ? 0.769    91.213  -4.910  1.00 16.50 ? 346 THR B CB  1 
ATOM   3902  O  OG1 . THR B  1 243 ? 1.705    91.241  -3.827  1.00 15.60 ? 346 THR B OG1 1 
ATOM   3903  C  CG2 . THR B  1 243 ? 1.512    91.429  -6.239  1.00 17.65 ? 346 THR B CG2 1 
ATOM   3904  N  N   . TRP B  1 244 ? -0.653   91.479  -2.403  1.00 15.59 ? 347 TRP B N   1 
ATOM   3905  C  CA  . TRP B  1 244 ? -1.395   91.280  -1.169  1.00 15.71 ? 347 TRP B CA  1 
ATOM   3906  C  C   . TRP B  1 244 ? -2.217   92.514  -0.780  1.00 15.65 ? 347 TRP B C   1 
ATOM   3907  O  O   . TRP B  1 244 ? -3.375   92.430  -0.364  1.00 14.10 ? 347 TRP B O   1 
ATOM   3908  C  CB  . TRP B  1 244 ? -0.455   90.886  -0.025  1.00 15.40 ? 347 TRP B CB  1 
ATOM   3909  C  CG  . TRP B  1 244 ? -1.064   91.024  1.349   1.00 15.29 ? 347 TRP B CG  1 
ATOM   3910  C  CD1 . TRP B  1 244 ? -1.925   90.169  1.939   1.00 15.37 ? 347 TRP B CD1 1 
ATOM   3911  C  CD2 . TRP B  1 244 ? -0.868   92.096  2.261   1.00 15.04 ? 347 TRP B CD2 1 
ATOM   3912  N  NE1 . TRP B  1 244 ? -2.287   90.645  3.153   1.00 15.26 ? 347 TRP B NE1 1 
ATOM   3913  C  CE2 . TRP B  1 244 ? -1.646   91.829  3.380   1.00 15.53 ? 347 TRP B CE2 1 
ATOM   3914  C  CE3 . TRP B  1 244 ? -0.121   93.286  2.220   1.00 16.39 ? 347 TRP B CE3 1 
ATOM   3915  C  CZ2 . TRP B  1 244 ? -1.704   92.696  4.492   1.00 16.69 ? 347 TRP B CZ2 1 
ATOM   3916  C  CZ3 . TRP B  1 244 ? -0.181   94.154  3.290   1.00 16.93 ? 347 TRP B CZ3 1 
ATOM   3917  C  CH2 . TRP B  1 244 ? -0.977   93.850  4.430   1.00 16.95 ? 347 TRP B CH2 1 
ATOM   3918  N  N   . GLY B  1 245 ? -1.587   93.673  -0.892  1.00 15.64 ? 348 GLY B N   1 
ATOM   3919  C  CA  . GLY B  1 245 ? -2.197   94.908  -0.455  1.00 15.39 ? 348 GLY B CA  1 
ATOM   3920  C  C   . GLY B  1 245 ? -3.379   95.327  -1.284  1.00 14.97 ? 348 GLY B C   1 
ATOM   3921  O  O   . GLY B  1 245 ? -4.167   96.147  -0.854  1.00 16.07 ? 348 GLY B O   1 
ATOM   3922  N  N   . VAL B  1 246 ? -3.473   94.799  -2.486  1.00 14.65 ? 349 VAL B N   1 
ATOM   3923  C  CA  . VAL B  1 246 ? -4.570   95.058  -3.392  1.00 15.29 ? 349 VAL B CA  1 
ATOM   3924  C  C   . VAL B  1 246 ? -5.665   93.975  -3.274  1.00 16.50 ? 349 VAL B C   1 
ATOM   3925  O  O   . VAL B  1 246 ? -6.827   94.244  -3.480  1.00 18.73 ? 349 VAL B O   1 
ATOM   3926  C  CB  . VAL B  1 246 ? -4.059   95.146  -4.836  1.00 17.11 ? 349 VAL B CB  1 
ATOM   3927  C  CG1 . VAL B  1 246 ? -5.199   95.096  -5.878  1.00 17.00 ? 349 VAL B CG1 1 
ATOM   3928  C  CG2 . VAL B  1 246 ? -3.285   96.441  -5.024  1.00 16.79 ? 349 VAL B CG2 1 
ATOM   3929  N  N   . THR B  1 247 ? -5.292   92.771  -2.881  1.00 17.29 ? 350 THR B N   1 
ATOM   3930  C  CA  . THR B  1 247 ? -6.203   91.689  -2.618  1.00 19.01 ? 350 THR B CA  1 
ATOM   3931  C  C   . THR B  1 247 ? -7.052   91.890  -1.367  1.00 19.38 ? 350 THR B C   1 
ATOM   3932  O  O   . THR B  1 247 ? -8.252   91.648  -1.346  1.00 18.45 ? 350 THR B O   1 
ATOM   3933  C  CB  . THR B  1 247 ? -5.395   90.397  -2.384  1.00 19.92 ? 350 THR B CB  1 
ATOM   3934  O  OG1 . THR B  1 247 ? -4.645   90.076  -3.557  1.00 22.24 ? 350 THR B OG1 1 
ATOM   3935  C  CG2 . THR B  1 247 ? -6.291   89.198  -2.038  1.00 20.47 ? 350 THR B CG2 1 
ATOM   3936  N  N   . LYS B  1 248 ? -6.363   92.281  -0.322  1.00 19.95 ? 351 LYS B N   1 
ATOM   3937  C  CA  . LYS B  1 248 ? -6.807   92.242  1.071   1.00 20.99 ? 351 LYS B CA  1 
ATOM   3938  C  C   . LYS B  1 248 ? -8.269   92.654  1.394   1.00 19.15 ? 351 LYS B C   1 
ATOM   3939  O  O   . LYS B  1 248 ? -9.030   91.858  1.935   1.00 16.85 ? 351 LYS B O   1 
ATOM   3940  C  CB  . LYS B  1 248 ? -5.789   93.130  1.811   1.00 25.39 ? 351 LYS B CB  1 
ATOM   3941  C  CG  . LYS B  1 248 ? -5.953   93.478  3.264   1.00 31.83 ? 351 LYS B CG  1 
ATOM   3942  C  CD  . LYS B  1 248 ? -4.782   94.409  3.619   1.00 35.33 ? 351 LYS B CD  1 
ATOM   3943  C  CE  . LYS B  1 248 ? -4.828   95.039  4.999   1.00 41.50 ? 351 LYS B CE  1 
ATOM   3944  N  NZ  . LYS B  1 248 ? -6.183   95.519  5.357   1.00 50.39 ? 351 LYS B NZ  1 
ATOM   3945  N  N   . ALA B  1 249 ? -8.628   93.900  1.104   1.00 17.35 ? 352 ALA B N   1 
ATOM   3946  C  CA  . ALA B  1 249 ? -9.874   94.474  1.570   1.00 17.28 ? 352 ALA B CA  1 
ATOM   3947  C  C   . ALA B  1 249 ? -11.089  93.872  0.839   1.00 18.76 ? 352 ALA B C   1 
ATOM   3948  O  O   . ALA B  1 249 ? -12.116  93.590  1.457   1.00 17.85 ? 352 ALA B O   1 
ATOM   3949  C  CB  . ALA B  1 249 ? -9.859   95.997  1.448   1.00 16.55 ? 352 ALA B CB  1 
ATOM   3950  N  N   . ALA B  1 250 ? -10.966  93.725  -0.476  1.00 19.01 ? 353 ALA B N   1 
ATOM   3951  C  CA  . ALA B  1 250 ? -12.034  93.195  -1.304  1.00 18.68 ? 353 ALA B CA  1 
ATOM   3952  C  C   . ALA B  1 250 ? -12.248  91.719  -1.011  1.00 18.22 ? 353 ALA B C   1 
ATOM   3953  O  O   . ALA B  1 250 ? -13.371  91.283  -0.906  1.00 17.51 ? 353 ALA B O   1 
ATOM   3954  C  CB  . ALA B  1 250 ? -11.728  93.416  -2.776  1.00 18.74 ? 353 ALA B CB  1 
ATOM   3955  N  N   . GLU B  1 251 ? -11.171  90.980  -0.790  1.00 17.78 ? 354 GLU B N   1 
ATOM   3956  C  CA  . GLU B  1 251 ? -11.262  89.574  -0.352  1.00 18.28 ? 354 GLU B CA  1 
ATOM   3957  C  C   . GLU B  1 251 ? -12.082  89.418  0.971   1.00 19.27 ? 354 GLU B C   1 
ATOM   3958  O  O   . GLU B  1 251 ? -12.986  88.598  1.072   1.00 17.28 ? 354 GLU B O   1 
ATOM   3959  C  CB  . GLU B  1 251 ? -9.866   88.992  -0.143  1.00 18.36 ? 354 GLU B CB  1 
ATOM   3960  C  CG  . GLU B  1 251 ? -9.811   87.569  0.356   1.00 19.73 ? 354 GLU B CG  1 
ATOM   3961  C  CD  . GLU B  1 251 ? -8.378   87.040  0.558   1.00 21.87 ? 354 GLU B CD  1 
ATOM   3962  O  OE1 . GLU B  1 251 ? -7.753   87.363  1.604   1.00 25.97 ? 354 GLU B OE1 1 
ATOM   3963  O  OE2 . GLU B  1 251 ? -7.879   86.266  -0.298  1.00 23.06 ? 354 GLU B OE2 1 
ATOM   3964  N  N   . LYS B  1 252 ? -11.744  90.217  1.957   1.00 19.57 ? 355 LYS B N   1 
ATOM   3965  C  CA  . LYS B  1 252 ? -12.424  90.220  3.239   1.00 23.45 ? 355 LYS B CA  1 
ATOM   3966  C  C   . LYS B  1 252 ? -13.924  90.617  3.083   1.00 23.47 ? 355 LYS B C   1 
ATOM   3967  O  O   . LYS B  1 252 ? -14.790  90.052  3.710   1.00 22.13 ? 355 LYS B O   1 
ATOM   3968  C  CB  . LYS B  1 252 ? -11.687  91.218  4.148   1.00 29.04 ? 355 LYS B CB  1 
ATOM   3969  C  CG  . LYS B  1 252 ? -12.295  91.518  5.491   1.00 32.21 ? 355 LYS B CG  1 
ATOM   3970  C  CD  . LYS B  1 252 ? -12.119  90.344  6.413   1.00 38.43 ? 355 LYS B CD  1 
ATOM   3971  C  CE  . LYS B  1 252 ? -12.873  90.636  7.720   1.00 41.54 ? 355 LYS B CE  1 
ATOM   3972  N  NZ  . LYS B  1 252 ? -12.666  89.565  8.723   1.00 47.47 ? 355 LYS B NZ  1 
ATOM   3973  N  N   . GLN B  1 253 ? -14.204  91.621  2.261   1.00 22.86 ? 356 GLN B N   1 
ATOM   3974  C  CA  . GLN B  1 253 ? -15.547  92.047  2.008   1.00 24.25 ? 356 GLN B CA  1 
ATOM   3975  C  C   . GLN B  1 253 ? -16.391  90.927  1.345   1.00 25.07 ? 356 GLN B C   1 
ATOM   3976  O  O   . GLN B  1 253 ? -17.530  90.665  1.743   1.00 24.78 ? 356 GLN B O   1 
ATOM   3977  C  CB  . GLN B  1 253 ? -15.490  93.291  1.169   1.00 27.33 ? 356 GLN B CB  1 
ATOM   3978  C  CG  . GLN B  1 253 ? -16.776  94.076  1.038   1.00 31.78 ? 356 GLN B CG  1 
ATOM   3979  C  CD  . GLN B  1 253 ? -16.570  95.282  0.120   1.00 35.34 ? 356 GLN B CD  1 
ATOM   3980  O  OE1 . GLN B  1 253 ? -15.786  96.178  0.394   1.00 38.24 ? 356 GLN B OE1 1 
ATOM   3981  N  NE2 . GLN B  1 253 ? -17.236  95.272  -0.993  1.00 39.23 ? 356 GLN B NE2 1 
ATOM   3982  N  N   . MET B  1 254 ? -15.846  90.276  0.332   1.00 22.70 ? 357 MET B N   1 
ATOM   3983  C  CA  . MET B  1 254 ? -16.578  89.210  -0.332  1.00 21.82 ? 357 MET B CA  1 
ATOM   3984  C  C   . MET B  1 254 ? -16.837  88.038  0.620   1.00 21.45 ? 357 MET B C   1 
ATOM   3985  O  O   . MET B  1 254 ? -17.893  87.441  0.607   1.00 19.44 ? 357 MET B O   1 
ATOM   3986  C  CB  . MET B  1 254 ? -15.825  88.726  -1.549  1.00 22.59 ? 357 MET B CB  1 
ATOM   3987  C  CG  . MET B  1 254 ? -16.480  87.540  -2.234  1.00 22.40 ? 357 MET B CG  1 
ATOM   3988  S  SD  . MET B  1 254 ? -15.712  87.223  -3.805  1.00 20.90 ? 357 MET B SD  1 
ATOM   3989  C  CE  . MET B  1 254 ? -16.748  85.877  -4.435  1.00 23.02 ? 357 MET B CE  1 
ATOM   3990  N  N   . LYS B  1 255 ? -15.881  87.738  1.476   1.00 20.63 ? 358 LYS B N   1 
ATOM   3991  C  CA  . LYS B  1 255 ? -16.046  86.663  2.422   1.00 19.90 ? 358 LYS B CA  1 
ATOM   3992  C  C   . LYS B  1 255 ? -17.067  86.985  3.508   1.00 21.62 ? 358 LYS B C   1 
ATOM   3993  O  O   . LYS B  1 255 ? -17.832  86.128  3.925   1.00 21.00 ? 358 LYS B O   1 
ATOM   3994  C  CB  . LYS B  1 255 ? -14.704  86.297  3.000   1.00 20.09 ? 358 LYS B CB  1 
ATOM   3995  C  CG  . LYS B  1 255 ? -14.736  85.290  4.123   1.00 20.58 ? 358 LYS B CG  1 
ATOM   3996  C  CD  . LYS B  1 255 ? -15.168  83.903  3.680   1.00 21.43 ? 358 LYS B CD  1 
ATOM   3997  C  CE  . LYS B  1 255 ? -15.095  83.039  4.940   1.00 23.39 ? 358 LYS B CE  1 
ATOM   3998  N  NZ  . LYS B  1 255 ? -15.128  81.605  4.685   1.00 26.41 ? 358 LYS B NZ  1 
ATOM   3999  N  N   . ASP B  1 256 ? -17.046  88.205  4.020   1.00 22.46 ? 359 ASP B N   1 
ATOM   4000  C  CA  . ASP B  1 256 ? -18.056  88.625  5.006   1.00 24.82 ? 359 ASP B CA  1 
ATOM   4001  C  C   . ASP B  1 256 ? -19.473  88.445  4.445   1.00 22.95 ? 359 ASP B C   1 
ATOM   4002  O  O   . ASP B  1 256 ? -20.367  88.029  5.152   1.00 20.81 ? 359 ASP B O   1 
ATOM   4003  C  CB  . ASP B  1 256 ? -17.853  90.088  5.432   1.00 25.66 ? 359 ASP B CB  1 
ATOM   4004  C  CG  . ASP B  1 256 ? -16.555  90.305  6.260   1.00 30.60 ? 359 ASP B CG  1 
ATOM   4005  O  OD1 . ASP B  1 256 ? -15.935  89.313  6.776   1.00 28.37 ? 359 ASP B OD1 1 
ATOM   4006  O  OD2 . ASP B  1 256 ? -16.160  91.493  6.371   1.00 31.70 ? 359 ASP B OD2 1 
ATOM   4007  N  N   . LYS B  1 257 ? -19.627  88.757  3.174   1.00 22.91 ? 360 LYS B N   1 
ATOM   4008  C  CA  . LYS B  1 257 ? -20.916  88.715  2.503   1.00 25.16 ? 360 LYS B CA  1 
ATOM   4009  C  C   . LYS B  1 257 ? -21.350  87.265  2.420   1.00 24.33 ? 360 LYS B C   1 
ATOM   4010  O  O   . LYS B  1 257 ? -22.476  86.963  2.760   1.00 25.60 ? 360 LYS B O   1 
ATOM   4011  C  CB  . LYS B  1 257 ? -20.857  89.367  1.133   1.00 27.23 ? 360 LYS B CB  1 
ATOM   4012  C  CG  . LYS B  1 257 ? -22.194  89.426  0.398   1.00 32.41 ? 360 LYS B CG  1 
ATOM   4013  C  CD  . LYS B  1 257 ? -22.188  89.694  -1.138  1.00 36.31 ? 360 LYS B CD  1 
ATOM   4014  C  CE  . LYS B  1 257 ? -21.077  90.596  -1.637  1.00 43.12 ? 360 LYS B CE  1 
ATOM   4015  N  NZ  . LYS B  1 257 ? -21.073  91.984  -1.075  1.00 49.04 ? 360 LYS B NZ  1 
ATOM   4016  N  N   . GLN B  1 258 ? -20.439  86.368  2.064   1.00 23.34 ? 361 GLN B N   1 
ATOM   4017  C  CA  . GLN B  1 258 ? -20.755  84.943  1.984   1.00 22.06 ? 361 GLN B CA  1 
ATOM   4018  C  C   . GLN B  1 258 ? -21.054  84.317  3.332   1.00 23.26 ? 361 GLN B C   1 
ATOM   4019  O  O   . GLN B  1 258 ? -21.910  83.449  3.431   1.00 23.93 ? 361 GLN B O   1 
ATOM   4020  C  CB  . GLN B  1 258 ? -19.637  84.147  1.332   1.00 22.22 ? 361 GLN B CB  1 
ATOM   4021  C  CG  . GLN B  1 258 ? -19.310  84.538  -0.105  1.00 20.59 ? 361 GLN B CG  1 
ATOM   4022  C  CD  . GLN B  1 258 ? -18.157  83.727  -0.680  1.00 20.32 ? 361 GLN B CD  1 
ATOM   4023  O  OE1 . GLN B  1 258 ? -17.415  83.041  0.039   1.00 21.50 ? 361 GLN B OE1 1 
ATOM   4024  N  NE2 . GLN B  1 258 ? -18.008  83.792  -1.985  1.00 20.48 ? 361 GLN B NE2 1 
ATOM   4025  N  N   . ASP B  1 259 ? -20.360  84.760  4.367   1.00 24.80 ? 362 ASP B N   1 
ATOM   4026  C  CA  . ASP B  1 259 ? -20.616  84.302  5.740   1.00 26.65 ? 362 ASP B CA  1 
ATOM   4027  C  C   . ASP B  1 259 ? -22.027  84.717  6.201   1.00 27.11 ? 362 ASP B C   1 
ATOM   4028  O  O   . ASP B  1 259 ? -22.743  83.921  6.766   1.00 28.52 ? 362 ASP B O   1 
ATOM   4029  C  CB  . ASP B  1 259 ? -19.592  84.881  6.724   1.00 27.79 ? 362 ASP B CB  1 
ATOM   4030  C  CG  . ASP B  1 259 ? -18.201  84.235  6.606   1.00 32.49 ? 362 ASP B CG  1 
ATOM   4031  O  OD1 . ASP B  1 259 ? -18.048  83.219  5.878   1.00 33.09 ? 362 ASP B OD1 1 
ATOM   4032  O  OD2 . ASP B  1 259 ? -17.257  84.744  7.278   1.00 30.96 ? 362 ASP B OD2 1 
ATOM   4033  N  N   . GLU B  1 260 ? -22.392  85.963  5.954   1.00 29.53 ? 363 GLU B N   1 
ATOM   4034  C  CA  . GLU B  1 260 ? -23.739  86.470  6.241   1.00 33.22 ? 363 GLU B CA  1 
ATOM   4035  C  C   . GLU B  1 260 ? -24.825  85.687  5.507   1.00 34.34 ? 363 GLU B C   1 
ATOM   4036  O  O   . GLU B  1 260 ? -25.787  85.256  6.139   1.00 32.32 ? 363 GLU B O   1 
ATOM   4037  C  CB  . GLU B  1 260 ? -23.868  87.935  5.888   1.00 36.76 ? 363 GLU B CB  1 
ATOM   4038  C  CG  . GLU B  1 260 ? -23.168  88.873  6.873   1.00 46.07 ? 363 GLU B CG  1 
ATOM   4039  C  CD  . GLU B  1 260 ? -24.003  90.134  7.158   1.00 56.71 ? 363 GLU B CD  1 
ATOM   4040  O  OE1 . GLU B  1 260 ? -25.189  89.960  7.532   1.00 63.57 ? 363 GLU B OE1 1 
ATOM   4041  O  OE2 . GLU B  1 260 ? -23.503  91.291  6.998   1.00 59.82 ? 363 GLU B OE2 1 
ATOM   4042  N  N   . GLU B  1 261 ? -24.658  85.446  4.215   1.00 32.15 ? 364 GLU B N   1 
ATOM   4043  C  CA  . GLU B  1 261 ? -25.643  84.628  3.483   1.00 39.99 ? 364 GLU B CA  1 
ATOM   4044  C  C   . GLU B  1 261 ? -25.749  83.181  4.037   1.00 42.74 ? 364 GLU B C   1 
ATOM   4045  O  O   . GLU B  1 261 ? -26.833  82.621  4.149   1.00 48.97 ? 364 GLU B O   1 
ATOM   4046  C  CB  . GLU B  1 261 ? -25.372  84.552  1.984   1.00 43.58 ? 364 GLU B CB  1 
ATOM   4047  C  CG  . GLU B  1 261 ? -25.030  85.898  1.309   1.00 48.63 ? 364 GLU B CG  1 
ATOM   4048  C  CD  . GLU B  1 261 ? -26.162  86.898  1.288   1.00 54.70 ? 364 GLU B CD  1 
ATOM   4049  O  OE1 . GLU B  1 261 ? -27.312  86.514  1.559   1.00 61.99 ? 364 GLU B OE1 1 
ATOM   4050  O  OE2 . GLU B  1 261 ? -25.907  88.074  0.969   1.00 67.60 ? 364 GLU B OE2 1 
ATOM   4051  N  N   . GLN B  1 262 ? -24.622  82.602  4.397   1.00 40.60 ? 365 GLN B N   1 
ATOM   4052  C  CA  . GLN B  1 262 ? -24.601  81.297  5.005   1.00 43.54 ? 365 GLN B CA  1 
ATOM   4053  C  C   . GLN B  1 262 ? -25.443  81.254  6.283   1.00 41.12 ? 365 GLN B C   1 
ATOM   4054  O  O   . GLN B  1 262 ? -26.203  80.337  6.485   1.00 41.79 ? 365 GLN B O   1 
ATOM   4055  C  CB  . GLN B  1 262 ? -23.154  80.915  5.333   1.00 49.43 ? 365 GLN B CB  1 
ATOM   4056  C  CG  . GLN B  1 262 ? -22.945  79.474  5.759   1.00 49.32 ? 365 GLN B CG  1 
ATOM   4057  C  CD  . GLN B  1 262 ? -23.481  78.470  4.750   1.00 52.91 ? 365 GLN B CD  1 
ATOM   4058  O  OE1 . GLN B  1 262 ? -23.959  77.417  5.140   1.00 48.26 ? 365 GLN B OE1 1 
ATOM   4059  N  NE2 . GLN B  1 262 ? -23.409  78.789  3.449   1.00 56.72 ? 365 GLN B NE2 1 
ATOM   4060  N  N   . ARG B  1 263 ? -25.300  82.267  7.123   1.00 40.21 ? 366 ARG B N   1 
ATOM   4061  C  CA  . ARG B  1 263 ? -26.066  82.385  8.359   1.00 40.49 ? 366 ARG B CA  1 
ATOM   4062  C  C   . ARG B  1 263 ? -27.607  82.469  8.138   1.00 43.26 ? 366 ARG B C   1 
ATOM   4063  O  O   . ARG B  1 263 ? -28.358  82.156  9.046   1.00 52.42 ? 366 ARG B O   1 
ATOM   4064  C  CB  . ARG B  1 263 ? -25.568  83.600  9.181   1.00 38.81 ? 366 ARG B CB  1 
ATOM   4065  N  N   . LEU B  1 264 ? -28.071  82.882  6.960   1.00 38.75 ? 367 LEU B N   1 
ATOM   4066  C  CA  . LEU B  1 264 ? -29.510  83.048  6.682   1.00 38.92 ? 367 LEU B CA  1 
ATOM   4067  C  C   . LEU B  1 264 ? -30.112  81.962  5.790   1.00 35.83 ? 367 LEU B C   1 
ATOM   4068  O  O   . LEU B  1 264 ? -29.556  80.897  5.639   1.00 36.91 ? 367 LEU B O   1 
ATOM   4069  C  CB  . LEU B  1 264 ? -29.768  84.388  5.977   1.00 37.45 ? 367 LEU B CB  1 
ATOM   4070  C  CG  . LEU B  1 264 ? -29.249  85.636  6.671   1.00 36.85 ? 367 LEU B CG  1 
ATOM   4071  C  CD1 . LEU B  1 264 ? -28.983  86.772  5.697   1.00 40.55 ? 367 LEU B CD1 1 
ATOM   4072  C  CD2 . LEU B  1 264 ? -30.205  86.083  7.766   1.00 38.06 ? 367 LEU B CD2 1 
ATOM   4073  N  N   . PRO C  1 10  ? -28.493  23.354  5.873   1.00 36.14 ? 19  PRO C N   1 
ATOM   4074  C  CA  . PRO C  1 10  ? -27.267  23.364  5.031   1.00 34.07 ? 19  PRO C CA  1 
ATOM   4075  C  C   . PRO C  1 10  ? -26.156  22.694  5.764   1.00 32.78 ? 19  PRO C C   1 
ATOM   4076  O  O   . PRO C  1 10  ? -25.789  23.110  6.851   1.00 35.20 ? 19  PRO C O   1 
ATOM   4077  C  CB  . PRO C  1 10  ? -26.960  24.839  4.803   1.00 35.40 ? 19  PRO C CB  1 
ATOM   4078  C  CG  . PRO C  1 10  ? -27.932  25.619  5.626   1.00 36.77 ? 19  PRO C CG  1 
ATOM   4079  C  CD  . PRO C  1 10  ? -29.005  24.702  6.156   1.00 36.44 ? 19  PRO C CD  1 
ATOM   4080  N  N   . ALA C  1 11  ? -25.669  21.606  5.213   1.00 32.14 ? 20  ALA C N   1 
ATOM   4081  C  CA  . ALA C  1 11  ? -24.638  20.823  5.896   1.00 31.03 ? 20  ALA C CA  1 
ATOM   4082  C  C   . ALA C  1 11  ? -23.259  21.380  5.538   1.00 28.86 ? 20  ALA C C   1 
ATOM   4083  O  O   . ALA C  1 11  ? -22.964  21.618  4.373   1.00 26.94 ? 20  ALA C O   1 
ATOM   4084  C  CB  . ALA C  1 11  ? -24.738  19.357  5.507   1.00 31.20 ? 20  ALA C CB  1 
ATOM   4085  N  N   . VAL C  1 12  ? -22.439  21.601  6.556   1.00 28.21 ? 21  VAL C N   1 
ATOM   4086  C  CA  . VAL C  1 12  ? -21.061  22.037  6.373   1.00 27.99 ? 21  VAL C CA  1 
ATOM   4087  C  C   . VAL C  1 12  ? -20.201  20.890  6.822   1.00 26.22 ? 21  VAL C C   1 
ATOM   4088  O  O   . VAL C  1 12  ? -20.032  20.690  7.980   1.00 22.52 ? 21  VAL C O   1 
ATOM   4089  C  CB  . VAL C  1 12  ? -20.743  23.306  7.192   1.00 28.66 ? 21  VAL C CB  1 
ATOM   4090  C  CG1 . VAL C  1 12  ? -19.313  23.759  6.928   1.00 29.39 ? 21  VAL C CG1 1 
ATOM   4091  C  CG2 . VAL C  1 12  ? -21.701  24.449  6.806   1.00 28.46 ? 21  VAL C CG2 1 
ATOM   4092  N  N   . TYR C  1 13  ? -19.693  20.118  5.883   1.00 26.84 ? 22  TYR C N   1 
ATOM   4093  C  CA  . TYR C  1 13  ? -18.862  18.981  6.217   1.00 28.70 ? 22  TYR C CA  1 
ATOM   4094  C  C   . TYR C  1 13  ? -17.407  19.368  6.557   1.00 28.27 ? 22  TYR C C   1 
ATOM   4095  O  O   . TYR C  1 13  ? -16.679  18.599  7.166   1.00 25.41 ? 22  TYR C O   1 
ATOM   4096  C  CB  . TYR C  1 13  ? -18.830  17.997  5.043   1.00 32.35 ? 22  TYR C CB  1 
ATOM   4097  C  CG  . TYR C  1 13  ? -20.185  17.570  4.585   1.00 34.18 ? 22  TYR C CG  1 
ATOM   4098  C  CD1 . TYR C  1 13  ? -21.044  16.855  5.436   1.00 35.72 ? 22  TYR C CD1 1 
ATOM   4099  C  CD2 . TYR C  1 13  ? -20.625  17.882  3.302   1.00 36.91 ? 22  TYR C CD2 1 
ATOM   4100  C  CE1 . TYR C  1 13  ? -22.306  16.468  5.012   1.00 36.00 ? 22  TYR C CE1 1 
ATOM   4101  C  CE2 . TYR C  1 13  ? -21.871  17.480  2.861   1.00 38.41 ? 22  TYR C CE2 1 
ATOM   4102  C  CZ  . TYR C  1 13  ? -22.709  16.767  3.712   1.00 38.49 ? 22  TYR C CZ  1 
ATOM   4103  O  OH  . TYR C  1 13  ? -23.960  16.414  3.239   1.00 39.24 ? 22  TYR C OH  1 
ATOM   4104  N  N   . PHE C  1 14  ? -16.969  20.520  6.039   1.00 27.68 ? 23  PHE C N   1 
ATOM   4105  C  CA  . PHE C  1 14  ? -15.603  21.006  6.219   1.00 24.43 ? 23  PHE C CA  1 
ATOM   4106  C  C   . PHE C  1 14  ? -15.520  22.473  5.894   1.00 23.57 ? 23  PHE C C   1 
ATOM   4107  O  O   . PHE C  1 14  ? -16.046  22.938  4.870   1.00 20.54 ? 23  PHE C O   1 
ATOM   4108  C  CB  . PHE C  1 14  ? -14.602  20.248  5.343   1.00 26.42 ? 23  PHE C CB  1 
ATOM   4109  C  CG  . PHE C  1 14  ? -13.141  20.559  5.668   1.00 28.18 ? 23  PHE C CG  1 
ATOM   4110  C  CD1 . PHE C  1 14  ? -12.613  20.269  6.948   1.00 28.75 ? 23  PHE C CD1 1 
ATOM   4111  C  CD2 . PHE C  1 14  ? -12.294  21.131  4.716   1.00 28.92 ? 23  PHE C CD2 1 
ATOM   4112  C  CE1 . PHE C  1 14  ? -11.283  20.538  7.253   1.00 29.61 ? 23  PHE C CE1 1 
ATOM   4113  C  CE2 . PHE C  1 14  ? -10.956  21.402  5.020   1.00 31.57 ? 23  PHE C CE2 1 
ATOM   4114  C  CZ  . PHE C  1 14  ? -10.455  21.105  6.287   1.00 32.86 ? 23  PHE C CZ  1 
ATOM   4115  N  N   . LYS C  1 15  ? -14.870  23.200  6.793   1.00 23.03 ? 24  LYS C N   1 
ATOM   4116  C  CA  . LYS C  1 15  ? -14.547  24.600  6.575   1.00 23.57 ? 24  LYS C CA  1 
ATOM   4117  C  C   . LYS C  1 15  ? -13.148  24.863  7.113   1.00 22.80 ? 24  LYS C C   1 
ATOM   4118  O  O   . LYS C  1 15  ? -12.834  24.480  8.234   1.00 22.64 ? 24  LYS C O   1 
ATOM   4119  C  CB  . LYS C  1 15  ? -15.566  25.507  7.260   1.00 22.87 ? 24  LYS C CB  1 
ATOM   4120  C  CG  . LYS C  1 15  ? -15.501  26.939  6.776   1.00 24.26 ? 24  LYS C CG  1 
ATOM   4121  C  CD  . LYS C  1 15  ? -16.404  27.887  7.547   1.00 24.01 ? 24  LYS C CD  1 
ATOM   4122  C  CE  . LYS C  1 15  ? -17.856  27.580  7.252   1.00 25.73 ? 24  LYS C CE  1 
ATOM   4123  N  NZ  . LYS C  1 15  ? -18.664  28.788  7.063   1.00 24.08 ? 24  LYS C NZ  1 
ATOM   4124  N  N   . GLU C  1 16  ? -12.313  25.550  6.335   1.00 21.35 ? 25  GLU C N   1 
ATOM   4125  C  CA  . GLU C  1 16  ? -10.985  25.988  6.838   1.00 20.06 ? 25  GLU C CA  1 
ATOM   4126  C  C   . GLU C  1 16  ? -10.618  27.378  6.302   1.00 19.13 ? 25  GLU C C   1 
ATOM   4127  O  O   . GLU C  1 16  ? -10.405  27.557  5.099   1.00 19.37 ? 25  GLU C O   1 
ATOM   4128  C  CB  . GLU C  1 16  ? -9.890   24.959  6.480   1.00 21.49 ? 25  GLU C CB  1 
ATOM   4129  C  CG  . GLU C  1 16  ? -8.473   25.297  6.961   1.00 21.42 ? 25  GLU C CG  1 
ATOM   4130  C  CD  . GLU C  1 16  ? -8.302   25.286  8.471   1.00 21.21 ? 25  GLU C CD  1 
ATOM   4131  O  OE1 . GLU C  1 16  ? -7.843   24.223  8.982   1.00 23.04 ? 25  GLU C OE1 1 
ATOM   4132  O  OE2 . GLU C  1 16  ? -8.612   26.308  9.133   1.00 19.66 ? 25  GLU C OE2 1 
ATOM   4133  N  N   . GLN C  1 17  ? -10.509  28.334  7.211   1.00 17.54 ? 26  GLN C N   1 
ATOM   4134  C  CA  . GLN C  1 17  ? -10.028  29.651  6.861   1.00 18.12 ? 26  GLN C CA  1 
ATOM   4135  C  C   . GLN C  1 17  ? -8.669   30.066  7.479   1.00 16.95 ? 26  GLN C C   1 
ATOM   4136  O  O   . GLN C  1 17  ? -8.162   31.152  7.178   1.00 15.29 ? 26  GLN C O   1 
ATOM   4137  C  CB  . GLN C  1 17  ? -11.085  30.686  7.134   1.00 18.07 ? 26  GLN C CB  1 
ATOM   4138  C  CG  . GLN C  1 17  ? -12.457  30.218  6.718   1.00 20.01 ? 26  GLN C CG  1 
ATOM   4139  C  CD  . GLN C  1 17  ? -13.506  31.226  7.045   1.00 19.52 ? 26  GLN C CD  1 
ATOM   4140  O  OE1 . GLN C  1 17  ? -14.283  31.035  7.956   1.00 24.32 ? 26  GLN C OE1 1 
ATOM   4141  N  NE2 . GLN C  1 17  ? -13.524  32.325  6.321   1.00 21.92 ? 26  GLN C NE2 1 
ATOM   4142  N  N   . PHE C  1 18  ? -8.084   29.186  8.284   1.00 16.72 ? 27  PHE C N   1 
ATOM   4143  C  CA  . PHE C  1 18  ? -6.852   29.475  8.981   1.00 16.41 ? 27  PHE C CA  1 
ATOM   4144  C  C   . PHE C  1 18  ? -6.923   30.841  9.664   1.00 17.62 ? 27  PHE C C   1 
ATOM   4145  O  O   . PHE C  1 18  ? -6.024   31.663  9.499   1.00 15.99 ? 27  PHE C O   1 
ATOM   4146  C  CB  . PHE C  1 18  ? -5.729   29.480  7.993   1.00 17.50 ? 27  PHE C CB  1 
ATOM   4147  C  CG  . PHE C  1 18  ? -5.698   28.268  7.090   1.00 17.14 ? 27  PHE C CG  1 
ATOM   4148  C  CD1 . PHE C  1 18  ? -5.074   27.136  7.498   1.00 17.54 ? 27  PHE C CD1 1 
ATOM   4149  C  CD2 . PHE C  1 18  ? -6.256   28.308  5.839   1.00 17.40 ? 27  PHE C CD2 1 
ATOM   4150  C  CE1 . PHE C  1 18  ? -5.010   26.023  6.708   1.00 17.97 ? 27  PHE C CE1 1 
ATOM   4151  C  CE2 . PHE C  1 18  ? -6.201   27.196  5.024   1.00 18.23 ? 27  PHE C CE2 1 
ATOM   4152  C  CZ  . PHE C  1 18  ? -5.585   26.038  5.468   1.00 18.30 ? 27  PHE C CZ  1 
ATOM   4153  N  N   . LEU C  1 19  ? -7.973   31.075  10.464  1.00 18.87 ? 28  LEU C N   1 
ATOM   4154  C  CA  . LEU C  1 19  ? -8.157   32.338  11.199  1.00 21.01 ? 28  LEU C CA  1 
ATOM   4155  C  C   . LEU C  1 19  ? -7.623   32.314  12.645  1.00 23.13 ? 28  LEU C C   1 
ATOM   4156  O  O   . LEU C  1 19  ? -7.512   33.350  13.273  1.00 24.26 ? 28  LEU C O   1 
ATOM   4157  C  CB  . LEU C  1 19  ? -9.640   32.698  11.269  1.00 21.56 ? 28  LEU C CB  1 
ATOM   4158  C  CG  . LEU C  1 19  ? -10.321  33.088  9.953   1.00 22.72 ? 28  LEU C CG  1 
ATOM   4159  C  CD1 . LEU C  1 19  ? -11.827  32.954  10.108  1.00 22.88 ? 28  LEU C CD1 1 
ATOM   4160  C  CD2 . LEU C  1 19  ? -9.922   34.501  9.519   1.00 24.74 ? 28  LEU C CD2 1 
ATOM   4161  N  N   . ASP C  1 20  ? -7.275   31.138  13.156  1.00 25.88 ? 29  ASP C N   1 
ATOM   4162  C  CA  . ASP C  1 20  ? -6.953   30.948  14.604  1.00 26.13 ? 29  ASP C CA  1 
ATOM   4163  C  C   . ASP C  1 20  ? -5.443   30.611  14.784  1.00 25.45 ? 29  ASP C C   1 
ATOM   4164  O  O   . ASP C  1 20  ? -5.058   29.637  15.427  1.00 25.55 ? 29  ASP C O   1 
ATOM   4165  C  CB  . ASP C  1 20  ? -7.868   29.865  15.206  1.00 25.03 ? 29  ASP C CB  1 
ATOM   4166  C  CG  . ASP C  1 20  ? -7.646   28.507  14.573  1.00 29.27 ? 29  ASP C CG  1 
ATOM   4167  O  OD1 . ASP C  1 20  ? -7.140   28.428  13.420  1.00 33.39 ? 29  ASP C OD1 1 
ATOM   4168  O  OD2 . ASP C  1 20  ? -7.932   27.495  15.230  1.00 34.78 ? 29  ASP C OD2 1 
ATOM   4169  N  N   . GLY C  1 21  ? -4.610   31.492  14.271  1.00 25.33 ? 30  GLY C N   1 
ATOM   4170  C  CA  . GLY C  1 21  ? -3.186   31.390  14.433  1.00 26.81 ? 30  GLY C CA  1 
ATOM   4171  C  C   . GLY C  1 21  ? -2.617   30.089  13.903  1.00 29.39 ? 30  GLY C C   1 
ATOM   4172  O  O   . GLY C  1 21  ? -2.873   29.720  12.776  1.00 27.19 ? 30  GLY C O   1 
ATOM   4173  N  N   . ASP C  1 22  ? -1.874   29.390  14.754  1.00 31.31 ? 31  ASP C N   1 
ATOM   4174  C  CA  . ASP C  1 22  ? -1.260   28.118  14.418  1.00 30.77 ? 31  ASP C CA  1 
ATOM   4175  C  C   . ASP C  1 22  ? -2.236   26.912  14.671  1.00 28.80 ? 31  ASP C C   1 
ATOM   4176  O  O   . ASP C  1 22  ? -1.848   25.750  14.481  1.00 28.35 ? 31  ASP C O   1 
ATOM   4177  C  CB  . ASP C  1 22  ? 0.155    27.954  15.093  1.00 34.27 ? 31  ASP C CB  1 
ATOM   4178  C  CG  . ASP C  1 22  ? 0.109    27.887  16.618  1.00 37.12 ? 31  ASP C CG  1 
ATOM   4179  O  OD1 . ASP C  1 22  ? -0.994   27.704  17.195  1.00 37.63 ? 31  ASP C OD1 1 
ATOM   4180  O  OD2 . ASP C  1 22  ? 1.202    28.012  17.243  1.00 43.49 ? 31  ASP C OD2 1 
ATOM   4181  N  N   . GLY C  1 23  ? -3.487   27.191  15.043  1.00 24.23 ? 32  GLY C N   1 
ATOM   4182  C  CA  . GLY C  1 23  ? -4.515   26.151  15.216  1.00 23.12 ? 32  GLY C CA  1 
ATOM   4183  C  C   . GLY C  1 23  ? -4.529   25.082  14.119  1.00 23.62 ? 32  GLY C C   1 
ATOM   4184  O  O   . GLY C  1 23  ? -4.727   23.910  14.380  1.00 22.78 ? 32  GLY C O   1 
ATOM   4185  N  N   . TRP C  1 24  ? -4.342   25.505  12.876  1.00 23.38 ? 33  TRP C N   1 
ATOM   4186  C  CA  . TRP C  1 24  ? -4.367   24.591  11.751  1.00 22.40 ? 33  TRP C CA  1 
ATOM   4187  C  C   . TRP C  1 24  ? -3.407   23.436  11.843  1.00 23.12 ? 33  TRP C C   1 
ATOM   4188  O  O   . TRP C  1 24  ? -3.662   22.398  11.238  1.00 24.16 ? 33  TRP C O   1 
ATOM   4189  C  CB  . TRP C  1 24  ? -4.075   25.327  10.449  1.00 20.97 ? 33  TRP C CB  1 
ATOM   4190  C  CG  . TRP C  1 24  ? -2.658   25.707  10.272  1.00 19.68 ? 33  TRP C CG  1 
ATOM   4191  C  CD1 . TRP C  1 24  ? -2.068   26.854  10.685  1.00 20.34 ? 33  TRP C CD1 1 
ATOM   4192  C  CD2 . TRP C  1 24  ? -1.654   24.970  9.577   1.00 19.61 ? 33  TRP C CD2 1 
ATOM   4193  N  NE1 . TRP C  1 24  ? -0.741   26.866  10.326  1.00 21.33 ? 33  TRP C NE1 1 
ATOM   4194  C  CE2 . TRP C  1 24  ? -0.461   25.718  9.643   1.00 19.58 ? 33  TRP C CE2 1 
ATOM   4195  C  CE3 . TRP C  1 24  ? -1.634   23.723  8.946   1.00 19.96 ? 33  TRP C CE3 1 
ATOM   4196  C  CZ2 . TRP C  1 24  ? 0.727    25.291  9.074   1.00 20.27 ? 33  TRP C CZ2 1 
ATOM   4197  C  CZ3 . TRP C  1 24  ? -0.450   23.299  8.380   1.00 21.76 ? 33  TRP C CZ3 1 
ATOM   4198  C  CH2 . TRP C  1 24  ? 0.726    24.082  8.447   1.00 20.47 ? 33  TRP C CH2 1 
ATOM   4199  N  N   . THR C  1 25  ? -2.305   23.599  12.576  1.00 24.16 ? 34  THR C N   1 
ATOM   4200  C  CA  . THR C  1 25  ? -1.275   22.530  12.702  1.00 24.46 ? 34  THR C CA  1 
ATOM   4201  C  C   . THR C  1 25  ? -1.777   21.311  13.471  1.00 22.53 ? 34  THR C C   1 
ATOM   4202  O  O   . THR C  1 25  ? -1.205   20.254  13.367  1.00 21.53 ? 34  THR C O   1 
ATOM   4203  C  CB  . THR C  1 25  ? 0.011    23.000  13.402  1.00 25.81 ? 34  THR C CB  1 
ATOM   4204  O  OG1 . THR C  1 25  ? -0.327   23.588  14.657  1.00 24.23 ? 34  THR C OG1 1 
ATOM   4205  C  CG2 . THR C  1 25  ? 0.730    24.052  12.550  1.00 27.99 ? 34  THR C CG2 1 
ATOM   4206  N  N   . SER C  1 26  ? -2.872   21.466  14.210  1.00 22.83 ? 35  SER C N   1 
ATOM   4207  C  CA  . SER C  1 26  ? -3.564   20.317  14.808  1.00 23.67 ? 35  SER C CA  1 
ATOM   4208  C  C   . SER C  1 26  ? -4.735   19.763  13.959  1.00 23.88 ? 35  SER C C   1 
ATOM   4209  O  O   . SER C  1 26  ? -5.323   18.752  14.329  1.00 22.20 ? 35  SER C O   1 
ATOM   4210  C  CB  . SER C  1 26  ? -4.042   20.668  16.201  1.00 24.19 ? 35  SER C CB  1 
ATOM   4211  O  OG  . SER C  1 26  ? -5.125   21.556  16.113  1.00 24.21 ? 35  SER C OG  1 
ATOM   4212  N  N   . ARG C  1 27  ? -5.018   20.355  12.788  1.00 24.14 ? 36  ARG C N   1 
ATOM   4213  C  CA  . ARG C  1 27  ? -6.098   19.861  11.886  1.00 21.37 ? 36  ARG C CA  1 
ATOM   4214  C  C   . ARG C  1 27  ? -5.578   19.226  10.610  1.00 22.00 ? 36  ARG C C   1 
ATOM   4215  O  O   . ARG C  1 27  ? -6.309   18.549  9.891   1.00 21.42 ? 36  ARG C O   1 
ATOM   4216  C  CB  . ARG C  1 27  ? -7.047   20.992  11.548  1.00 22.77 ? 36  ARG C CB  1 
ATOM   4217  C  CG  . ARG C  1 27  ? -7.710   21.585  12.785  1.00 23.18 ? 36  ARG C CG  1 
ATOM   4218  C  CD  . ARG C  1 27  ? -8.869   22.523  12.453  1.00 24.79 ? 36  ARG C CD  1 
ATOM   4219  N  NE  . ARG C  1 27  ? -8.463   23.805  11.882  1.00 26.27 ? 36  ARG C NE  1 
ATOM   4220  C  CZ  . ARG C  1 27  ? -8.136   24.910  12.571  1.00 26.65 ? 36  ARG C CZ  1 
ATOM   4221  N  NH1 . ARG C  1 27  ? -8.161   24.938  13.900  1.00 23.79 ? 36  ARG C NH1 1 
ATOM   4222  N  NH2 . ARG C  1 27  ? -7.740   26.000  11.902  1.00 26.31 ? 36  ARG C NH2 1 
ATOM   4223  N  N   . TRP C  1 28  ? -4.294   19.410  10.321  1.00 21.02 ? 37  TRP C N   1 
ATOM   4224  C  CA  . TRP C  1 28  ? -3.735   18.917  9.079   1.00 20.37 ? 37  TRP C CA  1 
ATOM   4225  C  C   . TRP C  1 28  ? -2.546   18.007  9.373   1.00 22.46 ? 37  TRP C C   1 
ATOM   4226  O  O   . TRP C  1 28  ? -1.830   18.248  10.315  1.00 25.00 ? 37  TRP C O   1 
ATOM   4227  C  CB  . TRP C  1 28  ? -3.314   20.099  8.126   1.00 19.02 ? 37  TRP C CB  1 
ATOM   4228  C  CG  . TRP C  1 28  ? -4.462   20.974  7.648   1.00 17.25 ? 37  TRP C CG  1 
ATOM   4229  C  CD1 . TRP C  1 28  ? -5.197   21.830  8.384   1.00 15.98 ? 37  TRP C CD1 1 
ATOM   4230  C  CD2 . TRP C  1 28  ? -4.989   21.022  6.320   1.00 17.00 ? 37  TRP C CD2 1 
ATOM   4231  N  NE1 . TRP C  1 28  ? -6.156   22.438  7.603   1.00 17.22 ? 37  TRP C NE1 1 
ATOM   4232  C  CE2 . TRP C  1 28  ? -6.055   21.937  6.327   1.00 17.39 ? 37  TRP C CE2 1 
ATOM   4233  C  CE3 . TRP C  1 28  ? -4.673   20.354  5.125   1.00 18.08 ? 37  TRP C CE3 1 
ATOM   4234  C  CZ2 . TRP C  1 28  ? -6.791   22.239  5.183   1.00 17.24 ? 37  TRP C CZ2 1 
ATOM   4235  C  CZ3 . TRP C  1 28  ? -5.422   20.631  3.999   1.00 18.55 ? 37  TRP C CZ3 1 
ATOM   4236  C  CH2 . TRP C  1 28  ? -6.459   21.576  4.035   1.00 18.59 ? 37  TRP C CH2 1 
ATOM   4237  N  N   . ILE C  1 29  ? -2.304   17.034  8.498   1.00 22.88 ? 38  ILE C N   1 
ATOM   4238  C  CA  . ILE C  1 29  ? -1.307   16.018  8.712   1.00 25.49 ? 38  ILE C CA  1 
ATOM   4239  C  C   . ILE C  1 29  ? -0.421   15.918  7.486   1.00 26.80 ? 38  ILE C C   1 
ATOM   4240  O  O   . ILE C  1 29  ? -0.926   15.816  6.377   1.00 27.46 ? 38  ILE C O   1 
ATOM   4241  C  CB  . ILE C  1 29  ? -1.966   14.607  8.904   1.00 26.90 ? 38  ILE C CB  1 
ATOM   4242  C  CG1 . ILE C  1 29  ? -2.942   14.578  10.094  1.00 28.51 ? 38  ILE C CG1 1 
ATOM   4243  C  CG2 . ILE C  1 29  ? -0.906   13.513  9.014   1.00 26.61 ? 38  ILE C CG2 1 
ATOM   4244  C  CD1 . ILE C  1 29  ? -2.291   14.713  11.439  1.00 28.58 ? 38  ILE C CD1 1 
ATOM   4245  N  N   . GLU C  1 30  ? 0.890    15.867  7.707   1.00 27.95 ? 39  GLU C N   1 
ATOM   4246  C  CA  . GLU C  1 30  ? 1.875    15.727  6.646   1.00 32.16 ? 39  GLU C CA  1 
ATOM   4247  C  C   . GLU C  1 30  ? 2.075    14.269  6.348   1.00 30.17 ? 39  GLU C C   1 
ATOM   4248  O  O   . GLU C  1 30  ? 2.214    13.478  7.239   1.00 29.05 ? 39  GLU C O   1 
ATOM   4249  C  CB  . GLU C  1 30  ? 3.234    16.323  7.042   1.00 36.11 ? 39  GLU C CB  1 
ATOM   4250  C  CG  . GLU C  1 30  ? 3.335    17.815  6.840   1.00 41.92 ? 39  GLU C CG  1 
ATOM   4251  C  CD  . GLU C  1 30  ? 4.690    18.412  7.262   1.00 48.97 ? 39  GLU C CD  1 
ATOM   4252  O  OE1 . GLU C  1 30  ? 5.545    17.730  7.879   1.00 56.21 ? 39  GLU C OE1 1 
ATOM   4253  O  OE2 . GLU C  1 30  ? 4.898    19.609  6.992   1.00 53.40 ? 39  GLU C OE2 1 
ATOM   4254  N  N   . SER C  1 31  ? 2.032    13.903  5.079   1.00 30.16 ? 40  SER C N   1 
ATOM   4255  C  CA  . SER C  1 31  ? 2.351    12.532  4.694   1.00 29.81 ? 40  SER C CA  1 
ATOM   4256  C  C   . SER C  1 31  ? 3.851    12.295  4.900   1.00 31.47 ? 40  SER C C   1 
ATOM   4257  O  O   . SER C  1 31  ? 4.647    13.189  4.649   1.00 25.99 ? 40  SER C O   1 
ATOM   4258  C  CB  . SER C  1 31  ? 2.036    12.288  3.229   1.00 31.13 ? 40  SER C CB  1 
ATOM   4259  O  OG  . SER C  1 31  ? 2.608    11.089  2.769   1.00 27.93 ? 40  SER C OG  1 
ATOM   4260  N  N   . LYS C  1 32  ? 4.203    11.107  5.384   1.00 31.58 ? 41  LYS C N   1 
ATOM   4261  C  CA  . LYS C  1 32  ? 5.607    10.678  5.458   1.00 35.67 ? 41  LYS C CA  1 
ATOM   4262  C  C   . LYS C  1 32  ? 5.944    9.646   4.392   1.00 36.31 ? 41  LYS C C   1 
ATOM   4263  O  O   . LYS C  1 32  ? 6.953    8.974   4.486   1.00 36.04 ? 41  LYS C O   1 
ATOM   4264  C  CB  . LYS C  1 32  ? 5.936    10.137  6.821   1.00 36.42 ? 41  LYS C CB  1 
ATOM   4265  C  CG  . LYS C  1 32  ? 5.682    11.172  7.879   1.00 43.08 ? 41  LYS C CG  1 
ATOM   4266  C  CD  . LYS C  1 32  ? 5.894    10.586  9.243   1.00 49.79 ? 41  LYS C CD  1 
ATOM   4267  C  CE  . LYS C  1 32  ? 5.523    11.656  10.242  1.00 53.85 ? 41  LYS C CE  1 
ATOM   4268  N  NZ  . LYS C  1 32  ? 4.130    11.356  10.643  1.00 59.79 ? 41  LYS C NZ  1 
ATOM   4269  N  N   . HIS C  1 33  ? 5.111    9.543   3.360   1.00 35.83 ? 42  HIS C N   1 
ATOM   4270  C  CA  . HIS C  1 33  ? 5.359    8.551   2.318   1.00 33.59 ? 42  HIS C CA  1 
ATOM   4271  C  C   . HIS C  1 33  ? 6.762    8.706   1.727   1.00 37.49 ? 42  HIS C C   1 
ATOM   4272  O  O   . HIS C  1 33  ? 7.407    7.725   1.356   1.00 35.28 ? 42  HIS C O   1 
ATOM   4273  C  CB  . HIS C  1 33  ? 4.325    8.626   1.222   1.00 31.24 ? 42  HIS C CB  1 
ATOM   4274  C  CG  . HIS C  1 33  ? 4.557    7.648   0.115   1.00 29.80 ? 42  HIS C CG  1 
ATOM   4275  N  ND1 . HIS C  1 33  ? 4.268    6.304   0.231   1.00 27.90 ? 42  HIS C ND1 1 
ATOM   4276  C  CD2 . HIS C  1 33  ? 5.053    7.821   -1.138  1.00 29.85 ? 42  HIS C CD2 1 
ATOM   4277  C  CE1 . HIS C  1 33  ? 4.571    5.688   -0.905  1.00 27.68 ? 42  HIS C CE1 1 
ATOM   4278  N  NE2 . HIS C  1 33  ? 5.063    6.583   -1.745  1.00 28.59 ? 42  HIS C NE2 1 
ATOM   4279  N  N   . LYS C  1 34  ? 7.202    9.955   1.615   1.00 39.42 ? 43  LYS C N   1 
ATOM   4280  C  CA  . LYS C  1 34  ? 8.545    10.305  1.201   1.00 41.91 ? 43  LYS C CA  1 
ATOM   4281  C  C   . LYS C  1 34  ? 9.176    11.195  2.250   1.00 42.80 ? 43  LYS C C   1 
ATOM   4282  O  O   . LYS C  1 34  ? 8.462    11.804  3.068   1.00 39.00 ? 43  LYS C O   1 
ATOM   4283  C  CB  . LYS C  1 34  ? 8.521    11.059  -0.124  1.00 49.29 ? 43  LYS C CB  1 
ATOM   4284  C  CG  . LYS C  1 34  ? 8.369    10.205  -1.379  1.00 56.90 ? 43  LYS C CG  1 
ATOM   4285  C  CD  . LYS C  1 34  ? 8.429    11.193  -2.564  1.00 62.22 ? 43  LYS C CD  1 
ATOM   4286  C  CE  . LYS C  1 34  ? 7.985    10.572  -3.938  1.00 62.38 ? 43  LYS C CE  1 
ATOM   4287  N  NZ  . LYS C  1 34  ? 6.565    10.860  -4.270  1.00 59.44 ? 43  LYS C NZ  1 
ATOM   4288  N  N   . SER C  1 35  ? 10.511   11.294  2.204   1.00 38.67 ? 44  SER C N   1 
ATOM   4289  C  CA  . SER C  1 35  ? 11.276   12.100  3.173   1.00 38.01 ? 44  SER C CA  1 
ATOM   4290  C  C   . SER C  1 35  ? 11.491   13.558  2.720   1.00 37.03 ? 44  SER C C   1 
ATOM   4291  O  O   . SER C  1 35  ? 11.821   14.392  3.545   1.00 38.84 ? 44  SER C O   1 
ATOM   4292  C  CB  . SER C  1 35  ? 12.644   11.461  3.450   1.00 39.33 ? 44  SER C CB  1 
ATOM   4293  O  OG  . SER C  1 35  ? 13.497   11.553  2.316   1.00 32.77 ? 44  SER C OG  1 
ATOM   4294  N  N   . ASP C  1 36  ? 11.294   13.837  1.427   1.00 33.72 ? 45  ASP C N   1 
ATOM   4295  C  CA  . ASP C  1 36  ? 11.633   15.136  0.800   1.00 31.99 ? 45  ASP C CA  1 
ATOM   4296  C  C   . ASP C  1 36  ? 10.431   15.921  0.219   1.00 30.39 ? 45  ASP C C   1 
ATOM   4297  O  O   . ASP C  1 36  ? 10.577   16.679  -0.734  1.00 28.38 ? 45  ASP C O   1 
ATOM   4298  C  CB  . ASP C  1 36  ? 12.659   14.924  -0.308  1.00 32.52 ? 45  ASP C CB  1 
ATOM   4299  C  CG  . ASP C  1 36  ? 12.115   14.078  -1.460  1.00 35.75 ? 45  ASP C CG  1 
ATOM   4300  O  OD1 . ASP C  1 36  ? 11.074   13.380  -1.287  1.00 34.02 ? 45  ASP C OD1 1 
ATOM   4301  O  OD2 . ASP C  1 36  ? 12.736   14.092  -2.544  1.00 37.37 ? 45  ASP C OD2 1 
ATOM   4302  N  N   . PHE C  1 37  ? 9.241    15.699  0.770   1.00 30.30 ? 46  PHE C N   1 
ATOM   4303  C  CA  . PHE C  1 37  ? 8.085    16.545  0.447   1.00 28.41 ? 46  PHE C CA  1 
ATOM   4304  C  C   . PHE C  1 37  ? 8.388    17.999  0.829   1.00 26.40 ? 46  PHE C C   1 
ATOM   4305  O  O   . PHE C  1 37  ? 8.988    18.265  1.862   1.00 25.28 ? 46  PHE C O   1 
ATOM   4306  C  CB  . PHE C  1 37  ? 6.809    16.113  1.215   1.00 28.39 ? 46  PHE C CB  1 
ATOM   4307  C  CG  . PHE C  1 37  ? 6.130    14.856  0.679   1.00 28.90 ? 46  PHE C CG  1 
ATOM   4308  C  CD1 . PHE C  1 37  ? 5.876    14.691  -0.684  1.00 28.04 ? 46  PHE C CD1 1 
ATOM   4309  C  CD2 . PHE C  1 37  ? 5.721    13.859  1.547   1.00 26.65 ? 46  PHE C CD2 1 
ATOM   4310  C  CE1 . PHE C  1 37  ? 5.224    13.555  -1.157  1.00 26.13 ? 46  PHE C CE1 1 
ATOM   4311  C  CE2 . PHE C  1 37  ? 5.086    12.719  1.076   1.00 26.83 ? 46  PHE C CE2 1 
ATOM   4312  C  CZ  . PHE C  1 37  ? 4.847    12.563  -0.276  1.00 25.52 ? 46  PHE C CZ  1 
ATOM   4313  N  N   . GLY C  1 38  ? 7.933    18.926  0.006   1.00 25.88 ? 47  GLY C N   1 
ATOM   4314  C  CA  . GLY C  1 38  ? 7.972    20.325  0.354   1.00 26.12 ? 47  GLY C CA  1 
ATOM   4315  C  C   . GLY C  1 38  ? 7.091    20.617  1.549   1.00 25.14 ? 47  GLY C C   1 
ATOM   4316  O  O   . GLY C  1 38  ? 6.209    19.848  1.864   1.00 27.37 ? 47  GLY C O   1 
ATOM   4317  N  N   . LYS C  1 39  ? 7.334    21.735  2.226   1.00 25.15 ? 48  LYS C N   1 
ATOM   4318  C  CA  . LYS C  1 39  ? 6.554    22.107  3.436   1.00 24.85 ? 48  LYS C CA  1 
ATOM   4319  C  C   . LYS C  1 39  ? 5.603    23.274  3.102   1.00 25.10 ? 48  LYS C C   1 
ATOM   4320  O  O   . LYS C  1 39  ? 5.973    24.231  2.388   1.00 23.24 ? 48  LYS C O   1 
ATOM   4321  C  CB  . LYS C  1 39  ? 7.431    22.455  4.646   1.00 22.60 ? 48  LYS C CB  1 
ATOM   4322  N  N   . PHE C  1 40  ? 4.381    23.173  3.602   1.00 24.00 ? 49  PHE C N   1 
ATOM   4323  C  CA  . PHE C  1 40  ? 3.468    24.304  3.594   1.00 26.43 ? 49  PHE C CA  1 
ATOM   4324  C  C   . PHE C  1 40  ? 3.799    25.168  4.793   1.00 24.78 ? 49  PHE C C   1 
ATOM   4325  O  O   . PHE C  1 40  ? 4.134    24.677  5.842   1.00 23.26 ? 49  PHE C O   1 
ATOM   4326  C  CB  . PHE C  1 40  ? 1.977    23.891  3.675   1.00 28.44 ? 49  PHE C CB  1 
ATOM   4327  C  CG  . PHE C  1 40  ? 1.445    23.322  2.418   1.00 28.48 ? 49  PHE C CG  1 
ATOM   4328  C  CD1 . PHE C  1 40  ? 0.880    24.145  1.431   1.00 28.37 ? 49  PHE C CD1 1 
ATOM   4329  C  CD2 . PHE C  1 40  ? 1.498    21.958  2.202   1.00 28.83 ? 49  PHE C CD2 1 
ATOM   4330  C  CE1 . PHE C  1 40  ? 0.393    23.596  0.255   1.00 28.23 ? 49  PHE C CE1 1 
ATOM   4331  C  CE2 . PHE C  1 40  ? 0.989    21.400  1.033   1.00 28.72 ? 49  PHE C CE2 1 
ATOM   4332  C  CZ  . PHE C  1 40  ? 0.446    22.216  0.057   1.00 27.86 ? 49  PHE C CZ  1 
ATOM   4333  N  N   . VAL C  1 41  ? 3.602    26.466  4.618   1.00 23.89 ? 50  VAL C N   1 
ATOM   4334  C  CA  . VAL C  1 41  ? 3.754    27.439  5.671   1.00 22.29 ? 50  VAL C CA  1 
ATOM   4335  C  C   . VAL C  1 41  ? 2.528    28.319  5.708   1.00 21.15 ? 50  VAL C C   1 
ATOM   4336  O  O   . VAL C  1 41  ? 1.931    28.580  4.695   1.00 23.37 ? 50  VAL C O   1 
ATOM   4337  C  CB  . VAL C  1 41  ? 5.034    28.253  5.340   1.00 24.73 ? 50  VAL C CB  1 
ATOM   4338  C  CG1 . VAL C  1 41  ? 4.960    29.667  5.846   1.00 27.28 ? 50  VAL C CG1 1 
ATOM   4339  C  CG2 . VAL C  1 41  ? 6.248    27.519  5.883   1.00 23.56 ? 50  VAL C CG2 1 
ATOM   4340  N  N   . LEU C  1 42  ? 2.167    28.819  6.870   1.00 19.99 ? 51  LEU C N   1 
ATOM   4341  C  CA  . LEU C  1 42  ? 1.084    29.767  6.973   1.00 19.46 ? 51  LEU C CA  1 
ATOM   4342  C  C   . LEU C  1 42  ? 1.545    31.154  6.572   1.00 20.80 ? 51  LEU C C   1 
ATOM   4343  O  O   . LEU C  1 42  ? 2.513    31.657  7.133   1.00 23.55 ? 51  LEU C O   1 
ATOM   4344  C  CB  . LEU C  1 42  ? 0.549    29.820  8.395   1.00 20.65 ? 51  LEU C CB  1 
ATOM   4345  C  CG  . LEU C  1 42  ? -0.760   30.599  8.550   1.00 21.94 ? 51  LEU C CG  1 
ATOM   4346  C  CD1 . LEU C  1 42  ? -1.924   29.844  7.889   1.00 22.30 ? 51  LEU C CD1 1 
ATOM   4347  C  CD2 . LEU C  1 42  ? -1.063   30.854  10.024  1.00 22.42 ? 51  LEU C CD2 1 
ATOM   4348  N  N   . SER C  1 43  ? 0.837    31.787  5.621   1.00 18.88 ? 52  SER C N   1 
ATOM   4349  C  CA  . SER C  1 43  ? 1.223    33.085  5.097   1.00 18.86 ? 52  SER C CA  1 
ATOM   4350  C  C   . SER C  1 43  ? 0.089    33.786  4.314   1.00 18.33 ? 52  SER C C   1 
ATOM   4351  O  O   . SER C  1 43  ? -0.731   33.122  3.693   1.00 14.88 ? 52  SER C O   1 
ATOM   4352  C  CB  . SER C  1 43  ? 2.402    32.893  4.147   1.00 20.40 ? 52  SER C CB  1 
ATOM   4353  O  OG  . SER C  1 43  ? 2.936    34.132  3.729   1.00 23.18 ? 52  SER C OG  1 
ATOM   4354  N  N   . SER C  1 44  ? 0.073    35.125  4.367   1.00 16.96 ? 53  SER C N   1 
ATOM   4355  C  CA  . SER C  1 44  ? -0.772   35.955  3.473   1.00 16.49 ? 53  SER C CA  1 
ATOM   4356  C  C   . SER C  1 44  ? 0.046    36.567  2.321   1.00 15.95 ? 53  SER C C   1 
ATOM   4357  O  O   . SER C  1 44  ? -0.467   37.338  1.552   1.00 15.14 ? 53  SER C O   1 
ATOM   4358  C  CB  . SER C  1 44  ? -1.562   37.039  4.226   1.00 16.20 ? 53  SER C CB  1 
ATOM   4359  O  OG  . SER C  1 44  ? -0.785   37.782  5.129   1.00 19.23 ? 53  SER C OG  1 
ATOM   4360  N  N   . GLY C  1 45  ? 1.338    36.253  2.253   1.00 16.61 ? 54  GLY C N   1 
ATOM   4361  C  CA  . GLY C  1 45  ? 2.213    36.706  1.163   1.00 16.24 ? 54  GLY C CA  1 
ATOM   4362  C  C   . GLY C  1 45  ? 2.524    38.175  1.158   1.00 17.11 ? 54  GLY C C   1 
ATOM   4363  O  O   . GLY C  1 45  ? 2.279    38.884  2.139   1.00 16.86 ? 54  GLY C O   1 
ATOM   4364  N  N   . LYS C  1 46  ? 3.058    38.650  0.041   1.00 19.12 ? 55  LYS C N   1 
ATOM   4365  C  CA  . LYS C  1 46  ? 3.556    40.053  -0.073  1.00 22.92 ? 55  LYS C CA  1 
ATOM   4366  C  C   . LYS C  1 46  ? 2.460    41.092  -0.230  1.00 20.13 ? 55  LYS C C   1 
ATOM   4367  O  O   . LYS C  1 46  ? 2.624    42.220  0.161   1.00 19.31 ? 55  LYS C O   1 
ATOM   4368  C  CB  . LYS C  1 46  ? 4.469    40.235  -1.295  1.00 29.08 ? 55  LYS C CB  1 
ATOM   4369  C  CG  . LYS C  1 46  ? 5.877    39.768  -1.099  1.00 37.17 ? 55  LYS C CG  1 
ATOM   4370  C  CD  . LYS C  1 46  ? 6.861    40.442  -2.087  1.00 43.45 ? 55  LYS C CD  1 
ATOM   4371  C  CE  . LYS C  1 46  ? 7.216    41.927  -1.731  1.00 48.01 ? 55  LYS C CE  1 
ATOM   4372  N  NZ  . LYS C  1 46  ? 8.627    42.449  -1.903  1.00 51.03 ? 55  LYS C NZ  1 
ATOM   4373  N  N   . PHE C  1 47  ? 1.371    40.700  -0.879  1.00 17.54 ? 56  PHE C N   1 
ATOM   4374  C  CA  . PHE C  1 47  ? 0.173    41.554  -0.969  1.00 16.79 ? 56  PHE C CA  1 
ATOM   4375  C  C   . PHE C  1 47  ? -1.094   40.753  -0.682  1.00 17.00 ? 56  PHE C C   1 
ATOM   4376  O  O   . PHE C  1 47  ? -1.119   39.548  -0.856  1.00 16.26 ? 56  PHE C O   1 
ATOM   4377  C  CB  . PHE C  1 47  ? 0.053    42.191  -2.339  1.00 16.13 ? 56  PHE C CB  1 
ATOM   4378  C  CG  . PHE C  1 47  ? -0.049   41.223  -3.428  1.00 15.00 ? 56  PHE C CG  1 
ATOM   4379  C  CD1 . PHE C  1 47  ? 1.109    40.621  -3.948  1.00 15.65 ? 56  PHE C CD1 1 
ATOM   4380  C  CD2 . PHE C  1 47  ? -1.265   40.915  -3.976  1.00 15.18 ? 56  PHE C CD2 1 
ATOM   4381  C  CE1 . PHE C  1 47  ? 1.022    39.689  -4.965  1.00 15.20 ? 56  PHE C CE1 1 
ATOM   4382  C  CE2 . PHE C  1 47  ? -1.362   40.014  -5.037  1.00 15.23 ? 56  PHE C CE2 1 
ATOM   4383  C  CZ  . PHE C  1 47  ? -0.227   39.377  -5.509  1.00 14.77 ? 56  PHE C CZ  1 
ATOM   4384  N  N   . TYR C  1 48  ? -2.131   41.461  -0.273  1.00 15.49 ? 57  TYR C N   1 
ATOM   4385  C  CA  . TYR C  1 48  ? -3.307   40.863  0.264   1.00 15.85 ? 57  TYR C CA  1 
ATOM   4386  C  C   . TYR C  1 48  ? -4.371   41.926  0.446   1.00 16.10 ? 57  TYR C C   1 
ATOM   4387  O  O   . TYR C  1 48  ? -4.107   43.097  0.431   1.00 15.03 ? 57  TYR C O   1 
ATOM   4388  C  CB  . TYR C  1 48  ? -3.020   40.232  1.645   1.00 16.36 ? 57  TYR C CB  1 
ATOM   4389  C  CG  . TYR C  1 48  ? -2.095   41.105  2.488   1.00 16.75 ? 57  TYR C CG  1 
ATOM   4390  C  CD1 . TYR C  1 48  ? -2.549   42.280  3.090   1.00 16.85 ? 57  TYR C CD1 1 
ATOM   4391  C  CD2 . TYR C  1 48  ? -0.749   40.776  2.615   1.00 17.99 ? 57  TYR C CD2 1 
ATOM   4392  C  CE1 . TYR C  1 48  ? -1.687   43.091  3.804   1.00 16.51 ? 57  TYR C CE1 1 
ATOM   4393  C  CE2 . TYR C  1 48  ? 0.105    41.568  3.350   1.00 17.88 ? 57  TYR C CE2 1 
ATOM   4394  C  CZ  . TYR C  1 48  ? -0.383   42.711  3.919   1.00 17.17 ? 57  TYR C CZ  1 
ATOM   4395  O  OH  . TYR C  1 48  ? 0.487    43.438  4.617   1.00 21.43 ? 57  TYR C OH  1 
ATOM   4396  N  N   . GLY C  1 49  ? -5.593   41.471  0.653   1.00 16.71 ? 58  GLY C N   1 
ATOM   4397  C  CA  . GLY C  1 49  ? -6.669   42.347  1.028   1.00 15.79 ? 58  GLY C CA  1 
ATOM   4398  C  C   . GLY C  1 49  ? -6.653   42.657  2.491   1.00 15.44 ? 58  GLY C C   1 
ATOM   4399  O  O   . GLY C  1 49  ? -6.932   43.767  2.875   1.00 15.68 ? 58  GLY C O   1 
ATOM   4400  N  N   . ASP C  1 50  ? -6.404   41.642  3.312   1.00 16.74 ? 59  ASP C N   1 
ATOM   4401  C  CA  . ASP C  1 50  ? -6.317   41.817  4.767   1.00 17.82 ? 59  ASP C CA  1 
ATOM   4402  C  C   . ASP C  1 50  ? -5.251   40.880  5.261   1.00 19.56 ? 59  ASP C C   1 
ATOM   4403  O  O   . ASP C  1 50  ? -5.298   39.675  4.990   1.00 20.33 ? 59  ASP C O   1 
ATOM   4404  C  CB  . ASP C  1 50  ? -7.624   41.474  5.435   1.00 19.82 ? 59  ASP C CB  1 
ATOM   4405  C  CG  . ASP C  1 50  ? -7.564   41.618  6.941   1.00 20.17 ? 59  ASP C CG  1 
ATOM   4406  O  OD1 . ASP C  1 50  ? -7.042   40.753  7.730   1.00 21.27 ? 59  ASP C OD1 1 
ATOM   4407  O  OD2 . ASP C  1 50  ? -8.076   42.635  7.366   1.00 21.53 ? 59  ASP C OD2 1 
ATOM   4408  N  N   . GLU C  1 51  ? -4.260   41.424  5.948   1.00 19.93 ? 60  GLU C N   1 
ATOM   4409  C  CA  . GLU C  1 51  ? -3.068   40.663  6.317   1.00 21.75 ? 60  GLU C CA  1 
ATOM   4410  C  C   . GLU C  1 51  ? -3.372   39.377  7.089   1.00 21.80 ? 60  GLU C C   1 
ATOM   4411  O  O   . GLU C  1 51  ? -2.664   38.359  6.949   1.00 21.23 ? 60  GLU C O   1 
ATOM   4412  C  CB  . GLU C  1 51  ? -2.089   41.531  7.148   1.00 23.89 ? 60  GLU C CB  1 
ATOM   4413  C  CG  . GLU C  1 51  ? -0.684   40.917  7.265   1.00 27.33 ? 60  GLU C CG  1 
ATOM   4414  C  CD  . GLU C  1 51  ? 0.343    41.826  7.962   1.00 30.13 ? 60  GLU C CD  1 
ATOM   4415  O  OE1 . GLU C  1 51  ? -0.041   42.919  8.437   1.00 30.78 ? 60  GLU C OE1 1 
ATOM   4416  O  OE2 . GLU C  1 51  ? 1.541    41.434  8.040   1.00 30.91 ? 60  GLU C OE2 1 
ATOM   4417  N  N   . GLU C  1 52  ? -4.395   39.441  7.921   1.00 22.23 ? 61  GLU C N   1 
ATOM   4418  C  CA  . GLU C  1 52  ? -4.794   38.299  8.764   1.00 22.03 ? 61  GLU C CA  1 
ATOM   4419  C  C   . GLU C  1 52  ? -5.801   37.352  8.074   1.00 19.56 ? 61  GLU C C   1 
ATOM   4420  O  O   . GLU C  1 52  ? -5.592   36.146  8.030   1.00 18.21 ? 61  GLU C O   1 
ATOM   4421  C  CB  . GLU C  1 52  ? -5.361   38.777  10.118  1.00 24.01 ? 61  GLU C CB  1 
ATOM   4422  C  CG  . GLU C  1 52  ? -4.316   39.441  11.028  1.00 27.77 ? 61  GLU C CG  1 
ATOM   4423  C  CD  . GLU C  1 52  ? -2.908   38.783  11.040  1.00 33.18 ? 61  GLU C CD  1 
ATOM   4424  O  OE1 . GLU C  1 52  ? -2.728   37.552  11.107  1.00 34.10 ? 61  GLU C OE1 1 
ATOM   4425  O  OE2 . GLU C  1 52  ? -1.922   39.521  10.996  1.00 37.76 ? 61  GLU C OE2 1 
ATOM   4426  N  N   . LYS C  1 53  ? -6.868   37.905  7.504   1.00 18.36 ? 62  LYS C N   1 
ATOM   4427  C  CA  . LYS C  1 53  ? -7.892   37.073  6.876   1.00 17.00 ? 62  LYS C CA  1 
ATOM   4428  C  C   . LYS C  1 53  ? -7.336   36.249  5.755   1.00 15.90 ? 62  LYS C C   1 
ATOM   4429  O  O   . LYS C  1 53  ? -7.665   35.052  5.603   1.00 14.84 ? 62  LYS C O   1 
ATOM   4430  C  CB  . LYS C  1 53  ? -9.019   37.925  6.351   1.00 19.48 ? 62  LYS C CB  1 
ATOM   4431  C  CG  . LYS C  1 53  ? -9.864   38.588  7.415   1.00 20.56 ? 62  LYS C CG  1 
ATOM   4432  C  CD  . LYS C  1 53  ? -10.941  39.407  6.734   1.00 23.43 ? 62  LYS C CD  1 
ATOM   4433  C  CE  . LYS C  1 53  ? -11.648  40.250  7.744   1.00 25.77 ? 62  LYS C CE  1 
ATOM   4434  N  NZ  . LYS C  1 53  ? -12.490  41.223  6.986   1.00 28.68 ? 62  LYS C NZ  1 
ATOM   4435  N  N   . ASP C  1 54  ? -6.425   36.857  4.993   1.00 15.17 ? 63  ASP C N   1 
ATOM   4436  C  CA  . ASP C  1 54  ? -5.894   36.235  3.790   1.00 15.83 ? 63  ASP C CA  1 
ATOM   4437  C  C   . ASP C  1 54  ? -4.706   35.298  4.039   1.00 16.63 ? 63  ASP C C   1 
ATOM   4438  O  O   . ASP C  1 54  ? -4.057   34.815  3.086   1.00 16.59 ? 63  ASP C O   1 
ATOM   4439  C  CB  . ASP C  1 54  ? -5.608   37.278  2.711   1.00 15.10 ? 63  ASP C CB  1 
ATOM   4440  C  CG  . ASP C  1 54  ? -6.915   37.938  2.201   1.00 16.91 ? 63  ASP C CG  1 
ATOM   4441  O  OD1 . ASP C  1 54  ? -7.893   37.161  1.924   1.00 17.05 ? 63  ASP C OD1 1 
ATOM   4442  O  OD2 . ASP C  1 54  ? -7.009   39.197  2.164   1.00 16.90 ? 63  ASP C OD2 1 
ATOM   4443  N  N   . LYS C  1 55  ? -4.488   34.949  5.290   1.00 17.48 ? 64  LYS C N   1 
ATOM   4444  C  CA  . LYS C  1 55  ? -3.596   33.808  5.579   1.00 19.86 ? 64  LYS C CA  1 
ATOM   4445  C  C   . LYS C  1 55  ? -4.159   32.456  5.110   1.00 17.62 ? 64  LYS C C   1 
ATOM   4446  O  O   . LYS C  1 55  ? -5.309   32.150  5.308   1.00 14.83 ? 64  LYS C O   1 
ATOM   4447  C  CB  . LYS C  1 55  ? -3.293   33.709  7.053   1.00 21.85 ? 64  LYS C CB  1 
ATOM   4448  C  CG  . LYS C  1 55  ? -2.611   34.941  7.649   1.00 25.13 ? 64  LYS C CG  1 
ATOM   4449  C  CD  . LYS C  1 55  ? -1.509   34.524  8.603   1.00 29.44 ? 64  LYS C CD  1 
ATOM   4450  C  CE  . LYS C  1 55  ? -1.224   35.487  9.757   1.00 36.60 ? 64  LYS C CE  1 
ATOM   4451  N  NZ  . LYS C  1 55  ? -0.387   36.674  9.562   1.00 39.53 ? 64  LYS C NZ  1 
ATOM   4452  N  N   . GLY C  1 56  ? -3.279   31.677  4.485   1.00 17.83 ? 65  GLY C N   1 
ATOM   4453  C  CA  . GLY C  1 56  ? -3.581   30.340  4.049   1.00 17.49 ? 65  GLY C CA  1 
ATOM   4454  C  C   . GLY C  1 56  ? -2.327   29.495  3.956   1.00 18.73 ? 65  GLY C C   1 
ATOM   4455  O  O   . GLY C  1 56  ? -1.257   29.892  4.349   1.00 19.37 ? 65  GLY C O   1 
ATOM   4456  N  N   . LEU C  1 57  ? -2.441   28.329  3.374   1.00 20.07 ? 66  LEU C N   1 
ATOM   4457  C  CA  . LEU C  1 57  ? -1.297   27.450  3.251   1.00 20.31 ? 66  LEU C CA  1 
ATOM   4458  C  C   . LEU C  1 57  ? -0.536   27.791  2.027   1.00 19.97 ? 66  LEU C C   1 
ATOM   4459  O  O   . LEU C  1 57  ? -1.071   27.733  0.915   1.00 22.06 ? 66  LEU C O   1 
ATOM   4460  C  CB  . LEU C  1 57  ? -1.731   25.988  3.144   1.00 22.24 ? 66  LEU C CB  1 
ATOM   4461  C  CG  . LEU C  1 57  ? -2.461   25.441  4.355   1.00 24.08 ? 66  LEU C CG  1 
ATOM   4462  C  CD1 . LEU C  1 57  ? -3.138   24.120  4.012   1.00 25.64 ? 66  LEU C CD1 1 
ATOM   4463  C  CD2 . LEU C  1 57  ? -1.495   25.264  5.502   1.00 25.70 ? 66  LEU C CD2 1 
ATOM   4464  N  N   . GLN C  1 58  ? 0.752    28.065  2.202   1.00 19.57 ? 67  GLN C N   1 
ATOM   4465  C  CA  . GLN C  1 58  ? 1.604    28.467  1.114   1.00 17.27 ? 67  GLN C CA  1 
ATOM   4466  C  C   . GLN C  1 58  ? 2.676    27.436  0.857   1.00 16.39 ? 67  GLN C C   1 
ATOM   4467  O  O   . GLN C  1 58  ? 3.379    27.032  1.765   1.00 15.93 ? 67  GLN C O   1 
ATOM   4468  C  CB  . GLN C  1 58  ? 2.254    29.824  1.428   1.00 19.76 ? 67  GLN C CB  1 
ATOM   4469  C  CG  . GLN C  1 58  ? 3.154    30.358  0.316   1.00 20.30 ? 67  GLN C CG  1 
ATOM   4470  C  CD  . GLN C  1 58  ? 3.713    31.727  0.622   1.00 22.27 ? 67  GLN C CD  1 
ATOM   4471  O  OE1 . GLN C  1 58  ? 4.273    31.952  1.666   1.00 25.28 ? 67  GLN C OE1 1 
ATOM   4472  N  NE2 . GLN C  1 58  ? 3.591    32.636  -0.318  1.00 23.73 ? 67  GLN C NE2 1 
ATOM   4473  N  N   . THR C  1 59  ? 2.829    27.029  -0.397  1.00 15.52 ? 68  THR C N   1 
ATOM   4474  C  CA  . THR C  1 59  ? 3.951    26.197  -0.763  1.00 16.97 ? 68  THR C CA  1 
ATOM   4475  C  C   . THR C  1 59  ? 5.270    27.003  -0.623  1.00 17.56 ? 68  THR C C   1 
ATOM   4476  O  O   . THR C  1 59  ? 5.371    28.123  -1.133  1.00 17.08 ? 68  THR C O   1 
ATOM   4477  C  CB  . THR C  1 59  ? 3.834    25.664  -2.197  1.00 17.72 ? 68  THR C CB  1 
ATOM   4478  O  OG1 . THR C  1 59  ? 3.650    26.750  -3.106  1.00 16.68 ? 68  THR C OG1 1 
ATOM   4479  C  CG2 . THR C  1 59  ? 2.675    24.709  -2.311  1.00 18.00 ? 68  THR C CG2 1 
ATOM   4480  N  N   . SER C  1 60  ? 6.250    26.427  0.091   1.00 17.96 ? 69  SER C N   1 
ATOM   4481  C  CA  . SER C  1 60  ? 7.468    27.154  0.515   1.00 19.12 ? 69  SER C CA  1 
ATOM   4482  C  C   . SER C  1 60  ? 8.759    26.702  -0.142  1.00 20.79 ? 69  SER C C   1 
ATOM   4483  O  O   . SER C  1 60  ? 9.782    27.308  0.102   1.00 24.43 ? 69  SER C O   1 
ATOM   4484  C  CB  . SER C  1 60  ? 7.667    27.053  2.019   1.00 18.90 ? 69  SER C CB  1 
ATOM   4485  O  OG  . SER C  1 60  ? 8.259    25.805  2.305   1.00 19.91 ? 69  SER C OG  1 
ATOM   4486  N  N   . GLN C  1 61  ? 8.711    25.686  -0.996  1.00 19.77 ? 70  GLN C N   1 
ATOM   4487  C  CA  . GLN C  1 61  ? 9.896    25.195  -1.626  1.00 21.13 ? 70  GLN C CA  1 
ATOM   4488  C  C   . GLN C  1 61  ? 9.709    24.853  -3.092  1.00 22.63 ? 70  GLN C C   1 
ATOM   4489  O  O   . GLN C  1 61  ? 8.727    24.245  -3.498  1.00 24.12 ? 70  GLN C O   1 
ATOM   4490  C  CB  . GLN C  1 61  ? 10.410   23.943  -0.936  1.00 21.67 ? 70  GLN C CB  1 
ATOM   4491  C  CG  . GLN C  1 61  ? 10.729   24.137  0.528   1.00 21.89 ? 70  GLN C CG  1 
ATOM   4492  C  CD  . GLN C  1 61  ? 11.059   22.833  1.236   1.00 22.33 ? 70  GLN C CD  1 
ATOM   4493  O  OE1 . GLN C  1 61  ? 10.273   22.326  2.052   1.00 20.45 ? 70  GLN C OE1 1 
ATOM   4494  N  NE2 . GLN C  1 61  ? 12.186   22.237  0.876   1.00 22.99 ? 70  GLN C NE2 1 
ATOM   4495  N  N   . LYS C  1 62  ? 10.724   25.194  -3.859  1.00 22.33 ? 71  LYS C N   1 
ATOM   4496  C  CA  . LYS C  1 62  ? 10.711   25.038  -5.272  1.00 21.62 ? 71  LYS C CA  1 
ATOM   4497  C  C   . LYS C  1 62  ? 10.964   23.582  -5.680  1.00 20.98 ? 71  LYS C C   1 
ATOM   4498  O  O   . LYS C  1 62  ? 11.752   22.882  -5.062  1.00 19.14 ? 71  LYS C O   1 
ATOM   4499  C  CB  . LYS C  1 62  ? 11.757   25.985  -5.875  1.00 23.73 ? 71  LYS C CB  1 
ATOM   4500  C  CG  . LYS C  1 62  ? 11.864   25.937  -7.381  1.00 25.54 ? 71  LYS C CG  1 
ATOM   4501  C  CD  . LYS C  1 62  ? 12.646   27.095  -7.966  1.00 26.45 ? 71  LYS C CD  1 
ATOM   4502  C  CE  . LYS C  1 62  ? 12.736   26.929  -9.488  1.00 30.53 ? 71  LYS C CE  1 
ATOM   4503  N  NZ  . LYS C  1 62  ? 13.806   27.739  -10.122 1.00 32.38 ? 71  LYS C NZ  1 
ATOM   4504  N  N   . ALA C  1 63  ? 10.352   23.177  -6.788  1.00 20.01 ? 72  ALA C N   1 
ATOM   4505  C  CA  . ALA C  1 63  ? 10.550   21.871  -7.384  1.00 21.38 ? 72  ALA C CA  1 
ATOM   4506  C  C   . ALA C  1 63  ? 10.376   20.782  -6.363  1.00 22.59 ? 72  ALA C C   1 
ATOM   4507  O  O   . ALA C  1 63  ? 11.303   20.040  -6.055  1.00 22.54 ? 72  ALA C O   1 
ATOM   4508  C  CB  . ALA C  1 63  ? 11.909   21.760  -8.085  1.00 23.37 ? 72  ALA C CB  1 
ATOM   4509  N  N   . ARG C  1 64  ? 9.168    20.702  -5.818  1.00 23.40 ? 73  ARG C N   1 
ATOM   4510  C  CA  . ARG C  1 64  ? 8.842    19.716  -4.813  1.00 24.35 ? 73  ARG C CA  1 
ATOM   4511  C  C   . ARG C  1 64  ? 7.430    19.154  -4.977  1.00 25.68 ? 73  ARG C C   1 
ATOM   4512  O  O   . ARG C  1 64  ? 6.527    19.819  -5.485  1.00 22.87 ? 73  ARG C O   1 
ATOM   4513  C  CB  . ARG C  1 64  ? 8.979    20.313  -3.426  1.00 25.77 ? 73  ARG C CB  1 
ATOM   4514  C  CG  . ARG C  1 64  ? 10.418   20.677  -3.048  1.00 27.27 ? 73  ARG C CG  1 
ATOM   4515  C  CD  . ARG C  1 64  ? 11.231   19.441  -2.713  1.00 31.78 ? 73  ARG C CD  1 
ATOM   4516  N  NE  . ARG C  1 64  ? 12.598   19.679  -2.199  1.00 37.77 ? 73  ARG C NE  1 
ATOM   4517  C  CZ  . ARG C  1 64  ? 13.615   20.143  -2.930  1.00 46.70 ? 73  ARG C CZ  1 
ATOM   4518  N  NH1 . ARG C  1 64  ? 13.452   20.487  -4.208  1.00 49.87 ? 73  ARG C NH1 1 
ATOM   4519  N  NH2 . ARG C  1 64  ? 14.807   20.283  -2.387  1.00 48.63 ? 73  ARG C NH2 1 
ATOM   4520  N  N   . PHE C  1 65  ? 7.278    17.919  -4.516  1.00 23.87 ? 74  PHE C N   1 
ATOM   4521  C  CA  . PHE C  1 65  ? 5.984    17.344  -4.251  1.00 23.61 ? 74  PHE C CA  1 
ATOM   4522  C  C   . PHE C  1 65  ? 5.496    17.763  -2.882  1.00 23.57 ? 74  PHE C C   1 
ATOM   4523  O  O   . PHE C  1 65  ? 6.265    17.910  -1.946  1.00 22.24 ? 74  PHE C O   1 
ATOM   4524  C  CB  . PHE C  1 65  ? 6.016    15.811  -4.307  1.00 24.41 ? 74  PHE C CB  1 
ATOM   4525  C  CG  . PHE C  1 65  ? 6.230    15.278  -5.686  1.00 25.79 ? 74  PHE C CG  1 
ATOM   4526  C  CD1 . PHE C  1 65  ? 5.173    15.217  -6.598  1.00 25.25 ? 74  PHE C CD1 1 
ATOM   4527  C  CD2 . PHE C  1 65  ? 7.477    14.834  -6.067  1.00 26.19 ? 74  PHE C CD2 1 
ATOM   4528  C  CE1 . PHE C  1 65  ? 5.364    14.714  -7.878  1.00 28.21 ? 74  PHE C CE1 1 
ATOM   4529  C  CE2 . PHE C  1 65  ? 7.694    14.336  -7.353  1.00 31.11 ? 74  PHE C CE2 1 
ATOM   4530  C  CZ  . PHE C  1 65  ? 6.640    14.268  -8.265  1.00 31.50 ? 74  PHE C CZ  1 
ATOM   4531  N  N   . TYR C  1 66  ? 4.187    17.938  -2.785  1.00 22.94 ? 75  TYR C N   1 
ATOM   4532  C  CA  . TYR C  1 66  ? 3.533    18.304  -1.529  1.00 21.91 ? 75  TYR C CA  1 
ATOM   4533  C  C   . TYR C  1 66  ? 2.475    17.262  -1.196  1.00 21.50 ? 75  TYR C C   1 
ATOM   4534  O  O   . TYR C  1 66  ? 1.886    16.648  -2.084  1.00 23.74 ? 75  TYR C O   1 
ATOM   4535  C  CB  . TYR C  1 66  ? 2.908    19.687  -1.644  1.00 21.41 ? 75  TYR C CB  1 
ATOM   4536  C  CG  . TYR C  1 66  ? 3.930    20.781  -1.766  1.00 22.86 ? 75  TYR C CG  1 
ATOM   4537  C  CD1 . TYR C  1 66  ? 4.600    21.018  -2.982  1.00 23.07 ? 75  TYR C CD1 1 
ATOM   4538  C  CD2 . TYR C  1 66  ? 4.272    21.555  -0.663  1.00 20.95 ? 75  TYR C CD2 1 
ATOM   4539  C  CE1 . TYR C  1 66  ? 5.561    22.013  -3.074  1.00 23.64 ? 75  TYR C CE1 1 
ATOM   4540  C  CE2 . TYR C  1 66  ? 5.245    22.519  -0.741  1.00 20.41 ? 75  TYR C CE2 1 
ATOM   4541  C  CZ  . TYR C  1 66  ? 5.874    22.761  -1.937  1.00 22.19 ? 75  TYR C CZ  1 
ATOM   4542  O  OH  . TYR C  1 66  ? 6.820    23.768  -1.990  1.00 25.21 ? 75  TYR C OH  1 
ATOM   4543  N  N   . ALA C  1 67  ? 2.200    17.111  0.076   1.00 20.07 ? 76  ALA C N   1 
ATOM   4544  C  CA  . ALA C  1 67  ? 1.276    16.123  0.533   1.00 21.10 ? 76  ALA C CA  1 
ATOM   4545  C  C   . ALA C  1 67  ? 0.861    16.431  1.971   1.00 20.16 ? 76  ALA C C   1 
ATOM   4546  O  O   . ALA C  1 67  ? 1.462    15.975  2.913   1.00 21.77 ? 76  ALA C O   1 
ATOM   4547  C  CB  . ALA C  1 67  ? 1.888    14.743  0.436   1.00 23.15 ? 76  ALA C CB  1 
ATOM   4548  N  N   . LEU C  1 68  ? -0.199   17.195  2.102   1.00 19.88 ? 77  LEU C N   1 
ATOM   4549  C  CA  . LEU C  1 68  ? -0.753   17.591  3.386   1.00 21.18 ? 77  LEU C CA  1 
ATOM   4550  C  C   . LEU C  1 68  ? -2.281   17.398  3.320   1.00 23.88 ? 77  LEU C C   1 
ATOM   4551  O  O   . LEU C  1 68  ? -2.892   17.688  2.283   1.00 25.91 ? 77  LEU C O   1 
ATOM   4552  C  CB  . LEU C  1 68  ? -0.438   19.065  3.636   1.00 20.62 ? 77  LEU C CB  1 
ATOM   4553  C  CG  . LEU C  1 68  ? -0.818   19.624  4.989   1.00 19.72 ? 77  LEU C CG  1 
ATOM   4554  C  CD1 . LEU C  1 68  ? 0.192    19.244  6.046   1.00 20.14 ? 77  LEU C CD1 1 
ATOM   4555  C  CD2 . LEU C  1 68  ? -0.991   21.133  4.937   1.00 19.55 ? 77  LEU C CD2 1 
ATOM   4556  N  N   . SER C  1 69  ? -2.901   16.946  4.403   1.00 22.10 ? 78  SER C N   1 
ATOM   4557  C  CA  . SER C  1 69  ? -4.338   16.629  4.354   1.00 24.39 ? 78  SER C CA  1 
ATOM   4558  C  C   . SER C  1 69  ? -5.049   16.892  5.650   1.00 23.43 ? 78  SER C C   1 
ATOM   4559  O  O   . SER C  1 69  ? -4.449   16.941  6.719   1.00 24.98 ? 78  SER C O   1 
ATOM   4560  C  CB  . SER C  1 69  ? -4.621   15.183  3.851   1.00 23.89 ? 78  SER C CB  1 
ATOM   4561  O  OG  . SER C  1 69  ? -4.052   14.224  4.696   1.00 26.09 ? 78  SER C OG  1 
ATOM   4562  N  N   . ALA C  1 70  ? -6.352   17.090  5.526   1.00 23.08 ? 79  ALA C N   1 
ATOM   4563  C  CA  . ALA C  1 70  ? -7.231   17.345  6.666   1.00 24.34 ? 79  ALA C CA  1 
ATOM   4564  C  C   . ALA C  1 70  ? -8.430   16.375  6.644   1.00 27.17 ? 79  ALA C C   1 
ATOM   4565  O  O   . ALA C  1 70  ? -9.146   16.227  5.612   1.00 24.87 ? 79  ALA C O   1 
ATOM   4566  C  CB  . ALA C  1 70  ? -7.734   18.770  6.633   1.00 23.84 ? 79  ALA C CB  1 
ATOM   4567  N  N   . SER C  1 71  ? -8.654   15.737  7.784   1.00 26.11 ? 80  SER C N   1 
ATOM   4568  C  CA  . SER C  1 71  ? -9.805   14.836  7.982   1.00 24.31 ? 80  SER C CA  1 
ATOM   4569  C  C   . SER C  1 71  ? -10.993  15.589  8.552   1.00 22.85 ? 80  SER C C   1 
ATOM   4570  O  O   . SER C  1 71  ? -10.872  16.642  9.159   1.00 21.45 ? 80  SER C O   1 
ATOM   4571  C  CB  . SER C  1 71  ? -9.450   13.600  8.822   1.00 22.76 ? 80  SER C CB  1 
ATOM   4572  O  OG  . SER C  1 71  ? -9.269   13.976  10.151  1.00 25.52 ? 80  SER C OG  1 
ATOM   4573  N  N   . PHE C  1 72  ? -12.171  15.042  8.265   1.00 21.86 ? 81  PHE C N   1 
ATOM   4574  C  CA  . PHE C  1 72  ? -13.418  15.576  8.774   1.00 22.22 ? 81  PHE C CA  1 
ATOM   4575  C  C   . PHE C  1 72  ? -14.332  14.381  9.039   1.00 21.89 ? 81  PHE C C   1 
ATOM   4576  O  O   . PHE C  1 72  ? -14.095  13.286  8.522   1.00 19.90 ? 81  PHE C O   1 
ATOM   4577  C  CB  . PHE C  1 72  ? -14.045  16.611  7.778   1.00 22.28 ? 81  PHE C CB  1 
ATOM   4578  C  CG  . PHE C  1 72  ? -14.026  16.166  6.335   1.00 22.70 ? 81  PHE C CG  1 
ATOM   4579  C  CD1 . PHE C  1 72  ? -14.990  15.283  5.843   1.00 22.19 ? 81  PHE C CD1 1 
ATOM   4580  C  CD2 . PHE C  1 72  ? -13.004  16.582  5.493   1.00 22.44 ? 81  PHE C CD2 1 
ATOM   4581  C  CE1 . PHE C  1 72  ? -14.919  14.814  4.547   1.00 24.79 ? 81  PHE C CE1 1 
ATOM   4582  C  CE2 . PHE C  1 72  ? -12.928  16.128  4.191   1.00 24.48 ? 81  PHE C CE2 1 
ATOM   4583  C  CZ  . PHE C  1 72  ? -13.885  15.244  3.707   1.00 25.59 ? 81  PHE C CZ  1 
ATOM   4584  N  N   . GLU C  1 73  ? -15.371  14.607  9.835   1.00 24.21 ? 82  GLU C N   1 
ATOM   4585  C  CA  . GLU C  1 73  ? -16.448  13.601  10.058  1.00 26.81 ? 82  GLU C CA  1 
ATOM   4586  C  C   . GLU C  1 73  ? -16.951  13.085  8.664   1.00 26.31 ? 82  GLU C C   1 
ATOM   4587  O  O   . GLU C  1 73  ? -17.446  13.857  7.826   1.00 23.42 ? 82  GLU C O   1 
ATOM   4588  C  CB  . GLU C  1 73  ? -17.584  14.215  10.885  1.00 32.11 ? 82  GLU C CB  1 
ATOM   4589  C  CG  . GLU C  1 73  ? -18.715  13.272  11.427  1.00 39.90 ? 82  GLU C CG  1 
ATOM   4590  C  CD  . GLU C  1 73  ? -19.818  14.065  12.165  1.00 49.30 ? 82  GLU C CD  1 
ATOM   4591  O  OE1 . GLU C  1 73  ? -19.808  15.338  12.070  1.00 49.58 ? 82  GLU C OE1 1 
ATOM   4592  O  OE2 . GLU C  1 73  ? -20.689  13.421  12.853  1.00 54.43 ? 82  GLU C OE2 1 
ATOM   4593  N  N   . PRO C  1 74  ? -16.772  11.788  8.396   1.00 24.31 ? 83  PRO C N   1 
ATOM   4594  C  CA  . PRO C  1 74  ? -17.128  11.226  7.096   1.00 23.18 ? 83  PRO C CA  1 
ATOM   4595  C  C   . PRO C  1 74  ? -18.598  11.441  6.690   1.00 23.19 ? 83  PRO C C   1 
ATOM   4596  O  O   . PRO C  1 74  ? -19.464  11.622  7.543   1.00 20.46 ? 83  PRO C O   1 
ATOM   4597  C  CB  . PRO C  1 74  ? -16.824  9.726   7.235   1.00 22.92 ? 83  PRO C CB  1 
ATOM   4598  C  CG  . PRO C  1 74  ? -15.855  9.637   8.346   1.00 25.26 ? 83  PRO C CG  1 
ATOM   4599  C  CD  . PRO C  1 74  ? -16.101  10.808  9.270   1.00 24.57 ? 83  PRO C CD  1 
ATOM   4600  N  N   . PHE C  1 75  ? -18.832  11.467  5.377   1.00 22.43 ? 84  PHE C N   1 
ATOM   4601  C  CA  . PHE C  1 75  ? -20.164  11.640  4.847   1.00 21.07 ? 84  PHE C CA  1 
ATOM   4602  C  C   . PHE C  1 75  ? -20.211  11.019  3.494   1.00 21.65 ? 84  PHE C C   1 
ATOM   4603  O  O   . PHE C  1 75  ? -19.178  10.659  2.902   1.00 22.19 ? 84  PHE C O   1 
ATOM   4604  C  CB  . PHE C  1 75  ? -20.550  13.118  4.804   1.00 22.51 ? 84  PHE C CB  1 
ATOM   4605  C  CG  . PHE C  1 75  ? -19.925  13.890  3.658   1.00 22.10 ? 84  PHE C CG  1 
ATOM   4606  C  CD1 . PHE C  1 75  ? -18.664  14.453  3.780   1.00 22.01 ? 84  PHE C CD1 1 
ATOM   4607  C  CD2 . PHE C  1 75  ? -20.631  14.085  2.484   1.00 22.51 ? 84  PHE C CD2 1 
ATOM   4608  C  CE1 . PHE C  1 75  ? -18.114  15.171  2.756   1.00 23.04 ? 84  PHE C CE1 1 
ATOM   4609  C  CE2 . PHE C  1 75  ? -20.087  14.804  1.440   1.00 23.59 ? 84  PHE C CE2 1 
ATOM   4610  C  CZ  . PHE C  1 75  ? -18.816  15.343  1.569   1.00 24.45 ? 84  PHE C CZ  1 
ATOM   4611  N  N   . SER C  1 76  ? -21.437  10.851  3.015   1.00 22.73 ? 85  SER C N   1 
ATOM   4612  C  CA  . SER C  1 76  ? -21.708  10.371  1.660   1.00 21.60 ? 85  SER C CA  1 
ATOM   4613  C  C   . SER C  1 76  ? -22.500  11.455  0.929   1.00 20.50 ? 85  SER C C   1 
ATOM   4614  O  O   . SER C  1 76  ? -23.327  12.113  1.544   1.00 18.80 ? 85  SER C O   1 
ATOM   4615  C  CB  . SER C  1 76  ? -22.504  9.072   1.703   1.00 23.05 ? 85  SER C CB  1 
ATOM   4616  O  OG  . SER C  1 76  ? -22.773  8.605   0.378   1.00 26.16 ? 85  SER C OG  1 
ATOM   4617  N  N   . ASN C  1 77  ? -22.210  11.663  -0.363  1.00 18.61 ? 86  ASN C N   1 
ATOM   4618  C  CA  . ASN C  1 77  ? -23.028  12.565  -1.178  1.00 19.27 ? 86  ASN C CA  1 
ATOM   4619  C  C   . ASN C  1 77  ? -24.260  11.832  -1.893  1.00 21.91 ? 86  ASN C C   1 
ATOM   4620  O  O   . ASN C  1 77  ? -25.050  12.494  -2.625  1.00 20.75 ? 86  ASN C O   1 
ATOM   4621  C  CB  . ASN C  1 77  ? -22.221  13.250  -2.259  1.00 16.16 ? 86  ASN C CB  1 
ATOM   4622  C  CG  . ASN C  1 77  ? -21.654  12.274  -3.240  1.00 15.66 ? 86  ASN C CG  1 
ATOM   4623  O  OD1 . ASN C  1 77  ? -21.264  11.180  -2.829  1.00 16.09 ? 86  ASN C OD1 1 
ATOM   4624  N  ND2 . ASN C  1 77  ? -21.566  12.639  -4.498  1.00 13.84 ? 86  ASN C ND2 1 
ATOM   4625  N  N   . LYS C  1 78  ? -24.456  10.541  -1.604  1.00 24.30 ? 87  LYS C N   1 
ATOM   4626  C  CA  . LYS C  1 78  ? -25.622  9.763   -2.125  1.00 27.43 ? 87  LYS C CA  1 
ATOM   4627  C  C   . LYS C  1 78  ? -26.934  10.476  -1.911  1.00 23.07 ? 87  LYS C C   1 
ATOM   4628  O  O   . LYS C  1 78  ? -27.257  10.848  -0.772  1.00 18.70 ? 87  LYS C O   1 
ATOM   4629  C  CB  . LYS C  1 78  ? -25.787  8.418   -1.394  1.00 35.88 ? 87  LYS C CB  1 
ATOM   4630  C  CG  . LYS C  1 78  ? -24.799  7.365   -1.818  1.00 42.33 ? 87  LYS C CG  1 
ATOM   4631  C  CD  . LYS C  1 78  ? -24.707  6.105   -0.941  1.00 44.57 ? 87  LYS C CD  1 
ATOM   4632  C  CE  . LYS C  1 78  ? -23.689  5.125   -1.556  1.00 46.02 ? 87  LYS C CE  1 
ATOM   4633  N  NZ  . LYS C  1 78  ? -23.990  3.657   -1.468  1.00 46.32 ? 87  LYS C NZ  1 
ATOM   4634  N  N   . GLY C  1 79  ? -27.660  10.695  -2.992  1.00 19.53 ? 88  GLY C N   1 
ATOM   4635  C  CA  . GLY C  1 79  ? -28.928  11.389  -2.889  1.00 21.69 ? 88  GLY C CA  1 
ATOM   4636  C  C   . GLY C  1 79  ? -28.890  12.897  -2.672  1.00 21.56 ? 88  GLY C C   1 
ATOM   4637  O  O   . GLY C  1 79  ? -29.922  13.528  -2.403  1.00 25.09 ? 88  GLY C O   1 
ATOM   4638  N  N   . GLN C  1 80  ? -27.697  13.467  -2.716  1.00 22.57 ? 89  GLN C N   1 
ATOM   4639  C  CA  . GLN C  1 80  ? -27.459  14.883  -2.343  1.00 22.76 ? 89  GLN C CA  1 
ATOM   4640  C  C   . GLN C  1 80  ? -26.551  15.633  -3.305  1.00 20.28 ? 89  GLN C C   1 
ATOM   4641  O  O   . GLN C  1 80  ? -25.767  15.029  -4.039  1.00 18.99 ? 89  GLN C O   1 
ATOM   4642  C  CB  . GLN C  1 80  ? -26.729  14.977  -0.991  1.00 25.11 ? 89  GLN C CB  1 
ATOM   4643  C  CG  . GLN C  1 80  ? -27.633  14.984  0.179   1.00 28.40 ? 89  GLN C CG  1 
ATOM   4644  C  CD  . GLN C  1 80  ? -26.899  15.253  1.474   1.00 27.53 ? 89  GLN C CD  1 
ATOM   4645  O  OE1 . GLN C  1 80  ? -27.306  16.114  2.253   1.00 30.22 ? 89  GLN C OE1 1 
ATOM   4646  N  NE2 . GLN C  1 80  ? -25.861  14.476  1.752   1.00 27.93 ? 89  GLN C NE2 1 
ATOM   4647  N  N   . THR C  1 81  ? -26.583  16.956  -3.181  1.00 18.78 ? 90  THR C N   1 
ATOM   4648  C  CA  . THR C  1 81  ? -25.638  17.815  -3.838  1.00 20.06 ? 90  THR C CA  1 
ATOM   4649  C  C   . THR C  1 81  ? -24.339  17.846  -3.030  1.00 21.57 ? 90  THR C C   1 
ATOM   4650  O  O   . THR C  1 81  ? -24.339  17.876  -1.798  1.00 20.30 ? 90  THR C O   1 
ATOM   4651  C  CB  . THR C  1 81  ? -26.206  19.239  -4.051  1.00 21.27 ? 90  THR C CB  1 
ATOM   4652  O  OG1 . THR C  1 81  ? -27.300  19.168  -4.980  1.00 18.39 ? 90  THR C OG1 1 
ATOM   4653  C  CG2 . THR C  1 81  ? -25.149  20.136  -4.690  1.00 22.09 ? 90  THR C CG2 1 
ATOM   4654  N  N   . LEU C  1 82  ? -23.243  17.754  -3.757  1.00 21.90 ? 91  LEU C N   1 
ATOM   4655  C  CA  . LEU C  1 82  ? -21.900  17.967  -3.198  1.00 21.08 ? 91  LEU C CA  1 
ATOM   4656  C  C   . LEU C  1 82  ? -21.282  19.214  -3.810  1.00 17.96 ? 91  LEU C C   1 
ATOM   4657  O  O   . LEU C  1 82  ? -21.166  19.319  -5.020  1.00 18.10 ? 91  LEU C O   1 
ATOM   4658  C  CB  . LEU C  1 82  ? -20.991  16.774  -3.507  1.00 21.61 ? 91  LEU C CB  1 
ATOM   4659  C  CG  . LEU C  1 82  ? -19.527  16.941  -3.040  1.00 22.76 ? 91  LEU C CG  1 
ATOM   4660  C  CD1 . LEU C  1 82  ? -19.420  17.053  -1.537  1.00 22.75 ? 91  LEU C CD1 1 
ATOM   4661  C  CD2 . LEU C  1 82  ? -18.674  15.814  -3.545  1.00 24.02 ? 91  LEU C CD2 1 
ATOM   4662  N  N   . VAL C  1 83  ? -20.880  20.120  -2.952  1.00 18.52 ? 92  VAL C N   1 
ATOM   4663  C  CA  . VAL C  1 83  ? -20.121  21.317  -3.334  1.00 19.07 ? 92  VAL C CA  1 
ATOM   4664  C  C   . VAL C  1 83  ? -18.734  21.388  -2.655  1.00 18.67 ? 92  VAL C C   1 
ATOM   4665  O  O   . VAL C  1 83  ? -18.607  21.293  -1.425  1.00 18.23 ? 92  VAL C O   1 
ATOM   4666  C  CB  . VAL C  1 83  ? -20.829  22.610  -2.964  1.00 20.19 ? 92  VAL C CB  1 
ATOM   4667  C  CG1 . VAL C  1 83  ? -20.087  23.790  -3.630  1.00 21.63 ? 92  VAL C CG1 1 
ATOM   4668  C  CG2 . VAL C  1 83  ? -22.287  22.577  -3.412  1.00 20.08 ? 92  VAL C CG2 1 
ATOM   4669  N  N   . VAL C  1 84  ? -17.717  21.517  -3.508  1.00 18.10 ? 93  VAL C N   1 
ATOM   4670  C  CA  . VAL C  1 84  ? -16.304  21.642  -3.120  1.00 18.26 ? 93  VAL C CA  1 
ATOM   4671  C  C   . VAL C  1 84  ? -15.795  22.991  -3.592  1.00 16.04 ? 93  VAL C C   1 
ATOM   4672  O  O   . VAL C  1 84  ? -15.854  23.299  -4.771  1.00 16.36 ? 93  VAL C O   1 
ATOM   4673  C  CB  . VAL C  1 84  ? -15.421  20.589  -3.798  1.00 19.72 ? 93  VAL C CB  1 
ATOM   4674  C  CG1 . VAL C  1 84  ? -14.023  20.668  -3.241  1.00 22.19 ? 93  VAL C CG1 1 
ATOM   4675  C  CG2 . VAL C  1 84  ? -15.929  19.195  -3.525  1.00 22.24 ? 93  VAL C CG2 1 
ATOM   4676  N  N   . GLN C  1 85  ? -15.301  23.783  -2.660  1.00 15.52 ? 94  GLN C N   1 
ATOM   4677  C  CA  . GLN C  1 85  ? -14.899  25.149  -2.938  1.00 14.89 ? 94  GLN C CA  1 
ATOM   4678  C  C   . GLN C  1 85  ? -13.657  25.583  -2.141  1.00 14.03 ? 94  GLN C C   1 
ATOM   4679  O  O   . GLN C  1 85  ? -13.475  25.201  -1.009  1.00 12.89 ? 94  GLN C O   1 
ATOM   4680  C  CB  . GLN C  1 85  ? -16.076  26.053  -2.666  1.00 15.02 ? 94  GLN C CB  1 
ATOM   4681  C  CG  . GLN C  1 85  ? -15.798  27.523  -2.821  1.00 14.85 ? 94  GLN C CG  1 
ATOM   4682  C  CD  . GLN C  1 85  ? -17.082  28.348  -2.746  1.00 15.65 ? 94  GLN C CD  1 
ATOM   4683  O  OE1 . GLN C  1 85  ? -17.906  28.307  -3.664  1.00 16.70 ? 94  GLN C OE1 1 
ATOM   4684  N  NE2 . GLN C  1 85  ? -17.225  29.142  -1.690  1.00 14.79 ? 94  GLN C NE2 1 
ATOM   4685  N  N   . PHE C  1 86  ? -12.796  26.366  -2.772  1.00 13.23 ? 95  PHE C N   1 
ATOM   4686  C  CA  . PHE C  1 86  ? -11.592  26.918  -2.112  1.00 12.56 ? 95  PHE C CA  1 
ATOM   4687  C  C   . PHE C  1 86  ? -11.016  28.067  -2.949  1.00 12.66 ? 95  PHE C C   1 
ATOM   4688  O  O   . PHE C  1 86  ? -11.369  28.243  -4.132  1.00 12.04 ? 95  PHE C O   1 
ATOM   4689  C  CB  . PHE C  1 86  ? -10.535  25.821  -1.887  1.00 12.15 ? 95  PHE C CB  1 
ATOM   4690  C  CG  . PHE C  1 86  ? -10.109  25.115  -3.156  1.00 12.39 ? 95  PHE C CG  1 
ATOM   4691  C  CD1 . PHE C  1 86  ? -10.894  24.137  -3.704  1.00 12.56 ? 95  PHE C CD1 1 
ATOM   4692  C  CD2 . PHE C  1 86  ? -8.927   25.440  -3.783  1.00 12.91 ? 95  PHE C CD2 1 
ATOM   4693  C  CE1 . PHE C  1 86  ? -10.542  23.508  -4.869  1.00 12.73 ? 95  PHE C CE1 1 
ATOM   4694  C  CE2 . PHE C  1 86  ? -8.557   24.831  -4.974  1.00 13.16 ? 95  PHE C CE2 1 
ATOM   4695  C  CZ  . PHE C  1 86  ? -9.368   23.864  -5.523  1.00 12.98 ? 95  PHE C CZ  1 
ATOM   4696  N  N   . THR C  1 87  ? -10.155  28.868  -2.333  1.00 13.46 ? 96  THR C N   1 
ATOM   4697  C  CA  . THR C  1 87  ? -9.407   29.906  -3.080  1.00 13.70 ? 96  THR C CA  1 
ATOM   4698  C  C   . THR C  1 87  ? -7.971   29.470  -3.347  1.00 14.48 ? 96  THR C C   1 
ATOM   4699  O  O   . THR C  1 87  ? -7.359   28.766  -2.567  1.00 14.10 ? 96  THR C O   1 
ATOM   4700  C  CB  . THR C  1 87  ? -9.433   31.298  -2.403  1.00 13.80 ? 96  THR C CB  1 
ATOM   4701  O  OG1 . THR C  1 87  ? -8.851   31.232  -1.109  1.00 14.18 ? 96  THR C OG1 1 
ATOM   4702  C  CG2 . THR C  1 87  ? -10.860  31.852  -2.282  1.00 13.98 ? 96  THR C CG2 1 
ATOM   4703  N  N   . VAL C  1 88  ? -7.467   29.900  -4.498  1.00 16.90 ? 97  VAL C N   1 
ATOM   4704  C  CA  . VAL C  1 88  ? -6.084   29.658  -4.939  1.00 17.15 ? 97  VAL C CA  1 
ATOM   4705  C  C   . VAL C  1 88  ? -5.487   30.971  -5.461  1.00 17.59 ? 97  VAL C C   1 
ATOM   4706  O  O   . VAL C  1 88  ? -6.108   31.710  -6.250  1.00 17.76 ? 97  VAL C O   1 
ATOM   4707  C  CB  . VAL C  1 88  ? -6.021   28.665  -6.078  1.00 18.72 ? 97  VAL C CB  1 
ATOM   4708  C  CG1 . VAL C  1 88  ? -4.598   28.350  -6.429  1.00 19.97 ? 97  VAL C CG1 1 
ATOM   4709  C  CG2 . VAL C  1 88  ? -6.679   27.373  -5.694  1.00 21.61 ? 97  VAL C CG2 1 
ATOM   4710  N  N   . LYS C  1 89  ? -4.267   31.232  -5.012  1.00 16.99 ? 98  LYS C N   1 
ATOM   4711  C  CA  . LYS C  1 89  ? -3.525   32.437  -5.347  1.00 17.64 ? 98  LYS C CA  1 
ATOM   4712  C  C   . LYS C  1 89  ? -2.081   32.118  -5.721  1.00 16.95 ? 98  LYS C C   1 
ATOM   4713  O  O   . LYS C  1 89  ? -1.283   31.763  -4.893  1.00 17.05 ? 98  LYS C O   1 
ATOM   4714  C  CB  . LYS C  1 89  ? -3.531   33.370  -4.162  1.00 17.45 ? 98  LYS C CB  1 
ATOM   4715  C  CG  . LYS C  1 89  ? -2.674   34.610  -4.336  1.00 17.71 ? 98  LYS C CG  1 
ATOM   4716  C  CD  . LYS C  1 89  ? -2.884   35.455  -3.108  1.00 17.69 ? 98  LYS C CD  1 
ATOM   4717  C  CE  . LYS C  1 89  ? -1.980   36.637  -2.990  1.00 19.45 ? 98  LYS C CE  1 
ATOM   4718  N  NZ  . LYS C  1 89  ? -1.925   37.090  -1.580  1.00 21.11 ? 98  LYS C NZ  1 
ATOM   4719  N  N   . HIS C  1 90  ? -1.794   32.181  -7.001  1.00 17.77 ? 99  HIS C N   1 
ATOM   4720  C  CA  . HIS C  1 90  ? -0.454   31.920  -7.483  1.00 18.94 ? 99  HIS C CA  1 
ATOM   4721  C  C   . HIS C  1 90  ? 0.298    33.246  -7.513  1.00 19.45 ? 99  HIS C C   1 
ATOM   4722  O  O   . HIS C  1 90  ? 0.615    33.754  -8.574  1.00 19.69 ? 99  HIS C O   1 
ATOM   4723  C  CB  . HIS C  1 90  ? -0.478   31.324  -8.883  1.00 18.47 ? 99  HIS C CB  1 
ATOM   4724  C  CG  . HIS C  1 90  ? -1.140   29.990  -8.970  1.00 20.16 ? 99  HIS C CG  1 
ATOM   4725  N  ND1 . HIS C  1 90  ? -0.733   28.904  -8.212  1.00 20.62 ? 99  HIS C ND1 1 
ATOM   4726  C  CD2 . HIS C  1 90  ? -2.147   29.543  -9.767  1.00 19.39 ? 99  HIS C CD2 1 
ATOM   4727  C  CE1 . HIS C  1 90  ? -1.449   27.842  -8.558  1.00 20.14 ? 99  HIS C CE1 1 
ATOM   4728  N  NE2 . HIS C  1 90  ? -2.323   28.206  -9.484  1.00 19.67 ? 99  HIS C NE2 1 
ATOM   4729  N  N   . GLU C  1 91  ? 0.553    33.775  -6.328  1.00 21.09 ? 100 GLU C N   1 
ATOM   4730  C  CA  . GLU C  1 91  ? 1.327    34.977  -6.088  1.00 23.76 ? 100 GLU C CA  1 
ATOM   4731  C  C   . GLU C  1 91  ? 2.659    35.053  -6.849  1.00 23.54 ? 100 GLU C C   1 
ATOM   4732  O  O   . GLU C  1 91  ? 3.069    36.104  -7.276  1.00 26.57 ? 100 GLU C O   1 
ATOM   4733  C  CB  . GLU C  1 91  ? 1.563    35.104  -4.579  1.00 26.14 ? 100 GLU C CB  1 
ATOM   4734  C  CG  . GLU C  1 91  ? 2.386    36.272  -4.085  1.00 31.50 ? 100 GLU C CG  1 
ATOM   4735  C  CD  . GLU C  1 91  ? 2.202    36.566  -2.607  1.00 33.94 ? 100 GLU C CD  1 
ATOM   4736  O  OE1 . GLU C  1 91  ? 1.333    35.932  -1.950  1.00 36.53 ? 100 GLU C OE1 1 
ATOM   4737  O  OE2 . GLU C  1 91  ? 2.893    37.500  -2.131  1.00 37.84 ? 100 GLU C OE2 1 
ATOM   4738  N  N   . GLN C  1 92  ? 3.312    33.932  -7.035  1.00 22.26 ? 101 GLN C N   1 
ATOM   4739  C  CA  . GLN C  1 92  ? 4.645    33.879  -7.639  1.00 21.75 ? 101 GLN C CA  1 
ATOM   4740  C  C   . GLN C  1 92  ? 4.656    33.923  -9.160  1.00 23.92 ? 101 GLN C C   1 
ATOM   4741  O  O   . GLN C  1 92  ? 5.708    33.779  -9.779  1.00 25.41 ? 101 GLN C O   1 
ATOM   4742  C  CB  . GLN C  1 92  ? 5.298    32.568  -7.240  1.00 21.50 ? 101 GLN C CB  1 
ATOM   4743  C  CG  . GLN C  1 92  ? 4.757    31.309  -7.961  1.00 21.58 ? 101 GLN C CG  1 
ATOM   4744  C  CD  . GLN C  1 92  ? 3.525    30.688  -7.313  1.00 21.79 ? 101 GLN C CD  1 
ATOM   4745  O  OE1 . GLN C  1 92  ? 2.632    31.392  -6.844  1.00 22.63 ? 101 GLN C OE1 1 
ATOM   4746  N  NE2 . GLN C  1 92  ? 3.495    29.367  -7.235  1.00 22.67 ? 101 GLN C NE2 1 
ATOM   4747  N  N   . ASN C  1 93  ? 3.493    34.067  -9.785  1.00 25.52 ? 102 ASN C N   1 
ATOM   4748  C  CA  . ASN C  1 93  ? 3.381    33.910  -11.261 1.00 25.59 ? 102 ASN C CA  1 
ATOM   4749  C  C   . ASN C  1 93  ? 3.924    32.562  -11.705 1.00 27.94 ? 102 ASN C C   1 
ATOM   4750  O  O   . ASN C  1 93  ? 5.068    32.457  -12.184 1.00 29.10 ? 102 ASN C O   1 
ATOM   4751  C  CB  . ASN C  1 93  ? 4.107    35.043  -11.977 1.00 26.43 ? 102 ASN C CB  1 
ATOM   4752  C  CG  . ASN C  1 93  ? 3.333    36.364  -11.876 1.00 26.62 ? 102 ASN C CG  1 
ATOM   4753  O  OD1 . ASN C  1 93  ? 2.108    36.486  -12.232 1.00 30.34 ? 102 ASN C OD1 1 
ATOM   4754  N  ND2 . ASN C  1 93  ? 4.024    37.359  -11.420 1.00 24.55 ? 102 ASN C ND2 1 
ATOM   4755  N  N   . ILE C  1 94  ? 3.109    31.535  -11.500 1.00 25.49 ? 103 ILE C N   1 
ATOM   4756  C  CA  . ILE C  1 94  ? 3.587    30.182  -11.545 1.00 26.23 ? 103 ILE C CA  1 
ATOM   4757  C  C   . ILE C  1 94  ? 3.943    29.817  -12.982 1.00 28.86 ? 103 ILE C C   1 
ATOM   4758  O  O   . ILE C  1 94  ? 3.288    30.262  -13.903 1.00 29.20 ? 103 ILE C O   1 
ATOM   4759  C  CB  . ILE C  1 94  ? 2.603    29.207  -10.889 1.00 24.78 ? 103 ILE C CB  1 
ATOM   4760  C  CG1 . ILE C  1 94  ? 3.216    27.816  -10.770 1.00 25.95 ? 103 ILE C CG1 1 
ATOM   4761  C  CG2 . ILE C  1 94  ? 1.299    29.137  -11.639 1.00 25.35 ? 103 ILE C CG2 1 
ATOM   4762  C  CD1 . ILE C  1 94  ? 2.544    26.948  -9.702  1.00 24.70 ? 103 ILE C CD1 1 
ATOM   4763  N  N   . ASP C  1 95  ? 4.986    29.012  -13.146 1.00 27.74 ? 104 ASP C N   1 
ATOM   4764  C  CA  . ASP C  1 95  ? 5.380    28.496  -14.481 1.00 27.59 ? 104 ASP C CA  1 
ATOM   4765  C  C   . ASP C  1 95  ? 4.738    27.112  -14.698 1.00 24.52 ? 104 ASP C C   1 
ATOM   4766  O  O   . ASP C  1 95  ? 4.154    26.831  -15.754 1.00 22.05 ? 104 ASP C O   1 
ATOM   4767  C  CB  . ASP C  1 95  ? 6.925    28.431  -14.658 1.00 26.12 ? 104 ASP C CB  1 
ATOM   4768  C  CG  . ASP C  1 95  ? 7.682    27.792  -13.427 1.00 29.46 ? 104 ASP C CG  1 
ATOM   4769  O  OD1 . ASP C  1 95  ? 7.052    27.345  -12.420 1.00 32.02 ? 104 ASP C OD1 1 
ATOM   4770  O  OD2 . ASP C  1 95  ? 8.932    27.725  -13.458 1.00 31.40 ? 104 ASP C OD2 1 
ATOM   4771  N  N   . CYS C  1 96  ? 4.859    26.271  -13.690 1.00 22.66 ? 105 CYS C N   1 
ATOM   4772  C  CA  . CYS C  1 96  ? 4.370    24.920  -13.746 1.00 25.42 ? 105 CYS C CA  1 
ATOM   4773  C  C   . CYS C  1 96  ? 4.111    24.446  -12.327 1.00 23.73 ? 105 CYS C C   1 
ATOM   4774  O  O   . CYS C  1 96  ? 4.990    24.452  -11.492 1.00 24.76 ? 105 CYS C O   1 
ATOM   4775  C  CB  . CYS C  1 96  ? 5.345    23.989  -14.511 1.00 27.60 ? 105 CYS C CB  1 
ATOM   4776  S  SG  . CYS C  1 96  ? 4.803    22.277  -14.659 1.00 31.92 ? 105 CYS C SG  1 
ATOM   4777  N  N   . GLY C  1 97  ? 2.871    24.018  -12.093 1.00 26.07 ? 106 GLY C N   1 
ATOM   4778  C  CA  . GLY C  1 97  ? 2.444    23.478  -10.817 1.00 25.43 ? 106 GLY C CA  1 
ATOM   4779  C  C   . GLY C  1 97  ? 0.944    23.361  -10.667 1.00 24.70 ? 106 GLY C C   1 
ATOM   4780  O  O   . GLY C  1 97  ? 0.179    24.107  -11.256 1.00 25.74 ? 106 GLY C O   1 
ATOM   4781  N  N   . GLY C  1 98  ? 0.536    22.422  -9.829  1.00 23.68 ? 107 GLY C N   1 
ATOM   4782  C  CA  . GLY C  1 98  ? -0.873   22.183  -9.533  1.00 23.21 ? 107 GLY C CA  1 
ATOM   4783  C  C   . GLY C  1 98  ? -1.427   23.117  -8.456  1.00 22.12 ? 107 GLY C C   1 
ATOM   4784  O  O   . GLY C  1 98  ? -0.692   23.673  -7.650  1.00 20.37 ? 107 GLY C O   1 
ATOM   4785  N  N   . GLY C  1 99  ? -2.746   23.301  -8.492  1.00 22.38 ? 108 GLY C N   1 
ATOM   4786  C  CA  . GLY C  1 99  ? -3.474   24.066  -7.494  1.00 23.03 ? 108 GLY C CA  1 
ATOM   4787  C  C   . GLY C  1 99  ? -4.781   23.395  -7.117  1.00 21.13 ? 108 GLY C C   1 
ATOM   4788  O  O   . GLY C  1 99  ? -5.743   24.053  -6.712  1.00 20.94 ? 108 GLY C O   1 
ATOM   4789  N  N   . TYR C  1 100 ? -4.785   22.080  -7.216  1.00 20.72 ? 109 TYR C N   1 
ATOM   4790  C  CA  . TYR C  1 100 ? -6.021   21.301  -7.055  1.00 21.08 ? 109 TYR C CA  1 
ATOM   4791  C  C   . TYR C  1 100 ? -6.064   20.514  -5.796  1.00 19.93 ? 109 TYR C C   1 
ATOM   4792  O  O   . TYR C  1 100 ? -5.064   20.246  -5.151  1.00 20.71 ? 109 TYR C O   1 
ATOM   4793  C  CB  . TYR C  1 100 ? -6.220   20.344  -8.227  1.00 21.21 ? 109 TYR C CB  1 
ATOM   4794  C  CG  . TYR C  1 100 ? -4.996   19.580  -8.581  1.00 22.59 ? 109 TYR C CG  1 
ATOM   4795  C  CD1 . TYR C  1 100 ? -4.606   18.496  -7.821  1.00 23.68 ? 109 TYR C CD1 1 
ATOM   4796  C  CD2 . TYR C  1 100 ? -4.209   19.942  -9.681  1.00 23.27 ? 109 TYR C CD2 1 
ATOM   4797  C  CE1 . TYR C  1 100 ? -3.461   17.777  -8.134  1.00 23.62 ? 109 TYR C CE1 1 
ATOM   4798  C  CE2 . TYR C  1 100 ? -3.061   19.236  -10.006 1.00 23.61 ? 109 TYR C CE2 1 
ATOM   4799  C  CZ  . TYR C  1 100 ? -2.689   18.149  -9.213  1.00 23.20 ? 109 TYR C CZ  1 
ATOM   4800  O  OH  . TYR C  1 100 ? -1.570   17.426  -9.521  1.00 22.79 ? 109 TYR C OH  1 
ATOM   4801  N  N   . VAL C  1 101 ? -7.277   20.190  -5.423  1.00 21.28 ? 110 VAL C N   1 
ATOM   4802  C  CA  . VAL C  1 101 ? -7.636   19.459  -4.223  1.00 22.25 ? 110 VAL C CA  1 
ATOM   4803  C  C   . VAL C  1 101 ? -8.083   18.036  -4.544  1.00 21.32 ? 110 VAL C C   1 
ATOM   4804  O  O   . VAL C  1 101 ? -8.421   17.717  -5.675  1.00 22.81 ? 110 VAL C O   1 
ATOM   4805  C  CB  . VAL C  1 101 ? -8.806   20.342  -3.683  1.00 25.91 ? 110 VAL C CB  1 
ATOM   4806  C  CG1 . VAL C  1 101 ? -10.208  19.689  -3.639  1.00 27.00 ? 110 VAL C CG1 1 
ATOM   4807  C  CG2 . VAL C  1 101 ? -8.429   20.948  -2.384  1.00 26.76 ? 110 VAL C CG2 1 
ATOM   4808  N  N   . LYS C  1 102 ? -7.978   17.149  -3.575  1.00 22.62 ? 111 LYS C N   1 
ATOM   4809  C  CA  . LYS C  1 102 ? -8.474   15.789  -3.710  1.00 21.65 ? 111 LYS C CA  1 
ATOM   4810  C  C   . LYS C  1 102 ? -9.306   15.421  -2.518  1.00 20.47 ? 111 LYS C C   1 
ATOM   4811  O  O   . LYS C  1 102 ? -8.922   15.694  -1.394  1.00 18.32 ? 111 LYS C O   1 
ATOM   4812  C  CB  . LYS C  1 102 ? -7.364   14.782  -3.776  1.00 22.18 ? 111 LYS C CB  1 
ATOM   4813  C  CG  . LYS C  1 102 ? -6.486   14.954  -4.969  1.00 22.81 ? 111 LYS C CG  1 
ATOM   4814  C  CD  . LYS C  1 102 ? -5.486   13.813  -5.062  1.00 21.55 ? 111 LYS C CD  1 
ATOM   4815  C  CE  . LYS C  1 102 ? -4.321   14.245  -5.882  1.00 21.70 ? 111 LYS C CE  1 
ATOM   4816  N  NZ  . LYS C  1 102 ? -3.865   13.170  -6.757  1.00 22.24 ? 111 LYS C NZ  1 
ATOM   4817  N  N   . LEU C  1 103 ? -10.441  14.787  -2.805  1.00 20.19 ? 112 LEU C N   1 
ATOM   4818  C  CA  . LEU C  1 103 ? -11.321  14.260  -1.782  1.00 22.82 ? 112 LEU C CA  1 
ATOM   4819  C  C   . LEU C  1 103 ? -11.177  12.738  -1.737  1.00 22.33 ? 112 LEU C C   1 
ATOM   4820  O  O   . LEU C  1 103 ? -11.310  12.058  -2.767  1.00 22.39 ? 112 LEU C O   1 
ATOM   4821  C  CB  . LEU C  1 103 ? -12.780  14.581  -2.063  1.00 27.22 ? 112 LEU C CB  1 
ATOM   4822  C  CG  . LEU C  1 103 ? -13.418  15.895  -1.636  1.00 30.37 ? 112 LEU C CG  1 
ATOM   4823  C  CD1 . LEU C  1 103 ? -12.418  16.919  -2.032  1.00 30.99 ? 112 LEU C CD1 1 
ATOM   4824  C  CD2 . LEU C  1 103 ? -14.813  16.282  -2.175  1.00 32.53 ? 112 LEU C CD2 1 
ATOM   4825  N  N   . PHE C  1 104 ? -10.879  12.245  -0.548  1.00 21.33 ? 113 PHE C N   1 
ATOM   4826  C  CA  . PHE C  1 104 ? -10.494  10.867  -0.318  1.00 21.28 ? 113 PHE C CA  1 
ATOM   4827  C  C   . PHE C  1 104 ? -11.520  10.161  0.583   1.00 20.27 ? 113 PHE C C   1 
ATOM   4828  O  O   . PHE C  1 104 ? -12.123  10.790  1.455   1.00 19.85 ? 113 PHE C O   1 
ATOM   4829  C  CB  . PHE C  1 104 ? -9.142   10.771  0.435   1.00 23.30 ? 113 PHE C CB  1 
ATOM   4830  C  CG  . PHE C  1 104 ? -7.932   11.131  -0.388  1.00 23.60 ? 113 PHE C CG  1 
ATOM   4831  C  CD1 . PHE C  1 104 ? -7.300   10.172  -1.181  1.00 21.80 ? 113 PHE C CD1 1 
ATOM   4832  C  CD2 . PHE C  1 104 ? -7.381   12.410  -0.298  1.00 22.58 ? 113 PHE C CD2 1 
ATOM   4833  C  CE1 . PHE C  1 104 ? -6.180   10.498  -1.902  1.00 20.86 ? 113 PHE C CE1 1 
ATOM   4834  C  CE2 . PHE C  1 104 ? -6.278   12.743  -1.046  1.00 20.51 ? 113 PHE C CE2 1 
ATOM   4835  C  CZ  . PHE C  1 104 ? -5.682   11.795  -1.850  1.00 20.38 ? 113 PHE C CZ  1 
ATOM   4836  N  N   . PRO C  1 105 ? -11.681  8.842   0.384   1.00 20.16 ? 114 PRO C N   1 
ATOM   4837  C  CA  . PRO C  1 105 ? -12.379  8.034   1.345   1.00 23.51 ? 114 PRO C CA  1 
ATOM   4838  C  C   . PRO C  1 105 ? -11.682  8.050   2.684   1.00 25.12 ? 114 PRO C C   1 
ATOM   4839  O  O   . PRO C  1 105 ? -10.456  8.248   2.760   1.00 21.42 ? 114 PRO C O   1 
ATOM   4840  C  CB  . PRO C  1 105 ? -12.315  6.602   0.778   1.00 23.35 ? 114 PRO C CB  1 
ATOM   4841  C  CG  . PRO C  1 105 ? -11.355  6.618   -0.332  1.00 23.00 ? 114 PRO C CG  1 
ATOM   4842  C  CD  . PRO C  1 105 ? -11.019  8.039   -0.663  1.00 22.85 ? 114 PRO C CD  1 
ATOM   4843  N  N   . ASN C  1 106 ? -12.462  7.847   3.727   1.00 27.89 ? 115 ASN C N   1 
ATOM   4844  C  CA  . ASN C  1 106 ? -11.912  7.789   5.094   1.00 32.32 ? 115 ASN C CA  1 
ATOM   4845  C  C   . ASN C  1 106 ? -10.938  6.640   5.350   1.00 29.36 ? 115 ASN C C   1 
ATOM   4846  O  O   . ASN C  1 106 ? -10.251  6.630   6.340   1.00 32.27 ? 115 ASN C O   1 
ATOM   4847  C  CB  . ASN C  1 106 ? -13.031  7.669   6.110   1.00 35.48 ? 115 ASN C CB  1 
ATOM   4848  C  CG  . ASN C  1 106 ? -12.644  8.227   7.448   1.00 41.24 ? 115 ASN C CG  1 
ATOM   4849  O  OD1 . ASN C  1 106 ? -11.977  9.275   7.559   1.00 50.27 ? 115 ASN C OD1 1 
ATOM   4850  N  ND2 . ASN C  1 106 ? -13.049  7.530   8.492   1.00 43.85 ? 115 ASN C ND2 1 
ATOM   4851  N  N   . SER C  1 107 ? -10.881  5.667   4.457   1.00 29.89 ? 116 SER C N   1 
ATOM   4852  C  CA  . SER C  1 107 ? -9.881   4.607   4.551   1.00 31.13 ? 116 SER C CA  1 
ATOM   4853  C  C   . SER C  1 107 ? -8.428   5.050   4.217   1.00 33.79 ? 116 SER C C   1 
ATOM   4854  O  O   . SER C  1 107 ? -7.499   4.271   4.327   1.00 34.47 ? 116 SER C O   1 
ATOM   4855  C  CB  . SER C  1 107 ? -10.257  3.489   3.611   1.00 32.29 ? 116 SER C CB  1 
ATOM   4856  O  OG  . SER C  1 107 ? -10.263  3.973   2.288   1.00 36.70 ? 116 SER C OG  1 
ATOM   4857  N  N   . LEU C  1 108 ? -8.239   6.277   3.743   1.00 34.40 ? 117 LEU C N   1 
ATOM   4858  C  CA  . LEU C  1 108 ? -6.897   6.773   3.468   1.00 34.17 ? 117 LEU C CA  1 
ATOM   4859  C  C   . LEU C  1 108 ? -6.076   6.921   4.768   1.00 31.39 ? 117 LEU C C   1 
ATOM   4860  O  O   . LEU C  1 108 ? -6.501   7.579   5.732   1.00 27.74 ? 117 LEU C O   1 
ATOM   4861  C  CB  . LEU C  1 108 ? -6.940   8.131   2.758   1.00 32.94 ? 117 LEU C CB  1 
ATOM   4862  C  CG  . LEU C  1 108 ? -5.575   8.780   2.531   1.00 31.76 ? 117 LEU C CG  1 
ATOM   4863  C  CD1 . LEU C  1 108 ? -4.863   8.188   1.322   1.00 32.87 ? 117 LEU C CD1 1 
ATOM   4864  C  CD2 . LEU C  1 108 ? -5.689   10.281  2.384   1.00 32.83 ? 117 LEU C CD2 1 
ATOM   4865  N  N   . ASP C  1 109 ? -4.883   6.351   4.748   1.00 29.30 ? 118 ASP C N   1 
ATOM   4866  C  CA  . ASP C  1 109 ? -3.861   6.644   5.761   1.00 31.90 ? 118 ASP C CA  1 
ATOM   4867  C  C   . ASP C  1 109 ? -3.170   7.989   5.411   1.00 28.52 ? 118 ASP C C   1 
ATOM   4868  O  O   . ASP C  1 109 ? -2.370   8.051   4.460   1.00 31.05 ? 118 ASP C O   1 
ATOM   4869  C  CB  . ASP C  1 109 ? -2.843   5.501   5.807   1.00 34.90 ? 118 ASP C CB  1 
ATOM   4870  C  CG  . ASP C  1 109 ? -1.749   5.709   6.843   1.00 38.99 ? 118 ASP C CG  1 
ATOM   4871  O  OD1 . ASP C  1 109 ? -1.759   6.710   7.623   1.00 42.28 ? 118 ASP C OD1 1 
ATOM   4872  O  OD2 . ASP C  1 109 ? -0.844   4.853   6.863   1.00 48.62 ? 118 ASP C OD2 1 
ATOM   4873  N  N   . GLN C  1 110 ? -3.494   9.037   6.169   1.00 23.68 ? 119 GLN C N   1 
ATOM   4874  C  CA  . GLN C  1 110 ? -3.001   10.406  5.898   1.00 26.20 ? 119 GLN C CA  1 
ATOM   4875  C  C   . GLN C  1 110 ? -1.468   10.496  5.919   1.00 24.64 ? 119 GLN C C   1 
ATOM   4876  O  O   . GLN C  1 110 ? -0.878   11.302  5.225   1.00 24.69 ? 119 GLN C O   1 
ATOM   4877  C  CB  . GLN C  1 110 ? -3.592   11.401  6.905   1.00 25.26 ? 119 GLN C CB  1 
ATOM   4878  C  CG  . GLN C  1 110 ? -5.061   11.696  6.700   1.00 23.90 ? 119 GLN C CG  1 
ATOM   4879  C  CD  . GLN C  1 110 ? -5.570   12.716  7.678   1.00 24.17 ? 119 GLN C CD  1 
ATOM   4880  O  OE1 . GLN C  1 110 ? -6.092   12.366  8.724   1.00 24.97 ? 119 GLN C OE1 1 
ATOM   4881  N  NE2 . GLN C  1 110 ? -5.423   13.997  7.357   1.00 25.35 ? 119 GLN C NE2 1 
ATOM   4882  N  N   . THR C  1 111 ? -0.855   9.674   6.763   1.00 27.66 ? 120 THR C N   1 
ATOM   4883  C  CA  . THR C  1 111 ? 0.610    9.661   6.897   1.00 30.23 ? 120 THR C CA  1 
ATOM   4884  C  C   . THR C  1 111 ? 1.263    8.916   5.731   1.00 30.90 ? 120 THR C C   1 
ATOM   4885  O  O   . THR C  1 111 ? 2.490    8.878   5.662   1.00 33.65 ? 120 THR C O   1 
ATOM   4886  C  CB  . THR C  1 111 ? 1.109    9.069   8.235   1.00 29.30 ? 120 THR C CB  1 
ATOM   4887  O  OG1 . THR C  1 111 ? 0.902    7.656   8.219   1.00 33.35 ? 120 THR C OG1 1 
ATOM   4888  C  CG2 . THR C  1 111 ? 0.387    9.707   9.456   1.00 29.71 ? 120 THR C CG2 1 
ATOM   4889  N  N   . ASP C  1 112 ? 0.471    8.329   4.833   1.00 30.12 ? 121 ASP C N   1 
ATOM   4890  C  CA  . ASP C  1 112 ? 1.041    7.671   3.647   1.00 32.68 ? 121 ASP C CA  1 
ATOM   4891  C  C   . ASP C  1 112 ? 0.496    8.223   2.327   1.00 30.87 ? 121 ASP C C   1 
ATOM   4892  O  O   . ASP C  1 112 ? 0.748    7.664   1.249   1.00 25.52 ? 121 ASP C O   1 
ATOM   4893  C  CB  . ASP C  1 112 ? 0.833    6.165   3.694   1.00 35.70 ? 121 ASP C CB  1 
ATOM   4894  C  CG  . ASP C  1 112 ? 1.690    5.429   2.659   1.00 40.26 ? 121 ASP C CG  1 
ATOM   4895  O  OD1 . ASP C  1 112 ? 2.891    5.781   2.493   1.00 40.72 ? 121 ASP C OD1 1 
ATOM   4896  O  OD2 . ASP C  1 112 ? 1.164    4.504   1.991   1.00 47.06 ? 121 ASP C OD2 1 
ATOM   4897  N  N   . MET C  1 113 ? -0.202   9.355   2.410   1.00 30.16 ? 122 MET C N   1 
ATOM   4898  C  CA  . MET C  1 113 ? -0.773   9.957   1.223   1.00 28.97 ? 122 MET C CA  1 
ATOM   4899  C  C   . MET C  1 113 ? 0.306    10.261  0.198   1.00 30.48 ? 122 MET C C   1 
ATOM   4900  O  O   . MET C  1 113 ? 1.371    10.794  0.535   1.00 33.61 ? 122 MET C O   1 
ATOM   4901  C  CB  . MET C  1 113 ? -1.519   11.239  1.553   1.00 29.64 ? 122 MET C CB  1 
ATOM   4902  C  CG  . MET C  1 113 ? -2.200   11.877  0.339   1.00 30.77 ? 122 MET C CG  1 
ATOM   4903  S  SD  . MET C  1 113 ? -3.083   13.409  0.721   1.00 31.15 ? 122 MET C SD  1 
ATOM   4904  C  CE  . MET C  1 113 ? -1.876   14.667  0.937   1.00 31.59 ? 122 MET C CE  1 
ATOM   4905  N  N   . HIS C  1 114 ? 0.011    9.934   -1.055  1.00 31.40 ? 123 HIS C N   1 
ATOM   4906  C  CA  . HIS C  1 114 ? 0.861    10.317  -2.167  1.00 31.27 ? 123 HIS C CA  1 
ATOM   4907  C  C   . HIS C  1 114 ? 0.137    10.289  -3.516  1.00 30.18 ? 123 HIS C C   1 
ATOM   4908  O  O   . HIS C  1 114 ? -1.036   10.001  -3.600  1.00 28.14 ? 123 HIS C O   1 
ATOM   4909  C  CB  . HIS C  1 114 ? 2.106    9.424   -2.211  1.00 32.35 ? 123 HIS C CB  1 
ATOM   4910  C  CG  . HIS C  1 114 ? 1.800    7.981   -2.416  1.00 32.81 ? 123 HIS C CG  1 
ATOM   4911  N  ND1 . HIS C  1 114 ? 1.225    7.194   -1.434  1.00 32.84 ? 123 HIS C ND1 1 
ATOM   4912  C  CD2 . HIS C  1 114 ? 1.986    7.181   -3.488  1.00 33.39 ? 123 HIS C CD2 1 
ATOM   4913  C  CE1 . HIS C  1 114 ? 1.070    5.970   -1.897  1.00 32.55 ? 123 HIS C CE1 1 
ATOM   4914  N  NE2 . HIS C  1 114 ? 1.510    5.938   -3.142  1.00 35.31 ? 123 HIS C NE2 1 
ATOM   4915  N  N   . GLY C  1 115 ? 0.869    10.640  -4.576  1.00 33.72 ? 124 GLY C N   1 
ATOM   4916  C  CA  . GLY C  1 115 ? 0.338    10.772  -5.928  1.00 35.71 ? 124 GLY C CA  1 
ATOM   4917  C  C   . GLY C  1 115 ? -0.488   9.579   -6.389  1.00 37.92 ? 124 GLY C C   1 
ATOM   4918  O  O   . GLY C  1 115 ? -1.389   9.740   -7.163  1.00 32.45 ? 124 GLY C O   1 
ATOM   4919  N  N   . ASP C  1 116 ? -0.215   8.394   -5.862  1.00 41.30 ? 125 ASP C N   1 
ATOM   4920  C  CA  . ASP C  1 116 ? -0.943   7.196   -6.286  1.00 43.85 ? 125 ASP C CA  1 
ATOM   4921  C  C   . ASP C  1 116 ? -1.916   6.683   -5.260  1.00 38.76 ? 125 ASP C C   1 
ATOM   4922  O  O   . ASP C  1 116 ? -2.507   5.648   -5.476  1.00 36.67 ? 125 ASP C O   1 
ATOM   4923  C  CB  . ASP C  1 116 ? 0.019    6.090   -6.642  1.00 48.34 ? 125 ASP C CB  1 
ATOM   4924  C  CG  . ASP C  1 116 ? 0.806    6.402   -7.889  1.00 57.64 ? 125 ASP C CG  1 
ATOM   4925  O  OD1 . ASP C  1 116 ? 0.650    7.507   -8.457  1.00 64.89 ? 125 ASP C OD1 1 
ATOM   4926  O  OD2 . ASP C  1 116 ? 1.590    5.534   -8.303  1.00 71.18 ? 125 ASP C OD2 1 
ATOM   4927  N  N   . SER C  1 117 ? -2.129   7.419   -4.175  1.00 36.97 ? 126 SER C N   1 
ATOM   4928  C  CA  . SER C  1 117 ? -3.215   7.078   -3.262  1.00 34.11 ? 126 SER C CA  1 
ATOM   4929  C  C   . SER C  1 117 ? -4.589   7.211   -3.984  1.00 35.15 ? 126 SER C C   1 
ATOM   4930  O  O   . SER C  1 117 ? -4.788   8.061   -4.879  1.00 30.87 ? 126 SER C O   1 
ATOM   4931  C  CB  . SER C  1 117 ? -3.205   7.959   -2.024  1.00 33.09 ? 126 SER C CB  1 
ATOM   4932  O  OG  . SER C  1 117 ? -1.965   7.934   -1.393  1.00 33.38 ? 126 SER C OG  1 
ATOM   4933  N  N   . GLU C  1 118 ? -5.520   6.344   -3.602  1.00 34.16 ? 127 GLU C N   1 
ATOM   4934  C  CA  . GLU C  1 118 ? -6.828   6.267   -4.241  1.00 35.63 ? 127 GLU C CA  1 
ATOM   4935  C  C   . GLU C  1 118 ? -7.774   7.343   -3.691  1.00 29.10 ? 127 GLU C C   1 
ATOM   4936  O  O   . GLU C  1 118 ? -8.180   7.318   -2.539  1.00 24.86 ? 127 GLU C O   1 
ATOM   4937  C  CB  . GLU C  1 118 ? -7.430   4.869   -4.066  1.00 40.02 ? 127 GLU C CB  1 
ATOM   4938  C  CG  . GLU C  1 118 ? -8.686   4.647   -4.891  1.00 50.24 ? 127 GLU C CG  1 
ATOM   4939  C  CD  . GLU C  1 118 ? -9.430   3.377   -4.489  1.00 57.47 ? 127 GLU C CD  1 
ATOM   4940  O  OE1 . GLU C  1 118 ? -9.302   2.436   -5.276  1.00 58.91 ? 127 GLU C OE1 1 
ATOM   4941  O  OE2 . GLU C  1 118 ? -10.119  3.308   -3.423  1.00 59.78 ? 127 GLU C OE2 1 
ATOM   4942  N  N   . TYR C  1 119 ? -8.108   8.298   -4.545  1.00 25.18 ? 128 TYR C N   1 
ATOM   4943  C  CA  . TYR C  1 119 ? -9.069   9.340   -4.159  1.00 24.78 ? 128 TYR C CA  1 
ATOM   4944  C  C   . TYR C  1 119 ? -10.431  9.065   -4.855  1.00 23.51 ? 128 TYR C C   1 
ATOM   4945  O  O   . TYR C  1 119 ? -10.504  8.287   -5.782  1.00 20.00 ? 128 TYR C O   1 
ATOM   4946  C  CB  . TYR C  1 119 ? -8.532   10.752  -4.487  1.00 23.80 ? 128 TYR C CB  1 
ATOM   4947  C  CG  . TYR C  1 119 ? -8.132   10.914  -5.932  1.00 23.90 ? 128 TYR C CG  1 
ATOM   4948  C  CD1 . TYR C  1 119 ? -9.078   11.181  -6.880  1.00 24.08 ? 128 TYR C CD1 1 
ATOM   4949  C  CD2 . TYR C  1 119 ? -6.826   10.727  -6.352  1.00 22.50 ? 128 TYR C CD2 1 
ATOM   4950  C  CE1 . TYR C  1 119 ? -8.732   11.325  -8.208  1.00 23.23 ? 128 TYR C CE1 1 
ATOM   4951  C  CE2 . TYR C  1 119 ? -6.478   10.826  -7.683  1.00 23.05 ? 128 TYR C CE2 1 
ATOM   4952  C  CZ  . TYR C  1 119 ? -7.450   11.147  -8.601  1.00 23.47 ? 128 TYR C CZ  1 
ATOM   4953  O  OH  . TYR C  1 119 ? -7.191   11.255  -9.952  1.00 22.48 ? 128 TYR C OH  1 
ATOM   4954  N  N   . ASN C  1 120 ? -11.478  9.743   -4.389  1.00 25.56 ? 129 ASN C N   1 
ATOM   4955  C  CA  . ASN C  1 120 ? -12.793  9.756   -5.058  1.00 23.27 ? 129 ASN C CA  1 
ATOM   4956  C  C   . ASN C  1 120 ? -12.886  10.776  -6.172  1.00 23.10 ? 129 ASN C C   1 
ATOM   4957  O  O   . ASN C  1 120 ? -13.286  10.465  -7.305  1.00 22.86 ? 129 ASN C O   1 
ATOM   4958  C  CB  . ASN C  1 120 ? -13.875  10.049  -4.035  1.00 24.54 ? 129 ASN C CB  1 
ATOM   4959  C  CG  . ASN C  1 120 ? -14.054  8.894   -3.057  1.00 23.99 ? 129 ASN C CG  1 
ATOM   4960  O  OD1 . ASN C  1 120 ? -13.656  7.759   -3.361  1.00 24.14 ? 129 ASN C OD1 1 
ATOM   4961  N  ND2 . ASN C  1 120 ? -14.612  9.176   -1.889  1.00 20.64 ? 129 ASN C ND2 1 
ATOM   4962  N  N   . ILE C  1 121 ? -12.528  12.015  -5.844  1.00 23.99 ? 130 ILE C N   1 
ATOM   4963  C  CA  . ILE C  1 121 ? -12.609  13.163  -6.772  1.00 22.61 ? 130 ILE C CA  1 
ATOM   4964  C  C   . ILE C  1 121 ? -11.364  14.043  -6.647  1.00 22.61 ? 130 ILE C C   1 
ATOM   4965  O  O   . ILE C  1 121 ? -10.898  14.314  -5.553  1.00 21.61 ? 130 ILE C O   1 
ATOM   4966  C  CB  . ILE C  1 121 ? -13.820  14.045  -6.444  1.00 23.89 ? 130 ILE C CB  1 
ATOM   4967  C  CG1 . ILE C  1 121 ? -15.119  13.268  -6.631  1.00 24.28 ? 130 ILE C CG1 1 
ATOM   4968  C  CG2 . ILE C  1 121 ? -13.873  15.281  -7.333  1.00 24.29 ? 130 ILE C CG2 1 
ATOM   4969  C  CD1 . ILE C  1 121 ? -16.332  13.959  -6.041  1.00 24.54 ? 130 ILE C CD1 1 
ATOM   4970  N  N   . MET C  1 122 ? -10.890  14.533  -7.787  1.00 22.93 ? 131 MET C N   1 
ATOM   4971  C  CA  . MET C  1 122 ? -9.890   15.571  -7.835  1.00 23.18 ? 131 MET C CA  1 
ATOM   4972  C  C   . MET C  1 122 ? -10.440  16.804  -8.574  1.00 22.39 ? 131 MET C C   1 
ATOM   4973  O  O   . MET C  1 122 ? -10.991  16.675  -9.661  1.00 21.25 ? 131 MET C O   1 
ATOM   4974  C  CB  . MET C  1 122 ? -8.629   15.068  -8.536  1.00 26.45 ? 131 MET C CB  1 
ATOM   4975  C  CG  . MET C  1 122 ? -7.585   16.144  -8.771  1.00 31.52 ? 131 MET C CG  1 
ATOM   4976  S  SD  . MET C  1 122 ? -6.107   15.377  -9.502  1.00 37.22 ? 131 MET C SD  1 
ATOM   4977  C  CE  . MET C  1 122 ? -5.687   16.591  -10.751 1.00 37.57 ? 131 MET C CE  1 
ATOM   4978  N  N   . PHE C  1 123 ? -10.182  17.998  -8.029  1.00 18.50 ? 132 PHE C N   1 
ATOM   4979  C  CA  . PHE C  1 123 ? -10.701  19.215  -8.625  1.00 15.97 ? 132 PHE C CA  1 
ATOM   4980  C  C   . PHE C  1 123 ? -9.789   20.423  -8.462  1.00 15.00 ? 132 PHE C C   1 
ATOM   4981  O  O   . PHE C  1 123 ? -9.387   20.723  -7.359  1.00 13.98 ? 132 PHE C O   1 
ATOM   4982  C  CB  . PHE C  1 123 ? -12.042  19.539  -7.975  1.00 14.57 ? 132 PHE C CB  1 
ATOM   4983  C  CG  . PHE C  1 123 ? -12.587  20.853  -8.363  1.00 12.97 ? 132 PHE C CG  1 
ATOM   4984  C  CD1 . PHE C  1 123 ? -12.828  21.129  -9.683  1.00 12.76 ? 132 PHE C CD1 1 
ATOM   4985  C  CD2 . PHE C  1 123 ? -12.806  21.846  -7.414  1.00 11.90 ? 132 PHE C CD2 1 
ATOM   4986  C  CE1 . PHE C  1 123 ? -13.310  22.371  -10.080 1.00 11.90 ? 132 PHE C CE1 1 
ATOM   4987  C  CE2 . PHE C  1 123 ? -13.332  23.060  -7.786  1.00 11.70 ? 132 PHE C CE2 1 
ATOM   4988  C  CZ  . PHE C  1 123 ? -13.577  23.327  -9.129  1.00 11.76 ? 132 PHE C CZ  1 
ATOM   4989  N  N   . GLY C  1 124 ? -9.474   21.084  -9.555  1.00 14.49 ? 133 GLY C N   1 
ATOM   4990  C  CA  . GLY C  1 124 ? -8.900   22.403  -9.475  1.00 14.89 ? 133 GLY C CA  1 
ATOM   4991  C  C   . GLY C  1 124 ? -7.897   22.733  -10.535 1.00 14.88 ? 133 GLY C C   1 
ATOM   4992  O  O   . GLY C  1 124 ? -7.637   21.943  -11.434 1.00 14.62 ? 133 GLY C O   1 
ATOM   4993  N  N   . PRO C  1 125 ? -7.329   23.937  -10.456 1.00 16.48 ? 134 PRO C N   1 
ATOM   4994  C  CA  . PRO C  1 125 ? -6.414   24.424  -11.499 1.00 17.82 ? 134 PRO C CA  1 
ATOM   4995  C  C   . PRO C  1 125 ? -5.074   23.686  -11.613 1.00 19.18 ? 134 PRO C C   1 
ATOM   4996  O  O   . PRO C  1 125 ? -4.500   23.262  -10.627 1.00 16.63 ? 134 PRO C O   1 
ATOM   4997  C  CB  . PRO C  1 125 ? -6.187   25.898  -11.119 1.00 17.86 ? 134 PRO C CB  1 
ATOM   4998  C  CG  . PRO C  1 125 ? -6.453   25.975  -9.668  1.00 16.93 ? 134 PRO C CG  1 
ATOM   4999  C  CD  . PRO C  1 125 ? -7.534   24.934  -9.401  1.00 16.84 ? 134 PRO C CD  1 
ATOM   5000  N  N   . ASP C  1 126 ? -4.613   23.544  -12.854 1.00 23.70 ? 135 ASP C N   1 
ATOM   5001  C  CA  . ASP C  1 126 ? -3.316   22.970  -13.158 1.00 25.96 ? 135 ASP C CA  1 
ATOM   5002  C  C   . ASP C  1 126 ? -2.665   23.760  -14.267 1.00 25.05 ? 135 ASP C C   1 
ATOM   5003  O  O   . ASP C  1 126 ? -3.204   23.924  -15.374 1.00 22.95 ? 135 ASP C O   1 
ATOM   5004  C  CB  . ASP C  1 126 ? -3.429   21.500  -13.561 1.00 30.55 ? 135 ASP C CB  1 
ATOM   5005  C  CG  . ASP C  1 126 ? -2.085   20.753  -13.523 1.00 34.09 ? 135 ASP C CG  1 
ATOM   5006  O  OD1 . ASP C  1 126 ? -1.095   21.247  -12.941 1.00 39.17 ? 135 ASP C OD1 1 
ATOM   5007  O  OD2 . ASP C  1 126 ? -2.023   19.626  -14.058 1.00 41.29 ? 135 ASP C OD2 1 
ATOM   5008  N  N   . ILE C  1 127 ? -1.453   24.212  -13.969 1.00 26.55 ? 136 ILE C N   1 
ATOM   5009  C  CA  . ILE C  1 127 ? -0.721   25.032  -14.880 1.00 26.56 ? 136 ILE C CA  1 
ATOM   5010  C  C   . ILE C  1 127 ? 0.596    24.299  -15.207 1.00 27.46 ? 136 ILE C C   1 
ATOM   5011  O  O   . ILE C  1 127 ? 1.315    23.858  -14.334 1.00 25.51 ? 136 ILE C O   1 
ATOM   5012  C  CB  . ILE C  1 127 ? -0.386   26.399  -14.257 1.00 27.91 ? 136 ILE C CB  1 
ATOM   5013  C  CG1 . ILE C  1 127 ? -1.500   27.071  -13.401 1.00 30.82 ? 136 ILE C CG1 1 
ATOM   5014  C  CG2 . ILE C  1 127 ? 0.362    27.254  -15.276 1.00 27.71 ? 136 ILE C CG2 1 
ATOM   5015  C  CD1 . ILE C  1 127 ? -2.117   28.244  -14.062 1.00 32.50 ? 136 ILE C CD1 1 
ATOM   5016  N  N   . CYS C  1 128 ? 0.940    24.247  -16.487 1.00 29.87 ? 137 CYS C N   1 
ATOM   5017  C  CA  . CYS C  1 128 ? 2.277    23.854  -16.895 1.00 31.72 ? 137 CYS C CA  1 
ATOM   5018  C  C   . CYS C  1 128 ? 2.660    24.507  -18.220 1.00 32.34 ? 137 CYS C C   1 
ATOM   5019  O  O   . CYS C  1 128 ? 2.246    24.086  -19.295 1.00 36.81 ? 137 CYS C O   1 
ATOM   5020  C  CB  . CYS C  1 128 ? 2.443    22.349  -16.916 1.00 33.18 ? 137 CYS C CB  1 
ATOM   5021  S  SG  . CYS C  1 128 ? 4.192    21.936  -16.718 1.00 38.66 ? 137 CYS C SG  1 
ATOM   5022  N  N   . GLY C  1 129 ? 3.391    25.600  -18.115 1.00 34.24 ? 138 GLY C N   1 
ATOM   5023  C  CA  . GLY C  1 129 ? 3.837    26.398  -19.273 1.00 38.01 ? 138 GLY C CA  1 
ATOM   5024  C  C   . GLY C  1 129 ? 2.697    27.151  -19.952 1.00 39.02 ? 138 GLY C C   1 
ATOM   5025  O  O   . GLY C  1 129 ? 1.556    27.098  -19.484 1.00 33.91 ? 138 GLY C O   1 
ATOM   5026  N  N   . PRO C  1 130 ? 2.979    27.801  -21.099 1.00 41.90 ? 139 PRO C N   1 
ATOM   5027  C  CA  . PRO C  1 130 ? 1.935    28.538  -21.836 1.00 42.48 ? 139 PRO C CA  1 
ATOM   5028  C  C   . PRO C  1 130 ? 0.782    27.627  -22.300 1.00 41.18 ? 139 PRO C C   1 
ATOM   5029  O  O   . PRO C  1 130 ? -0.368   28.064  -22.304 1.00 37.27 ? 139 PRO C O   1 
ATOM   5030  C  CB  . PRO C  1 130 ? 2.681    29.135  -23.052 1.00 44.07 ? 139 PRO C CB  1 
ATOM   5031  C  CG  . PRO C  1 130 ? 4.029    28.484  -23.077 1.00 45.88 ? 139 PRO C CG  1 
ATOM   5032  C  CD  . PRO C  1 130 ? 4.134    27.488  -21.961 1.00 45.02 ? 139 PRO C CD  1 
ATOM   5033  N  N   . GLY C  1 131 ? 1.103    26.379  -22.654 1.00 38.11 ? 140 GLY C N   1 
ATOM   5034  C  CA  . GLY C  1 131 ? 0.132    25.439  -23.216 1.00 38.97 ? 140 GLY C CA  1 
ATOM   5035  C  C   . GLY C  1 131 ? -0.949   24.833  -22.312 1.00 37.44 ? 140 GLY C C   1 
ATOM   5036  O  O   . GLY C  1 131 ? -2.018   24.495  -22.799 1.00 39.76 ? 140 GLY C O   1 
ATOM   5037  N  N   . THR C  1 132 ? -0.682   24.707  -21.017 1.00 32.73 ? 141 THR C N   1 
ATOM   5038  C  CA  . THR C  1 132 ? -1.633   24.119  -20.072 1.00 29.02 ? 141 THR C CA  1 
ATOM   5039  C  C   . THR C  1 132 ? -2.082   25.101  -19.000 1.00 28.22 ? 141 THR C C   1 
ATOM   5040  O  O   . THR C  1 132 ? -1.295   25.511  -18.143 1.00 23.78 ? 141 THR C O   1 
ATOM   5041  C  CB  . THR C  1 132 ? -1.041   22.897  -19.368 1.00 29.06 ? 141 THR C CB  1 
ATOM   5042  O  OG1 . THR C  1 132 ? -0.574   22.004  -20.360 1.00 32.18 ? 141 THR C OG1 1 
ATOM   5043  C  CG2 . THR C  1 132 ? -2.075   22.168  -18.521 1.00 28.93 ? 141 THR C CG2 1 
ATOM   5044  N  N   . LYS C  1 133 ? -3.342   25.496  -19.091 1.00 25.59 ? 142 LYS C N   1 
ATOM   5045  C  CA  . LYS C  1 133 ? -3.995   26.314  -18.101 1.00 28.84 ? 142 LYS C CA  1 
ATOM   5046  C  C   . LYS C  1 133 ? -5.404   25.746  -17.975 1.00 28.34 ? 142 LYS C C   1 
ATOM   5047  O  O   . LYS C  1 133 ? -6.343   26.233  -18.566 1.00 25.18 ? 142 LYS C O   1 
ATOM   5048  C  CB  . LYS C  1 133 ? -4.044   27.809  -18.468 1.00 31.01 ? 142 LYS C CB  1 
ATOM   5049  C  CG  . LYS C  1 133 ? -2.787   28.666  -18.213 1.00 35.04 ? 142 LYS C CG  1 
ATOM   5050  C  CD  . LYS C  1 133 ? -2.093   28.935  -19.501 1.00 37.31 ? 142 LYS C CD  1 
ATOM   5051  C  CE  . LYS C  1 133 ? -0.816   29.644  -19.189 1.00 38.13 ? 142 LYS C CE  1 
ATOM   5052  N  NZ  . LYS C  1 133 ? -0.929   30.977  -19.763 1.00 38.00 ? 142 LYS C NZ  1 
ATOM   5053  N  N   . LYS C  1 134 ? -5.532   24.735  -17.142 1.00 27.17 ? 143 LYS C N   1 
ATOM   5054  C  CA  . LYS C  1 134 ? -6.647   23.857  -17.213 1.00 27.26 ? 143 LYS C CA  1 
ATOM   5055  C  C   . LYS C  1 134 ? -7.230   23.601  -15.820 1.00 24.30 ? 143 LYS C C   1 
ATOM   5056  O  O   . LYS C  1 134 ? -6.522   23.596  -14.843 1.00 19.58 ? 143 LYS C O   1 
ATOM   5057  C  CB  . LYS C  1 134 ? -6.174   22.572  -17.936 1.00 31.46 ? 143 LYS C CB  1 
ATOM   5058  C  CG  . LYS C  1 134 ? -6.519   21.274  -17.242 1.00 37.70 ? 143 LYS C CG  1 
ATOM   5059  C  CD  . LYS C  1 134 ? -6.543   20.076  -18.173 1.00 43.03 ? 143 LYS C CD  1 
ATOM   5060  C  CE  . LYS C  1 134 ? -7.426   18.937  -17.647 1.00 46.20 ? 143 LYS C CE  1 
ATOM   5061  N  NZ  . LYS C  1 134 ? -8.325   18.027  -18.438 1.00 47.39 ? 143 LYS C NZ  1 
ATOM   5062  N  N   . VAL C  1 135 ? -8.549   23.466  -15.750 1.00 23.14 ? 144 VAL C N   1 
ATOM   5063  C  CA  . VAL C  1 135 ? -9.209   23.008  -14.535 1.00 21.80 ? 144 VAL C CA  1 
ATOM   5064  C  C   . VAL C  1 135 ? -9.519   21.507  -14.641 1.00 22.37 ? 144 VAL C C   1 
ATOM   5065  O  O   . VAL C  1 135 ? -10.347  21.047  -15.473 1.00 23.90 ? 144 VAL C O   1 
ATOM   5066  C  CB  . VAL C  1 135 ? -10.493  23.770  -14.222 1.00 20.51 ? 144 VAL C CB  1 
ATOM   5067  C  CG1 . VAL C  1 135 ? -11.030  23.336  -12.881 1.00 20.37 ? 144 VAL C CG1 1 
ATOM   5068  C  CG2 . VAL C  1 135 ? -10.252  25.260  -14.229 1.00 20.93 ? 144 VAL C CG2 1 
ATOM   5069  N  N   . HIS C  1 136 ? -8.874   20.741  -13.781 1.00 20.13 ? 145 HIS C N   1 
ATOM   5070  C  CA  . HIS C  1 136 ? -9.148   19.316  -13.684 1.00 21.43 ? 145 HIS C CA  1 
ATOM   5071  C  C   . HIS C  1 136 ? -10.442  19.034  -12.947 1.00 20.16 ? 145 HIS C C   1 
ATOM   5072  O  O   . HIS C  1 136 ? -10.722  19.607  -11.904 1.00 17.91 ? 145 HIS C O   1 
ATOM   5073  C  CB  . HIS C  1 136 ? -8.071   18.587  -12.910 1.00 23.79 ? 145 HIS C CB  1 
ATOM   5074  C  CG  . HIS C  1 136 ? -6.824   18.341  -13.672 1.00 25.55 ? 145 HIS C CG  1 
ATOM   5075  N  ND1 . HIS C  1 136 ? -6.780   17.535  -14.780 1.00 30.31 ? 145 HIS C ND1 1 
ATOM   5076  C  CD2 . HIS C  1 136 ? -5.558   18.754  -13.453 1.00 28.21 ? 145 HIS C CD2 1 
ATOM   5077  C  CE1 . HIS C  1 136 ? -5.543   17.495  -15.246 1.00 32.30 ? 145 HIS C CE1 1 
ATOM   5078  N  NE2 . HIS C  1 136 ? -4.784   18.243  -14.463 1.00 33.44 ? 145 HIS C NE2 1 
ATOM   5079  N  N   . VAL C  1 137 ? -11.225  18.113  -13.505 1.00 19.19 ? 146 VAL C N   1 
ATOM   5080  C  CA  . VAL C  1 137 ? -12.347  17.495  -12.770 1.00 18.49 ? 146 VAL C CA  1 
ATOM   5081  C  C   . VAL C  1 137 ? -12.239  16.008  -13.027 1.00 17.97 ? 146 VAL C C   1 
ATOM   5082  O  O   . VAL C  1 137 ? -12.428  15.550  -14.177 1.00 17.24 ? 146 VAL C O   1 
ATOM   5083  C  CB  . VAL C  1 137 ? -13.709  18.000  -13.240 1.00 17.64 ? 146 VAL C CB  1 
ATOM   5084  C  CG1 . VAL C  1 137 ? -14.758  17.563  -12.268 1.00 17.78 ? 146 VAL C CG1 1 
ATOM   5085  C  CG2 . VAL C  1 137 ? -13.702  19.509  -13.314 1.00 18.77 ? 146 VAL C CG2 1 
ATOM   5086  N  N   . ILE C  1 138 ? -11.775  15.283  -12.015 1.00 18.03 ? 147 ILE C N   1 
ATOM   5087  C  CA  . ILE C  1 138 ? -11.486  13.841  -12.159 1.00 18.14 ? 147 ILE C CA  1 
ATOM   5088  C  C   . ILE C  1 138 ? -12.330  13.026  -11.213 1.00 18.07 ? 147 ILE C C   1 
ATOM   5089  O  O   . ILE C  1 138 ? -12.453  13.335  -10.023 1.00 18.95 ? 147 ILE C O   1 
ATOM   5090  C  CB  . ILE C  1 138 ? -10.019  13.500  -11.921 1.00 20.18 ? 147 ILE C CB  1 
ATOM   5091  C  CG1 . ILE C  1 138 ? -9.139   14.330  -12.839 1.00 22.01 ? 147 ILE C CG1 1 
ATOM   5092  C  CG2 . ILE C  1 138 ? -9.744   12.009  -12.194 1.00 20.86 ? 147 ILE C CG2 1 
ATOM   5093  C  CD1 . ILE C  1 138 ? -7.645   14.093  -12.670 1.00 22.65 ? 147 ILE C CD1 1 
ATOM   5094  N  N   . PHE C  1 139 ? -12.964  12.014  -11.768 1.00 17.61 ? 148 PHE C N   1 
ATOM   5095  C  CA  . PHE C  1 139 ? -13.797  11.107  -10.979 1.00 19.69 ? 148 PHE C CA  1 
ATOM   5096  C  C   . PHE C  1 139 ? -13.159  9.736   -11.022 1.00 20.13 ? 148 PHE C C   1 
ATOM   5097  O  O   . PHE C  1 139 ? -12.781  9.254   -12.091 1.00 19.73 ? 148 PHE C O   1 
ATOM   5098  C  CB  . PHE C  1 139 ? -15.235  10.995  -11.527 1.00 19.02 ? 148 PHE C CB  1 
ATOM   5099  C  CG  . PHE C  1 139 ? -16.128  12.145  -11.124 1.00 20.62 ? 148 PHE C CG  1 
ATOM   5100  C  CD1 . PHE C  1 139 ? -16.866  12.109  -9.955  1.00 20.38 ? 148 PHE C CD1 1 
ATOM   5101  C  CD2 . PHE C  1 139 ? -16.237  13.259  -11.932 1.00 22.88 ? 148 PHE C CD2 1 
ATOM   5102  C  CE1 . PHE C  1 139 ? -17.691  13.161  -9.595  1.00 20.02 ? 148 PHE C CE1 1 
ATOM   5103  C  CE2 . PHE C  1 139 ? -17.063  14.311  -11.578 1.00 22.82 ? 148 PHE C CE2 1 
ATOM   5104  C  CZ  . PHE C  1 139 ? -17.784  14.268  -10.403 1.00 21.15 ? 148 PHE C CZ  1 
ATOM   5105  N  N   . ASN C  1 140 ? -13.054  9.134   -9.855  1.00 22.30 ? 149 ASN C N   1 
ATOM   5106  C  CA  . ASN C  1 140 ? -12.634  7.756   -9.753  1.00 25.74 ? 149 ASN C CA  1 
ATOM   5107  C  C   . ASN C  1 140 ? -13.818  6.797   -9.894  1.00 27.29 ? 149 ASN C C   1 
ATOM   5108  O  O   . ASN C  1 140 ? -14.799  6.875   -9.145  1.00 25.37 ? 149 ASN C O   1 
ATOM   5109  C  CB  . ASN C  1 140 ? -11.951  7.471   -8.430  1.00 26.59 ? 149 ASN C CB  1 
ATOM   5110  C  CG  . ASN C  1 140 ? -11.450  6.038   -8.365  1.00 26.73 ? 149 ASN C CG  1 
ATOM   5111  O  OD1 . ASN C  1 140 ? -11.945  5.258   -7.566  1.00 30.02 ? 149 ASN C OD1 1 
ATOM   5112  N  ND2 . ASN C  1 140 ? -10.510  5.690   -9.213  1.00 26.39 ? 149 ASN C ND2 1 
ATOM   5113  N  N   . TYR C  1 141 ? -13.700  5.907   -10.872 1.00 28.46 ? 150 TYR C N   1 
ATOM   5114  C  CA  . TYR C  1 141 ? -14.769  4.984   -11.203 1.00 30.01 ? 150 TYR C CA  1 
ATOM   5115  C  C   . TYR C  1 141 ? -14.205  3.683   -11.725 1.00 28.93 ? 150 TYR C C   1 
ATOM   5116  O  O   . TYR C  1 141 ? -13.407  3.687   -12.672 1.00 24.00 ? 150 TYR C O   1 
ATOM   5117  C  CB  . TYR C  1 141 ? -15.674  5.620   -12.279 1.00 32.83 ? 150 TYR C CB  1 
ATOM   5118  C  CG  . TYR C  1 141 ? -16.880  4.801   -12.686 1.00 31.88 ? 150 TYR C CG  1 
ATOM   5119  C  CD1 . TYR C  1 141 ? -17.958  4.613   -11.800 1.00 28.70 ? 150 TYR C CD1 1 
ATOM   5120  C  CD2 . TYR C  1 141 ? -16.959  4.249   -13.971 1.00 31.71 ? 150 TYR C CD2 1 
ATOM   5121  C  CE1 . TYR C  1 141 ? -19.059  3.877   -12.173 1.00 29.13 ? 150 TYR C CE1 1 
ATOM   5122  C  CE2 . TYR C  1 141 ? -18.066  3.513   -14.352 1.00 32.71 ? 150 TYR C CE2 1 
ATOM   5123  C  CZ  . TYR C  1 141 ? -19.111  3.331   -13.448 1.00 32.39 ? 150 TYR C CZ  1 
ATOM   5124  O  OH  . TYR C  1 141 ? -20.215  2.620   -13.844 1.00 36.25 ? 150 TYR C OH  1 
ATOM   5125  N  N   . LYS C  1 142 ? -14.645  2.579   -11.125 1.00 30.13 ? 151 LYS C N   1 
ATOM   5126  C  CA  . LYS C  1 142 ? -14.176  1.228   -11.517 1.00 34.23 ? 151 LYS C CA  1 
ATOM   5127  C  C   . LYS C  1 142 ? -12.677  1.181   -11.605 1.00 33.81 ? 151 LYS C C   1 
ATOM   5128  O  O   . LYS C  1 142 ? -12.139  0.741   -12.613 1.00 37.01 ? 151 LYS C O   1 
ATOM   5129  C  CB  . LYS C  1 142 ? -14.763  0.781   -12.873 1.00 37.51 ? 151 LYS C CB  1 
ATOM   5130  C  CG  . LYS C  1 142 ? -16.275  0.715   -12.911 1.00 39.97 ? 151 LYS C CG  1 
ATOM   5131  C  CD  . LYS C  1 142 ? -16.856  -0.113  -11.771 1.00 44.55 ? 151 LYS C CD  1 
ATOM   5132  C  CE  . LYS C  1 142 ? -18.375  0.038   -11.651 1.00 50.59 ? 151 LYS C CE  1 
ATOM   5133  N  NZ  . LYS C  1 142 ? -19.217  -0.885  -12.436 1.00 52.92 ? 151 LYS C NZ  1 
ATOM   5134  N  N   . GLY C  1 143 ? -12.019  1.709   -10.573 1.00 36.12 ? 152 GLY C N   1 
ATOM   5135  C  CA  . GLY C  1 143 ? -10.562  1.663   -10.451 1.00 36.13 ? 152 GLY C CA  1 
ATOM   5136  C  C   . GLY C  1 143 ? -9.820   2.447   -11.501 1.00 37.91 ? 152 GLY C C   1 
ATOM   5137  O  O   . GLY C  1 143 ? -8.626   2.225   -11.709 1.00 38.84 ? 152 GLY C O   1 
ATOM   5138  N  N   . LYS C  1 144 ? -10.519  3.345   -12.191 1.00 34.67 ? 153 LYS C N   1 
ATOM   5139  C  CA  . LYS C  1 144 ? -9.877   4.292   -13.107 1.00 31.05 ? 153 LYS C CA  1 
ATOM   5140  C  C   . LYS C  1 144 ? -10.159  5.723   -12.693 1.00 27.15 ? 153 LYS C C   1 
ATOM   5141  O  O   . LYS C  1 144 ? -11.204  6.032   -12.148 1.00 28.11 ? 153 LYS C O   1 
ATOM   5142  C  CB  . LYS C  1 144 ? -10.386  4.125   -14.522 1.00 36.70 ? 153 LYS C CB  1 
ATOM   5143  C  CG  . LYS C  1 144 ? -9.901   2.833   -15.173 1.00 39.83 ? 153 LYS C CG  1 
ATOM   5144  C  CD  . LYS C  1 144 ? -8.418   2.848   -15.465 1.00 43.61 ? 153 LYS C CD  1 
ATOM   5145  C  CE  . LYS C  1 144 ? -7.815   1.656   -16.181 1.00 49.36 ? 153 LYS C CE  1 
ATOM   5146  N  NZ  . LYS C  1 144 ? -6.324   1.773   -16.285 1.00 52.51 ? 153 LYS C NZ  1 
ATOM   5147  N  N   . ASN C  1 145 ? -9.197   6.587   -12.932 1.00 24.86 ? 154 ASN C N   1 
ATOM   5148  C  CA  . ASN C  1 145 ? -9.327   8.012   -12.696 1.00 23.14 ? 154 ASN C CA  1 
ATOM   5149  C  C   . ASN C  1 145 ? -9.688   8.662   -14.004 1.00 24.11 ? 154 ASN C C   1 
ATOM   5150  O  O   . ASN C  1 145 ? -8.879   8.753   -14.902 1.00 26.69 ? 154 ASN C O   1 
ATOM   5151  C  CB  . ASN C  1 145 ? -8.026   8.580   -12.180 1.00 22.18 ? 154 ASN C CB  1 
ATOM   5152  C  CG  . ASN C  1 145 ? -7.769   8.195   -10.731 1.00 22.42 ? 154 ASN C CG  1 
ATOM   5153  O  OD1 . ASN C  1 145 ? -8.686   8.066   -9.928  1.00 20.56 ? 154 ASN C OD1 1 
ATOM   5154  N  ND2 . ASN C  1 145 ? -6.498   8.054   -10.392 1.00 22.07 ? 154 ASN C ND2 1 
ATOM   5155  N  N   . VAL C  1 146 ? -10.924  9.095   -14.116 1.00 25.26 ? 155 VAL C N   1 
ATOM   5156  C  CA  . VAL C  1 146 ? -11.443  9.529   -15.400 1.00 23.84 ? 155 VAL C CA  1 
ATOM   5157  C  C   . VAL C  1 146 ? -11.428  11.044  -15.451 1.00 21.98 ? 155 VAL C C   1 
ATOM   5158  O  O   . VAL C  1 146 ? -11.989  11.714  -14.580 1.00 18.14 ? 155 VAL C O   1 
ATOM   5159  C  CB  . VAL C  1 146 ? -12.873  8.966   -15.647 1.00 25.09 ? 155 VAL C CB  1 
ATOM   5160  C  CG1 . VAL C  1 146 ? -13.259  9.157   -17.106 1.00 26.48 ? 155 VAL C CG1 1 
ATOM   5161  C  CG2 . VAL C  1 146 ? -12.927  7.485   -15.300 1.00 25.74 ? 155 VAL C CG2 1 
ATOM   5162  N  N   . LEU C  1 147 ? -10.848  11.556  -16.527 1.00 23.44 ? 156 LEU C N   1 
ATOM   5163  C  CA  . LEU C  1 147 ? -10.628  12.982  -16.700 1.00 25.38 ? 156 LEU C CA  1 
ATOM   5164  C  C   . LEU C  1 147 ? -11.750  13.617  -17.505 1.00 25.71 ? 156 LEU C C   1 
ATOM   5165  O  O   . LEU C  1 147 ? -12.211  13.049  -18.485 1.00 25.54 ? 156 LEU C O   1 
ATOM   5166  C  CB  . LEU C  1 147 ? -9.300   13.249  -17.424 1.00 28.17 ? 156 LEU C CB  1 
ATOM   5167  C  CG  . LEU C  1 147 ? -8.040   13.208  -16.554 1.00 30.68 ? 156 LEU C CG  1 
ATOM   5168  C  CD1 . LEU C  1 147 ? -7.722   11.771  -16.124 1.00 30.72 ? 156 LEU C CD1 1 
ATOM   5169  C  CD2 . LEU C  1 147 ? -6.872   13.844  -17.293 1.00 29.48 ? 156 LEU C CD2 1 
ATOM   5170  N  N   . ILE C  1 148 ? -12.147  14.826  -17.141 1.00 23.80 ? 157 ILE C N   1 
ATOM   5171  C  CA  . ILE C  1 148 ? -13.222  15.485  -17.871 1.00 23.76 ? 157 ILE C CA  1 
ATOM   5172  C  C   . ILE C  1 148 ? -12.767  15.724  -19.305 1.00 28.80 ? 157 ILE C C   1 
ATOM   5173  O  O   . ILE C  1 148 ? -11.610  15.962  -19.531 1.00 27.28 ? 157 ILE C O   1 
ATOM   5174  C  CB  . ILE C  1 148 ? -13.660  16.787  -17.204 1.00 24.95 ? 157 ILE C CB  1 
ATOM   5175  C  CG1 . ILE C  1 148 ? -15.015  17.257  -17.764 1.00 23.46 ? 157 ILE C CG1 1 
ATOM   5176  C  CG2 . ILE C  1 148 ? -12.566  17.855  -17.321 1.00 23.36 ? 157 ILE C CG2 1 
ATOM   5177  C  CD1 . ILE C  1 148 ? -15.559  18.511  -17.101 1.00 23.00 ? 157 ILE C CD1 1 
ATOM   5178  N  N   . ASN C  1 149 ? -13.687  15.611  -20.262 1.00 31.21 ? 158 ASN C N   1 
ATOM   5179  C  CA  . ASN C  1 149 ? -13.409  15.822  -21.695 1.00 34.20 ? 158 ASN C CA  1 
ATOM   5180  C  C   . ASN C  1 149 ? -13.573  17.231  -22.163 1.00 32.74 ? 158 ASN C C   1 
ATOM   5181  O  O   . ASN C  1 149 ? -13.260  17.520  -23.284 1.00 37.40 ? 158 ASN C O   1 
ATOM   5182  C  CB  . ASN C  1 149 ? -14.371  15.011  -22.554 1.00 38.03 ? 158 ASN C CB  1 
ATOM   5183  C  CG  . ASN C  1 149 ? -14.164  13.523  -22.427 1.00 44.14 ? 158 ASN C CG  1 
ATOM   5184  O  OD1 . ASN C  1 149 ? -13.198  13.066  -21.828 1.00 49.37 ? 158 ASN C OD1 1 
ATOM   5185  N  ND2 . ASN C  1 149 ? -15.091  12.753  -22.987 1.00 51.15 ? 158 ASN C ND2 1 
ATOM   5186  N  N   . LYS C  1 150 ? -14.154  18.080  -21.346 1.00 33.57 ? 159 LYS C N   1 
ATOM   5187  C  CA  . LYS C  1 150 ? -14.281  19.485  -21.691 1.00 31.39 ? 159 LYS C CA  1 
ATOM   5188  C  C   . LYS C  1 150 ? -13.016  20.233  -21.284 1.00 33.49 ? 159 LYS C C   1 
ATOM   5189  O  O   . LYS C  1 150 ? -12.378  19.925  -20.274 1.00 27.69 ? 159 LYS C O   1 
ATOM   5190  C  CB  . LYS C  1 150 ? -15.478  20.112  -21.002 1.00 33.25 ? 159 LYS C CB  1 
ATOM   5191  C  CG  . LYS C  1 150 ? -16.815  19.575  -21.495 1.00 32.14 ? 159 LYS C CG  1 
ATOM   5192  C  CD  . LYS C  1 150 ? -17.731  20.707  -21.901 1.00 31.30 ? 159 LYS C CD  1 
ATOM   5193  C  CE  . LYS C  1 150 ? -19.123  20.237  -22.324 1.00 30.62 ? 159 LYS C CE  1 
ATOM   5194  N  NZ  . LYS C  1 150 ? -20.147  20.440  -21.267 1.00 30.77 ? 159 LYS C NZ  1 
ATOM   5195  N  N   . ASP C  1 151 ? -12.688  21.244  -22.064 1.00 32.06 ? 160 ASP C N   1 
ATOM   5196  C  CA  . ASP C  1 151 ? -11.514  22.060  -21.805 1.00 35.03 ? 160 ASP C CA  1 
ATOM   5197  C  C   . ASP C  1 151 ? -11.936  23.296  -21.012 1.00 30.87 ? 160 ASP C C   1 
ATOM   5198  O  O   . ASP C  1 151 ? -12.576  24.193  -21.544 1.00 32.97 ? 160 ASP C O   1 
ATOM   5199  C  CB  . ASP C  1 151 ? -10.832  22.408  -23.139 1.00 39.02 ? 160 ASP C CB  1 
ATOM   5200  C  CG  . ASP C  1 151 ? -9.611   23.322  -22.991 1.00 45.51 ? 160 ASP C CG  1 
ATOM   5201  O  OD1 . ASP C  1 151 ? -9.672   24.269  -22.180 1.00 55.07 ? 160 ASP C OD1 1 
ATOM   5202  O  OD2 . ASP C  1 151 ? -8.580   23.138  -23.704 1.00 51.35 ? 160 ASP C OD2 1 
ATOM   5203  N  N   . ILE C  1 152 ? -11.561  23.335  -19.740 1.00 26.25 ? 161 ILE C N   1 
ATOM   5204  C  CA  . ILE C  1 152 ? -11.849  24.468  -18.890 1.00 24.15 ? 161 ILE C CA  1 
ATOM   5205  C  C   . ILE C  1 152 ? -10.562  25.239  -18.603 1.00 22.22 ? 161 ILE C C   1 
ATOM   5206  O  O   . ILE C  1 152 ? -9.637   24.710  -18.056 1.00 22.59 ? 161 ILE C O   1 
ATOM   5207  C  CB  . ILE C  1 152 ? -12.479  24.022  -17.564 1.00 21.58 ? 161 ILE C CB  1 
ATOM   5208  C  CG1 . ILE C  1 152 ? -13.682  23.137  -17.838 1.00 21.21 ? 161 ILE C CG1 1 
ATOM   5209  C  CG2 . ILE C  1 152 ? -12.928  25.236  -16.745 1.00 23.53 ? 161 ILE C CG2 1 
ATOM   5210  C  CD1 . ILE C  1 152 ? -14.216  22.453  -16.599 1.00 19.52 ? 161 ILE C CD1 1 
ATOM   5211  N  N   . ARG C  1 153 ? -10.541  26.498  -18.956 1.00 23.72 ? 162 ARG C N   1 
ATOM   5212  C  CA  . ARG C  1 153 ? -9.382   27.326  -18.684 1.00 26.50 ? 162 ARG C CA  1 
ATOM   5213  C  C   . ARG C  1 153 ? -9.360   27.799  -17.273 1.00 22.07 ? 162 ARG C C   1 
ATOM   5214  O  O   . ARG C  1 153 ? -10.360  28.244  -16.757 1.00 23.52 ? 162 ARG C O   1 
ATOM   5215  C  CB  . ARG C  1 153 ? -9.218   28.522  -19.645 1.00 30.91 ? 162 ARG C CB  1 
ATOM   5216  C  CG  . ARG C  1 153 ? -9.154   27.994  -21.130 1.00 38.52 ? 162 ARG C CG  1 
ATOM   5217  C  CD  . ARG C  1 153 ? -7.807   27.270  -21.433 1.00 44.15 ? 162 ARG C CD  1 
ATOM   5218  N  NE  . ARG C  1 153 ? -7.723   26.403  -22.649 1.00 48.20 ? 162 ARG C NE  1 
ATOM   5219  C  CZ  . ARG C  1 153 ? -7.094   26.690  -23.816 1.00 51.74 ? 162 ARG C CZ  1 
ATOM   5220  N  NH1 . ARG C  1 153 ? -6.493   27.861  -24.035 1.00 47.77 ? 162 ARG C NH1 1 
ATOM   5221  N  NH2 . ARG C  1 153 ? -7.073   25.785  -24.804 1.00 52.51 ? 162 ARG C NH2 1 
ATOM   5222  N  N   . CYS C  1 154 ? -8.204   27.716  -16.644 1.00 21.12 ? 163 CYS C N   1 
ATOM   5223  C  CA  . CYS C  1 154 ? -8.081   28.196  -15.281 1.00 22.00 ? 163 CYS C CA  1 
ATOM   5224  C  C   . CYS C  1 154 ? -7.529   29.607  -15.312 1.00 23.49 ? 163 CYS C C   1 
ATOM   5225  O  O   . CYS C  1 154 ? -7.168   30.119  -16.388 1.00 25.01 ? 163 CYS C O   1 
ATOM   5226  C  CB  . CYS C  1 154 ? -7.209   27.296  -14.458 1.00 23.03 ? 163 CYS C CB  1 
ATOM   5227  S  SG  . CYS C  1 154 ? -5.435   27.368  -14.852 1.00 23.96 ? 163 CYS C SG  1 
ATOM   5228  N  N   . LYS C  1 155 ? -7.501   30.273  -14.172 1.00 22.32 ? 164 LYS C N   1 
ATOM   5229  C  CA  . LYS C  1 155 ? -6.832   31.579  -14.093 1.00 23.81 ? 164 LYS C CA  1 
ATOM   5230  C  C   . LYS C  1 155 ? -5.337   31.391  -13.914 1.00 24.63 ? 164 LYS C C   1 
ATOM   5231  O  O   . LYS C  1 155 ? -4.887   30.398  -13.348 1.00 23.91 ? 164 LYS C O   1 
ATOM   5232  C  CB  . LYS C  1 155 ? -7.364   32.378  -12.922 1.00 24.11 ? 164 LYS C CB  1 
ATOM   5233  C  CG  . LYS C  1 155 ? -8.854   32.628  -12.986 1.00 25.22 ? 164 LYS C CG  1 
ATOM   5234  C  CD  . LYS C  1 155 ? -9.213   33.618  -14.065 1.00 25.79 ? 164 LYS C CD  1 
ATOM   5235  C  CE  . LYS C  1 155 ? -10.548  34.234  -13.722 1.00 28.03 ? 164 LYS C CE  1 
ATOM   5236  N  NZ  . LYS C  1 155 ? -11.076  35.061  -14.821 1.00 29.66 ? 164 LYS C NZ  1 
ATOM   5237  N  N   . ASP C  1 156 ? -4.564   32.360  -14.373 1.00 27.76 ? 165 ASP C N   1 
ATOM   5238  C  CA  . ASP C  1 156 ? -3.098   32.250  -14.275 1.00 31.49 ? 165 ASP C CA  1 
ATOM   5239  C  C   . ASP C  1 156 ? -2.373   33.508  -13.778 1.00 28.54 ? 165 ASP C C   1 
ATOM   5240  O  O   . ASP C  1 156 ? -1.171   33.492  -13.669 1.00 35.01 ? 165 ASP C O   1 
ATOM   5241  C  CB  . ASP C  1 156 ? -2.504   31.852  -15.624 1.00 36.70 ? 165 ASP C CB  1 
ATOM   5242  C  CG  . ASP C  1 156 ? -2.734   32.924  -16.685 1.00 43.02 ? 165 ASP C CG  1 
ATOM   5243  O  OD1 . ASP C  1 156 ? -3.446   33.914  -16.349 1.00 45.64 ? 165 ASP C OD1 1 
ATOM   5244  O  OD2 . ASP C  1 156 ? -2.182   32.796  -17.813 1.00 43.78 ? 165 ASP C OD2 1 
ATOM   5245  N  N   . ASP C  1 157 ? -3.085   34.587  -13.486 1.00 23.97 ? 166 ASP C N   1 
ATOM   5246  C  CA  . ASP C  1 157 ? -2.461   35.776  -12.919 1.00 21.10 ? 166 ASP C CA  1 
ATOM   5247  C  C   . ASP C  1 157 ? -2.037   35.575  -11.453 1.00 18.65 ? 166 ASP C C   1 
ATOM   5248  O  O   . ASP C  1 157 ? -2.003   34.459  -10.952 1.00 18.09 ? 166 ASP C O   1 
ATOM   5249  C  CB  . ASP C  1 157 ? -3.389   36.994  -13.099 1.00 20.15 ? 166 ASP C CB  1 
ATOM   5250  C  CG  . ASP C  1 157 ? -4.652   36.913  -12.255 1.00 20.10 ? 166 ASP C CG  1 
ATOM   5251  O  OD1 . ASP C  1 157 ? -4.746   36.034  -11.367 1.00 19.12 ? 166 ASP C OD1 1 
ATOM   5252  O  OD2 . ASP C  1 157 ? -5.545   37.769  -12.456 1.00 20.98 ? 166 ASP C OD2 1 
ATOM   5253  N  N   . GLU C  1 158 ? -1.702   36.654  -10.766 1.00 16.86 ? 167 GLU C N   1 
ATOM   5254  C  CA  . GLU C  1 158 ? -1.166   36.541  -9.408  1.00 16.44 ? 167 GLU C CA  1 
ATOM   5255  C  C   . GLU C  1 158 ? -2.192   36.685  -8.293  1.00 14.74 ? 167 GLU C C   1 
ATOM   5256  O  O   . GLU C  1 158 ? -1.856   36.609  -7.138  1.00 13.15 ? 167 GLU C O   1 
ATOM   5257  C  CB  . GLU C  1 158 ? -0.038   37.559  -9.207  1.00 18.42 ? 167 GLU C CB  1 
ATOM   5258  C  CG  . GLU C  1 158 ? -0.436   39.031  -9.124  1.00 19.90 ? 167 GLU C CG  1 
ATOM   5259  C  CD  . GLU C  1 158 ? -0.457   39.763  -10.479 1.00 20.90 ? 167 GLU C CD  1 
ATOM   5260  O  OE1 . GLU C  1 158 ? -1.032   39.220  -11.440 1.00 21.50 ? 167 GLU C OE1 1 
ATOM   5261  O  OE2 . GLU C  1 158 ? 0.084    40.911  -10.575 1.00 21.54 ? 167 GLU C OE2 1 
ATOM   5262  N  N   . PHE C  1 159 ? -3.454   36.899  -8.649  1.00 13.65 ? 168 PHE C N   1 
ATOM   5263  C  CA  . PHE C  1 159 ? -4.468   37.247  -7.694  1.00 12.52 ? 168 PHE C CA  1 
ATOM   5264  C  C   . PHE C  1 159 ? -5.239   36.034  -7.168  1.00 12.24 ? 168 PHE C C   1 
ATOM   5265  O  O   . PHE C  1 159 ? -5.023   34.922  -7.620  1.00 12.21 ? 168 PHE C O   1 
ATOM   5266  C  CB  . PHE C  1 159 ? -5.394   38.324  -8.292  1.00 12.87 ? 168 PHE C CB  1 
ATOM   5267  C  CG  . PHE C  1 159 ? -4.666   39.598  -8.651  1.00 12.37 ? 168 PHE C CG  1 
ATOM   5268  C  CD1 . PHE C  1 159 ? -4.336   40.513  -7.674  1.00 12.65 ? 168 PHE C CD1 1 
ATOM   5269  C  CD2 . PHE C  1 159 ? -4.292   39.851  -9.943  1.00 12.94 ? 168 PHE C CD2 1 
ATOM   5270  C  CE1 . PHE C  1 159 ? -3.654   41.681  -7.991  1.00 12.85 ? 168 PHE C CE1 1 
ATOM   5271  C  CE2 . PHE C  1 159 ? -3.610   41.041  -10.286 1.00 12.72 ? 168 PHE C CE2 1 
ATOM   5272  C  CZ  . PHE C  1 159 ? -3.279   41.938  -9.305  1.00 12.35 ? 168 PHE C CZ  1 
ATOM   5273  N  N   . THR C  1 160 ? -6.049   36.251  -6.125  1.00 12.67 ? 169 THR C N   1 
ATOM   5274  C  CA  . THR C  1 160 ? -6.811   35.182  -5.479  1.00 13.30 ? 169 THR C CA  1 
ATOM   5275  C  C   . THR C  1 160 ? -8.043   34.816  -6.354  1.00 12.97 ? 169 THR C C   1 
ATOM   5276  O  O   . THR C  1 160 ? -8.857   35.680  -6.674  1.00 14.07 ? 169 THR C O   1 
ATOM   5277  C  CB  . THR C  1 160 ? -7.287   35.610  -4.086  1.00 13.74 ? 169 THR C CB  1 
ATOM   5278  O  OG1 . THR C  1 160 ? -6.160   35.852  -3.259  1.00 13.88 ? 169 THR C OG1 1 
ATOM   5279  C  CG2 . THR C  1 160 ? -8.109   34.529  -3.400  1.00 13.99 ? 169 THR C CG2 1 
ATOM   5280  N  N   . HIS C  1 161 ? -8.185   33.547  -6.716  1.00 11.28 ? 170 HIS C N   1 
ATOM   5281  C  CA  . HIS C  1 161 ? -9.395   33.105  -7.438  1.00 11.17 ? 170 HIS C CA  1 
ATOM   5282  C  C   . HIS C  1 161 ? -10.153  32.023  -6.699  1.00 11.05 ? 170 HIS C C   1 
ATOM   5283  O  O   . HIS C  1 161 ? -9.542   31.130  -6.093  1.00 10.41 ? 170 HIS C O   1 
ATOM   5284  C  CB  . HIS C  1 161 ? -9.065   32.715  -8.868  1.00 11.21 ? 170 HIS C CB  1 
ATOM   5285  C  CG  . HIS C  1 161 ? -8.506   33.855  -9.651  1.00 11.58 ? 170 HIS C CG  1 
ATOM   5286  N  ND1 . HIS C  1 161 ? -9.270   34.960  -9.988  1.00 11.94 ? 170 HIS C ND1 1 
ATOM   5287  C  CD2 . HIS C  1 161 ? -7.241   34.145  -10.029 1.00 11.37 ? 170 HIS C CD2 1 
ATOM   5288  C  CE1 . HIS C  1 161 ? -8.500   35.870  -10.562 1.00 11.75 ? 170 HIS C CE1 1 
ATOM   5289  N  NE2 . HIS C  1 161 ? -7.274   35.385  -10.632 1.00 11.76 ? 170 HIS C NE2 1 
ATOM   5290  N  N   . LEU C  1 162 ? -11.482  32.124  -6.781  1.00 11.05 ? 171 LEU C N   1 
ATOM   5291  C  CA  . LEU C  1 162 ? -12.419  31.148  -6.181  1.00 11.05 ? 171 LEU C CA  1 
ATOM   5292  C  C   . LEU C  1 162 ? -12.765  30.023  -7.160  1.00 11.20 ? 171 LEU C C   1 
ATOM   5293  O  O   . LEU C  1 162 ? -13.158  30.276  -8.289  1.00 10.39 ? 171 LEU C O   1 
ATOM   5294  C  CB  . LEU C  1 162 ? -13.697  31.847  -5.774  1.00 11.51 ? 171 LEU C CB  1 
ATOM   5295  C  CG  . LEU C  1 162 ? -14.702  31.016  -4.956  1.00 11.46 ? 171 LEU C CG  1 
ATOM   5296  C  CD1 . LEU C  1 162 ? -14.223  30.754  -3.555  1.00 11.60 ? 171 LEU C CD1 1 
ATOM   5297  C  CD2 . LEU C  1 162 ? -16.045  31.708  -4.911  1.00 11.22 ? 171 LEU C CD2 1 
ATOM   5298  N  N   . TYR C  1 163 ? -12.551  28.780  -6.724  1.00 11.70 ? 172 TYR C N   1 
ATOM   5299  C  CA  . TYR C  1 163 ? -12.867  27.602  -7.524  1.00 11.86 ? 172 TYR C CA  1 
ATOM   5300  C  C   . TYR C  1 163 ? -13.989  26.812  -6.844  1.00 11.93 ? 172 TYR C C   1 
ATOM   5301  O  O   . TYR C  1 163 ? -13.879  26.451  -5.670  1.00 12.16 ? 172 TYR C O   1 
ATOM   5302  C  CB  . TYR C  1 163 ? -11.638  26.722  -7.757  1.00 12.09 ? 172 TYR C CB  1 
ATOM   5303  C  CG  . TYR C  1 163 ? -10.680  27.317  -8.765  1.00 11.82 ? 172 TYR C CG  1 
ATOM   5304  C  CD1 . TYR C  1 163 ? -10.848  27.097  -10.108 1.00 12.21 ? 172 TYR C CD1 1 
ATOM   5305  C  CD2 . TYR C  1 163 ? -9.686   28.174  -8.369  1.00 11.68 ? 172 TYR C CD2 1 
ATOM   5306  C  CE1 . TYR C  1 163 ? -10.014  27.682  -11.047 1.00 12.70 ? 172 TYR C CE1 1 
ATOM   5307  C  CE2 . TYR C  1 163 ? -8.845   28.760  -9.285  1.00 11.68 ? 172 TYR C CE2 1 
ATOM   5308  C  CZ  . TYR C  1 163 ? -8.976   28.491  -10.615 1.00 12.73 ? 172 TYR C CZ  1 
ATOM   5309  O  OH  . TYR C  1 163 ? -8.116   29.050  -11.547 1.00 12.64 ? 172 TYR C OH  1 
ATOM   5310  N  N   . THR C  1 164 ? -15.017  26.497  -7.614  1.00 10.39 ? 173 THR C N   1 
ATOM   5311  C  CA  . THR C  1 164 ? -16.189  25.790  -7.073  1.00 10.77 ? 173 THR C CA  1 
ATOM   5312  C  C   . THR C  1 164 ? -16.583  24.639  -7.994  1.00 10.73 ? 173 THR C C   1 
ATOM   5313  O  O   . THR C  1 164 ? -16.789  24.824  -9.215  1.00 10.20 ? 173 THR C O   1 
ATOM   5314  C  CB  . THR C  1 164 ? -17.407  26.744  -6.960  1.00 10.92 ? 173 THR C CB  1 
ATOM   5315  O  OG1 . THR C  1 164 ? -17.027  27.949  -6.260  1.00 10.26 ? 173 THR C OG1 1 
ATOM   5316  C  CG2 . THR C  1 164 ? -18.586  26.102  -6.268  1.00 10.94 ? 173 THR C CG2 1 
ATOM   5317  N  N   . LEU C  1 165 ? -16.728  23.465  -7.403  1.00 11.16 ? 174 LEU C N   1 
ATOM   5318  C  CA  . LEU C  1 165 ? -17.297  22.334  -8.095  1.00 12.23 ? 174 LEU C CA  1 
ATOM   5319  C  C   . LEU C  1 165 ? -18.615  21.962  -7.435  1.00 12.43 ? 174 LEU C C   1 
ATOM   5320  O  O   . LEU C  1 165 ? -18.665  21.685  -6.251  1.00 12.25 ? 174 LEU C O   1 
ATOM   5321  C  CB  . LEU C  1 165 ? -16.361  21.128  -8.097  1.00 12.30 ? 174 LEU C CB  1 
ATOM   5322  C  CG  . LEU C  1 165 ? -16.930  19.808  -8.604  1.00 12.74 ? 174 LEU C CG  1 
ATOM   5323  C  CD1 . LEU C  1 165 ? -17.127  19.844  -10.136 1.00 14.43 ? 174 LEU C CD1 1 
ATOM   5324  C  CD2 . LEU C  1 165 ? -16.029  18.625  -8.296  1.00 12.23 ? 174 LEU C CD2 1 
ATOM   5325  N  N   . ILE C  1 166 ? -19.639  21.835  -8.272  1.00 13.00 ? 175 ILE C N   1 
ATOM   5326  C  CA  . ILE C  1 166 ? -20.968  21.405  -7.861  1.00 13.64 ? 175 ILE C CA  1 
ATOM   5327  C  C   . ILE C  1 166 ? -21.319  20.082  -8.571  1.00 13.69 ? 175 ILE C C   1 
ATOM   5328  O  O   . ILE C  1 166 ? -21.268  19.960  -9.798  1.00 12.44 ? 175 ILE C O   1 
ATOM   5329  C  CB  . ILE C  1 166 ? -22.087  22.386  -8.305  1.00 14.23 ? 175 ILE C CB  1 
ATOM   5330  C  CG1 . ILE C  1 166 ? -21.737  23.813  -8.150  1.00 15.88 ? 175 ILE C CG1 1 
ATOM   5331  C  CG2 . ILE C  1 166 ? -23.448  21.952  -7.812  1.00 13.91 ? 175 ILE C CG2 1 
ATOM   5332  C  CD1 . ILE C  1 166 ? -22.158  24.480  -6.934  1.00 17.40 ? 175 ILE C CD1 1 
ATOM   5333  N  N   . VAL C  1 167 ? -21.699  19.104  -7.764  1.00 16.13 ? 176 VAL C N   1 
ATOM   5334  C  CA  . VAL C  1 167 ? -22.095  17.752  -8.281  1.00 19.18 ? 176 VAL C CA  1 
ATOM   5335  C  C   . VAL C  1 167 ? -23.453  17.366  -7.712  1.00 18.17 ? 176 VAL C C   1 
ATOM   5336  O  O   . VAL C  1 167 ? -23.612  17.325  -6.506  1.00 17.48 ? 176 VAL C O   1 
ATOM   5337  C  CB  . VAL C  1 167 ? -21.094  16.630  -7.869  1.00 19.68 ? 176 VAL C CB  1 
ATOM   5338  C  CG1 . VAL C  1 167 ? -21.530  15.284  -8.424  1.00 22.66 ? 176 VAL C CG1 1 
ATOM   5339  C  CG2 . VAL C  1 167 ? -19.690  16.942  -8.344  1.00 20.37 ? 176 VAL C CG2 1 
ATOM   5340  N  N   . ARG C  1 168 ? -24.386  17.058  -8.591  1.00 19.38 ? 177 ARG C N   1 
ATOM   5341  C  CA  . ARG C  1 168 ? -25.781  16.830  -8.185  1.00 20.78 ? 177 ARG C CA  1 
ATOM   5342  C  C   . ARG C  1 168 ? -26.249  15.401  -8.413  1.00 19.61 ? 177 ARG C C   1 
ATOM   5343  O  O   . ARG C  1 168 ? -25.756  14.726  -9.324  1.00 18.71 ? 177 ARG C O   1 
ATOM   5344  C  CB  . ARG C  1 168 ? -26.711  17.770  -8.954  1.00 21.60 ? 177 ARG C CB  1 
ATOM   5345  C  CG  . ARG C  1 168 ? -26.401  19.225  -8.742  1.00 21.18 ? 177 ARG C CG  1 
ATOM   5346  C  CD  . ARG C  1 168 ? -27.460  20.081  -9.391  1.00 22.03 ? 177 ARG C CD  1 
ATOM   5347  N  NE  . ARG C  1 168 ? -27.052  21.483  -9.494  1.00 20.83 ? 177 ARG C NE  1 
ATOM   5348  C  CZ  . ARG C  1 168 ? -26.448  21.990  -10.561 1.00 20.86 ? 177 ARG C CZ  1 
ATOM   5349  N  NH1 . ARG C  1 168 ? -26.181  21.240  -11.628 1.00 19.24 ? 177 ARG C NH1 1 
ATOM   5350  N  NH2 . ARG C  1 168 ? -26.107  23.258  -10.557 1.00 22.48 ? 177 ARG C NH2 1 
ATOM   5351  N  N   . PRO C  1 169 ? -27.217  14.953  -7.617  1.00 19.79 ? 178 PRO C N   1 
ATOM   5352  C  CA  . PRO C  1 169 ? -27.685  13.561  -7.697  1.00 22.54 ? 178 PRO C CA  1 
ATOM   5353  C  C   . PRO C  1 169 ? -28.457  13.156  -8.962  1.00 23.61 ? 178 PRO C C   1 
ATOM   5354  O  O   . PRO C  1 169 ? -28.735  11.984  -9.132  1.00 26.88 ? 178 PRO C O   1 
ATOM   5355  C  CB  . PRO C  1 169 ? -28.571  13.396  -6.458  1.00 20.87 ? 178 PRO C CB  1 
ATOM   5356  C  CG  . PRO C  1 169 ? -28.870  14.751  -5.962  1.00 19.72 ? 178 PRO C CG  1 
ATOM   5357  C  CD  . PRO C  1 169 ? -28.028  15.747  -6.693  1.00 20.18 ? 178 PRO C CD  1 
ATOM   5358  N  N   . ASP C  1 170 ? -28.719  14.075  -9.880  1.00 24.50 ? 179 ASP C N   1 
ATOM   5359  C  CA  . ASP C  1 170 ? -29.106  13.687  -11.244 1.00 22.90 ? 179 ASP C CA  1 
ATOM   5360  C  C   . ASP C  1 170 ? -27.930  13.504  -12.169 1.00 22.51 ? 179 ASP C C   1 
ATOM   5361  O  O   . ASP C  1 170 ? -28.102  13.528  -13.375 1.00 20.09 ? 179 ASP C O   1 
ATOM   5362  C  CB  . ASP C  1 170 ? -30.138  14.663  -11.824 1.00 26.64 ? 179 ASP C CB  1 
ATOM   5363  C  CG  . ASP C  1 170 ? -29.667  16.113  -11.835 1.00 34.34 ? 179 ASP C CG  1 
ATOM   5364  O  OD1 . ASP C  1 170 ? -28.479  16.377  -11.544 1.00 41.97 ? 179 ASP C OD1 1 
ATOM   5365  O  OD2 . ASP C  1 170 ? -30.504  17.027  -12.082 1.00 43.29 ? 179 ASP C OD2 1 
ATOM   5366  N  N   . ASN C  1 171 ? -26.713  13.399  -11.615 1.00 23.34 ? 180 ASN C N   1 
ATOM   5367  C  CA  . ASN C  1 171 ? -25.471  13.330  -12.393 1.00 22.45 ? 180 ASN C CA  1 
ATOM   5368  C  C   . ASN C  1 171 ? -25.189  14.585  -13.217 1.00 20.40 ? 180 ASN C C   1 
ATOM   5369  O  O   . ASN C  1 171 ? -24.553  14.502  -14.281 1.00 23.42 ? 180 ASN C O   1 
ATOM   5370  C  CB  . ASN C  1 171 ? -25.472  12.163  -13.360 1.00 25.28 ? 180 ASN C CB  1 
ATOM   5371  C  CG  . ASN C  1 171 ? -24.922  10.874  -12.812 1.00 29.49 ? 180 ASN C CG  1 
ATOM   5372  O  OD1 . ASN C  1 171 ? -24.216  10.790  -11.815 1.00 30.90 ? 180 ASN C OD1 1 
ATOM   5373  N  ND2 . ASN C  1 171 ? -25.318  9.805   -13.482 1.00 31.80 ? 180 ASN C ND2 1 
ATOM   5374  N  N   . THR C  1 172 ? -25.713  15.730  -12.818 1.00 18.94 ? 181 THR C N   1 
ATOM   5375  C  CA  . THR C  1 172 ? -25.286  16.979  -13.439 1.00 20.04 ? 181 THR C CA  1 
ATOM   5376  C  C   . THR C  1 172 ? -24.158  17.576  -12.627 1.00 18.84 ? 181 THR C C   1 
ATOM   5377  O  O   . THR C  1 172 ? -24.013  17.310  -11.437 1.00 19.42 ? 181 THR C O   1 
ATOM   5378  C  CB  . THR C  1 172 ? -26.412  18.017  -13.574 1.00 19.86 ? 181 THR C CB  1 
ATOM   5379  O  OG1 . THR C  1 172 ? -27.014  18.268  -12.309 1.00 18.66 ? 181 THR C OG1 1 
ATOM   5380  C  CG2 . THR C  1 172 ? -27.476  17.542  -14.575 1.00 20.34 ? 181 THR C CG2 1 
ATOM   5381  N  N   . TYR C  1 173 ? -23.376  18.428  -13.255 1.00 17.17 ? 182 TYR C N   1 
ATOM   5382  C  CA  . TYR C  1 173 ? -22.300  19.135  -12.525 1.00 15.34 ? 182 TYR C CA  1 
ATOM   5383  C  C   . TYR C  1 173 ? -22.190  20.552  -13.078 1.00 14.54 ? 182 TYR C C   1 
ATOM   5384  O  O   . TYR C  1 173 ? -22.569  20.847  -14.184 1.00 13.53 ? 182 TYR C O   1 
ATOM   5385  C  CB  . TYR C  1 173 ? -20.962  18.397  -12.679 1.00 13.39 ? 182 TYR C CB  1 
ATOM   5386  C  CG  . TYR C  1 173 ? -20.356  18.664  -14.015 1.00 13.06 ? 182 TYR C CG  1 
ATOM   5387  C  CD1 . TYR C  1 173 ? -20.798  17.973  -15.148 1.00 12.47 ? 182 TYR C CD1 1 
ATOM   5388  C  CD2 . TYR C  1 173 ? -19.375  19.650  -14.186 1.00 12.24 ? 182 TYR C CD2 1 
ATOM   5389  C  CE1 . TYR C  1 173 ? -20.295  18.270  -16.400 1.00 12.85 ? 182 TYR C CE1 1 
ATOM   5390  C  CE2 . TYR C  1 173 ? -18.885  19.945  -15.445 1.00 12.61 ? 182 TYR C CE2 1 
ATOM   5391  C  CZ  . TYR C  1 173 ? -19.331  19.240  -16.543 1.00 12.12 ? 182 TYR C CZ  1 
ATOM   5392  O  OH  . TYR C  1 173 ? -18.864  19.513  -17.819 1.00 13.76 ? 182 TYR C OH  1 
ATOM   5393  N  N   . GLU C  1 174 ? -21.596  21.392  -12.285 1.00 15.97 ? 183 GLU C N   1 
ATOM   5394  C  CA  . GLU C  1 174 ? -21.296  22.737  -12.684 1.00 16.82 ? 183 GLU C CA  1 
ATOM   5395  C  C   . GLU C  1 174 ? -19.942  23.122  -12.105 1.00 15.52 ? 183 GLU C C   1 
ATOM   5396  O  O   . GLU C  1 174 ? -19.585  22.754  -10.960 1.00 15.48 ? 183 GLU C O   1 
ATOM   5397  C  CB  . GLU C  1 174 ? -22.381  23.645  -12.141 1.00 18.68 ? 183 GLU C CB  1 
ATOM   5398  C  CG  . GLU C  1 174 ? -22.297  25.074  -12.547 1.00 21.68 ? 183 GLU C CG  1 
ATOM   5399  C  CD  . GLU C  1 174 ? -23.540  25.873  -12.113 1.00 26.29 ? 183 GLU C CD  1 
ATOM   5400  O  OE1 . GLU C  1 174 ? -24.631  25.305  -11.891 1.00 27.68 ? 183 GLU C OE1 1 
ATOM   5401  O  OE2 . GLU C  1 174 ? -23.434  27.114  -12.042 1.00 34.54 ? 183 GLU C OE2 1 
ATOM   5402  N  N   . VAL C  1 175 ? -19.158  23.822  -12.893 1.00 13.79 ? 184 VAL C N   1 
ATOM   5403  C  CA  . VAL C  1 175 ? -17.897  24.400  -12.411 1.00 13.21 ? 184 VAL C CA  1 
ATOM   5404  C  C   . VAL C  1 175 ? -18.005  25.916  -12.462 1.00 12.83 ? 184 VAL C C   1 
ATOM   5405  O  O   . VAL C  1 175 ? -18.348  26.501  -13.495 1.00 13.56 ? 184 VAL C O   1 
ATOM   5406  C  CB  . VAL C  1 175 ? -16.667  23.921  -13.227 1.00 13.51 ? 184 VAL C CB  1 
ATOM   5407  C  CG1 . VAL C  1 175 ? -15.366  24.588  -12.764 1.00 13.41 ? 184 VAL C CG1 1 
ATOM   5408  C  CG2 . VAL C  1 175 ? -16.505  22.428  -13.107 1.00 14.16 ? 184 VAL C CG2 1 
ATOM   5409  N  N   . LYS C  1 176 ? -17.630  26.539  -11.361 1.00 13.23 ? 185 LYS C N   1 
ATOM   5410  C  CA  . LYS C  1 176 ? -17.498  27.988  -11.254 1.00 14.53 ? 185 LYS C CA  1 
ATOM   5411  C  C   . LYS C  1 176 ? -16.088  28.504  -10.904 1.00 13.95 ? 185 LYS C C   1 
ATOM   5412  O  O   . LYS C  1 176 ? -15.370  27.913  -10.140 1.00 14.08 ? 185 LYS C O   1 
ATOM   5413  C  CB  . LYS C  1 176 ? -18.392  28.497  -10.157 1.00 15.98 ? 185 LYS C CB  1 
ATOM   5414  C  CG  . LYS C  1 176 ? -19.847  28.203  -10.395 1.00 17.31 ? 185 LYS C CG  1 
ATOM   5415  C  CD  . LYS C  1 176 ? -20.627  28.534  -9.145  1.00 18.86 ? 185 LYS C CD  1 
ATOM   5416  C  CE  . LYS C  1 176 ? -21.909  29.221  -9.486  1.00 21.64 ? 185 LYS C CE  1 
ATOM   5417  N  NZ  . LYS C  1 176 ? -22.974  29.181  -8.422  1.00 23.50 ? 185 LYS C NZ  1 
ATOM   5418  N  N   . ILE C  1 177 ? -15.738  29.631  -11.510 1.00 13.74 ? 186 ILE C N   1 
ATOM   5419  C  CA  . ILE C  1 177 ? -14.565  30.388  -11.176 1.00 12.88 ? 186 ILE C CA  1 
ATOM   5420  C  C   . ILE C  1 177 ? -15.032  31.791  -10.782 1.00 12.81 ? 186 ILE C C   1 
ATOM   5421  O  O   . ILE C  1 177 ? -15.829  32.421  -11.493 1.00 11.43 ? 186 ILE C O   1 
ATOM   5422  C  CB  . ILE C  1 177 ? -13.563  30.457  -12.319 1.00 12.85 ? 186 ILE C CB  1 
ATOM   5423  C  CG1 . ILE C  1 177 ? -13.135  29.043  -12.672 1.00 12.29 ? 186 ILE C CG1 1 
ATOM   5424  C  CG2 . ILE C  1 177 ? -12.333  31.230  -11.859 1.00 13.79 ? 186 ILE C CG2 1 
ATOM   5425  C  CD1 . ILE C  1 177 ? -12.250  28.907  -13.878 1.00 12.47 ? 186 ILE C CD1 1 
ATOM   5426  N  N   . ASP C  1 178 ? -14.545  32.252  -9.633  1.00 12.09 ? 187 ASP C N   1 
ATOM   5427  C  CA  . ASP C  1 178 ? -14.927  33.575  -9.108  1.00 13.64 ? 187 ASP C CA  1 
ATOM   5428  C  C   . ASP C  1 178 ? -16.430  33.755  -9.053  1.00 14.08 ? 187 ASP C C   1 
ATOM   5429  O  O   . ASP C  1 178 ? -16.947  34.769  -9.438  1.00 13.52 ? 187 ASP C O   1 
ATOM   5430  C  CB  . ASP C  1 178 ? -14.225  34.711  -9.926  1.00 13.84 ? 187 ASP C CB  1 
ATOM   5431  C  CG  . ASP C  1 178 ? -12.708  34.691  -9.739  1.00 13.59 ? 187 ASP C CG  1 
ATOM   5432  O  OD1 . ASP C  1 178 ? -12.250  33.997  -8.809  1.00 13.97 ? 187 ASP C OD1 1 
ATOM   5433  O  OD2 . ASP C  1 178 ? -11.970  35.284  -10.548 1.00 14.37 ? 187 ASP C OD2 1 
ATOM   5434  N  N   . ASN C  1 179 ? -17.096  32.700  -8.572  1.00 15.53 ? 188 ASN C N   1 
ATOM   5435  C  CA  . ASN C  1 179 ? -18.538  32.627  -8.338  1.00 15.83 ? 188 ASN C CA  1 
ATOM   5436  C  C   . ASN C  1 179 ? -19.362  32.795  -9.595  1.00 16.62 ? 188 ASN C C   1 
ATOM   5437  O  O   . ASN C  1 179 ? -20.478  33.258  -9.551  1.00 16.68 ? 188 ASN C O   1 
ATOM   5438  C  CB  . ASN C  1 179 ? -18.991  33.621  -7.283  1.00 15.67 ? 188 ASN C CB  1 
ATOM   5439  C  CG  . ASN C  1 179 ? -19.468  32.958  -6.002  1.00 16.24 ? 188 ASN C CG  1 
ATOM   5440  O  OD1 . ASN C  1 179 ? -19.752  31.754  -5.965  1.00 16.80 ? 188 ASN C OD1 1 
ATOM   5441  N  ND2 . ASN C  1 179 ? -19.545  33.748  -4.923  1.00 14.92 ? 188 ASN C ND2 1 
ATOM   5442  N  N   . SER C  1 180 ? -18.815  32.415  -10.725 1.00 16.01 ? 189 SER C N   1 
ATOM   5443  C  CA  . SER C  1 180 ? -19.539  32.580  -11.950 1.00 16.19 ? 189 SER C CA  1 
ATOM   5444  C  C   . SER C  1 180 ? -19.277  31.346  -12.808 1.00 16.67 ? 189 SER C C   1 
ATOM   5445  O  O   . SER C  1 180 ? -18.124  30.898  -12.924 1.00 15.56 ? 189 SER C O   1 
ATOM   5446  C  CB  . SER C  1 180 ? -19.079  33.849  -12.622 1.00 17.81 ? 189 SER C CB  1 
ATOM   5447  O  OG  . SER C  1 180 ? -19.485  33.858  -13.963 1.00 21.26 ? 189 SER C OG  1 
ATOM   5448  N  N   . GLN C  1 181 ? -20.360  30.778  -13.346 1.00 16.10 ? 190 GLN C N   1 
ATOM   5449  C  CA  . GLN C  1 181 ? -20.301  29.513  -14.053 1.00 16.79 ? 190 GLN C CA  1 
ATOM   5450  C  C   . GLN C  1 181 ? -19.372  29.577  -15.233 1.00 16.10 ? 190 GLN C C   1 
ATOM   5451  O  O   . GLN C  1 181 ? -19.444  30.531  -16.008 1.00 17.43 ? 190 GLN C O   1 
ATOM   5452  C  CB  . GLN C  1 181 ? -21.687  29.113  -14.577 1.00 18.70 ? 190 GLN C CB  1 
ATOM   5453  C  CG  . GLN C  1 181 ? -21.686  27.816  -15.381 1.00 20.12 ? 190 GLN C CG  1 
ATOM   5454  C  CD  . GLN C  1 181 ? -23.060  27.357  -15.828 1.00 22.99 ? 190 GLN C CD  1 
ATOM   5455  O  OE1 . GLN C  1 181 ? -23.237  27.015  -16.979 1.00 27.71 ? 190 GLN C OE1 1 
ATOM   5456  N  NE2 . GLN C  1 181 ? -24.025  27.334  -14.931 1.00 24.41 ? 190 GLN C NE2 1 
ATOM   5457  N  N   . VAL C  1 182 ? -18.529  28.568  -15.409 1.00 15.02 ? 191 VAL C N   1 
ATOM   5458  C  CA  . VAL C  1 182 ? -17.652  28.494  -16.621 1.00 14.81 ? 191 VAL C CA  1 
ATOM   5459  C  C   . VAL C  1 182 ? -17.838  27.199  -17.366 1.00 15.78 ? 191 VAL C C   1 
ATOM   5460  O  O   . VAL C  1 182 ? -17.474  27.091  -18.512 1.00 16.89 ? 191 VAL C O   1 
ATOM   5461  C  CB  . VAL C  1 182 ? -16.159  28.631  -16.292 1.00 14.82 ? 191 VAL C CB  1 
ATOM   5462  C  CG1 . VAL C  1 182 ? -15.851  30.026  -15.735 1.00 13.83 ? 191 VAL C CG1 1 
ATOM   5463  C  CG2 . VAL C  1 182 ? -15.740  27.564  -15.274 1.00 15.12 ? 191 VAL C CG2 1 
ATOM   5464  N  N   . GLU C  1 183 ? -18.454  26.212  -16.726 1.00 17.42 ? 192 GLU C N   1 
ATOM   5465  C  CA  . GLU C  1 183 ? -18.724  24.930  -17.389 1.00 18.43 ? 192 GLU C CA  1 
ATOM   5466  C  C   . GLU C  1 183 ? -19.847  24.131  -16.706 1.00 17.60 ? 192 GLU C C   1 
ATOM   5467  O  O   . GLU C  1 183 ? -20.139  24.291  -15.505 1.00 15.61 ? 192 GLU C O   1 
ATOM   5468  C  CB  . GLU C  1 183 ? -17.496  24.075  -17.414 1.00 21.67 ? 192 GLU C CB  1 
ATOM   5469  C  CG  . GLU C  1 183 ? -17.461  22.967  -18.472 1.00 24.50 ? 192 GLU C CG  1 
ATOM   5470  C  CD  . GLU C  1 183 ? -18.070  23.302  -19.840 1.00 29.61 ? 192 GLU C CD  1 
ATOM   5471  O  OE1 . GLU C  1 183 ? -19.265  22.971  -20.118 1.00 30.50 ? 192 GLU C OE1 1 
ATOM   5472  O  OE2 . GLU C  1 183 ? -17.299  23.752  -20.703 1.00 34.36 ? 192 GLU C OE2 1 
ATOM   5473  N  N   . SER C  1 184 ? -20.551  23.359  -17.519 1.00 16.88 ? 193 SER C N   1 
ATOM   5474  C  CA  . SER C  1 184 ? -21.708  22.637  -17.052 1.00 16.63 ? 193 SER C CA  1 
ATOM   5475  C  C   . SER C  1 184 ? -22.072  21.449  -17.889 1.00 14.81 ? 193 SER C C   1 
ATOM   5476  O  O   . SER C  1 184 ? -21.811  21.466  -19.064 1.00 13.24 ? 193 SER C O   1 
ATOM   5477  C  CB  . SER C  1 184 ? -22.827  23.651  -17.375 1.00 17.04 ? 193 SER C CB  1 
ATOM   5478  O  OG  . SER C  1 184 ? -23.932  23.425  -16.644 1.00 18.78 ? 193 SER C OG  1 
ATOM   5479  N  N   . GLY C  1 185 ? -22.735  20.462  -17.312 1.00 14.81 ? 194 GLY C N   1 
ATOM   5480  C  CA  . GLY C  1 185 ? -23.247  19.356  -18.120 1.00 15.45 ? 194 GLY C CA  1 
ATOM   5481  C  C   . GLY C  1 185 ? -23.564  18.133  -17.272 1.00 16.44 ? 194 GLY C C   1 
ATOM   5482  O  O   . GLY C  1 185 ? -23.905  18.259  -16.107 1.00 15.64 ? 194 GLY C O   1 
ATOM   5483  N  N   . SER C  1 186 ? -23.501  16.968  -17.904 1.00 16.83 ? 195 SER C N   1 
ATOM   5484  C  CA  . SER C  1 186 ? -23.777  15.716  -17.258 1.00 18.92 ? 195 SER C CA  1 
ATOM   5485  C  C   . SER C  1 186 ? -22.548  14.848  -17.273 1.00 18.63 ? 195 SER C C   1 
ATOM   5486  O  O   . SER C  1 186 ? -21.819  14.805  -18.260 1.00 20.94 ? 195 SER C O   1 
ATOM   5487  C  CB  . SER C  1 186 ? -24.948  14.974  -17.935 1.00 18.48 ? 195 SER C CB  1 
ATOM   5488  O  OG  . SER C  1 186 ? -26.126  15.718  -17.754 1.00 19.90 ? 195 SER C OG  1 
ATOM   5489  N  N   . LEU C  1 187 ? -22.398  14.092  -16.208 1.00 19.17 ? 196 LEU C N   1 
ATOM   5490  C  CA  . LEU C  1 187 ? -21.303  13.136  -16.076 1.00 21.75 ? 196 LEU C CA  1 
ATOM   5491  C  C   . LEU C  1 187 ? -21.250  12.144  -17.228 1.00 24.62 ? 196 LEU C C   1 
ATOM   5492  O  O   . LEU C  1 187 ? -20.182  11.888  -17.741 1.00 27.56 ? 196 LEU C O   1 
ATOM   5493  C  CB  . LEU C  1 187 ? -21.399  12.387  -14.767 1.00 21.67 ? 196 LEU C CB  1 
ATOM   5494  C  CG  . LEU C  1 187 ? -20.760  13.088  -13.528 1.00 23.60 ? 196 LEU C CG  1 
ATOM   5495  C  CD1 . LEU C  1 187 ? -21.541  14.299  -13.139 1.00 25.18 ? 196 LEU C CD1 1 
ATOM   5496  C  CD2 . LEU C  1 187 ? -20.594  12.264  -12.265 1.00 24.34 ? 196 LEU C CD2 1 
ATOM   5497  N  N   . GLU C  1 188 ? -22.401  11.645  -17.672 1.00 26.13 ? 197 GLU C N   1 
ATOM   5498  C  CA  . GLU C  1 188 ? -22.414  10.596  -18.667 1.00 27.79 ? 197 GLU C CA  1 
ATOM   5499  C  C   . GLU C  1 188 ? -21.887  11.155  -19.987 1.00 26.55 ? 197 GLU C C   1 
ATOM   5500  O  O   . GLU C  1 188 ? -21.278  10.418  -20.767 1.00 23.37 ? 197 GLU C O   1 
ATOM   5501  C  CB  . GLU C  1 188 ? -23.786  9.824   -18.732 1.00 32.87 ? 197 GLU C CB  1 
ATOM   5502  C  CG  . GLU C  1 188 ? -25.071  10.584  -19.107 1.00 38.93 ? 197 GLU C CG  1 
ATOM   5503  C  CD  . GLU C  1 188 ? -25.757  11.270  -17.885 1.00 44.81 ? 197 GLU C CD  1 
ATOM   5504  O  OE1 . GLU C  1 188 ? -25.001  11.772  -17.059 1.00 45.75 ? 197 GLU C OE1 1 
ATOM   5505  O  OE2 . GLU C  1 188 ? -27.022  11.362  -17.710 1.00 45.05 ? 197 GLU C OE2 1 
ATOM   5506  N  N   . ASP C  1 189 ? -22.072  12.452  -20.248 1.00 26.27 ? 198 ASP C N   1 
ATOM   5507  C  CA  . ASP C  1 189 ? -21.632  13.028  -21.552 1.00 25.05 ? 198 ASP C CA  1 
ATOM   5508  C  C   . ASP C  1 189 ? -20.208  13.525  -21.497 1.00 24.59 ? 198 ASP C C   1 
ATOM   5509  O  O   . ASP C  1 189 ? -19.499  13.481  -22.475 1.00 22.51 ? 198 ASP C O   1 
ATOM   5510  C  CB  . ASP C  1 189 ? -22.548  14.186  -22.008 1.00 25.24 ? 198 ASP C CB  1 
ATOM   5511  C  CG  . ASP C  1 189 ? -24.056  13.818  -21.977 1.00 28.49 ? 198 ASP C CG  1 
ATOM   5512  O  OD1 . ASP C  1 189 ? -24.442  12.771  -22.525 1.00 34.30 ? 198 ASP C OD1 1 
ATOM   5513  O  OD2 . ASP C  1 189 ? -24.888  14.611  -21.458 1.00 29.84 ? 198 ASP C OD2 1 
ATOM   5514  N  N   . ASP C  1 190 ? -19.814  14.102  -20.367 1.00 24.87 ? 199 ASP C N   1 
ATOM   5515  C  CA  . ASP C  1 190 ? -18.580  14.893  -20.344 1.00 25.75 ? 199 ASP C CA  1 
ATOM   5516  C  C   . ASP C  1 190 ? -17.349  14.078  -19.883 1.00 26.75 ? 199 ASP C C   1 
ATOM   5517  O  O   . ASP C  1 190 ? -16.239  14.590  -19.796 1.00 23.53 ? 199 ASP C O   1 
ATOM   5518  C  CB  . ASP C  1 190 ? -18.799  16.165  -19.521 1.00 25.96 ? 199 ASP C CB  1 
ATOM   5519  C  CG  . ASP C  1 190 ? -19.746  17.169  -20.221 1.00 25.58 ? 199 ASP C CG  1 
ATOM   5520  O  OD1 . ASP C  1 190 ? -20.081  16.943  -21.392 1.00 22.78 ? 199 ASP C OD1 1 
ATOM   5521  O  OD2 . ASP C  1 190 ? -20.103  18.197  -19.594 1.00 23.58 ? 199 ASP C OD2 1 
ATOM   5522  N  N   . TRP C  1 191 ? -17.595  12.821  -19.535 1.00 29.07 ? 200 TRP C N   1 
ATOM   5523  C  CA  . TRP C  1 191 ? -16.534  11.837  -19.237 1.00 30.22 ? 200 TRP C CA  1 
ATOM   5524  C  C   . TRP C  1 191 ? -16.843  10.553  -19.984 1.00 30.45 ? 200 TRP C C   1 
ATOM   5525  O  O   . TRP C  1 191 ? -18.015  10.215  -20.146 1.00 28.54 ? 200 TRP C O   1 
ATOM   5526  C  CB  . TRP C  1 191 ? -16.480  11.503  -17.730 1.00 28.64 ? 200 TRP C CB  1 
ATOM   5527  C  CG  . TRP C  1 191 ? -15.973  12.607  -16.795 1.00 28.85 ? 200 TRP C CG  1 
ATOM   5528  C  CD1 . TRP C  1 191 ? -14.739  12.687  -16.214 1.00 26.38 ? 200 TRP C CD1 1 
ATOM   5529  C  CD2 . TRP C  1 191 ? -16.710  13.741  -16.318 1.00 28.85 ? 200 TRP C CD2 1 
ATOM   5530  N  NE1 . TRP C  1 191 ? -14.669  13.790  -15.405 1.00 27.95 ? 200 TRP C NE1 1 
ATOM   5531  C  CE2 . TRP C  1 191 ? -15.864  14.458  -15.450 1.00 28.15 ? 200 TRP C CE2 1 
ATOM   5532  C  CE3 . TRP C  1 191 ? -18.000  14.224  -16.542 1.00 29.17 ? 200 TRP C CE3 1 
ATOM   5533  C  CZ2 . TRP C  1 191 ? -16.267  15.643  -14.813 1.00 27.06 ? 200 TRP C CZ2 1 
ATOM   5534  C  CZ3 . TRP C  1 191 ? -18.407  15.401  -15.890 1.00 27.25 ? 200 TRP C CZ3 1 
ATOM   5535  C  CH2 . TRP C  1 191 ? -17.539  16.093  -15.037 1.00 26.08 ? 200 TRP C CH2 1 
ATOM   5536  N  N   . ASP C  1 192 ? -15.796  9.808   -20.326 1.00 30.80 ? 201 ASP C N   1 
ATOM   5537  C  CA  . ASP C  1 192 ? -15.932  8.445   -20.844 1.00 34.16 ? 201 ASP C CA  1 
ATOM   5538  C  C   . ASP C  1 192 ? -15.943  7.408   -19.732 1.00 31.83 ? 201 ASP C C   1 
ATOM   5539  O  O   . ASP C  1 192 ? -14.970  6.723   -19.528 1.00 33.55 ? 201 ASP C O   1 
ATOM   5540  C  CB  . ASP C  1 192 ? -14.758  8.087   -21.763 1.00 37.53 ? 201 ASP C CB  1 
ATOM   5541  C  CG  . ASP C  1 192 ? -14.676  8.971   -22.984 1.00 43.13 ? 201 ASP C CG  1 
ATOM   5542  O  OD1 . ASP C  1 192 ? -15.683  9.638   -23.338 1.00 43.61 ? 201 ASP C OD1 1 
ATOM   5543  O  OD2 . ASP C  1 192 ? -13.580  9.020   -23.584 1.00 50.57 ? 201 ASP C OD2 1 
ATOM   5544  N  N   . PHE C  1 193 ? -17.025  7.290   -18.996 1.00 31.01 ? 202 PHE C N   1 
ATOM   5545  C  CA  . PHE C  1 193 ? -17.123  6.245   -17.986 1.00 31.61 ? 202 PHE C CA  1 
ATOM   5546  C  C   . PHE C  1 193 ? -17.439  4.884   -18.647 1.00 35.26 ? 202 PHE C C   1 
ATOM   5547  O  O   . PHE C  1 193 ? -16.888  3.838   -18.274 1.00 33.88 ? 202 PHE C O   1 
ATOM   5548  C  CB  . PHE C  1 193 ? -18.234  6.593   -17.015 1.00 30.99 ? 202 PHE C CB  1 
ATOM   5549  C  CG  . PHE C  1 193 ? -17.931  7.784   -16.172 1.00 30.64 ? 202 PHE C CG  1 
ATOM   5550  C  CD1 . PHE C  1 193 ? -16.927  7.738   -15.226 1.00 28.29 ? 202 PHE C CD1 1 
ATOM   5551  C  CD2 . PHE C  1 193 ? -18.650  8.962   -16.338 1.00 30.06 ? 202 PHE C CD2 1 
ATOM   5552  C  CE1 . PHE C  1 193 ? -16.653  8.838   -14.440 1.00 29.25 ? 202 PHE C CE1 1 
ATOM   5553  C  CE2 . PHE C  1 193 ? -18.381  10.063  -15.554 1.00 31.67 ? 202 PHE C CE2 1 
ATOM   5554  C  CZ  . PHE C  1 193 ? -17.369  10.008  -14.601 1.00 30.22 ? 202 PHE C CZ  1 
ATOM   5555  N  N   . LEU C  1 194 ? -18.367  4.942   -19.606 1.00 37.25 ? 203 LEU C N   1 
ATOM   5556  C  CA  . LEU C  1 194 ? -19.026  3.811   -20.230 1.00 39.33 ? 203 LEU C CA  1 
ATOM   5557  C  C   . LEU C  1 194 ? -19.307  4.083   -21.701 1.00 38.61 ? 203 LEU C C   1 
ATOM   5558  O  O   . LEU C  1 194 ? -19.448  5.225   -22.106 1.00 41.50 ? 203 LEU C O   1 
ATOM   5559  C  CB  . LEU C  1 194 ? -20.384  3.615   -19.566 1.00 37.51 ? 203 LEU C CB  1 
ATOM   5560  C  CG  . LEU C  1 194 ? -20.372  3.205   -18.115 1.00 39.29 ? 203 LEU C CG  1 
ATOM   5561  C  CD1 . LEU C  1 194 ? -21.778  3.298   -17.568 1.00 41.46 ? 203 LEU C CD1 1 
ATOM   5562  C  CD2 . LEU C  1 194 ? -19.803  1.809   -17.892 1.00 39.16 ? 203 LEU C CD2 1 
ATOM   5563  N  N   . PRO C  1 195 ? -19.430  3.021   -22.498 1.00 39.78 ? 204 PRO C N   1 
ATOM   5564  C  CA  . PRO C  1 195 ? -19.728  3.144   -23.927 1.00 41.44 ? 204 PRO C CA  1 
ATOM   5565  C  C   . PRO C  1 195 ? -21.066  3.784   -24.231 1.00 42.89 ? 204 PRO C C   1 
ATOM   5566  O  O   . PRO C  1 195 ? -21.199  4.431   -25.253 1.00 49.48 ? 204 PRO C O   1 
ATOM   5567  C  CB  . PRO C  1 195 ? -19.753  1.694   -24.427 1.00 41.31 ? 204 PRO C CB  1 
ATOM   5568  C  CG  . PRO C  1 195 ? -19.705  0.843   -23.229 1.00 38.73 ? 204 PRO C CG  1 
ATOM   5569  C  CD  . PRO C  1 195 ? -19.152  1.633   -22.105 1.00 38.51 ? 204 PRO C CD  1 
ATOM   5570  N  N   . GLY C  1 196 ? -22.067  3.596   -23.391 1.00 39.24 ? 205 GLY C N   1 
ATOM   5571  C  CA  . GLY C  1 196 ? -23.340  4.190   -23.694 1.00 38.13 ? 205 GLY C CA  1 
ATOM   5572  C  C   . GLY C  1 196 ? -23.942  4.576   -22.399 1.00 43.51 ? 205 GLY C C   1 
ATOM   5573  O  O   . GLY C  1 196 ? -23.360  4.296   -21.319 1.00 49.03 ? 205 GLY C O   1 
ATOM   5574  N  N   . SER C  1 197 ? -25.103  5.204   -22.488 1.00 43.33 ? 206 SER C N   1 
ATOM   5575  C  CA  . SER C  1 197 ? -25.783  5.719   -21.324 1.00 51.56 ? 206 SER C CA  1 
ATOM   5576  C  C   . SER C  1 197 ? -26.220  4.578   -20.421 1.00 54.42 ? 206 SER C C   1 
ATOM   5577  O  O   . SER C  1 197 ? -26.571  3.455   -20.868 1.00 47.88 ? 206 SER C O   1 
ATOM   5578  C  CB  . SER C  1 197 ? -27.006  6.568   -21.689 1.00 51.71 ? 206 SER C CB  1 
ATOM   5579  O  OG  . SER C  1 197 ? -28.173  5.986   -21.114 1.00 54.99 ? 206 SER C OG  1 
ATOM   5580  N  N   . GLY C  1 198 ? -26.205  4.917   -19.140 1.00 54.47 ? 207 GLY C N   1 
ATOM   5581  C  CA  . GLY C  1 198 ? -26.553  4.020   -18.093 1.00 54.23 ? 207 GLY C CA  1 
ATOM   5582  C  C   . GLY C  1 198 ? -25.250  4.021   -17.325 1.00 60.32 ? 207 GLY C C   1 
ATOM   5583  O  O   . GLY C  1 198 ? -24.748  5.099   -16.921 1.00 54.16 ? 207 GLY C O   1 
ATOM   5584  N  N   . ASP C  1 199 ? -25.727  4.023   -15.853 1.00 41.32 ? 302 ASP C N   1 
ATOM   5585  C  CA  . ASP C  1 199 ? -25.303  4.078   -14.458 1.00 41.11 ? 302 ASP C CA  1 
ATOM   5586  C  C   . ASP C  1 199 ? -25.603  5.449   -13.871 1.00 37.85 ? 302 ASP C C   1 
ATOM   5587  O  O   . ASP C  1 199 ? -24.801  6.410   -13.936 1.00 34.24 ? 302 ASP C O   1 
ATOM   5588  C  CB  . ASP C  1 199 ? -23.839  3.675   -14.207 1.00 38.78 ? 302 ASP C CB  1 
ATOM   5589  C  CG  . ASP C  1 199 ? -23.552  3.400   -12.728 1.00 39.41 ? 302 ASP C CG  1 
ATOM   5590  O  OD1 . ASP C  1 199 ? -24.468  3.587   -11.865 1.00 37.06 ? 302 ASP C OD1 1 
ATOM   5591  O  OD2 . ASP C  1 199 ? -22.400  2.963   -12.445 1.00 37.87 ? 302 ASP C OD2 1 
ATOM   5592  N  N   . PRO C  1 200 ? -26.768  5.547   -13.262 1.00 36.99 ? 303 PRO C N   1 
ATOM   5593  C  CA  . PRO C  1 200 ? -27.138  6.837   -12.698 1.00 36.47 ? 303 PRO C CA  1 
ATOM   5594  C  C   . PRO C  1 200 ? -26.397  7.168   -11.380 1.00 33.48 ? 303 PRO C C   1 
ATOM   5595  O  O   . PRO C  1 200 ? -26.526  8.286   -10.903 1.00 31.92 ? 303 PRO C O   1 
ATOM   5596  C  CB  . PRO C  1 200 ? -28.636  6.677   -12.455 1.00 37.06 ? 303 PRO C CB  1 
ATOM   5597  C  CG  . PRO C  1 200 ? -28.822  5.196   -12.203 1.00 37.86 ? 303 PRO C CG  1 
ATOM   5598  C  CD  . PRO C  1 200 ? -27.643  4.460   -12.802 1.00 34.79 ? 303 PRO C CD  1 
ATOM   5599  N  N   . SER C  1 201 ? -25.693  6.206   -10.785 1.00 31.88 ? 304 SER C N   1 
ATOM   5600  C  CA  A SER C  1 201 ? -24.969  6.399   -9.510  0.50 30.74 ? 304 SER C CA  1 
ATOM   5601  C  CA  B SER C  1 201 ? -24.956  6.451   -9.512  0.50 32.08 ? 304 SER C CA  1 
ATOM   5602  C  C   . SER C  1 201 ? -23.471  6.855   -9.620  1.00 29.20 ? 304 SER C C   1 
ATOM   5603  O  O   . SER C  1 201 ? -22.762  6.884   -8.638  1.00 29.39 ? 304 SER C O   1 
ATOM   5604  C  CB  A SER C  1 201 ? -25.054  5.081   -8.718  0.50 29.64 ? 304 SER C CB  1 
ATOM   5605  C  CB  B SER C  1 201 ? -25.043  5.252   -8.608  0.50 32.33 ? 304 SER C CB  1 
ATOM   5606  O  OG  A SER C  1 201 ? -24.045  4.147   -9.133  0.50 26.70 ? 304 SER C OG  1 
ATOM   5607  O  OG  B SER C  1 201 ? -26.408  5.008   -8.363  0.50 32.63 ? 304 SER C OG  1 
ATOM   5608  N  N   . ILE C  1 202 ? -23.003  7.186   -10.810 1.00 29.30 ? 305 ILE C N   1 
ATOM   5609  C  CA  . ILE C  1 202 ? -21.593  7.567   -11.026 1.00 30.49 ? 305 ILE C CA  1 
ATOM   5610  C  C   . ILE C  1 202 ? -21.123  8.719   -10.133 1.00 29.71 ? 305 ILE C C   1 
ATOM   5611  O  O   . ILE C  1 202 ? -20.050  8.686   -9.582  1.00 32.26 ? 305 ILE C O   1 
ATOM   5612  C  CB  . ILE C  1 202 ? -21.341  7.962   -12.481 1.00 35.27 ? 305 ILE C CB  1 
ATOM   5613  C  CG1 . ILE C  1 202 ? -21.608  6.720   -13.354 1.00 36.21 ? 305 ILE C CG1 1 
ATOM   5614  C  CG2 . ILE C  1 202 ? -19.896  8.414   -12.693 1.00 35.29 ? 305 ILE C CG2 1 
ATOM   5615  C  CD1 . ILE C  1 202 ? -21.453  6.831   -14.852 1.00 37.07 ? 305 ILE C CD1 1 
ATOM   5616  N  N   . TYR C  1 203 ? -21.990  9.685   -9.914  1.00 27.03 ? 306 TYR C N   1 
ATOM   5617  C  CA  . TYR C  1 203 ? -21.699  10.824  -9.073  1.00 24.65 ? 306 TYR C CA  1 
ATOM   5618  C  C   . TYR C  1 203 ? -21.406  10.459  -7.597  1.00 23.23 ? 306 TYR C C   1 
ATOM   5619  O  O   . TYR C  1 203 ? -20.861  11.306  -6.855  1.00 23.74 ? 306 TYR C O   1 
ATOM   5620  C  CB  . TYR C  1 203 ? -22.894  11.807  -9.088  1.00 23.81 ? 306 TYR C CB  1 
ATOM   5621  C  CG  . TYR C  1 203 ? -24.010  11.408  -8.161  1.00 22.98 ? 306 TYR C CG  1 
ATOM   5622  C  CD1 . TYR C  1 203 ? -24.995  10.472  -8.553  1.00 21.48 ? 306 TYR C CD1 1 
ATOM   5623  C  CD2 . TYR C  1 203 ? -24.065  11.928  -6.880  1.00 21.57 ? 306 TYR C CD2 1 
ATOM   5624  C  CE1 . TYR C  1 203 ? -25.993  10.072  -7.654  1.00 22.04 ? 306 TYR C CE1 1 
ATOM   5625  C  CE2 . TYR C  1 203 ? -25.047  11.544  -5.994  1.00 22.40 ? 306 TYR C CE2 1 
ATOM   5626  C  CZ  . TYR C  1 203 ? -26.014  10.619  -6.377  1.00 20.84 ? 306 TYR C CZ  1 
ATOM   5627  O  OH  . TYR C  1 203 ? -26.950  10.272  -5.431  1.00 21.25 ? 306 TYR C OH  1 
ATOM   5628  N  N   . ALA C  1 204 ? -21.816  9.276   -7.171  1.00 20.19 ? 307 ALA C N   1 
ATOM   5629  C  CA  . ALA C  1 204 ? -21.974  9.016   -5.728  1.00 23.90 ? 307 ALA C CA  1 
ATOM   5630  C  C   . ALA C  1 204 ? -20.819  8.211   -5.123  1.00 20.90 ? 307 ALA C C   1 
ATOM   5631  O  O   . ALA C  1 204 ? -20.290  7.325   -5.740  1.00 18.84 ? 307 ALA C O   1 
ATOM   5632  C  CB  . ALA C  1 204 ? -23.299  8.307   -5.438  1.00 23.95 ? 307 ALA C CB  1 
ATOM   5633  N  N   . TYR C  1 205 ? -20.446  8.575   -3.903  1.00 21.10 ? 308 TYR C N   1 
ATOM   5634  C  CA  . TYR C  1 205 ? -19.369  7.918   -3.172  1.00 21.32 ? 308 TYR C CA  1 
ATOM   5635  C  C   . TYR C  1 205 ? -19.913  7.581   -1.802  1.00 23.86 ? 308 TYR C C   1 
ATOM   5636  O  O   . TYR C  1 205 ? -20.548  8.413   -1.143  1.00 21.60 ? 308 TYR C O   1 
ATOM   5637  C  CB  . TYR C  1 205 ? -18.040  8.779   -3.098  1.00 19.13 ? 308 TYR C CB  1 
ATOM   5638  C  CG  . TYR C  1 205 ? -17.409  8.874   -4.462  1.00 17.82 ? 308 TYR C CG  1 
ATOM   5639  C  CD1 . TYR C  1 205 ? -16.609  7.847   -4.967  1.00 17.33 ? 308 TYR C CD1 1 
ATOM   5640  C  CD2 . TYR C  1 205 ? -17.734  9.922   -5.316  1.00 16.68 ? 308 TYR C CD2 1 
ATOM   5641  C  CE1 . TYR C  1 205 ? -16.102  7.895   -6.276  1.00 17.16 ? 308 TYR C CE1 1 
ATOM   5642  C  CE2 . TYR C  1 205 ? -17.213  9.987   -6.589  1.00 16.59 ? 308 TYR C CE2 1 
ATOM   5643  C  CZ  . TYR C  1 205 ? -16.426  8.971   -7.065  1.00 18.19 ? 308 TYR C CZ  1 
ATOM   5644  O  OH  . TYR C  1 205 ? -15.939  9.070   -8.351  1.00 22.82 ? 308 TYR C OH  1 
ATOM   5645  N  N   . ASP C  1 206 ? -19.542  6.394   -1.338  1.00 28.10 ? 309 ASP C N   1 
ATOM   5646  C  CA  . ASP C  1 206 ? -19.980  5.931   -0.046  1.00 33.19 ? 309 ASP C CA  1 
ATOM   5647  C  C   . ASP C  1 206 ? -19.449  6.788   1.070   1.00 33.03 ? 309 ASP C C   1 
ATOM   5648  O  O   . ASP C  1 206 ? -20.097  6.992   2.094   1.00 36.22 ? 309 ASP C O   1 
ATOM   5649  C  CB  . ASP C  1 206 ? -19.517  4.498   0.159   1.00 37.65 ? 309 ASP C CB  1 
ATOM   5650  C  CG  . ASP C  1 206 ? -20.286  3.528   -0.701  1.00 48.32 ? 309 ASP C CG  1 
ATOM   5651  O  OD1 . ASP C  1 206 ? -21.534  3.719   -0.838  1.00 54.94 ? 309 ASP C OD1 1 
ATOM   5652  O  OD2 . ASP C  1 206 ? -19.663  2.563   -1.232  1.00 58.12 ? 309 ASP C OD2 1 
ATOM   5653  N  N   . ASN C  1 207 ? -18.225  7.243   0.899   1.00 32.48 ? 310 ASN C N   1 
ATOM   5654  C  CA  . ASN C  1 207 ? -17.527  7.850   1.968   1.00 33.44 ? 310 ASN C CA  1 
ATOM   5655  C  C   . ASN C  1 207 ? -16.520  8.915   1.528   1.00 32.41 ? 310 ASN C C   1 
ATOM   5656  O  O   . ASN C  1 207 ? -15.635  8.689   0.663   1.00 32.77 ? 310 ASN C O   1 
ATOM   5657  C  CB  . ASN C  1 207 ? -16.905  6.707   2.784   1.00 37.69 ? 310 ASN C CB  1 
ATOM   5658  C  CG  . ASN C  1 207 ? -16.112  7.194   3.955   1.00 41.07 ? 310 ASN C CG  1 
ATOM   5659  O  OD1 . ASN C  1 207 ? -15.408  8.214   3.890   1.00 42.67 ? 310 ASN C OD1 1 
ATOM   5660  N  ND2 . ASN C  1 207 ? -16.237  6.478   5.063   1.00 47.47 ? 310 ASN C ND2 1 
ATOM   5661  N  N   . PHE C  1 208 ? -16.650  10.077  2.150   1.00 27.73 ? 311 PHE C N   1 
ATOM   5662  C  CA  . PHE C  1 208 ? -15.649  11.132  2.063   1.00 28.29 ? 311 PHE C CA  1 
ATOM   5663  C  C   . PHE C  1 208 ? -15.169  11.364  3.471   1.00 29.81 ? 311 PHE C C   1 
ATOM   5664  O  O   . PHE C  1 208 ? -15.995  11.565  4.358   1.00 26.22 ? 311 PHE C O   1 
ATOM   5665  C  CB  . PHE C  1 208 ? -16.256  12.429  1.541   1.00 26.18 ? 311 PHE C CB  1 
ATOM   5666  C  CG  . PHE C  1 208 ? -16.600  12.378  0.081   1.00 24.34 ? 311 PHE C CG  1 
ATOM   5667  C  CD1 . PHE C  1 208 ? -15.600  12.339  -0.878  1.00 24.05 ? 311 PHE C CD1 1 
ATOM   5668  C  CD2 . PHE C  1 208 ? -17.913  12.386  -0.322  1.00 24.13 ? 311 PHE C CD2 1 
ATOM   5669  C  CE1 . PHE C  1 208 ? -15.895  12.296  -2.224  1.00 24.58 ? 311 PHE C CE1 1 
ATOM   5670  C  CE2 . PHE C  1 208 ? -18.229  12.347  -1.675  1.00 25.42 ? 311 PHE C CE2 1 
ATOM   5671  C  CZ  . PHE C  1 208 ? -17.216  12.295  -2.629  1.00 26.39 ? 311 PHE C CZ  1 
ATOM   5672  N  N   . GLY C  1 209 ? -13.843  11.326  3.677   1.00 30.44 ? 312 GLY C N   1 
ATOM   5673  C  CA  . GLY C  1 209 ? -13.260  11.586  5.022   1.00 29.28 ? 312 GLY C CA  1 
ATOM   5674  C  C   . GLY C  1 209 ? -12.024  12.482  5.090   1.00 26.81 ? 312 GLY C C   1 
ATOM   5675  O  O   . GLY C  1 209 ? -11.726  13.041  6.144   1.00 26.13 ? 312 GLY C O   1 
ATOM   5676  N  N   . VAL C  1 210 ? -11.349  12.688  3.965   1.00 24.61 ? 313 VAL C N   1 
ATOM   5677  C  CA  . VAL C  1 210 ? -10.185  13.547  3.946   1.00 24.38 ? 313 VAL C CA  1 
ATOM   5678  C  C   . VAL C  1 210 ? -10.103  14.383  2.672   1.00 22.94 ? 313 VAL C C   1 
ATOM   5679  O  O   . VAL C  1 210 ? -10.381  13.922  1.555   1.00 21.94 ? 313 VAL C O   1 
ATOM   5680  C  CB  . VAL C  1 210 ? -8.921   12.720  4.276   1.00 27.70 ? 313 VAL C CB  1 
ATOM   5681  C  CG1 . VAL C  1 210 ? -8.896   11.625  3.283   1.00 33.27 ? 313 VAL C CG1 1 
ATOM   5682  C  CG2 . VAL C  1 210 ? -7.547   13.445  4.251   1.00 28.64 ? 313 VAL C CG2 1 
ATOM   5683  N  N   . LEU C  1 211 ? -9.724   15.639  2.867   1.00 22.87 ? 314 LEU C N   1 
ATOM   5684  C  CA  . LEU C  1 211 ? -9.311   16.539  1.787   1.00 21.68 ? 314 LEU C CA  1 
ATOM   5685  C  C   . LEU C  1 211 ? -7.792   16.694  1.776   1.00 20.92 ? 314 LEU C C   1 
ATOM   5686  O  O   . LEU C  1 211 ? -7.181   17.161  2.736   1.00 17.99 ? 314 LEU C O   1 
ATOM   5687  C  CB  . LEU C  1 211 ? -9.939   17.934  1.976   1.00 23.40 ? 314 LEU C CB  1 
ATOM   5688  C  CG  . LEU C  1 211 ? -9.673   18.866  0.785   1.00 24.54 ? 314 LEU C CG  1 
ATOM   5689  C  CD1 . LEU C  1 211 ? -10.857  19.778  0.501   1.00 24.72 ? 314 LEU C CD1 1 
ATOM   5690  C  CD2 . LEU C  1 211 ? -8.418   19.706  0.974   1.00 25.31 ? 314 LEU C CD2 1 
ATOM   5691  N  N   . GLY C  1 212 ? -7.184   16.386  0.643   1.00 21.42 ? 315 GLY C N   1 
ATOM   5692  C  CA  . GLY C  1 212 ? -5.731   16.510  0.486   1.00 21.55 ? 315 GLY C CA  1 
ATOM   5693  C  C   . GLY C  1 212 ? -5.257   17.501  -0.544  1.00 21.64 ? 315 GLY C C   1 
ATOM   5694  O  O   . GLY C  1 212 ? -5.834   17.648  -1.631  1.00 20.76 ? 315 GLY C O   1 
ATOM   5695  N  N   . LEU C  1 213 ? -4.157   18.166  -0.192  1.00 22.31 ? 316 LEU C N   1 
ATOM   5696  C  CA  . LEU C  1 213 ? -3.337   18.889  -1.149  1.00 21.73 ? 316 LEU C CA  1 
ATOM   5697  C  C   . LEU C  1 213 ? -2.151   17.980  -1.498  1.00 22.77 ? 316 LEU C C   1 
ATOM   5698  O  O   . LEU C  1 213 ? -1.236   17.816  -0.697  1.00 23.97 ? 316 LEU C O   1 
ATOM   5699  C  CB  . LEU C  1 213 ? -2.868   20.214  -0.556  1.00 22.80 ? 316 LEU C CB  1 
ATOM   5700  C  CG  . LEU C  1 213 ? -3.979   21.120  -0.066  1.00 22.42 ? 316 LEU C CG  1 
ATOM   5701  C  CD1 . LEU C  1 213 ? -3.452   22.246  0.794   1.00 22.77 ? 316 LEU C CD1 1 
ATOM   5702  C  CD2 . LEU C  1 213 ? -4.731   21.696  -1.249  1.00 22.42 ? 316 LEU C CD2 1 
ATOM   5703  N  N   . ASP C  1 214 ? -2.181   17.413  -2.688  1.00 23.32 ? 317 ASP C N   1 
ATOM   5704  C  CA  . ASP C  1 214 ? -1.217   16.396  -3.117  1.00 28.82 ? 317 ASP C CA  1 
ATOM   5705  C  C   . ASP C  1 214 ? -0.849   16.725  -4.533  1.00 28.75 ? 317 ASP C C   1 
ATOM   5706  O  O   . ASP C  1 214 ? -1.654   16.519  -5.429  1.00 29.53 ? 317 ASP C O   1 
ATOM   5707  C  CB  . ASP C  1 214 ? -1.891   15.021  -2.992  1.00 36.70 ? 317 ASP C CB  1 
ATOM   5708  C  CG  . ASP C  1 214 ? -1.142   13.839  -3.642  1.00 43.37 ? 317 ASP C CG  1 
ATOM   5709  O  OD1 . ASP C  1 214 ? -0.474   13.898  -4.680  1.00 48.10 ? 317 ASP C OD1 1 
ATOM   5710  O  OD2 . ASP C  1 214 ? -1.397   12.736  -3.160  1.00 51.08 ? 317 ASP C OD2 1 
ATOM   5711  N  N   . LEU C  1 215 ? 0.330    17.313  -4.719  1.00 26.33 ? 318 LEU C N   1 
ATOM   5712  C  CA  . LEU C  1 215 ? 0.636    18.020  -5.947  1.00 27.46 ? 318 LEU C CA  1 
ATOM   5713  C  C   . LEU C  1 215 ? 2.118    18.370  -6.106  1.00 26.62 ? 318 LEU C C   1 
ATOM   5714  O  O   . LEU C  1 215 ? 2.910    18.190  -5.208  1.00 26.74 ? 318 LEU C O   1 
ATOM   5715  C  CB  . LEU C  1 215 ? -0.209   19.302  -6.058  1.00 27.88 ? 318 LEU C CB  1 
ATOM   5716  C  CG  . LEU C  1 215 ? -0.205   20.300  -4.890  1.00 26.36 ? 318 LEU C CG  1 
ATOM   5717  C  CD1 . LEU C  1 215 ? 0.889    21.324  -5.072  1.00 26.19 ? 318 LEU C CD1 1 
ATOM   5718  C  CD2 . LEU C  1 215 ? -1.533   21.034  -4.788  1.00 25.99 ? 318 LEU C CD2 1 
ATOM   5719  N  N   . TRP C  1 216 ? 2.443    18.850  -7.294  1.00 25.37 ? 319 TRP C N   1 
ATOM   5720  C  CA  . TRP C  1 216 ? 3.788    19.133  -7.691  1.00 23.13 ? 319 TRP C CA  1 
ATOM   5721  C  C   . TRP C  1 216 ? 3.903    20.594  -8.070  1.00 23.30 ? 319 TRP C C   1 
ATOM   5722  O  O   . TRP C  1 216 ? 2.959    21.160  -8.599  1.00 21.36 ? 319 TRP C O   1 
ATOM   5723  C  CB  . TRP C  1 216 ? 4.179    18.288  -8.899  1.00 22.77 ? 319 TRP C CB  1 
ATOM   5724  C  CG  . TRP C  1 216 ? 5.417    18.810  -9.594  1.00 21.97 ? 319 TRP C CG  1 
ATOM   5725  C  CD1 . TRP C  1 216 ? 5.455    19.504  -10.766 1.00 21.95 ? 319 TRP C CD1 1 
ATOM   5726  C  CD2 . TRP C  1 216 ? 6.786    18.646  -9.163  1.00 20.89 ? 319 TRP C CD2 1 
ATOM   5727  N  NE1 . TRP C  1 216 ? 6.763    19.783  -11.102 1.00 24.17 ? 319 TRP C NE1 1 
ATOM   5728  C  CE2 . TRP C  1 216 ? 7.597    19.253  -10.139 1.00 22.62 ? 319 TRP C CE2 1 
ATOM   5729  C  CE3 . TRP C  1 216 ? 7.402    18.003  -8.070  1.00 22.10 ? 319 TRP C CE3 1 
ATOM   5730  C  CZ2 . TRP C  1 216 ? 9.005    19.297  -10.034 1.00 22.47 ? 319 TRP C CZ2 1 
ATOM   5731  C  CZ3 . TRP C  1 216 ? 8.800    18.035  -7.961  1.00 21.48 ? 319 TRP C CZ3 1 
ATOM   5732  C  CH2 . TRP C  1 216 ? 9.582    18.688  -8.950  1.00 22.58 ? 319 TRP C CH2 1 
ATOM   5733  N  N   . GLN C  1 217 ? 5.044    21.205  -7.733  1.00 23.29 ? 320 GLN C N   1 
ATOM   5734  C  CA  . GLN C  1 217 ? 5.290    22.606  -8.041  1.00 24.36 ? 320 GLN C CA  1 
ATOM   5735  C  C   . GLN C  1 217 ? 6.730    22.869  -8.388  1.00 22.25 ? 320 GLN C C   1 
ATOM   5736  O  O   . GLN C  1 217 ? 7.604    22.419  -7.711  1.00 20.07 ? 320 GLN C O   1 
ATOM   5737  C  CB  . GLN C  1 217 ? 4.886    23.533  -6.866  1.00 27.06 ? 320 GLN C CB  1 
ATOM   5738  C  CG  . GLN C  1 217 ? 3.392    23.772  -6.831  1.00 27.98 ? 320 GLN C CG  1 
ATOM   5739  C  CD  . GLN C  1 217 ? 2.897    25.036  -6.168  1.00 28.92 ? 320 GLN C CD  1 
ATOM   5740  O  OE1 . GLN C  1 217 ? 3.584    25.755  -5.437  1.00 35.62 ? 320 GLN C OE1 1 
ATOM   5741  N  NE2 . GLN C  1 217 ? 1.652    25.310  -6.440  1.00 30.90 ? 320 GLN C NE2 1 
ATOM   5742  N  N   . VAL C  1 218 ? 6.946    23.612  -9.459  1.00 22.62 ? 321 VAL C N   1 
ATOM   5743  C  CA  . VAL C  1 218 ? 8.255    24.123  -9.784  1.00 21.66 ? 321 VAL C CA  1 
ATOM   5744  C  C   . VAL C  1 218 ? 8.338    25.392  -8.948  1.00 21.06 ? 321 VAL C C   1 
ATOM   5745  O  O   . VAL C  1 218 ? 8.717    25.327  -7.779  1.00 17.53 ? 321 VAL C O   1 
ATOM   5746  C  CB  . VAL C  1 218 ? 8.462    24.330  -11.293 1.00 24.37 ? 321 VAL C CB  1 
ATOM   5747  C  CG1 . VAL C  1 218 ? 9.870    24.861  -11.595 1.00 24.88 ? 321 VAL C CG1 1 
ATOM   5748  C  CG2 . VAL C  1 218 ? 8.308    22.999  -12.022 1.00 25.83 ? 321 VAL C CG2 1 
ATOM   5749  N  N   . LYS C  1 219 ? 7.970    26.545  -9.506  1.00 21.56 ? 322 LYS C N   1 
ATOM   5750  C  CA  . LYS C  1 219 ? 8.031    27.790  -8.717  1.00 22.71 ? 322 LYS C CA  1 
ATOM   5751  C  C   . LYS C  1 219 ? 6.964    27.789  -7.661  1.00 20.47 ? 322 LYS C C   1 
ATOM   5752  O  O   . LYS C  1 219 ? 5.790    27.690  -7.977  1.00 20.12 ? 322 LYS C O   1 
ATOM   5753  C  CB  . LYS C  1 219 ? 7.832    29.032  -9.582  1.00 24.30 ? 322 LYS C CB  1 
ATOM   5754  C  CG  . LYS C  1 219 ? 9.030    29.467  -10.391 1.00 23.96 ? 322 LYS C CG  1 
ATOM   5755  C  CD  . LYS C  1 219 ? 8.678    30.662  -11.295 1.00 24.19 ? 322 LYS C CD  1 
ATOM   5756  C  CE  . LYS C  1 219 ? 8.319    31.885  -10.483 1.00 22.43 ? 322 LYS C CE  1 
ATOM   5757  N  NZ  . LYS C  1 219 ? 7.968    32.990  -11.387 1.00 23.31 ? 322 LYS C NZ  1 
ATOM   5758  N  N   . SER C  1 220 ? 7.390    27.957  -6.416  1.00 19.56 ? 323 SER C N   1 
ATOM   5759  C  CA  . SER C  1 220 ? 6.543    27.829  -5.246  1.00 19.62 ? 323 SER C CA  1 
ATOM   5760  C  C   . SER C  1 220 ? 6.017    29.170  -4.811  1.00 18.91 ? 323 SER C C   1 
ATOM   5761  O  O   . SER C  1 220 ? 6.319    30.164  -5.435  1.00 20.38 ? 323 SER C O   1 
ATOM   5762  C  CB  . SER C  1 220 ? 7.338    27.218  -4.100  1.00 21.16 ? 323 SER C CB  1 
ATOM   5763  O  OG  . SER C  1 220 ? 8.409    28.077  -3.681  1.00 22.20 ? 323 SER C OG  1 
ATOM   5764  N  N   . GLY C  1 221 ? 5.177    29.203  -3.779  1.00 18.28 ? 324 GLY C N   1 
ATOM   5765  C  CA  . GLY C  1 221 ? 4.488    30.449  -3.366  1.00 17.59 ? 324 GLY C CA  1 
ATOM   5766  C  C   . GLY C  1 221 ? 2.950    30.504  -3.505  1.00 17.43 ? 324 GLY C C   1 
ATOM   5767  O  O   . GLY C  1 221 ? 2.294    31.474  -3.097  1.00 18.98 ? 324 GLY C O   1 
ATOM   5768  N  N   . THR C  1 222 ? 2.344    29.452  -4.024  1.00 16.32 ? 325 THR C N   1 
ATOM   5769  C  CA  . THR C  1 222 ? 0.872    29.362  -4.098  1.00 15.02 ? 325 THR C CA  1 
ATOM   5770  C  C   . THR C  1 222 ? 0.248    29.337  -2.717  1.00 14.92 ? 325 THR C C   1 
ATOM   5771  O  O   . THR C  1 222 ? 0.680    28.600  -1.853  1.00 15.19 ? 325 THR C O   1 
ATOM   5772  C  CB  . THR C  1 222 ? 0.440    28.107  -4.844  1.00 14.65 ? 325 THR C CB  1 
ATOM   5773  O  OG1 . THR C  1 222 ? 0.955    28.148  -6.193  1.00 12.85 ? 325 THR C OG1 1 
ATOM   5774  C  CG2 . THR C  1 222 ? -1.070   28.012  -4.903  1.00 16.76 ? 325 THR C CG2 1 
ATOM   5775  N  N   . ILE C  1 223 ? -0.801   30.143  -2.519  1.00 14.48 ? 326 ILE C N   1 
ATOM   5776  C  CA  . ILE C  1 223 ? -1.549   30.163  -1.250  1.00 13.74 ? 326 ILE C CA  1 
ATOM   5777  C  C   . ILE C  1 223 ? -3.007   29.627  -1.436  1.00 14.59 ? 326 ILE C C   1 
ATOM   5778  O  O   . ILE C  1 223 ? -3.801   30.159  -2.249  1.00 12.53 ? 326 ILE C O   1 
ATOM   5779  C  CB  . ILE C  1 223 ? -1.651   31.573  -0.667  1.00 12.58 ? 326 ILE C CB  1 
ATOM   5780  C  CG1 . ILE C  1 223 ? -0.250   32.174  -0.508  1.00 12.72 ? 326 ILE C CG1 1 
ATOM   5781  C  CG2 . ILE C  1 223 ? -2.425   31.557  0.626   1.00 12.43 ? 326 ILE C CG2 1 
ATOM   5782  C  CD1 . ILE C  1 223 ? -0.227   33.502  0.216   1.00 12.07 ? 326 ILE C CD1 1 
ATOM   5783  N  N   . PHE C  1 224 ? -3.320   28.604  -0.648  1.00 14.17 ? 327 PHE C N   1 
ATOM   5784  C  CA  . PHE C  1 224 ? -4.668   28.015  -0.581  1.00 15.21 ? 327 PHE C CA  1 
ATOM   5785  C  C   . PHE C  1 224 ? -5.420   28.498  0.690   1.00 13.58 ? 327 PHE C C   1 
ATOM   5786  O  O   . PHE C  1 224 ? -4.874   28.476  1.759   1.00 12.51 ? 327 PHE C O   1 
ATOM   5787  C  CB  . PHE C  1 224 ? -4.585   26.499  -0.522  1.00 15.79 ? 327 PHE C CB  1 
ATOM   5788  C  CG  . PHE C  1 224 ? -3.883   25.867  -1.697  1.00 17.02 ? 327 PHE C CG  1 
ATOM   5789  C  CD1 . PHE C  1 224 ? -2.524   25.661  -1.651  1.00 18.52 ? 327 PHE C CD1 1 
ATOM   5790  C  CD2 . PHE C  1 224 ? -4.570   25.454  -2.805  1.00 17.28 ? 327 PHE C CD2 1 
ATOM   5791  C  CE1 . PHE C  1 224 ? -1.843   25.094  -2.699  1.00 18.86 ? 327 PHE C CE1 1 
ATOM   5792  C  CE2 . PHE C  1 224 ? -3.905   24.889  -3.870  1.00 18.61 ? 327 PHE C CE2 1 
ATOM   5793  C  CZ  . PHE C  1 224 ? -2.533   24.700  -3.815  1.00 20.09 ? 327 PHE C CZ  1 
ATOM   5794  N  N   . ASP C  1 225 ? -6.654   28.976  0.542   1.00 13.09 ? 328 ASP C N   1 
ATOM   5795  C  CA  . ASP C  1 225 ? -7.427   29.498  1.682   1.00 12.99 ? 328 ASP C CA  1 
ATOM   5796  C  C   . ASP C  1 225 ? -8.926   29.138  1.445   1.00 13.16 ? 328 ASP C C   1 
ATOM   5797  O  O   . ASP C  1 225 ? -9.325   28.593  0.412   1.00 12.15 ? 328 ASP C O   1 
ATOM   5798  C  CB  . ASP C  1 225 ? -7.255   31.044  1.829   1.00 12.92 ? 328 ASP C CB  1 
ATOM   5799  C  CG  . ASP C  1 225 ? -7.619   31.680  3.286   1.00 12.87 ? 328 ASP C CG  1 
ATOM   5800  O  OD1 . ASP C  1 225 ? -8.032   30.909  4.170   1.00 14.89 ? 328 ASP C OD1 1 
ATOM   5801  O  OD2 . ASP C  1 225 ? -7.506   32.905  3.260   1.00 13.00 ? 328 ASP C OD2 1 
ATOM   5802  N  N   . ASN C  1 226 ? -9.700   29.404  2.474   1.00 12.38 ? 329 ASN C N   1 
ATOM   5803  C  CA  . ASN C  1 226 ? -11.153  29.389  2.448   1.00 13.63 ? 329 ASN C CA  1 
ATOM   5804  C  C   . ASN C  1 226 ? -11.801  28.120  1.863   1.00 15.12 ? 329 ASN C C   1 
ATOM   5805  O  O   . ASN C  1 226 ? -12.665  28.191  0.994   1.00 16.94 ? 329 ASN C O   1 
ATOM   5806  C  CB  . ASN C  1 226 ? -11.649  30.630  1.738   1.00 12.91 ? 329 ASN C CB  1 
ATOM   5807  C  CG  . ASN C  1 226 ? -11.213  31.886  2.428   1.00 12.10 ? 329 ASN C CG  1 
ATOM   5808  O  OD1 . ASN C  1 226 ? -11.487  32.089  3.605   1.00 11.50 ? 329 ASN C OD1 1 
ATOM   5809  N  ND2 . ASN C  1 226 ? -10.422  32.690  1.724   1.00 12.36 ? 329 ASN C ND2 1 
ATOM   5810  N  N   . PHE C  1 227 ? -11.381  26.967  2.383   1.00 15.86 ? 330 PHE C N   1 
ATOM   5811  C  CA  . PHE C  1 227 ? -11.875  25.691  1.936   1.00 16.15 ? 330 PHE C CA  1 
ATOM   5812  C  C   . PHE C  1 227 ? -13.297  25.506  2.492   1.00 16.60 ? 330 PHE C C   1 
ATOM   5813  O  O   . PHE C  1 227 ? -13.561  25.851  3.623   1.00 17.19 ? 330 PHE C O   1 
ATOM   5814  C  CB  . PHE C  1 227 ? -11.008  24.540  2.444   1.00 15.76 ? 330 PHE C CB  1 
ATOM   5815  C  CG  . PHE C  1 227 ? -9.625   24.489  1.874   1.00 14.39 ? 330 PHE C CG  1 
ATOM   5816  C  CD1 . PHE C  1 227 ? -8.594   25.150  2.512   1.00 14.83 ? 330 PHE C CD1 1 
ATOM   5817  C  CD2 . PHE C  1 227 ? -9.328   23.670  0.805   1.00 14.48 ? 330 PHE C CD2 1 
ATOM   5818  C  CE1 . PHE C  1 227 ? -7.294   25.068  2.039   1.00 14.09 ? 330 PHE C CE1 1 
ATOM   5819  C  CE2 . PHE C  1 227 ? -8.047   23.611  0.280   1.00 14.74 ? 330 PHE C CE2 1 
ATOM   5820  C  CZ  . PHE C  1 227 ? -7.024   24.313  0.907   1.00 14.48 ? 330 PHE C CZ  1 
ATOM   5821  N  N   . LEU C  1 228 ? -14.189  24.995  1.654   1.00 15.82 ? 331 LEU C N   1 
ATOM   5822  C  CA  . LEU C  1 228 ? -15.579  24.680  2.053   1.00 17.38 ? 331 LEU C CA  1 
ATOM   5823  C  C   . LEU C  1 228 ? -16.095  23.426  1.335   1.00 16.44 ? 331 LEU C C   1 
ATOM   5824  O  O   . LEU C  1 228 ? -15.939  23.264  0.116   1.00 13.59 ? 331 LEU C O   1 
ATOM   5825  C  CB  . LEU C  1 228 ? -16.509  25.819  1.740   1.00 19.10 ? 331 LEU C CB  1 
ATOM   5826  C  CG  . LEU C  1 228 ? -17.975  25.552  2.009   1.00 19.45 ? 331 LEU C CG  1 
ATOM   5827  C  CD1 . LEU C  1 228 ? -18.248  25.550  3.497   1.00 19.54 ? 331 LEU C CD1 1 
ATOM   5828  C  CD2 . LEU C  1 228 ? -18.836  26.582  1.326   1.00 18.36 ? 331 LEU C CD2 1 
ATOM   5829  N  N   . ILE C  1 229 ? -16.582  22.483  2.125   1.00 17.59 ? 332 ILE C N   1 
ATOM   5830  C  CA  . ILE C  1 229 ? -17.331  21.340  1.597   1.00 18.68 ? 332 ILE C CA  1 
ATOM   5831  C  C   . ILE C  1 229 ? -18.704  21.375  2.213   1.00 20.11 ? 332 ILE C C   1 
ATOM   5832  O  O   . ILE C  1 229 ? -18.846  21.355  3.434   1.00 20.35 ? 332 ILE C O   1 
ATOM   5833  C  CB  . ILE C  1 229 ? -16.673  20.012  1.857   1.00 19.44 ? 332 ILE C CB  1 
ATOM   5834  C  CG1 . ILE C  1 229 ? -15.206  20.142  1.518   1.00 19.64 ? 332 ILE C CG1 1 
ATOM   5835  C  CG2 . ILE C  1 229 ? -17.346  18.913  1.051   1.00 19.96 ? 332 ILE C CG2 1 
ATOM   5836  C  CD1 . ILE C  1 229 ? -14.499  18.874  1.156   1.00 19.56 ? 332 ILE C CD1 1 
ATOM   5837  N  N   . THR C  1 230 ? -19.701  21.448  1.332   1.00 20.33 ? 333 THR C N   1 
ATOM   5838  C  CA  . THR C  1 230 ? -21.098  21.641  1.725   1.00 19.52 ? 333 THR C CA  1 
ATOM   5839  C  C   . THR C  1 230 ? -22.032  20.903  0.760   1.00 18.73 ? 333 THR C C   1 
ATOM   5840  O  O   . THR C  1 230 ? -21.632  20.315  -0.261  1.00 15.34 ? 333 THR C O   1 
ATOM   5841  C  CB  . THR C  1 230 ? -21.436  23.160  1.820   1.00 21.70 ? 333 THR C CB  1 
ATOM   5842  O  OG1 . THR C  1 230 ? -22.717  23.368  2.410   1.00 24.63 ? 333 THR C OG1 1 
ATOM   5843  C  CG2 . THR C  1 230 ? -21.410  23.832  0.467   1.00 20.41 ? 333 THR C CG2 1 
ATOM   5844  N  N   . ASN C  1 231 ? -23.302  20.904  1.113   1.00 21.55 ? 334 ASN C N   1 
ATOM   5845  C  CA  . ASN C  1 231 ? -24.352  20.285  0.249   1.00 22.68 ? 334 ASN C CA  1 
ATOM   5846  C  C   . ASN C  1 231 ? -25.326  21.330  -0.278  1.00 22.63 ? 334 ASN C C   1 
ATOM   5847  O  O   . ASN C  1 231 ? -26.314  20.981  -0.878  1.00 23.01 ? 334 ASN C O   1 
ATOM   5848  C  CB  . ASN C  1 231 ? -25.115  19.191  0.992   1.00 21.46 ? 334 ASN C CB  1 
ATOM   5849  C  CG  . ASN C  1 231 ? -25.993  19.734  2.095   1.00 21.60 ? 334 ASN C CG  1 
ATOM   5850  O  OD1 . ASN C  1 231 ? -25.981  20.938  2.429   1.00 21.96 ? 334 ASN C OD1 1 
ATOM   5851  N  ND2 . ASN C  1 231 ? -26.800  18.864  2.647   1.00 24.40 ? 334 ASN C ND2 1 
ATOM   5852  N  N   . ASP C  1 232 ? -24.995  22.603  -0.076  1.00 23.72 ? 335 ASP C N   1 
ATOM   5853  C  CA  . ASP C  1 232 ? -25.841  23.727  -0.439  1.00 24.43 ? 335 ASP C CA  1 
ATOM   5854  C  C   . ASP C  1 232 ? -25.110  24.713  -1.387  1.00 21.82 ? 335 ASP C C   1 
ATOM   5855  O  O   . ASP C  1 232 ? -24.174  25.415  -0.977  1.00 22.30 ? 335 ASP C O   1 
ATOM   5856  C  CB  . ASP C  1 232 ? -26.299  24.417  0.848   1.00 26.36 ? 335 ASP C CB  1 
ATOM   5857  C  CG  . ASP C  1 232 ? -27.390  25.439  0.626   1.00 29.77 ? 335 ASP C CG  1 
ATOM   5858  O  OD1 . ASP C  1 232 ? -27.462  26.101  -0.421  1.00 34.75 ? 335 ASP C OD1 1 
ATOM   5859  O  OD2 . ASP C  1 232 ? -28.211  25.586  1.518   1.00 35.81 ? 335 ASP C OD2 1 
ATOM   5860  N  N   . GLU C  1 233 ? -25.582  24.787  -2.633  1.00 19.75 ? 336 GLU C N   1 
ATOM   5861  C  CA  . GLU C  1 233 ? -25.010  25.691  -3.676  1.00 20.40 ? 336 GLU C CA  1 
ATOM   5862  C  C   . GLU C  1 233 ? -25.113  27.156  -3.310  1.00 19.55 ? 336 GLU C C   1 
ATOM   5863  O  O   . GLU C  1 233 ? -24.183  27.914  -3.494  1.00 20.64 ? 336 GLU C O   1 
ATOM   5864  C  CB  . GLU C  1 233 ? -25.698  25.549  -5.033  1.00 21.56 ? 336 GLU C CB  1 
ATOM   5865  C  CG  . GLU C  1 233 ? -25.741  24.141  -5.620  1.00 23.79 ? 336 GLU C CG  1 
ATOM   5866  C  CD  . GLU C  1 233 ? -26.403  24.071  -7.005  1.00 24.93 ? 336 GLU C CD  1 
ATOM   5867  O  OE1 . GLU C  1 233 ? -26.233  25.001  -7.817  1.00 29.64 ? 336 GLU C OE1 1 
ATOM   5868  O  OE2 . GLU C  1 233 ? -27.044  23.057  -7.325  1.00 25.70 ? 336 GLU C OE2 1 
ATOM   5869  N  N   . ALA C  1 234 ? -26.262  27.543  -2.792  1.00 18.98 ? 337 ALA C N   1 
ATOM   5870  C  CA  . ALA C  1 234 ? -26.491  28.905  -2.382  1.00 17.53 ? 337 ALA C CA  1 
ATOM   5871  C  C   . ALA C  1 234 ? -25.557  29.300  -1.234  1.00 17.95 ? 337 ALA C C   1 
ATOM   5872  O  O   . ALA C  1 234 ? -24.966  30.377  -1.242  1.00 18.64 ? 337 ALA C O   1 
ATOM   5873  C  CB  . ALA C  1 234 ? -27.919  29.097  -1.967  1.00 17.28 ? 337 ALA C CB  1 
ATOM   5874  N  N   . TYR C  1 235 ? -25.386  28.436  -0.259  1.00 18.08 ? 338 TYR C N   1 
ATOM   5875  C  CA  . TYR C  1 235 ? -24.475  28.729  0.832   1.00 18.17 ? 338 TYR C CA  1 
ATOM   5876  C  C   . TYR C  1 235 ? -23.014  28.850  0.345   1.00 16.29 ? 338 TYR C C   1 
ATOM   5877  O  O   . TYR C  1 235 ? -22.282  29.753  0.741   1.00 15.47 ? 338 TYR C O   1 
ATOM   5878  C  CB  . TYR C  1 235 ? -24.549  27.658  1.922   1.00 19.61 ? 338 TYR C CB  1 
ATOM   5879  C  CG  . TYR C  1 235 ? -23.666  28.040  3.047   1.00 21.84 ? 338 TYR C CG  1 
ATOM   5880  C  CD1 . TYR C  1 235 ? -23.907  29.221  3.776   1.00 22.56 ? 338 TYR C CD1 1 
ATOM   5881  C  CD2 . TYR C  1 235 ? -22.542  27.269  3.369   1.00 23.10 ? 338 TYR C CD2 1 
ATOM   5882  C  CE1 . TYR C  1 235 ? -23.058  29.589  4.807   1.00 24.06 ? 338 TYR C CE1 1 
ATOM   5883  C  CE2 . TYR C  1 235 ? -21.710  27.625  4.425   1.00 25.19 ? 338 TYR C CE2 1 
ATOM   5884  C  CZ  . TYR C  1 235 ? -21.983  28.776  5.132   1.00 24.96 ? 338 TYR C CZ  1 
ATOM   5885  O  OH  . TYR C  1 235 ? -21.101  29.149  6.117   1.00 34.06 ? 338 TYR C OH  1 
ATOM   5886  N  N   . ALA C  1 236 ? -22.609  27.953  -0.527  1.00 14.93 ? 339 ALA C N   1 
ATOM   5887  C  CA  . ALA C  1 236 ? -21.306  28.071  -1.139  1.00 15.38 ? 339 ALA C CA  1 
ATOM   5888  C  C   . ALA C  1 236 ? -21.114  29.454  -1.752  1.00 16.49 ? 339 ALA C C   1 
ATOM   5889  O  O   . ALA C  1 236 ? -20.029  30.028  -1.682  1.00 18.00 ? 339 ALA C O   1 
ATOM   5890  C  CB  . ALA C  1 236 ? -21.101  26.997  -2.198  1.00 14.93 ? 339 ALA C CB  1 
ATOM   5891  N  N   . GLU C  1 237 ? -22.122  29.936  -2.446  1.00 17.48 ? 340 GLU C N   1 
ATOM   5892  C  CA  . GLU C  1 237 ? -22.013  31.226  -3.155  1.00 20.36 ? 340 GLU C CA  1 
ATOM   5893  C  C   . GLU C  1 237 ? -21.902  32.373  -2.159  1.00 19.67 ? 340 GLU C C   1 
ATOM   5894  O  O   . GLU C  1 237 ? -21.118  33.288  -2.352  1.00 19.38 ? 340 GLU C O   1 
ATOM   5895  C  CB  . GLU C  1 237 ? -23.228  31.456  -4.083  1.00 21.84 ? 340 GLU C CB  1 
ATOM   5896  C  CG  . GLU C  1 237 ? -23.089  32.714  -4.889  1.00 23.77 ? 340 GLU C CG  1 
ATOM   5897  C  CD  . GLU C  1 237 ? -24.132  32.875  -5.996  1.00 29.34 ? 340 GLU C CD  1 
ATOM   5898  O  OE1 . GLU C  1 237 ? -24.411  34.012  -6.486  1.00 31.52 ? 340 GLU C OE1 1 
ATOM   5899  O  OE2 . GLU C  1 237 ? -24.658  31.829  -6.422  1.00 31.15 ? 340 GLU C OE2 1 
ATOM   5900  N  N   . GLU C  1 238 ? -22.682  32.298  -1.087  1.00 19.14 ? 341 GLU C N   1 
ATOM   5901  C  CA  . GLU C  1 238 ? -22.594  33.289  0.001   1.00 19.88 ? 341 GLU C CA  1 
ATOM   5902  C  C   . GLU C  1 238 ? -21.205  33.337  0.599   1.00 17.48 ? 341 GLU C C   1 
ATOM   5903  O  O   . GLU C  1 238 ? -20.641  34.390  0.767   1.00 16.72 ? 341 GLU C O   1 
ATOM   5904  C  CB  . GLU C  1 238 ? -23.523  32.946  1.144   1.00 22.03 ? 341 GLU C CB  1 
ATOM   5905  C  CG  . GLU C  1 238 ? -24.989  33.103  0.811   1.00 27.36 ? 341 GLU C CG  1 
ATOM   5906  C  CD  . GLU C  1 238 ? -25.960  32.479  1.838   1.00 29.32 ? 341 GLU C CD  1 
ATOM   5907  O  OE1 . GLU C  1 238 ? -25.549  32.336  3.024   1.00 32.05 ? 341 GLU C OE1 1 
ATOM   5908  O  OE2 . GLU C  1 238 ? -27.114  32.114  1.443   1.00 32.28 ? 341 GLU C OE2 1 
ATOM   5909  N  N   . PHE C  1 239 ? -20.698  32.169  0.972   1.00 15.14 ? 342 PHE C N   1 
ATOM   5910  C  CA  . PHE C  1 239 ? -19.406  32.058  1.595   1.00 14.64 ? 342 PHE C CA  1 
ATOM   5911  C  C   . PHE C  1 239 ? -18.303  32.604  0.630   1.00 14.05 ? 342 PHE C C   1 
ATOM   5912  O  O   . PHE C  1 239 ? -17.308  33.164  1.066   1.00 12.61 ? 342 PHE C O   1 
ATOM   5913  C  CB  . PHE C  1 239 ? -19.139  30.596  1.952   1.00 14.23 ? 342 PHE C CB  1 
ATOM   5914  C  CG  . PHE C  1 239 ? -17.920  30.382  2.789   1.00 14.48 ? 342 PHE C CG  1 
ATOM   5915  C  CD1 . PHE C  1 239 ? -17.815  30.973  4.037   1.00 15.24 ? 342 PHE C CD1 1 
ATOM   5916  C  CD2 . PHE C  1 239 ? -16.884  29.542  2.354   1.00 15.59 ? 342 PHE C CD2 1 
ATOM   5917  C  CE1 . PHE C  1 239 ? -16.706  30.745  4.846   1.00 16.04 ? 342 PHE C CE1 1 
ATOM   5918  C  CE2 . PHE C  1 239 ? -15.748  29.326  3.160   1.00 16.58 ? 342 PHE C CE2 1 
ATOM   5919  C  CZ  . PHE C  1 239 ? -15.667  29.921  4.411   1.00 16.28 ? 342 PHE C CZ  1 
ATOM   5920  N  N   . GLY C  1 240 ? -18.479  32.341  -0.654  1.00 13.42 ? 343 GLY C N   1 
ATOM   5921  C  CA  . GLY C  1 240 ? -17.546  32.784  -1.666  1.00 14.57 ? 343 GLY C CA  1 
ATOM   5922  C  C   . GLY C  1 240 ? -17.513  34.286  -1.692  1.00 16.27 ? 343 GLY C C   1 
ATOM   5923  O  O   . GLY C  1 240 ? -16.433  34.884  -1.719  1.00 16.53 ? 343 GLY C O   1 
ATOM   5924  N  N   . ASN C  1 241 ? -18.688  34.917  -1.590  1.00 17.42 ? 344 ASN C N   1 
ATOM   5925  C  CA  . ASN C  1 241 ? -18.754  36.398  -1.546  1.00 17.90 ? 344 ASN C CA  1 
ATOM   5926  C  C   . ASN C  1 241 ? -18.260  37.017  -0.250  1.00 18.62 ? 344 ASN C C   1 
ATOM   5927  O  O   . ASN C  1 241 ? -17.812  38.174  -0.248  1.00 19.66 ? 344 ASN C O   1 
ATOM   5928  C  CB  . ASN C  1 241 ? -20.149  36.910  -1.909  1.00 17.51 ? 344 ASN C CB  1 
ATOM   5929  C  CG  . ASN C  1 241 ? -20.448  36.723  -3.366  1.00 17.47 ? 344 ASN C CG  1 
ATOM   5930  O  OD1 . ASN C  1 241 ? -19.526  36.586  -4.169  1.00 20.00 ? 344 ASN C OD1 1 
ATOM   5931  N  ND2 . ASN C  1 241 ? -21.698  36.643  -3.722  1.00 16.75 ? 344 ASN C ND2 1 
ATOM   5932  N  N   . GLU C  1 242 ? -18.330  36.254  0.830   1.00 19.28 ? 345 GLU C N   1 
ATOM   5933  C  CA  . GLU C  1 242 ? -17.846  36.694  2.159   1.00 18.97 ? 345 GLU C CA  1 
ATOM   5934  C  C   . GLU C  1 242 ? -16.331  36.455  2.306   1.00 18.06 ? 345 GLU C C   1 
ATOM   5935  O  O   . GLU C  1 242 ? -15.742  36.958  3.224   1.00 17.97 ? 345 GLU C O   1 
ATOM   5936  C  CB  . GLU C  1 242 ? -18.555  35.927  3.288   1.00 21.90 ? 345 GLU C CB  1 
ATOM   5937  C  CG  . GLU C  1 242 ? -19.924  36.510  3.694   1.00 27.49 ? 345 GLU C CG  1 
ATOM   5938  C  CD  . GLU C  1 242 ? -20.870  35.522  4.429   1.00 30.86 ? 345 GLU C CD  1 
ATOM   5939  O  OE1 . GLU C  1 242 ? -20.597  34.280  4.443   1.00 36.33 ? 345 GLU C OE1 1 
ATOM   5940  O  OE2 . GLU C  1 242 ? -21.863  35.988  5.052   1.00 31.22 ? 345 GLU C OE2 1 
ATOM   5941  N  N   . THR C  1 243 ? -15.728  35.650  1.424   1.00 16.46 ? 346 THR C N   1 
ATOM   5942  C  CA  . THR C  1 243 ? -14.301  35.366  1.491   1.00 15.25 ? 346 THR C CA  1 
ATOM   5943  C  C   . THR C  1 243 ? -13.548  35.998  0.282   1.00 14.38 ? 346 THR C C   1 
ATOM   5944  O  O   . THR C  1 243 ? -13.028  37.087  0.380   1.00 13.49 ? 346 THR C O   1 
ATOM   5945  C  CB  . THR C  1 243 ? -14.041  33.854  1.611   1.00 16.07 ? 346 THR C CB  1 
ATOM   5946  O  OG1 . THR C  1 243 ? -14.660  33.153  0.521   1.00 17.26 ? 346 THR C OG1 1 
ATOM   5947  C  CG2 . THR C  1 243 ? -14.602  33.302  2.939   1.00 16.02 ? 346 THR C CG2 1 
ATOM   5948  N  N   . TRP C  1 244 ? -13.505  35.307  -0.840  1.00 13.63 ? 347 TRP C N   1 
ATOM   5949  C  CA  . TRP C  1 244 ? -12.953  35.842  -2.090  1.00 14.01 ? 347 TRP C CA  1 
ATOM   5950  C  C   . TRP C  1 244 ? -13.488  37.241  -2.421  1.00 14.98 ? 347 TRP C C   1 
ATOM   5951  O  O   . TRP C  1 244 ? -12.746  38.155  -2.791  1.00 12.79 ? 347 TRP C O   1 
ATOM   5952  C  CB  . TRP C  1 244 ? -13.236  34.906  -3.268  1.00 13.47 ? 347 TRP C CB  1 
ATOM   5953  C  CG  . TRP C  1 244 ? -13.045  35.540  -4.586  1.00 12.94 ? 347 TRP C CG  1 
ATOM   5954  C  CD1 . TRP C  1 244 ? -11.845  35.772  -5.215  1.00 12.88 ? 347 TRP C CD1 1 
ATOM   5955  C  CD2 . TRP C  1 244 ? -14.057  36.063  -5.449  1.00 12.82 ? 347 TRP C CD2 1 
ATOM   5956  N  NE1 . TRP C  1 244 ? -12.054  36.412  -6.377  1.00 12.80 ? 347 TRP C NE1 1 
ATOM   5957  C  CE2 . TRP C  1 244 ? -13.399  36.592  -6.572  1.00 12.74 ? 347 TRP C CE2 1 
ATOM   5958  C  CE3 . TRP C  1 244 ? -15.458  36.164  -5.364  1.00 12.75 ? 347 TRP C CE3 1 
ATOM   5959  C  CZ2 . TRP C  1 244 ? -14.089  37.197  -7.633  1.00 13.10 ? 347 TRP C CZ2 1 
ATOM   5960  C  CZ3 . TRP C  1 244 ? -16.153  36.767  -6.389  1.00 13.06 ? 347 TRP C CZ3 1 
ATOM   5961  C  CH2 . TRP C  1 244 ? -15.473  37.263  -7.539  1.00 13.77 ? 347 TRP C CH2 1 
ATOM   5962  N  N   . GLY C  1 245 ? -14.774  37.397  -2.258  1.00 15.28 ? 348 GLY C N   1 
ATOM   5963  C  CA  . GLY C  1 245 ? -15.425  38.643  -2.609  1.00 14.96 ? 348 GLY C CA  1 
ATOM   5964  C  C   . GLY C  1 245 ? -15.035  39.808  -1.727  1.00 15.10 ? 348 GLY C C   1 
ATOM   5965  O  O   . GLY C  1 245 ? -15.247  40.952  -2.081  1.00 14.14 ? 348 GLY C O   1 
ATOM   5966  N  N   . VAL C  1 246 ? -14.546  39.514  -0.551  1.00 15.21 ? 349 VAL C N   1 
ATOM   5967  C  CA  . VAL C  1 246 ? -14.080  40.534  0.398   1.00 16.41 ? 349 VAL C CA  1 
ATOM   5968  C  C   . VAL C  1 246 ? -12.560  40.786  0.221   1.00 17.07 ? 349 VAL C C   1 
ATOM   5969  O  O   . VAL C  1 246 ? -12.069  41.847  0.509   1.00 17.56 ? 349 VAL C O   1 
ATOM   5970  C  CB  . VAL C  1 246 ? -14.387  40.087  1.861   1.00 17.42 ? 349 VAL C CB  1 
ATOM   5971  C  CG1 . VAL C  1 246 ? -13.636  40.894  2.910   1.00 15.90 ? 349 VAL C CG1 1 
ATOM   5972  C  CG2 . VAL C  1 246 ? -15.877  40.217  2.106   1.00 17.60 ? 349 VAL C CG2 1 
ATOM   5973  N  N   . THR C  1 247 ? -11.827  39.782  -0.220  1.00 17.73 ? 350 THR C N   1 
ATOM   5974  C  CA  . THR C  1 247 ? -10.394  39.897  -0.508  1.00 17.57 ? 350 THR C CA  1 
ATOM   5975  C  C   . THR C  1 247 ? -10.107  40.767  -1.737  1.00 18.31 ? 350 THR C C   1 
ATOM   5976  O  O   . THR C  1 247 ? -9.207   41.590  -1.741  1.00 17.15 ? 350 THR C O   1 
ATOM   5977  C  CB  . THR C  1 247 ? -9.838   38.484  -0.828  1.00 16.13 ? 350 THR C CB  1 
ATOM   5978  O  OG1 . THR C  1 247 ? -10.002  37.646  0.311   1.00 16.28 ? 350 THR C OG1 1 
ATOM   5979  C  CG2 . THR C  1 247 ? -8.372   38.515  -1.227  1.00 16.36 ? 350 THR C CG2 1 
ATOM   5980  N  N   . LYS C  1 248 ? -10.885  40.513  -2.777  1.00 18.99 ? 351 LYS C N   1 
ATOM   5981  C  CA  . LYS C  1 248 ? -10.620  40.904  -4.166  1.00 20.31 ? 351 LYS C CA  1 
ATOM   5982  C  C   . LYS C  1 248 ? -10.116  42.338  -4.452  1.00 18.72 ? 351 LYS C C   1 
ATOM   5983  O  O   . LYS C  1 248 ? -9.030   42.516  -4.981  1.00 17.85 ? 351 LYS C O   1 
ATOM   5984  C  CB  . LYS C  1 248 ? -11.940  40.626  -4.883  1.00 26.04 ? 351 LYS C CB  1 
ATOM   5985  C  CG  . LYS C  1 248 ? -12.135  41.014  -6.324  1.00 29.71 ? 351 LYS C CG  1 
ATOM   5986  C  CD  . LYS C  1 248 ? -13.593  40.629  -6.652  1.00 34.51 ? 351 LYS C CD  1 
ATOM   5987  C  CE  . LYS C  1 248 ? -14.110  41.091  -8.009  1.00 36.13 ? 351 LYS C CE  1 
ATOM   5988  N  NZ  . LYS C  1 248 ? -13.697  42.480  -8.318  1.00 40.92 ? 351 LYS C NZ  1 
ATOM   5989  N  N   . ALA C  1 249 ? -10.908  43.344  -4.096  1.00 16.50 ? 352 ALA C N   1 
ATOM   5990  C  CA  . ALA C  1 249 ? -10.638  44.732  -4.464  1.00 15.62 ? 352 ALA C CA  1 
ATOM   5991  C  C   . ALA C  1 249 ? -9.419   45.361  -3.737  1.00 15.78 ? 352 ALA C C   1 
ATOM   5992  O  O   . ALA C  1 249 ? -8.597   46.013  -4.342  1.00 15.53 ? 352 ALA C O   1 
ATOM   5993  C  CB  . ALA C  1 249 ? -11.880  45.589  -4.245  1.00 15.35 ? 352 ALA C CB  1 
ATOM   5994  N  N   . ALA C  1 250 ? -9.321   45.114  -2.443  1.00 16.38 ? 353 ALA C N   1 
ATOM   5995  C  CA  . ALA C  1 250 ? -8.227   45.578  -1.614  1.00 16.36 ? 353 ALA C CA  1 
ATOM   5996  C  C   . ALA C  1 250 ? -6.929   44.887  -2.002  1.00 15.78 ? 353 ALA C C   1 
ATOM   5997  O  O   . ALA C  1 250 ? -5.903   45.526  -2.094  1.00 15.48 ? 353 ALA C O   1 
ATOM   5998  C  CB  . ALA C  1 250 ? -8.539   45.356  -0.135  1.00 15.80 ? 353 ALA C CB  1 
ATOM   5999  N  N   . GLU C  1 251 ? -6.984   43.592  -2.269  1.00 15.02 ? 354 GLU C N   1 
ATOM   6000  C  CA  . GLU C  1 251 ? -5.798   42.877  -2.776  1.00 15.21 ? 354 GLU C CA  1 
ATOM   6001  C  C   . GLU C  1 251 ? -5.239   43.553  -4.054  1.00 15.43 ? 354 GLU C C   1 
ATOM   6002  O  O   . GLU C  1 251 ? -4.037   43.739  -4.229  1.00 15.01 ? 354 GLU C O   1 
ATOM   6003  C  CB  . GLU C  1 251 ? -6.152   41.393  -3.056  1.00 14.40 ? 354 GLU C CB  1 
ATOM   6004  C  CG  . GLU C  1 251 ? -5.051   40.536  -3.635  1.00 14.65 ? 354 GLU C CG  1 
ATOM   6005  C  CD  . GLU C  1 251 ? -5.489   39.072  -3.888  1.00 15.37 ? 354 GLU C CD  1 
ATOM   6006  O  OE1 . GLU C  1 251 ? -6.146   38.801  -4.927  1.00 17.87 ? 354 GLU C OE1 1 
ATOM   6007  O  OE2 . GLU C  1 251 ? -5.121   38.164  -3.088  1.00 14.51 ? 354 GLU C OE2 1 
ATOM   6008  N  N   . LYS C  1 252 ? -6.123   43.790  -5.008  1.00 16.54 ? 355 LYS C N   1 
ATOM   6009  C  CA  . LYS C  1 252 ? -5.768   44.369  -6.306  1.00 18.22 ? 355 LYS C CA  1 
ATOM   6010  C  C   . LYS C  1 252 ? -5.196   45.795  -6.116  1.00 18.48 ? 355 LYS C C   1 
ATOM   6011  O  O   . LYS C  1 252 ? -4.235   46.182  -6.755  1.00 19.26 ? 355 LYS C O   1 
ATOM   6012  C  CB  . LYS C  1 252 ? -7.037   44.397  -7.169  1.00 20.91 ? 355 LYS C CB  1 
ATOM   6013  C  CG  . LYS C  1 252 ? -6.953   45.125  -8.488  1.00 23.74 ? 355 LYS C CG  1 
ATOM   6014  C  CD  . LYS C  1 252 ? -6.145   44.334  -9.481  1.00 28.72 ? 355 LYS C CD  1 
ATOM   6015  C  CE  . LYS C  1 252 ? -5.980   45.170  -10.749 1.00 33.88 ? 355 LYS C CE  1 
ATOM   6016  N  NZ  . LYS C  1 252 ? -5.282   44.416  -11.811 1.00 39.28 ? 355 LYS C NZ  1 
ATOM   6017  N  N   . GLN C  1 253 ? -5.803   46.571  -5.226  1.00 18.17 ? 356 GLN C N   1 
ATOM   6018  C  CA  . GLN C  1 253 ? -5.321   47.892  -4.904  1.00 18.83 ? 356 GLN C CA  1 
ATOM   6019  C  C   . GLN C  1 253 ? -3.901   47.879  -4.305  1.00 17.61 ? 356 GLN C C   1 
ATOM   6020  O  O   . GLN C  1 253 ? -3.025   48.644  -4.717  1.00 16.81 ? 356 GLN C O   1 
ATOM   6021  C  CB  . GLN C  1 253 ? -6.317   48.538  -3.965  1.00 22.07 ? 356 GLN C CB  1 
ATOM   6022  C  CG  . GLN C  1 253 ? -6.153   50.028  -3.711  1.00 25.50 ? 356 GLN C CG  1 
ATOM   6023  C  CD  . GLN C  1 253 ? -7.118   50.518  -2.624  1.00 29.08 ? 356 GLN C CD  1 
ATOM   6024  O  OE1 . GLN C  1 253 ? -8.328   50.486  -2.777  1.00 30.68 ? 356 GLN C OE1 1 
ATOM   6025  N  NE2 . GLN C  1 253 ? -6.577   50.921  -1.519  1.00 35.72 ? 356 GLN C NE2 1 
ATOM   6026  N  N   . MET C  1 254 ? -3.666   47.017  -3.337  1.00 17.13 ? 357 MET C N   1 
ATOM   6027  C  CA  . MET C  1 254 ? -2.344   46.915  -2.746  1.00 18.10 ? 357 MET C CA  1 
ATOM   6028  C  C   . MET C  1 254 ? -1.300   46.483  -3.764  1.00 18.32 ? 357 MET C C   1 
ATOM   6029  O  O   . MET C  1 254 ? -0.178   46.974  -3.768  1.00 19.05 ? 357 MET C O   1 
ATOM   6030  C  CB  . MET C  1 254 ? -2.363   45.954  -1.581  1.00 19.02 ? 357 MET C CB  1 
ATOM   6031  C  CG  . MET C  1 254 ? -1.005   45.787  -0.936  1.00 19.91 ? 357 MET C CG  1 
ATOM   6032  S  SD  . MET C  1 254 ? -1.126   44.869  0.586   1.00 19.74 ? 357 MET C SD  1 
ATOM   6033  C  CE  . MET C  1 254 ? -1.919   46.072  1.687   1.00 26.69 ? 357 MET C CE  1 
ATOM   6034  N  N   . LYS C  1 255 ? -1.659   45.577  -4.643  1.00 18.61 ? 358 LYS C N   1 
ATOM   6035  C  CA  . LYS C  1 255 ? -0.719   45.112  -5.635  1.00 19.12 ? 358 LYS C CA  1 
ATOM   6036  C  C   . LYS C  1 255 ? -0.425   46.164  -6.741  1.00 20.25 ? 358 LYS C C   1 
ATOM   6037  O  O   . LYS C  1 255 ? 0.717    46.326  -7.161  1.00 18.01 ? 358 LYS C O   1 
ATOM   6038  C  CB  . LYS C  1 255 ? -1.234   43.827  -6.251  1.00 20.77 ? 358 LYS C CB  1 
ATOM   6039  C  CG  . LYS C  1 255 ? -0.446   43.329  -7.439  1.00 20.60 ? 358 LYS C CG  1 
ATOM   6040  C  CD  . LYS C  1 255 ? 0.940    42.858  -7.069  1.00 20.56 ? 358 LYS C CD  1 
ATOM   6041  C  CE  . LYS C  1 255 ? 1.543    42.340  -8.354  1.00 22.51 ? 358 LYS C CE  1 
ATOM   6042  N  NZ  . LYS C  1 255 ? 2.730    41.508  -8.173  1.00 24.25 ? 358 LYS C NZ  1 
ATOM   6043  N  N   . ASP C  1 256 ? -1.436   46.882  -7.194  1.00 20.80 ? 359 ASP C N   1 
ATOM   6044  C  CA  . ASP C  1 256 ? -1.188   48.007  -8.105  1.00 23.58 ? 359 ASP C CA  1 
ATOM   6045  C  C   . ASP C  1 256 ? -0.174   49.009  -7.501  1.00 23.43 ? 359 ASP C C   1 
ATOM   6046  O  O   . ASP C  1 256 ? 0.655    49.558  -8.213  1.00 24.40 ? 359 ASP C O   1 
ATOM   6047  C  CB  . ASP C  1 256 ? -2.494   48.742  -8.439  1.00 25.00 ? 359 ASP C CB  1 
ATOM   6048  C  CG  . ASP C  1 256 ? -3.468   47.877  -9.275  1.00 29.51 ? 359 ASP C CG  1 
ATOM   6049  O  OD1 . ASP C  1 256 ? -3.067   46.819  -9.848  1.00 30.78 ? 359 ASP C OD1 1 
ATOM   6050  O  OD2 . ASP C  1 256 ? -4.667   48.260  -9.312  1.00 34.99 ? 359 ASP C OD2 1 
ATOM   6051  N  N   . LYS C  1 257 ? -0.279   49.250  -6.203  1.00 21.67 ? 360 LYS C N   1 
ATOM   6052  C  CA  . LYS C  1 257 ? 0.528    50.234  -5.545  1.00 24.61 ? 360 LYS C CA  1 
ATOM   6053  C  C   . LYS C  1 257 ? 1.964    49.759  -5.530  1.00 22.72 ? 360 LYS C C   1 
ATOM   6054  O  O   . LYS C  1 257 ? 2.855    50.516  -5.863  1.00 20.50 ? 360 LYS C O   1 
ATOM   6055  C  CB  . LYS C  1 257 ? 0.015    50.503  -4.138  1.00 29.50 ? 360 LYS C CB  1 
ATOM   6056  C  CG  . LYS C  1 257 ? 0.794    51.544  -3.357  1.00 36.99 ? 360 LYS C CG  1 
ATOM   6057  C  CD  . LYS C  1 257 ? 0.580    51.447  -1.836  1.00 43.50 ? 360 LYS C CD  1 
ATOM   6058  C  CE  . LYS C  1 257 ? 1.412    50.288  -1.173  1.00 50.56 ? 360 LYS C CE  1 
ATOM   6059  N  NZ  . LYS C  1 257 ? 0.742    49.435  -0.123  1.00 50.39 ? 360 LYS C NZ  1 
ATOM   6060  N  N   . GLN C  1 258 ? 2.166    48.492  -5.214  1.00 20.74 ? 361 GLN C N   1 
ATOM   6061  C  CA  . GLN C  1 258 ? 3.499    47.916  -5.217  1.00 19.58 ? 361 GLN C CA  1 
ATOM   6062  C  C   . GLN C  1 258 ? 4.110    47.882  -6.603  1.00 20.65 ? 361 GLN C C   1 
ATOM   6063  O  O   . GLN C  1 258 ? 5.317    48.023  -6.734  1.00 20.05 ? 361 GLN C O   1 
ATOM   6064  C  CB  . GLN C  1 258 ? 3.504    46.503  -4.660  1.00 19.30 ? 361 GLN C CB  1 
ATOM   6065  C  CG  . GLN C  1 258 ? 3.040    46.393  -3.207  1.00 20.57 ? 361 GLN C CG  1 
ATOM   6066  C  CD  . GLN C  1 258 ? 2.997    44.949  -2.695  1.00 20.78 ? 361 GLN C CD  1 
ATOM   6067  O  OE1 . GLN C  1 258 ? 3.091    43.978  -3.465  1.00 22.58 ? 361 GLN C OE1 1 
ATOM   6068  N  NE2 . GLN C  1 258 ? 2.908    44.803  -1.392  1.00 19.94 ? 361 GLN C NE2 1 
ATOM   6069  N  N   . ASP C  1 259 ? 3.299    47.618  -7.623  1.00 22.58 ? 362 ASP C N   1 
ATOM   6070  C  CA  . ASP C  1 259 ? 3.771    47.586  -9.011  1.00 23.90 ? 362 ASP C CA  1 
ATOM   6071  C  C   . ASP C  1 259 ? 4.272    48.969  -9.416  1.00 26.70 ? 362 ASP C C   1 
ATOM   6072  O  O   . ASP C  1 259 ? 5.327    49.082  -10.025 1.00 23.91 ? 362 ASP C O   1 
ATOM   6073  C  CB  . ASP C  1 259 ? 2.668    47.152  -9.992  1.00 23.89 ? 362 ASP C CB  1 
ATOM   6074  C  CG  . ASP C  1 259 ? 2.388    45.646  -9.959  1.00 26.95 ? 362 ASP C CG  1 
ATOM   6075  O  OD1 . ASP C  1 259 ? 3.118    44.882  -9.269  1.00 28.44 ? 362 ASP C OD1 1 
ATOM   6076  O  OD2 . ASP C  1 259 ? 1.395    45.204  -10.596 1.00 28.81 ? 362 ASP C OD2 1 
ATOM   6077  N  N   . GLU C  1 260 ? 3.495    50.001  -9.093  1.00 30.59 ? 363 GLU C N   1 
ATOM   6078  C  CA  . GLU C  1 260 ? 3.875    51.406  -9.363  1.00 36.90 ? 363 GLU C CA  1 
ATOM   6079  C  C   . GLU C  1 260 ? 5.204    51.744  -8.684  1.00 35.24 ? 363 GLU C C   1 
ATOM   6080  O  O   . GLU C  1 260 ? 6.102    52.282  -9.320  1.00 35.96 ? 363 GLU C O   1 
ATOM   6081  C  CB  . GLU C  1 260 ? 2.795    52.414  -8.891  1.00 43.33 ? 363 GLU C CB  1 
ATOM   6082  C  CG  . GLU C  1 260 ? 1.420    52.591  -9.589  1.00 55.44 ? 363 GLU C CG  1 
ATOM   6083  C  CD  . GLU C  1 260 ? 0.408    53.513  -8.832  1.00 68.00 ? 363 GLU C CD  1 
ATOM   6084  O  OE1 . GLU C  1 260 ? -0.035   53.118  -7.709  1.00 79.23 ? 363 GLU C OE1 1 
ATOM   6085  O  OE2 . GLU C  1 260 ? -0.030   54.587  -9.349  1.00 74.29 ? 363 GLU C OE2 1 
ATOM   6086  N  N   . GLU C  1 261 ? 5.362    51.406  -7.416  1.00 34.90 ? 364 GLU C N   1 
ATOM   6087  C  CA  . GLU C  1 261 ? 6.652    51.708  -6.727  1.00 41.54 ? 364 GLU C CA  1 
ATOM   6088  C  C   . GLU C  1 261 ? 7.833    50.943  -7.340  1.00 38.08 ? 364 GLU C C   1 
ATOM   6089  O  O   . GLU C  1 261 ? 8.925    51.467  -7.474  1.00 41.37 ? 364 GLU C O   1 
ATOM   6090  C  CB  . GLU C  1 261 ? 6.622    51.411  -5.219  1.00 43.57 ? 364 GLU C CB  1 
ATOM   6091  C  CG  . GLU C  1 261 ? 5.535    52.118  -4.470  1.00 52.92 ? 364 GLU C CG  1 
ATOM   6092  C  CD  . GLU C  1 261 ? 5.131    51.517  -3.137  1.00 61.83 ? 364 GLU C CD  1 
ATOM   6093  O  OE1 . GLU C  1 261 ? 5.690    50.449  -2.747  1.00 76.65 ? 364 GLU C OE1 1 
ATOM   6094  O  OE2 . GLU C  1 261 ? 4.239    52.143  -2.477  1.00 63.64 ? 364 GLU C OE2 1 
ATOM   6095  N  N   . GLN C  1 262 ? 7.596    49.705  -7.711  1.00 33.90 ? 365 GLN C N   1 
ATOM   6096  C  CA  . GLN C  1 262 ? 8.597    48.919  -8.380  1.00 34.12 ? 365 GLN C CA  1 
ATOM   6097  C  C   . GLN C  1 262 ? 9.077    49.606  -9.669  1.00 32.68 ? 365 GLN C C   1 
ATOM   6098  O  O   . GLN C  1 262 ? 10.269   49.654  -9.923  1.00 32.52 ? 365 GLN C O   1 
ATOM   6099  C  CB  . GLN C  1 262 ? 8.025    47.545  -8.719  1.00 34.17 ? 365 GLN C CB  1 
ATOM   6100  C  CG  . GLN C  1 262 ? 9.047    46.544  -9.205  1.00 37.41 ? 365 GLN C CG  1 
ATOM   6101  C  CD  . GLN C  1 262 ? 10.232   46.401  -8.252  1.00 42.66 ? 365 GLN C CD  1 
ATOM   6102  O  OE1 . GLN C  1 262 ? 10.094   46.480  -7.027  1.00 46.23 ? 365 GLN C OE1 1 
ATOM   6103  N  NE2 . GLN C  1 262 ? 11.410   46.201  -8.823  1.00 43.46 ? 365 GLN C NE2 1 
ATOM   6104  N  N   . ARG C  1 263 ? 8.140    50.121  -10.471 1.00 30.62 ? 366 ARG C N   1 
ATOM   6105  C  CA  . ARG C  1 263 ? 8.439    50.810  -11.742 1.00 32.68 ? 366 ARG C CA  1 
ATOM   6106  C  C   . ARG C  1 263 ? 9.319    52.067  -11.557 1.00 36.65 ? 366 ARG C C   1 
ATOM   6107  O  O   . ARG C  1 263 ? 10.010   52.484  -12.461 1.00 40.54 ? 366 ARG C O   1 
ATOM   6108  C  CB  . ARG C  1 263 ? 7.153    51.205  -12.491 1.00 29.22 ? 366 ARG C CB  1 
ATOM   6109  N  N   . LEU C  1 264 ? 9.311    52.663  -10.377 1.00 37.57 ? 367 LEU C N   1 
ATOM   6110  C  CA  . LEU C  1 264 ? 10.089   53.870  -10.160 1.00 36.55 ? 367 LEU C CA  1 
ATOM   6111  C  C   . LEU C  1 264 ? 11.432   53.459  -9.614  1.00 33.71 ? 367 LEU C C   1 
ATOM   6112  O  O   . LEU C  1 264 ? 11.646   53.567  -8.447  1.00 29.95 ? 367 LEU C O   1 
ATOM   6113  C  CB  . LEU C  1 264 ? 9.287    54.875  -9.292  1.00 35.38 ? 367 LEU C CB  1 
ATOM   6114  C  CG  . LEU C  1 264 ? 7.925    55.247  -9.909  1.00 37.31 ? 367 LEU C CG  1 
ATOM   6115  C  CD1 . LEU C  1 264 ? 6.915    55.717  -8.859  1.00 39.92 ? 367 LEU C CD1 1 
ATOM   6116  C  CD2 . LEU C  1 264 ? 8.078    56.297  -11.001 1.00 36.00 ? 367 LEU C CD2 1 
ATOM   6117  N  N   . GLU D  1 9   ? -70.775  103.049 8.642   1.00 48.08 ? 18  GLU D N   1 
ATOM   6118  C  CA  . GLU D  1 9   ? -69.511  103.810 8.533   1.00 46.14 ? 18  GLU D CA  1 
ATOM   6119  C  C   . GLU D  1 9   ? -68.439  102.995 7.790   1.00 41.27 ? 18  GLU D C   1 
ATOM   6120  O  O   . GLU D  1 9   ? -68.449  101.767 7.781   1.00 43.49 ? 18  GLU D O   1 
ATOM   6121  C  CB  . GLU D  1 9   ? -68.988  104.211 9.929   1.00 50.04 ? 18  GLU D CB  1 
ATOM   6122  C  CG  . GLU D  1 9   ? -69.606  105.522 10.444  1.00 54.50 ? 18  GLU D CG  1 
ATOM   6123  C  CD  . GLU D  1 9   ? -68.611  106.404 11.168  1.00 62.42 ? 18  GLU D CD  1 
ATOM   6124  O  OE1 . GLU D  1 9   ? -67.471  106.571 10.667  1.00 69.66 ? 18  GLU D OE1 1 
ATOM   6125  O  OE2 . GLU D  1 9   ? -68.981  106.966 12.224  1.00 63.01 ? 18  GLU D OE2 1 
ATOM   6126  N  N   . PRO D  1 10  ? -67.486  103.681 7.175   1.00 34.72 ? 19  PRO D N   1 
ATOM   6127  C  CA  . PRO D  1 10  ? -66.414  103.051 6.425   1.00 32.54 ? 19  PRO D CA  1 
ATOM   6128  C  C   . PRO D  1 10  ? -65.463  102.253 7.271   1.00 30.33 ? 19  PRO D C   1 
ATOM   6129  O  O   . PRO D  1 10  ? -65.111  102.676 8.344   1.00 36.40 ? 19  PRO D O   1 
ATOM   6130  C  CB  . PRO D  1 10  ? -65.624  104.208 5.884   1.00 34.86 ? 19  PRO D CB  1 
ATOM   6131  C  CG  . PRO D  1 10  ? -66.159  105.444 6.530   1.00 37.47 ? 19  PRO D CG  1 
ATOM   6132  C  CD  . PRO D  1 10  ? -67.467  105.148 7.150   1.00 36.12 ? 19  PRO D CD  1 
ATOM   6133  N  N   . ALA D  1 11  ? -65.034  101.113 6.783   1.00 26.64 ? 20  ALA D N   1 
ATOM   6134  C  CA  . ALA D  1 11  ? -64.043  100.332 7.490   1.00 28.21 ? 20  ALA D CA  1 
ATOM   6135  C  C   . ALA D  1 11  ? -62.652  100.801 7.072   1.00 26.87 ? 20  ALA D C   1 
ATOM   6136  O  O   . ALA D  1 11  ? -62.369  100.977 5.889   1.00 26.45 ? 20  ALA D O   1 
ATOM   6137  C  CB  . ALA D  1 11  ? -64.201  98.858  7.167   1.00 31.21 ? 20  ALA D CB  1 
ATOM   6138  N  N   . VAL D  1 12  ? -61.800  101.028 8.054   1.00 24.29 ? 21  VAL D N   1 
ATOM   6139  C  CA  . VAL D  1 12  ? -60.436  101.416 7.811   1.00 21.76 ? 21  VAL D CA  1 
ATOM   6140  C  C   . VAL D  1 12  ? -59.614  100.270 8.281   1.00 21.41 ? 21  VAL D C   1 
ATOM   6141  O  O   . VAL D  1 12  ? -59.432  100.102 9.456   1.00 26.93 ? 21  VAL D O   1 
ATOM   6142  C  CB  . VAL D  1 12  ? -60.069  102.719 8.573   1.00 22.82 ? 21  VAL D CB  1 
ATOM   6143  C  CG1 . VAL D  1 12  ? -58.632  103.124 8.283   1.00 22.39 ? 21  VAL D CG1 1 
ATOM   6144  C  CG2 . VAL D  1 12  ? -61.010  103.854 8.178   1.00 21.03 ? 21  VAL D CG2 1 
ATOM   6145  N  N   . TYR D  1 13  ? -59.101  99.469  7.369   1.00 22.22 ? 22  TYR D N   1 
ATOM   6146  C  CA  . TYR D  1 13  ? -58.267  98.328  7.741   1.00 22.21 ? 22  TYR D CA  1 
ATOM   6147  C  C   . TYR D  1 13  ? -56.809  98.680  8.039   1.00 21.39 ? 22  TYR D C   1 
ATOM   6148  O  O   . TYR D  1 13  ? -56.098  97.938  8.713   1.00 22.49 ? 22  TYR D O   1 
ATOM   6149  C  CB  . TYR D  1 13  ? -58.281  97.299  6.637   1.00 22.65 ? 22  TYR D CB  1 
ATOM   6150  C  CG  . TYR D  1 13  ? -59.677  96.894  6.230   1.00 24.03 ? 22  TYR D CG  1 
ATOM   6151  C  CD1 . TYR D  1 13  ? -60.549  96.243  7.141   1.00 24.35 ? 22  TYR D CD1 1 
ATOM   6152  C  CD2 . TYR D  1 13  ? -60.132  97.144  4.949   1.00 23.53 ? 22  TYR D CD2 1 
ATOM   6153  C  CE1 . TYR D  1 13  ? -61.844  95.901  6.772   1.00 23.14 ? 22  TYR D CE1 1 
ATOM   6154  C  CE2 . TYR D  1 13  ? -61.389  96.772  4.565   1.00 23.40 ? 22  TYR D CE2 1 
ATOM   6155  C  CZ  . TYR D  1 13  ? -62.233  96.149  5.477   1.00 25.19 ? 22  TYR D CZ  1 
ATOM   6156  O  OH  . TYR D  1 13  ? -63.494  95.815  5.018   1.00 28.88 ? 22  TYR D OH  1 
ATOM   6157  N  N   . PHE D  1 14  ? -56.353  99.779  7.463   1.00 22.22 ? 23  PHE D N   1 
ATOM   6158  C  CA  . PHE D  1 14  ? -54.959  100.235 7.629   1.00 20.14 ? 23  PHE D CA  1 
ATOM   6159  C  C   . PHE D  1 14  ? -54.849  101.684 7.246   1.00 20.15 ? 23  PHE D C   1 
ATOM   6160  O  O   . PHE D  1 14  ? -55.418  102.132 6.219   1.00 20.43 ? 23  PHE D O   1 
ATOM   6161  C  CB  . PHE D  1 14  ? -53.999  99.425  6.775   1.00 20.54 ? 23  PHE D CB  1 
ATOM   6162  C  CG  . PHE D  1 14  ? -52.540  99.709  7.041   1.00 22.91 ? 23  PHE D CG  1 
ATOM   6163  C  CD1 . PHE D  1 14  ? -51.987  99.463  8.325   1.00 23.92 ? 23  PHE D CD1 1 
ATOM   6164  C  CD2 . PHE D  1 14  ? -51.715  100.253 6.062   1.00 23.15 ? 23  PHE D CD2 1 
ATOM   6165  C  CE1 . PHE D  1 14  ? -50.651  99.725  8.609   1.00 22.84 ? 23  PHE D CE1 1 
ATOM   6166  C  CE2 . PHE D  1 14  ? -50.372  100.529 6.349   1.00 24.34 ? 23  PHE D CE2 1 
ATOM   6167  C  CZ  . PHE D  1 14  ? -49.839  100.245 7.608   1.00 24.08 ? 23  PHE D CZ  1 
ATOM   6168  N  N   . LYS D  1 15  ? -54.167  102.435 8.109   1.00 19.40 ? 24  LYS D N   1 
ATOM   6169  C  CA  . LYS D  1 15  ? -53.848  103.821 7.847   1.00 17.95 ? 24  LYS D CA  1 
ATOM   6170  C  C   . LYS D  1 15  ? -52.460  104.103 8.362   1.00 18.03 ? 24  LYS D C   1 
ATOM   6171  O  O   . LYS D  1 15  ? -52.129  103.727 9.485   1.00 18.53 ? 24  LYS D O   1 
ATOM   6172  C  CB  . LYS D  1 15  ? -54.850  104.745 8.503   1.00 18.18 ? 24  LYS D CB  1 
ATOM   6173  C  CG  . LYS D  1 15  ? -54.784  106.166 7.967   1.00 18.27 ? 24  LYS D CG  1 
ATOM   6174  C  CD  . LYS D  1 15  ? -55.656  107.129 8.718   1.00 18.47 ? 24  LYS D CD  1 
ATOM   6175  C  CE  . LYS D  1 15  ? -57.110  106.852 8.442   1.00 19.19 ? 24  LYS D CE  1 
ATOM   6176  N  NZ  . LYS D  1 15  ? -57.891  108.089 8.218   1.00 20.93 ? 24  LYS D NZ  1 
ATOM   6177  N  N   . GLU D  1 16  ? -51.610  104.724 7.539   1.00 17.64 ? 25  GLU D N   1 
ATOM   6178  C  CA  . GLU D  1 16  ? -50.253  105.119 8.000   1.00 16.85 ? 25  GLU D CA  1 
ATOM   6179  C  C   . GLU D  1 16  ? -49.837  106.474 7.422   1.00 17.23 ? 25  GLU D C   1 
ATOM   6180  O  O   . GLU D  1 16  ? -49.700  106.633 6.198   1.00 17.06 ? 25  GLU D O   1 
ATOM   6181  C  CB  . GLU D  1 16  ? -49.211  104.064 7.667   1.00 17.34 ? 25  GLU D CB  1 
ATOM   6182  C  CG  . GLU D  1 16  ? -47.785  104.391 8.111   1.00 18.15 ? 25  GLU D CG  1 
ATOM   6183  C  CD  . GLU D  1 16  ? -47.593  104.425 9.618   1.00 17.64 ? 25  GLU D CD  1 
ATOM   6184  O  OE1 . GLU D  1 16  ? -47.158  103.383 10.160  1.00 17.22 ? 25  GLU D OE1 1 
ATOM   6185  O  OE2 . GLU D  1 16  ? -47.887  105.485 10.249  1.00 18.16 ? 25  GLU D OE2 1 
ATOM   6186  N  N   . GLN D  1 17  ? -49.700  107.464 8.311   1.00 16.97 ? 26  GLN D N   1 
ATOM   6187  C  CA  . GLN D  1 17  ? -49.239  108.787 7.892   1.00 17.24 ? 26  GLN D CA  1 
ATOM   6188  C  C   . GLN D  1 17  ? -47.889  109.211 8.486   1.00 16.26 ? 26  GLN D C   1 
ATOM   6189  O  O   . GLN D  1 17  ? -47.372  110.252 8.137   1.00 16.05 ? 26  GLN D O   1 
ATOM   6190  C  CB  . GLN D  1 17  ? -50.295  109.829 8.139   1.00 17.29 ? 26  GLN D CB  1 
ATOM   6191  C  CG  . GLN D  1 17  ? -51.686  109.372 7.751   1.00 19.03 ? 26  GLN D CG  1 
ATOM   6192  C  CD  . GLN D  1 17  ? -52.732  110.401 8.045   1.00 20.21 ? 26  GLN D CD  1 
ATOM   6193  O  OE1 . GLN D  1 17  ? -53.492  110.263 8.987   1.00 21.45 ? 26  GLN D OE1 1 
ATOM   6194  N  NE2 . GLN D  1 17  ? -52.744  111.470 7.287   1.00 21.47 ? 26  GLN D NE2 1 
ATOM   6195  N  N   . PHE D  1 18  ? -47.333  108.368 9.336   1.00 16.53 ? 27  PHE D N   1 
ATOM   6196  C  CA  . PHE D  1 18  ? -46.086  108.628 9.992   1.00 16.74 ? 27  PHE D CA  1 
ATOM   6197  C  C   . PHE D  1 18  ? -46.106  109.997 10.653  1.00 18.97 ? 27  PHE D C   1 
ATOM   6198  O  O   . PHE D  1 18  ? -45.199  110.798 10.432  1.00 17.41 ? 27  PHE D O   1 
ATOM   6199  C  CB  . PHE D  1 18  ? -44.973  108.588 8.984   1.00 16.34 ? 27  PHE D CB  1 
ATOM   6200  C  CG  . PHE D  1 18  ? -44.963  107.343 8.133   1.00 16.45 ? 27  PHE D CG  1 
ATOM   6201  C  CD1 . PHE D  1 18  ? -44.351  106.205 8.591   1.00 16.75 ? 27  PHE D CD1 1 
ATOM   6202  C  CD2 . PHE D  1 18  ? -45.566  107.321 6.890   1.00 15.54 ? 27  PHE D CD2 1 
ATOM   6203  C  CE1 . PHE D  1 18  ? -44.340  105.052 7.829   1.00 17.44 ? 27  PHE D CE1 1 
ATOM   6204  C  CE2 . PHE D  1 18  ? -45.535  106.196 6.125   1.00 16.06 ? 27  PHE D CE2 1 
ATOM   6205  C  CZ  . PHE D  1 18  ? -44.928  105.055 6.582   1.00 16.77 ? 27  PHE D CZ  1 
ATOM   6206  N  N   . LEU D  1 19  ? -47.147  110.279 11.441  1.00 19.42 ? 28  LEU D N   1 
ATOM   6207  C  CA  . LEU D  1 19  ? -47.305  111.561 12.131  1.00 20.99 ? 28  LEU D CA  1 
ATOM   6208  C  C   . LEU D  1 19  ? -46.736  111.581 13.552  1.00 23.38 ? 28  LEU D C   1 
ATOM   6209  O  O   . LEU D  1 19  ? -46.616  112.639 14.138  1.00 25.72 ? 28  LEU D O   1 
ATOM   6210  C  CB  . LEU D  1 19  ? -48.785  111.937 12.219  1.00 20.90 ? 28  LEU D CB  1 
ATOM   6211  C  CG  . LEU D  1 19  ? -49.479  112.297 10.891  1.00 22.57 ? 28  LEU D CG  1 
ATOM   6212  C  CD1 . LEU D  1 19  ? -50.991  112.190 11.066  1.00 24.25 ? 28  LEU D CD1 1 
ATOM   6213  C  CD2 . LEU D  1 19  ? -49.078  113.693 10.420  1.00 22.13 ? 28  LEU D CD2 1 
ATOM   6214  N  N   . ASP D  1 20  ? -46.421  110.414 14.112  1.00 26.21 ? 29  ASP D N   1 
ATOM   6215  C  CA  . ASP D  1 20  ? -46.100  110.268 15.557  1.00 25.95 ? 29  ASP D CA  1 
ATOM   6216  C  C   . ASP D  1 20  ? -44.603  109.918 15.759  1.00 25.75 ? 29  ASP D C   1 
ATOM   6217  O  O   . ASP D  1 20  ? -44.229  108.962 16.415  1.00 22.77 ? 29  ASP D O   1 
ATOM   6218  C  CB  . ASP D  1 20  ? -47.031  109.225 16.190  1.00 26.76 ? 29  ASP D CB  1 
ATOM   6219  C  CG  . ASP D  1 20  ? -46.858  107.852 15.596  1.00 27.47 ? 29  ASP D CG  1 
ATOM   6220  O  OD1 . ASP D  1 20  ? -46.350  107.717 14.454  1.00 31.12 ? 29  ASP D OD1 1 
ATOM   6221  O  OD2 . ASP D  1 20  ? -47.147  106.867 16.293  1.00 28.91 ? 29  ASP D OD2 1 
ATOM   6222  N  N   . GLY D  1 21  ? -43.763  110.762 15.197  1.00 26.21 ? 30  GLY D N   1 
ATOM   6223  C  CA  . GLY D  1 21  ? -42.341  110.640 15.327  1.00 26.99 ? 30  GLY D CA  1 
ATOM   6224  C  C   . GLY D  1 21  ? -41.837  109.319 14.838  1.00 29.23 ? 30  GLY D C   1 
ATOM   6225  O  O   . GLY D  1 21  ? -42.085  108.924 13.719  1.00 28.95 ? 30  GLY D O   1 
ATOM   6226  N  N   . ASP D  1 22  ? -41.116  108.628 15.709  1.00 32.88 ? 31  ASP D N   1 
ATOM   6227  C  CA  . ASP D  1 22  ? -40.582  107.305 15.390  1.00 34.35 ? 31  ASP D CA  1 
ATOM   6228  C  C   . ASP D  1 22  ? -41.521  106.152 15.670  1.00 29.24 ? 31  ASP D C   1 
ATOM   6229  O  O   . ASP D  1 22  ? -41.091  105.003 15.566  1.00 31.71 ? 31  ASP D O   1 
ATOM   6230  C  CB  . ASP D  1 22  ? -39.349  107.069 16.194  1.00 40.46 ? 31  ASP D CB  1 
ATOM   6231  C  CG  . ASP D  1 22  ? -38.354  108.115 15.943  1.00 51.34 ? 31  ASP D CG  1 
ATOM   6232  O  OD1 . ASP D  1 22  ? -38.680  108.993 15.055  1.00 56.88 ? 31  ASP D OD1 1 
ATOM   6233  O  OD2 . ASP D  1 22  ? -37.283  108.053 16.604  1.00 62.02 ? 31  ASP D OD2 1 
ATOM   6234  N  N   . GLY D  1 23  ? -42.756  106.463 16.051  1.00 23.37 ? 32  GLY D N   1 
ATOM   6235  C  CA  . GLY D  1 23  ? -43.779  105.453 16.300  1.00 23.34 ? 32  GLY D CA  1 
ATOM   6236  C  C   . GLY D  1 23  ? -43.844  104.356 15.240  1.00 23.42 ? 32  GLY D C   1 
ATOM   6237  O  O   . GLY D  1 23  ? -44.000  103.199 15.553  1.00 21.21 ? 32  GLY D O   1 
ATOM   6238  N  N   . TRP D  1 24  ? -43.631  104.732 13.979  1.00 21.95 ? 33  TRP D N   1 
ATOM   6239  C  CA  . TRP D  1 24  ? -43.677  103.781 12.882  1.00 20.05 ? 33  TRP D CA  1 
ATOM   6240  C  C   . TRP D  1 24  ? -42.722  102.619 13.028  1.00 22.06 ? 33  TRP D C   1 
ATOM   6241  O  O   . TRP D  1 24  ? -42.985  101.573 12.439  1.00 20.60 ? 33  TRP D O   1 
ATOM   6242  C  CB  . TRP D  1 24  ? -43.372  104.469 11.542  1.00 19.16 ? 33  TRP D CB  1 
ATOM   6243  C  CG  . TRP D  1 24  ? -41.958  104.816 11.326  1.00 16.99 ? 33  TRP D CG  1 
ATOM   6244  C  CD1 . TRP D  1 24  ? -41.330  105.995 11.712  1.00 16.84 ? 33  TRP D CD1 1 
ATOM   6245  C  CD2 . TRP D  1 24  ? -40.972  104.047 10.646  1.00 15.44 ? 33  TRP D CD2 1 
ATOM   6246  N  NE1 . TRP D  1 24  ? -40.007  105.963 11.337  1.00 16.63 ? 33  TRP D NE1 1 
ATOM   6247  C  CE2 . TRP D  1 24  ? -39.758  104.781 10.694  1.00 14.82 ? 33  TRP D CE2 1 
ATOM   6248  C  CE3 . TRP D  1 24  ? -40.989  102.812 10.012  1.00 15.85 ? 33  TRP D CE3 1 
ATOM   6249  C  CZ2 . TRP D  1 24  ? -38.606  104.330 10.139  1.00 15.98 ? 33  TRP D CZ2 1 
ATOM   6250  C  CZ3 . TRP D  1 24  ? -39.819  102.331 9.460   1.00 15.69 ? 33  TRP D CZ3 1 
ATOM   6251  C  CH2 . TRP D  1 24  ? -38.631  103.083 9.529   1.00 17.07 ? 33  TRP D CH2 1 
ATOM   6252  N  N   . THR D  1 25  ? -41.592  102.803 13.744  1.00 21.43 ? 34  THR D N   1 
ATOM   6253  C  CA  . THR D  1 25  ? -40.565  101.739 13.866  1.00 22.22 ? 34  THR D CA  1 
ATOM   6254  C  C   . THR D  1 25  ? -41.081  100.544 14.678  1.00 23.36 ? 34  THR D C   1 
ATOM   6255  O  O   . THR D  1 25  ? -40.518  99.468  14.602  1.00 25.58 ? 34  THR D O   1 
ATOM   6256  C  CB  . THR D  1 25  ? -39.271  102.205 14.534  1.00 23.49 ? 34  THR D CB  1 
ATOM   6257  O  OG1 . THR D  1 25  ? -39.595  102.837 15.777  1.00 24.21 ? 34  THR D OG1 1 
ATOM   6258  C  CG2 . THR D  1 25  ? -38.527  103.214 13.655  1.00 22.96 ? 34  THR D CG2 1 
ATOM   6259  N  N   . SER D  1 26  ? -42.170  100.730 15.415  1.00 21.86 ? 35  SER D N   1 
ATOM   6260  C  CA  . SER D  1 26  ? -42.828  99.607  16.059  1.00 24.33 ? 35  SER D CA  1 
ATOM   6261  C  C   . SER D  1 26  ? -43.995  99.000  15.229  1.00 23.96 ? 35  SER D C   1 
ATOM   6262  O  O   . SER D  1 26  ? -44.629  98.059  15.677  1.00 26.29 ? 35  SER D O   1 
ATOM   6263  C  CB  . SER D  1 26  ? -43.294  100.009 17.467  1.00 24.23 ? 35  SER D CB  1 
ATOM   6264  O  OG  . SER D  1 26  ? -44.358  100.922 17.373  1.00 24.11 ? 35  SER D OG  1 
ATOM   6265  N  N   . ARG D  1 27  ? -44.305  99.572  14.061  1.00 23.80 ? 36  ARG D N   1 
ATOM   6266  C  CA  . ARG D  1 27  ? -45.430  99.092  13.188  1.00 20.90 ? 36  ARG D CA  1 
ATOM   6267  C  C   . ARG D  1 27  ? -44.940  98.433  11.913  1.00 18.61 ? 36  ARG D C   1 
ATOM   6268  O  O   . ARG D  1 27  ? -45.690  97.740  11.258  1.00 21.30 ? 36  ARG D O   1 
ATOM   6269  C  CB  . ARG D  1 27  ? -46.362  100.229 12.839  1.00 21.29 ? 36  ARG D CB  1 
ATOM   6270  C  CG  . ARG D  1 27  ? -47.012  100.860 14.050  1.00 22.08 ? 36  ARG D CG  1 
ATOM   6271  C  CD  . ARG D  1 27  ? -48.154  101.798 13.697  1.00 22.08 ? 36  ARG D CD  1 
ATOM   6272  N  NE  . ARG D  1 27  ? -47.707  103.029 13.073  1.00 22.60 ? 36  ARG D NE  1 
ATOM   6273  C  CZ  . ARG D  1 27  ? -47.389  104.160 13.709  1.00 27.95 ? 36  ARG D CZ  1 
ATOM   6274  N  NH1 . ARG D  1 27  ? -47.421  104.249 15.054  1.00 28.35 ? 36  ARG D NH1 1 
ATOM   6275  N  NH2 . ARG D  1 27  ? -47.008  105.249 13.001  1.00 25.88 ? 36  ARG D NH2 1 
ATOM   6276  N  N   . TRP D  1 28  ? -43.657  98.583  11.598  1.00 16.18 ? 37  TRP D N   1 
ATOM   6277  C  CA  . TRP D  1 28  ? -43.129  98.022  10.390  1.00 15.23 ? 37  TRP D CA  1 
ATOM   6278  C  C   . TRP D  1 28  ? -41.973  97.122  10.714  1.00 16.49 ? 37  TRP D C   1 
ATOM   6279  O  O   . TRP D  1 28  ? -41.229  97.384  11.633  1.00 18.35 ? 37  TRP D O   1 
ATOM   6280  C  CB  . TRP D  1 28  ? -42.700  99.139  9.383   1.00 14.13 ? 37  TRP D CB  1 
ATOM   6281  C  CG  . TRP D  1 28  ? -43.852  100.028 8.875   1.00 12.48 ? 37  TRP D CG  1 
ATOM   6282  C  CD1 . TRP D  1 28  ? -44.536  100.954 9.591   1.00 12.20 ? 37  TRP D CD1 1 
ATOM   6283  C  CD2 . TRP D  1 28  ? -44.407  100.051 7.546   1.00 10.95 ? 37  TRP D CD2 1 
ATOM   6284  N  NE1 . TRP D  1 28  ? -45.519  101.548 8.784   1.00 12.14 ? 37  TRP D NE1 1 
ATOM   6285  C  CE2 . TRP D  1 28  ? -45.433  101.008 7.528   1.00 10.82 ? 37  TRP D CE2 1 
ATOM   6286  C  CE3 . TRP D  1 28  ? -44.124  99.343  6.371   1.00 10.81 ? 37  TRP D CE3 1 
ATOM   6287  C  CZ2 . TRP D  1 28  ? -46.180  101.267 6.397   1.00 10.57 ? 37  TRP D CZ2 1 
ATOM   6288  C  CZ3 . TRP D  1 28  ? -44.861  99.604  5.254   1.00 9.96  ? 37  TRP D CZ3 1 
ATOM   6289  C  CH2 . TRP D  1 28  ? -45.881  100.553 5.268   1.00 10.10 ? 37  TRP D CH2 1 
ATOM   6290  N  N   . ILE D  1 29  ? -41.761  96.102  9.881   1.00 17.24 ? 38  ILE D N   1 
ATOM   6291  C  CA  . ILE D  1 29  ? -40.760  95.090  10.117  1.00 18.53 ? 38  ILE D CA  1 
ATOM   6292  C  C   . ILE D  1 29  ? -39.907  94.926  8.863   1.00 20.55 ? 38  ILE D C   1 
ATOM   6293  O  O   . ILE D  1 29  ? -40.428  94.774  7.769   1.00 17.80 ? 38  ILE D O   1 
ATOM   6294  C  CB  . ILE D  1 29  ? -41.433  93.686  10.382  1.00 19.27 ? 38  ILE D CB  1 
ATOM   6295  C  CG1 . ILE D  1 29  ? -42.387  93.714  11.581  1.00 22.17 ? 38  ILE D CG1 1 
ATOM   6296  C  CG2 . ILE D  1 29  ? -40.401  92.586  10.501  1.00 18.02 ? 38  ILE D CG2 1 
ATOM   6297  C  CD1 . ILE D  1 29  ? -41.713  93.886  12.908  1.00 22.18 ? 38  ILE D CD1 1 
ATOM   6298  N  N   . GLU D  1 30  ? -38.599  94.850  9.059   1.00 24.97 ? 39  GLU D N   1 
ATOM   6299  C  CA  . GLU D  1 30  ? -37.643  94.637  7.981   1.00 27.01 ? 39  GLU D CA  1 
ATOM   6300  C  C   . GLU D  1 30  ? -37.489  93.171  7.732   1.00 26.14 ? 39  GLU D C   1 
ATOM   6301  O  O   . GLU D  1 30  ? -37.333  92.411  8.652   1.00 27.78 ? 39  GLU D O   1 
ATOM   6302  C  CB  . GLU D  1 30  ? -36.271  95.209  8.339   1.00 32.92 ? 39  GLU D CB  1 
ATOM   6303  C  CG  . GLU D  1 30  ? -36.145  96.710  8.088   1.00 40.16 ? 39  GLU D CG  1 
ATOM   6304  C  CD  . GLU D  1 30  ? -34.759  97.290  8.450   1.00 48.48 ? 39  GLU D CD  1 
ATOM   6305  O  OE1 . GLU D  1 30  ? -33.888  96.596  9.044   1.00 54.27 ? 39  GLU D OE1 1 
ATOM   6306  O  OE2 . GLU D  1 30  ? -34.545  98.488  8.175   1.00 54.72 ? 39  GLU D OE2 1 
ATOM   6307  N  N   . SER D  1 31  ? -37.547  92.766  6.488   1.00 24.26 ? 40  SER D N   1 
ATOM   6308  C  CA  . SER D  1 31  ? -37.238  91.385  6.152   1.00 24.40 ? 40  SER D CA  1 
ATOM   6309  C  C   . SER D  1 31  ? -35.753  91.123  6.354   1.00 24.94 ? 40  SER D C   1 
ATOM   6310  O  O   . SER D  1 31  ? -34.938  91.977  6.060   1.00 24.22 ? 40  SER D O   1 
ATOM   6311  C  CB  . SER D  1 31  ? -37.574  91.095  4.704   1.00 22.64 ? 40  SER D CB  1 
ATOM   6312  O  OG  . SER D  1 31  ? -37.039  89.851  4.283   1.00 21.10 ? 40  SER D OG  1 
ATOM   6313  N  N   . LYS D  1 32  ? -35.412  89.933  6.831   1.00 25.26 ? 41  LYS D N   1 
ATOM   6314  C  CA  . LYS D  1 32  ? -34.007  89.487  6.891   1.00 26.20 ? 41  LYS D CA  1 
ATOM   6315  C  C   . LYS D  1 32  ? -33.704  88.416  5.872   1.00 29.35 ? 41  LYS D C   1 
ATOM   6316  O  O   . LYS D  1 32  ? -32.715  87.702  5.989   1.00 36.94 ? 41  LYS D O   1 
ATOM   6317  C  CB  . LYS D  1 32  ? -33.654  88.982  8.270   1.00 28.19 ? 41  LYS D CB  1 
ATOM   6318  C  CG  . LYS D  1 32  ? -33.851  90.060  9.320   1.00 31.26 ? 41  LYS D CG  1 
ATOM   6319  C  CD  . LYS D  1 32  ? -33.603  89.472  10.697  1.00 38.30 ? 41  LYS D CD  1 
ATOM   6320  C  CE  . LYS D  1 32  ? -33.850  90.491  11.811  1.00 40.42 ? 41  LYS D CE  1 
ATOM   6321  N  NZ  . LYS D  1 32  ? -34.806  89.911  12.794  1.00 40.74 ? 41  LYS D NZ  1 
ATOM   6322  N  N   . HIS D  1 33  ? -34.547  88.290  4.863   1.00 28.38 ? 42  HIS D N   1 
ATOM   6323  C  CA  . HIS D  1 33  ? -34.353  87.242  3.860   1.00 28.70 ? 42  HIS D CA  1 
ATOM   6324  C  C   . HIS D  1 33  ? -32.975  87.333  3.211   1.00 30.83 ? 42  HIS D C   1 
ATOM   6325  O  O   . HIS D  1 33  ? -32.359  86.323  2.886   1.00 28.50 ? 42  HIS D O   1 
ATOM   6326  C  CB  . HIS D  1 33  ? -35.422  87.305  2.765   1.00 25.28 ? 42  HIS D CB  1 
ATOM   6327  C  CG  . HIS D  1 33  ? -35.237  86.292  1.699   1.00 22.27 ? 42  HIS D CG  1 
ATOM   6328  N  ND1 . HIS D  1 33  ? -35.546  84.955  1.885   1.00 22.69 ? 42  HIS D ND1 1 
ATOM   6329  C  CD2 . HIS D  1 33  ? -34.750  86.397  0.439   1.00 21.76 ? 42  HIS D CD2 1 
ATOM   6330  C  CE1 . HIS D  1 33  ? -35.278  84.290  0.773   1.00 20.54 ? 42  HIS D CE1 1 
ATOM   6331  N  NE2 . HIS D  1 33  ? -34.791  85.140  -0.117  1.00 20.12 ? 42  HIS D NE2 1 
ATOM   6332  N  N   . LYS D  1 34  ? -32.514  88.563  3.039   1.00 34.51 ? 43  LYS D N   1 
ATOM   6333  C  CA  . LYS D  1 34  ? -31.167  88.857  2.593   1.00 35.53 ? 43  LYS D CA  1 
ATOM   6334  C  C   . LYS D  1 34  ? -30.492  89.766  3.594   1.00 35.39 ? 43  LYS D C   1 
ATOM   6335  O  O   . LYS D  1 34  ? -31.166  90.414  4.422   1.00 32.05 ? 43  LYS D O   1 
ATOM   6336  C  CB  . LYS D  1 34  ? -31.187  89.556  1.258   1.00 39.50 ? 43  LYS D CB  1 
ATOM   6337  C  CG  . LYS D  1 34  ? -31.425  88.664  0.067   1.00 42.86 ? 43  LYS D CG  1 
ATOM   6338  C  CD  . LYS D  1 34  ? -31.521  89.656  -1.092  1.00 48.54 ? 43  LYS D CD  1 
ATOM   6339  C  CE  . LYS D  1 34  ? -32.516  89.302  -2.163  1.00 47.12 ? 43  LYS D CE  1 
ATOM   6340  N  NZ  . LYS D  1 34  ? -32.300  90.053  -3.414  1.00 45.97 ? 43  LYS D NZ  1 
ATOM   6341  N  N   . SER D  1 35  ? -29.151  89.791  3.527   1.00 35.41 ? 44  SER D N   1 
ATOM   6342  C  CA  . SER D  1 35  ? -28.319  90.590  4.466   1.00 37.39 ? 44  SER D CA  1 
ATOM   6343  C  C   . SER D  1 35  ? -28.037  92.020  3.966   1.00 33.78 ? 44  SER D C   1 
ATOM   6344  O  O   . SER D  1 35  ? -27.705  92.869  4.763   1.00 32.79 ? 44  SER D O   1 
ATOM   6345  C  CB  . SER D  1 35  ? -26.974  89.907  4.722   1.00 41.15 ? 44  SER D CB  1 
ATOM   6346  O  OG  . SER D  1 35  ? -26.157  89.942  3.550   1.00 41.56 ? 44  SER D OG  1 
ATOM   6347  N  N   . ASP D  1 36  ? -28.275  92.275  2.671   1.00 32.34 ? 45  ASP D N   1 
ATOM   6348  C  CA  . ASP D  1 36  ? -27.958  93.556  2.006   1.00 29.24 ? 45  ASP D CA  1 
ATOM   6349  C  C   . ASP D  1 36  ? -29.159  94.326  1.418   1.00 25.60 ? 45  ASP D C   1 
ATOM   6350  O  O   . ASP D  1 36  ? -29.015  95.088  0.450   1.00 24.00 ? 45  ASP D O   1 
ATOM   6351  C  CB  . ASP D  1 36  ? -26.947  93.298  0.888   1.00 29.44 ? 45  ASP D CB  1 
ATOM   6352  C  CG  . ASP D  1 36  ? -27.510  92.426  -0.218  1.00 33.71 ? 45  ASP D CG  1 
ATOM   6353  O  OD1 . ASP D  1 36  ? -28.570  91.756  -0.009  1.00 37.90 ? 45  ASP D OD1 1 
ATOM   6354  O  OD2 . ASP D  1 36  ? -26.906  92.423  -1.320  1.00 37.14 ? 45  ASP D OD2 1 
ATOM   6355  N  N   . PHE D  1 37  ? -30.331  94.166  2.017   1.00 23.76 ? 46  PHE D N   1 
ATOM   6356  C  CA  . PHE D  1 37  ? -31.475  95.070  1.712   1.00 24.11 ? 46  PHE D CA  1 
ATOM   6357  C  C   . PHE D  1 37  ? -31.141  96.532  2.036   1.00 23.19 ? 46  PHE D C   1 
ATOM   6358  O  O   . PHE D  1 37  ? -30.509  96.812  3.032   1.00 24.30 ? 46  PHE D O   1 
ATOM   6359  C  CB  . PHE D  1 37  ? -32.747  94.699  2.490   1.00 23.11 ? 46  PHE D CB  1 
ATOM   6360  C  CG  . PHE D  1 37  ? -33.462  93.441  1.998   1.00 22.33 ? 46  PHE D CG  1 
ATOM   6361  C  CD1 . PHE D  1 37  ? -33.715  93.222  0.642   1.00 21.13 ? 46  PHE D CD1 1 
ATOM   6362  C  CD2 . PHE D  1 37  ? -33.901  92.487  2.919   1.00 21.78 ? 46  PHE D CD2 1 
ATOM   6363  C  CE1 . PHE D  1 37  ? -34.383  92.078  0.204   1.00 20.66 ? 46  PHE D CE1 1 
ATOM   6364  C  CE2 . PHE D  1 37  ? -34.568  91.335  2.500   1.00 21.75 ? 46  PHE D CE2 1 
ATOM   6365  C  CZ  . PHE D  1 37  ? -34.811  91.133  1.136   1.00 21.96 ? 46  PHE D CZ  1 
ATOM   6366  N  N   . GLY D  1 38  ? -31.604  97.450  1.202   1.00 22.66 ? 47  GLY D N   1 
ATOM   6367  C  CA  . GLY D  1 38  ? -31.558  98.873  1.501   1.00 22.31 ? 47  GLY D CA  1 
ATOM   6368  C  C   . GLY D  1 38  ? -32.406  99.224  2.689   1.00 22.93 ? 47  GLY D C   1 
ATOM   6369  O  O   . GLY D  1 38  ? -33.277  98.477  3.048   1.00 25.40 ? 47  GLY D O   1 
ATOM   6370  N  N   . LYS D  1 39  ? -32.148  100.371 3.307   1.00 25.61 ? 48  LYS D N   1 
ATOM   6371  C  CA  . LYS D  1 39  ? -32.871  100.833 4.491   1.00 26.96 ? 48  LYS D CA  1 
ATOM   6372  C  C   . LYS D  1 39  ? -33.819  101.969 4.124   1.00 23.68 ? 48  LYS D C   1 
ATOM   6373  O  O   . LYS D  1 39  ? -33.451  102.894 3.410   1.00 22.55 ? 48  LYS D O   1 
ATOM   6374  C  CB  . LYS D  1 39  ? -31.912  101.429 5.570   1.00 33.73 ? 48  LYS D CB  1 
ATOM   6375  C  CG  . LYS D  1 39  ? -30.788  100.484 6.101   1.00 41.25 ? 48  LYS D CG  1 
ATOM   6376  C  CD  . LYS D  1 39  ? -31.296  99.715  7.316   1.00 46.08 ? 48  LYS D CD  1 
ATOM   6377  C  CE  . LYS D  1 39  ? -30.260  98.906  8.055   1.00 49.93 ? 48  LYS D CE  1 
ATOM   6378  N  NZ  . LYS D  1 39  ? -30.760  97.622  8.624   1.00 53.99 ? 48  LYS D NZ  1 
ATOM   6379  N  N   . PHE D  1 40  ? -35.015  101.936 4.686   1.00 20.92 ? 49  PHE D N   1 
ATOM   6380  C  CA  . PHE D  1 40  ? -35.916  103.092 4.660   1.00 18.92 ? 49  PHE D CA  1 
ATOM   6381  C  C   . PHE D  1 40  ? -35.558  103.974 5.810   1.00 18.49 ? 49  PHE D C   1 
ATOM   6382  O  O   . PHE D  1 40  ? -35.231  103.491 6.872   1.00 16.80 ? 49  PHE D O   1 
ATOM   6383  C  CB  . PHE D  1 40  ? -37.420  102.702 4.760   1.00 18.94 ? 49  PHE D CB  1 
ATOM   6384  C  CG  . PHE D  1 40  ? -37.979  102.083 3.515   1.00 19.32 ? 49  PHE D CG  1 
ATOM   6385  C  CD1 . PHE D  1 40  ? -38.550  102.875 2.516   1.00 17.74 ? 49  PHE D CD1 1 
ATOM   6386  C  CD2 . PHE D  1 40  ? -37.939  100.697 3.344   1.00 18.36 ? 49  PHE D CD2 1 
ATOM   6387  C  CE1 . PHE D  1 40  ? -39.049  102.294 1.358   1.00 17.72 ? 49  PHE D CE1 1 
ATOM   6388  C  CE2 . PHE D  1 40  ? -38.486  100.112 2.217   1.00 18.45 ? 49  PHE D CE2 1 
ATOM   6389  C  CZ  . PHE D  1 40  ? -39.032  100.911 1.214   1.00 18.06 ? 49  PHE D CZ  1 
ATOM   6390  N  N   . VAL D  1 41  ? -35.686  105.286 5.593   1.00 18.32 ? 50  VAL D N   1 
ATOM   6391  C  CA  . VAL D  1 41  ? -35.569  106.275 6.652   1.00 17.78 ? 50  VAL D CA  1 
ATOM   6392  C  C   . VAL D  1 41  ? -36.771  107.192 6.634   1.00 17.04 ? 50  VAL D C   1 
ATOM   6393  O  O   . VAL D  1 41  ? -37.371  107.406 5.612   1.00 16.58 ? 50  VAL D O   1 
ATOM   6394  C  CB  . VAL D  1 41  ? -34.261  107.111 6.581   1.00 18.90 ? 50  VAL D CB  1 
ATOM   6395  C  CG1 . VAL D  1 41  ? -33.070  106.166 6.647   1.00 19.10 ? 50  VAL D CG1 1 
ATOM   6396  C  CG2 . VAL D  1 41  ? -34.183  107.980 5.323   1.00 19.85 ? 50  VAL D CG2 1 
ATOM   6397  N  N   . LEU D  1 42  ? -37.103  107.749 7.775   1.00 17.09 ? 51  LEU D N   1 
ATOM   6398  C  CA  . LEU D  1 42  ? -38.176  108.711 7.861   1.00 16.82 ? 51  LEU D CA  1 
ATOM   6399  C  C   . LEU D  1 42  ? -37.684  110.042 7.408   1.00 18.21 ? 51  LEU D C   1 
ATOM   6400  O  O   . LEU D  1 42  ? -36.706  110.551 7.926   1.00 18.97 ? 51  LEU D O   1 
ATOM   6401  C  CB  . LEU D  1 42  ? -38.696  108.803 9.292   1.00 17.94 ? 51  LEU D CB  1 
ATOM   6402  C  CG  . LEU D  1 42  ? -39.978  109.623 9.435   1.00 18.73 ? 51  LEU D CG  1 
ATOM   6403  C  CD1 . LEU D  1 42  ? -41.160  108.860 8.827   1.00 19.09 ? 51  LEU D CD1 1 
ATOM   6404  C  CD2 . LEU D  1 42  ? -40.253  109.952 10.898  1.00 19.88 ? 51  LEU D CD2 1 
ATOM   6405  N  N   . SER D  1 43  ? -38.393  110.646 6.452   1.00 19.62 ? 52  SER D N   1 
ATOM   6406  C  CA  . SER D  1 43  ? -38.007  111.915 5.859   1.00 17.92 ? 52  SER D CA  1 
ATOM   6407  C  C   . SER D  1 43  ? -39.144  112.601 5.119   1.00 17.24 ? 52  SER D C   1 
ATOM   6408  O  O   . SER D  1 43  ? -39.969  111.950 4.493   1.00 16.88 ? 52  SER D O   1 
ATOM   6409  C  CB  . SER D  1 43  ? -36.849  111.675 4.885   1.00 19.07 ? 52  SER D CB  1 
ATOM   6410  O  OG  . SER D  1 43  ? -36.292  112.902 4.428   1.00 20.27 ? 52  SER D OG  1 
ATOM   6411  N  N   . SER D  1 44  ? -39.135  113.944 5.132   1.00 18.00 ? 53  SER D N   1 
ATOM   6412  C  CA  . SER D  1 44  ? -39.986  114.784 4.217   1.00 17.11 ? 53  SER D CA  1 
ATOM   6413  C  C   . SER D  1 44  ? -39.170  115.365 3.029   1.00 15.98 ? 53  SER D C   1 
ATOM   6414  O  O   . SER D  1 44  ? -39.689  116.100 2.223   1.00 15.71 ? 53  SER D O   1 
ATOM   6415  C  CB  . SER D  1 44  ? -40.742  115.888 4.938   1.00 16.19 ? 53  SER D CB  1 
ATOM   6416  O  OG  . SER D  1 44  ? -39.906  116.652 5.808   1.00 16.65 ? 53  SER D OG  1 
ATOM   6417  N  N   . GLY D  1 45  ? -37.901  115.002 2.935   1.00 16.40 ? 54  GLY D N   1 
ATOM   6418  C  CA  . GLY D  1 45  ? -37.013  115.419 1.802   1.00 15.83 ? 54  GLY D CA  1 
ATOM   6419  C  C   . GLY D  1 45  ? -36.715  116.902 1.759   1.00 16.34 ? 54  GLY D C   1 
ATOM   6420  O  O   . GLY D  1 45  ? -36.922  117.628 2.723   1.00 15.70 ? 54  GLY D O   1 
ATOM   6421  N  N   . LYS D  1 46  ? -36.189  117.351 0.632   1.00 18.61 ? 55  LYS D N   1 
ATOM   6422  C  CA  . LYS D  1 46  ? -35.641  118.735 0.475   1.00 19.16 ? 55  LYS D CA  1 
ATOM   6423  C  C   . LYS D  1 46  ? -36.735  119.768 0.285   1.00 18.54 ? 55  LYS D C   1 
ATOM   6424  O  O   . LYS D  1 46  ? -36.579  120.917 0.650   1.00 21.46 ? 55  LYS D O   1 
ATOM   6425  C  CB  . LYS D  1 46  ? -34.593  118.778 -0.672  1.00 19.64 ? 55  LYS D CB  1 
ATOM   6426  N  N   . PHE D  1 47  ? -37.842  119.368 -0.326  1.00 18.03 ? 56  PHE D N   1 
ATOM   6427  C  CA  . PHE D  1 47  ? -39.032  120.242 -0.440  1.00 14.72 ? 56  PHE D CA  1 
ATOM   6428  C  C   . PHE D  1 47  ? -40.284  119.461 -0.111  1.00 13.84 ? 56  PHE D C   1 
ATOM   6429  O  O   . PHE D  1 47  ? -40.326  118.247 -0.255  1.00 14.38 ? 56  PHE D O   1 
ATOM   6430  C  CB  . PHE D  1 47  ? -39.151  120.855 -1.834  1.00 14.16 ? 56  PHE D CB  1 
ATOM   6431  C  CG  . PHE D  1 47  ? -39.272  119.861 -2.918  1.00 14.30 ? 56  PHE D CG  1 
ATOM   6432  C  CD1 . PHE D  1 47  ? -38.145  119.201 -3.388  1.00 14.21 ? 56  PHE D CD1 1 
ATOM   6433  C  CD2 . PHE D  1 47  ? -40.513  119.565 -3.467  1.00 13.42 ? 56  PHE D CD2 1 
ATOM   6434  C  CE1 . PHE D  1 47  ? -38.245  118.243 -4.386  1.00 14.14 ? 56  PHE D CE1 1 
ATOM   6435  C  CE2 . PHE D  1 47  ? -40.619  118.634 -4.461  1.00 13.89 ? 56  PHE D CE2 1 
ATOM   6436  C  CZ  . PHE D  1 47  ? -39.489  117.955 -4.921  1.00 13.80 ? 56  PHE D CZ  1 
ATOM   6437  N  N   . TYR D  1 48  ? -41.306  120.186 0.303   1.00 13.09 ? 57  TYR D N   1 
ATOM   6438  C  CA  . TYR D  1 48  ? -42.492  119.613 0.872   1.00 13.10 ? 57  TYR D CA  1 
ATOM   6439  C  C   . TYR D  1 48  ? -43.538  120.683 1.060   1.00 12.79 ? 57  TYR D C   1 
ATOM   6440  O  O   . TYR D  1 48  ? -43.270  121.864 0.963   1.00 11.88 ? 57  TYR D O   1 
ATOM   6441  C  CB  . TYR D  1 48  ? -42.190  119.036 2.244   1.00 14.62 ? 57  TYR D CB  1 
ATOM   6442  C  CG  . TYR D  1 48  ? -41.261  119.927 3.052   1.00 14.96 ? 57  TYR D CG  1 
ATOM   6443  C  CD1 . TYR D  1 48  ? -41.697  121.120 3.624   1.00 15.49 ? 57  TYR D CD1 1 
ATOM   6444  C  CD2 . TYR D  1 48  ? -39.921  119.591 3.174   1.00 16.27 ? 57  TYR D CD2 1 
ATOM   6445  C  CE1 . TYR D  1 48  ? -40.828  121.933 4.317   1.00 15.11 ? 57  TYR D CE1 1 
ATOM   6446  C  CE2 . TYR D  1 48  ? -39.049  120.397 3.868   1.00 16.99 ? 57  TYR D CE2 1 
ATOM   6447  C  CZ  . TYR D  1 48  ? -39.521  121.545 4.444   1.00 15.78 ? 57  TYR D CZ  1 
ATOM   6448  O  OH  . TYR D  1 48  ? -38.622  122.286 5.103   1.00 17.91 ? 57  TYR D OH  1 
ATOM   6449  N  N   . GLY D  1 49  ? -44.761  120.247 1.280   1.00 12.17 ? 58  GLY D N   1 
ATOM   6450  C  CA  . GLY D  1 49  ? -45.816  121.147 1.610   1.00 12.71 ? 58  GLY D CA  1 
ATOM   6451  C  C   . GLY D  1 49  ? -45.793  121.501 3.076   1.00 13.48 ? 58  GLY D C   1 
ATOM   6452  O  O   . GLY D  1 49  ? -46.073  122.635 3.421   1.00 14.25 ? 58  GLY D O   1 
ATOM   6453  N  N   . ASP D  1 50  ? -45.526  120.523 3.927   1.00 14.19 ? 59  ASP D N   1 
ATOM   6454  C  CA  . ASP D  1 50  ? -45.442  120.745 5.382   1.00 15.93 ? 59  ASP D CA  1 
ATOM   6455  C  C   . ASP D  1 50  ? -44.383  119.814 5.908   1.00 17.11 ? 59  ASP D C   1 
ATOM   6456  O  O   . ASP D  1 50  ? -44.442  118.597 5.659   1.00 18.20 ? 59  ASP D O   1 
ATOM   6457  C  CB  . ASP D  1 50  ? -46.756  120.425 6.066   1.00 17.32 ? 59  ASP D CB  1 
ATOM   6458  C  CG  . ASP D  1 50  ? -46.707  120.607 7.584   1.00 18.00 ? 59  ASP D CG  1 
ATOM   6459  O  OD1 . ASP D  1 50  ? -46.166  119.777 8.380   1.00 19.85 ? 59  ASP D OD1 1 
ATOM   6460  O  OD2 . ASP D  1 50  ? -47.182  121.642 7.976   1.00 17.29 ? 59  ASP D OD2 1 
ATOM   6461  N  N   . GLU D  1 51  ? -43.378  120.374 6.566   1.00 17.13 ? 60  GLU D N   1 
ATOM   6462  C  CA  . GLU D  1 51  ? -42.181  119.595 6.928   1.00 18.16 ? 60  GLU D CA  1 
ATOM   6463  C  C   . GLU D  1 51  ? -42.503  118.320 7.734   1.00 17.31 ? 60  GLU D C   1 
ATOM   6464  O  O   . GLU D  1 51  ? -41.804  117.306 7.617   1.00 16.84 ? 60  GLU D O   1 
ATOM   6465  C  CB  . GLU D  1 51  ? -41.173  120.466 7.706   1.00 19.85 ? 60  GLU D CB  1 
ATOM   6466  C  CG  . GLU D  1 51  ? -39.777  119.817 7.822   1.00 21.87 ? 60  GLU D CG  1 
ATOM   6467  C  CD  . GLU D  1 51  ? -38.714  120.715 8.465   1.00 23.80 ? 60  GLU D CD  1 
ATOM   6468  O  OE1 . GLU D  1 51  ? -39.062  121.823 8.932   1.00 23.94 ? 60  GLU D OE1 1 
ATOM   6469  O  OE2 . GLU D  1 51  ? -37.528  120.301 8.511   1.00 24.73 ? 60  GLU D OE2 1 
ATOM   6470  N  N   . GLU D  1 52  ? -43.527  118.414 8.567   1.00 16.87 ? 61  GLU D N   1 
ATOM   6471  C  CA  . GLU D  1 52  ? -43.926  117.307 9.465   1.00 17.68 ? 61  GLU D CA  1 
ATOM   6472  C  C   . GLU D  1 52  ? -44.965  116.365 8.834   1.00 16.43 ? 61  GLU D C   1 
ATOM   6473  O  O   . GLU D  1 52  ? -44.747  115.167 8.796   1.00 17.85 ? 61  GLU D O   1 
ATOM   6474  C  CB  . GLU D  1 52  ? -44.487  117.839 10.819  1.00 19.39 ? 61  GLU D CB  1 
ATOM   6475  C  CG  . GLU D  1 52  ? -43.425  118.488 11.719  1.00 22.20 ? 61  GLU D CG  1 
ATOM   6476  C  CD  . GLU D  1 52  ? -42.053  117.767 11.788  1.00 26.05 ? 61  GLU D CD  1 
ATOM   6477  O  OE1 . GLU D  1 52  ? -41.988  116.506 11.928  1.00 27.06 ? 61  GLU D OE1 1 
ATOM   6478  O  OE2 . GLU D  1 52  ? -41.022  118.494 11.665  1.00 29.96 ? 61  GLU D OE2 1 
ATOM   6479  N  N   . LYS D  1 53  ? -46.047  116.918 8.282   1.00 15.71 ? 62  LYS D N   1 
ATOM   6480  C  CA  . LYS D  1 53  ? -47.070  116.088 7.646   1.00 15.78 ? 62  LYS D CA  1 
ATOM   6481  C  C   . LYS D  1 53  ? -46.505  115.212 6.550   1.00 14.93 ? 62  LYS D C   1 
ATOM   6482  O  O   . LYS D  1 53  ? -46.871  114.037 6.428   1.00 15.04 ? 62  LYS D O   1 
ATOM   6483  C  CB  . LYS D  1 53  ? -48.180  116.924 7.074   1.00 16.70 ? 62  LYS D CB  1 
ATOM   6484  C  CG  . LYS D  1 53  ? -49.026  117.618 8.113   1.00 17.91 ? 62  LYS D CG  1 
ATOM   6485  C  CD  . LYS D  1 53  ? -50.086  118.436 7.406   1.00 18.87 ? 62  LYS D CD  1 
ATOM   6486  C  CE  . LYS D  1 53  ? -50.789  119.309 8.399   1.00 22.49 ? 62  LYS D CE  1 
ATOM   6487  N  NZ  . LYS D  1 53  ? -51.619  120.288 7.607   1.00 23.05 ? 62  LYS D NZ  1 
ATOM   6488  N  N   . ASP D  1 54  ? -45.579  115.776 5.755   1.00 14.11 ? 63  ASP D N   1 
ATOM   6489  C  CA  . ASP D  1 54  ? -45.078  115.116 4.553   1.00 13.78 ? 63  ASP D CA  1 
ATOM   6490  C  C   . ASP D  1 54  ? -43.929  114.158 4.810   1.00 14.45 ? 63  ASP D C   1 
ATOM   6491  O  O   . ASP D  1 54  ? -43.281  113.669 3.869   1.00 15.17 ? 63  ASP D O   1 
ATOM   6492  C  CB  . ASP D  1 54  ? -44.796  116.134 3.446   1.00 14.21 ? 63  ASP D CB  1 
ATOM   6493  C  CG  . ASP D  1 54  ? -46.107  116.795 2.939   1.00 15.22 ? 63  ASP D CG  1 
ATOM   6494  O  OD1 . ASP D  1 54  ? -47.074  116.020 2.660   1.00 15.93 ? 63  ASP D OD1 1 
ATOM   6495  O  OD2 . ASP D  1 54  ? -46.189  118.056 2.860   1.00 14.98 ? 63  ASP D OD2 1 
ATOM   6496  N  N   . LYS D  1 55  ? -43.698  113.835 6.078   1.00 15.32 ? 64  LYS D N   1 
ATOM   6497  C  CA  . LYS D  1 55  ? -42.802  112.738 6.377   1.00 16.99 ? 64  LYS D CA  1 
ATOM   6498  C  C   . LYS D  1 55  ? -43.382  111.402 5.952   1.00 15.78 ? 64  LYS D C   1 
ATOM   6499  O  O   . LYS D  1 55  ? -44.532  111.115 6.191   1.00 15.68 ? 64  LYS D O   1 
ATOM   6500  C  CB  . LYS D  1 55  ? -42.445  112.678 7.857   1.00 20.33 ? 64  LYS D CB  1 
ATOM   6501  C  CG  . LYS D  1 55  ? -41.753  113.913 8.393   1.00 23.16 ? 64  LYS D CG  1 
ATOM   6502  C  CD  . LYS D  1 55  ? -40.627  113.532 9.338   1.00 26.55 ? 64  LYS D CD  1 
ATOM   6503  C  CE  . LYS D  1 55  ? -39.887  114.758 9.827   1.00 28.93 ? 64  LYS D CE  1 
ATOM   6504  N  NZ  . LYS D  1 55  ? -40.158  115.138 11.228  1.00 31.02 ? 64  LYS D NZ  1 
ATOM   6505  N  N   . GLY D  1 56  ? -42.524  110.577 5.350   1.00 15.40 ? 65  GLY D N   1 
ATOM   6506  C  CA  . GLY D  1 56  ? -42.857  109.233 4.953   1.00 13.60 ? 65  GLY D CA  1 
ATOM   6507  C  C   . GLY D  1 56  ? -41.619  108.367 4.881   1.00 13.68 ? 65  GLY D C   1 
ATOM   6508  O  O   . GLY D  1 56  ? -40.547  108.759 5.268   1.00 13.09 ? 65  GLY D O   1 
ATOM   6509  N  N   . LEU D  1 57  ? -41.759  107.183 4.333   1.00 14.66 ? 66  LEU D N   1 
ATOM   6510  C  CA  . LEU D  1 57  ? -40.651  106.283 4.224   1.00 15.26 ? 66  LEU D CA  1 
ATOM   6511  C  C   . LEU D  1 57  ? -39.904  106.558 2.977   1.00 16.27 ? 66  LEU D C   1 
ATOM   6512  O  O   . LEU D  1 57  ? -40.438  106.490 1.896   1.00 16.42 ? 66  LEU D O   1 
ATOM   6513  C  CB  . LEU D  1 57  ? -41.100  104.849 4.192   1.00 15.56 ? 66  LEU D CB  1 
ATOM   6514  C  CG  . LEU D  1 57  ? -41.825  104.352 5.432   1.00 17.11 ? 66  LEU D CG  1 
ATOM   6515  C  CD1 . LEU D  1 57  ? -42.532  103.006 5.149   1.00 16.85 ? 66  LEU D CD1 1 
ATOM   6516  C  CD2 . LEU D  1 57  ? -40.849  104.198 6.557   1.00 17.45 ? 66  LEU D CD2 1 
ATOM   6517  N  N   . GLN D  1 58  ? -38.603  106.808 3.127   1.00 18.37 ? 67  GLN D N   1 
ATOM   6518  C  CA  . GLN D  1 58  ? -37.742  107.173 2.011   1.00 16.21 ? 67  GLN D CA  1 
ATOM   6519  C  C   . GLN D  1 58  ? -36.691  106.125 1.791   1.00 15.34 ? 67  GLN D C   1 
ATOM   6520  O  O   . GLN D  1 58  ? -35.992  105.737 2.715   1.00 16.96 ? 67  GLN D O   1 
ATOM   6521  C  CB  . GLN D  1 58  ? -37.081  108.531 2.293   1.00 17.45 ? 67  GLN D CB  1 
ATOM   6522  C  CG  . GLN D  1 58  ? -36.186  109.018 1.141   1.00 18.20 ? 67  GLN D CG  1 
ATOM   6523  C  CD  . GLN D  1 58  ? -35.572  110.380 1.384   1.00 18.97 ? 67  GLN D CD  1 
ATOM   6524  O  OE1 . GLN D  1 58  ? -35.011  110.636 2.434   1.00 20.94 ? 67  GLN D OE1 1 
ATOM   6525  N  NE2 . GLN D  1 58  ? -35.679  111.257 0.410   1.00 19.67 ? 67  GLN D NE2 1 
ATOM   6526  N  N   . THR D  1 59  ? -36.556  105.671 0.567   1.00 14.61 ? 68  THR D N   1 
ATOM   6527  C  CA  . THR D  1 59  ? -35.456  104.793 0.225   1.00 15.11 ? 68  THR D CA  1 
ATOM   6528  C  C   . THR D  1 59  ? -34.122  105.568 0.305   1.00 15.06 ? 68  THR D C   1 
ATOM   6529  O  O   . THR D  1 59  ? -34.011  106.682 -0.229  1.00 14.01 ? 68  THR D O   1 
ATOM   6530  C  CB  . THR D  1 59  ? -35.606  104.209 -1.185  1.00 16.10 ? 68  THR D CB  1 
ATOM   6531  O  OG1 . THR D  1 59  ? -35.783  105.274 -2.131  1.00 17.33 ? 68  THR D OG1 1 
ATOM   6532  C  CG2 . THR D  1 59  ? -36.787  103.274 -1.256  1.00 15.81 ? 68  THR D CG2 1 
ATOM   6533  N  N   . SER D  1 60  ? -33.135  104.993 1.016   1.00 14.54 ? 69  SER D N   1 
ATOM   6534  C  CA  . SER D  1 60  ? -31.915  105.725 1.411   1.00 14.31 ? 69  SER D CA  1 
ATOM   6535  C  C   . SER D  1 60  ? -30.635  105.235 0.757   1.00 14.41 ? 69  SER D C   1 
ATOM   6536  O  O   . SER D  1 60  ? -29.606  105.797 0.991   1.00 16.44 ? 69  SER D O   1 
ATOM   6537  C  CB  . SER D  1 60  ? -31.733  105.660 2.914   1.00 14.85 ? 69  SER D CB  1 
ATOM   6538  O  OG  . SER D  1 60  ? -31.144  104.405 3.256   1.00 15.63 ? 69  SER D OG  1 
ATOM   6539  N  N   . GLN D  1 61  ? -30.700  104.203 -0.051  1.00 15.12 ? 70  GLN D N   1 
ATOM   6540  C  CA  . GLN D  1 61  ? -29.528  103.650 -0.664  1.00 16.80 ? 70  GLN D CA  1 
ATOM   6541  C  C   . GLN D  1 61  ? -29.744  103.242 -2.129  1.00 18.68 ? 70  GLN D C   1 
ATOM   6542  O  O   . GLN D  1 61  ? -30.758  102.650 -2.492  1.00 17.50 ? 70  GLN D O   1 
ATOM   6543  C  CB  . GLN D  1 61  ? -29.046  102.385 0.062   1.00 17.27 ? 70  GLN D CB  1 
ATOM   6544  C  CG  . GLN D  1 61  ? -28.683  102.604 1.513   1.00 18.66 ? 70  GLN D CG  1 
ATOM   6545  C  CD  . GLN D  1 61  ? -28.354  101.304 2.231   1.00 20.00 ? 70  GLN D CD  1 
ATOM   6546  O  OE1 . GLN D  1 61  ? -27.342  100.661 1.962   1.00 23.50 ? 70  GLN D OE1 1 
ATOM   6547  N  NE2 . GLN D  1 61  ? -29.225  100.913 3.140   1.00 18.99 ? 70  GLN D NE2 1 
ATOM   6548  N  N   . LYS D  1 62  ? -28.728  103.529 -2.928  1.00 17.41 ? 71  LYS D N   1 
ATOM   6549  C  CA  . LYS D  1 62  ? -28.758  103.342 -4.333  1.00 17.96 ? 71  LYS D CA  1 
ATOM   6550  C  C   . LYS D  1 62  ? -28.513  101.901 -4.709  1.00 18.94 ? 71  LYS D C   1 
ATOM   6551  O  O   . LYS D  1 62  ? -27.779  101.189 -4.050  1.00 22.33 ? 71  LYS D O   1 
ATOM   6552  C  CB  . LYS D  1 62  ? -27.719  104.266 -4.973  1.00 19.45 ? 71  LYS D CB  1 
ATOM   6553  C  CG  . LYS D  1 62  ? -27.613  104.169 -6.488  1.00 21.31 ? 71  LYS D CG  1 
ATOM   6554  C  CD  . LYS D  1 62  ? -26.808  105.330 -7.066  1.00 23.49 ? 71  LYS D CD  1 
ATOM   6555  C  CE  . LYS D  1 62  ? -26.884  105.445 -8.568  1.00 27.04 ? 71  LYS D CE  1 
ATOM   6556  N  NZ  . LYS D  1 62  ? -25.568  105.448 -9.228  1.00 30.88 ? 71  LYS D NZ  1 
ATOM   6557  N  N   . ALA D  1 63  ? -29.170  101.463 -5.775  1.00 19.95 ? 72  ALA D N   1 
ATOM   6558  C  CA  . ALA D  1 63  ? -29.014  100.123 -6.315  1.00 20.06 ? 72  ALA D CA  1 
ATOM   6559  C  C   . ALA D  1 63  ? -29.185  99.097  -5.232  1.00 20.42 ? 72  ALA D C   1 
ATOM   6560  O  O   . ALA D  1 63  ? -28.284  98.328  -4.928  1.00 18.18 ? 72  ALA D O   1 
ATOM   6561  C  CB  . ALA D  1 63  ? -27.660  99.960  -7.035  1.00 20.44 ? 72  ALA D CB  1 
ATOM   6562  N  N   . ARG D  1 64  ? -30.398  99.026  -4.717  1.00 22.67 ? 73  ARG D N   1 
ATOM   6563  C  CA  . ARG D  1 64  ? -30.743  98.057  -3.692  1.00 23.34 ? 73  ARG D CA  1 
ATOM   6564  C  C   . ARG D  1 64  ? -32.154  97.529  -3.838  1.00 21.95 ? 73  ARG D C   1 
ATOM   6565  O  O   . ARG D  1 64  ? -33.057  98.212  -4.312  1.00 18.41 ? 73  ARG D O   1 
ATOM   6566  C  CB  . ARG D  1 64  ? -30.604  98.705  -2.293  1.00 25.87 ? 73  ARG D CB  1 
ATOM   6567  C  CG  . ARG D  1 64  ? -29.176  99.061  -1.936  1.00 27.47 ? 73  ARG D CG  1 
ATOM   6568  C  CD  . ARG D  1 64  ? -28.387  97.814  -1.633  1.00 29.75 ? 73  ARG D CD  1 
ATOM   6569  N  NE  . ARG D  1 64  ? -26.984  98.182  -1.615  1.00 36.13 ? 73  ARG D NE  1 
ATOM   6570  C  CZ  . ARG D  1 64  ? -26.272  98.373  -0.524  1.00 39.67 ? 73  ARG D CZ  1 
ATOM   6571  N  NH1 . ARG D  1 64  ? -26.793  98.173  0.686   1.00 40.44 ? 73  ARG D NH1 1 
ATOM   6572  N  NH2 . ARG D  1 64  ? -25.007  98.716  -0.654  1.00 39.20 ? 73  ARG D NH2 1 
ATOM   6573  N  N   . PHE D  1 65  ? -32.329  96.324  -3.310  1.00 19.88 ? 74  PHE D N   1 
ATOM   6574  C  CA  . PHE D  1 65  ? -33.625  95.785  -2.991  1.00 17.87 ? 74  PHE D CA  1 
ATOM   6575  C  C   . PHE D  1 65  ? -34.098  96.254  -1.639  1.00 17.03 ? 74  PHE D C   1 
ATOM   6576  O  O   . PHE D  1 65  ? -33.323  96.418  -0.714  1.00 19.31 ? 74  PHE D O   1 
ATOM   6577  C  CB  . PHE D  1 65  ? -33.621  94.255  -3.012  1.00 17.48 ? 74  PHE D CB  1 
ATOM   6578  C  CG  . PHE D  1 65  ? -33.431  93.698  -4.358  1.00 17.71 ? 74  PHE D CG  1 
ATOM   6579  C  CD1 . PHE D  1 65  ? -34.496  93.627  -5.248  1.00 17.58 ? 74  PHE D CD1 1 
ATOM   6580  C  CD2 . PHE D  1 65  ? -32.179  93.224  -4.750  1.00 17.46 ? 74  PHE D CD2 1 
ATOM   6581  C  CE1 . PHE D  1 65  ? -34.315  93.099  -6.517  1.00 18.53 ? 74  PHE D CE1 1 
ATOM   6582  C  CE2 . PHE D  1 65  ? -31.994  92.685  -5.998  1.00 19.20 ? 74  PHE D CE2 1 
ATOM   6583  C  CZ  . PHE D  1 65  ? -33.059  92.620  -6.893  1.00 19.81 ? 74  PHE D CZ  1 
ATOM   6584  N  N   . TYR D  1 66  ? -35.398  96.478  -1.540  1.00 15.85 ? 75  TYR D N   1 
ATOM   6585  C  CA  . TYR D  1 66  ? -36.032  96.900  -0.297  1.00 15.39 ? 75  TYR D CA  1 
ATOM   6586  C  C   . TYR D  1 66  ? -37.134  95.901  0.088   1.00 14.84 ? 75  TYR D C   1 
ATOM   6587  O  O   . TYR D  1 66  ? -37.725  95.244  -0.756  1.00 13.39 ? 75  TYR D O   1 
ATOM   6588  C  CB  . TYR D  1 66  ? -36.624  98.288  -0.427  1.00 15.72 ? 75  TYR D CB  1 
ATOM   6589  C  CG  . TYR D  1 66  ? -35.580  99.346  -0.588  1.00 15.76 ? 75  TYR D CG  1 
ATOM   6590  C  CD1 . TYR D  1 66  ? -34.935  99.543  -1.820  1.00 15.74 ? 75  TYR D CD1 1 
ATOM   6591  C  CD2 . TYR D  1 66  ? -35.203  100.104 0.473   1.00 15.40 ? 75  TYR D CD2 1 
ATOM   6592  C  CE1 . TYR D  1 66  ? -33.941  100.491 -1.958  1.00 15.31 ? 75  TYR D CE1 1 
ATOM   6593  C  CE2 . TYR D  1 66  ? -34.222  101.066 0.338   1.00 16.48 ? 75  TYR D CE2 1 
ATOM   6594  C  CZ  . TYR D  1 66  ? -33.584  101.246 -0.873  1.00 15.48 ? 75  TYR D CZ  1 
ATOM   6595  O  OH  . TYR D  1 66  ? -32.653  102.259 -0.950  1.00 16.73 ? 75  TYR D OH  1 
ATOM   6596  N  N   . ALA D  1 67  ? -37.378  95.788  1.387   1.00 15.54 ? 76  ALA D N   1 
ATOM   6597  C  CA  . ALA D  1 67  ? -38.327  94.806  1.908   1.00 15.82 ? 76  ALA D CA  1 
ATOM   6598  C  C   . ALA D  1 67  ? -38.707  95.175  3.322   1.00 15.92 ? 76  ALA D C   1 
ATOM   6599  O  O   . ALA D  1 67  ? -38.081  94.768  4.264   1.00 17.50 ? 76  ALA D O   1 
ATOM   6600  C  CB  . ALA D  1 67  ? -37.740  93.435  1.843   1.00 17.01 ? 76  ALA D CB  1 
ATOM   6601  N  N   . LEU D  1 68  ? -39.733  95.997  3.445   1.00 15.72 ? 77  LEU D N   1 
ATOM   6602  C  CA  . LEU D  1 68  ? -40.270  96.446  4.712   1.00 15.98 ? 77  LEU D CA  1 
ATOM   6603  C  C   . LEU D  1 68  ? -41.803  96.257  4.671   1.00 17.14 ? 77  LEU D C   1 
ATOM   6604  O  O   . LEU D  1 68  ? -42.431  96.529  3.644   1.00 16.67 ? 77  LEU D O   1 
ATOM   6605  C  CB  . LEU D  1 68  ? -39.931  97.908  4.899   1.00 16.33 ? 77  LEU D CB  1 
ATOM   6606  C  CG  . LEU D  1 68  ? -40.293  98.537  6.234   1.00 17.32 ? 77  LEU D CG  1 
ATOM   6607  C  CD1 . LEU D  1 68  ? -39.265  98.180  7.300   1.00 17.57 ? 77  LEU D CD1 1 
ATOM   6608  C  CD2 . LEU D  1 68  ? -40.453  100.036 6.151   1.00 16.53 ? 77  LEU D CD2 1 
ATOM   6609  N  N   . SER D  1 69  ? -42.411  95.850  5.771   1.00 16.79 ? 78  SER D N   1 
ATOM   6610  C  CA  . SER D  1 69  ? -43.852  95.590  5.775   1.00 17.18 ? 78  SER D CA  1 
ATOM   6611  C  C   . SER D  1 69  ? -44.530  95.914  7.054   1.00 18.01 ? 78  SER D C   1 
ATOM   6612  O  O   . SER D  1 69  ? -43.921  95.971  8.127   1.00 19.84 ? 78  SER D O   1 
ATOM   6613  C  CB  . SER D  1 69  ? -44.182  94.148  5.356   1.00 17.89 ? 78  SER D CB  1 
ATOM   6614  O  OG  . SER D  1 69  ? -43.611  93.185  6.216   1.00 17.21 ? 78  SER D OG  1 
ATOM   6615  N  N   . ALA D  1 70  ? -45.833  96.128  6.950   1.00 19.14 ? 79  ALA D N   1 
ATOM   6616  C  CA  . ALA D  1 70  ? -46.677  96.420  8.101   1.00 19.10 ? 79  ALA D CA  1 
ATOM   6617  C  C   . ALA D  1 70  ? -47.884  95.461  8.127   1.00 20.22 ? 79  ALA D C   1 
ATOM   6618  O  O   . ALA D  1 70  ? -48.640  95.329  7.136   1.00 19.81 ? 79  ALA D O   1 
ATOM   6619  C  CB  . ALA D  1 70  ? -47.164  97.866  8.030   1.00 19.27 ? 79  ALA D CB  1 
ATOM   6620  N  N   . SER D  1 71  ? -48.110  94.884  9.299   1.00 21.15 ? 80  SER D N   1 
ATOM   6621  C  CA  . SER D  1 71  ? -49.278  94.053  9.576   1.00 20.84 ? 80  SER D CA  1 
ATOM   6622  C  C   . SER D  1 71  ? -50.431  94.842  10.149  1.00 19.91 ? 80  SER D C   1 
ATOM   6623  O  O   . SER D  1 71  ? -50.298  95.925  10.696  1.00 19.44 ? 80  SER D O   1 
ATOM   6624  C  CB  . SER D  1 71  ? -48.928  92.860  10.470  1.00 21.67 ? 80  SER D CB  1 
ATOM   6625  O  OG  . SER D  1 71  ? -48.713  93.292  11.778  1.00 23.23 ? 80  SER D OG  1 
ATOM   6626  N  N   . PHE D  1 72  ? -51.611  94.307  9.928   1.00 19.90 ? 81  PHE D N   1 
ATOM   6627  C  CA  . PHE D  1 72  ? -52.852  94.905  10.423  1.00 20.02 ? 81  PHE D CA  1 
ATOM   6628  C  C   . PHE D  1 72  ? -53.799  93.749  10.731  1.00 21.00 ? 81  PHE D C   1 
ATOM   6629  O  O   . PHE D  1 72  ? -53.592  92.626  10.283  1.00 20.53 ? 81  PHE D O   1 
ATOM   6630  C  CB  . PHE D  1 72  ? -53.465  95.885  9.387   1.00 19.81 ? 81  PHE D CB  1 
ATOM   6631  C  CG  . PHE D  1 72  ? -53.465  95.363  7.973   1.00 20.85 ? 81  PHE D CG  1 
ATOM   6632  C  CD1 . PHE D  1 72  ? -54.470  94.490  7.514   1.00 21.58 ? 81  PHE D CD1 1 
ATOM   6633  C  CD2 . PHE D  1 72  ? -52.474  95.747  7.071   1.00 20.65 ? 81  PHE D CD2 1 
ATOM   6634  C  CE1 . PHE D  1 72  ? -54.463  94.011  6.206   1.00 19.84 ? 81  PHE D CE1 1 
ATOM   6635  C  CE2 . PHE D  1 72  ? -52.456  95.273  5.783   1.00 18.70 ? 81  PHE D CE2 1 
ATOM   6636  C  CZ  . PHE D  1 72  ? -53.466  94.408  5.348   1.00 20.06 ? 81  PHE D CZ  1 
ATOM   6637  N  N   . GLU D  1 73  ? -54.821  94.045  11.505  1.00 24.36 ? 82  GLU D N   1 
ATOM   6638  C  CA  . GLU D  1 73  ? -55.903  93.098  11.802  1.00 27.32 ? 82  GLU D CA  1 
ATOM   6639  C  C   . GLU D  1 73  ? -56.428  92.512  10.477  1.00 24.99 ? 82  GLU D C   1 
ATOM   6640  O  O   . GLU D  1 73  ? -56.940  93.253  9.613   1.00 23.52 ? 82  GLU D O   1 
ATOM   6641  C  CB  . GLU D  1 73  ? -57.021  93.818  12.585  1.00 30.17 ? 82  GLU D CB  1 
ATOM   6642  C  CG  . GLU D  1 73  ? -58.153  92.939  13.074  1.00 35.02 ? 82  GLU D CG  1 
ATOM   6643  C  CD  . GLU D  1 73  ? -57.729  91.827  14.042  1.00 40.87 ? 82  GLU D CD  1 
ATOM   6644  O  OE1 . GLU D  1 73  ? -56.711  91.947  14.762  1.00 48.47 ? 82  GLU D OE1 1 
ATOM   6645  O  OE2 . GLU D  1 73  ? -58.421  90.797  14.067  1.00 40.66 ? 82  GLU D OE2 1 
ATOM   6646  N  N   . PRO D  1 74  ? -56.276  91.198  10.293  1.00 21.34 ? 83  PRO D N   1 
ATOM   6647  C  CA  . PRO D  1 74  ? -56.693  90.583  9.026   1.00 20.78 ? 83  PRO D CA  1 
ATOM   6648  C  C   . PRO D  1 74  ? -58.157  90.803  8.642   1.00 19.98 ? 83  PRO D C   1 
ATOM   6649  O  O   . PRO D  1 74  ? -59.003  91.045  9.486   1.00 21.60 ? 83  PRO D O   1 
ATOM   6650  C  CB  . PRO D  1 74  ? -56.426  89.092  9.240   1.00 21.21 ? 83  PRO D CB  1 
ATOM   6651  C  CG  . PRO D  1 74  ? -55.410  89.028  10.328  1.00 22.06 ? 83  PRO D CG  1 
ATOM   6652  C  CD  . PRO D  1 74  ? -55.600  90.243  11.179  1.00 21.89 ? 83  PRO D CD  1 
ATOM   6653  N  N   . PHE D  1 75  ? -58.418  90.791  7.344   1.00 18.37 ? 84  PHE D N   1 
ATOM   6654  C  CA  . PHE D  1 75  ? -59.741  90.975  6.830   1.00 16.97 ? 84  PHE D CA  1 
ATOM   6655  C  C   . PHE D  1 75  ? -59.836  90.275  5.476   1.00 16.03 ? 84  PHE D C   1 
ATOM   6656  O  O   . PHE D  1 75  ? -58.836  89.919  4.867   1.00 14.93 ? 84  PHE D O   1 
ATOM   6657  C  CB  . PHE D  1 75  ? -60.104  92.468  6.724   1.00 17.94 ? 84  PHE D CB  1 
ATOM   6658  C  CG  . PHE D  1 75  ? -59.484  93.172  5.509   1.00 19.13 ? 84  PHE D CG  1 
ATOM   6659  C  CD1 . PHE D  1 75  ? -58.188  93.683  5.567   1.00 18.61 ? 84  PHE D CD1 1 
ATOM   6660  C  CD2 . PHE D  1 75  ? -60.205  93.353  4.340   1.00 18.19 ? 84  PHE D CD2 1 
ATOM   6661  C  CE1 . PHE D  1 75  ? -57.643  94.332  4.466   1.00 19.18 ? 84  PHE D CE1 1 
ATOM   6662  C  CE2 . PHE D  1 75  ? -59.665  94.023  3.252   1.00 18.71 ? 84  PHE D CE2 1 
ATOM   6663  C  CZ  . PHE D  1 75  ? -58.377  94.497  3.306   1.00 17.87 ? 84  PHE D CZ  1 
ATOM   6664  N  N   . SER D  1 76  ? -61.077  90.149  5.014   1.00 15.75 ? 85  SER D N   1 
ATOM   6665  C  CA  . SER D  1 76  ? -61.389  89.665  3.705   1.00 15.04 ? 85  SER D CA  1 
ATOM   6666  C  C   . SER D  1 76  ? -62.199  90.720  2.966   1.00 13.90 ? 85  SER D C   1 
ATOM   6667  O  O   . SER D  1 76  ? -62.964  91.437  3.566   1.00 14.01 ? 85  SER D O   1 
ATOM   6668  C  CB  . SER D  1 76  ? -62.208  88.366  3.813   1.00 15.76 ? 85  SER D CB  1 
ATOM   6669  O  OG  . SER D  1 76  ? -62.513  87.874  2.508   1.00 16.44 ? 85  SER D OG  1 
ATOM   6670  N  N   . ASN D  1 77  ? -62.037  90.810  1.656   1.00 13.63 ? 86  ASN D N   1 
ATOM   6671  C  CA  . ASN D  1 77  ? -62.816  91.751  0.844   1.00 13.73 ? 86  ASN D CA  1 
ATOM   6672  C  C   . ASN D  1 77  ? -64.071  91.096  0.261   1.00 16.40 ? 86  ASN D C   1 
ATOM   6673  O  O   . ASN D  1 77  ? -64.785  91.708  -0.581  1.00 16.41 ? 86  ASN D O   1 
ATOM   6674  C  CB  . ASN D  1 77  ? -61.959  92.397  -0.306  1.00 12.39 ? 86  ASN D CB  1 
ATOM   6675  C  CG  . ASN D  1 77  ? -61.393  91.395  -1.245  1.00 11.74 ? 86  ASN D CG  1 
ATOM   6676  O  OD1 . ASN D  1 77  ? -61.031  90.304  -0.813  1.00 12.28 ? 86  ASN D OD1 1 
ATOM   6677  N  ND2 . ASN D  1 77  ? -61.287  91.730  -2.552  1.00 11.45 ? 86  ASN D ND2 1 
ATOM   6678  N  N   . LYS D  1 78  ? -64.274  89.826  0.619   1.00 17.96 ? 87  LYS D N   1 
ATOM   6679  C  CA  . LYS D  1 78  ? -65.390  89.036  0.111   1.00 20.09 ? 87  LYS D CA  1 
ATOM   6680  C  C   . LYS D  1 78  ? -66.700  89.772  0.326   1.00 16.68 ? 87  LYS D C   1 
ATOM   6681  O  O   . LYS D  1 78  ? -66.988  90.203  1.385   1.00 15.61 ? 87  LYS D O   1 
ATOM   6682  C  CB  . LYS D  1 78  ? -65.384  87.656  0.763   1.00 23.88 ? 87  LYS D CB  1 
ATOM   6683  C  CG  . LYS D  1 78  ? -66.566  86.723  0.397   1.00 30.65 ? 87  LYS D CG  1 
ATOM   6684  C  CD  . LYS D  1 78  ? -66.195  85.713  -0.722  1.00 36.27 ? 87  LYS D CD  1 
ATOM   6685  C  CE  . LYS D  1 78  ? -67.062  84.440  -0.822  1.00 35.55 ? 87  LYS D CE  1 
ATOM   6686  N  NZ  . LYS D  1 78  ? -68.026  84.464  0.296   1.00 35.51 ? 87  LYS D NZ  1 
ATOM   6687  N  N   . GLY D  1 79  ? -67.442  89.975  -0.739  1.00 15.24 ? 88  GLY D N   1 
ATOM   6688  C  CA  . GLY D  1 79  ? -68.704  90.695  -0.635  1.00 15.89 ? 88  GLY D CA  1 
ATOM   6689  C  C   . GLY D  1 79  ? -68.594  92.204  -0.457  1.00 16.24 ? 88  GLY D C   1 
ATOM   6690  O  O   . GLY D  1 79  ? -69.626  92.888  -0.332  1.00 14.50 ? 88  GLY D O   1 
ATOM   6691  N  N   . GLN D  1 80  ? -67.375  92.732  -0.595  1.00 16.24 ? 89  GLN D N   1 
ATOM   6692  C  CA  . GLN D  1 80  ? -67.085  94.159  -0.364  1.00 17.33 ? 89  GLN D CA  1 
ATOM   6693  C  C   . GLN D  1 80  ? -66.176  94.829  -1.397  1.00 16.45 ? 89  GLN D C   1 
ATOM   6694  O  O   . GLN D  1 80  ? -65.456  94.182  -2.138  1.00 18.46 ? 89  GLN D O   1 
ATOM   6695  C  CB  . GLN D  1 80  ? -66.355  94.306  0.975   1.00 19.15 ? 89  GLN D CB  1 
ATOM   6696  C  CG  . GLN D  1 80  ? -67.246  94.359  2.154   1.00 22.58 ? 89  GLN D CG  1 
ATOM   6697  C  CD  . GLN D  1 80  ? -66.513  94.635  3.458   1.00 24.74 ? 89  GLN D CD  1 
ATOM   6698  O  OE1 . GLN D  1 80  ? -66.876  95.553  4.168   1.00 25.45 ? 89  GLN D OE1 1 
ATOM   6699  N  NE2 . GLN D  1 80  ? -65.474  93.878  3.746   1.00 27.09 ? 89  GLN D NE2 1 
ATOM   6700  N  N   . THR D  1 81  ? -66.226  96.152  -1.415  1.00 16.15 ? 90  THR D N   1 
ATOM   6701  C  CA  . THR D  1 81  ? -65.276  96.956  -2.120  1.00 15.41 ? 90  THR D CA  1 
ATOM   6702  C  C   . THR D  1 81  ? -63.962  96.998  -1.335  1.00 14.29 ? 90  THR D C   1 
ATOM   6703  O  O   . THR D  1 81  ? -63.927  97.062  -0.097  1.00 12.79 ? 90  THR D O   1 
ATOM   6704  C  CB  . THR D  1 81  ? -65.787  98.373  -2.370  1.00 15.98 ? 90  THR D CB  1 
ATOM   6705  O  OG1 . THR D  1 81  ? -66.900  98.307  -3.261  1.00 18.02 ? 90  THR D OG1 1 
ATOM   6706  C  CG2 . THR D  1 81  ? -64.717  99.214  -3.091  1.00 16.13 ? 90  THR D CG2 1 
ATOM   6707  N  N   . LEU D  1 82  ? -62.878  96.865  -2.085  1.00 13.83 ? 91  LEU D N   1 
ATOM   6708  C  CA  . LEU D  1 82  ? -61.522  97.052  -1.552  1.00 13.66 ? 91  LEU D CA  1 
ATOM   6709  C  C   . LEU D  1 82  ? -60.879  98.238  -2.221  1.00 12.43 ? 91  LEU D C   1 
ATOM   6710  O  O   . LEU D  1 82  ? -60.760  98.288  -3.437  1.00 11.98 ? 91  LEU D O   1 
ATOM   6711  C  CB  . LEU D  1 82  ? -60.641  95.815  -1.809  1.00 14.19 ? 91  LEU D CB  1 
ATOM   6712  C  CG  . LEU D  1 82  ? -59.178  95.957  -1.381  1.00 14.74 ? 91  LEU D CG  1 
ATOM   6713  C  CD1 . LEU D  1 82  ? -59.039  96.123  0.125   1.00 15.09 ? 91  LEU D CD1 1 
ATOM   6714  C  CD2 . LEU D  1 82  ? -58.370  94.791  -1.840  1.00 15.54 ? 91  LEU D CD2 1 
ATOM   6715  N  N   . VAL D  1 83  ? -60.403  99.142  -1.404  1.00 13.13 ? 92  VAL D N   1 
ATOM   6716  C  CA  . VAL D  1 83  ? -59.624  100.300 -1.872  1.00 13.28 ? 92  VAL D CA  1 
ATOM   6717  C  C   . VAL D  1 83  ? -58.250  100.340 -1.220  1.00 13.45 ? 92  VAL D C   1 
ATOM   6718  O  O   . VAL D  1 83  ? -58.109  100.332 0.031   1.00 14.29 ? 92  VAL D O   1 
ATOM   6719  C  CB  . VAL D  1 83  ? -60.299  101.637 -1.549  1.00 13.61 ? 92  VAL D CB  1 
ATOM   6720  C  CG1 . VAL D  1 83  ? -59.555  102.779 -2.259  1.00 14.29 ? 92  VAL D CG1 1 
ATOM   6721  C  CG2 . VAL D  1 83  ? -61.758  101.630 -1.983  1.00 13.94 ? 92  VAL D CG2 1 
ATOM   6722  N  N   . VAL D  1 84  ? -57.248  100.406 -2.083  1.00 13.21 ? 93  VAL D N   1 
ATOM   6723  C  CA  . VAL D  1 84  ? -55.824  100.519 -1.714  1.00 13.03 ? 93  VAL D CA  1 
ATOM   6724  C  C   . VAL D  1 84  ? -55.274  101.841 -2.260  1.00 12.84 ? 93  VAL D C   1 
ATOM   6725  O  O   . VAL D  1 84  ? -55.356  102.135 -3.454  1.00 12.09 ? 93  VAL D O   1 
ATOM   6726  C  CB  . VAL D  1 84  ? -54.967  99.438  -2.363  1.00 13.31 ? 93  VAL D CB  1 
ATOM   6727  C  CG1 . VAL D  1 84  ? -53.568  99.512  -1.831  1.00 13.64 ? 93  VAL D CG1 1 
ATOM   6728  C  CG2 . VAL D  1 84  ? -55.515  98.078  -2.040  1.00 14.23 ? 93  VAL D CG2 1 
ATOM   6729  N  N   . GLN D  1 85  ? -54.705  102.640 -1.373  1.00 12.22 ? 94  GLN D N   1 
ATOM   6730  C  CA  . GLN D  1 85  ? -54.322  104.014 -1.739  1.00 11.78 ? 94  GLN D CA  1 
ATOM   6731  C  C   . GLN D  1 85  ? -53.060  104.463 -0.978  1.00 10.61 ? 94  GLN D C   1 
ATOM   6732  O  O   . GLN D  1 85  ? -52.888  104.112 0.196   1.00 10.40 ? 94  GLN D O   1 
ATOM   6733  C  CB  . GLN D  1 85  ? -55.491  104.950 -1.472  1.00 11.97 ? 94  GLN D CB  1 
ATOM   6734  C  CG  . GLN D  1 85  ? -55.187  106.417 -1.675  1.00 12.78 ? 94  GLN D CG  1 
ATOM   6735  C  CD  . GLN D  1 85  ? -56.435  107.272 -1.621  1.00 13.30 ? 94  GLN D CD  1 
ATOM   6736  O  OE1 . GLN D  1 85  ? -57.288  107.211 -2.525  1.00 15.70 ? 94  GLN D OE1 1 
ATOM   6737  N  NE2 . GLN D  1 85  ? -56.548  108.093 -0.602  1.00 12.71 ? 94  GLN D NE2 1 
ATOM   6738  N  N   . PHE D  1 86  ? -52.197  105.209 -1.644  1.00 9.69  ? 95  PHE D N   1 
ATOM   6739  C  CA  . PHE D  1 86  ? -50.985  105.759 -1.002  1.00 9.64  ? 95  PHE D CA  1 
ATOM   6740  C  C   . PHE D  1 86  ? -50.385  106.860 -1.886  1.00 10.14 ? 95  PHE D C   1 
ATOM   6741  O  O   . PHE D  1 86  ? -50.773  107.013 -3.064  1.00 9.82  ? 95  PHE D O   1 
ATOM   6742  C  CB  . PHE D  1 86  ? -49.959  104.664 -0.741  1.00 9.42  ? 95  PHE D CB  1 
ATOM   6743  C  CG  . PHE D  1 86  ? -49.566  103.917 -1.975  1.00 9.71  ? 95  PHE D CG  1 
ATOM   6744  C  CD1 . PHE D  1 86  ? -50.372  102.923 -2.464  1.00 10.20 ? 95  PHE D CD1 1 
ATOM   6745  C  CD2 . PHE D  1 86  ? -48.379  104.189 -2.635  1.00 9.92  ? 95  PHE D CD2 1 
ATOM   6746  C  CE1 . PHE D  1 86  ? -50.047  102.241 -3.628  1.00 10.54 ? 95  PHE D CE1 1 
ATOM   6747  C  CE2 . PHE D  1 86  ? -48.055  103.541 -3.794  1.00 10.44 ? 95  PHE D CE2 1 
ATOM   6748  C  CZ  . PHE D  1 86  ? -48.900  102.571 -4.312  1.00 10.39 ? 95  PHE D CZ  1 
ATOM   6749  N  N   . THR D  1 87  ? -49.489  107.672 -1.311  1.00 10.81 ? 96  THR D N   1 
ATOM   6750  C  CA  . THR D  1 87  ? -48.756  108.671 -2.074  1.00 11.00 ? 96  THR D CA  1 
ATOM   6751  C  C   . THR D  1 87  ? -47.348  108.215 -2.355  1.00 12.12 ? 96  THR D C   1 
ATOM   6752  O  O   . THR D  1 87  ? -46.735  107.511 -1.568  1.00 11.77 ? 96  THR D O   1 
ATOM   6753  C  CB  . THR D  1 87  ? -48.762  110.071 -1.456  1.00 11.35 ? 96  THR D CB  1 
ATOM   6754  O  OG1 . THR D  1 87  ? -48.157  110.053 -0.165  1.00 12.30 ? 96  THR D OG1 1 
ATOM   6755  C  CG2 . THR D  1 87  ? -50.163  110.656 -1.352  1.00 10.65 ? 96  THR D CG2 1 
ATOM   6756  N  N   . VAL D  1 88  ? -46.867  108.598 -3.541  1.00 14.31 ? 97  VAL D N   1 
ATOM   6757  C  CA  . VAL D  1 88  ? -45.496  108.319 -4.004  1.00 14.37 ? 97  VAL D CA  1 
ATOM   6758  C  C   . VAL D  1 88  ? -44.877  109.587 -4.582  1.00 15.22 ? 97  VAL D C   1 
ATOM   6759  O  O   . VAL D  1 88  ? -45.481  110.321 -5.356  1.00 13.46 ? 97  VAL D O   1 
ATOM   6760  C  CB  . VAL D  1 88  ? -45.450  107.270 -5.109  1.00 15.29 ? 97  VAL D CB  1 
ATOM   6761  C  CG1 . VAL D  1 88  ? -44.034  106.918 -5.465  1.00 16.27 ? 97  VAL D CG1 1 
ATOM   6762  C  CG2 . VAL D  1 88  ? -46.129  106.010 -4.655  1.00 16.41 ? 97  VAL D CG2 1 
ATOM   6763  N  N   . LYS D  1 89  ? -43.641  109.836 -4.154  1.00 17.58 ? 98  LYS D N   1 
ATOM   6764  C  CA  . LYS D  1 89  ? -42.877  111.020 -4.536  1.00 16.89 ? 98  LYS D CA  1 
ATOM   6765  C  C   . LYS D  1 89  ? -41.455  110.615 -4.895  1.00 15.70 ? 98  LYS D C   1 
ATOM   6766  O  O   . LYS D  1 89  ? -40.641  110.329 -4.048  1.00 14.29 ? 98  LYS D O   1 
ATOM   6767  C  CB  . LYS D  1 89  ? -42.861  112.002 -3.379  1.00 17.84 ? 98  LYS D CB  1 
ATOM   6768  C  CG  . LYS D  1 89  ? -41.989  113.228 -3.581  1.00 19.79 ? 98  LYS D CG  1 
ATOM   6769  C  CD  . LYS D  1 89  ? -42.135  114.104 -2.337  1.00 21.57 ? 98  LYS D CD  1 
ATOM   6770  C  CE  . LYS D  1 89  ? -41.013  115.093 -2.113  1.00 24.47 ? 98  LYS D CE  1 
ATOM   6771  N  NZ  . LYS D  1 89  ? -41.497  116.487 -2.127  1.00 28.20 ? 98  LYS D NZ  1 
ATOM   6772  N  N   . HIS D  1 90  ? -41.161  110.639 -6.171  1.00 16.06 ? 99  HIS D N   1 
ATOM   6773  C  CA  . HIS D  1 90  ? -39.840  110.361 -6.641  1.00 16.57 ? 99  HIS D CA  1 
ATOM   6774  C  C   . HIS D  1 90  ? -39.050  111.700 -6.724  1.00 17.86 ? 99  HIS D C   1 
ATOM   6775  O  O   . HIS D  1 90  ? -38.739  112.181 -7.804  1.00 16.48 ? 99  HIS D O   1 
ATOM   6776  C  CB  . HIS D  1 90  ? -39.894  109.732 -8.012  1.00 16.52 ? 99  HIS D CB  1 
ATOM   6777  C  CG  . HIS D  1 90  ? -40.570  108.399 -8.053  1.00 15.70 ? 99  HIS D CG  1 
ATOM   6778  N  ND1 . HIS D  1 90  ? -40.160  107.327 -7.283  1.00 15.11 ? 99  HIS D ND1 1 
ATOM   6779  C  CD2 . HIS D  1 90  ? -41.613  107.959 -8.796  1.00 14.77 ? 99  HIS D CD2 1 
ATOM   6780  C  CE1 . HIS D  1 90  ? -40.873  106.264 -7.607  1.00 14.75 ? 99  HIS D CE1 1 
ATOM   6781  N  NE2 . HIS D  1 90  ? -41.781  106.625 -8.502  1.00 14.93 ? 99  HIS D NE2 1 
ATOM   6782  N  N   . GLU D  1 91  ? -38.781  112.262 -5.563  1.00 19.38 ? 100 GLU D N   1 
ATOM   6783  C  CA  . GLU D  1 91  ? -37.977  113.487 -5.359  1.00 23.69 ? 100 GLU D CA  1 
ATOM   6784  C  C   . GLU D  1 91  ? -36.639  113.513 -6.113  1.00 21.56 ? 100 GLU D C   1 
ATOM   6785  O  O   . GLU D  1 91  ? -36.236  114.533 -6.604  1.00 23.12 ? 100 GLU D O   1 
ATOM   6786  C  CB  . GLU D  1 91  ? -37.735  113.660 -3.861  1.00 24.88 ? 100 GLU D CB  1 
ATOM   6787  C  CG  . GLU D  1 91  ? -36.911  114.833 -3.423  1.00 31.14 ? 100 GLU D CG  1 
ATOM   6788  C  CD  . GLU D  1 91  ? -37.094  115.192 -1.955  1.00 33.21 ? 100 GLU D CD  1 
ATOM   6789  O  OE1 . GLU D  1 91  ? -37.923  114.558 -1.260  1.00 37.23 ? 100 GLU D OE1 1 
ATOM   6790  O  OE2 . GLU D  1 91  ? -36.400  116.131 -1.512  1.00 39.31 ? 100 GLU D OE2 1 
ATOM   6791  N  N   . GLN D  1 92  ? -36.024  112.361 -6.281  1.00 21.00 ? 101 GLN D N   1 
ATOM   6792  C  CA  . GLN D  1 92  ? -34.709  112.234 -6.915  1.00 19.88 ? 101 GLN D CA  1 
ATOM   6793  C  C   . GLN D  1 92  ? -34.715  112.251 -8.444  1.00 21.86 ? 101 GLN D C   1 
ATOM   6794  O  O   . GLN D  1 92  ? -33.671  112.036 -9.070  1.00 22.23 ? 101 GLN D O   1 
ATOM   6795  C  CB  . GLN D  1 92  ? -34.060  110.918 -6.481  1.00 18.54 ? 101 GLN D CB  1 
ATOM   6796  C  CG  . GLN D  1 92  ? -34.627  109.649 -7.133  1.00 19.18 ? 101 GLN D CG  1 
ATOM   6797  C  CD  . GLN D  1 92  ? -35.860  109.080 -6.422  1.00 19.37 ? 101 GLN D CD  1 
ATOM   6798  O  OE1 . GLN D  1 92  ? -36.755  109.821 -6.019  1.00 18.20 ? 101 GLN D OE1 1 
ATOM   6799  N  NE2 . GLN D  1 92  ? -35.923  107.759 -6.307  1.00 19.26 ? 101 GLN D NE2 1 
ATOM   6800  N  N   . ASN D  1 93  ? -35.876  112.422 -9.055  1.00 21.45 ? 102 ASN D N   1 
ATOM   6801  C  CA  . ASN D  1 93  ? -35.996  112.181 -10.507 1.00 22.63 ? 102 ASN D CA  1 
ATOM   6802  C  C   . ASN D  1 93  ? -35.480  110.797 -10.907 1.00 22.38 ? 102 ASN D C   1 
ATOM   6803  O  O   . ASN D  1 93  ? -34.369  110.651 -11.423 1.00 24.28 ? 102 ASN D O   1 
ATOM   6804  C  CB  . ASN D  1 93  ? -35.249  113.262 -11.283 1.00 22.66 ? 102 ASN D CB  1 
ATOM   6805  C  CG  . ASN D  1 93  ? -35.946  114.602 -11.196 1.00 22.12 ? 102 ASN D CG  1 
ATOM   6806  O  OD1 . ASN D  1 93  ? -35.396  115.523 -10.625 1.00 22.01 ? 102 ASN D OD1 1 
ATOM   6807  N  ND2 . ASN D  1 93  ? -37.179  114.691 -11.698 1.00 21.65 ? 102 ASN D ND2 1 
ATOM   6808  N  N   . ILE D  1 94  ? -36.298  109.802 -10.660 1.00 20.12 ? 103 ILE D N   1 
ATOM   6809  C  CA  . ILE D  1 94  ? -35.850  108.428 -10.689 1.00 21.15 ? 103 ILE D CA  1 
ATOM   6810  C  C   . ILE D  1 94  ? -35.534  107.993 -12.112 1.00 22.19 ? 103 ILE D C   1 
ATOM   6811  O  O   . ILE D  1 94  ? -36.203  108.416 -13.040 1.00 22.82 ? 103 ILE D O   1 
ATOM   6812  C  CB  . ILE D  1 94  ? -36.859  107.481 -9.979  1.00 20.27 ? 103 ILE D CB  1 
ATOM   6813  C  CG1 . ILE D  1 94  ? -36.277  106.085 -9.811  1.00 20.36 ? 103 ILE D CG1 1 
ATOM   6814  C  CG2 . ILE D  1 94  ? -38.184  107.410 -10.719 1.00 21.15 ? 103 ILE D CG2 1 
ATOM   6815  C  CD1 . ILE D  1 94  ? -36.968  105.267 -8.711  1.00 19.64 ? 103 ILE D CD1 1 
ATOM   6816  N  N   . ASP D  1 95  ? -34.511  107.157 -12.262 1.00 21.20 ? 104 ASP D N   1 
ATOM   6817  C  CA  . ASP D  1 95  ? -34.153  106.583 -13.559 1.00 23.35 ? 104 ASP D CA  1 
ATOM   6818  C  C   . ASP D  1 95  ? -34.809  105.223 -13.734 1.00 21.29 ? 104 ASP D C   1 
ATOM   6819  O  O   . ASP D  1 95  ? -35.410  104.919 -14.783 1.00 21.88 ? 104 ASP D O   1 
ATOM   6820  C  CB  . ASP D  1 95  ? -32.601  106.490 -13.755 1.00 24.40 ? 104 ASP D CB  1 
ATOM   6821  C  CG  . ASP D  1 95  ? -31.841  105.876 -12.515 1.00 28.22 ? 104 ASP D CG  1 
ATOM   6822  O  OD1 . ASP D  1 95  ? -32.474  105.481 -11.492 1.00 27.86 ? 104 ASP D OD1 1 
ATOM   6823  O  OD2 . ASP D  1 95  ? -30.597  105.795 -12.562 1.00 28.49 ? 104 ASP D OD2 1 
ATOM   6824  N  N   . CYS D  1 96  ? -34.686  104.402 -12.706 1.00 20.34 ? 105 CYS D N   1 
ATOM   6825  C  CA  . CYS D  1 96  ? -35.200  103.050 -12.722 1.00 23.37 ? 105 CYS D CA  1 
ATOM   6826  C  C   . CYS D  1 96  ? -35.460  102.591 -11.290 1.00 24.15 ? 105 CYS D C   1 
ATOM   6827  O  O   . CYS D  1 96  ? -34.578  102.665 -10.444 1.00 24.99 ? 105 CYS D O   1 
ATOM   6828  C  CB  . CYS D  1 96  ? -34.267  102.086 -13.453 1.00 26.81 ? 105 CYS D CB  1 
ATOM   6829  S  SG  . CYS D  1 96  ? -34.861  100.371 -13.528 1.00 32.62 ? 105 CYS D SG  1 
ATOM   6830  N  N   . GLY D  1 97  ? -36.714  102.205 -11.026 1.00 21.38 ? 106 GLY D N   1 
ATOM   6831  C  CA  . GLY D  1 97  ? -37.138  101.743 -9.731  1.00 20.74 ? 106 GLY D CA  1 
ATOM   6832  C  C   . GLY D  1 97  ? -38.661  101.667 -9.546  1.00 19.75 ? 106 GLY D C   1 
ATOM   6833  O  O   . GLY D  1 97  ? -39.408  102.428 -10.134 1.00 18.34 ? 106 GLY D O   1 
ATOM   6834  N  N   . GLY D  1 98  ? -39.082  100.742 -8.682  1.00 17.52 ? 107 GLY D N   1 
ATOM   6835  C  CA  . GLY D  1 98  ? -40.473  100.552 -8.326  1.00 17.10 ? 107 GLY D CA  1 
ATOM   6836  C  C   . GLY D  1 98  ? -40.996  101.518 -7.248  1.00 16.29 ? 107 GLY D C   1 
ATOM   6837  O  O   . GLY D  1 98  ? -40.243  102.127 -6.521  1.00 15.26 ? 107 GLY D O   1 
ATOM   6838  N  N   . GLY D  1 99  ? -42.310  101.705 -7.258  1.00 16.71 ? 108 GLY D N   1 
ATOM   6839  C  CA  . GLY D  1 99  ? -43.018  102.569 -6.314  1.00 15.71 ? 108 GLY D CA  1 
ATOM   6840  C  C   . GLY D  1 99  ? -44.333  101.950 -5.902  1.00 15.00 ? 108 GLY D C   1 
ATOM   6841  O  O   . GLY D  1 99  ? -45.275  102.640 -5.542  1.00 13.68 ? 108 GLY D O   1 
ATOM   6842  N  N   . TYR D  1 100 ? -44.373  100.627 -5.947  1.00 15.66 ? 109 TYR D N   1 
ATOM   6843  C  CA  . TYR D  1 100 ? -45.633  99.887  -5.772  1.00 15.46 ? 109 TYR D CA  1 
ATOM   6844  C  C   . TYR D  1 100 ? -45.691  99.150  -4.462  1.00 16.30 ? 109 TYR D C   1 
ATOM   6845  O  O   . TYR D  1 100 ? -44.660  98.880  -3.844  1.00 20.40 ? 109 TYR D O   1 
ATOM   6846  C  CB  . TYR D  1 100 ? -45.853  98.898  -6.904  1.00 14.71 ? 109 TYR D CB  1 
ATOM   6847  C  CG  . TYR D  1 100 ? -44.643  98.099  -7.228  1.00 15.29 ? 109 TYR D CG  1 
ATOM   6848  C  CD1 . TYR D  1 100 ? -44.284  97.023  -6.450  1.00 15.98 ? 109 TYR D CD1 1 
ATOM   6849  C  CD2 . TYR D  1 100 ? -43.843  98.415  -8.321  1.00 15.78 ? 109 TYR D CD2 1 
ATOM   6850  C  CE1 . TYR D  1 100 ? -43.167  96.264  -6.759  1.00 16.62 ? 109 TYR D CE1 1 
ATOM   6851  C  CE2 . TYR D  1 100 ? -42.717  97.674  -8.641  1.00 15.61 ? 109 TYR D CE2 1 
ATOM   6852  C  CZ  . TYR D  1 100 ? -42.378  96.609  -7.860  1.00 16.89 ? 109 TYR D CZ  1 
ATOM   6853  O  OH  . TYR D  1 100 ? -41.281  95.833  -8.163  1.00 17.56 ? 109 TYR D OH  1 
ATOM   6854  N  N   . VAL D  1 101 ? -46.914  98.867  -4.029  1.00 15.46 ? 110 VAL D N   1 
ATOM   6855  C  CA  . VAL D  1 101 ? -47.187  98.105  -2.816  1.00 15.53 ? 110 VAL D CA  1 
ATOM   6856  C  C   . VAL D  1 101 ? -47.686  96.709  -3.123  1.00 16.60 ? 110 VAL D C   1 
ATOM   6857  O  O   . VAL D  1 101 ? -48.071  96.406  -4.231  1.00 17.26 ? 110 VAL D O   1 
ATOM   6858  C  CB  . VAL D  1 101 ? -48.182  98.779  -1.853  1.00 14.94 ? 110 VAL D CB  1 
ATOM   6859  C  CG1 . VAL D  1 101 ? -47.708  100.183 -1.484  1.00 15.61 ? 110 VAL D CG1 1 
ATOM   6860  C  CG2 . VAL D  1 101 ? -49.588  98.847  -2.425  1.00 15.60 ? 110 VAL D CG2 1 
ATOM   6861  N  N   . LYS D  1 102 ? -47.590  95.848  -2.124  1.00 16.97 ? 111 LYS D N   1 
ATOM   6862  C  CA  . LYS D  1 102 ? -48.132  94.524  -2.185  1.00 16.35 ? 111 LYS D CA  1 
ATOM   6863  C  C   . LYS D  1 102 ? -48.934  94.207  -0.982  1.00 16.18 ? 111 LYS D C   1 
ATOM   6864  O  O   . LYS D  1 102 ? -48.553  94.538  0.141   1.00 15.15 ? 111 LYS D O   1 
ATOM   6865  C  CB  . LYS D  1 102 ? -47.051  93.508  -2.237  1.00 17.49 ? 111 LYS D CB  1 
ATOM   6866  C  CG  . LYS D  1 102 ? -46.206  93.624  -3.452  1.00 18.27 ? 111 LYS D CG  1 
ATOM   6867  C  CD  . LYS D  1 102 ? -45.248  92.469  -3.507  1.00 19.81 ? 111 LYS D CD  1 
ATOM   6868  C  CE  . LYS D  1 102 ? -44.065  92.842  -4.375  1.00 21.00 ? 111 LYS D CE  1 
ATOM   6869  N  NZ  . LYS D  1 102 ? -43.668  91.697  -5.208  1.00 21.94 ? 111 LYS D NZ  1 
ATOM   6870  N  N   . LEU D  1 103 ? -50.075  93.582  -1.227  1.00 18.02 ? 112 LEU D N   1 
ATOM   6871  C  CA  . LEU D  1 103 ? -50.980  93.132  -0.140  1.00 19.58 ? 112 LEU D CA  1 
ATOM   6872  C  C   . LEU D  1 103 ? -50.876  91.640  -0.031  1.00 18.36 ? 112 LEU D C   1 
ATOM   6873  O  O   . LEU D  1 103 ? -51.046  90.924  -1.029  1.00 17.95 ? 112 LEU D O   1 
ATOM   6874  C  CB  . LEU D  1 103 ? -52.425  93.492  -0.414  1.00 22.02 ? 112 LEU D CB  1 
ATOM   6875  C  CG  . LEU D  1 103 ? -52.811  94.961  -0.489  1.00 24.37 ? 112 LEU D CG  1 
ATOM   6876  C  CD1 . LEU D  1 103 ? -54.292  95.343  -0.689  1.00 28.02 ? 112 LEU D CD1 1 
ATOM   6877  C  CD2 . LEU D  1 103 ? -52.345  95.574  0.785   1.00 26.87 ? 112 LEU D CD2 1 
ATOM   6878  N  N   . PHE D  1 104 ? -50.561  91.187  1.180   1.00 17.15 ? 113 PHE D N   1 
ATOM   6879  C  CA  . PHE D  1 104 ? -50.217  89.786  1.452   1.00 15.03 ? 113 PHE D CA  1 
ATOM   6880  C  C   . PHE D  1 104 ? -51.240  89.160  2.368   1.00 16.82 ? 113 PHE D C   1 
ATOM   6881  O  O   . PHE D  1 104 ? -51.818  89.840  3.243   1.00 17.93 ? 113 PHE D O   1 
ATOM   6882  C  CB  . PHE D  1 104 ? -48.860  89.684  2.176   1.00 14.27 ? 113 PHE D CB  1 
ATOM   6883  C  CG  . PHE D  1 104 ? -47.661  90.007  1.323   1.00 12.50 ? 113 PHE D CG  1 
ATOM   6884  C  CD1 . PHE D  1 104 ? -47.058  89.034  0.577   1.00 12.17 ? 113 PHE D CD1 1 
ATOM   6885  C  CD2 . PHE D  1 104 ? -47.098  91.274  1.328   1.00 11.68 ? 113 PHE D CD2 1 
ATOM   6886  C  CE1 . PHE D  1 104 ? -45.934  89.307  -0.194  1.00 11.87 ? 113 PHE D CE1 1 
ATOM   6887  C  CE2 . PHE D  1 104 ? -45.992  91.557  0.553   1.00 11.28 ? 113 PHE D CE2 1 
ATOM   6888  C  CZ  . PHE D  1 104 ? -45.419  90.580  -0.219  1.00 11.48 ? 113 PHE D CZ  1 
ATOM   6889  N  N   . PRO D  1 105 ? -51.424  87.835  2.240   1.00 18.09 ? 114 PRO D N   1 
ATOM   6890  C  CA  . PRO D  1 105 ? -52.124  87.079  3.283   1.00 19.24 ? 114 PRO D CA  1 
ATOM   6891  C  C   . PRO D  1 105 ? -51.404  87.148  4.599   1.00 21.56 ? 114 PRO D C   1 
ATOM   6892  O  O   . PRO D  1 105 ? -50.173  87.307  4.635   1.00 22.09 ? 114 PRO D O   1 
ATOM   6893  C  CB  . PRO D  1 105 ? -52.104  85.627  2.781   1.00 18.39 ? 114 PRO D CB  1 
ATOM   6894  C  CG  . PRO D  1 105 ? -51.185  85.589  1.645   1.00 18.57 ? 114 PRO D CG  1 
ATOM   6895  C  CD  . PRO D  1 105 ? -50.805  86.980  1.224   1.00 17.83 ? 114 PRO D CD  1 
ATOM   6896  N  N   . ASN D  1 106 ? -52.158  87.018  5.668   1.00 24.82 ? 115 ASN D N   1 
ATOM   6897  C  CA  . ASN D  1 106 ? -51.587  86.983  6.989   1.00 27.70 ? 115 ASN D CA  1 
ATOM   6898  C  C   . ASN D  1 106 ? -50.598  85.839  7.249   1.00 28.74 ? 115 ASN D C   1 
ATOM   6899  O  O   . ASN D  1 106 ? -49.926  85.821  8.268   1.00 29.95 ? 115 ASN D O   1 
ATOM   6900  C  CB  . ASN D  1 106 ? -52.682  86.901  8.037   1.00 32.03 ? 115 ASN D CB  1 
ATOM   6901  C  CG  . ASN D  1 106 ? -52.254  87.506  9.365   1.00 37.72 ? 115 ASN D CG  1 
ATOM   6902  O  OD1 . ASN D  1 106 ? -51.562  88.550  9.422   1.00 43.42 ? 115 ASN D OD1 1 
ATOM   6903  N  ND2 . ASN D  1 106 ? -52.647  86.856  10.442  1.00 36.40 ? 115 ASN D ND2 1 
ATOM   6904  N  N   . SER D  1 107 ? -50.562  84.844  6.386   1.00 28.14 ? 116 SER D N   1 
ATOM   6905  C  CA  . SER D  1 107 ? -49.619  83.739  6.553   1.00 26.58 ? 116 SER D CA  1 
ATOM   6906  C  C   . SER D  1 107 ? -48.173  84.130  6.197   1.00 27.26 ? 116 SER D C   1 
ATOM   6907  O  O   . SER D  1 107 ? -47.265  83.324  6.325   1.00 23.90 ? 116 SER D O   1 
ATOM   6908  C  CB  . SER D  1 107 ? -50.053  82.587  5.660   1.00 25.33 ? 116 SER D CB  1 
ATOM   6909  O  OG  . SER D  1 107 ? -50.074  83.025  4.329   1.00 22.79 ? 116 SER D OG  1 
ATOM   6910  N  N   . LEU D  1 108 ? -47.972  85.335  5.663   1.00 28.26 ? 117 LEU D N   1 
ATOM   6911  C  CA  . LEU D  1 108 ? -46.615  85.800  5.322   1.00 25.42 ? 117 LEU D CA  1 
ATOM   6912  C  C   . LEU D  1 108 ? -45.763  86.013  6.592   1.00 23.44 ? 117 LEU D C   1 
ATOM   6913  O  O   . LEU D  1 108 ? -46.174  86.661  7.536   1.00 23.50 ? 117 LEU D O   1 
ATOM   6914  C  CB  . LEU D  1 108 ? -46.650  87.107  4.558   1.00 24.92 ? 117 LEU D CB  1 
ATOM   6915  C  CG  . LEU D  1 108 ? -45.268  87.722  4.284   1.00 24.79 ? 117 LEU D CG  1 
ATOM   6916  C  CD1 . LEU D  1 108 ? -44.602  87.062  3.092   1.00 25.29 ? 117 LEU D CD1 1 
ATOM   6917  C  CD2 . LEU D  1 108 ? -45.364  89.224  4.083   1.00 22.97 ? 117 LEU D CD2 1 
ATOM   6918  N  N   . ASP D  1 109 ? -44.589  85.406  6.582   1.00 23.46 ? 118 ASP D N   1 
ATOM   6919  C  CA  . ASP D  1 109 ? -43.550  85.682  7.592   1.00 24.58 ? 118 ASP D CA  1 
ATOM   6920  C  C   . ASP D  1 109 ? -42.823  86.981  7.172   1.00 22.20 ? 118 ASP D C   1 
ATOM   6921  O  O   . ASP D  1 109 ? -42.056  86.992  6.191   1.00 19.40 ? 118 ASP D O   1 
ATOM   6922  C  CB  . ASP D  1 109 ? -42.568  84.515  7.661   1.00 26.63 ? 118 ASP D CB  1 
ATOM   6923  C  CG  . ASP D  1 109 ? -41.442  84.737  8.653   1.00 29.99 ? 118 ASP D CG  1 
ATOM   6924  O  OD1 . ASP D  1 109 ? -41.413  85.759  9.390   1.00 30.39 ? 118 ASP D OD1 1 
ATOM   6925  O  OD2 . ASP D  1 109 ? -40.550  83.859  8.678   1.00 33.40 ? 118 ASP D OD2 1 
ATOM   6926  N  N   . GLN D  1 110 ? -43.145  88.061  7.866   1.00 21.22 ? 119 GLN D N   1 
ATOM   6927  C  CA  . GLN D  1 110 ? -42.636  89.396  7.538   1.00 23.93 ? 119 GLN D CA  1 
ATOM   6928  C  C   . GLN D  1 110 ? -41.101  89.462  7.550   1.00 26.03 ? 119 GLN D C   1 
ATOM   6929  O  O   . GLN D  1 110 ? -40.487  90.241  6.791   1.00 29.35 ? 119 GLN D O   1 
ATOM   6930  C  CB  . GLN D  1 110 ? -43.182  90.428  8.513   1.00 23.24 ? 119 GLN D CB  1 
ATOM   6931  C  CG  . GLN D  1 110 ? -44.650  90.755  8.315   1.00 22.35 ? 119 GLN D CG  1 
ATOM   6932  C  CD  . GLN D  1 110 ? -45.131  91.829  9.274   1.00 24.00 ? 119 GLN D CD  1 
ATOM   6933  O  OE1 . GLN D  1 110 ? -45.620  91.533  10.349  1.00 26.00 ? 119 GLN D OE1 1 
ATOM   6934  N  NE2 . GLN D  1 110 ? -44.961  93.088  8.905   1.00 24.33 ? 119 GLN D NE2 1 
ATOM   6935  N  N   . THR D  1 111 ? -40.480  88.663  8.419   1.00 23.97 ? 120 THR D N   1 
ATOM   6936  C  CA  . THR D  1 111 ? -39.002  88.632  8.507   1.00 23.45 ? 120 THR D CA  1 
ATOM   6937  C  C   . THR D  1 111 ? -38.369  87.830  7.355   1.00 22.68 ? 120 THR D C   1 
ATOM   6938  O  O   . THR D  1 111 ? -37.163  87.762  7.268   1.00 22.24 ? 120 THR D O   1 
ATOM   6939  C  CB  . THR D  1 111 ? -38.493  88.077  9.863   1.00 23.29 ? 120 THR D CB  1 
ATOM   6940  O  OG1 . THR D  1 111 ? -38.721  86.663  9.910   1.00 21.37 ? 120 THR D OG1 1 
ATOM   6941  C  CG2 . THR D  1 111 ? -39.175  88.784  11.062  1.00 22.83 ? 120 THR D CG2 1 
ATOM   6942  N  N   . ASP D  1 112 ? -39.178  87.220  6.493   1.00 22.56 ? 121 ASP D N   1 
ATOM   6943  C  CA  . ASP D  1 112 ? -38.656  86.507  5.321   1.00 24.43 ? 121 ASP D CA  1 
ATOM   6944  C  C   . ASP D  1 112 ? -39.209  87.022  3.996   1.00 24.79 ? 121 ASP D C   1 
ATOM   6945  O  O   . ASP D  1 112 ? -39.006  86.418  2.935   1.00 25.09 ? 121 ASP D O   1 
ATOM   6946  C  CB  . ASP D  1 112 ? -38.918  85.009  5.423   1.00 25.99 ? 121 ASP D CB  1 
ATOM   6947  C  CG  . ASP D  1 112 ? -38.081  84.202  4.426   1.00 30.69 ? 121 ASP D CG  1 
ATOM   6948  O  OD1 . ASP D  1 112 ? -36.885  84.529  4.208   1.00 32.95 ? 121 ASP D OD1 1 
ATOM   6949  O  OD2 . ASP D  1 112 ? -38.633  83.273  3.795   1.00 35.13 ? 121 ASP D OD2 1 
ATOM   6950  N  N   . MET D  1 113 ? -39.887  88.155  4.046   1.00 25.28 ? 122 MET D N   1 
ATOM   6951  C  CA  . MET D  1 113 ? -40.478  88.725  2.831   1.00 24.63 ? 122 MET D CA  1 
ATOM   6952  C  C   . MET D  1 113 ? -39.412  88.974  1.787   1.00 25.74 ? 122 MET D C   1 
ATOM   6953  O  O   . MET D  1 113 ? -38.337  89.504  2.086   1.00 25.92 ? 122 MET D O   1 
ATOM   6954  C  CB  . MET D  1 113 ? -41.199  90.037  3.130   1.00 23.46 ? 122 MET D CB  1 
ATOM   6955  C  CG  . MET D  1 113 ? -41.891  90.640  1.904   1.00 23.07 ? 122 MET D CG  1 
ATOM   6956  S  SD  . MET D  1 113 ? -42.739  92.209  2.266   1.00 21.25 ? 122 MET D SD  1 
ATOM   6957  C  CE  . MET D  1 113 ? -41.493  93.443  2.406   1.00 21.38 ? 122 MET D CE  1 
ATOM   6958  N  N   . HIS D  1 114 ? -39.729  88.595  0.555   1.00 25.26 ? 123 HIS D N   1 
ATOM   6959  C  CA  . HIS D  1 114 ? -38.887  88.924  -0.595  1.00 26.04 ? 123 HIS D CA  1 
ATOM   6960  C  C   . HIS D  1 114 ? -39.662  88.858  -1.942  1.00 26.48 ? 123 HIS D C   1 
ATOM   6961  O  O   . HIS D  1 114 ? -40.851  88.616  -1.980  1.00 26.05 ? 123 HIS D O   1 
ATOM   6962  C  CB  . HIS D  1 114 ? -37.668  88.004  -0.634  1.00 25.49 ? 123 HIS D CB  1 
ATOM   6963  C  CG  . HIS D  1 114 ? -38.006  86.553  -0.768  1.00 25.91 ? 123 HIS D CG  1 
ATOM   6964  N  ND1 . HIS D  1 114 ? -38.564  85.818  0.257   1.00 25.13 ? 123 HIS D ND1 1 
ATOM   6965  C  CD2 . HIS D  1 114 ? -37.848  85.696  -1.802  1.00 26.99 ? 123 HIS D CD2 1 
ATOM   6966  C  CE1 . HIS D  1 114 ? -38.780  84.583  -0.152  1.00 25.16 ? 123 HIS D CE1 1 
ATOM   6967  N  NE2 . HIS D  1 114 ? -38.353  84.481  -1.399  1.00 27.03 ? 123 HIS D NE2 1 
ATOM   6968  N  N   . GLY D  1 115 ? -38.953  89.112  -3.019  1.00 26.82 ? 124 GLY D N   1 
ATOM   6969  C  CA  . GLY D  1 115 ? -39.515  89.220  -4.348  1.00 29.79 ? 124 GLY D CA  1 
ATOM   6970  C  C   . GLY D  1 115 ? -40.371  88.040  -4.731  1.00 30.24 ? 124 GLY D C   1 
ATOM   6971  O  O   . GLY D  1 115 ? -41.277  88.186  -5.515  1.00 34.04 ? 124 GLY D O   1 
ATOM   6972  N  N   . ASP D  1 116 ? -40.099  86.876  -4.170  1.00 31.19 ? 125 ASP D N   1 
ATOM   6973  C  CA  . ASP D  1 116 ? -40.860  85.675  -4.529  1.00 31.84 ? 125 ASP D CA  1 
ATOM   6974  C  C   . ASP D  1 116 ? -41.845  85.234  -3.485  1.00 28.38 ? 125 ASP D C   1 
ATOM   6975  O  O   . ASP D  1 116 ? -42.447  84.202  -3.639  1.00 29.50 ? 125 ASP D O   1 
ATOM   6976  C  CB  . ASP D  1 116 ? -39.922  84.533  -4.844  1.00 34.69 ? 125 ASP D CB  1 
ATOM   6977  C  CG  . ASP D  1 116 ? -39.135  84.777  -6.104  1.00 42.17 ? 125 ASP D CG  1 
ATOM   6978  O  OD1 . ASP D  1 116 ? -39.293  85.854  -6.739  1.00 44.88 ? 125 ASP D OD1 1 
ATOM   6979  O  OD2 . ASP D  1 116 ? -38.371  83.877  -6.480  1.00 57.72 ? 125 ASP D OD2 1 
ATOM   6980  N  N   . SER D  1 117 ? -42.045  86.036  -2.446  1.00 26.03 ? 126 SER D N   1 
ATOM   6981  C  CA  . SER D  1 117 ? -43.105  85.738  -1.506  1.00 27.24 ? 126 SER D CA  1 
ATOM   6982  C  C   . SER D  1 117 ? -44.482  85.848  -2.221  1.00 25.68 ? 126 SER D C   1 
ATOM   6983  O  O   . SER D  1 117 ? -44.665  86.693  -3.111  1.00 23.29 ? 126 SER D O   1 
ATOM   6984  C  CB  . SER D  1 117 ? -43.038  86.665  -0.277  1.00 28.33 ? 126 SER D CB  1 
ATOM   6985  O  OG  . SER D  1 117 ? -41.766  86.630  0.336   1.00 28.80 ? 126 SER D OG  1 
ATOM   6986  N  N   . GLU D  1 118 ? -45.430  85.013  -1.790  1.00 24.39 ? 127 GLU D N   1 
ATOM   6987  C  CA  . GLU D  1 118 ? -46.755  84.958  -2.390  1.00 24.99 ? 127 GLU D CA  1 
ATOM   6988  C  C   . GLU D  1 118 ? -47.646  86.084  -1.855  1.00 21.98 ? 127 GLU D C   1 
ATOM   6989  O  O   . GLU D  1 118 ? -48.024  86.120  -0.680  1.00 20.91 ? 127 GLU D O   1 
ATOM   6990  C  CB  . GLU D  1 118 ? -47.384  83.590  -2.160  1.00 28.93 ? 127 GLU D CB  1 
ATOM   6991  C  CG  . GLU D  1 118 ? -48.676  83.350  -2.946  1.00 35.11 ? 127 GLU D CG  1 
ATOM   6992  C  CD  . GLU D  1 118 ? -49.562  82.160  -2.427  1.00 40.57 ? 127 GLU D CD  1 
ATOM   6993  O  OE1 . GLU D  1 118 ? -49.205  81.429  -1.483  1.00 44.12 ? 127 GLU D OE1 1 
ATOM   6994  O  OE2 . GLU D  1 118 ? -50.697  81.961  -2.912  1.00 46.64 ? 127 GLU D OE2 1 
ATOM   6995  N  N   . TYR D  1 119 ? -47.960  87.029  -2.724  1.00 18.87 ? 128 TYR D N   1 
ATOM   6996  C  CA  . TYR D  1 119 ? -48.893  88.096  -2.366  1.00 16.92 ? 128 TYR D CA  1 
ATOM   6997  C  C   . TYR D  1 119 ? -50.267  87.853  -3.014  1.00 14.97 ? 128 TYR D C   1 
ATOM   6998  O  O   . TYR D  1 119 ? -50.398  87.035  -3.899  1.00 14.49 ? 128 TYR D O   1 
ATOM   6999  C  CB  . TYR D  1 119 ? -48.324  89.466  -2.761  1.00 16.92 ? 128 TYR D CB  1 
ATOM   7000  C  CG  . TYR D  1 119 ? -47.965  89.523  -4.212  1.00 15.78 ? 128 TYR D CG  1 
ATOM   7001  C  CD1 . TYR D  1 119 ? -48.938  89.792  -5.152  1.00 15.24 ? 128 TYR D CD1 1 
ATOM   7002  C  CD2 . TYR D  1 119 ? -46.663  89.320  -4.652  1.00 15.75 ? 128 TYR D CD2 1 
ATOM   7003  C  CE1 . TYR D  1 119 ? -48.621  89.872  -6.489  1.00 14.83 ? 128 TYR D CE1 1 
ATOM   7004  C  CE2 . TYR D  1 119 ? -46.338  89.396  -5.994  1.00 14.64 ? 128 TYR D CE2 1 
ATOM   7005  C  CZ  . TYR D  1 119 ? -47.338  89.683  -6.898  1.00 14.62 ? 128 TYR D CZ  1 
ATOM   7006  O  OH  . TYR D  1 119 ? -47.124  89.741  -8.234  1.00 14.17 ? 128 TYR D OH  1 
ATOM   7007  N  N   . ASN D  1 120 ? -51.273  88.602  -2.565  1.00 14.85 ? 129 ASN D N   1 
ATOM   7008  C  CA  . ASN D  1 120 ? -52.609  88.589  -3.188  1.00 14.25 ? 129 ASN D CA  1 
ATOM   7009  C  C   . ASN D  1 120 ? -52.709  89.584  -4.363  1.00 13.54 ? 129 ASN D C   1 
ATOM   7010  O  O   . ASN D  1 120 ? -53.162  89.230  -5.452  1.00 13.21 ? 129 ASN D O   1 
ATOM   7011  C  CB  . ASN D  1 120 ? -53.688  88.918  -2.147  1.00 14.16 ? 129 ASN D CB  1 
ATOM   7012  C  CG  . ASN D  1 120 ? -53.866  87.825  -1.150  1.00 14.11 ? 129 ASN D CG  1 
ATOM   7013  O  OD1 . ASN D  1 120 ? -53.500  86.673  -1.401  1.00 14.75 ? 129 ASN D OD1 1 
ATOM   7014  N  ND2 . ASN D  1 120 ? -54.411  88.164  0.007   1.00 14.46 ? 129 ASN D ND2 1 
ATOM   7015  N  N   . ILE D  1 121 ? -52.322  90.821  -4.091  1.00 12.81 ? 130 ILE D N   1 
ATOM   7016  C  CA  . ILE D  1 121 ? -52.409  91.939  -5.044  1.00 12.91 ? 130 ILE D CA  1 
ATOM   7017  C  C   . ILE D  1 121 ? -51.169  92.806  -4.993  1.00 13.85 ? 130 ILE D C   1 
ATOM   7018  O  O   . ILE D  1 121 ? -50.636  93.071  -3.916  1.00 13.33 ? 130 ILE D O   1 
ATOM   7019  C  CB  . ILE D  1 121 ? -53.605  92.850  -4.729  1.00 12.20 ? 130 ILE D CB  1 
ATOM   7020  C  CG1 . ILE D  1 121 ? -54.919  92.094  -4.882  1.00 12.15 ? 130 ILE D CG1 1 
ATOM   7021  C  CG2 . ILE D  1 121 ? -53.640  94.029  -5.654  1.00 12.56 ? 130 ILE D CG2 1 
ATOM   7022  C  CD1 . ILE D  1 121 ? -56.094  92.809  -4.310  1.00 12.23 ? 130 ILE D CD1 1 
ATOM   7023  N  N   . MET D  1 122 ? -50.692  93.212  -6.166  1.00 16.09 ? 131 MET D N   1 
ATOM   7024  C  CA  . MET D  1 122 ? -49.632  94.217  -6.289  1.00 17.17 ? 131 MET D CA  1 
ATOM   7025  C  C   . MET D  1 122 ? -50.124  95.409  -7.075  1.00 15.71 ? 131 MET D C   1 
ATOM   7026  O  O   . MET D  1 122 ? -50.730  95.259  -8.125  1.00 15.91 ? 131 MET D O   1 
ATOM   7027  C  CB  . MET D  1 122 ? -48.399  93.662  -6.974  1.00 20.44 ? 131 MET D CB  1 
ATOM   7028  C  CG  . MET D  1 122 ? -47.346  94.723  -7.288  1.00 24.23 ? 131 MET D CG  1 
ATOM   7029  S  SD  . MET D  1 122 ? -45.910  93.904  -7.981  1.00 36.46 ? 131 MET D SD  1 
ATOM   7030  C  CE  . MET D  1 122 ? -45.451  95.037  -9.298  1.00 34.21 ? 131 MET D CE  1 
ATOM   7031  N  N   . PHE D  1 123 ? -49.834  96.610  -6.581  1.00 13.85 ? 132 PHE D N   1 
ATOM   7032  C  CA  . PHE D  1 123 ? -50.337  97.816  -7.220  1.00 12.08 ? 132 PHE D CA  1 
ATOM   7033  C  C   . PHE D  1 123 ? -49.404  99.001  -7.124  1.00 11.39 ? 132 PHE D C   1 
ATOM   7034  O  O   . PHE D  1 123 ? -48.991  99.353  -6.025  1.00 10.59 ? 132 PHE D O   1 
ATOM   7035  C  CB  . PHE D  1 123 ? -51.653  98.199  -6.560  1.00 11.32 ? 132 PHE D CB  1 
ATOM   7036  C  CG  . PHE D  1 123 ? -52.168  99.512  -7.001  1.00 10.78 ? 132 PHE D CG  1 
ATOM   7037  C  CD1 . PHE D  1 123 ? -52.449  99.735  -8.345  1.00 10.37 ? 132 PHE D CD1 1 
ATOM   7038  C  CD2 . PHE D  1 123 ? -52.357  100.545 -6.090  1.00 10.06 ? 132 PHE D CD2 1 
ATOM   7039  C  CE1 . PHE D  1 123 ? -52.944  100.955 -8.754  1.00 9.98  ? 132 PHE D CE1 1 
ATOM   7040  C  CE2 . PHE D  1 123 ? -52.836  101.771 -6.520  1.00 9.69  ? 132 PHE D CE2 1 
ATOM   7041  C  CZ  . PHE D  1 123 ? -53.093  101.984 -7.841  1.00 9.31  ? 132 PHE D CZ  1 
ATOM   7042  N  N   . GLY D  1 124 ? -49.108  99.624  -8.253  1.00 10.81 ? 133 GLY D N   1 
ATOM   7043  C  CA  . GLY D  1 124 ? -48.518  100.962 -8.235  1.00 11.52 ? 133 GLY D CA  1 
ATOM   7044  C  C   . GLY D  1 124 ? -47.479  101.226 -9.316  1.00 11.38 ? 133 GLY D C   1 
ATOM   7045  O  O   . GLY D  1 124 ? -47.267  100.387 -10.170 1.00 11.38 ? 133 GLY D O   1 
ATOM   7046  N  N   . PRO D  1 125 ? -46.846  102.405 -9.275  1.00 11.32 ? 134 PRO D N   1 
ATOM   7047  C  CA  . PRO D  1 125 ? -45.969  102.877 -10.359 1.00 12.57 ? 134 PRO D CA  1 
ATOM   7048  C  C   . PRO D  1 125 ? -44.616  102.140 -10.455 1.00 14.03 ? 134 PRO D C   1 
ATOM   7049  O  O   . PRO D  1 125 ? -44.087  101.690 -9.442  1.00 14.37 ? 134 PRO D O   1 
ATOM   7050  C  CB  . PRO D  1 125 ? -45.723  104.348 -10.033 1.00 11.86 ? 134 PRO D CB  1 
ATOM   7051  C  CG  . PRO D  1 125 ? -45.984  104.472 -8.578  1.00 11.62 ? 134 PRO D CG  1 
ATOM   7052  C  CD  . PRO D  1 125 ? -47.060  103.450 -8.263  1.00 11.67 ? 134 PRO D CD  1 
ATOM   7053  N  N   . ASP D  1 126 ? -44.191  101.892 -11.692 1.00 15.24 ? 135 ASP D N   1 
ATOM   7054  C  CA  . ASP D  1 126 ? -42.927  101.273 -11.979 1.00 17.20 ? 135 ASP D CA  1 
ATOM   7055  C  C   . ASP D  1 126 ? -42.261  102.009 -13.134 1.00 17.58 ? 135 ASP D C   1 
ATOM   7056  O  O   . ASP D  1 126 ? -42.822  102.147 -14.230 1.00 15.47 ? 135 ASP D O   1 
ATOM   7057  C  CB  . ASP D  1 126 ? -43.083  99.806  -12.321 1.00 20.30 ? 135 ASP D CB  1 
ATOM   7058  C  CG  . ASP D  1 126 ? -41.752  99.012  -12.255 1.00 23.42 ? 135 ASP D CG  1 
ATOM   7059  O  OD1 . ASP D  1 126 ? -40.737  99.523  -11.710 1.00 25.71 ? 135 ASP D OD1 1 
ATOM   7060  O  OD2 . ASP D  1 126 ? -41.749  97.841  -12.737 1.00 29.58 ? 135 ASP D OD2 1 
ATOM   7061  N  N   . ILE D  1 127 ? -41.037  102.437 -12.871 1.00 19.04 ? 136 ILE D N   1 
ATOM   7062  C  CA  . ILE D  1 127 ? -40.260  103.233 -13.817 1.00 20.29 ? 136 ILE D CA  1 
ATOM   7063  C  C   . ILE D  1 127 ? -38.972  102.533 -14.112 1.00 21.63 ? 136 ILE D C   1 
ATOM   7064  O  O   . ILE D  1 127 ? -38.294  102.060 -13.221 1.00 23.00 ? 136 ILE D O   1 
ATOM   7065  C  CB  . ILE D  1 127 ? -39.974  104.625 -13.271 1.00 20.61 ? 136 ILE D CB  1 
ATOM   7066  C  CG1 . ILE D  1 127 ? -41.308  105.275 -12.882 1.00 20.60 ? 136 ILE D CG1 1 
ATOM   7067  C  CG2 . ILE D  1 127 ? -39.198  105.430 -14.285 1.00 21.82 ? 136 ILE D CG2 1 
ATOM   7068  C  CD1 . ILE D  1 127 ? -41.368  106.761 -12.664 1.00 22.14 ? 136 ILE D CD1 1 
ATOM   7069  N  N   . CYS D  1 128 ? -38.661  102.425 -15.387 1.00 24.35 ? 137 CYS D N   1 
ATOM   7070  C  CA  . CYS D  1 128 ? -37.363  101.951 -15.796 1.00 26.97 ? 137 CYS D CA  1 
ATOM   7071  C  C   . CYS D  1 128 ? -36.989  102.518 -17.148 1.00 27.73 ? 137 CYS D C   1 
ATOM   7072  O  O   . CYS D  1 128 ? -37.434  102.063 -18.190 1.00 24.24 ? 137 CYS D O   1 
ATOM   7073  C  CB  . CYS D  1 128 ? -37.246  100.427 -15.759 1.00 29.38 ? 137 CYS D CB  1 
ATOM   7074  S  SG  . CYS D  1 128 ? -35.492  99.980  -15.560 1.00 38.66 ? 137 CYS D SG  1 
ATOM   7075  N  N   . GLY D  1 129 ? -36.184  103.566 -17.084 1.00 31.54 ? 138 GLY D N   1 
ATOM   7076  C  CA  . GLY D  1 129 ? -35.680  104.224 -18.247 1.00 34.26 ? 138 GLY D CA  1 
ATOM   7077  C  C   . GLY D  1 129 ? -36.761  104.932 -19.026 1.00 42.61 ? 138 GLY D C   1 
ATOM   7078  O  O   . GLY D  1 129 ? -37.931  105.068 -18.538 1.00 45.41 ? 138 GLY D O   1 
ATOM   7079  N  N   . PRO D  1 130 ? -36.406  105.326 -20.275 1.00 47.69 ? 139 PRO D N   1 
ATOM   7080  C  CA  . PRO D  1 130 ? -37.270  106.148 -21.111 1.00 46.77 ? 139 PRO D CA  1 
ATOM   7081  C  C   . PRO D  1 130 ? -38.539  105.388 -21.499 1.00 43.02 ? 139 PRO D C   1 
ATOM   7082  O  O   . PRO D  1 130 ? -39.603  105.971 -21.518 1.00 43.01 ? 139 PRO D O   1 
ATOM   7083  C  CB  . PRO D  1 130 ? -36.411  106.462 -22.346 1.00 48.93 ? 139 PRO D CB  1 
ATOM   7084  C  CG  . PRO D  1 130 ? -35.196  105.596 -22.258 1.00 50.61 ? 139 PRO D CG  1 
ATOM   7085  C  CD  . PRO D  1 130 ? -35.290  104.727 -21.043 1.00 50.20 ? 139 PRO D CD  1 
ATOM   7086  N  N   . GLY D  1 131 ? -38.412  104.079 -21.736 1.00 40.35 ? 140 GLY D N   1 
ATOM   7087  C  CA  . GLY D  1 131 ? -39.514  103.238 -22.199 1.00 40.37 ? 140 GLY D CA  1 
ATOM   7088  C  C   . GLY D  1 131 ? -40.615  102.831 -21.230 1.00 39.35 ? 140 GLY D C   1 
ATOM   7089  O  O   . GLY D  1 131 ? -41.736  102.608 -21.663 1.00 43.59 ? 140 GLY D O   1 
ATOM   7090  N  N   . THR D  1 132 ? -40.322  102.725 -19.935 1.00 35.84 ? 141 THR D N   1 
ATOM   7091  C  CA  . THR D  1 132 ? -41.288  102.204 -18.952 1.00 32.59 ? 141 THR D CA  1 
ATOM   7092  C  C   . THR D  1 132 ? -41.714  103.219 -17.919 1.00 27.90 ? 141 THR D C   1 
ATOM   7093  O  O   . THR D  1 132 ? -40.921  103.627 -17.075 1.00 25.76 ? 141 THR D O   1 
ATOM   7094  C  CB  . THR D  1 132 ? -40.729  100.976 -18.223 1.00 34.16 ? 141 THR D CB  1 
ATOM   7095  O  OG1 . THR D  1 132 ? -40.312  100.052 -19.203 1.00 36.83 ? 141 THR D OG1 1 
ATOM   7096  C  CG2 . THR D  1 132 ? -41.782  100.274 -17.345 1.00 33.17 ? 141 THR D CG2 1 
ATOM   7097  N  N   . LYS D  1 133 ? -42.975  103.617 -18.009 1.00 23.72 ? 142 LYS D N   1 
ATOM   7098  C  CA  . LYS D  1 133 ? -43.630  104.456 -17.007 1.00 25.10 ? 142 LYS D CA  1 
ATOM   7099  C  C   . LYS D  1 133 ? -45.038  103.907 -16.855 1.00 22.02 ? 142 LYS D C   1 
ATOM   7100  O  O   . LYS D  1 133 ? -45.959  104.405 -17.460 1.00 17.85 ? 142 LYS D O   1 
ATOM   7101  C  CB  . LYS D  1 133 ? -43.777  105.897 -17.462 1.00 28.72 ? 142 LYS D CB  1 
ATOM   7102  C  CG  . LYS D  1 133 ? -42.497  106.593 -17.686 1.00 31.36 ? 142 LYS D CG  1 
ATOM   7103  C  CD  . LYS D  1 133 ? -42.577  108.029 -18.177 1.00 37.40 ? 142 LYS D CD  1 
ATOM   7104  C  CE  . LYS D  1 133 ? -41.156  108.729 -18.163 1.00 41.69 ? 142 LYS D CE  1 
ATOM   7105  N  NZ  . LYS D  1 133 ? -40.252  108.492 -19.326 1.00 47.27 ? 142 LYS D NZ  1 
ATOM   7106  N  N   . LYS D  1 134 ? -45.177  102.927 -15.996 1.00 19.01 ? 143 LYS D N   1 
ATOM   7107  C  CA  . LYS D  1 134 ? -46.309  102.081 -16.033 1.00 19.49 ? 143 LYS D CA  1 
ATOM   7108  C  C   . LYS D  1 134 ? -46.883  101.894 -14.619 1.00 18.60 ? 143 LYS D C   1 
ATOM   7109  O  O   . LYS D  1 134 ? -46.154  101.905 -13.650 1.00 17.02 ? 143 LYS D O   1 
ATOM   7110  C  CB  . LYS D  1 134 ? -45.896  100.771 -16.746 1.00 22.19 ? 143 LYS D CB  1 
ATOM   7111  C  CG  . LYS D  1 134 ? -46.405  99.484  -16.179 1.00 24.01 ? 143 LYS D CG  1 
ATOM   7112  C  CD  . LYS D  1 134 ? -45.873  98.322  -16.942 1.00 24.96 ? 143 LYS D CD  1 
ATOM   7113  C  CE  . LYS D  1 134 ? -46.754  97.130  -16.579 1.00 27.77 ? 143 LYS D CE  1 
ATOM   7114  N  NZ  . LYS D  1 134 ? -47.971  96.870  -17.399 1.00 27.82 ? 143 LYS D NZ  1 
ATOM   7115  N  N   . VAL D  1 135 ? -48.205  101.773 -14.533 1.00 17.92 ? 144 VAL D N   1 
ATOM   7116  C  CA  . VAL D  1 135 ? -48.873  101.350 -13.306 1.00 16.58 ? 144 VAL D CA  1 
ATOM   7117  C  C   . VAL D  1 135 ? -49.221  99.848  -13.364 1.00 16.53 ? 144 VAL D C   1 
ATOM   7118  O  O   . VAL D  1 135 ? -50.058  99.386  -14.137 1.00 16.20 ? 144 VAL D O   1 
ATOM   7119  C  CB  . VAL D  1 135 ? -50.123  102.155 -13.003 1.00 16.31 ? 144 VAL D CB  1 
ATOM   7120  C  CG1 . VAL D  1 135 ? -50.660  101.794 -11.622 1.00 17.60 ? 144 VAL D CG1 1 
ATOM   7121  C  CG2 . VAL D  1 135 ? -49.846  103.646 -13.057 1.00 16.38 ? 144 VAL D CG2 1 
ATOM   7122  N  N   . HIS D  1 136 ? -48.595  99.104  -12.478 1.00 15.87 ? 145 HIS D N   1 
ATOM   7123  C  CA  . HIS D  1 136 ? -48.916  97.717  -12.317 1.00 16.73 ? 145 HIS D CA  1 
ATOM   7124  C  C   . HIS D  1 136 ? -50.210  97.515  -11.551 1.00 16.73 ? 145 HIS D C   1 
ATOM   7125  O  O   . HIS D  1 136 ? -50.424  98.102  -10.501 1.00 15.31 ? 145 HIS D O   1 
ATOM   7126  C  CB  . HIS D  1 136 ? -47.831  97.002  -11.520 1.00 17.91 ? 145 HIS D CB  1 
ATOM   7127  C  CG  . HIS D  1 136 ? -46.602  96.716  -12.299 1.00 19.35 ? 145 HIS D CG  1 
ATOM   7128  N  ND1 . HIS D  1 136 ? -46.600  95.873  -13.379 1.00 22.30 ? 145 HIS D ND1 1 
ATOM   7129  C  CD2 . HIS D  1 136 ? -45.326  97.145  -12.150 1.00 20.71 ? 145 HIS D CD2 1 
ATOM   7130  C  CE1 . HIS D  1 136 ? -45.374  95.780  -13.860 1.00 20.50 ? 145 HIS D CE1 1 
ATOM   7131  N  NE2 . HIS D  1 136 ? -44.587  96.562  -13.142 1.00 20.00 ? 145 HIS D NE2 1 
ATOM   7132  N  N   . VAL D  1 137 ? -51.015  96.578  -12.037 1.00 16.40 ? 146 VAL D N   1 
ATOM   7133  C  CA  . VAL D  1 137 ? -52.088  96.017  -11.261 1.00 15.26 ? 146 VAL D CA  1 
ATOM   7134  C  C   . VAL D  1 137 ? -52.006  94.521  -11.466 1.00 15.85 ? 146 VAL D C   1 
ATOM   7135  O  O   . VAL D  1 137 ? -52.268  94.005  -12.550 1.00 15.73 ? 146 VAL D O   1 
ATOM   7136  C  CB  . VAL D  1 137 ? -53.447  96.533  -11.712 1.00 15.24 ? 146 VAL D CB  1 
ATOM   7137  C  CG1 . VAL D  1 137 ? -54.498  96.147  -10.692 1.00 14.79 ? 146 VAL D CG1 1 
ATOM   7138  C  CG2 . VAL D  1 137 ? -53.416  98.034  -11.851 1.00 14.70 ? 146 VAL D CG2 1 
ATOM   7139  N  N   . ILE D  1 138 ? -51.578  93.809  -10.423 1.00 16.42 ? 147 ILE D N   1 
ATOM   7140  C  CA  . ILE D  1 138 ? -51.382  92.363  -10.501 1.00 16.08 ? 147 ILE D CA  1 
ATOM   7141  C  C   . ILE D  1 138 ? -52.263  91.627  -9.491  1.00 15.96 ? 147 ILE D C   1 
ATOM   7142  O  O   . ILE D  1 138 ? -52.297  91.953  -8.310  1.00 14.62 ? 147 ILE D O   1 
ATOM   7143  C  CB  . ILE D  1 138 ? -49.898  91.980  -10.276 1.00 17.60 ? 147 ILE D CB  1 
ATOM   7144  C  CG1 . ILE D  1 138 ? -49.003  92.757  -11.217 1.00 17.38 ? 147 ILE D CG1 1 
ATOM   7145  C  CG2 . ILE D  1 138 ? -49.670  90.489  -10.467 1.00 17.77 ? 147 ILE D CG2 1 
ATOM   7146  C  CD1 . ILE D  1 138 ? -47.520  92.483  -11.060 1.00 17.45 ? 147 ILE D CD1 1 
ATOM   7147  N  N   . PHE D  1 139 ? -52.937  90.601  -9.984  1.00 15.97 ? 148 PHE D N   1 
ATOM   7148  C  CA  . PHE D  1 139 ? -53.754  89.742  -9.150  1.00 17.81 ? 148 PHE D CA  1 
ATOM   7149  C  C   . PHE D  1 139 ? -53.152  88.348  -9.126  1.00 18.27 ? 148 PHE D C   1 
ATOM   7150  O  O   . PHE D  1 139 ? -52.785  87.807  -10.182 1.00 18.95 ? 148 PHE D O   1 
ATOM   7151  C  CB  . PHE D  1 139 ? -55.199  89.625  -9.681  1.00 18.29 ? 148 PHE D CB  1 
ATOM   7152  C  CG  . PHE D  1 139 ? -56.062  90.803  -9.372  1.00 19.01 ? 148 PHE D CG  1 
ATOM   7153  C  CD1 . PHE D  1 139 ? -56.099  91.895  -10.201 1.00 18.61 ? 148 PHE D CD1 1 
ATOM   7154  C  CD2 . PHE D  1 139 ? -56.817  90.816  -8.226  1.00 20.24 ? 148 PHE D CD2 1 
ATOM   7155  C  CE1 . PHE D  1 139 ? -56.888  92.978  -9.887  1.00 19.57 ? 148 PHE D CE1 1 
ATOM   7156  C  CE2 . PHE D  1 139 ? -57.611  91.881  -7.919  1.00 19.81 ? 148 PHE D CE2 1 
ATOM   7157  C  CZ  . PHE D  1 139 ? -57.650  92.970  -8.735  1.00 19.48 ? 148 PHE D CZ  1 
ATOM   7158  N  N   . ASN D  1 140 ? -53.026  87.800  -7.928  1.00 17.24 ? 149 ASN D N   1 
ATOM   7159  C  CA  . ASN D  1 140 ? -52.645  86.402  -7.792  1.00 19.23 ? 149 ASN D CA  1 
ATOM   7160  C  C   . ASN D  1 140 ? -53.885  85.505  -7.897  1.00 18.91 ? 149 ASN D C   1 
ATOM   7161  O  O   . ASN D  1 140 ? -54.818  85.620  -7.107  1.00 17.06 ? 149 ASN D O   1 
ATOM   7162  C  CB  . ASN D  1 140 ? -51.937  86.142  -6.446  1.00 19.86 ? 149 ASN D CB  1 
ATOM   7163  C  CG  . ASN D  1 140 ? -51.476  84.683  -6.277  1.00 20.93 ? 149 ASN D CG  1 
ATOM   7164  O  OD1 . ASN D  1 140 ? -50.680  84.110  -7.068  1.00 22.78 ? 149 ASN D OD1 1 
ATOM   7165  N  ND2 . ASN D  1 140 ? -51.897  84.116  -5.207  1.00 21.87 ? 149 ASN D ND2 1 
ATOM   7166  N  N   . TYR D  1 141 ? -53.829  84.570  -8.834  1.00 20.97 ? 150 TYR D N   1 
ATOM   7167  C  CA  . TYR D  1 141 ? -54.935  83.645  -9.093  1.00 21.90 ? 150 TYR D CA  1 
ATOM   7168  C  C   . TYR D  1 141 ? -54.407  82.307  -9.568  1.00 22.54 ? 150 TYR D C   1 
ATOM   7169  O  O   . TYR D  1 141 ? -53.596  82.245  -10.483 1.00 22.07 ? 150 TYR D O   1 
ATOM   7170  C  CB  . TYR D  1 141 ? -55.828  84.246  -10.152 1.00 24.81 ? 150 TYR D CB  1 
ATOM   7171  C  CG  . TYR D  1 141 ? -57.048  83.445  -10.516 1.00 24.48 ? 150 TYR D CG  1 
ATOM   7172  C  CD1 . TYR D  1 141 ? -58.122  83.352  -9.638  1.00 26.51 ? 150 TYR D CD1 1 
ATOM   7173  C  CD2 . TYR D  1 141 ? -57.162  82.855  -11.772 1.00 25.13 ? 150 TYR D CD2 1 
ATOM   7174  C  CE1 . TYR D  1 141 ? -59.265  82.645  -9.991  1.00 28.21 ? 150 TYR D CE1 1 
ATOM   7175  C  CE2 . TYR D  1 141 ? -58.281  82.121  -12.133 1.00 26.17 ? 150 TYR D CE2 1 
ATOM   7176  C  CZ  . TYR D  1 141 ? -59.322  82.022  -11.252 1.00 29.52 ? 150 TYR D CZ  1 
ATOM   7177  O  OH  . TYR D  1 141 ? -60.457  81.337  -11.615 1.00 34.90 ? 150 TYR D OH  1 
ATOM   7178  N  N   . LYS D  1 142 ? -54.874  81.236  -8.928  1.00 26.41 ? 151 LYS D N   1 
ATOM   7179  C  CA  . LYS D  1 142 ? -54.444  79.861  -9.255  1.00 30.82 ? 151 LYS D CA  1 
ATOM   7180  C  C   . LYS D  1 142 ? -52.930  79.768  -9.342  1.00 31.75 ? 151 LYS D C   1 
ATOM   7181  O  O   . LYS D  1 142 ? -52.396  79.280  -10.334 1.00 32.45 ? 151 LYS D O   1 
ATOM   7182  C  CB  . LYS D  1 142 ? -55.033  79.381  -10.595 1.00 32.38 ? 151 LYS D CB  1 
ATOM   7183  C  CG  . LYS D  1 142 ? -56.543  79.338  -10.640 1.00 35.46 ? 151 LYS D CG  1 
ATOM   7184  C  CD  . LYS D  1 142 ? -57.160  78.538  -9.520  1.00 38.42 ? 151 LYS D CD  1 
ATOM   7185  C  CE  . LYS D  1 142 ? -58.677  78.743  -9.421  1.00 43.61 ? 151 LYS D CE  1 
ATOM   7186  N  NZ  . LYS D  1 142 ? -59.544  77.849  -10.217 1.00 48.56 ? 151 LYS D NZ  1 
ATOM   7187  N  N   . GLY D  1 143 ? -52.255  80.308  -8.328  1.00 33.29 ? 152 GLY D N   1 
ATOM   7188  C  CA  . GLY D  1 143 ? -50.791  80.254  -8.212  1.00 30.24 ? 152 GLY D CA  1 
ATOM   7189  C  C   . GLY D  1 143 ? -50.020  81.005  -9.274  1.00 30.66 ? 152 GLY D C   1 
ATOM   7190  O  O   . GLY D  1 143 ? -48.842  80.760  -9.473  1.00 31.49 ? 152 GLY D O   1 
ATOM   7191  N  N   . LYS D  1 144 ? -50.698  81.864  -10.014 1.00 29.67 ? 153 LYS D N   1 
ATOM   7192  C  CA  . LYS D  1 144 ? -50.042  82.725  -10.984 1.00 29.66 ? 153 LYS D CA  1 
ATOM   7193  C  C   . LYS D  1 144 ? -50.260  84.188  -10.596 1.00 24.31 ? 153 LYS D C   1 
ATOM   7194  O  O   . LYS D  1 144 ? -51.308  84.545  -10.108 1.00 21.71 ? 153 LYS D O   1 
ATOM   7195  C  CB  . LYS D  1 144 ? -50.613  82.523  -12.381 1.00 35.29 ? 153 LYS D CB  1 
ATOM   7196  C  CG  . LYS D  1 144 ? -50.276  81.187  -12.990 1.00 39.42 ? 153 LYS D CG  1 
ATOM   7197  C  CD  . LYS D  1 144 ? -48.935  81.199  -13.681 1.00 45.26 ? 153 LYS D CD  1 
ATOM   7198  C  CE  . LYS D  1 144 ? -49.073  81.688  -15.093 1.00 46.65 ? 153 LYS D CE  1 
ATOM   7199  N  NZ  . LYS D  1 144 ? -47.776  81.635  -15.812 1.00 48.47 ? 153 LYS D NZ  1 
ATOM   7200  N  N   . ASN D  1 145 ? -49.282  85.011  -10.928 1.00 20.63 ? 154 ASN D N   1 
ATOM   7201  C  CA  . ASN D  1 145 ? -49.361  86.431  -10.786 1.00 19.89 ? 154 ASN D CA  1 
ATOM   7202  C  C   . ASN D  1 145 ? -49.749  87.004  -12.131 1.00 20.31 ? 154 ASN D C   1 
ATOM   7203  O  O   . ASN D  1 145 ? -48.953  87.065  -13.048 1.00 19.56 ? 154 ASN D O   1 
ATOM   7204  C  CB  . ASN D  1 145 ? -48.037  87.014  -10.328 1.00 19.14 ? 154 ASN D CB  1 
ATOM   7205  C  CG  . ASN D  1 145 ? -47.712  86.673  -8.896  1.00 18.98 ? 154 ASN D CG  1 
ATOM   7206  O  OD1 . ASN D  1 145 ? -46.562  86.335  -8.589  1.00 21.54 ? 154 ASN D OD1 1 
ATOM   7207  N  ND2 . ASN D  1 145 ? -48.679  86.767  -8.014  1.00 19.84 ? 154 ASN D ND2 1 
ATOM   7208  N  N   . VAL D  1 146 ? -50.999  87.453  -12.229 1.00 19.29 ? 155 VAL D N   1 
ATOM   7209  C  CA  . VAL D  1 146 ? -51.524  87.874  -13.524 1.00 17.61 ? 155 VAL D CA  1 
ATOM   7210  C  C   . VAL D  1 146 ? -51.457  89.398  -13.658 1.00 17.11 ? 155 VAL D C   1 
ATOM   7211  O  O   . VAL D  1 146 ? -51.967  90.135  -12.792 1.00 15.80 ? 155 VAL D O   1 
ATOM   7212  C  CB  . VAL D  1 146 ? -52.952  87.345  -13.727 1.00 16.90 ? 155 VAL D CB  1 
ATOM   7213  C  CG1 . VAL D  1 146 ? -53.365  87.486  -15.177 1.00 17.28 ? 155 VAL D CG1 1 
ATOM   7214  C  CG2 . VAL D  1 146 ? -53.037  85.885  -13.315 1.00 16.67 ? 155 VAL D CG2 1 
ATOM   7215  N  N   . LEU D  1 147 ? -50.870  89.844  -14.756 1.00 17.08 ? 156 LEU D N   1 
ATOM   7216  C  CA  . LEU D  1 147 ? -50.625  91.256  -14.997 1.00 19.09 ? 156 LEU D CA  1 
ATOM   7217  C  C   . LEU D  1 147 ? -51.723  91.893  -15.794 1.00 18.68 ? 156 LEU D C   1 
ATOM   7218  O  O   . LEU D  1 147 ? -52.222  91.303  -16.738 1.00 18.88 ? 156 LEU D O   1 
ATOM   7219  C  CB  . LEU D  1 147 ? -49.304  91.460  -15.766 1.00 20.88 ? 156 LEU D CB  1 
ATOM   7220  C  CG  . LEU D  1 147 ? -48.027  91.425  -14.891 1.00 22.45 ? 156 LEU D CG  1 
ATOM   7221  C  CD1 . LEU D  1 147 ? -47.730  90.016  -14.414 1.00 22.20 ? 156 LEU D CD1 1 
ATOM   7222  C  CD2 . LEU D  1 147 ? -46.842  91.999  -15.683 1.00 23.03 ? 156 LEU D CD2 1 
ATOM   7223  N  N   . ILE D  1 148 ? -52.069  93.122  -15.463 1.00 18.18 ? 157 ILE D N   1 
ATOM   7224  C  CA  . ILE D  1 148 ? -53.128  93.780  -16.187 1.00 18.77 ? 157 ILE D CA  1 
ATOM   7225  C  C   . ILE D  1 148 ? -52.673  93.938  -17.639 1.00 20.51 ? 157 ILE D C   1 
ATOM   7226  O  O   . ILE D  1 148 ? -51.524  94.153  -17.907 1.00 18.59 ? 157 ILE D O   1 
ATOM   7227  C  CB  . ILE D  1 148 ? -53.524  95.115  -15.577 1.00 17.33 ? 157 ILE D CB  1 
ATOM   7228  C  CG1 . ILE D  1 148 ? -54.869  95.593  -16.147 1.00 17.65 ? 157 ILE D CG1 1 
ATOM   7229  C  CG2 . ILE D  1 148 ? -52.408  96.145  -15.781 1.00 17.65 ? 157 ILE D CG2 1 
ATOM   7230  C  CD1 . ILE D  1 148 ? -55.374  96.904  -15.564 1.00 18.33 ? 157 ILE D CD1 1 
ATOM   7231  N  N   . ASN D  1 149 ? -53.614  93.808  -18.563 1.00 25.76 ? 158 ASN D N   1 
ATOM   7232  C  CA  . ASN D  1 149 ? -53.323  93.885  -20.012 1.00 29.37 ? 158 ASN D CA  1 
ATOM   7233  C  C   . ASN D  1 149 ? -53.522  95.303  -20.565 1.00 27.54 ? 158 ASN D C   1 
ATOM   7234  O  O   . ASN D  1 149 ? -53.200  95.578  -21.711 1.00 29.66 ? 158 ASN D O   1 
ATOM   7235  C  CB  . ASN D  1 149 ? -54.138  92.760  -20.714 1.00 32.91 ? 158 ASN D CB  1 
ATOM   7236  C  CG  . ASN D  1 149 ? -55.619  93.063  -20.812 1.00 33.32 ? 158 ASN D CG  1 
ATOM   7237  O  OD1 . ASN D  1 149 ? -56.056  94.199  -20.593 1.00 40.43 ? 158 ASN D OD1 1 
ATOM   7238  N  ND2 . ASN D  1 149 ? -56.401  92.057  -21.181 1.00 36.03 ? 158 ASN D ND2 1 
ATOM   7239  N  N   . LYS D  1 150 ? -54.028  96.221  -19.752 1.00 25.86 ? 159 LYS D N   1 
ATOM   7240  C  CA  . LYS D  1 150 ? -54.118  97.632  -20.170 1.00 25.98 ? 159 LYS D CA  1 
ATOM   7241  C  C   . LYS D  1 150 ? -52.837  98.369  -19.831 1.00 26.35 ? 159 LYS D C   1 
ATOM   7242  O  O   . LYS D  1 150 ? -52.195  98.105  -18.837 1.00 31.59 ? 159 LYS D O   1 
ATOM   7243  C  CB  . LYS D  1 150 ? -55.306  98.350  -19.508 1.00 26.49 ? 159 LYS D CB  1 
ATOM   7244  C  CG  . LYS D  1 150 ? -56.666  97.831  -19.960 1.00 28.43 ? 159 LYS D CG  1 
ATOM   7245  C  CD  . LYS D  1 150 ? -57.561  98.958  -20.425 1.00 28.54 ? 159 LYS D CD  1 
ATOM   7246  C  CE  . LYS D  1 150 ? -58.981  98.505  -20.791 1.00 26.35 ? 159 LYS D CE  1 
ATOM   7247  N  NZ  . LYS D  1 150 ? -59.976  98.798  -19.716 1.00 25.36 ? 159 LYS D NZ  1 
ATOM   7248  N  N   . ASP D  1 151 ? -52.520  99.345  -20.636 1.00 26.97 ? 160 ASP D N   1 
ATOM   7249  C  CA  . ASP D  1 151 ? -51.355  100.160 -20.442 1.00 28.96 ? 160 ASP D CA  1 
ATOM   7250  C  C   . ASP D  1 151 ? -51.681  101.490 -19.733 1.00 25.23 ? 160 ASP D C   1 
ATOM   7251  O  O   . ASP D  1 151 ? -52.318  102.350 -20.296 1.00 25.64 ? 160 ASP D O   1 
ATOM   7252  C  CB  . ASP D  1 151 ? -50.683  100.423 -21.801 1.00 31.77 ? 160 ASP D CB  1 
ATOM   7253  C  CG  . ASP D  1 151 ? -49.488  101.291 -21.664 1.00 37.27 ? 160 ASP D CG  1 
ATOM   7254  O  OD1 . ASP D  1 151 ? -48.600  100.955 -20.838 1.00 41.12 ? 160 ASP D OD1 1 
ATOM   7255  O  OD2 . ASP D  1 151 ? -49.467  102.334 -22.327 1.00 41.36 ? 160 ASP D OD2 1 
ATOM   7256  N  N   . ILE D  1 152 ? -51.252  101.614 -18.484 1.00 21.26 ? 161 ILE D N   1 
ATOM   7257  C  CA  . ILE D  1 152 ? -51.533  102.756 -17.663 1.00 17.74 ? 161 ILE D CA  1 
ATOM   7258  C  C   . ILE D  1 152 ? -50.242  103.499 -17.399 1.00 18.71 ? 161 ILE D C   1 
ATOM   7259  O  O   . ILE D  1 152 ? -49.295  102.957 -16.869 1.00 17.45 ? 161 ILE D O   1 
ATOM   7260  C  CB  . ILE D  1 152 ? -52.151  102.347 -16.326 1.00 18.02 ? 161 ILE D CB  1 
ATOM   7261  C  CG1 . ILE D  1 152 ? -53.372  101.467 -16.539 1.00 16.70 ? 161 ILE D CG1 1 
ATOM   7262  C  CG2 . ILE D  1 152 ? -52.564  103.585 -15.509 1.00 18.46 ? 161 ILE D CG2 1 
ATOM   7263  C  CD1 . ILE D  1 152 ? -53.891  100.850 -15.267 1.00 16.26 ? 161 ILE D CD1 1 
ATOM   7264  N  N   . ARG D  1 153 ? -50.189  104.751 -17.803 1.00 19.46 ? 162 ARG D N   1 
ATOM   7265  C  CA  . ARG D  1 153 ? -49.000  105.533 -17.623 1.00 19.96 ? 162 ARG D CA  1 
ATOM   7266  C  C   . ARG D  1 153 ? -48.926  106.098 -16.221 1.00 18.46 ? 162 ARG D C   1 
ATOM   7267  O  O   . ARG D  1 153 ? -49.925  106.537 -15.679 1.00 17.30 ? 162 ARG D O   1 
ATOM   7268  C  CB  . ARG D  1 153 ? -48.946  106.628 -18.646 1.00 26.38 ? 162 ARG D CB  1 
ATOM   7269  C  CG  . ARG D  1 153 ? -48.058  107.800 -18.296 1.00 32.67 ? 162 ARG D CG  1 
ATOM   7270  C  CD  . ARG D  1 153 ? -47.866  108.685 -19.518 1.00 37.74 ? 162 ARG D CD  1 
ATOM   7271  N  NE  . ARG D  1 153 ? -46.746  109.608 -19.426 1.00 45.83 ? 162 ARG D NE  1 
ATOM   7272  C  CZ  . ARG D  1 153 ? -46.580  110.581 -20.319 1.00 49.54 ? 162 ARG D CZ  1 
ATOM   7273  N  NH1 . ARG D  1 153 ? -47.428  110.682 -21.346 1.00 45.92 ? 162 ARG D NH1 1 
ATOM   7274  N  NH2 . ARG D  1 153 ? -45.578  111.430 -20.197 1.00 51.85 ? 162 ARG D NH2 1 
ATOM   7275  N  N   . CYS D  1 154 ? -47.752  106.012 -15.595 1.00 16.71 ? 163 CYS D N   1 
ATOM   7276  C  CA  . CYS D  1 154 ? -47.620  106.533 -14.265 1.00 17.64 ? 163 CYS D CA  1 
ATOM   7277  C  C   . CYS D  1 154 ? -47.064  107.939 -14.351 1.00 17.90 ? 163 CYS D C   1 
ATOM   7278  O  O   . CYS D  1 154 ? -46.704  108.383 -15.407 1.00 18.32 ? 163 CYS D O   1 
ATOM   7279  C  CB  . CYS D  1 154 ? -46.759  105.636 -13.409 1.00 18.03 ? 163 CYS D CB  1 
ATOM   7280  S  SG  . CYS D  1 154 ? -44.993  105.649 -13.798 1.00 19.01 ? 163 CYS D SG  1 
ATOM   7281  N  N   . LYS D  1 155 ? -47.012  108.643 -13.238 1.00 19.64 ? 164 LYS D N   1 
ATOM   7282  C  CA  . LYS D  1 155 ? -46.311  109.944 -13.200 1.00 21.06 ? 164 LYS D CA  1 
ATOM   7283  C  C   . LYS D  1 155 ? -44.813  109.727 -13.031 1.00 22.83 ? 164 LYS D C   1 
ATOM   7284  O  O   . LYS D  1 155 ? -44.381  108.738 -12.419 1.00 21.11 ? 164 LYS D O   1 
ATOM   7285  C  CB  . LYS D  1 155 ? -46.804  110.776 -12.047 1.00 21.88 ? 164 LYS D CB  1 
ATOM   7286  C  CG  . LYS D  1 155 ? -48.297  111.041 -12.098 1.00 22.13 ? 164 LYS D CG  1 
ATOM   7287  C  CD  . LYS D  1 155 ? -48.644  112.024 -13.196 1.00 22.76 ? 164 LYS D CD  1 
ATOM   7288  C  CE  . LYS D  1 155 ? -49.957  112.676 -12.856 1.00 23.15 ? 164 LYS D CE  1 
ATOM   7289  N  NZ  . LYS D  1 155 ? -50.477  113.478 -13.972 1.00 24.55 ? 164 LYS D NZ  1 
ATOM   7290  N  N   . ASP D  1 156 ? -44.020  110.681 -13.506 1.00 24.50 ? 165 ASP D N   1 
ATOM   7291  C  CA  . ASP D  1 156 ? -42.571  110.555 -13.400 1.00 29.22 ? 165 ASP D CA  1 
ATOM   7292  C  C   . ASP D  1 156 ? -41.819  111.790 -12.922 1.00 26.73 ? 165 ASP D C   1 
ATOM   7293  O  O   . ASP D  1 156 ? -40.597  111.764 -12.857 1.00 30.73 ? 165 ASP D O   1 
ATOM   7294  C  CB  . ASP D  1 156 ? -41.983  110.115 -14.746 1.00 37.45 ? 165 ASP D CB  1 
ATOM   7295  C  CG  . ASP D  1 156 ? -42.209  111.151 -15.834 1.00 47.53 ? 165 ASP D CG  1 
ATOM   7296  O  OD1 . ASP D  1 156 ? -42.889  112.158 -15.529 1.00 52.33 ? 165 ASP D OD1 1 
ATOM   7297  O  OD2 . ASP D  1 156 ? -41.732  110.958 -16.988 1.00 63.85 ? 165 ASP D OD2 1 
ATOM   7298  N  N   . ASP D  1 157 ? -42.503  112.888 -12.653 1.00 22.68 ? 166 ASP D N   1 
ATOM   7299  C  CA  . ASP D  1 157 ? -41.831  114.112 -12.165 1.00 18.70 ? 166 ASP D CA  1 
ATOM   7300  C  C   . ASP D  1 157 ? -41.369  113.966 -10.723 1.00 17.27 ? 166 ASP D C   1 
ATOM   7301  O  O   . ASP D  1 157 ? -41.363  112.857 -10.175 1.00 17.26 ? 166 ASP D O   1 
ATOM   7302  C  CB  . ASP D  1 157 ? -42.738  115.336 -12.379 1.00 17.75 ? 166 ASP D CB  1 
ATOM   7303  C  CG  . ASP D  1 157 ? -43.996  115.300 -11.532 1.00 17.43 ? 166 ASP D CG  1 
ATOM   7304  O  OD1 . ASP D  1 157 ? -44.095  114.447 -10.615 1.00 17.74 ? 166 ASP D OD1 1 
ATOM   7305  O  OD2 . ASP D  1 157 ? -44.877  116.162 -11.750 1.00 16.25 ? 166 ASP D OD2 1 
ATOM   7306  N  N   . GLU D  1 158 ? -41.013  115.069 -10.073 1.00 15.86 ? 167 GLU D N   1 
ATOM   7307  C  CA  . GLU D  1 158 ? -40.475  115.002 -8.706  1.00 14.78 ? 167 GLU D CA  1 
ATOM   7308  C  C   . GLU D  1 158 ? -41.493  115.195 -7.594  1.00 13.22 ? 167 GLU D C   1 
ATOM   7309  O  O   . GLU D  1 158 ? -41.156  115.132 -6.439  1.00 12.30 ? 167 GLU D O   1 
ATOM   7310  C  CB  . GLU D  1 158 ? -39.331  116.002 -8.550  1.00 16.04 ? 167 GLU D CB  1 
ATOM   7311  C  CG  . GLU D  1 158 ? -39.709  117.478 -8.507  1.00 17.60 ? 167 GLU D CG  1 
ATOM   7312  C  CD  . GLU D  1 158 ? -39.754  118.173 -9.879  1.00 20.28 ? 167 GLU D CD  1 
ATOM   7313  O  OE1 . GLU D  1 158 ? -40.347  117.594 -10.828 1.00 22.67 ? 167 GLU D OE1 1 
ATOM   7314  O  OE2 . GLU D  1 158 ? -39.209  119.306 -10.021 1.00 21.23 ? 167 GLU D OE2 1 
ATOM   7315  N  N   . PHE D  1 159 ? -42.748  115.422 -7.948  1.00 12.48 ? 168 PHE D N   1 
ATOM   7316  C  CA  . PHE D  1 159 ? -43.766  115.790 -6.984  1.00 11.66 ? 168 PHE D CA  1 
ATOM   7317  C  C   . PHE D  1 159 ? -44.541  114.588 -6.409  1.00 10.93 ? 168 PHE D C   1 
ATOM   7318  O  O   . PHE D  1 159 ? -44.341  113.462 -6.839  1.00 9.33  ? 168 PHE D O   1 
ATOM   7319  C  CB  . PHE D  1 159 ? -44.702  116.845 -7.604  1.00 11.88 ? 168 PHE D CB  1 
ATOM   7320  C  CG  . PHE D  1 159 ? -43.981  118.105 -7.999  1.00 11.78 ? 168 PHE D CG  1 
ATOM   7321  C  CD1 . PHE D  1 159 ? -43.671  119.071 -7.059  1.00 11.40 ? 168 PHE D CD1 1 
ATOM   7322  C  CD2 . PHE D  1 159 ? -43.602  118.305 -9.308  1.00 12.42 ? 168 PHE D CD2 1 
ATOM   7323  C  CE1 . PHE D  1 159 ? -42.993  120.242 -7.419  1.00 12.44 ? 168 PHE D CE1 1 
ATOM   7324  C  CE2 . PHE D  1 159 ? -42.927  119.490 -9.691  1.00 12.73 ? 168 PHE D CE2 1 
ATOM   7325  C  CZ  . PHE D  1 159 ? -42.605  120.452 -8.738  1.00 12.23 ? 168 PHE D CZ  1 
ATOM   7326  N  N   . THR D  1 160 ? -45.354  114.856 -5.377  1.00 10.78 ? 169 THR D N   1 
ATOM   7327  C  CA  . THR D  1 160 ? -46.126  113.831 -4.695  1.00 10.67 ? 169 THR D CA  1 
ATOM   7328  C  C   . THR D  1 160 ? -47.368  113.447 -5.518  1.00 10.46 ? 169 THR D C   1 
ATOM   7329  O  O   . THR D  1 160 ? -48.168  114.303 -5.891  1.00 11.63 ? 169 THR D O   1 
ATOM   7330  C  CB  . THR D  1 160 ? -46.571  114.326 -3.304  1.00 10.92 ? 169 THR D CB  1 
ATOM   7331  O  OG1 . THR D  1 160 ? -45.434  114.554 -2.499  1.00 11.49 ? 169 THR D OG1 1 
ATOM   7332  C  CG2 . THR D  1 160 ? -47.390  113.285 -2.563  1.00 11.54 ? 169 THR D CG2 1 
ATOM   7333  N  N   . HIS D  1 161 ? -47.542  112.170 -5.820  1.00 9.79  ? 170 HIS D N   1 
ATOM   7334  C  CA  . HIS D  1 161 ? -48.756  111.717 -6.552  1.00 9.60  ? 170 HIS D CA  1 
ATOM   7335  C  C   . HIS D  1 161 ? -49.509  110.645 -5.819  1.00 9.60  ? 170 HIS D C   1 
ATOM   7336  O  O   . HIS D  1 161 ? -48.913  109.797 -5.147  1.00 9.43  ? 170 HIS D O   1 
ATOM   7337  C  CB  . HIS D  1 161 ? -48.435  111.295 -7.969  1.00 9.45  ? 170 HIS D CB  1 
ATOM   7338  C  CG  . HIS D  1 161 ? -47.866  112.418 -8.777  1.00 9.81  ? 170 HIS D CG  1 
ATOM   7339  N  ND1 . HIS D  1 161 ? -48.618  113.529 -9.149  1.00 10.49 ? 170 HIS D ND1 1 
ATOM   7340  C  CD2 . HIS D  1 161 ? -46.614  112.657 -9.212  1.00 9.51  ? 170 HIS D CD2 1 
ATOM   7341  C  CE1 . HIS D  1 161 ? -47.846  114.384 -9.801  1.00 9.65  ? 170 HIS D CE1 1 
ATOM   7342  N  NE2 . HIS D  1 161 ? -46.633  113.871 -9.858  1.00 9.55  ? 170 HIS D NE2 1 
ATOM   7343  N  N   . LEU D  1 162 ? -50.839  110.762 -5.900  1.00 9.64  ? 171 LEU D N   1 
ATOM   7344  C  CA  . LEU D  1 162 ? -51.784  109.868 -5.228  1.00 9.55  ? 171 LEU D CA  1 
ATOM   7345  C  C   . LEU D  1 162 ? -52.151  108.727 -6.157  1.00 9.17  ? 171 LEU D C   1 
ATOM   7346  O  O   . LEU D  1 162 ? -52.563  108.941 -7.273  1.00 8.77  ? 171 LEU D O   1 
ATOM   7347  C  CB  . LEU D  1 162 ? -53.058  110.621 -4.802  1.00 9.24  ? 171 LEU D CB  1 
ATOM   7348  C  CG  . LEU D  1 162 ? -54.059  109.815 -3.967  1.00 9.32  ? 171 LEU D CG  1 
ATOM   7349  C  CD1 . LEU D  1 162 ? -53.575  109.588 -2.544  1.00 9.18  ? 171 LEU D CD1 1 
ATOM   7350  C  CD2 . LEU D  1 162 ? -55.404  110.513 -3.936  1.00 9.56  ? 171 LEU D CD2 1 
ATOM   7351  N  N   . TYR D  1 163 ? -51.942  107.499 -5.678  1.00 9.34  ? 172 TYR D N   1 
ATOM   7352  C  CA  . TYR D  1 163 ? -52.310  106.267 -6.410  1.00 9.56  ? 172 TYR D CA  1 
ATOM   7353  C  C   . TYR D  1 163 ? -53.426  105.497 -5.675  1.00 9.50  ? 172 TYR D C   1 
ATOM   7354  O  O   . TYR D  1 163 ? -53.334  105.214 -4.506  1.00 8.94  ? 172 TYR D O   1 
ATOM   7355  C  CB  . TYR D  1 163 ? -51.113  105.362 -6.625  1.00 9.50  ? 172 TYR D CB  1 
ATOM   7356  C  CG  . TYR D  1 163 ? -50.164  105.920 -7.683  1.00 9.92  ? 172 TYR D CG  1 
ATOM   7357  C  CD1 . TYR D  1 163 ? -50.358  105.650 -9.040  1.00 9.93  ? 172 TYR D CD1 1 
ATOM   7358  C  CD2 . TYR D  1 163 ? -49.138  106.745 -7.336  1.00 9.62  ? 172 TYR D CD2 1 
ATOM   7359  C  CE1 . TYR D  1 163 ? -49.489  106.139 -9.995  1.00 9.61  ? 172 TYR D CE1 1 
ATOM   7360  C  CE2 . TYR D  1 163 ? -48.305  107.283 -8.288  1.00 9.83  ? 172 TYR D CE2 1 
ATOM   7361  C  CZ  . TYR D  1 163 ? -48.473  106.979 -9.614  1.00 9.75  ? 172 TYR D CZ  1 
ATOM   7362  O  OH  . TYR D  1 163 ? -47.599  107.502 -10.545 1.00 9.59  ? 172 TYR D OH  1 
ATOM   7363  N  N   . THR D  1 164 ? -54.462  105.163 -6.425  1.00 9.60  ? 173 THR D N   1 
ATOM   7364  C  CA  . THR D  1 164 ? -55.647  104.545 -5.844  1.00 9.96  ? 173 THR D CA  1 
ATOM   7365  C  C   . THR D  1 164 ? -56.080  103.389 -6.708  1.00 10.03 ? 173 THR D C   1 
ATOM   7366  O  O   . THR D  1 164 ? -56.309  103.538 -7.937  1.00 9.55  ? 173 THR D O   1 
ATOM   7367  C  CB  . THR D  1 164 ? -56.842  105.536 -5.779  1.00 10.27 ? 173 THR D CB  1 
ATOM   7368  O  OG1 . THR D  1 164 ? -56.454  106.750 -5.124  1.00 9.82  ? 173 THR D OG1 1 
ATOM   7369  C  CG2 . THR D  1 164 ? -58.051  104.928 -5.004  1.00 9.98  ? 173 THR D CG2 1 
ATOM   7370  N  N   . LEU D  1 165 ? -56.267  102.252 -6.067  1.00 9.77  ? 174 LEU D N   1 
ATOM   7371  C  CA  . LEU D  1 165 ? -56.882  101.091 -6.741  1.00 9.68  ? 174 LEU D CA  1 
ATOM   7372  C  C   . LEU D  1 165 ? -58.182  100.733 -6.030  1.00 9.88  ? 174 LEU D C   1 
ATOM   7373  O  O   . LEU D  1 165 ? -58.220  100.530 -4.818  1.00 10.23 ? 174 LEU D O   1 
ATOM   7374  C  CB  . LEU D  1 165 ? -55.957  99.874  -6.698  1.00 9.66  ? 174 LEU D CB  1 
ATOM   7375  C  CG  . LEU D  1 165 ? -56.582  98.537  -7.170  1.00 9.70  ? 174 LEU D CG  1 
ATOM   7376  C  CD1 . LEU D  1 165 ? -56.784  98.521  -8.666  1.00 9.34  ? 174 LEU D CD1 1 
ATOM   7377  C  CD2 . LEU D  1 165 ? -55.683  97.367  -6.790  1.00 9.97  ? 174 LEU D CD2 1 
ATOM   7378  N  N   . ILE D  1 166 ? -59.227  100.617 -6.818  1.00 10.04 ? 175 ILE D N   1 
ATOM   7379  C  CA  . ILE D  1 166 ? -60.562  100.220 -6.384  1.00 10.15 ? 175 ILE D CA  1 
ATOM   7380  C  C   . ILE D  1 166 ? -60.945  98.879  -7.031  1.00 10.32 ? 175 ILE D C   1 
ATOM   7381  O  O   . ILE D  1 166 ? -60.925  98.758  -8.257  1.00 9.86  ? 175 ILE D O   1 
ATOM   7382  C  CB  . ILE D  1 166 ? -61.607  101.225 -6.821  1.00 10.36 ? 175 ILE D CB  1 
ATOM   7383  C  CG1 . ILE D  1 166 ? -61.259  102.518 -6.127  1.00 10.51 ? 175 ILE D CG1 1 
ATOM   7384  C  CG2 . ILE D  1 166 ? -63.002  100.826 -6.338  1.00 10.84 ? 175 ILE D CG2 1 
ATOM   7385  C  CD1 . ILE D  1 166 ? -62.048  103.746 -6.417  1.00 11.06 ? 175 ILE D CD1 1 
ATOM   7386  N  N   . VAL D  1 167 ? -61.292  97.924  -6.184  1.00 10.52 ? 176 VAL D N   1 
ATOM   7387  C  CA  . VAL D  1 167 ? -61.767  96.610  -6.614  1.00 11.95 ? 176 VAL D CA  1 
ATOM   7388  C  C   . VAL D  1 167 ? -63.128  96.314  -6.008  1.00 12.19 ? 176 VAL D C   1 
ATOM   7389  O  O   . VAL D  1 167 ? -63.286  96.304  -4.791  1.00 12.85 ? 176 VAL D O   1 
ATOM   7390  C  CB  . VAL D  1 167 ? -60.795  95.484  -6.188  1.00 11.76 ? 176 VAL D CB  1 
ATOM   7391  C  CG1 . VAL D  1 167 ? -61.296  94.124  -6.677  1.00 11.79 ? 176 VAL D CG1 1 
ATOM   7392  C  CG2 . VAL D  1 167 ? -59.406  95.764  -6.708  1.00 11.53 ? 176 VAL D CG2 1 
ATOM   7393  N  N   . ARG D  1 168 ? -64.088  96.000  -6.850  1.00 13.48 ? 177 ARG D N   1 
ATOM   7394  C  CA  . ARG D  1 168 ? -65.503  95.817  -6.390  1.00 14.00 ? 177 ARG D CA  1 
ATOM   7395  C  C   . ARG D  1 168 ? -65.991  94.372  -6.517  1.00 14.40 ? 177 ARG D C   1 
ATOM   7396  O  O   . ARG D  1 168 ? -65.553  93.666  -7.422  1.00 15.59 ? 177 ARG D O   1 
ATOM   7397  C  CB  . ARG D  1 168 ? -66.428  96.724  -7.189  1.00 14.09 ? 177 ARG D CB  1 
ATOM   7398  C  CG  . ARG D  1 168 ? -66.080  98.174  -7.065  1.00 14.58 ? 177 ARG D CG  1 
ATOM   7399  C  CD  . ARG D  1 168 ? -67.123  99.037  -7.736  1.00 14.87 ? 177 ARG D CD  1 
ATOM   7400  N  NE  . ARG D  1 168 ? -66.681  100.430 -7.929  1.00 14.60 ? 177 ARG D NE  1 
ATOM   7401  C  CZ  . ARG D  1 168 ? -66.090  100.881 -9.034  1.00 14.08 ? 177 ARG D CZ  1 
ATOM   7402  N  NH1 . ARG D  1 168 ? -65.829  100.067 -10.043 1.00 12.92 ? 177 ARG D NH1 1 
ATOM   7403  N  NH2 . ARG D  1 168 ? -65.748  102.152 -9.110  1.00 13.64 ? 177 ARG D NH2 1 
ATOM   7404  N  N   . PRO D  1 169 ? -66.957  93.958  -5.674  1.00 15.31 ? 178 PRO D N   1 
ATOM   7405  C  CA  . PRO D  1 169 ? -67.469  92.595  -5.665  1.00 15.78 ? 178 PRO D CA  1 
ATOM   7406  C  C   . PRO D  1 169 ? -68.272  92.165  -6.903  1.00 16.41 ? 178 PRO D C   1 
ATOM   7407  O  O   . PRO D  1 169 ? -68.586  91.019  -7.015  1.00 18.87 ? 178 PRO D O   1 
ATOM   7408  C  CB  . PRO D  1 169 ? -68.325  92.520  -4.409  1.00 16.24 ? 178 PRO D CB  1 
ATOM   7409  C  CG  . PRO D  1 169 ? -68.600  93.909  -3.997  1.00 15.90 ? 178 PRO D CG  1 
ATOM   7410  C  CD  . PRO D  1 169 ? -67.750  94.843  -4.804  1.00 16.24 ? 178 PRO D CD  1 
ATOM   7411  N  N   . ASP D  1 170 ? -68.523  93.047  -7.856  1.00 17.49 ? 179 ASP D N   1 
ATOM   7412  C  CA  . ASP D  1 170 ? -68.972  92.630  -9.191  1.00 18.44 ? 179 ASP D CA  1 
ATOM   7413  C  C   . ASP D  1 170 ? -67.837  92.454  -10.170 1.00 17.61 ? 179 ASP D C   1 
ATOM   7414  O  O   . ASP D  1 170 ? -68.042  92.387  -11.361 1.00 15.21 ? 179 ASP D O   1 
ATOM   7415  C  CB  . ASP D  1 170 ? -70.009  93.633  -9.765  1.00 21.01 ? 179 ASP D CB  1 
ATOM   7416  C  CG  . ASP D  1 170 ? -69.490  95.078  -9.832  1.00 22.95 ? 179 ASP D CG  1 
ATOM   7417  O  OD1 . ASP D  1 170 ? -68.285  95.297  -9.647  1.00 25.26 ? 179 ASP D OD1 1 
ATOM   7418  O  OD2 . ASP D  1 170 ? -70.280  95.997  -10.130 1.00 24.93 ? 179 ASP D OD2 1 
ATOM   7419  N  N   . ASN D  1 171 ? -66.617  92.356  -9.645  1.00 19.05 ? 180 ASN D N   1 
ATOM   7420  C  CA  . ASN D  1 171 ? -65.405  92.181  -10.462 1.00 19.28 ? 180 ASN D CA  1 
ATOM   7421  C  C   . ASN D  1 171 ? -65.123  93.359  -11.392 1.00 17.84 ? 180 ASN D C   1 
ATOM   7422  O  O   . ASN D  1 171 ? -64.498  93.203  -12.415 1.00 18.02 ? 180 ASN D O   1 
ATOM   7423  C  CB  . ASN D  1 171 ? -65.467  90.937  -11.319 1.00 21.56 ? 180 ASN D CB  1 
ATOM   7424  C  CG  . ASN D  1 171 ? -65.068  89.647  -10.594 1.00 26.37 ? 180 ASN D CG  1 
ATOM   7425  O  OD1 . ASN D  1 171 ? -64.235  89.592  -9.706  1.00 25.19 ? 180 ASN D OD1 1 
ATOM   7426  N  ND2 . ASN D  1 171 ? -65.560  88.565  -11.141 1.00 33.55 ? 180 ASN D ND2 1 
ATOM   7427  N  N   . THR D  1 172 ? -65.598  94.535  -11.041 1.00 16.88 ? 181 THR D N   1 
ATOM   7428  C  CA  . THR D  1 172 ? -65.140  95.751  -11.697 1.00 16.32 ? 181 THR D CA  1 
ATOM   7429  C  C   . THR D  1 172 ? -63.968  96.372  -10.888 1.00 14.73 ? 181 THR D C   1 
ATOM   7430  O  O   . THR D  1 172 ? -63.784  96.111  -9.713  1.00 14.15 ? 181 THR D O   1 
ATOM   7431  C  CB  . THR D  1 172 ? -66.225  96.813  -11.839 1.00 16.55 ? 181 THR D CB  1 
ATOM   7432  O  OG1 . THR D  1 172 ? -66.769  97.112  -10.557 1.00 17.75 ? 181 THR D OG1 1 
ATOM   7433  C  CG2 . THR D  1 172 ? -67.318  96.326  -12.755 1.00 18.59 ? 181 THR D CG2 1 
ATOM   7434  N  N   . TYR D  1 173 ? -63.161  97.157  -11.567 1.00 13.95 ? 182 TYR D N   1 
ATOM   7435  C  CA  . TYR D  1 173 ? -62.051  97.850  -10.899 1.00 13.15 ? 182 TYR D CA  1 
ATOM   7436  C  C   . TYR D  1 173 ? -61.905  99.240  -11.523 1.00 13.31 ? 182 TYR D C   1 
ATOM   7437  O  O   . TYR D  1 173 ? -62.294  99.517  -12.636 1.00 12.83 ? 182 TYR D O   1 
ATOM   7438  C  CB  . TYR D  1 173 ? -60.726  97.078  -11.063 1.00 11.23 ? 182 TYR D CB  1 
ATOM   7439  C  CG  . TYR D  1 173 ? -60.131  97.314  -12.418 1.00 9.95  ? 182 TYR D CG  1 
ATOM   7440  C  CD1 . TYR D  1 173 ? -60.609  96.623  -13.511 1.00 9.60  ? 182 TYR D CD1 1 
ATOM   7441  C  CD2 . TYR D  1 173 ? -59.123  98.269  -12.633 1.00 9.81  ? 182 TYR D CD2 1 
ATOM   7442  C  CE1 . TYR D  1 173 ? -60.108  96.837  -14.781 1.00 8.98  ? 182 TYR D CE1 1 
ATOM   7443  C  CE2 . TYR D  1 173 ? -58.610  98.515  -13.923 1.00 9.34  ? 182 TYR D CE2 1 
ATOM   7444  C  CZ  . TYR D  1 173 ? -59.107  97.764  -14.993 1.00 9.21  ? 182 TYR D CZ  1 
ATOM   7445  O  OH  . TYR D  1 173 ? -58.660  97.968  -16.267 1.00 8.36  ? 182 TYR D OH  1 
ATOM   7446  N  N   . GLU D  1 174 ? -61.244  100.087 -10.783 1.00 16.03 ? 183 GLU D N   1 
ATOM   7447  C  CA  . GLU D  1 174 ? -60.918  101.429 -11.258 1.00 17.36 ? 183 GLU D CA  1 
ATOM   7448  C  C   . GLU D  1 174 ? -59.520  101.801 -10.706 1.00 16.15 ? 183 GLU D C   1 
ATOM   7449  O  O   . GLU D  1 174 ? -59.185  101.468 -9.553  1.00 14.61 ? 183 GLU D O   1 
ATOM   7450  C  CB  . GLU D  1 174 ? -61.985  102.386 -10.742 1.00 19.63 ? 183 GLU D CB  1 
ATOM   7451  C  CG  . GLU D  1 174 ? -61.874  103.795 -11.225 1.00 24.64 ? 183 GLU D CG  1 
ATOM   7452  C  CD  . GLU D  1 174 ? -63.102  104.633 -10.846 1.00 28.93 ? 183 GLU D CD  1 
ATOM   7453  O  OE1 . GLU D  1 174 ? -64.202  104.082 -10.584 1.00 32.88 ? 183 GLU D OE1 1 
ATOM   7454  O  OE2 . GLU D  1 174 ? -62.956  105.876 -10.798 1.00 32.70 ? 183 GLU D OE2 1 
ATOM   7455  N  N   . VAL D  1 175 ? -58.723  102.462 -11.533 1.00 14.58 ? 184 VAL D N   1 
ATOM   7456  C  CA  . VAL D  1 175 ? -57.439  103.041 -11.104 1.00 13.00 ? 184 VAL D CA  1 
ATOM   7457  C  C   . VAL D  1 175 ? -57.469  104.559 -11.235 1.00 12.56 ? 184 VAL D C   1 
ATOM   7458  O  O   . VAL D  1 175 ? -57.889  105.108 -12.250 1.00 11.38 ? 184 VAL D O   1 
ATOM   7459  C  CB  . VAL D  1 175 ? -56.259  102.493 -11.902 1.00 13.11 ? 184 VAL D CB  1 
ATOM   7460  C  CG1 . VAL D  1 175 ? -54.957  103.156 -11.483 1.00 12.62 ? 184 VAL D CG1 1 
ATOM   7461  C  CG2 . VAL D  1 175 ? -56.159  100.999 -11.728 1.00 13.43 ? 184 VAL D CG2 1 
ATOM   7462  N  N   . LYS D  1 176 ? -57.068  105.215 -10.156 1.00 12.49 ? 185 LYS D N   1 
ATOM   7463  C  CA  . LYS D  1 176 ? -56.957  106.653 -10.100 1.00 12.60 ? 185 LYS D CA  1 
ATOM   7464  C  C   . LYS D  1 176 ? -55.543  107.122 -9.795  1.00 11.85 ? 185 LYS D C   1 
ATOM   7465  O  O   . LYS D  1 176 ? -54.842  106.554 -8.994  1.00 10.86 ? 185 LYS D O   1 
ATOM   7466  C  CB  . LYS D  1 176 ? -57.827  107.208 -9.029  1.00 13.59 ? 185 LYS D CB  1 
ATOM   7467  C  CG  . LYS D  1 176 ? -59.306  106.968 -9.202  1.00 16.06 ? 185 LYS D CG  1 
ATOM   7468  C  CD  . LYS D  1 176 ? -60.021  107.786 -8.151  1.00 16.89 ? 185 LYS D CD  1 
ATOM   7469  C  CE  . LYS D  1 176 ? -61.356  107.214 -7.870  1.00 20.80 ? 185 LYS D CE  1 
ATOM   7470  N  NZ  . LYS D  1 176 ? -62.385  108.205 -7.422  1.00 21.03 ? 185 LYS D NZ  1 
ATOM   7471  N  N   . ILE D  1 177 ? -55.179  108.205 -10.458 1.00 11.68 ? 186 ILE D N   1 
ATOM   7472  C  CA  . ILE D  1 177 ? -53.985  108.987 -10.157 1.00 11.42 ? 186 ILE D CA  1 
ATOM   7473  C  C   . ILE D  1 177 ? -54.402  110.415 -9.814  1.00 11.19 ? 186 ILE D C   1 
ATOM   7474  O  O   . ILE D  1 177 ? -55.218  111.025 -10.524 1.00 11.49 ? 186 ILE D O   1 
ATOM   7475  C  CB  . ILE D  1 177 ? -52.993  108.982 -11.316 1.00 10.84 ? 186 ILE D CB  1 
ATOM   7476  C  CG1 . ILE D  1 177 ? -52.618  107.552 -11.594 1.00 10.67 ? 186 ILE D CG1 1 
ATOM   7477  C  CG2 . ILE D  1 177 ? -51.748  109.747 -10.895 1.00 11.34 ? 186 ILE D CG2 1 
ATOM   7478  C  CD1 . ILE D  1 177 ? -51.746  107.348 -12.814 1.00 10.60 ? 186 ILE D CD1 1 
ATOM   7479  N  N   . ASP D  1 178 ? -53.900  110.911 -8.688  1.00 11.13 ? 187 ASP D N   1 
ATOM   7480  C  CA  . ASP D  1 178 ? -54.261  112.235 -8.195  1.00 11.57 ? 187 ASP D CA  1 
ATOM   7481  C  C   . ASP D  1 178 ? -55.775  112.431 -8.147  1.00 11.85 ? 187 ASP D C   1 
ATOM   7482  O  O   . ASP D  1 178 ? -56.276  113.455 -8.545  1.00 12.52 ? 187 ASP D O   1 
ATOM   7483  C  CB  . ASP D  1 178 ? -53.563  113.334 -9.042  1.00 11.42 ? 187 ASP D CB  1 
ATOM   7484  C  CG  . ASP D  1 178 ? -52.065  113.277 -8.892  1.00 10.96 ? 187 ASP D CG  1 
ATOM   7485  O  OD1 . ASP D  1 178 ? -51.600  112.610 -7.934  1.00 10.11 ? 187 ASP D OD1 1 
ATOM   7486  O  OD2 . ASP D  1 178 ? -51.319  113.849 -9.720  1.00 11.20 ? 187 ASP D OD2 1 
ATOM   7487  N  N   . ASN D  1 179 ? -56.450  111.422 -7.619  1.00 11.96 ? 188 ASN D N   1 
ATOM   7488  C  CA  . ASN D  1 179 ? -57.893  111.405 -7.372  1.00 13.05 ? 188 ASN D CA  1 
ATOM   7489  C  C   . ASN D  1 179 ? -58.722  111.554 -8.624  1.00 14.15 ? 188 ASN D C   1 
ATOM   7490  O  O   . ASN D  1 179 ? -59.835  112.049 -8.575  1.00 16.38 ? 188 ASN D O   1 
ATOM   7491  C  CB  . ASN D  1 179 ? -58.336  112.444 -6.328  1.00 11.96 ? 188 ASN D CB  1 
ATOM   7492  C  CG  . ASN D  1 179 ? -58.826  111.817 -5.026  1.00 11.94 ? 188 ASN D CG  1 
ATOM   7493  O  OD1 . ASN D  1 179 ? -59.105  110.615 -4.949  1.00 12.81 ? 188 ASN D OD1 1 
ATOM   7494  N  ND2 . ASN D  1 179 ? -58.860  112.615 -3.970  1.00 11.30 ? 188 ASN D ND2 1 
ATOM   7495  N  N   . SER D  1 180 ? -58.197  111.122 -9.734  1.00 14.48 ? 189 SER D N   1 
ATOM   7496  C  CA  . SER D  1 180 ? -58.920  111.252 -10.970 1.00 15.16 ? 189 SER D CA  1 
ATOM   7497  C  C   . SER D  1 180 ? -58.694  110.014 -11.794 1.00 16.21 ? 189 SER D C   1 
ATOM   7498  O  O   . SER D  1 180 ? -57.563  109.502 -11.856 1.00 16.72 ? 189 SER D O   1 
ATOM   7499  C  CB  . SER D  1 180 ? -58.447  112.478 -11.694 1.00 15.51 ? 189 SER D CB  1 
ATOM   7500  O  OG  . SER D  1 180 ? -58.938  112.447 -12.994 1.00 17.29 ? 189 SER D OG  1 
ATOM   7501  N  N   . GLN D  1 181 ? -59.787  109.468 -12.331 1.00 15.93 ? 190 GLN D N   1 
ATOM   7502  C  CA  . GLN D  1 181 ? -59.778  108.151 -12.954 1.00 17.39 ? 190 GLN D CA  1 
ATOM   7503  C  C   . GLN D  1 181 ? -58.875  108.148 -14.135 1.00 16.50 ? 190 GLN D C   1 
ATOM   7504  O  O   . GLN D  1 181 ? -58.907  109.053 -14.916 1.00 18.59 ? 190 GLN D O   1 
ATOM   7505  C  CB  . GLN D  1 181 ? -61.165  107.756 -13.441 1.00 18.30 ? 190 GLN D CB  1 
ATOM   7506  C  CG  . GLN D  1 181 ? -61.191  106.429 -14.165 1.00 19.95 ? 190 GLN D CG  1 
ATOM   7507  C  CD  . GLN D  1 181 ? -62.601  106.007 -14.610 1.00 22.60 ? 190 GLN D CD  1 
ATOM   7508  O  OE1 . GLN D  1 181 ? -62.778  105.589 -15.733 1.00 27.12 ? 190 GLN D OE1 1 
ATOM   7509  N  NE2 . GLN D  1 181 ? -63.556  106.046 -13.722 1.00 22.70 ? 190 GLN D NE2 1 
ATOM   7510  N  N   . VAL D  1 182 ? -58.091  107.109 -14.264 1.00 14.38 ? 191 VAL D N   1 
ATOM   7511  C  CA  . VAL D  1 182 ? -57.194  106.974 -15.382 1.00 15.56 ? 191 VAL D CA  1 
ATOM   7512  C  C   . VAL D  1 182 ? -57.443  105.628 -16.135 1.00 15.33 ? 191 VAL D C   1 
ATOM   7513  O  O   . VAL D  1 182 ? -57.104  105.478 -17.303 1.00 15.07 ? 191 VAL D O   1 
ATOM   7514  C  CB  . VAL D  1 182 ? -55.771  107.225 -14.800 1.00 16.19 ? 191 VAL D CB  1 
ATOM   7515  C  CG1 . VAL D  1 182 ? -54.853  106.145 -15.191 1.00 17.43 ? 191 VAL D CG1 1 
ATOM   7516  C  CG2 . VAL D  1 182 ? -55.206  108.612 -15.097 1.00 15.02 ? 191 VAL D CG2 1 
ATOM   7517  N  N   . GLU D  1 183 ? -58.078  104.677 -15.473 1.00 15.12 ? 192 GLU D N   1 
ATOM   7518  C  CA  . GLU D  1 183 ? -58.391  103.401 -16.079 1.00 16.25 ? 192 GLU D CA  1 
ATOM   7519  C  C   . GLU D  1 183 ? -59.541  102.693 -15.336 1.00 14.48 ? 192 GLU D C   1 
ATOM   7520  O  O   . GLU D  1 183 ? -59.757  102.863 -14.149 1.00 14.02 ? 192 GLU D O   1 
ATOM   7521  C  CB  . GLU D  1 183 ? -57.156  102.507 -16.074 1.00 19.64 ? 192 GLU D CB  1 
ATOM   7522  C  CG  . GLU D  1 183 ? -57.180  101.352 -17.081 1.00 24.51 ? 192 GLU D CG  1 
ATOM   7523  C  CD  . GLU D  1 183 ? -57.819  101.756 -18.430 1.00 28.41 ? 192 GLU D CD  1 
ATOM   7524  O  OE1 . GLU D  1 183 ? -57.127  102.460 -19.211 1.00 33.26 ? 192 GLU D OE1 1 
ATOM   7525  O  OE2 . GLU D  1 183 ? -59.015  101.423 -18.705 1.00 28.15 ? 192 GLU D OE2 1 
ATOM   7526  N  N   . SER D  1 184 ? -60.314  101.911 -16.069 1.00 14.09 ? 193 SER D N   1 
ATOM   7527  C  CA  . SER D  1 184 ? -61.416  101.136 -15.473 1.00 13.52 ? 193 SER D CA  1 
ATOM   7528  C  C   . SER D  1 184 ? -61.859  99.976  -16.362 1.00 12.49 ? 193 SER D C   1 
ATOM   7529  O  O   . SER D  1 184 ? -61.573  99.941  -17.540 1.00 9.99  ? 193 SER D O   1 
ATOM   7530  C  CB  . SER D  1 184 ? -62.656  102.019 -15.145 1.00 14.06 ? 193 SER D CB  1 
ATOM   7531  O  OG  . SER D  1 184 ? -63.143  102.663 -16.322 1.00 13.59 ? 193 SER D OG  1 
ATOM   7532  N  N   . GLY D  1 185 ? -62.564  99.029  -15.747 1.00 12.22 ? 194 GLY D N   1 
ATOM   7533  C  CA  . GLY D  1 185 ? -63.097  97.900  -16.495 1.00 12.68 ? 194 GLY D CA  1 
ATOM   7534  C  C   . GLY D  1 185 ? -63.438  96.745  -15.597 1.00 12.91 ? 194 GLY D C   1 
ATOM   7535  O  O   . GLY D  1 185 ? -63.743  96.916  -14.424 1.00 13.22 ? 194 GLY D O   1 
ATOM   7536  N  N   . SER D  1 186 ? -63.394  95.558  -16.158 1.00 14.87 ? 195 SER D N   1 
ATOM   7537  C  CA  . SER D  1 186 ? -63.719  94.315  -15.435 1.00 16.92 ? 195 SER D CA  1 
ATOM   7538  C  C   . SER D  1 186 ? -62.532  93.387  -15.466 1.00 16.63 ? 195 SER D C   1 
ATOM   7539  O  O   . SER D  1 186 ? -61.784  93.327  -16.437 1.00 14.94 ? 195 SER D O   1 
ATOM   7540  C  CB  . SER D  1 186 ? -64.919  93.585  -16.053 1.00 18.28 ? 195 SER D CB  1 
ATOM   7541  O  OG  . SER D  1 186 ? -66.077  94.377  -15.894 1.00 20.42 ? 195 SER D OG  1 
ATOM   7542  N  N   . LEU D  1 187 ? -62.393  92.660  -14.369 1.00 18.78 ? 196 LEU D N   1 
ATOM   7543  C  CA  . LEU D  1 187 ? -61.308  91.730  -14.186 1.00 19.62 ? 196 LEU D CA  1 
ATOM   7544  C  C   . LEU D  1 187 ? -61.276  90.704  -15.284 1.00 21.72 ? 196 LEU D C   1 
ATOM   7545  O  O   . LEU D  1 187 ? -60.222  90.396  -15.795 1.00 21.08 ? 196 LEU D O   1 
ATOM   7546  C  CB  . LEU D  1 187 ? -61.452  91.039  -12.843 1.00 21.36 ? 196 LEU D CB  1 
ATOM   7547  C  CG  . LEU D  1 187 ? -61.248  91.786  -11.516 1.00 22.84 ? 196 LEU D CG  1 
ATOM   7548  C  CD1 . LEU D  1 187 ? -60.665  90.921  -10.410 1.00 24.16 ? 196 LEU D CD1 1 
ATOM   7549  C  CD2 . LEU D  1 187 ? -60.382  92.982  -11.686 1.00 22.86 ? 196 LEU D CD2 1 
ATOM   7550  N  N   . GLU D  1 188 ? -62.443  90.219  -15.697 1.00 24.46 ? 197 GLU D N   1 
ATOM   7551  C  CA  . GLU D  1 188 ? -62.497  89.129  -16.687 1.00 27.45 ? 197 GLU D CA  1 
ATOM   7552  C  C   . GLU D  1 188 ? -61.970  89.616  -18.015 1.00 24.06 ? 197 GLU D C   1 
ATOM   7553  O  O   . GLU D  1 188 ? -61.394  88.835  -18.747 1.00 27.60 ? 197 GLU D O   1 
ATOM   7554  C  CB  . GLU D  1 188 ? -63.925  88.465  -16.814 1.00 30.72 ? 197 GLU D CB  1 
ATOM   7555  C  CG  . GLU D  1 188 ? -65.097  89.438  -16.713 1.00 36.16 ? 197 GLU D CG  1 
ATOM   7556  C  CD  . GLU D  1 188 ? -65.514  89.784  -15.314 1.00 39.53 ? 197 GLU D CD  1 
ATOM   7557  O  OE1 . GLU D  1 188 ? -65.230  89.031  -14.359 1.00 45.38 ? 197 GLU D OE1 1 
ATOM   7558  O  OE2 . GLU D  1 188 ? -66.164  90.827  -15.205 1.00 48.24 ? 197 GLU D OE2 1 
ATOM   7559  N  N   . ASP D  1 189 ? -62.126  90.900  -18.332 1.00 22.32 ? 198 ASP D N   1 
ATOM   7560  C  CA  . ASP D  1 189 ? -61.706  91.425  -19.642 1.00 19.89 ? 198 ASP D CA  1 
ATOM   7561  C  C   . ASP D  1 189 ? -60.261  91.894  -19.638 1.00 19.33 ? 198 ASP D C   1 
ATOM   7562  O  O   . ASP D  1 189 ? -59.568  91.780  -20.621 1.00 15.86 ? 198 ASP D O   1 
ATOM   7563  C  CB  . ASP D  1 189 ? -62.584  92.596  -20.110 1.00 21.12 ? 198 ASP D CB  1 
ATOM   7564  C  CG  . ASP D  1 189 ? -64.105  92.299  -20.061 1.00 24.73 ? 198 ASP D CG  1 
ATOM   7565  O  OD1 . ASP D  1 189 ? -64.555  91.254  -20.566 1.00 27.04 ? 198 ASP D OD1 1 
ATOM   7566  O  OD2 . ASP D  1 189 ? -64.895  93.141  -19.584 1.00 28.54 ? 198 ASP D OD2 1 
ATOM   7567  N  N   . ASP D  1 190 ? -59.832  92.515  -18.543 1.00 20.25 ? 199 ASP D N   1 
ATOM   7568  C  CA  . ASP D  1 190 ? -58.556  93.258  -18.545 1.00 20.13 ? 199 ASP D CA  1 
ATOM   7569  C  C   . ASP D  1 190 ? -57.369  92.431  -18.014 1.00 19.96 ? 199 ASP D C   1 
ATOM   7570  O  O   . ASP D  1 190 ? -56.219  92.885  -18.017 1.00 21.29 ? 199 ASP D O   1 
ATOM   7571  C  CB  . ASP D  1 190 ? -58.720  94.569  -17.788 1.00 21.80 ? 199 ASP D CB  1 
ATOM   7572  C  CG  . ASP D  1 190 ? -59.622  95.558  -18.521 1.00 23.16 ? 199 ASP D CG  1 
ATOM   7573  O  OD1 . ASP D  1 190 ? -60.013  95.288  -19.669 1.00 26.40 ? 199 ASP D OD1 1 
ATOM   7574  O  OD2 . ASP D  1 190 ? -59.972  96.611  -17.952 1.00 22.89 ? 199 ASP D OD2 1 
ATOM   7575  N  N   . TRP D  1 191 ? -57.642  91.205  -17.607 1.00 20.53 ? 200 TRP D N   1 
ATOM   7576  C  CA  . TRP D  1 191 ? -56.595  90.193  -17.305 1.00 21.09 ? 200 TRP D CA  1 
ATOM   7577  C  C   . TRP D  1 191 ? -56.958  88.865  -17.988 1.00 22.51 ? 200 TRP D C   1 
ATOM   7578  O  O   . TRP D  1 191 ? -58.138  88.553  -18.147 1.00 23.30 ? 200 TRP D O   1 
ATOM   7579  C  CB  . TRP D  1 191 ? -56.537  89.911  -15.803 1.00 19.30 ? 200 TRP D CB  1 
ATOM   7580  C  CG  . TRP D  1 191 ? -55.992  91.031  -14.941 1.00 20.57 ? 200 TRP D CG  1 
ATOM   7581  C  CD1 . TRP D  1 191 ? -54.749  91.089  -14.377 1.00 19.98 ? 200 TRP D CD1 1 
ATOM   7582  C  CD2 . TRP D  1 191 ? -56.679  92.216  -14.508 1.00 18.54 ? 200 TRP D CD2 1 
ATOM   7583  N  NE1 . TRP D  1 191 ? -54.620  92.240  -13.648 1.00 21.19 ? 200 TRP D NE1 1 
ATOM   7584  C  CE2 . TRP D  1 191 ? -55.783  92.954  -13.713 1.00 19.09 ? 200 TRP D CE2 1 
ATOM   7585  C  CE3 . TRP D  1 191 ? -57.962  92.726  -14.725 1.00 19.00 ? 200 TRP D CE3 1 
ATOM   7586  C  CZ2 . TRP D  1 191 ? -56.131  94.148  -13.110 1.00 17.13 ? 200 TRP D CZ2 1 
ATOM   7587  C  CZ3 . TRP D  1 191 ? -58.311  93.914  -14.138 1.00 17.84 ? 200 TRP D CZ3 1 
ATOM   7588  C  CH2 . TRP D  1 191 ? -57.393  94.625  -13.344 1.00 17.59 ? 200 TRP D CH2 1 
ATOM   7589  N  N   . ASP D  1 192 ? -55.955  88.058  -18.292 1.00 24.51 ? 201 ASP D N   1 
ATOM   7590  C  CA  . ASP D  1 192 ? -56.146  86.680  -18.782 1.00 26.39 ? 201 ASP D CA  1 
ATOM   7591  C  C   . ASP D  1 192 ? -56.183  85.689  -17.663 1.00 25.51 ? 201 ASP D C   1 
ATOM   7592  O  O   . ASP D  1 192 ? -55.205  85.009  -17.419 1.00 30.05 ? 201 ASP D O   1 
ATOM   7593  C  CB  . ASP D  1 192 ? -54.990  86.258  -19.702 1.00 29.50 ? 201 ASP D CB  1 
ATOM   7594  C  CG  . ASP D  1 192 ? -54.873  87.116  -20.951 1.00 36.29 ? 201 ASP D CG  1 
ATOM   7595  O  OD1 . ASP D  1 192 ? -55.877  87.764  -21.346 1.00 43.85 ? 201 ASP D OD1 1 
ATOM   7596  O  OD2 . ASP D  1 192 ? -53.781  87.083  -21.578 1.00 38.13 ? 201 ASP D OD2 1 
ATOM   7597  N  N   . PHE D  1 193 ? -57.260  85.627  -16.933 1.00 24.94 ? 202 PHE D N   1 
ATOM   7598  C  CA  . PHE D  1 193 ? -57.364  84.647  -15.850 1.00 29.50 ? 202 PHE D CA  1 
ATOM   7599  C  C   . PHE D  1 193 ? -57.732  83.247  -16.374 1.00 30.63 ? 202 PHE D C   1 
ATOM   7600  O  O   . PHE D  1 193 ? -57.133  82.239  -16.017 1.00 29.39 ? 202 PHE D O   1 
ATOM   7601  C  CB  . PHE D  1 193 ? -58.459  85.080  -14.863 1.00 27.80 ? 202 PHE D CB  1 
ATOM   7602  C  CG  . PHE D  1 193 ? -58.107  86.290  -14.070 1.00 28.27 ? 202 PHE D CG  1 
ATOM   7603  C  CD1 . PHE D  1 193 ? -57.086  86.246  -13.117 1.00 26.91 ? 202 PHE D CD1 1 
ATOM   7604  C  CD2 . PHE D  1 193 ? -58.811  87.473  -14.247 1.00 28.90 ? 202 PHE D CD2 1 
ATOM   7605  C  CE1 . PHE D  1 193 ? -56.767  87.361  -12.378 1.00 28.92 ? 202 PHE D CE1 1 
ATOM   7606  C  CE2 . PHE D  1 193 ? -58.504  88.601  -13.497 1.00 30.11 ? 202 PHE D CE2 1 
ATOM   7607  C  CZ  . PHE D  1 193 ? -57.475  88.551  -12.565 1.00 29.14 ? 202 PHE D CZ  1 
ATOM   7608  N  N   . LEU D  1 194 ? -58.736  83.209  -17.243 1.00 31.99 ? 203 LEU D N   1 
ATOM   7609  C  CA  . LEU D  1 194 ? -59.357  81.894  -17.631 1.00 34.96 ? 203 LEU D CA  1 
ATOM   7610  C  C   . LEU D  1 194 ? -60.396  82.064  -18.743 1.00 34.48 ? 203 LEU D C   1 
ATOM   7611  O  O   . LEU D  1 194 ? -60.871  83.178  -18.937 1.00 35.51 ? 203 LEU D O   1 
ATOM   7612  C  CB  . LEU D  1 194 ? -59.963  81.081  -16.435 1.00 36.65 ? 203 LEU D CB  1 
ATOM   7613  C  CG  . LEU D  1 194 ? -61.425  81.239  -15.947 1.00 39.60 ? 203 LEU D CG  1 
ATOM   7614  C  CD1 . LEU D  1 194 ? -61.765  80.115  -14.974 1.00 39.17 ? 203 LEU D CD1 1 
ATOM   7615  C  CD2 . LEU D  1 194 ? -61.716  82.597  -15.307 1.00 39.90 ? 203 LEU D CD2 1 
ATOM   7616  N  N   . PRO D  1 195 ? -60.683  80.976  -19.507 1.00 36.48 ? 204 PRO D N   1 
ATOM   7617  C  CA  . PRO D  1 195 ? -61.667  80.965  -20.617 1.00 37.83 ? 204 PRO D CA  1 
ATOM   7618  C  C   . PRO D  1 195 ? -63.143  81.114  -20.198 1.00 38.23 ? 204 PRO D C   1 
ATOM   7619  O  O   . PRO D  1 195 ? -63.530  80.711  -19.102 1.00 35.57 ? 204 PRO D O   1 
ATOM   7620  C  CB  . PRO D  1 195 ? -61.455  79.586  -21.288 1.00 35.54 ? 204 PRO D CB  1 
ATOM   7621  C  CG  . PRO D  1 195 ? -60.551  78.814  -20.410 1.00 36.46 ? 204 PRO D CG  1 
ATOM   7622  C  CD  . PRO D  1 195 ? -59.808  79.782  -19.546 1.00 36.97 ? 204 PRO D CD  1 
ATOM   7623  N  N   . GLY D  1 196 ? -63.967  81.619  -21.113 1.00 40.87 ? 205 GLY D N   1 
ATOM   7624  C  CA  . GLY D  1 196 ? -65.405  81.789  -20.885 1.00 42.76 ? 205 GLY D CA  1 
ATOM   7625  C  C   . GLY D  1 196 ? -65.838  83.013  -20.125 1.00 40.62 ? 205 GLY D C   1 
ATOM   7626  O  O   . GLY D  1 196 ? -65.169  84.044  -20.066 1.00 37.87 ? 205 GLY D O   1 
ATOM   7627  N  N   . SER D  1 197 ? -66.998  82.864  -19.520 1.00 45.96 ? 206 SER D N   1 
ATOM   7628  C  CA  . SER D  1 197 ? -67.574  83.965  -18.748 1.00 47.56 ? 206 SER D CA  1 
ATOM   7629  C  C   . SER D  1 197 ? -66.603  84.560  -17.738 1.00 50.35 ? 206 SER D C   1 
ATOM   7630  O  O   . SER D  1 197 ? -66.582  85.778  -17.539 1.00 57.46 ? 206 SER D O   1 
ATOM   7631  C  CB  . SER D  1 197 ? -68.829  83.512  -17.997 1.00 45.52 ? 206 SER D CB  1 
ATOM   7632  O  OG  . SER D  1 197 ? -69.974  84.093  -18.568 1.00 56.24 ? 206 SER D OG  1 
ATOM   7633  N  N   . GLY D  1 198 ? -65.824  83.689  -17.103 1.00 49.08 ? 207 GLY D N   1 
ATOM   7634  C  CA  . GLY D  1 198 ? -65.050  84.057  -15.965 1.00 47.09 ? 207 GLY D CA  1 
ATOM   7635  C  C   . GLY D  1 198 ? -65.789  83.364  -14.845 1.00 46.94 ? 207 GLY D C   1 
ATOM   7636  O  O   . GLY D  1 198 ? -66.093  82.165  -14.907 1.00 45.04 ? 207 GLY D O   1 
ATOM   7637  N  N   . ASP D  1 199 ? -65.647  83.506  -13.467 1.00 32.51 ? 302 ASP D N   1 
ATOM   7638  C  CA  . ASP D  1 199 ? -65.467  83.004  -12.131 1.00 34.11 ? 302 ASP D CA  1 
ATOM   7639  C  C   . ASP D  1 199 ? -65.730  84.284  -11.434 1.00 34.99 ? 302 ASP D C   1 
ATOM   7640  O  O   . ASP D  1 199 ? -64.958  85.230  -11.589 1.00 39.58 ? 302 ASP D O   1 
ATOM   7641  C  CB  . ASP D  1 199 ? -64.048  82.484  -11.925 1.00 33.98 ? 302 ASP D CB  1 
ATOM   7642  C  CG  . ASP D  1 199 ? -63.745  82.176  -10.470 1.00 34.85 ? 302 ASP D CG  1 
ATOM   7643  O  OD1 . ASP D  1 199 ? -64.587  82.383  -9.567  1.00 32.90 ? 302 ASP D OD1 1 
ATOM   7644  O  OD2 . ASP D  1 199 ? -62.616  81.737  -10.208 1.00 41.27 ? 302 ASP D OD2 1 
ATOM   7645  N  N   . PRO D  1 200 ? -66.872  84.364  -10.757 1.00 34.65 ? 303 PRO D N   1 
ATOM   7646  C  CA  . PRO D  1 200 ? -67.256  85.651  -10.220 1.00 34.60 ? 303 PRO D CA  1 
ATOM   7647  C  C   . PRO D  1 200 ? -66.496  85.990  -8.935  1.00 33.02 ? 303 PRO D C   1 
ATOM   7648  O  O   . PRO D  1 200 ? -66.549  87.131  -8.525  1.00 34.71 ? 303 PRO D O   1 
ATOM   7649  C  CB  . PRO D  1 200 ? -68.753  85.469  -9.909  1.00 34.17 ? 303 PRO D CB  1 
ATOM   7650  C  CG  . PRO D  1 200 ? -68.915  84.007  -9.648  1.00 33.28 ? 303 PRO D CG  1 
ATOM   7651  C  CD  . PRO D  1 200 ? -67.776  83.284  -10.312 1.00 35.10 ? 303 PRO D CD  1 
ATOM   7652  N  N   . SER D  1 201 ? -65.773  85.030  -8.366  1.00 27.54 ? 304 SER D N   1 
ATOM   7653  C  CA  . SER D  1 201 ? -64.981  85.263  -7.158  1.00 26.64 ? 304 SER D CA  1 
ATOM   7654  C  C   . SER D  1 201 ? -63.481  85.702  -7.351  1.00 24.55 ? 304 SER D C   1 
ATOM   7655  O  O   . SER D  1 201 ? -62.741  85.788  -6.387  1.00 22.43 ? 304 SER D O   1 
ATOM   7656  C  CB  . SER D  1 201 ? -65.001  83.967  -6.335  1.00 27.10 ? 304 SER D CB  1 
ATOM   7657  O  OG  . SER D  1 201 ? -63.994  83.030  -6.800  1.00 28.19 ? 304 SER D OG  1 
ATOM   7658  N  N   . ILE D  1 202 ? -63.052  86.005  -8.569  1.00 22.80 ? 305 ILE D N   1 
ATOM   7659  C  CA  . ILE D  1 202 ? -61.654  86.361  -8.827  1.00 24.03 ? 305 ILE D CA  1 
ATOM   7660  C  C   . ILE D  1 202 ? -61.149  87.497  -7.922  1.00 19.59 ? 305 ILE D C   1 
ATOM   7661  O  O   . ILE D  1 202 ? -60.043  87.484  -7.482  1.00 17.85 ? 305 ILE D O   1 
ATOM   7662  C  CB  . ILE D  1 202 ? -61.440  86.744  -10.318 1.00 26.40 ? 305 ILE D CB  1 
ATOM   7663  C  CG1 . ILE D  1 202 ? -61.749  85.502  -11.160 1.00 28.22 ? 305 ILE D CG1 1 
ATOM   7664  C  CG2 . ILE D  1 202 ? -59.983  87.141  -10.581 1.00 27.61 ? 305 ILE D CG2 1 
ATOM   7665  C  CD1 . ILE D  1 202 ? -61.623  85.565  -12.668 1.00 30.61 ? 305 ILE D CD1 1 
ATOM   7666  N  N   . TYR D  1 203 ? -61.995  88.490  -7.722  1.00 17.33 ? 306 TYR D N   1 
ATOM   7667  C  CA  . TYR D  1 203 ? -61.645  89.690  -6.980  1.00 16.06 ? 306 TYR D CA  1 
ATOM   7668  C  C   . TYR D  1 203 ? -61.310  89.407  -5.520  1.00 17.02 ? 306 TYR D C   1 
ATOM   7669  O  O   . TYR D  1 203 ? -60.720  90.240  -4.858  1.00 15.63 ? 306 TYR D O   1 
ATOM   7670  C  CB  . TYR D  1 203 ? -62.810  90.688  -7.038  1.00 15.33 ? 306 TYR D CB  1 
ATOM   7671  C  CG  . TYR D  1 203 ? -63.903  90.364  -6.059  1.00 14.23 ? 306 TYR D CG  1 
ATOM   7672  C  CD1 . TYR D  1 203 ? -64.919  89.424  -6.371  1.00 14.26 ? 306 TYR D CD1 1 
ATOM   7673  C  CD2 . TYR D  1 203 ? -63.918  90.950  -4.825  1.00 14.04 ? 306 TYR D CD2 1 
ATOM   7674  C  CE1 . TYR D  1 203 ? -65.901  89.090  -5.459  1.00 13.20 ? 306 TYR D CE1 1 
ATOM   7675  C  CE2 . TYR D  1 203 ? -64.872  90.624  -3.883  1.00 14.48 ? 306 TYR D CE2 1 
ATOM   7676  C  CZ  . TYR D  1 203 ? -65.871  89.690  -4.196  1.00 14.48 ? 306 TYR D CZ  1 
ATOM   7677  O  OH  . TYR D  1 203 ? -66.794  89.409  -3.231  1.00 13.91 ? 306 TYR D OH  1 
ATOM   7678  N  N   . ALA D  1 204 ? -61.721  88.237  -5.017  1.00 17.20 ? 307 ALA D N   1 
ATOM   7679  C  CA  . ALA D  1 204 ? -61.840  88.036  -3.557  1.00 16.64 ? 307 ALA D CA  1 
ATOM   7680  C  C   . ALA D  1 204 ? -60.708  87.214  -2.957  1.00 14.71 ? 307 ALA D C   1 
ATOM   7681  O  O   . ALA D  1 204 ? -60.214  86.308  -3.571  1.00 14.10 ? 307 ALA D O   1 
ATOM   7682  C  CB  . ALA D  1 204 ? -63.182  87.373  -3.216  1.00 17.70 ? 307 ALA D CB  1 
ATOM   7683  N  N   . TYR D  1 205 ? -60.295  87.602  -1.759  1.00 14.75 ? 308 TYR D N   1 
ATOM   7684  C  CA  . TYR D  1 205 ? -59.173  86.979  -1.049  1.00 15.17 ? 308 TYR D CA  1 
ATOM   7685  C  C   . TYR D  1 205 ? -59.624  86.767  0.349   1.00 18.14 ? 308 TYR D C   1 
ATOM   7686  O  O   . TYR D  1 205 ? -60.311  87.590  0.960   1.00 19.90 ? 308 TYR D O   1 
ATOM   7687  C  CB  . TYR D  1 205 ? -57.850  87.803  -1.097  1.00 13.28 ? 308 TYR D CB  1 
ATOM   7688  C  CG  . TYR D  1 205 ? -57.268  87.843  -2.472  1.00 12.09 ? 308 TYR D CG  1 
ATOM   7689  C  CD1 . TYR D  1 205 ? -56.497  86.796  -2.955  1.00 11.71 ? 308 TYR D CD1 1 
ATOM   7690  C  CD2 . TYR D  1 205 ? -57.588  88.873  -3.363  1.00 11.85 ? 308 TYR D CD2 1 
ATOM   7691  C  CE1 . TYR D  1 205 ? -56.023  86.803  -4.261  1.00 11.43 ? 308 TYR D CE1 1 
ATOM   7692  C  CE2 . TYR D  1 205 ? -57.105  88.882  -4.669  1.00 11.10 ? 308 TYR D CE2 1 
ATOM   7693  C  CZ  . TYR D  1 205 ? -56.343  87.867  -5.111  1.00 10.72 ? 308 TYR D CZ  1 
ATOM   7694  O  OH  . TYR D  1 205 ? -55.881  87.862  -6.387  1.00 10.72 ? 308 TYR D OH  1 
ATOM   7695  N  N   . ASP D  1 206 ? -59.312  85.586  0.833   1.00 23.58 ? 309 ASP D N   1 
ATOM   7696  C  CA  . ASP D  1 206 ? -59.810  85.151  2.143   1.00 29.61 ? 309 ASP D CA  1 
ATOM   7697  C  C   . ASP D  1 206 ? -59.235  86.001  3.224   1.00 27.50 ? 309 ASP D C   1 
ATOM   7698  O  O   . ASP D  1 206 ? -59.847  86.244  4.243   1.00 25.84 ? 309 ASP D O   1 
ATOM   7699  C  CB  . ASP D  1 206 ? -59.422  83.681  2.383   1.00 35.92 ? 309 ASP D CB  1 
ATOM   7700  C  CG  . ASP D  1 206 ? -60.276  82.719  1.555   1.00 42.57 ? 309 ASP D CG  1 
ATOM   7701  O  OD1 . ASP D  1 206 ? -61.496  82.980  1.448   1.00 49.13 ? 309 ASP D OD1 1 
ATOM   7702  O  OD2 . ASP D  1 206 ? -59.730  81.728  1.019   1.00 48.45 ? 309 ASP D OD2 1 
ATOM   7703  N  N   . ASN D  1 207 ? -58.021  86.435  2.985   1.00 28.21 ? 310 ASN D N   1 
ATOM   7704  C  CA  . ASN D  1 207 ? -57.270  87.051  4.017   1.00 29.63 ? 310 ASN D CA  1 
ATOM   7705  C  C   . ASN D  1 207 ? -56.226  88.070  3.500   1.00 26.69 ? 310 ASN D C   1 
ATOM   7706  O  O   . ASN D  1 207 ? -55.386  87.785  2.626   1.00 27.04 ? 310 ASN D O   1 
ATOM   7707  C  CB  . ASN D  1 207 ? -56.650  85.914  4.848   1.00 35.36 ? 310 ASN D CB  1 
ATOM   7708  C  CG  . ASN D  1 207 ? -55.823  86.424  5.988   1.00 41.08 ? 310 ASN D CG  1 
ATOM   7709  O  OD1 . ASN D  1 207 ? -55.090  87.418  5.862   1.00 41.44 ? 310 ASN D OD1 1 
ATOM   7710  N  ND2 . ASN D  1 207 ? -55.959  85.764  7.141   1.00 45.56 ? 310 ASN D ND2 1 
ATOM   7711  N  N   . PHE D  1 208 ? -56.321  89.261  4.055   1.00 24.05 ? 311 PHE D N   1 
ATOM   7712  C  CA  . PHE D  1 208 ? -55.305  90.270  3.906   1.00 23.01 ? 311 PHE D CA  1 
ATOM   7713  C  C   . PHE D  1 208 ? -54.792  90.537  5.319   1.00 22.90 ? 311 PHE D C   1 
ATOM   7714  O  O   . PHE D  1 208 ? -55.599  90.778  6.217   1.00 23.28 ? 311 PHE D O   1 
ATOM   7715  C  CB  . PHE D  1 208 ? -55.900  91.543  3.346   1.00 22.03 ? 311 PHE D CB  1 
ATOM   7716  C  CG  . PHE D  1 208 ? -56.269  91.452  1.903   1.00 20.10 ? 311 PHE D CG  1 
ATOM   7717  C  CD1 . PHE D  1 208 ? -55.303  91.392  0.938   1.00 19.65 ? 311 PHE D CD1 1 
ATOM   7718  C  CD2 . PHE D  1 208 ? -57.598  91.452  1.522   1.00 20.15 ? 311 PHE D CD2 1 
ATOM   7719  C  CE1 . PHE D  1 208 ? -55.642  91.336  -0.410  1.00 19.81 ? 311 PHE D CE1 1 
ATOM   7720  C  CE2 . PHE D  1 208 ? -57.946  91.404  0.185   1.00 19.00 ? 311 PHE D CE2 1 
ATOM   7721  C  CZ  . PHE D  1 208 ? -56.966  91.371  -0.789  1.00 17.72 ? 311 PHE D CZ  1 
ATOM   7722  N  N   . GLY D  1 209 ? -53.471  90.490  5.498   1.00 20.73 ? 312 GLY D N   1 
ATOM   7723  C  CA  . GLY D  1 209 ? -52.856  90.792  6.804   1.00 21.25 ? 312 GLY D CA  1 
ATOM   7724  C  C   . GLY D  1 209 ? -51.629  91.688  6.810   1.00 19.80 ? 312 GLY D C   1 
ATOM   7725  O  O   . GLY D  1 209 ? -51.277  92.241  7.848   1.00 22.86 ? 312 GLY D O   1 
ATOM   7726  N  N   . VAL D  1 210 ? -50.958  91.812  5.675   1.00 18.28 ? 313 VAL D N   1 
ATOM   7727  C  CA  . VAL D  1 210 ? -49.746  92.611  5.568   1.00 17.62 ? 313 VAL D CA  1 
ATOM   7728  C  C   . VAL D  1 210 ? -49.672  93.416  4.279   1.00 17.34 ? 313 VAL D C   1 
ATOM   7729  O  O   . VAL D  1 210 ? -49.986  92.922  3.189   1.00 16.02 ? 313 VAL D O   1 
ATOM   7730  C  CB  . VAL D  1 210 ? -48.486  91.741  5.608   1.00 18.11 ? 313 VAL D CB  1 
ATOM   7731  C  CG1 . VAL D  1 210 ? -47.216  92.590  5.523   1.00 18.01 ? 313 VAL D CG1 1 
ATOM   7732  C  CG2 . VAL D  1 210 ? -48.441  90.924  6.880   1.00 17.90 ? 313 VAL D CG2 1 
ATOM   7733  N  N   . LEU D  1 211 ? -49.255  94.661  4.437   1.00 18.39 ? 314 LEU D N   1 
ATOM   7734  C  CA  . LEU D  1 211 ? -48.854  95.526  3.314   1.00 21.42 ? 314 LEU D CA  1 
ATOM   7735  C  C   . LEU D  1 211 ? -47.334  95.638  3.243   1.00 20.89 ? 314 LEU D C   1 
ATOM   7736  O  O   . LEU D  1 211 ? -46.708  96.118  4.183   1.00 21.18 ? 314 LEU D O   1 
ATOM   7737  C  CB  . LEU D  1 211 ? -49.458  96.930  3.438   1.00 20.48 ? 314 LEU D CB  1 
ATOM   7738  C  CG  . LEU D  1 211 ? -49.184  97.795  2.177   1.00 24.05 ? 314 LEU D CG  1 
ATOM   7739  C  CD1 . LEU D  1 211 ? -50.351  98.730  1.866   1.00 24.85 ? 314 LEU D CD1 1 
ATOM   7740  C  CD2 . LEU D  1 211 ? -47.920  98.628  2.319   1.00 23.80 ? 314 LEU D CD2 1 
ATOM   7741  N  N   . GLY D  1 212 ? -46.758  95.272  2.114   1.00 20.97 ? 315 GLY D N   1 
ATOM   7742  C  CA  . GLY D  1 212 ? -45.300  95.342  1.920   1.00 20.62 ? 315 GLY D CA  1 
ATOM   7743  C  C   . GLY D  1 212 ? -44.816  96.283  0.830   1.00 19.32 ? 315 GLY D C   1 
ATOM   7744  O  O   . GLY D  1 212 ? -45.422  96.416  -0.226  1.00 17.55 ? 315 GLY D O   1 
ATOM   7745  N  N   . LEU D  1 213 ? -43.711  96.939  1.136   1.00 19.33 ? 316 LEU D N   1 
ATOM   7746  C  CA  . LEU D  1 213 ? -42.889  97.628  0.156   1.00 19.97 ? 316 LEU D CA  1 
ATOM   7747  C  C   . LEU D  1 213 ? -41.732  96.701  -0.167  1.00 21.30 ? 316 LEU D C   1 
ATOM   7748  O  O   . LEU D  1 213 ? -40.807  96.521  0.636   1.00 22.64 ? 316 LEU D O   1 
ATOM   7749  C  CB  . LEU D  1 213 ? -42.378  98.963  0.707   1.00 21.12 ? 316 LEU D CB  1 
ATOM   7750  C  CG  . LEU D  1 213 ? -43.468  99.913  1.184   1.00 21.56 ? 316 LEU D CG  1 
ATOM   7751  C  CD1 . LEU D  1 213 ? -42.918  101.050 2.000   1.00 23.16 ? 316 LEU D CD1 1 
ATOM   7752  C  CD2 . LEU D  1 213 ? -44.226  100.478 -0.002  1.00 22.93 ? 316 LEU D CD2 1 
ATOM   7753  N  N   . ASP D  1 214 ? -41.798  96.091  -1.325  1.00 20.90 ? 317 ASP D N   1 
ATOM   7754  C  CA  . ASP D  1 214 ? -40.881  95.052  -1.707  1.00 25.54 ? 317 ASP D CA  1 
ATOM   7755  C  C   . ASP D  1 214 ? -40.519  95.318  -3.162  1.00 23.99 ? 317 ASP D C   1 
ATOM   7756  O  O   . ASP D  1 214 ? -41.329  95.067  -4.036  1.00 24.36 ? 317 ASP D O   1 
ATOM   7757  C  CB  . ASP D  1 214 ? -41.546  93.664  -1.542  1.00 32.18 ? 317 ASP D CB  1 
ATOM   7758  C  CG  . ASP D  1 214 ? -40.648  92.521  -2.026  1.00 39.81 ? 317 ASP D CG  1 
ATOM   7759  O  OD1 . ASP D  1 214 ? -39.529  92.444  -1.487  1.00 53.21 ? 317 ASP D OD1 1 
ATOM   7760  O  OD2 . ASP D  1 214 ? -41.018  91.704  -2.915  1.00 42.45 ? 317 ASP D OD2 1 
ATOM   7761  N  N   . LEU D  1 215 ? -39.322  95.856  -3.393  1.00 22.01 ? 318 LEU D N   1 
ATOM   7762  C  CA  . LEU D  1 215 ? -39.010  96.500  -4.637  1.00 21.56 ? 318 LEU D CA  1 
ATOM   7763  C  C   . LEU D  1 215 ? -37.533  96.796  -4.845  1.00 22.38 ? 318 LEU D C   1 
ATOM   7764  O  O   . LEU D  1 215 ? -36.714  96.652  -3.941  1.00 25.95 ? 318 LEU D O   1 
ATOM   7765  C  CB  . LEU D  1 215 ? -39.821  97.801  -4.778  1.00 22.13 ? 318 LEU D CB  1 
ATOM   7766  C  CG  . LEU D  1 215 ? -39.805  98.833  -3.656  1.00 19.94 ? 318 LEU D CG  1 
ATOM   7767  C  CD1 . LEU D  1 215 ? -38.674  99.817  -3.879  1.00 22.10 ? 318 LEU D CD1 1 
ATOM   7768  C  CD2 . LEU D  1 215 ? -41.097  99.595  -3.571  1.00 17.98 ? 318 LEU D CD2 1 
ATOM   7769  N  N   . TRP D  1 216 ? -37.202  97.202  -6.067  1.00 21.38 ? 319 TRP D N   1 
ATOM   7770  C  CA  . TRP D  1 216 ? -35.837  97.486  -6.471  1.00 19.47 ? 319 TRP D CA  1 
ATOM   7771  C  C   . TRP D  1 216 ? -35.714  98.948  -6.871  1.00 20.00 ? 319 TRP D C   1 
ATOM   7772  O  O   . TRP D  1 216 ? -36.644  99.512  -7.427  1.00 19.19 ? 319 TRP D O   1 
ATOM   7773  C  CB  . TRP D  1 216 ? -35.465  96.619  -7.658  1.00 19.86 ? 319 TRP D CB  1 
ATOM   7774  C  CG  . TRP D  1 216 ? -34.211  97.083  -8.394  1.00 20.07 ? 319 TRP D CG  1 
ATOM   7775  C  CD1 . TRP D  1 216 ? -34.173  97.762  -9.562  1.00 21.18 ? 319 TRP D CD1 1 
ATOM   7776  C  CD2 . TRP D  1 216 ? -32.844  96.890  -7.993  1.00 19.20 ? 319 TRP D CD2 1 
ATOM   7777  N  NE1 . TRP D  1 216 ? -32.875  97.994  -9.925  1.00 21.01 ? 319 TRP D NE1 1 
ATOM   7778  C  CE2 . TRP D  1 216 ? -32.038  97.479  -8.977  1.00 19.99 ? 319 TRP D CE2 1 
ATOM   7779  C  CE3 . TRP D  1 216 ? -32.229  96.279  -6.884  1.00 19.22 ? 319 TRP D CE3 1 
ATOM   7780  C  CZ2 . TRP D  1 216 ? -30.642  97.492  -8.897  1.00 19.45 ? 319 TRP D CZ2 1 
ATOM   7781  C  CZ3 . TRP D  1 216 ? -30.825  96.276  -6.808  1.00 18.29 ? 319 TRP D CZ3 1 
ATOM   7782  C  CH2 . TRP D  1 216 ? -30.058  96.883  -7.798  1.00 18.88 ? 319 TRP D CH2 1 
ATOM   7783  N  N   . GLN D  1 217 ? -34.567  99.550  -6.574  1.00 19.09 ? 320 GLN D N   1 
ATOM   7784  C  CA  . GLN D  1 217 ? -34.297  100.927 -6.940  1.00 19.71 ? 320 GLN D CA  1 
ATOM   7785  C  C   . GLN D  1 217 ? -32.844  101.157 -7.324  1.00 21.07 ? 320 GLN D C   1 
ATOM   7786  O  O   . GLN D  1 217 ? -31.957  100.727 -6.626  1.00 22.51 ? 320 GLN D O   1 
ATOM   7787  C  CB  . GLN D  1 217 ? -34.656  101.911 -5.801  1.00 19.18 ? 320 GLN D CB  1 
ATOM   7788  C  CG  . GLN D  1 217 ? -36.133  102.199 -5.746  1.00 19.29 ? 320 GLN D CG  1 
ATOM   7789  C  CD  . GLN D  1 217 ? -36.574  103.513 -5.171  1.00 18.57 ? 320 GLN D CD  1 
ATOM   7790  O  OE1 . GLN D  1 217 ? -35.898  104.203 -4.431  1.00 19.06 ? 320 GLN D OE1 1 
ATOM   7791  N  NE2 . GLN D  1 217 ? -37.831  103.811 -5.447  1.00 21.22 ? 320 GLN D NE2 1 
ATOM   7792  N  N   . VAL D  1 218 ? -32.624  101.855 -8.433  1.00 20.69 ? 321 VAL D N   1 
ATOM   7793  C  CA  . VAL D  1 218 ? -31.306  102.337 -8.790  1.00 19.85 ? 321 VAL D CA  1 
ATOM   7794  C  C   . VAL D  1 218 ? -31.168  103.639 -8.001  1.00 19.82 ? 321 VAL D C   1 
ATOM   7795  O  O   . VAL D  1 218 ? -30.777  103.603 -6.819  1.00 20.96 ? 321 VAL D O   1 
ATOM   7796  C  CB  . VAL D  1 218 ? -31.093  102.468 -10.299 1.00 19.76 ? 321 VAL D CB  1 
ATOM   7797  C  CG1 . VAL D  1 218 ? -29.679  102.972 -10.620 1.00 20.16 ? 321 VAL D CG1 1 
ATOM   7798  C  CG2 . VAL D  1 218 ? -31.284  101.131 -10.965 1.00 19.84 ? 321 VAL D CG2 1 
ATOM   7799  N  N   . LYS D  1 219 ? -31.518  104.772 -8.576  1.00 21.02 ? 322 LYS D N   1 
ATOM   7800  C  CA  . LYS D  1 219 ? -31.433  106.042 -7.826  1.00 22.32 ? 322 LYS D CA  1 
ATOM   7801  C  C   . LYS D  1 219 ? -32.491  106.093 -6.755  1.00 22.21 ? 322 LYS D C   1 
ATOM   7802  O  O   . LYS D  1 219 ? -33.679  106.012 -7.048  1.00 27.71 ? 322 LYS D O   1 
ATOM   7803  C  CB  . LYS D  1 219 ? -31.623  107.244 -8.714  1.00 23.67 ? 322 LYS D CB  1 
ATOM   7804  C  CG  . LYS D  1 219 ? -30.421  107.637 -9.554  1.00 26.18 ? 322 LYS D CG  1 
ATOM   7805  C  CD  . LYS D  1 219 ? -30.765  108.793 -10.518 1.00 27.02 ? 322 LYS D CD  1 
ATOM   7806  C  CE  . LYS D  1 219 ? -31.107  110.054 -9.739  1.00 27.38 ? 322 LYS D CE  1 
ATOM   7807  N  NZ  . LYS D  1 219 ? -31.469  111.150 -10.680 1.00 29.19 ? 322 LYS D NZ  1 
ATOM   7808  N  N   . SER D  1 220 ? -32.054  106.284 -5.525  1.00 20.00 ? 323 SER D N   1 
ATOM   7809  C  CA  . SER D  1 220 ? -32.900  106.228 -4.351  1.00 18.68 ? 323 SER D CA  1 
ATOM   7810  C  C   . SER D  1 220 ? -33.418  107.582 -3.976  1.00 14.92 ? 323 SER D C   1 
ATOM   7811  O  O   . SER D  1 220 ? -33.071  108.554 -4.601  1.00 14.96 ? 323 SER D O   1 
ATOM   7812  C  CB  . SER D  1 220 ? -32.084  105.636 -3.181  1.00 21.29 ? 323 SER D CB  1 
ATOM   7813  O  OG  . SER D  1 220 ? -31.005  106.475 -2.804  1.00 21.03 ? 323 SER D OG  1 
ATOM   7814  N  N   . GLY D  1 221 ? -34.281  107.652 -2.971  1.00 13.09 ? 324 GLY D N   1 
ATOM   7815  C  CA  . GLY D  1 221 ? -34.904  108.934 -2.535  1.00 11.87 ? 324 GLY D CA  1 
ATOM   7816  C  C   . GLY D  1 221 ? -36.434  109.019 -2.624  1.00 12.03 ? 324 GLY D C   1 
ATOM   7817  O  O   . GLY D  1 221 ? -37.054  110.039 -2.276  1.00 10.56 ? 324 GLY D O   1 
ATOM   7818  N  N   . THR D  1 222 ? -37.072  107.972 -3.131  1.00 11.53 ? 325 THR D N   1 
ATOM   7819  C  CA  . THR D  1 222 ? -38.534  107.935 -3.207  1.00 11.42 ? 325 THR D CA  1 
ATOM   7820  C  C   . THR D  1 222 ? -39.140  107.973 -1.815  1.00 11.95 ? 325 THR D C   1 
ATOM   7821  O  O   . THR D  1 222 ? -38.707  107.229 -0.925  1.00 13.17 ? 325 THR D O   1 
ATOM   7822  C  CB  . THR D  1 222 ? -39.007  106.655 -3.889  1.00 11.26 ? 325 THR D CB  1 
ATOM   7823  O  OG1 . THR D  1 222 ? -38.490  106.630 -5.242  1.00 11.79 ? 325 THR D OG1 1 
ATOM   7824  C  CG2 . THR D  1 222 ? -40.507  106.576 -3.923  1.00 10.88 ? 325 THR D CG2 1 
ATOM   7825  N  N   . ILE D  1 223 ? -40.161  108.794 -1.637  1.00 11.62 ? 326 ILE D N   1 
ATOM   7826  C  CA  . ILE D  1 223 ? -40.901  108.858 -0.391  1.00 12.24 ? 326 ILE D CA  1 
ATOM   7827  C  C   . ILE D  1 223 ? -42.362  108.363 -0.511  1.00 12.36 ? 326 ILE D C   1 
ATOM   7828  O  O   . ILE D  1 223 ? -43.160  108.866 -1.330  1.00 12.09 ? 326 ILE D O   1 
ATOM   7829  C  CB  . ILE D  1 223 ? -40.971  110.285 0.151   1.00 12.91 ? 326 ILE D CB  1 
ATOM   7830  C  CG1 . ILE D  1 223 ? -39.540  110.860 0.309   1.00 12.85 ? 326 ILE D CG1 1 
ATOM   7831  C  CG2 . ILE D  1 223 ? -41.733  110.334 1.486   1.00 13.34 ? 326 ILE D CG2 1 
ATOM   7832  C  CD1 . ILE D  1 223 ? -39.499  112.206 0.987   1.00 13.08 ? 326 ILE D CD1 1 
ATOM   7833  N  N   . PHE D  1 224 ? -42.689  107.378 0.323   1.00 11.96 ? 327 PHE D N   1 
ATOM   7834  C  CA  . PHE D  1 224 ? -44.055  106.803 0.430   1.00 11.92 ? 327 PHE D CA  1 
ATOM   7835  C  C   . PHE D  1 224 ? -44.781  107.326 1.673   1.00 12.01 ? 327 PHE D C   1 
ATOM   7836  O  O   . PHE D  1 224 ? -44.218  107.327 2.759   1.00 12.45 ? 327 PHE D O   1 
ATOM   7837  C  CB  . PHE D  1 224 ? -43.978  105.302 0.534   1.00 11.64 ? 327 PHE D CB  1 
ATOM   7838  C  CG  . PHE D  1 224 ? -43.292  104.635 -0.609  1.00 11.66 ? 327 PHE D CG  1 
ATOM   7839  C  CD1 . PHE D  1 224 ? -44.002  104.187 -1.703  1.00 11.96 ? 327 PHE D CD1 1 
ATOM   7840  C  CD2 . PHE D  1 224 ? -41.957  104.374 -0.555  1.00 12.34 ? 327 PHE D CD2 1 
ATOM   7841  C  CE1 . PHE D  1 224 ? -43.370  103.558 -2.745  1.00 12.57 ? 327 PHE D CE1 1 
ATOM   7842  C  CE2 . PHE D  1 224 ? -41.285  103.739 -1.603  1.00 12.33 ? 327 PHE D CE2 1 
ATOM   7843  C  CZ  . PHE D  1 224 ? -41.992  103.323 -2.696  1.00 12.86 ? 327 PHE D CZ  1 
ATOM   7844  N  N   . ASP D  1 225 ? -45.992  107.842 1.525   1.00 11.82 ? 328 ASP D N   1 
ATOM   7845  C  CA  . ASP D  1 225 ? -46.741  108.387 2.665   1.00 12.20 ? 328 ASP D CA  1 
ATOM   7846  C  C   . ASP D  1 225 ? -48.232  107.996 2.484   1.00 12.57 ? 328 ASP D C   1 
ATOM   7847  O  O   . ASP D  1 225 ? -48.668  107.484 1.455   1.00 11.79 ? 328 ASP D O   1 
ATOM   7848  C  CB  . ASP D  1 225 ? -46.552  109.930 2.754   1.00 12.52 ? 328 ASP D CB  1 
ATOM   7849  C  CG  . ASP D  1 225 ? -46.879  110.617 4.216   1.00 13.23 ? 328 ASP D CG  1 
ATOM   7850  O  OD1 . ASP D  1 225 ? -47.281  109.906 5.127   1.00 13.09 ? 328 ASP D OD1 1 
ATOM   7851  O  OD2 . ASP D  1 225 ? -46.758  111.855 4.146   1.00 15.91 ? 328 ASP D OD2 1 
ATOM   7852  N  N   . ASN D  1 226 ? -48.977  108.288 3.513   1.00 12.45 ? 329 ASN D N   1 
ATOM   7853  C  CA  . ASN D  1 226 ? -50.446  108.337 3.497   1.00 13.69 ? 329 ASN D CA  1 
ATOM   7854  C  C   . ASN D  1 226 ? -51.142  107.084 2.963   1.00 12.82 ? 329 ASN D C   1 
ATOM   7855  O  O   . ASN D  1 226 ? -52.007  107.154 2.094   1.00 13.33 ? 329 ASN D O   1 
ATOM   7856  C  CB  . ASN D  1 226 ? -50.913  109.567 2.729   1.00 13.99 ? 329 ASN D CB  1 
ATOM   7857  C  CG  . ASN D  1 226 ? -50.451  110.859 3.374   1.00 14.83 ? 329 ASN D CG  1 
ATOM   7858  O  OD1 . ASN D  1 226 ? -50.723  111.121 4.555   1.00 15.80 ? 329 ASN D OD1 1 
ATOM   7859  N  ND2 . ASN D  1 226 ? -49.684  111.647 2.618   1.00 14.59 ? 329 ASN D ND2 1 
ATOM   7860  N  N   . PHE D  1 227 ? -50.730  105.953 3.498   1.00 12.20 ? 330 PHE D N   1 
ATOM   7861  C  CA  . PHE D  1 227 ? -51.261  104.665 3.109   1.00 11.79 ? 330 PHE D CA  1 
ATOM   7862  C  C   . PHE D  1 227 ? -52.648  104.504 3.702   1.00 12.32 ? 330 PHE D C   1 
ATOM   7863  O  O   . PHE D  1 227 ? -52.904  104.934 4.821   1.00 11.85 ? 330 PHE D O   1 
ATOM   7864  C  CB  . PHE D  1 227 ? -50.408  103.535 3.629   1.00 11.35 ? 330 PHE D CB  1 
ATOM   7865  C  CG  . PHE D  1 227 ? -49.053  103.457 3.051   1.00 10.96 ? 330 PHE D CG  1 
ATOM   7866  C  CD1 . PHE D  1 227 ? -47.994  104.157 3.639   1.00 11.71 ? 330 PHE D CD1 1 
ATOM   7867  C  CD2 . PHE D  1 227 ? -48.776  102.629 1.989   1.00 11.05 ? 330 PHE D CD2 1 
ATOM   7868  C  CE1 . PHE D  1 227 ? -46.691  104.016 3.162   1.00 11.51 ? 330 PHE D CE1 1 
ATOM   7869  C  CE2 . PHE D  1 227 ? -47.492  102.509 1.484   1.00 10.86 ? 330 PHE D CE2 1 
ATOM   7870  C  CZ  . PHE D  1 227 ? -46.444  103.189 2.082   1.00 11.14 ? 330 PHE D CZ  1 
ATOM   7871  N  N   . LEU D  1 228 ? -53.560  103.973 2.897   1.00 13.12 ? 331 LEU D N   1 
ATOM   7872  C  CA  . LEU D  1 228 ? -54.947  103.741 3.326   1.00 13.63 ? 331 LEU D CA  1 
ATOM   7873  C  C   . LEU D  1 228 ? -55.498  102.473 2.675   1.00 14.76 ? 331 LEU D C   1 
ATOM   7874  O  O   . LEU D  1 228 ? -55.383  102.287 1.446   1.00 15.68 ? 331 LEU D O   1 
ATOM   7875  C  CB  . LEU D  1 228 ? -55.849  104.903 2.968   1.00 13.13 ? 331 LEU D CB  1 
ATOM   7876  C  CG  . LEU D  1 228 ? -57.334  104.660 3.256   1.00 13.06 ? 331 LEU D CG  1 
ATOM   7877  C  CD1 . LEU D  1 228 ? -57.592  104.705 4.765   1.00 12.91 ? 331 LEU D CD1 1 
ATOM   7878  C  CD2 . LEU D  1 228 ? -58.181  105.662 2.555   1.00 12.32 ? 331 LEU D CD2 1 
ATOM   7879  N  N   . ILE D  1 229 ? -56.004  101.572 3.505   1.00 15.02 ? 332 ILE D N   1 
ATOM   7880  C  CA  . ILE D  1 229 ? -56.792  100.441 3.032   1.00 16.10 ? 332 ILE D CA  1 
ATOM   7881  C  C   . ILE D  1 229 ? -58.153  100.525 3.664   1.00 16.39 ? 332 ILE D C   1 
ATOM   7882  O  O   . ILE D  1 229 ? -58.279  100.567 4.889   1.00 17.95 ? 332 ILE D O   1 
ATOM   7883  C  CB  . ILE D  1 229 ? -56.159  99.121  3.338   1.00 18.00 ? 332 ILE D CB  1 
ATOM   7884  C  CG1 . ILE D  1 229 ? -54.698  99.229  2.963   1.00 18.50 ? 332 ILE D CG1 1 
ATOM   7885  C  CG2 . ILE D  1 229 ? -56.867  98.010  2.593   1.00 19.03 ? 332 ILE D CG2 1 
ATOM   7886  C  CD1 . ILE D  1 229 ? -54.020  97.959  2.617   1.00 20.94 ? 332 ILE D CD1 1 
ATOM   7887  N  N   . THR D  1 230 ? -59.159  100.602 2.809   1.00 15.16 ? 333 THR D N   1 
ATOM   7888  C  CA  . THR D  1 230 ? -60.525  100.849 3.215   1.00 15.28 ? 333 THR D CA  1 
ATOM   7889  C  C   . THR D  1 230 ? -61.527  100.075 2.308   1.00 16.31 ? 333 THR D C   1 
ATOM   7890  O  O   . THR D  1 230 ? -61.143  99.459  1.293   1.00 14.35 ? 333 THR D O   1 
ATOM   7891  C  CB  . THR D  1 230 ? -60.837  102.381 3.231   1.00 15.45 ? 333 THR D CB  1 
ATOM   7892  O  OG1 . THR D  1 230 ? -62.120  102.640 3.838   1.00 14.74 ? 333 THR D OG1 1 
ATOM   7893  C  CG2 . THR D  1 230 ? -60.819  102.976 1.862   1.00 15.40 ? 333 THR D CG2 1 
ATOM   7894  N  N   . ASN D  1 231 ? -62.803  100.149 2.671   1.00 16.85 ? 334 ASN D N   1 
ATOM   7895  C  CA  . ASN D  1 231 ? -63.875  99.536  1.860   1.00 18.29 ? 334 ASN D CA  1 
ATOM   7896  C  C   . ASN D  1 231 ? -64.811  100.551 1.291   1.00 18.64 ? 334 ASN D C   1 
ATOM   7897  O  O   . ASN D  1 231 ? -65.817  100.218 0.714   1.00 19.20 ? 334 ASN D O   1 
ATOM   7898  C  CB  . ASN D  1 231 ? -64.658  98.500  2.678   1.00 17.87 ? 334 ASN D CB  1 
ATOM   7899  C  CG  . ASN D  1 231 ? -65.526  99.131  3.745   1.00 18.41 ? 334 ASN D CG  1 
ATOM   7900  O  OD1 . ASN D  1 231 ? -65.439  100.330 4.037   1.00 17.36 ? 334 ASN D OD1 1 
ATOM   7901  N  ND2 . ASN D  1 231 ? -66.372  98.324  4.342   1.00 18.50 ? 334 ASN D ND2 1 
ATOM   7902  N  N   . ASP D  1 232 ? -64.425  101.819 1.383   1.00 21.46 ? 335 ASP D N   1 
ATOM   7903  C  CA  . ASP D  1 232 ? -65.270  102.933 0.958   1.00 22.47 ? 335 ASP D CA  1 
ATOM   7904  C  C   . ASP D  1 232 ? -64.503  103.852 -0.030  1.00 21.69 ? 335 ASP D C   1 
ATOM   7905  O  O   . ASP D  1 232 ? -63.577  104.568 0.362   1.00 21.32 ? 335 ASP D O   1 
ATOM   7906  C  CB  . ASP D  1 232 ? -65.715  103.682 2.224   1.00 25.49 ? 335 ASP D CB  1 
ATOM   7907  C  CG  . ASP D  1 232 ? -66.791  104.708 1.979   1.00 29.57 ? 335 ASP D CG  1 
ATOM   7908  O  OD1 . ASP D  1 232 ? -66.855  105.346 0.926   1.00 32.47 ? 335 ASP D OD1 1 
ATOM   7909  O  OD2 . ASP D  1 232 ? -67.582  104.923 2.896   1.00 41.29 ? 335 ASP D OD2 1 
ATOM   7910  N  N   . GLU D  1 233 ? -64.975  103.891 -1.266  1.00 20.45 ? 336 GLU D N   1 
ATOM   7911  C  CA  . GLU D  1 233 ? -64.416  104.742 -2.330  1.00 20.36 ? 336 GLU D CA  1 
ATOM   7912  C  C   . GLU D  1 233 ? -64.491  106.218 -2.021  1.00 18.28 ? 336 GLU D C   1 
ATOM   7913  O  O   . GLU D  1 233 ? -63.563  106.957 -2.260  1.00 16.19 ? 336 GLU D O   1 
ATOM   7914  C  CB  . GLU D  1 233 ? -65.146  104.596 -3.664  1.00 21.45 ? 336 GLU D CB  1 
ATOM   7915  C  CG  . GLU D  1 233 ? -65.221  103.174 -4.192  1.00 24.42 ? 336 GLU D CG  1 
ATOM   7916  C  CD  . GLU D  1 233 ? -65.877  103.071 -5.573  1.00 26.66 ? 336 GLU D CD  1 
ATOM   7917  O  OE1 . GLU D  1 233 ? -65.703  103.983 -6.420  1.00 27.68 ? 336 GLU D OE1 1 
ATOM   7918  O  OE2 . GLU D  1 233 ? -66.580  102.074 -5.825  1.00 30.89 ? 336 GLU D OE2 1 
ATOM   7919  N  N   . ALA D  1 234 ? -65.632  106.646 -1.516  1.00 17.94 ? 337 ALA D N   1 
ATOM   7920  C  CA  . ALA D  1 234 ? -65.829  108.038 -1.156  1.00 16.75 ? 337 ALA D CA  1 
ATOM   7921  C  C   . ALA D  1 234 ? -64.867  108.452 -0.039  1.00 15.21 ? 337 ALA D C   1 
ATOM   7922  O  O   . ALA D  1 234 ? -64.265  109.503 -0.103  1.00 15.93 ? 337 ALA D O   1 
ATOM   7923  C  CB  . ALA D  1 234 ? -67.265  108.277 -0.722  1.00 16.71 ? 337 ALA D CB  1 
ATOM   7924  N  N   . TYR D  1 235 ? -64.731  107.635 0.975   1.00 13.52 ? 338 TYR D N   1 
ATOM   7925  C  CA  . TYR D  1 235 ? -63.795  107.926 2.021   1.00 13.96 ? 338 TYR D CA  1 
ATOM   7926  C  C   . TYR D  1 235 ? -62.348  108.006 1.477   1.00 14.03 ? 338 TYR D C   1 
ATOM   7927  O  O   . TYR D  1 235 ? -61.574  108.899 1.863   1.00 13.02 ? 338 TYR D O   1 
ATOM   7928  C  CB  . TYR D  1 235 ? -63.856  106.932 3.165   1.00 13.80 ? 338 TYR D CB  1 
ATOM   7929  C  CG  . TYR D  1 235 ? -62.922  107.330 4.264   1.00 15.62 ? 338 TYR D CG  1 
ATOM   7930  C  CD1 . TYR D  1 235 ? -63.117  108.518 4.949   1.00 17.06 ? 338 TYR D CD1 1 
ATOM   7931  C  CD2 . TYR D  1 235 ? -61.826  106.550 4.613   1.00 16.18 ? 338 TYR D CD2 1 
ATOM   7932  C  CE1 . TYR D  1 235 ? -62.259  108.906 5.951   1.00 18.76 ? 338 TYR D CE1 1 
ATOM   7933  C  CE2 . TYR D  1 235 ? -60.980  106.918 5.629   1.00 18.13 ? 338 TYR D CE2 1 
ATOM   7934  C  CZ  . TYR D  1 235 ? -61.185  108.103 6.273   1.00 19.70 ? 338 TYR D CZ  1 
ATOM   7935  O  OH  . TYR D  1 235 ? -60.327  108.489 7.283   1.00 24.71 ? 338 TYR D OH  1 
ATOM   7936  N  N   . ALA D  1 236 ? -61.972  107.056 0.643   1.00 13.98 ? 339 ALA D N   1 
ATOM   7937  C  CA  . ALA D  1 236 ? -60.655  107.116 0.030   1.00 15.58 ? 339 ALA D CA  1 
ATOM   7938  C  C   . ALA D  1 236 ? -60.429  108.463 -0.675  1.00 15.46 ? 339 ALA D C   1 
ATOM   7939  O  O   . ALA D  1 236 ? -59.350  109.036 -0.577  1.00 15.24 ? 339 ALA D O   1 
ATOM   7940  C  CB  . ALA D  1 236 ? -60.496  106.021 -0.965  1.00 16.21 ? 339 ALA D CB  1 
ATOM   7941  N  N   . GLU D  1 237 ? -61.433  108.935 -1.387  1.00 15.70 ? 340 GLU D N   1 
ATOM   7942  C  CA  . GLU D  1 237 ? -61.333  110.191 -2.114  1.00 17.87 ? 340 GLU D CA  1 
ATOM   7943  C  C   . GLU D  1 237 ? -61.182  111.388 -1.125  1.00 17.68 ? 340 GLU D C   1 
ATOM   7944  O  O   . GLU D  1 237 ? -60.389  112.277 -1.355  1.00 16.93 ? 340 GLU D O   1 
ATOM   7945  C  CB  . GLU D  1 237 ? -62.546  110.416 -3.010  1.00 20.45 ? 340 GLU D CB  1 
ATOM   7946  C  CG  . GLU D  1 237 ? -62.373  111.645 -3.875  1.00 25.54 ? 340 GLU D CG  1 
ATOM   7947  C  CD  . GLU D  1 237 ? -63.325  111.794 -5.055  1.00 28.72 ? 340 GLU D CD  1 
ATOM   7948  O  OE1 . GLU D  1 237 ? -64.044  110.816 -5.308  1.00 32.38 ? 340 GLU D OE1 1 
ATOM   7949  O  OE2 . GLU D  1 237 ? -63.369  112.882 -5.720  1.00 31.53 ? 340 GLU D OE2 1 
ATOM   7950  N  N   . GLU D  1 238 ? -61.948  111.374 -0.039  1.00 16.89 ? 341 GLU D N   1 
ATOM   7951  C  CA  . GLU D  1 238 ? -61.825  112.362 0.996   1.00 17.63 ? 341 GLU D CA  1 
ATOM   7952  C  C   . GLU D  1 238 ? -60.436  112.407 1.573   1.00 17.10 ? 341 GLU D C   1 
ATOM   7953  O  O   . GLU D  1 238 ? -59.868  113.474 1.730   1.00 19.38 ? 341 GLU D O   1 
ATOM   7954  C  CB  . GLU D  1 238 ? -62.768  112.085 2.171   1.00 19.50 ? 341 GLU D CB  1 
ATOM   7955  C  CG  . GLU D  1 238 ? -64.232  112.259 1.854   1.00 23.95 ? 341 GLU D CG  1 
ATOM   7956  C  CD  . GLU D  1 238 ? -65.198  111.664 2.912   1.00 26.65 ? 341 GLU D CD  1 
ATOM   7957  O  OE1 . GLU D  1 238 ? -64.794  111.591 4.102   1.00 29.88 ? 341 GLU D OE1 1 
ATOM   7958  O  OE2 . GLU D  1 238 ? -66.371  111.343 2.550   1.00 25.19 ? 341 GLU D OE2 1 
ATOM   7959  N  N   . PHE D  1 239 ? -59.946  111.254 1.983   1.00 14.68 ? 342 PHE D N   1 
ATOM   7960  C  CA  . PHE D  1 239 ? -58.654  111.137 2.617   1.00 15.75 ? 342 PHE D CA  1 
ATOM   7961  C  C   . PHE D  1 239 ? -57.537  111.584 1.649   1.00 14.82 ? 342 PHE D C   1 
ATOM   7962  O  O   . PHE D  1 239 ? -56.556  112.195 2.042   1.00 14.39 ? 342 PHE D O   1 
ATOM   7963  C  CB  . PHE D  1 239 ? -58.411  109.687 3.040   1.00 16.07 ? 342 PHE D CB  1 
ATOM   7964  C  CG  . PHE D  1 239 ? -57.181  109.478 3.890   1.00 15.97 ? 342 PHE D CG  1 
ATOM   7965  C  CD1 . PHE D  1 239 ? -57.068  110.082 5.107   1.00 15.55 ? 342 PHE D CD1 1 
ATOM   7966  C  CD2 . PHE D  1 239 ? -56.158  108.641 3.462   1.00 16.97 ? 342 PHE D CD2 1 
ATOM   7967  C  CE1 . PHE D  1 239 ? -55.955  109.887 5.888   1.00 16.86 ? 342 PHE D CE1 1 
ATOM   7968  C  CE2 . PHE D  1 239 ? -55.032  108.428 4.260   1.00 17.80 ? 342 PHE D CE2 1 
ATOM   7969  C  CZ  . PHE D  1 239 ? -54.930  109.053 5.479   1.00 17.33 ? 342 PHE D CZ  1 
ATOM   7970  N  N   . GLY D  1 240 ? -57.720  111.273 0.383   1.00 14.07 ? 343 GLY D N   1 
ATOM   7971  C  CA  . GLY D  1 240 ? -56.822  111.714 -0.677  1.00 13.96 ? 343 GLY D CA  1 
ATOM   7972  C  C   . GLY D  1 240 ? -56.771  113.230 -0.728  1.00 13.90 ? 343 GLY D C   1 
ATOM   7973  O  O   . GLY D  1 240 ? -55.690  113.797 -0.811  1.00 13.49 ? 343 GLY D O   1 
ATOM   7974  N  N   . ASN D  1 241 ? -57.935  113.884 -0.645  1.00 13.49 ? 344 ASN D N   1 
ATOM   7975  C  CA  . ASN D  1 241 ? -57.973  115.338 -0.658  1.00 14.48 ? 344 ASN D CA  1 
ATOM   7976  C  C   . ASN D  1 241 ? -57.467  116.008 0.611   1.00 16.33 ? 344 ASN D C   1 
ATOM   7977  O  O   . ASN D  1 241 ? -57.014  117.154 0.565   1.00 20.00 ? 344 ASN D O   1 
ATOM   7978  C  CB  . ASN D  1 241 ? -59.367  115.856 -1.034  1.00 13.48 ? 344 ASN D CB  1 
ATOM   7979  C  CG  . ASN D  1 241 ? -59.679  115.618 -2.510  1.00 13.13 ? 344 ASN D CG  1 
ATOM   7980  O  OD1 . ASN D  1 241 ? -58.774  115.482 -3.303  1.00 12.70 ? 344 ASN D OD1 1 
ATOM   7981  N  ND2 . ASN D  1 241 ? -60.944  115.549 -2.865  1.00 13.40 ? 344 ASN D ND2 1 
ATOM   7982  N  N   . GLU D  1 242 ? -57.517  115.277 1.725   1.00 17.98 ? 345 GLU D N   1 
ATOM   7983  C  CA  . GLU D  1 242 ? -57.018  115.736 3.014   1.00 19.34 ? 345 GLU D CA  1 
ATOM   7984  C  C   . GLU D  1 242 ? -55.531  115.484 3.146   1.00 18.35 ? 345 GLU D C   1 
ATOM   7985  O  O   . GLU D  1 242 ? -54.915  116.014 4.064   1.00 21.46 ? 345 GLU D O   1 
ATOM   7986  C  CB  . GLU D  1 242 ? -57.736  115.033 4.174   1.00 23.54 ? 345 GLU D CB  1 
ATOM   7987  C  CG  . GLU D  1 242 ? -59.098  115.659 4.582   1.00 28.08 ? 345 GLU D CG  1 
ATOM   7988  C  CD  . GLU D  1 242 ? -60.037  114.720 5.362   1.00 29.67 ? 345 GLU D CD  1 
ATOM   7989  O  OE1 . GLU D  1 242 ? -59.792  113.479 5.418   1.00 37.25 ? 345 GLU D OE1 1 
ATOM   7990  O  OE2 . GLU D  1 242 ? -61.041  115.212 5.941   1.00 33.21 ? 345 GLU D OE2 1 
ATOM   7991  N  N   . THR D  1 243 ? -54.957  114.662 2.268   1.00 15.34 ? 346 THR D N   1 
ATOM   7992  C  CA  . THR D  1 243 ? -53.540  114.345 2.331   1.00 14.38 ? 346 THR D CA  1 
ATOM   7993  C  C   . THR D  1 243 ? -52.791  114.922 1.115   1.00 13.82 ? 346 THR D C   1 
ATOM   7994  O  O   . THR D  1 243 ? -52.227  115.996 1.197   1.00 13.40 ? 346 THR D O   1 
ATOM   7995  C  CB  . THR D  1 243 ? -53.294  112.823 2.510   1.00 15.08 ? 346 THR D CB  1 
ATOM   7996  O  OG1 . THR D  1 243 ? -53.928  112.099 1.465   1.00 13.52 ? 346 THR D OG1 1 
ATOM   7997  C  CG2 . THR D  1 243 ? -53.842  112.344 3.878   1.00 15.13 ? 346 THR D CG2 1 
ATOM   7998  N  N   . TRP D  1 244 ? -52.798  114.204 -0.007  1.00 13.30 ? 347 TRP D N   1 
ATOM   7999  C  CA  . TRP D  1 244 ? -52.235  114.676 -1.250  1.00 12.36 ? 347 TRP D CA  1 
ATOM   8000  C  C   . TRP D  1 244 ? -52.735  116.075 -1.592  1.00 11.42 ? 347 TRP D C   1 
ATOM   8001  O  O   . TRP D  1 244 ? -51.979  116.957 -2.009  1.00 9.85  ? 347 TRP D O   1 
ATOM   8002  C  CB  . TRP D  1 244 ? -52.508  113.690 -2.388  1.00 12.26 ? 347 TRP D CB  1 
ATOM   8003  C  CG  . TRP D  1 244 ? -52.293  114.286 -3.755  1.00 12.45 ? 347 TRP D CG  1 
ATOM   8004  C  CD1 . TRP D  1 244 ? -51.121  114.463 -4.394  1.00 13.05 ? 347 TRP D CD1 1 
ATOM   8005  C  CD2 . TRP D  1 244 ? -53.302  114.837 -4.614  1.00 12.15 ? 347 TRP D CD2 1 
ATOM   8006  N  NE1 . TRP D  1 244 ? -51.339  115.092 -5.613  1.00 12.96 ? 347 TRP D NE1 1 
ATOM   8007  C  CE2 . TRP D  1 244 ? -52.671  115.303 -5.773  1.00 12.02 ? 347 TRP D CE2 1 
ATOM   8008  C  CE3 . TRP D  1 244 ? -54.699  114.939 -4.520  1.00 12.45 ? 347 TRP D CE3 1 
ATOM   8009  C  CZ2 . TRP D  1 244 ? -53.372  115.912 -6.824  1.00 12.27 ? 347 TRP D CZ2 1 
ATOM   8010  C  CZ3 . TRP D  1 244 ? -55.405  115.510 -5.590  1.00 11.54 ? 347 TRP D CZ3 1 
ATOM   8011  C  CH2 . TRP D  1 244 ? -54.741  116.004 -6.704  1.00 11.43 ? 347 TRP D CH2 1 
ATOM   8012  N  N   . GLY D  1 245 ? -54.010  116.268 -1.401  1.00 11.28 ? 348 GLY D N   1 
ATOM   8013  C  CA  . GLY D  1 245 ? -54.651  117.500 -1.789  1.00 11.33 ? 348 GLY D CA  1 
ATOM   8014  C  C   . GLY D  1 245 ? -54.259  118.677 -0.954  1.00 11.73 ? 348 GLY D C   1 
ATOM   8015  O  O   . GLY D  1 245 ? -54.442  119.819 -1.366  1.00 12.07 ? 348 GLY D O   1 
ATOM   8016  N  N   . VAL D  1 246 ? -53.745  118.411 0.220   1.00 12.72 ? 349 VAL D N   1 
ATOM   8017  C  CA  . VAL D  1 246 ? -53.237  119.435 1.105   1.00 14.69 ? 349 VAL D CA  1 
ATOM   8018  C  C   . VAL D  1 246 ? -51.720  119.675 0.874   1.00 15.53 ? 349 VAL D C   1 
ATOM   8019  O  O   . VAL D  1 246 ? -51.221  120.748 1.127   1.00 15.68 ? 349 VAL D O   1 
ATOM   8020  C  CB  . VAL D  1 246 ? -53.533  119.039 2.568   1.00 16.36 ? 349 VAL D CB  1 
ATOM   8021  C  CG1 . VAL D  1 246 ? -52.759  119.890 3.585   1.00 16.23 ? 349 VAL D CG1 1 
ATOM   8022  C  CG2 . VAL D  1 246 ? -55.027  119.209 2.827   1.00 17.37 ? 349 VAL D CG2 1 
ATOM   8023  N  N   . THR D  1 247 ? -51.004  118.636 0.466   1.00 15.93 ? 350 THR D N   1 
ATOM   8024  C  CA  . THR D  1 247 ? -49.591  118.701 0.167   1.00 18.07 ? 350 THR D CA  1 
ATOM   8025  C  C   . THR D  1 247 ? -49.290  119.531 -1.094  1.00 18.57 ? 350 THR D C   1 
ATOM   8026  O  O   . THR D  1 247 ? -48.391  120.355 -1.121  1.00 15.91 ? 350 THR D O   1 
ATOM   8027  C  CB  . THR D  1 247 ? -49.058  117.278 -0.119  1.00 18.37 ? 350 THR D CB  1 
ATOM   8028  O  OG1 . THR D  1 247 ? -49.202  116.486 1.066   1.00 20.36 ? 350 THR D OG1 1 
ATOM   8029  C  CG2 . THR D  1 247 ? -47.589  117.278 -0.526  1.00 18.62 ? 350 THR D CG2 1 
ATOM   8030  N  N   . LYS D  1 248 ? -50.093  119.265 -2.108  1.00 18.62 ? 351 LYS D N   1 
ATOM   8031  C  CA  . LYS D  1 248 ? -49.854  119.614 -3.499  1.00 20.30 ? 351 LYS D CA  1 
ATOM   8032  C  C   . LYS D  1 248 ? -49.329  121.039 -3.844  1.00 18.88 ? 351 LYS D C   1 
ATOM   8033  O  O   . LYS D  1 248 ? -48.248  121.184 -4.391  1.00 18.40 ? 351 LYS D O   1 
ATOM   8034  C  CB  . LYS D  1 248 ? -51.191  119.338 -4.193  1.00 24.28 ? 351 LYS D CB  1 
ATOM   8035  C  CG  . LYS D  1 248 ? -51.399  119.700 -5.636  1.00 29.62 ? 351 LYS D CG  1 
ATOM   8036  C  CD  . LYS D  1 248 ? -52.854  119.324 -5.952  1.00 35.67 ? 351 LYS D CD  1 
ATOM   8037  C  CE  . LYS D  1 248 ? -53.382  119.770 -7.313  1.00 37.69 ? 351 LYS D CE  1 
ATOM   8038  N  NZ  . LYS D  1 248 ? -52.965  121.145 -7.655  1.00 41.19 ? 351 LYS D NZ  1 
ATOM   8039  N  N   . ALA D  1 249 ? -50.108  122.057 -3.527  1.00 16.57 ? 352 ALA D N   1 
ATOM   8040  C  CA  . ALA D  1 249 ? -49.829  123.420 -3.938  1.00 16.19 ? 352 ALA D CA  1 
ATOM   8041  C  C   . ALA D  1 249 ? -48.611  124.035 -3.230  1.00 16.10 ? 352 ALA D C   1 
ATOM   8042  O  O   . ALA D  1 249 ? -47.777  124.680 -3.858  1.00 18.12 ? 352 ALA D O   1 
ATOM   8043  C  CB  . ALA D  1 249 ? -51.068  124.313 -3.725  1.00 15.76 ? 352 ALA D CB  1 
ATOM   8044  N  N   . ALA D  1 250 ? -48.520  123.837 -1.928  1.00 15.17 ? 353 ALA D N   1 
ATOM   8045  C  CA  . ALA D  1 250 ? -47.397  124.328 -1.145  1.00 15.17 ? 353 ALA D CA  1 
ATOM   8046  C  C   . ALA D  1 250 ? -46.109  123.624 -1.563  1.00 15.17 ? 353 ALA D C   1 
ATOM   8047  O  O   . ALA D  1 250 ? -45.078  124.243 -1.626  1.00 15.39 ? 353 ALA D O   1 
ATOM   8048  C  CB  . ALA D  1 250 ? -47.673  124.157 0.348   1.00 14.84 ? 353 ALA D CB  1 
ATOM   8049  N  N   . GLU D  1 251 ? -46.166  122.318 -1.796  1.00 14.61 ? 354 GLU D N   1 
ATOM   8050  C  CA  . GLU D  1 251 ? -45.003  121.567 -2.262  1.00 14.75 ? 354 GLU D CA  1 
ATOM   8051  C  C   . GLU D  1 251 ? -44.441  122.175 -3.562  1.00 14.80 ? 354 GLU D C   1 
ATOM   8052  O  O   . GLU D  1 251 ? -43.250  122.376 -3.728  1.00 12.87 ? 354 GLU D O   1 
ATOM   8053  C  CB  . GLU D  1 251 ? -45.374  120.087 -2.476  1.00 14.78 ? 354 GLU D CB  1 
ATOM   8054  C  CG  . GLU D  1 251 ? -44.294  119.203 -3.048  1.00 15.05 ? 354 GLU D CG  1 
ATOM   8055  C  CD  . GLU D  1 251 ? -44.721  117.730 -3.250  1.00 16.15 ? 354 GLU D CD  1 
ATOM   8056  O  OE1 . GLU D  1 251 ? -45.398  117.436 -4.259  1.00 17.31 ? 354 GLU D OE1 1 
ATOM   8057  O  OE2 . GLU D  1 251 ? -44.366  116.847 -2.406  1.00 15.97 ? 354 GLU D OE2 1 
ATOM   8058  N  N   . LYS D  1 252 ? -45.332  122.406 -4.501  1.00 16.40 ? 355 LYS D N   1 
ATOM   8059  C  CA  . LYS D  1 252 ? -45.000  122.955 -5.808  1.00 17.26 ? 355 LYS D CA  1 
ATOM   8060  C  C   . LYS D  1 252 ? -44.431  124.384 -5.667  1.00 17.02 ? 355 LYS D C   1 
ATOM   8061  O  O   . LYS D  1 252 ? -43.455  124.745 -6.324  1.00 15.55 ? 355 LYS D O   1 
ATOM   8062  C  CB  . LYS D  1 252 ? -46.267  122.973 -6.660  1.00 19.12 ? 355 LYS D CB  1 
ATOM   8063  C  CG  . LYS D  1 252 ? -46.177  123.668 -7.988  1.00 20.26 ? 355 LYS D CG  1 
ATOM   8064  C  CD  . LYS D  1 252 ? -45.390  122.833 -8.963  1.00 24.18 ? 355 LYS D CD  1 
ATOM   8065  C  CE  . LYS D  1 252 ? -45.219  123.630 -10.282 1.00 26.71 ? 355 LYS D CE  1 
ATOM   8066  N  NZ  . LYS D  1 252 ? -44.528  122.837 -11.320 1.00 28.10 ? 355 LYS D NZ  1 
ATOM   8067  N  N   . GLN D  1 253 ? -45.017  125.180 -4.775  1.00 17.09 ? 356 GLN D N   1 
ATOM   8068  C  CA  . GLN D  1 253 ? -44.518  126.524 -4.509  1.00 19.18 ? 356 GLN D CA  1 
ATOM   8069  C  C   . GLN D  1 253 ? -43.088  126.529 -3.923  1.00 19.93 ? 356 GLN D C   1 
ATOM   8070  O  O   . GLN D  1 253 ? -42.211  127.259 -4.364  1.00 19.16 ? 356 GLN D O   1 
ATOM   8071  C  CB  . GLN D  1 253 ? -45.486  127.205 -3.601  1.00 22.53 ? 356 GLN D CB  1 
ATOM   8072  C  CG  . GLN D  1 253 ? -45.346  128.689 -3.430  1.00 25.01 ? 356 GLN D CG  1 
ATOM   8073  C  CD  . GLN D  1 253 ? -46.302  129.244 -2.344  1.00 26.11 ? 356 GLN D CD  1 
ATOM   8074  O  OE1 . GLN D  1 253 ? -45.818  129.704 -1.375  1.00 33.76 ? 356 GLN D OE1 1 
ATOM   8075  N  NE2 . GLN D  1 253 ? -47.615  129.170 -2.498  1.00 26.61 ? 356 GLN D NE2 1 
ATOM   8076  N  N   . MET D  1 254 ? -42.850  125.688 -2.942  1.00 19.93 ? 357 MET D N   1 
ATOM   8077  C  CA  . MET D  1 254 ? -41.517  125.603 -2.354  1.00 20.19 ? 357 MET D CA  1 
ATOM   8078  C  C   . MET D  1 254 ? -40.506  125.142 -3.381  1.00 18.77 ? 357 MET D C   1 
ATOM   8079  O  O   . MET D  1 254 ? -39.374  125.599 -3.393  1.00 18.08 ? 357 MET D O   1 
ATOM   8080  C  CB  . MET D  1 254 ? -41.521  124.666 -1.150  1.00 19.65 ? 357 MET D CB  1 
ATOM   8081  C  CG  . MET D  1 254 ? -40.170  124.474 -0.521  1.00 19.71 ? 357 MET D CG  1 
ATOM   8082  S  SD  . MET D  1 254 ? -40.294  123.633 1.059   1.00 20.07 ? 357 MET D SD  1 
ATOM   8083  C  CE  . MET D  1 254 ? -38.572  123.664 1.586   1.00 20.90 ? 357 MET D CE  1 
ATOM   8084  N  N   . LYS D  1 255 ? -40.893  124.208 -4.237  1.00 18.37 ? 358 LYS D N   1 
ATOM   8085  C  CA  . LYS D  1 255 ? -39.955  123.682 -5.241  1.00 16.64 ? 358 LYS D CA  1 
ATOM   8086  C  C   . LYS D  1 255 ? -39.648  124.703 -6.346  1.00 16.87 ? 358 LYS D C   1 
ATOM   8087  O  O   . LYS D  1 255 ? -38.520  124.832 -6.775  1.00 17.60 ? 358 LYS D O   1 
ATOM   8088  C  CB  . LYS D  1 255 ? -40.478  122.403 -5.797  1.00 17.00 ? 358 LYS D CB  1 
ATOM   8089  C  CG  . LYS D  1 255 ? -39.702  121.851 -6.972  1.00 18.03 ? 358 LYS D CG  1 
ATOM   8090  C  CD  . LYS D  1 255 ? -38.319  121.378 -6.594  1.00 19.30 ? 358 LYS D CD  1 
ATOM   8091  C  CE  . LYS D  1 255 ? -37.727  120.815 -7.870  1.00 20.39 ? 358 LYS D CE  1 
ATOM   8092  N  NZ  . LYS D  1 255 ? -36.543  119.992 -7.663  1.00 21.58 ? 358 LYS D NZ  1 
ATOM   8093  N  N   . ASP D  1 256 ? -40.643  125.446 -6.785  1.00 17.99 ? 359 ASP D N   1 
ATOM   8094  C  CA  . ASP D  1 256 ? -40.415  126.517 -7.733  1.00 20.14 ? 359 ASP D CA  1 
ATOM   8095  C  C   . ASP D  1 256 ? -39.414  127.545 -7.205  1.00 21.18 ? 359 ASP D C   1 
ATOM   8096  O  O   . ASP D  1 256 ? -38.559  128.011 -7.928  1.00 21.57 ? 359 ASP D O   1 
ATOM   8097  C  CB  . ASP D  1 256 ? -41.731  127.241 -8.088  1.00 21.82 ? 359 ASP D CB  1 
ATOM   8098  C  CG  . ASP D  1 256 ? -42.708  126.356 -8.885  1.00 24.53 ? 359 ASP D CG  1 
ATOM   8099  O  OD1 . ASP D  1 256 ? -42.308  125.277 -9.440  1.00 21.90 ? 359 ASP D OD1 1 
ATOM   8100  O  OD2 . ASP D  1 256 ? -43.903  126.759 -8.925  1.00 30.78 ? 359 ASP D OD2 1 
ATOM   8101  N  N   . LYS D  1 257 ? -39.531  127.865 -5.931  1.00 21.79 ? 360 LYS D N   1 
ATOM   8102  C  CA  . LYS D  1 257 ? -38.670  128.832 -5.299  1.00 23.83 ? 360 LYS D CA  1 
ATOM   8103  C  C   . LYS D  1 257 ? -37.246  128.320 -5.279  1.00 23.54 ? 360 LYS D C   1 
ATOM   8104  O  O   . LYS D  1 257 ? -36.346  129.045 -5.624  1.00 21.39 ? 360 LYS D O   1 
ATOM   8105  C  CB  . LYS D  1 257 ? -39.163  129.131 -3.912  1.00 27.52 ? 360 LYS D CB  1 
ATOM   8106  C  CG  . LYS D  1 257 ? -38.421  130.214 -3.207  1.00 32.37 ? 360 LYS D CG  1 
ATOM   8107  C  CD  . LYS D  1 257 ? -38.989  130.335 -1.802  1.00 37.26 ? 360 LYS D CD  1 
ATOM   8108  C  CE  . LYS D  1 257 ? -37.980  130.988 -0.881  1.00 45.05 ? 360 LYS D CE  1 
ATOM   8109  N  NZ  . LYS D  1 257 ? -37.638  132.442 -1.007  1.00 48.35 ? 360 LYS D NZ  1 
ATOM   8110  N  N   . GLN D  1 258 ? -37.057  127.050 -4.934  1.00 23.17 ? 361 GLN D N   1 
ATOM   8111  C  CA  . GLN D  1 258 ? -35.718  126.460 -4.907  1.00 21.76 ? 361 GLN D CA  1 
ATOM   8112  C  C   . GLN D  1 258 ? -35.109  126.372 -6.292  1.00 21.31 ? 361 GLN D C   1 
ATOM   8113  O  O   . GLN D  1 258 ? -33.910  126.515 -6.437  1.00 18.23 ? 361 GLN D O   1 
ATOM   8114  C  CB  . GLN D  1 258 ? -35.726  125.060 -4.302  1.00 20.71 ? 361 GLN D CB  1 
ATOM   8115  C  CG  . GLN D  1 258 ? -36.159  124.990 -2.848  1.00 21.70 ? 361 GLN D CG  1 
ATOM   8116  C  CD  . GLN D  1 258 ? -36.180  123.569 -2.292  1.00 21.78 ? 361 GLN D CD  1 
ATOM   8117  O  OE1 . GLN D  1 258 ? -36.122  122.577 -3.034  1.00 22.35 ? 361 GLN D OE1 1 
ATOM   8118  N  NE2 . GLN D  1 258 ? -36.265  123.464 -0.974  1.00 20.04 ? 361 GLN D NE2 1 
ATOM   8119  N  N   . ASP D  1 259 ? -35.937  126.086 -7.293  1.00 22.36 ? 362 ASP D N   1 
ATOM   8120  C  CA  . ASP D  1 259 ? -35.474  126.010 -8.697  1.00 23.96 ? 362 ASP D CA  1 
ATOM   8121  C  C   . ASP D  1 259 ? -34.960  127.398 -9.164  1.00 24.99 ? 362 ASP D C   1 
ATOM   8122  O  O   . ASP D  1 259 ? -33.911  127.483 -9.762  1.00 23.95 ? 362 ASP D O   1 
ATOM   8123  C  CB  . ASP D  1 259 ? -36.575  125.551 -9.646  1.00 23.23 ? 362 ASP D CB  1 
ATOM   8124  C  CG  . ASP D  1 259 ? -36.892  124.063 -9.538  1.00 26.81 ? 362 ASP D CG  1 
ATOM   8125  O  OD1 . ASP D  1 259 ? -36.148  123.312 -8.853  1.00 29.76 ? 362 ASP D OD1 1 
ATOM   8126  O  OD2 . ASP D  1 259 ? -37.880  123.612 -10.179 1.00 26.35 ? 362 ASP D OD2 1 
ATOM   8127  N  N   . GLU D  1 260 ? -35.715  128.441 -8.872  1.00 25.67 ? 363 GLU D N   1 
ATOM   8128  C  CA  . GLU D  1 260 ? -35.287  129.799 -9.161  1.00 32.17 ? 363 GLU D CA  1 
ATOM   8129  C  C   . GLU D  1 260 ? -33.974  130.151 -8.496  1.00 31.86 ? 363 GLU D C   1 
ATOM   8130  O  O   . GLU D  1 260 ? -33.108  130.697 -9.148  1.00 30.57 ? 363 GLU D O   1 
ATOM   8131  C  CB  . GLU D  1 260 ? -36.256  130.790 -8.579  1.00 37.00 ? 363 GLU D CB  1 
ATOM   8132  C  CG  . GLU D  1 260 ? -37.720  130.570 -8.904  1.00 48.17 ? 363 GLU D CG  1 
ATOM   8133  C  CD  . GLU D  1 260 ? -38.267  131.621 -9.837  1.00 57.82 ? 363 GLU D CD  1 
ATOM   8134  O  OE1 . GLU D  1 260 ? -37.474  132.080 -10.713 1.00 70.84 ? 363 GLU D OE1 1 
ATOM   8135  O  OE2 . GLU D  1 260 ? -39.470  131.967 -9.691  1.00 58.77 ? 363 GLU D OE2 1 
ATOM   8136  N  N   . GLU D  1 261 ? -33.845  129.885 -7.198  1.00 29.66 ? 364 GLU D N   1 
ATOM   8137  C  CA  . GLU D  1 261 ? -32.567  130.187 -6.508  1.00 35.40 ? 364 GLU D CA  1 
ATOM   8138  C  C   . GLU D  1 261 ? -31.384  129.400 -7.104  1.00 32.45 ? 364 GLU D C   1 
ATOM   8139  O  O   . GLU D  1 261 ? -30.290  129.919 -7.268  1.00 32.48 ? 364 GLU D O   1 
ATOM   8140  C  CB  . GLU D  1 261 ? -32.595  129.928 -5.010  1.00 38.77 ? 364 GLU D CB  1 
ATOM   8141  C  CG  . GLU D  1 261 ? -33.672  130.614 -4.227  1.00 45.98 ? 364 GLU D CG  1 
ATOM   8142  C  CD  . GLU D  1 261 ? -34.014  129.991 -2.872  1.00 59.50 ? 364 GLU D CD  1 
ATOM   8143  O  OE1 . GLU D  1 261 ? -33.393  128.953 -2.485  1.00 63.89 ? 364 GLU D OE1 1 
ATOM   8144  O  OE2 . GLU D  1 261 ? -34.929  130.563 -2.202  1.00 65.35 ? 364 GLU D OE2 1 
ATOM   8145  N  N   . GLN D  1 262 ? -31.635  128.162 -7.463  1.00 30.67 ? 365 GLN D N   1 
ATOM   8146  C  CA  . GLN D  1 262 ? -30.636  127.348 -8.116  1.00 32.54 ? 365 GLN D CA  1 
ATOM   8147  C  C   . GLN D  1 262 ? -30.152  127.988 -9.414  1.00 31.69 ? 365 GLN D C   1 
ATOM   8148  O  O   . GLN D  1 262 ? -28.965  128.032 -9.676  1.00 32.74 ? 365 GLN D O   1 
ATOM   8149  C  CB  . GLN D  1 262 ? -31.220  125.969 -8.415  1.00 34.02 ? 365 GLN D CB  1 
ATOM   8150  C  CG  . GLN D  1 262 ? -30.214  124.936 -8.865  1.00 35.58 ? 365 GLN D CG  1 
ATOM   8151  C  CD  . GLN D  1 262 ? -29.048  124.759 -7.897  1.00 40.31 ? 365 GLN D CD  1 
ATOM   8152  O  OE1 . GLN D  1 262 ? -27.929  124.508 -8.335  1.00 40.51 ? 365 GLN D OE1 1 
ATOM   8153  N  NE2 . GLN D  1 262 ? -29.294  124.885 -6.593  1.00 41.31 ? 365 GLN D NE2 1 
ATOM   8154  N  N   . ARG D  1 263 ? -31.082  128.494 -10.224 1.00 33.15 ? 366 ARG D N   1 
ATOM   8155  C  CA  . ARG D  1 263 ? -30.766  129.114 -11.523 1.00 32.62 ? 366 ARG D CA  1 
ATOM   8156  C  C   . ARG D  1 263 ? -29.846  130.333 -11.359 1.00 36.53 ? 366 ARG D C   1 
ATOM   8157  O  O   . ARG D  1 263 ? -29.228  130.769 -12.308 1.00 43.51 ? 366 ARG D O   1 
ATOM   8158  C  CB  . ARG D  1 263 ? -32.061  129.519 -12.260 1.00 30.30 ? 366 ARG D CB  1 
ATOM   8159  N  N   . LEU D  1 264 ? -29.722  130.855 -10.145 1.00 36.04 ? 367 LEU D N   1 
ATOM   8160  C  CA  . LEU D  1 264 ? -29.364  132.232 -9.934  1.00 34.74 ? 367 LEU D CA  1 
ATOM   8161  C  C   . LEU D  1 264 ? -28.270  132.424 -8.860  1.00 33.48 ? 367 LEU D C   1 
ATOM   8162  O  O   . LEU D  1 264 ? -27.409  131.545 -8.663  1.00 31.87 ? 367 LEU D O   1 
ATOM   8163  C  CB  . LEU D  1 264 ? -30.697  132.820 -9.536  1.00 33.50 ? 367 LEU D CB  1 
ATOM   8164  C  CG  . LEU D  1 264 ? -30.949  134.282 -9.329  1.00 34.25 ? 367 LEU D CG  1 
ATOM   8165  C  CD1 . LEU D  1 264 ? -31.411  134.746 -10.682 1.00 35.01 ? 367 LEU D CD1 1 
ATOM   8166  C  CD2 . LEU D  1 264 ? -31.978  134.631 -8.238  1.00 36.46 ? 367 LEU D CD2 1 
ATOM   8167  N  N   . PRO E  1 10  ? -64.727  49.693  40.632  1.00 28.75 ? 19  PRO E N   1 
ATOM   8168  C  CA  . PRO E  1 10  ? -64.200  50.892  39.957  1.00 27.46 ? 19  PRO E CA  1 
ATOM   8169  C  C   . PRO E  1 10  ? -63.479  51.831  40.849  1.00 26.13 ? 19  PRO E C   1 
ATOM   8170  O  O   . PRO E  1 10  ? -63.934  52.122  41.933  1.00 27.27 ? 19  PRO E O   1 
ATOM   8171  C  CB  . PRO E  1 10  ? -65.440  51.639  39.455  1.00 29.48 ? 19  PRO E CB  1 
ATOM   8172  C  CG  . PRO E  1 10  ? -66.651  50.902  39.962  1.00 30.60 ? 19  PRO E CG  1 
ATOM   8173  C  CD  . PRO E  1 10  ? -66.205  49.588  40.555  1.00 29.46 ? 19  PRO E CD  1 
ATOM   8174  N  N   . ALA E  1 11  ? -62.353  52.331  40.378  1.00 26.10 ? 20  ALA E N   1 
ATOM   8175  C  CA  . ALA E  1 11  ? -61.572  53.287  41.145  1.00 25.45 ? 20  ALA E CA  1 
ATOM   8176  C  C   . ALA E  1 11  ? -62.061  54.672  40.803  1.00 26.42 ? 20  ALA E C   1 
ATOM   8177  O  O   . ALA E  1 11  ? -62.245  55.008  39.637  1.00 27.93 ? 20  ALA E O   1 
ATOM   8178  C  CB  . ALA E  1 11  ? -60.099  53.167  40.827  1.00 26.95 ? 20  ALA E CB  1 
ATOM   8179  N  N   . VAL E  1 12  ? -62.310  55.469  41.834  1.00 25.88 ? 21  VAL E N   1 
ATOM   8180  C  CA  . VAL E  1 12  ? -62.731  56.850  41.667  1.00 24.04 ? 21  VAL E CA  1 
ATOM   8181  C  C   . VAL E  1 12  ? -61.605  57.681  42.188  1.00 21.88 ? 21  VAL E C   1 
ATOM   8182  O  O   . VAL E  1 12  ? -61.442  57.780  43.369  1.00 21.55 ? 21  VAL E O   1 
ATOM   8183  C  CB  . VAL E  1 12  ? -64.037  57.153  42.429  1.00 24.70 ? 21  VAL E CB  1 
ATOM   8184  C  CG1 . VAL E  1 12  ? -64.458  58.589  42.207  1.00 26.33 ? 21  VAL E CG1 1 
ATOM   8185  C  CG2 . VAL E  1 12  ? -65.150  56.232  41.970  1.00 24.22 ? 21  VAL E CG2 1 
ATOM   8186  N  N   . TYR E  1 13  ? -60.795  58.242  41.308  1.00 20.35 ? 22  TYR E N   1 
ATOM   8187  C  CA  . TYR E  1 13  ? -59.664  59.036  41.736  1.00 20.21 ? 22  TYR E CA  1 
ATOM   8188  C  C   . TYR E  1 13  ? -60.054  60.468  42.114  1.00 21.74 ? 22  TYR E C   1 
ATOM   8189  O  O   . TYR E  1 13  ? -59.312  61.162  42.801  1.00 22.49 ? 22  TYR E O   1 
ATOM   8190  C  CB  . TYR E  1 13  ? -58.621  59.111  40.615  1.00 21.08 ? 22  TYR E CB  1 
ATOM   8191  C  CG  . TYR E  1 13  ? -58.185  57.770  40.145  1.00 22.39 ? 22  TYR E CG  1 
ATOM   8192  C  CD1 . TYR E  1 13  ? -57.537  56.851  41.022  1.00 21.66 ? 22  TYR E CD1 1 
ATOM   8193  C  CD2 . TYR E  1 13  ? -58.420  57.368  38.823  1.00 23.10 ? 22  TYR E CD2 1 
ATOM   8194  C  CE1 . TYR E  1 13  ? -57.137  55.593  40.569  1.00 22.22 ? 22  TYR E CE1 1 
ATOM   8195  C  CE2 . TYR E  1 13  ? -58.053  56.108  38.384  1.00 21.58 ? 22  TYR E CE2 1 
ATOM   8196  C  CZ  . TYR E  1 13  ? -57.426  55.224  39.251  1.00 21.58 ? 22  TYR E CZ  1 
ATOM   8197  O  OH  . TYR E  1 13  ? -57.041  54.013  38.750  1.00 22.49 ? 22  TYR E OH  1 
ATOM   8198  N  N   . PHE E  1 14  ? -61.157  60.937  41.552  1.00 22.24 ? 23  PHE E N   1 
ATOM   8199  C  CA  . PHE E  1 14  ? -61.623  62.312  41.757  1.00 23.55 ? 23  PHE E CA  1 
ATOM   8200  C  C   . PHE E  1 14  ? -63.077  62.447  41.358  1.00 23.55 ? 23  PHE E C   1 
ATOM   8201  O  O   . PHE E  1 14  ? -63.496  61.928  40.315  1.00 23.54 ? 23  PHE E O   1 
ATOM   8202  C  CB  . PHE E  1 14  ? -60.822  63.329  40.975  1.00 22.89 ? 23  PHE E CB  1 
ATOM   8203  C  CG  . PHE E  1 14  ? -61.144  64.752  41.344  1.00 24.69 ? 23  PHE E CG  1 
ATOM   8204  C  CD1 . PHE E  1 14  ? -60.929  65.224  42.644  1.00 24.14 ? 23  PHE E CD1 1 
ATOM   8205  C  CD2 . PHE E  1 14  ? -61.655  65.652  40.387  1.00 25.82 ? 23  PHE E CD2 1 
ATOM   8206  C  CE1 . PHE E  1 14  ? -61.191  66.557  42.972  1.00 26.14 ? 23  PHE E CE1 1 
ATOM   8207  C  CE2 . PHE E  1 14  ? -61.934  66.973  40.725  1.00 24.38 ? 23  PHE E CE2 1 
ATOM   8208  C  CZ  . PHE E  1 14  ? -61.694  67.432  42.013  1.00 25.12 ? 23  PHE E CZ  1 
ATOM   8209  N  N   . LYS E  1 15  ? -63.842  63.079  42.250  1.00 22.37 ? 24  LYS E N   1 
ATOM   8210  C  CA  . LYS E  1 15  ? -65.224  63.395  42.003  1.00 20.40 ? 24  LYS E CA  1 
ATOM   8211  C  C   . LYS E  1 15  ? -65.504  64.767  42.604  1.00 20.62 ? 24  LYS E C   1 
ATOM   8212  O  O   . LYS E  1 15  ? -65.178  65.025  43.735  1.00 19.15 ? 24  LYS E O   1 
ATOM   8213  C  CB  . LYS E  1 15  ? -66.161  62.352  42.612  1.00 20.16 ? 24  LYS E CB  1 
ATOM   8214  C  CG  . LYS E  1 15  ? -67.556  62.434  42.069  1.00 20.25 ? 24  LYS E CG  1 
ATOM   8215  C  CD  . LYS E  1 15  ? -68.521  61.504  42.756  1.00 20.66 ? 24  LYS E CD  1 
ATOM   8216  C  CE  . LYS E  1 15  ? -68.229  60.092  42.396  1.00 21.42 ? 24  LYS E CE  1 
ATOM   8217  N  NZ  . LYS E  1 15  ? -69.438  59.303  42.134  1.00 21.55 ? 24  LYS E NZ  1 
ATOM   8218  N  N   . GLU E  1 16  ? -66.142  65.643  41.828  1.00 20.67 ? 25  GLU E N   1 
ATOM   8219  C  CA  . GLU E  1 16  ? -66.589  66.955  42.352  1.00 19.05 ? 25  GLU E CA  1 
ATOM   8220  C  C   . GLU E  1 16  ? -67.960  67.351  41.746  1.00 18.47 ? 25  GLU E C   1 
ATOM   8221  O  O   . GLU E  1 16  ? -68.090  67.584  40.541  1.00 14.33 ? 25  GLU E O   1 
ATOM   8222  C  CB  . GLU E  1 16  ? -65.547  68.038  42.071  1.00 19.08 ? 25  GLU E CB  1 
ATOM   8223  C  CG  . GLU E  1 16  ? -65.899  69.426  42.596  1.00 20.17 ? 25  GLU E CG  1 
ATOM   8224  C  CD  . GLU E  1 16  ? -65.948  69.523  44.129  1.00 21.80 ? 25  GLU E CD  1 
ATOM   8225  O  OE1 . GLU E  1 16  ? -67.082  69.345  44.648  1.00 22.78 ? 25  GLU E OE1 1 
ATOM   8226  O  OE2 . GLU E  1 16  ? -64.899  69.679  44.822  1.00 19.26 ? 25  GLU E OE2 1 
ATOM   8227  N  N   . GLN E  1 17  ? -68.955  67.445  42.620  1.00 18.27 ? 26  GLN E N   1 
ATOM   8228  C  CA  . GLN E  1 17  ? -70.274  67.918  42.218  1.00 18.18 ? 26  GLN E CA  1 
ATOM   8229  C  C   . GLN E  1 17  ? -70.737  69.189  42.930  1.00 17.63 ? 26  GLN E C   1 
ATOM   8230  O  O   . GLN E  1 17  ? -71.784  69.763  42.563  1.00 17.79 ? 26  GLN E O   1 
ATOM   8231  C  CB  . GLN E  1 17  ? -71.314  66.832  42.399  1.00 18.31 ? 26  GLN E CB  1 
ATOM   8232  C  CG  . GLN E  1 17  ? -70.814  65.476  41.960  1.00 17.84 ? 26  GLN E CG  1 
ATOM   8233  C  CD  . GLN E  1 17  ? -71.814  64.415  42.254  1.00 18.88 ? 26  GLN E CD  1 
ATOM   8234  O  OE1 . GLN E  1 17  ? -72.879  64.338  41.634  1.00 22.06 ? 26  GLN E OE1 1 
ATOM   8235  N  NE2 . GLN E  1 17  ? -71.482  63.577  43.175  1.00 18.68 ? 26  GLN E NE2 1 
ATOM   8236  N  N   . PHE E  1 18  ? -69.908  69.694  43.848  1.00 17.43 ? 27  PHE E N   1 
ATOM   8237  C  CA  . PHE E  1 18  ? -70.185  70.941  44.534  1.00 16.37 ? 27  PHE E CA  1 
ATOM   8238  C  C   . PHE E  1 18  ? -71.553  70.895  45.182  1.00 16.37 ? 27  PHE E C   1 
ATOM   8239  O  O   . PHE E  1 18  ? -72.360  71.795  44.973  1.00 16.62 ? 27  PHE E O   1 
ATOM   8240  C  CB  . PHE E  1 18  ? -70.148  72.118  43.539  1.00 15.65 ? 27  PHE E CB  1 
ATOM   8241  C  CG  . PHE E  1 18  ? -68.918  72.185  42.735  1.00 16.15 ? 27  PHE E CG  1 
ATOM   8242  C  CD1 . PHE E  1 18  ? -67.783  72.799  43.219  1.00 16.38 ? 27  PHE E CD1 1 
ATOM   8243  C  CD2 . PHE E  1 18  ? -68.878  71.677  41.455  1.00 17.24 ? 27  PHE E CD2 1 
ATOM   8244  C  CE1 . PHE E  1 18  ? -66.629  72.929  42.440  1.00 15.67 ? 27  PHE E CE1 1 
ATOM   8245  C  CE2 . PHE E  1 18  ? -67.716  71.798  40.670  1.00 16.60 ? 27  PHE E CE2 1 
ATOM   8246  C  CZ  . PHE E  1 18  ? -66.584  72.383  41.185  1.00 15.64 ? 27  PHE E CZ  1 
ATOM   8247  N  N   . LEU E  1 19  ? -71.832  69.830  45.905  1.00 18.38 ? 28  LEU E N   1 
ATOM   8248  C  CA  . LEU E  1 19  ? -73.130  69.599  46.561  1.00 20.92 ? 28  LEU E CA  1 
ATOM   8249  C  C   . LEU E  1 19  ? -73.188  70.030  48.014  1.00 22.47 ? 28  LEU E C   1 
ATOM   8250  O  O   . LEU E  1 19  ? -74.260  70.128  48.581  1.00 25.41 ? 28  LEU E O   1 
ATOM   8251  C  CB  . LEU E  1 19  ? -73.498  68.106  46.528  1.00 22.30 ? 28  LEU E CB  1 
ATOM   8252  C  CG  . LEU E  1 19  ? -73.838  67.485  45.162  1.00 23.16 ? 28  LEU E CG  1 
ATOM   8253  C  CD1 . LEU E  1 19  ? -73.724  65.955  45.250  1.00 22.66 ? 28  LEU E CD1 1 
ATOM   8254  C  CD2 . LEU E  1 19  ? -75.225  67.923  44.685  1.00 23.18 ? 28  LEU E CD2 1 
ATOM   8255  N  N   . ASP E  1 20  ? -72.037  70.311  48.617  1.00 25.58 ? 29  ASP E N   1 
ATOM   8256  C  CA  . ASP E  1 20  ? -71.939  70.546  50.090  1.00 24.90 ? 29  ASP E CA  1 
ATOM   8257  C  C   . ASP E  1 20  ? -71.672  72.036  50.453  1.00 25.19 ? 29  ASP E C   1 
ATOM   8258  O  O   . ASP E  1 20  ? -70.662  72.415  51.075  1.00 25.26 ? 29  ASP E O   1 
ATOM   8259  C  CB  . ASP E  1 20  ? -70.869  69.623  50.680  1.00 23.47 ? 29  ASP E CB  1 
ATOM   8260  C  CG  . ASP E  1 20  ? -69.476  69.892  50.108  1.00 23.12 ? 29  ASP E CG  1 
ATOM   8261  O  OD1 . ASP E  1 20  ? -69.346  70.445  48.984  1.00 22.87 ? 29  ASP E OD1 1 
ATOM   8262  O  OD2 . ASP E  1 20  ? -68.502  69.557  50.786  1.00 24.47 ? 29  ASP E OD2 1 
ATOM   8263  N  N   . GLY E  1 21  ? -72.543  72.889  49.953  1.00 26.30 ? 30  GLY E N   1 
ATOM   8264  C  CA  . GLY E  1 21  ? -72.364  74.337  50.081  1.00 27.27 ? 30  GLY E CA  1 
ATOM   8265  C  C   . GLY E  1 21  ? -71.023  74.863  49.593  1.00 25.24 ? 30  GLY E C   1 
ATOM   8266  O  O   . GLY E  1 21  ? -70.618  74.683  48.452  1.00 23.83 ? 30  GLY E O   1 
ATOM   8267  N  N   . ASP E  1 22  ? -70.357  75.559  50.490  1.00 27.99 ? 31  ASP E N   1 
ATOM   8268  C  CA  . ASP E  1 22  ? -69.093  76.197  50.209  1.00 32.57 ? 31  ASP E CA  1 
ATOM   8269  C  C   . ASP E  1 22  ? -67.891  75.252  50.478  1.00 26.37 ? 31  ASP E C   1 
ATOM   8270  O  O   . ASP E  1 22  ? -66.720  75.670  50.383  1.00 23.63 ? 31  ASP E O   1 
ATOM   8271  C  CB  . ASP E  1 22  ? -69.001  77.475  51.066  1.00 38.23 ? 31  ASP E CB  1 
ATOM   8272  C  CG  . ASP E  1 22  ? -68.303  78.636  50.364  1.00 54.87 ? 31  ASP E CG  1 
ATOM   8273  O  OD1 . ASP E  1 22  ? -68.120  78.611  49.130  1.00 65.68 ? 31  ASP E OD1 1 
ATOM   8274  O  OD2 . ASP E  1 22  ? -67.919  79.585  51.076  1.00 61.90 ? 31  ASP E OD2 1 
ATOM   8275  N  N   . GLY E  1 23  ? -68.191  73.991  50.795  1.00 23.28 ? 32  GLY E N   1 
ATOM   8276  C  CA  . GLY E  1 23  ? -67.154  72.950  50.994  1.00 22.65 ? 32  GLY E CA  1 
ATOM   8277  C  C   . GLY E  1 23  ? -66.047  72.946  49.938  1.00 21.96 ? 32  GLY E C   1 
ATOM   8278  O  O   . GLY E  1 23  ? -64.870  72.784  50.251  1.00 22.71 ? 32  GLY E O   1 
ATOM   8279  N  N   . TRP E  1 24  ? -66.414  73.203  48.689  1.00 20.05 ? 33  TRP E N   1 
ATOM   8280  C  CA  . TRP E  1 24  ? -65.435  73.240  47.598  1.00 18.85 ? 33  TRP E CA  1 
ATOM   8281  C  C   . TRP E  1 24  ? -64.262  74.180  47.808  1.00 18.02 ? 33  TRP E C   1 
ATOM   8282  O  O   . TRP E  1 24  ? -63.213  73.975  47.206  1.00 15.02 ? 33  TRP E O   1 
ATOM   8283  C  CB  . TRP E  1 24  ? -66.116  73.599  46.266  1.00 18.28 ? 33  TRP E CB  1 
ATOM   8284  C  CG  . TRP E  1 24  ? -66.476  75.041  46.120  1.00 16.88 ? 33  TRP E CG  1 
ATOM   8285  C  CD1 . TRP E  1 24  ? -67.646  75.628  46.506  1.00 16.60 ? 33  TRP E CD1 1 
ATOM   8286  C  CD2 . TRP E  1 24  ? -65.682  76.077  45.512  1.00 15.38 ? 33  TRP E CD2 1 
ATOM   8287  N  NE1 . TRP E  1 24  ? -67.624  76.965  46.199  1.00 15.98 ? 33  TRP E NE1 1 
ATOM   8288  C  CE2 . TRP E  1 24  ? -66.441  77.270  45.580  1.00 16.18 ? 33  TRP E CE2 1 
ATOM   8289  C  CE3 . TRP E  1 24  ? -64.432  76.112  44.923  1.00 13.83 ? 33  TRP E CE3 1 
ATOM   8290  C  CZ2 . TRP E  1 24  ? -65.976  78.494  45.069  1.00 15.57 ? 33  TRP E CZ2 1 
ATOM   8291  C  CZ3 . TRP E  1 24  ? -63.958  77.314  44.455  1.00 14.17 ? 33  TRP E CZ3 1 
ATOM   8292  C  CH2 . TRP E  1 24  ? -64.728  78.497  44.531  1.00 14.44 ? 33  TRP E CH2 1 
ATOM   8293  N  N   . THR E  1 25  ? -64.468  75.243  48.599  1.00 18.12 ? 34  THR E N   1 
ATOM   8294  C  CA  . THR E  1 25  ? -63.412  76.259  48.774  1.00 19.96 ? 34  THR E CA  1 
ATOM   8295  C  C   . THR E  1 25  ? -62.216  75.728  49.542  1.00 18.88 ? 34  THR E C   1 
ATOM   8296  O  O   . THR E  1 25  ? -61.152  76.324  49.514  1.00 18.72 ? 34  THR E O   1 
ATOM   8297  C  CB  . THR E  1 25  ? -63.907  77.537  49.499  1.00 20.13 ? 34  THR E CB  1 
ATOM   8298  O  OG1 . THR E  1 25  ? -64.540  77.160  50.709  1.00 21.49 ? 34  THR E OG1 1 
ATOM   8299  C  CG2 . THR E  1 25  ? -64.923  78.313  48.645  1.00 21.34 ? 34  THR E CG2 1 
ATOM   8300  N  N   . SER E  1 26  ? -62.400  74.609  50.211  1.00 21.25 ? 35  SER E N   1 
ATOM   8301  C  CA  . SER E  1 26  ? -61.272  73.878  50.848  1.00 24.17 ? 35  SER E CA  1 
ATOM   8302  C  C   . SER E  1 26  ? -60.666  72.800  49.950  1.00 22.92 ? 35  SER E C   1 
ATOM   8303  O  O   . SER E  1 26  ? -59.711  72.167  50.358  1.00 27.83 ? 35  SER E O   1 
ATOM   8304  C  CB  . SER E  1 26  ? -61.713  73.085  52.121  1.00 25.90 ? 35  SER E CB  1 
ATOM   8305  O  OG  . SER E  1 26  ? -62.766  73.688  52.892  1.00 31.50 ? 35  SER E OG  1 
ATOM   8306  N  N   . ARG E  1 27  ? -61.226  72.554  48.771  1.00 21.05 ? 36  ARG E N   1 
ATOM   8307  C  CA  . ARG E  1 27  ? -60.705  71.511  47.838  1.00 18.62 ? 36  ARG E CA  1 
ATOM   8308  C  C   . ARG E  1 27  ? -60.016  72.092  46.618  1.00 18.09 ? 36  ARG E C   1 
ATOM   8309  O  O   . ARG E  1 27  ? -59.323  71.389  45.906  1.00 20.26 ? 36  ARG E O   1 
ATOM   8310  C  CB  . ARG E  1 27  ? -61.832  70.581  47.404  1.00 17.61 ? 36  ARG E CB  1 
ATOM   8311  C  CG  . ARG E  1 27  ? -62.469  69.868  48.585  1.00 17.86 ? 36  ARG E CG  1 
ATOM   8312  C  CD  . ARG E  1 27  ? -63.392  68.729  48.163  1.00 17.64 ? 36  ARG E CD  1 
ATOM   8313  N  NE  . ARG E  1 27  ? -64.627  69.210  47.575  1.00 17.72 ? 36  ARG E NE  1 
ATOM   8314  C  CZ  . ARG E  1 27  ? -65.763  69.487  48.231  1.00 17.49 ? 36  ARG E CZ  1 
ATOM   8315  N  NH1 . ARG E  1 27  ? -65.864  69.381  49.552  1.00 16.55 ? 36  ARG E NH1 1 
ATOM   8316  N  NH2 . ARG E  1 27  ? -66.832  69.895  47.534  1.00 18.78 ? 36  ARG E NH2 1 
ATOM   8317  N  N   . TRP E  1 28  ? -60.179  73.387  46.367  1.00 17.23 ? 37  TRP E N   1 
ATOM   8318  C  CA  . TRP E  1 28  ? -59.631  73.987  45.160  1.00 16.03 ? 37  TRP E CA  1 
ATOM   8319  C  C   . TRP E  1 28  ? -58.767  75.165  45.529  1.00 16.18 ? 37  TRP E C   1 
ATOM   8320  O  O   . TRP E  1 28  ? -59.028  75.836  46.506  1.00 18.16 ? 37  TRP E O   1 
ATOM   8321  C  CB  . TRP E  1 28  ? -60.779  74.435  44.195  1.00 15.62 ? 37  TRP E CB  1 
ATOM   8322  C  CG  . TRP E  1 28  ? -61.616  73.356  43.628  1.00 13.91 ? 37  TRP E CG  1 
ATOM   8323  C  CD1 . TRP E  1 28  ? -62.552  72.604  44.287  1.00 14.17 ? 37  TRP E CD1 1 
ATOM   8324  C  CD2 . TRP E  1 28  ? -61.594  72.870  42.269  1.00 13.66 ? 37  TRP E CD2 1 
ATOM   8325  N  NE1 . TRP E  1 28  ? -63.112  71.681  43.422  1.00 13.67 ? 37  TRP E NE1 1 
ATOM   8326  C  CE2 . TRP E  1 28  ? -62.533  71.830  42.188  1.00 13.83 ? 37  TRP E CE2 1 
ATOM   8327  C  CE3 . TRP E  1 28  ? -60.863  73.212  41.127  1.00 13.02 ? 37  TRP E CE3 1 
ATOM   8328  C  CZ2 . TRP E  1 28  ? -62.775  71.147  41.001  1.00 15.73 ? 37  TRP E CZ2 1 
ATOM   8329  C  CZ3 . TRP E  1 28  ? -61.110  72.538  39.946  1.00 13.84 ? 37  TRP E CZ3 1 
ATOM   8330  C  CH2 . TRP E  1 28  ? -62.037  71.520  39.882  1.00 14.33 ? 37  TRP E CH2 1 
ATOM   8331  N  N   . ILE E  1 29  ? -57.746  75.423  44.726  1.00 17.41 ? 38  ILE E N   1 
ATOM   8332  C  CA  . ILE E  1 29  ? -56.707  76.404  45.022  1.00 18.61 ? 38  ILE E CA  1 
ATOM   8333  C  C   . ILE E  1 29  ? -56.549  77.308  43.843  1.00 18.60 ? 38  ILE E C   1 
ATOM   8334  O  O   . ILE E  1 29  ? -56.385  76.858  42.735  1.00 18.13 ? 38  ILE E O   1 
ATOM   8335  C  CB  . ILE E  1 29  ? -55.299  75.754  45.299  1.00 19.48 ? 38  ILE E CB  1 
ATOM   8336  C  CG1 . ILE E  1 29  ? -55.408  75.192  46.728  1.00 20.61 ? 38  ILE E CG1 1 
ATOM   8337  C  CG2 . ILE E  1 29  ? -54.201  76.764  45.436  1.00 18.90 ? 38  ILE E CG2 1 
ATOM   8338  C  CD1 . ILE E  1 29  ? -54.338  74.387  47.472  1.00 21.84 ? 38  ILE E CD1 1 
ATOM   8339  N  N   . GLU E  1 30  ? -56.521  78.593  44.133  1.00 21.48 ? 39  GLU E N   1 
ATOM   8340  C  CA  . GLU E  1 30  ? -56.325  79.628  43.140  1.00 25.00 ? 39  GLU E CA  1 
ATOM   8341  C  C   . GLU E  1 30  ? -54.850  79.831  42.886  1.00 23.91 ? 39  GLU E C   1 
ATOM   8342  O  O   . GLU E  1 30  ? -54.085  79.931  43.817  1.00 26.59 ? 39  GLU E O   1 
ATOM   8343  C  CB  . GLU E  1 30  ? -56.935  80.956  43.620  1.00 27.34 ? 39  GLU E CB  1 
ATOM   8344  C  CG  . GLU E  1 30  ? -58.445  81.041  43.412  1.00 29.85 ? 39  GLU E CG  1 
ATOM   8345  C  CD  . GLU E  1 30  ? -59.105  82.281  44.039  1.00 33.21 ? 39  GLU E CD  1 
ATOM   8346  O  OE1 . GLU E  1 30  ? -58.438  83.113  44.720  1.00 35.66 ? 39  GLU E OE1 1 
ATOM   8347  O  OE2 . GLU E  1 30  ? -60.291  82.482  43.770  1.00 30.54 ? 39  GLU E OE2 1 
ATOM   8348  N  N   . SER E  1 31  ? -54.453  79.875  41.635  1.00 22.47 ? 40  SER E N   1 
ATOM   8349  C  CA  . SER E  1 31  ? -53.061  80.209  41.322  1.00 22.32 ? 40  SER E CA  1 
ATOM   8350  C  C   . SER E  1 31  ? -52.838  81.659  41.635  1.00 24.26 ? 40  SER E C   1 
ATOM   8351  O  O   . SER E  1 31  ? -53.700  82.478  41.367  1.00 23.53 ? 40  SER E O   1 
ATOM   8352  C  CB  . SER E  1 31  ? -52.741  79.960  39.861  1.00 19.68 ? 40  SER E CB  1 
ATOM   8353  O  OG  . SER E  1 31  ? -51.515  80.515  39.483  1.00 18.61 ? 40  SER E OG  1 
ATOM   8354  N  N   . LYS E  1 32  ? -51.661  81.983  42.168  1.00 25.19 ? 41  LYS E N   1 
ATOM   8355  C  CA  . LYS E  1 32  ? -51.220  83.393  42.286  1.00 27.41 ? 41  LYS E CA  1 
ATOM   8356  C  C   . LYS E  1 32  ? -50.160  83.784  41.267  1.00 24.17 ? 41  LYS E C   1 
ATOM   8357  O  O   . LYS E  1 32  ? -49.466  84.773  41.450  1.00 20.72 ? 41  LYS E O   1 
ATOM   8358  C  CB  . LYS E  1 32  ? -50.711  83.677  43.693  1.00 31.96 ? 41  LYS E CB  1 
ATOM   8359  C  CG  . LYS E  1 32  ? -51.761  83.404  44.735  1.00 39.20 ? 41  LYS E CG  1 
ATOM   8360  C  CD  . LYS E  1 32  ? -51.166  83.598  46.109  1.00 46.95 ? 41  LYS E CD  1 
ATOM   8361  C  CE  . LYS E  1 32  ? -52.159  83.266  47.213  1.00 54.13 ? 41  LYS E CE  1 
ATOM   8362  N  NZ  . LYS E  1 32  ? -51.527  82.294  48.152  1.00 56.92 ? 41  LYS E NZ  1 
ATOM   8363  N  N   . HIS E  1 33  ? -50.020  82.996  40.202  1.00 23.43 ? 42  HIS E N   1 
ATOM   8364  C  CA  . HIS E  1 33  ? -48.958  83.267  39.218  1.00 23.16 ? 42  HIS E CA  1 
ATOM   8365  C  C   . HIS E  1 33  ? -49.061  84.696  38.668  1.00 23.99 ? 42  HIS E C   1 
ATOM   8366  O  O   . HIS E  1 33  ? -48.068  85.334  38.399  1.00 27.26 ? 42  HIS E O   1 
ATOM   8367  C  CB  . HIS E  1 33  ? -48.993  82.260  38.081  1.00 23.87 ? 42  HIS E CB  1 
ATOM   8368  C  CG  . HIS E  1 33  ? -47.961  82.514  37.021  1.00 23.26 ? 42  HIS E CG  1 
ATOM   8369  N  ND1 . HIS E  1 33  ? -46.627  82.187  37.182  1.00 23.94 ? 42  HIS E ND1 1 
ATOM   8370  C  CD2 . HIS E  1 33  ? -48.066  83.075  35.798  1.00 22.12 ? 42  HIS E CD2 1 
ATOM   8371  C  CE1 . HIS E  1 33  ? -45.952  82.556  36.106  1.00 23.38 ? 42  HIS E CE1 1 
ATOM   8372  N  NE2 . HIS E  1 33  ? -46.805  83.095  35.250  1.00 25.42 ? 42  HIS E NE2 1 
ATOM   8373  N  N   . LYS E  1 34  ? -50.288  85.149  38.511  1.00 26.15 ? 43  LYS E N   1 
ATOM   8374  C  CA  . LYS E  1 34  ? -50.623  86.503  38.145  1.00 29.98 ? 43  LYS E CA  1 
ATOM   8375  C  C   . LYS E  1 34  ? -51.586  87.084  39.188  1.00 30.72 ? 43  LYS E C   1 
ATOM   8376  O  O   . LYS E  1 34  ? -52.210  86.345  39.959  1.00 30.12 ? 43  LYS E O   1 
ATOM   8377  C  CB  . LYS E  1 34  ? -51.301  86.545  36.781  1.00 35.35 ? 43  LYS E CB  1 
ATOM   8378  C  CG  . LYS E  1 34  ? -50.329  86.394  35.620  1.00 40.01 ? 43  LYS E CG  1 
ATOM   8379  C  CD  . LYS E  1 34  ? -50.936  86.226  34.279  1.00 43.39 ? 43  LYS E CD  1 
ATOM   8380  C  CE  . LYS E  1 34  ? -52.107  85.307  34.201  1.00 47.30 ? 43  LYS E CE  1 
ATOM   8381  N  NZ  . LYS E  1 34  ? -52.431  84.898  32.809  1.00 51.70 ? 43  LYS E NZ  1 
ATOM   8382  N  N   . SER E  1 35  ? -51.675  88.413  39.214  1.00 32.00 ? 44  SER E N   1 
ATOM   8383  C  CA  . SER E  1 35  ? -52.510  89.139  40.197  1.00 33.13 ? 44  SER E CA  1 
ATOM   8384  C  C   . SER E  1 35  ? -53.927  89.404  39.678  1.00 30.34 ? 44  SER E C   1 
ATOM   8385  O  O   . SER E  1 35  ? -54.793  89.730  40.458  1.00 29.22 ? 44  SER E O   1 
ATOM   8386  C  CB  . SER E  1 35  ? -51.846  90.462  40.575  1.00 36.68 ? 44  SER E CB  1 
ATOM   8387  O  OG  . SER E  1 35  ? -51.854  91.378  39.461  1.00 42.74 ? 44  SER E OG  1 
ATOM   8388  N  N   . ASP E  1 36  ? -54.140  89.247  38.369  1.00 29.64 ? 45  ASP E N   1 
ATOM   8389  C  CA  . ASP E  1 36  ? -55.395  89.631  37.687  1.00 28.98 ? 45  ASP E CA  1 
ATOM   8390  C  C   . ASP E  1 36  ? -56.160  88.465  37.017  1.00 27.50 ? 45  ASP E C   1 
ATOM   8391  O  O   . ASP E  1 36  ? -56.856  88.651  36.017  1.00 22.54 ? 45  ASP E O   1 
ATOM   8392  C  CB  . ASP E  1 36  ? -55.104  90.706  36.619  1.00 31.12 ? 45  ASP E CB  1 
ATOM   8393  C  CG  . ASP E  1 36  ? -54.204  90.188  35.481  1.00 31.47 ? 45  ASP E CG  1 
ATOM   8394  O  OD1 . ASP E  1 36  ? -53.530  89.163  35.659  1.00 28.75 ? 45  ASP E OD1 1 
ATOM   8395  O  OD2 . ASP E  1 36  ? -54.161  90.837  34.420  1.00 36.61 ? 45  ASP E OD2 1 
ATOM   8396  N  N   . PHE E  1 37  ? -55.977  87.265  37.538  1.00 26.65 ? 46  PHE E N   1 
ATOM   8397  C  CA  . PHE E  1 37  ? -56.792  86.135  37.111  1.00 26.44 ? 46  PHE E CA  1 
ATOM   8398  C  C   . PHE E  1 37  ? -58.268  86.421  37.425  1.00 25.34 ? 46  PHE E C   1 
ATOM   8399  O  O   . PHE E  1 37  ? -58.571  86.982  38.475  1.00 24.61 ? 46  PHE E O   1 
ATOM   8400  C  CB  . PHE E  1 37  ? -56.406  84.825  37.840  1.00 25.68 ? 46  PHE E CB  1 
ATOM   8401  C  CG  . PHE E  1 37  ? -55.128  84.175  37.349  1.00 25.65 ? 46  PHE E CG  1 
ATOM   8402  C  CD1 . PHE E  1 37  ? -54.897  83.968  36.000  1.00 24.87 ? 46  PHE E CD1 1 
ATOM   8403  C  CD2 . PHE E  1 37  ? -54.174  83.696  38.266  1.00 26.14 ? 46  PHE E CD2 1 
ATOM   8404  C  CE1 . PHE E  1 37  ? -53.746  83.311  35.562  1.00 25.31 ? 46  PHE E CE1 1 
ATOM   8405  C  CE2 . PHE E  1 37  ? -53.020  83.045  37.833  1.00 25.29 ? 46  PHE E CE2 1 
ATOM   8406  C  CZ  . PHE E  1 37  ? -52.806  82.851  36.478  1.00 25.10 ? 46  PHE E CZ  1 
ATOM   8407  N  N   . GLY E  1 38  ? -59.168  85.993  36.540  1.00 21.78 ? 47  GLY E N   1 
ATOM   8408  C  CA  . GLY E  1 38  ? -60.569  86.041  36.822  1.00 21.17 ? 47  GLY E CA  1 
ATOM   8409  C  C   . GLY E  1 38  ? -60.917  85.126  37.968  1.00 23.87 ? 47  GLY E C   1 
ATOM   8410  O  O   . GLY E  1 38  ? -60.163  84.225  38.292  1.00 24.25 ? 47  GLY E O   1 
ATOM   8411  N  N   . LYS E  1 39  ? -62.064  85.348  38.585  1.00 23.26 ? 48  LYS E N   1 
ATOM   8412  C  CA  . LYS E  1 39  ? -62.498  84.570  39.739  1.00 25.02 ? 48  LYS E CA  1 
ATOM   8413  C  C   . LYS E  1 39  ? -63.664  83.629  39.353  1.00 22.66 ? 48  LYS E C   1 
ATOM   8414  O  O   . LYS E  1 39  ? -64.568  84.003  38.623  1.00 20.74 ? 48  LYS E O   1 
ATOM   8415  C  CB  . LYS E  1 39  ? -62.909  85.526  40.859  1.00 28.38 ? 48  LYS E CB  1 
ATOM   8416  C  CG  . LYS E  1 39  ? -63.387  84.968  42.181  1.00 37.28 ? 48  LYS E CG  1 
ATOM   8417  C  CD  . LYS E  1 39  ? -63.513  85.991  43.333  1.00 40.97 ? 48  LYS E CD  1 
ATOM   8418  C  CE  . LYS E  1 39  ? -64.270  85.346  44.545  1.00 41.69 ? 48  LYS E CE  1 
ATOM   8419  N  NZ  . LYS E  1 39  ? -63.421  84.397  45.326  1.00 42.63 ? 48  LYS E NZ  1 
ATOM   8420  N  N   . PHE E  1 40  ? -63.573  82.384  39.781  1.00 21.14 ? 49  PHE E N   1 
ATOM   8421  C  CA  . PHE E  1 40  ? -64.702  81.457  39.698  1.00 21.42 ? 49  PHE E CA  1 
ATOM   8422  C  C   . PHE E  1 40  ? -65.619  81.728  40.874  1.00 20.83 ? 49  PHE E C   1 
ATOM   8423  O  O   . PHE E  1 40  ? -65.151  82.012  41.985  1.00 21.26 ? 49  PHE E O   1 
ATOM   8424  C  CB  . PHE E  1 40  ? -64.287  79.964  39.750  1.00 20.38 ? 49  PHE E CB  1 
ATOM   8425  C  CG  . PHE E  1 40  ? -63.663  79.471  38.482  1.00 19.55 ? 49  PHE E CG  1 
ATOM   8426  C  CD1 . PHE E  1 40  ? -64.434  78.991  37.439  1.00 17.85 ? 49  PHE E CD1 1 
ATOM   8427  C  CD2 . PHE E  1 40  ? -62.285  79.496  38.344  1.00 20.10 ? 49  PHE E CD2 1 
ATOM   8428  C  CE1 . PHE E  1 40  ? -63.831  78.528  36.275  1.00 18.75 ? 49  PHE E CE1 1 
ATOM   8429  C  CE2 . PHE E  1 40  ? -61.668  79.051  37.171  1.00 19.65 ? 49  PHE E CE2 1 
ATOM   8430  C  CZ  . PHE E  1 40  ? -62.440  78.561  36.135  1.00 19.37 ? 49  PHE E CZ  1 
ATOM   8431  N  N   . VAL E  1 41  ? -66.903  81.575  40.633  1.00 18.10 ? 50  VAL E N   1 
ATOM   8432  C  CA  . VAL E  1 41  ? -67.897  81.670  41.655  1.00 19.15 ? 50  VAL E CA  1 
ATOM   8433  C  C   . VAL E  1 41  ? -68.833  80.475  41.612  1.00 20.07 ? 50  VAL E C   1 
ATOM   8434  O  O   . VAL E  1 41  ? -69.020  79.909  40.579  1.00 19.20 ? 50  VAL E O   1 
ATOM   8435  C  CB  . VAL E  1 41  ? -68.688  82.952  41.346  1.00 20.85 ? 50  VAL E CB  1 
ATOM   8436  C  CG1 . VAL E  1 41  ? -70.133  82.863  41.809  1.00 22.89 ? 50  VAL E CG1 1 
ATOM   8437  C  CG2 . VAL E  1 41  ? -67.958  84.132  41.969  1.00 20.43 ? 50  VAL E CG2 1 
ATOM   8438  N  N   . LEU E  1 42  ? -69.366  80.059  42.757  1.00 21.16 ? 51  LEU E N   1 
ATOM   8439  C  CA  . LEU E  1 42  ? -70.303  78.932  42.806  1.00 22.16 ? 51  LEU E CA  1 
ATOM   8440  C  C   . LEU E  1 42  ? -71.698  79.418  42.393  1.00 21.90 ? 51  LEU E C   1 
ATOM   8441  O  O   . LEU E  1 42  ? -72.193  80.399  42.915  1.00 23.50 ? 51  LEU E O   1 
ATOM   8442  C  CB  . LEU E  1 42  ? -70.381  78.338  44.197  1.00 21.66 ? 51  LEU E CB  1 
ATOM   8443  C  CG  . LEU E  1 42  ? -71.186  77.059  44.252  1.00 24.97 ? 51  LEU E CG  1 
ATOM   8444  C  CD1 . LEU E  1 42  ? -70.423  75.938  43.571  1.00 27.09 ? 51  LEU E CD1 1 
ATOM   8445  C  CD2 . LEU E  1 42  ? -71.544  76.688  45.696  1.00 26.35 ? 51  LEU E CD2 1 
ATOM   8446  N  N   . SER E  1 43  ? -72.278  78.764  41.400  1.00 23.54 ? 52  SER E N   1 
ATOM   8447  C  CA  . SER E  1 43  ? -73.515  79.225  40.779  1.00 22.33 ? 52  SER E CA  1 
ATOM   8448  C  C   . SER E  1 43  ? -74.184  78.137  39.949  1.00 22.00 ? 52  SER E C   1 
ATOM   8449  O  O   . SER E  1 43  ? -73.505  77.347  39.275  1.00 22.79 ? 52  SER E O   1 
ATOM   8450  C  CB  . SER E  1 43  ? -73.243  80.436  39.859  1.00 22.20 ? 52  SER E CB  1 
ATOM   8451  O  OG  . SER E  1 43  ? -74.469  81.019  39.411  1.00 25.76 ? 52  SER E OG  1 
ATOM   8452  N  N   . SER E  1 44  ? -75.520  78.166  39.927  1.00 21.52 ? 53  SER E N   1 
ATOM   8453  C  CA  . SER E  1 44  ? -76.322  77.376  38.956  1.00 21.03 ? 53  SER E CA  1 
ATOM   8454  C  C   . SER E  1 44  ? -76.879  78.235  37.807  1.00 19.54 ? 53  SER E C   1 
ATOM   8455  O  O   . SER E  1 44  ? -77.597  77.748  36.971  1.00 19.84 ? 53  SER E O   1 
ATOM   8456  C  CB  . SER E  1 44  ? -77.428  76.568  39.641  1.00 20.91 ? 53  SER E CB  1 
ATOM   8457  O  OG  . SER E  1 44  ? -78.200  77.323  40.535  1.00 21.06 ? 53  SER E OG  1 
ATOM   8458  N  N   . GLY E  1 45  ? -76.512  79.510  37.777  1.00 20.27 ? 54  GLY E N   1 
ATOM   8459  C  CA  . GLY E  1 45  ? -76.908  80.439  36.708  1.00 20.57 ? 54  GLY E CA  1 
ATOM   8460  C  C   . GLY E  1 45  ? -78.374  80.801  36.668  1.00 20.57 ? 54  GLY E C   1 
ATOM   8461  O  O   . GLY E  1 45  ? -79.130  80.514  37.579  1.00 20.54 ? 54  GLY E O   1 
ATOM   8462  N  N   . LYS E  1 46  ? -78.795  81.356  35.551  1.00 23.40 ? 55  LYS E N   1 
ATOM   8463  C  CA  . LYS E  1 46  ? -80.183  81.851  35.374  1.00 25.92 ? 55  LYS E CA  1 
ATOM   8464  C  C   . LYS E  1 46  ? -81.206  80.782  35.129  1.00 23.68 ? 55  LYS E C   1 
ATOM   8465  O  O   . LYS E  1 46  ? -82.363  80.945  35.453  1.00 23.91 ? 55  LYS E O   1 
ATOM   8466  C  CB  . LYS E  1 46  ? -80.290  82.810  34.179  1.00 31.66 ? 55  LYS E CB  1 
ATOM   8467  C  CG  . LYS E  1 46  ? -79.813  84.204  34.518  1.00 36.48 ? 55  LYS E CG  1 
ATOM   8468  C  CD  . LYS E  1 46  ? -79.437  85.050  33.296  1.00 42.62 ? 55  LYS E CD  1 
ATOM   8469  C  CE  . LYS E  1 46  ? -80.681  85.768  32.751  1.00 46.26 ? 55  LYS E CE  1 
ATOM   8470  N  NZ  . LYS E  1 46  ? -80.613  86.213  31.330  1.00 49.68 ? 55  LYS E NZ  1 
ATOM   8471  N  N   . PHE E  1 47  ? -80.802  79.735  34.450  1.00 22.02 ? 56  PHE E N   1 
ATOM   8472  C  CA  . PHE E  1 47  ? -81.652  78.556  34.289  1.00 20.65 ? 56  PHE E CA  1 
ATOM   8473  C  C   . PHE E  1 47  ? -80.878  77.267  34.573  1.00 20.00 ? 56  PHE E C   1 
ATOM   8474  O  O   . PHE E  1 47  ? -79.672  77.219  34.429  1.00 18.00 ? 56  PHE E O   1 
ATOM   8475  C  CB  . PHE E  1 47  ? -82.223  78.490  32.872  1.00 20.51 ? 56  PHE E CB  1 
ATOM   8476  C  CG  . PHE E  1 47  ? -81.169  78.424  31.786  1.00 18.71 ? 56  PHE E CG  1 
ATOM   8477  C  CD1 . PHE E  1 47  ? -80.533  79.564  31.358  1.00 18.51 ? 56  PHE E CD1 1 
ATOM   8478  C  CD2 . PHE E  1 47  ? -80.857  77.226  31.193  1.00 18.02 ? 56  PHE E CD2 1 
ATOM   8479  C  CE1 . PHE E  1 47  ? -79.597  79.497  30.365  1.00 17.84 ? 56  PHE E CE1 1 
ATOM   8480  C  CE2 . PHE E  1 47  ? -79.950  77.159  30.174  1.00 16.45 ? 56  PHE E CE2 1 
ATOM   8481  C  CZ  . PHE E  1 47  ? -79.311  78.292  29.772  1.00 17.31 ? 56  PHE E CZ  1 
ATOM   8482  N  N   . TYR E  1 48  ? -81.619  76.219  34.889  1.00 19.12 ? 57  TYR E N   1 
ATOM   8483  C  CA  . TYR E  1 48  ? -81.033  75.010  35.394  1.00 20.60 ? 57  TYR E CA  1 
ATOM   8484  C  C   . TYR E  1 48  ? -82.093  73.939  35.473  1.00 19.56 ? 57  TYR E C   1 
ATOM   8485  O  O   . TYR E  1 48  ? -83.288  74.228  35.425  1.00 19.67 ? 57  TYR E O   1 
ATOM   8486  C  CB  . TYR E  1 48  ? -80.469  75.253  36.825  1.00 21.27 ? 57  TYR E CB  1 
ATOM   8487  C  CG  . TYR E  1 48  ? -81.361  76.158  37.673  1.00 21.08 ? 57  TYR E CG  1 
ATOM   8488  C  CD1 . TYR E  1 48  ? -82.565  75.696  38.182  1.00 22.07 ? 57  TYR E CD1 1 
ATOM   8489  C  CD2 . TYR E  1 48  ? -81.023  77.485  37.894  1.00 22.83 ? 57  TYR E CD2 1 
ATOM   8490  C  CE1 . TYR E  1 48  ? -83.388  76.533  38.895  1.00 23.02 ? 57  TYR E CE1 1 
ATOM   8491  C  CE2 . TYR E  1 48  ? -81.860  78.342  38.574  1.00 21.16 ? 57  TYR E CE2 1 
ATOM   8492  C  CZ  . TYR E  1 48  ? -83.012  77.862  39.063  1.00 22.28 ? 57  TYR E CZ  1 
ATOM   8493  O  OH  . TYR E  1 48  ? -83.808  78.681  39.806  1.00 26.97 ? 57  TYR E OH  1 
ATOM   8494  N  N   . GLY E  1 49  ? -81.654  72.706  35.667  1.00 17.31 ? 58  GLY E N   1 
ATOM   8495  C  CA  . GLY E  1 49  ? -82.572  71.628  35.945  1.00 18.18 ? 58  GLY E CA  1 
ATOM   8496  C  C   . GLY E  1 49  ? -82.974  71.600  37.409  1.00 20.30 ? 58  GLY E C   1 
ATOM   8497  O  O   . GLY E  1 49  ? -84.112  71.310  37.729  1.00 21.28 ? 58  GLY E O   1 
ATOM   8498  N  N   . ASP E  1 50  ? -82.019  71.866  38.287  1.00 20.94 ? 59  ASP E N   1 
ATOM   8499  C  CA  . ASP E  1 50  ? -82.242  71.857  39.728  1.00 22.41 ? 59  ASP E CA  1 
ATOM   8500  C  C   . ASP E  1 50  ? -81.330  72.903  40.291  1.00 21.86 ? 59  ASP E C   1 
ATOM   8501  O  O   . ASP E  1 50  ? -80.123  72.819  40.104  1.00 21.41 ? 59  ASP E O   1 
ATOM   8502  C  CB  . ASP E  1 50  ? -81.917  70.485  40.352  1.00 24.77 ? 59  ASP E CB  1 
ATOM   8503  C  CG  . ASP E  1 50  ? -82.206  70.409  41.871  1.00 26.71 ? 59  ASP E CG  1 
ATOM   8504  O  OD1 . ASP E  1 50  ? -83.377  70.165  42.109  1.00 29.50 ? 59  ASP E OD1 1 
ATOM   8505  O  OD2 . ASP E  1 50  ? -81.353  70.551  42.802  1.00 29.01 ? 59  ASP E OD2 1 
ATOM   8506  N  N   . GLU E  1 51  ? -81.917  73.883  40.984  1.00 22.76 ? 60  GLU E N   1 
ATOM   8507  C  CA  . GLU E  1 51  ? -81.149  75.039  41.477  1.00 24.28 ? 60  GLU E CA  1 
ATOM   8508  C  C   . GLU E  1 51  ? -79.905  74.668  42.313  1.00 21.99 ? 60  GLU E C   1 
ATOM   8509  O  O   . GLU E  1 51  ? -78.882  75.341  42.230  1.00 20.05 ? 60  GLU E O   1 
ATOM   8510  C  CB  . GLU E  1 51  ? -82.028  75.966  42.292  1.00 26.53 ? 60  GLU E CB  1 
ATOM   8511  C  CG  . GLU E  1 51  ? -81.395  77.328  42.513  1.00 29.19 ? 60  GLU E CG  1 
ATOM   8512  C  CD  . GLU E  1 51  ? -82.324  78.265  43.262  1.00 30.95 ? 60  GLU E CD  1 
ATOM   8513  O  OE1 . GLU E  1 51  ? -81.960  78.992  44.218  1.00 32.11 ? 60  GLU E OE1 1 
ATOM   8514  O  OE2 . GLU E  1 51  ? -83.466  78.251  42.855  1.00 35.34 ? 60  GLU E OE2 1 
ATOM   8515  N  N   . GLU E  1 52  ? -80.017  73.579  43.078  1.00 22.73 ? 61  GLU E N   1 
ATOM   8516  C  CA  . GLU E  1 52  ? -78.912  73.095  43.952  1.00 27.20 ? 61  GLU E CA  1 
ATOM   8517  C  C   . GLU E  1 52  ? -77.958  72.132  43.278  1.00 22.94 ? 61  GLU E C   1 
ATOM   8518  O  O   . GLU E  1 52  ? -76.753  72.345  43.272  1.00 21.36 ? 61  GLU E O   1 
ATOM   8519  C  CB  . GLU E  1 52  ? -79.424  72.415  45.242  1.00 33.71 ? 61  GLU E CB  1 
ATOM   8520  C  CG  . GLU E  1 52  ? -79.799  73.396  46.281  1.00 41.15 ? 61  GLU E CG  1 
ATOM   8521  C  CD  . GLU E  1 52  ? -78.493  74.101  46.714  1.00 51.21 ? 61  GLU E CD  1 
ATOM   8522  O  OE1 . GLU E  1 52  ? -78.528  75.231  46.342  1.00 57.21 ? 61  GLU E OE1 1 
ATOM   8523  O  OE2 . GLU E  1 52  ? -77.419  73.614  47.315  1.00 55.31 ? 61  GLU E OE2 1 
ATOM   8524  N  N   . LYS E  1 53  ? -78.509  71.094  42.664  1.00 20.19 ? 62  LYS E N   1 
ATOM   8525  C  CA  . LYS E  1 53  ? -77.653  70.105  41.996  1.00 20.07 ? 62  LYS E CA  1 
ATOM   8526  C  C   . LYS E  1 53  ? -76.738  70.730  40.947  1.00 16.75 ? 62  LYS E C   1 
ATOM   8527  O  O   . LYS E  1 53  ? -75.573  70.374  40.826  1.00 16.45 ? 62  LYS E O   1 
ATOM   8528  C  CB  . LYS E  1 53  ? -78.480  69.002  41.361  1.00 19.84 ? 62  LYS E CB  1 
ATOM   8529  C  CG  . LYS E  1 53  ? -79.191  68.141  42.369  1.00 21.79 ? 62  LYS E CG  1 
ATOM   8530  C  CD  . LYS E  1 53  ? -80.000  67.085  41.622  1.00 22.95 ? 62  LYS E CD  1 
ATOM   8531  C  CE  . LYS E  1 53  ? -80.863  66.327  42.592  1.00 23.31 ? 62  LYS E CE  1 
ATOM   8532  N  NZ  . LYS E  1 53  ? -81.820  65.541  41.758  1.00 26.20 ? 62  LYS E NZ  1 
ATOM   8533  N  N   . ASP E  1 54  ? -77.274  71.678  40.220  1.00 17.74 ? 63  ASP E N   1 
ATOM   8534  C  CA  . ASP E  1 54  ? -76.579  72.234  39.032  1.00 18.42 ? 63  ASP E CA  1 
ATOM   8535  C  C   . ASP E  1 54  ? -75.656  73.401  39.349  1.00 17.53 ? 63  ASP E C   1 
ATOM   8536  O  O   . ASP E  1 54  ? -75.175  74.085  38.468  1.00 16.79 ? 63  ASP E O   1 
ATOM   8537  C  CB  . ASP E  1 54  ? -77.606  72.557  37.932  1.00 19.09 ? 63  ASP E CB  1 
ATOM   8538  C  CG  . ASP E  1 54  ? -78.258  71.281  37.384  1.00 21.34 ? 63  ASP E CG  1 
ATOM   8539  O  OD1 . ASP E  1 54  ? -77.462  70.321  37.064  1.00 19.35 ? 63  ASP E OD1 1 
ATOM   8540  O  OD2 . ASP E  1 54  ? -79.519  71.224  37.240  1.00 19.32 ? 63  ASP E OD2 1 
ATOM   8541  N  N   . LYS E  1 55  ? -75.388  73.591  40.628  1.00 18.83 ? 64  LYS E N   1 
ATOM   8542  C  CA  . LYS E  1 55  ? -74.296  74.463  41.017  1.00 19.00 ? 64  LYS E CA  1 
ATOM   8543  C  C   . LYS E  1 55  ? -72.941  73.915  40.592  1.00 17.54 ? 64  LYS E C   1 
ATOM   8544  O  O   . LYS E  1 55  ? -72.641  72.710  40.746  1.00 16.65 ? 64  LYS E O   1 
ATOM   8545  C  CB  . LYS E  1 55  ? -74.279  74.667  42.517  1.00 21.84 ? 64  LYS E CB  1 
ATOM   8546  C  CG  . LYS E  1 55  ? -75.514  75.325  43.088  1.00 24.05 ? 64  LYS E CG  1 
ATOM   8547  C  CD  . LYS E  1 55  ? -75.130  76.345  44.148  1.00 26.45 ? 64  LYS E CD  1 
ATOM   8548  C  CE  . LYS E  1 55  ? -76.163  76.545  45.259  1.00 26.89 ? 64  LYS E CE  1 
ATOM   8549  N  NZ  . LYS E  1 55  ? -77.289  77.460  45.026  1.00 30.57 ? 64  LYS E NZ  1 
ATOM   8550  N  N   . GLY E  1 56  ? -72.129  74.804  40.055  1.00 15.51 ? 65  GLY E N   1 
ATOM   8551  C  CA  . GLY E  1 56  ? -70.793  74.469  39.625  1.00 15.52 ? 65  GLY E CA  1 
ATOM   8552  C  C   . GLY E  1 56  ? -69.942  75.722  39.570  1.00 16.14 ? 65  GLY E C   1 
ATOM   8553  O  O   . GLY E  1 56  ? -70.325  76.759  40.053  1.00 17.08 ? 65  GLY E O   1 
ATOM   8554  N  N   . LEU E  1 57  ? -68.733  75.610  39.072  1.00 15.79 ? 66  LEU E N   1 
ATOM   8555  C  CA  . LEU E  1 57  ? -67.838  76.727  39.057  1.00 15.95 ? 66  LEU E CA  1 
ATOM   8556  C  C   . LEU E  1 57  ? -68.116  77.544  37.837  1.00 16.67 ? 66  LEU E C   1 
ATOM   8557  O  O   . LEU E  1 57  ? -68.010  77.058  36.714  1.00 17.04 ? 66  LEU E O   1 
ATOM   8558  C  CB  . LEU E  1 57  ? -66.388  76.285  38.993  1.00 15.95 ? 66  LEU E CB  1 
ATOM   8559  C  CG  . LEU E  1 57  ? -65.917  75.489  40.210  1.00 16.27 ? 66  LEU E CG  1 
ATOM   8560  C  CD1 . LEU E  1 57  ? -64.584  74.811  39.898  1.00 16.97 ? 66  LEU E CD1 1 
ATOM   8561  C  CD2 . LEU E  1 57  ? -65.765  76.426  41.399  1.00 16.29 ? 66  LEU E CD2 1 
ATOM   8562  N  N   . GLN E  1 58  ? -68.398  78.812  38.063  1.00 16.65 ? 67  GLN E N   1 
ATOM   8563  C  CA  . GLN E  1 58  ? -68.756  79.727  36.975  1.00 18.02 ? 67  GLN E CA  1 
ATOM   8564  C  C   . GLN E  1 58  ? -67.709  80.799  36.806  1.00 16.07 ? 67  GLN E C   1 
ATOM   8565  O  O   . GLN E  1 58  ? -67.336  81.452  37.775  1.00 18.91 ? 67  GLN E O   1 
ATOM   8566  C  CB  . GLN E  1 58  ? -70.108  80.373  37.249  1.00 19.11 ? 67  GLN E CB  1 
ATOM   8567  C  CG  . GLN E  1 58  ? -70.579  81.312  36.136  1.00 22.05 ? 67  GLN E CG  1 
ATOM   8568  C  CD  . GLN E  1 58  ? -71.948  81.909  36.397  1.00 24.84 ? 67  GLN E CD  1 
ATOM   8569  O  OE1 . GLN E  1 58  ? -72.222  82.406  37.478  1.00 25.30 ? 67  GLN E OE1 1 
ATOM   8570  N  NE2 . GLN E  1 58  ? -72.816  81.831  35.410  1.00 27.33 ? 67  GLN E NE2 1 
ATOM   8571  N  N   . THR E  1 59  ? -67.210  80.974  35.599  1.00 14.72 ? 68  THR E N   1 
ATOM   8572  C  CA  . THR E  1 59  ? -66.352  82.108  35.309  1.00 14.59 ? 68  THR E CA  1 
ATOM   8573  C  C   . THR E  1 59  ? -67.197  83.415  35.485  1.00 16.44 ? 68  THR E C   1 
ATOM   8574  O  O   . THR E  1 59  ? -68.277  83.562  34.901  1.00 15.64 ? 68  THR E O   1 
ATOM   8575  C  CB  . THR E  1 59  ? -65.763  82.051  33.905  1.00 14.40 ? 68  THR E CB  1 
ATOM   8576  O  OG1 . THR E  1 59  ? -66.803  81.909  32.926  1.00 14.88 ? 68  THR E OG1 1 
ATOM   8577  C  CG2 . THR E  1 59  ? -64.812  80.906  33.778  1.00 15.06 ? 68  THR E CG2 1 
ATOM   8578  N  N   . SER E  1 60  ? -66.663  84.367  36.258  1.00 17.36 ? 69  SER E N   1 
ATOM   8579  C  CA  . SER E  1 60  ? -67.386  85.571  36.670  1.00 17.50 ? 69  SER E CA  1 
ATOM   8580  C  C   . SER E  1 60  ? -66.903  86.875  36.053  1.00 17.85 ? 69  SER E C   1 
ATOM   8581  O  O   . SER E  1 60  ? -67.509  87.914  36.320  1.00 20.45 ? 69  SER E O   1 
ATOM   8582  C  CB  . SER E  1 60  ? -67.354  85.721  38.186  1.00 17.34 ? 69  SER E CB  1 
ATOM   8583  O  OG  . SER E  1 60  ? -66.099  86.308  38.538  1.00 18.84 ? 69  SER E OG  1 
ATOM   8584  N  N   . GLN E  1 61  ? -65.867  86.864  35.234  1.00 16.79 ? 70  GLN E N   1 
ATOM   8585  C  CA  . GLN E  1 61  ? -65.338  88.108  34.659  1.00 17.61 ? 70  GLN E CA  1 
ATOM   8586  C  C   . GLN E  1 61  ? -64.923  87.965  33.234  1.00 18.15 ? 70  GLN E C   1 
ATOM   8587  O  O   . GLN E  1 61  ? -64.285  86.978  32.826  1.00 18.01 ? 70  GLN E O   1 
ATOM   8588  C  CB  . GLN E  1 61  ? -64.096  88.579  35.413  1.00 18.73 ? 70  GLN E CB  1 
ATOM   8589  C  CG  . GLN E  1 61  ? -64.324  88.837  36.883  1.00 21.54 ? 70  GLN E CG  1 
ATOM   8590  C  CD  . GLN E  1 61  ? -63.014  89.121  37.631  1.00 23.79 ? 70  GLN E CD  1 
ATOM   8591  O  OE1 . GLN E  1 61  ? -62.587  88.327  38.491  1.00 20.87 ? 70  GLN E OE1 1 
ATOM   8592  N  NE2 . GLN E  1 61  ? -62.383  90.253  37.315  1.00 24.23 ? 70  GLN E NE2 1 
ATOM   8593  N  N   . LYS E  1 62  ? -65.276  88.953  32.428  1.00 20.99 ? 71  LYS E N   1 
ATOM   8594  C  CA  . LYS E  1 62  ? -64.964  88.990  30.995  1.00 22.40 ? 71  LYS E CA  1 
ATOM   8595  C  C   . LYS E  1 62  ? -63.514  89.231  30.723  1.00 19.89 ? 71  LYS E C   1 
ATOM   8596  O  O   . LYS E  1 62  ? -62.867  89.918  31.452  1.00 18.51 ? 71  LYS E O   1 
ATOM   8597  C  CB  . LYS E  1 62  ? -65.665  90.119  30.250  1.00 27.65 ? 71  LYS E CB  1 
ATOM   8598  C  CG  . LYS E  1 62  ? -67.144  90.040  29.984  1.00 36.60 ? 71  LYS E CG  1 
ATOM   8599  C  CD  . LYS E  1 62  ? -67.619  91.175  29.060  1.00 38.97 ? 71  LYS E CD  1 
ATOM   8600  C  CE  . LYS E  1 62  ? -67.182  90.963  27.606  1.00 45.01 ? 71  LYS E CE  1 
ATOM   8601  N  NZ  . LYS E  1 62  ? -66.279  91.893  26.880  1.00 42.73 ? 71  LYS E NZ  1 
ATOM   8602  N  N   . ALA E  1 63  ? -63.052  88.694  29.620  1.00 18.52 ? 72  ALA E N   1 
ATOM   8603  C  CA  . ALA E  1 63  ? -61.703  88.907  29.083  1.00 17.93 ? 72  ALA E CA  1 
ATOM   8604  C  C   . ALA E  1 63  ? -60.643  88.688  30.154  1.00 19.43 ? 72  ALA E C   1 
ATOM   8605  O  O   . ALA E  1 63  ? -59.943  89.593  30.556  1.00 17.59 ? 72  ALA E O   1 
ATOM   8606  C  CB  . ALA E  1 63  ? -61.564  90.277  28.466  1.00 16.99 ? 72  ALA E CB  1 
ATOM   8607  N  N   . ARG E  1 64  ? -60.609  87.463  30.668  1.00 21.64 ? 73  ARG E N   1 
ATOM   8608  C  CA  . ARG E  1 64  ? -59.685  87.076  31.730  1.00 22.17 ? 73  ARG E CA  1 
ATOM   8609  C  C   . ARG E  1 64  ? -59.134  85.677  31.556  1.00 21.37 ? 73  ARG E C   1 
ATOM   8610  O  O   . ARG E  1 64  ? -59.784  84.791  30.974  1.00 19.28 ? 73  ARG E O   1 
ATOM   8611  C  CB  . ARG E  1 64  ? -60.357  87.170  33.103  1.00 23.74 ? 73  ARG E CB  1 
ATOM   8612  C  CG  . ARG E  1 64  ? -60.735  88.599  33.531  1.00 24.76 ? 73  ARG E CG  1 
ATOM   8613  C  CD  . ARG E  1 64  ? -59.486  89.412  33.927  1.00 24.64 ? 73  ARG E CD  1 
ATOM   8614  N  NE  . ARG E  1 64  ? -59.712  90.765  34.450  1.00 23.42 ? 73  ARG E NE  1 
ATOM   8615  C  CZ  . ARG E  1 64  ? -60.138  91.804  33.733  1.00 27.06 ? 73  ARG E CZ  1 
ATOM   8616  N  NH1 . ARG E  1 64  ? -60.415  91.690  32.423  1.00 28.21 ? 73  ARG E NH1 1 
ATOM   8617  N  NH2 . ARG E  1 64  ? -60.284  92.982  34.314  1.00 25.16 ? 73  ARG E NH2 1 
ATOM   8618  N  N   . PHE E  1 65  ? -57.915  85.502  32.061  1.00 19.92 ? 74  PHE E N   1 
ATOM   8619  C  CA  . PHE E  1 65  ? -57.353  84.182  32.285  1.00 19.46 ? 74  PHE E CA  1 
ATOM   8620  C  C   . PHE E  1 65  ? -57.860  83.642  33.604  1.00 20.81 ? 74  PHE E C   1 
ATOM   8621  O  O   . PHE E  1 65  ? -58.054  84.383  34.580  1.00 22.12 ? 74  PHE E O   1 
ATOM   8622  C  CB  . PHE E  1 65  ? -55.837  84.203  32.289  1.00 19.59 ? 74  PHE E CB  1 
ATOM   8623  C  CG  . PHE E  1 65  ? -55.236  84.482  30.935  1.00 18.63 ? 74  PHE E CG  1 
ATOM   8624  C  CD1 . PHE E  1 65  ? -55.123  83.482  29.992  1.00 18.37 ? 74  PHE E CD1 1 
ATOM   8625  C  CD2 . PHE E  1 65  ? -54.802  85.757  30.610  1.00 19.08 ? 74  PHE E CD2 1 
ATOM   8626  C  CE1 . PHE E  1 65  ? -54.574  83.747  28.738  1.00 17.80 ? 74  PHE E CE1 1 
ATOM   8627  C  CE2 . PHE E  1 65  ? -54.244  86.035  29.352  1.00 17.90 ? 74  PHE E CE2 1 
ATOM   8628  C  CZ  . PHE E  1 65  ? -54.148  85.036  28.413  1.00 17.59 ? 74  PHE E CZ  1 
ATOM   8629  N  N   . TYR E  1 66  ? -58.055  82.340  33.644  1.00 20.84 ? 75  TYR E N   1 
ATOM   8630  C  CA  . TYR E  1 66  ? -58.486  81.643  34.864  1.00 20.31 ? 75  TYR E CA  1 
ATOM   8631  C  C   . TYR E  1 66  ? -57.499  80.538  35.207  1.00 20.79 ? 75  TYR E C   1 
ATOM   8632  O  O   . TYR E  1 66  ? -56.807  80.001  34.336  1.00 24.20 ? 75  TYR E O   1 
ATOM   8633  C  CB  . TYR E  1 66  ? -59.865  81.044  34.669  1.00 20.29 ? 75  TYR E CB  1 
ATOM   8634  C  CG  . TYR E  1 66  ? -60.941  82.106  34.541  1.00 20.44 ? 75  TYR E CG  1 
ATOM   8635  C  CD1 . TYR E  1 66  ? -61.124  82.805  33.351  1.00 19.57 ? 75  TYR E CD1 1 
ATOM   8636  C  CD2 . TYR E  1 66  ? -61.752  82.411  35.630  1.00 20.99 ? 75  TYR E CD2 1 
ATOM   8637  C  CE1 . TYR E  1 66  ? -62.101  83.769  33.240  1.00 20.89 ? 75  TYR E CE1 1 
ATOM   8638  C  CE2 . TYR E  1 66  ? -62.735  83.363  35.536  1.00 21.69 ? 75  TYR E CE2 1 
ATOM   8639  C  CZ  . TYR E  1 66  ? -62.923  84.032  34.335  1.00 22.06 ? 75  TYR E CZ  1 
ATOM   8640  O  OH  . TYR E  1 66  ? -63.889  85.006  34.290  1.00 21.18 ? 75  TYR E OH  1 
ATOM   8641  N  N   . ALA E  1 67  ? -57.405  80.220  36.491  1.00 18.50 ? 76  ALA E N   1 
ATOM   8642  C  CA  . ALA E  1 67  ? -56.407  79.268  36.973  1.00 16.73 ? 76  ALA E CA  1 
ATOM   8643  C  C   . ALA E  1 67  ? -56.795  78.830  38.364  1.00 16.24 ? 76  ALA E C   1 
ATOM   8644  O  O   . ALA E  1 67  ? -56.404  79.423  39.359  1.00 18.40 ? 76  ALA E O   1 
ATOM   8645  C  CB  . ALA E  1 67  ? -55.033  79.891  36.966  1.00 16.34 ? 76  ALA E CB  1 
ATOM   8646  N  N   . LEU E  1 68  ? -57.580  77.781  38.418  1.00 15.21 ? 77  LEU E N   1 
ATOM   8647  C  CA  . LEU E  1 68  ? -58.026  77.185  39.643  1.00 15.68 ? 77  LEU E CA  1 
ATOM   8648  C  C   . LEU E  1 68  ? -57.806  75.650  39.529  1.00 15.83 ? 77  LEU E C   1 
ATOM   8649  O  O   . LEU E  1 68  ? -58.069  75.074  38.480  1.00 15.45 ? 77  LEU E O   1 
ATOM   8650  C  CB  . LEU E  1 68  ? -59.514  77.513  39.838  1.00 15.89 ? 77  LEU E CB  1 
ATOM   8651  C  CG  . LEU E  1 68  ? -60.138  77.042  41.171  1.00 17.44 ? 77  LEU E CG  1 
ATOM   8652  C  CD1 . LEU E  1 68  ? -59.795  78.001  42.308  1.00 17.29 ? 77  LEU E CD1 1 
ATOM   8653  C  CD2 . LEU E  1 68  ? -61.640  76.881  41.045  1.00 17.09 ? 77  LEU E CD2 1 
ATOM   8654  N  N   . SER E  1 69  ? -57.366  74.998  40.591  1.00 15.37 ? 78  SER E N   1 
ATOM   8655  C  CA  . SER E  1 69  ? -57.078  73.553  40.508  1.00 16.51 ? 78  SER E CA  1 
ATOM   8656  C  C   . SER E  1 69  ? -57.440  72.786  41.778  1.00 17.10 ? 78  SER E C   1 
ATOM   8657  O  O   . SER E  1 69  ? -57.546  73.339  42.881  1.00 16.26 ? 78  SER E O   1 
ATOM   8658  C  CB  . SER E  1 69  ? -55.650  73.264  40.080  1.00 16.19 ? 78  SER E CB  1 
ATOM   8659  O  OG  . SER E  1 69  ? -54.736  73.797  41.007  1.00 19.39 ? 78  SER E OG  1 
ATOM   8660  N  N   . ALA E  1 70  ? -57.683  71.502  41.585  1.00 17.74 ? 79  ALA E N   1 
ATOM   8661  C  CA  . ALA E  1 70  ? -57.988  70.578  42.691  1.00 18.40 ? 79  ALA E CA  1 
ATOM   8662  C  C   . ALA E  1 70  ? -57.030  69.356  42.675  1.00 18.34 ? 79  ALA E C   1 
ATOM   8663  O  O   . ALA E  1 70  ? -56.817  68.712  41.635  1.00 16.42 ? 79  ALA E O   1 
ATOM   8664  C  CB  . ALA E  1 70  ? -59.417  70.093  42.586  1.00 18.31 ? 79  ALA E CB  1 
ATOM   8665  N  N   . SER E  1 71  ? -56.427  69.100  43.837  1.00 19.02 ? 80  SER E N   1 
ATOM   8666  C  CA  . SER E  1 71  ? -55.552  67.956  44.029  1.00 18.33 ? 80  SER E CA  1 
ATOM   8667  C  C   . SER E  1 71  ? -56.346  66.755  44.509  1.00 17.95 ? 80  SER E C   1 
ATOM   8668  O  O   . SER E  1 71  ? -57.425  66.859  45.087  1.00 17.66 ? 80  SER E O   1 
ATOM   8669  C  CB  . SER E  1 71  ? -54.380  68.274  44.969  1.00 19.52 ? 80  SER E CB  1 
ATOM   8670  O  OG  . SER E  1 71  ? -54.847  68.387  46.307  1.00 21.04 ? 80  SER E OG  1 
ATOM   8671  N  N   . PHE E  1 72  ? -55.797  65.591  44.229  1.00 17.00 ? 81  PHE E N   1 
ATOM   8672  C  CA  . PHE E  1 72  ? -56.372  64.346  44.675  1.00 16.34 ? 81  PHE E CA  1 
ATOM   8673  C  C   . PHE E  1 72  ? -55.191  63.396  44.943  1.00 18.18 ? 81  PHE E C   1 
ATOM   8674  O  O   . PHE E  1 72  ? -54.054  63.659  44.527  1.00 16.71 ? 81  PHE E O   1 
ATOM   8675  C  CB  . PHE E  1 72  ? -57.330  63.767  43.622  1.00 15.73 ? 81  PHE E CB  1 
ATOM   8676  C  CG  . PHE E  1 72  ? -56.800  63.847  42.203  1.00 15.67 ? 81  PHE E CG  1 
ATOM   8677  C  CD1 . PHE E  1 72  ? -55.918  62.892  41.708  1.00 14.98 ? 81  PHE E CD1 1 
ATOM   8678  C  CD2 . PHE E  1 72  ? -57.178  64.887  41.368  1.00 14.32 ? 81  PHE E CD2 1 
ATOM   8679  C  CE1 . PHE E  1 72  ? -55.409  62.995  40.419  1.00 14.51 ? 81  PHE E CE1 1 
ATOM   8680  C  CE2 . PHE E  1 72  ? -56.664  64.989  40.085  1.00 14.26 ? 81  PHE E CE2 1 
ATOM   8681  C  CZ  . PHE E  1 72  ? -55.786  64.040  39.605  1.00 14.07 ? 81  PHE E CZ  1 
ATOM   8682  N  N   . GLU E  1 73  ? -55.477  62.316  45.656  1.00 20.66 ? 82  GLU E N   1 
ATOM   8683  C  CA  . GLU E  1 73  ? -54.501  61.244  45.929  1.00 24.36 ? 82  GLU E CA  1 
ATOM   8684  C  C   . GLU E  1 73  ? -53.890  60.788  44.571  1.00 23.51 ? 82  GLU E C   1 
ATOM   8685  O  O   . GLU E  1 73  ? -54.621  60.346  43.677  1.00 20.13 ? 82  GLU E O   1 
ATOM   8686  C  CB  . GLU E  1 73  ? -55.203  60.089  46.653  1.00 27.66 ? 82  GLU E CB  1 
ATOM   8687  C  CG  . GLU E  1 73  ? -54.311  58.931  47.070  1.00 33.65 ? 82  GLU E CG  1 
ATOM   8688  C  CD  . GLU E  1 73  ? -53.180  59.310  48.022  1.00 40.46 ? 82  GLU E CD  1 
ATOM   8689  O  OE1 . GLU E  1 73  ? -53.305  60.280  48.824  1.00 42.82 ? 82  GLU E OE1 1 
ATOM   8690  O  OE2 . GLU E  1 73  ? -52.152  58.607  47.972  1.00 47.47 ? 82  GLU E OE2 1 
ATOM   8691  N  N   . PRO E  1 74  ? -52.575  60.987  44.392  1.00 22.23 ? 83  PRO E N   1 
ATOM   8692  C  CA  . PRO E  1 74  ? -51.944  60.682  43.107  1.00 22.19 ? 83  PRO E CA  1 
ATOM   8693  C  C   . PRO E  1 74  ? -52.134  59.238  42.655  1.00 21.41 ? 83  PRO E C   1 
ATOM   8694  O  O   . PRO E  1 74  ? -52.365  58.339  43.456  1.00 20.50 ? 83  PRO E O   1 
ATOM   8695  C  CB  . PRO E  1 74  ? -50.451  60.965  43.346  1.00 23.19 ? 83  PRO E CB  1 
ATOM   8696  C  CG  . PRO E  1 74  ? -50.413  61.911  44.475  1.00 23.62 ? 83  PRO E CG  1 
ATOM   8697  C  CD  . PRO E  1 74  ? -51.642  61.634  45.326  1.00 22.61 ? 83  PRO E CD  1 
ATOM   8698  N  N   . PHE E  1 75  ? -52.139  59.053  41.341  1.00 22.42 ? 84  PHE E N   1 
ATOM   8699  C  CA  . PHE E  1 75  ? -52.301  57.743  40.758  1.00 21.73 ? 84  PHE E CA  1 
ATOM   8700  C  C   . PHE E  1 75  ? -51.586  57.735  39.400  1.00 20.99 ? 84  PHE E C   1 
ATOM   8701  O  O   . PHE E  1 75  ? -51.215  58.763  38.865  1.00 17.77 ? 84  PHE E O   1 
ATOM   8702  C  CB  . PHE E  1 75  ? -53.788  57.344  40.637  1.00 21.80 ? 84  PHE E CB  1 
ATOM   8703  C  CG  . PHE E  1 75  ? -54.511  57.999  39.480  1.00 24.05 ? 84  PHE E CG  1 
ATOM   8704  C  CD1 . PHE E  1 75  ? -55.011  59.286  39.589  1.00 23.43 ? 84  PHE E CD1 1 
ATOM   8705  C  CD2 . PHE E  1 75  ? -54.663  57.331  38.271  1.00 24.37 ? 84  PHE E CD2 1 
ATOM   8706  C  CE1 . PHE E  1 75  ? -55.649  59.885  38.514  1.00 24.73 ? 84  PHE E CE1 1 
ATOM   8707  C  CE2 . PHE E  1 75  ? -55.283  57.935  37.183  1.00 25.31 ? 84  PHE E CE2 1 
ATOM   8708  C  CZ  . PHE E  1 75  ? -55.794  59.212  37.312  1.00 24.48 ? 84  PHE E CZ  1 
ATOM   8709  N  N   . SER E  1 76  ? -51.416  56.521  38.881  1.00 19.91 ? 85  SER E N   1 
ATOM   8710  C  CA  . SER E  1 76  ? -50.892  56.279  37.557  1.00 18.25 ? 85  SER E CA  1 
ATOM   8711  C  C   . SER E  1 76  ? -51.929  55.486  36.779  1.00 15.94 ? 85  SER E C   1 
ATOM   8712  O  O   . SER E  1 76  ? -52.647  54.674  37.343  1.00 17.40 ? 85  SER E O   1 
ATOM   8713  C  CB  . SER E  1 76  ? -49.600  55.465  37.651  1.00 18.33 ? 85  SER E CB  1 
ATOM   8714  O  OG  . SER E  1 76  ? -49.089  55.225  36.344  1.00 19.69 ? 85  SER E OG  1 
ATOM   8715  N  N   . ASN E  1 77  ? -52.021  55.734  35.491  1.00 15.00 ? 86  ASN E N   1 
ATOM   8716  C  CA  . ASN E  1 77  ? -52.934  54.957  34.614  1.00 16.15 ? 86  ASN E CA  1 
ATOM   8717  C  C   . ASN E  1 77  ? -52.268  53.725  33.974  1.00 16.43 ? 86  ASN E C   1 
ATOM   8718  O  O   . ASN E  1 77  ? -52.860  53.052  33.118  1.00 16.64 ? 86  ASN E O   1 
ATOM   8719  C  CB  . ASN E  1 77  ? -53.573  55.853  33.514  1.00 14.61 ? 86  ASN E CB  1 
ATOM   8720  C  CG  . ASN E  1 77  ? -52.564  56.457  32.613  1.00 13.29 ? 86  ASN E CG  1 
ATOM   8721  O  OD1 . ASN E  1 77  ? -51.490  56.822  33.065  1.00 13.03 ? 86  ASN E OD1 1 
ATOM   8722  N  ND2 . ASN E  1 77  ? -52.907  56.625  31.330  1.00 13.12 ? 86  ASN E ND2 1 
ATOM   8723  N  N   . LYS E  1 78  ? -51.000  53.514  34.337  1.00 18.03 ? 87  LYS E N   1 
ATOM   8724  C  CA  . LYS E  1 78  ? -50.190  52.431  33.796  1.00 20.08 ? 87  LYS E CA  1 
ATOM   8725  C  C   . LYS E  1 78  ? -50.913  51.120  33.932  1.00 17.32 ? 87  LYS E C   1 
ATOM   8726  O  O   . LYS E  1 78  ? -51.356  50.768  34.988  1.00 17.63 ? 87  LYS E O   1 
ATOM   8727  C  CB  . LYS E  1 78  ? -48.833  52.433  34.462  1.00 24.41 ? 87  LYS E CB  1 
ATOM   8728  C  CG  . LYS E  1 78  ? -47.920  51.258  34.096  1.00 32.23 ? 87  LYS E CG  1 
ATOM   8729  C  CD  . LYS E  1 78  ? -46.941  51.613  32.987  1.00 40.67 ? 87  LYS E CD  1 
ATOM   8730  C  CE  . LYS E  1 78  ? -45.817  50.619  32.921  1.00 41.87 ? 87  LYS E CE  1 
ATOM   8731  N  NZ  . LYS E  1 78  ? -45.181  50.281  34.226  1.00 40.67 ? 87  LYS E NZ  1 
ATOM   8732  N  N   . GLY E  1 79  ? -51.080  50.417  32.828  1.00 16.04 ? 88  GLY E N   1 
ATOM   8733  C  CA  . GLY E  1 79  ? -51.805  49.150  32.851  1.00 16.90 ? 88  GLY E CA  1 
ATOM   8734  C  C   . GLY E  1 79  ? -53.307  49.228  33.024  1.00 17.38 ? 88  GLY E C   1 
ATOM   8735  O  O   . GLY E  1 79  ? -53.984  48.192  33.118  1.00 17.92 ? 88  GLY E O   1 
ATOM   8736  N  N   . GLN E  1 80  ? -53.845  50.445  32.958  1.00 16.99 ? 89  GLN E N   1 
ATOM   8737  C  CA  . GLN E  1 80  ? -55.264  50.702  33.191  1.00 18.16 ? 89  GLN E CA  1 
ATOM   8738  C  C   . GLN E  1 80  ? -55.941  51.649  32.217  1.00 16.59 ? 89  GLN E C   1 
ATOM   8739  O  O   . GLN E  1 80  ? -55.312  52.420  31.515  1.00 16.89 ? 89  GLN E O   1 
ATOM   8740  C  CB  . GLN E  1 80  ? -55.426  51.383  34.564  1.00 19.60 ? 89  GLN E CB  1 
ATOM   8741  C  CG  . GLN E  1 80  ? -55.495  50.444  35.705  1.00 21.49 ? 89  GLN E CG  1 
ATOM   8742  C  CD  . GLN E  1 80  ? -55.804  51.100  37.032  1.00 22.22 ? 89  GLN E CD  1 
ATOM   8743  O  OE1 . GLN E  1 80  ? -56.726  50.685  37.718  1.00 21.06 ? 89  GLN E OE1 1 
ATOM   8744  N  NE2 . GLN E  1 80  ? -55.057  52.129  37.383  1.00 24.21 ? 89  GLN E NE2 1 
ATOM   8745  N  N   . THR E  1 81  ? -57.269  51.591  32.219  1.00 16.13 ? 90  THR E N   1 
ATOM   8746  C  CA  . THR E  1 81  ? -58.080  52.593  31.527  1.00 14.97 ? 90  THR E CA  1 
ATOM   8747  C  C   . THR E  1 81  ? -58.129  53.866  32.388  1.00 13.87 ? 90  THR E C   1 
ATOM   8748  O  O   . THR E  1 81  ? -58.239  53.819  33.613  1.00 14.27 ? 90  THR E O   1 
ATOM   8749  C  CB  . THR E  1 81  ? -59.491  52.072  31.220  1.00 15.15 ? 90  THR E CB  1 
ATOM   8750  O  OG1 . THR E  1 81  ? -59.404  50.984  30.304  1.00 13.80 ? 90  THR E OG1 1 
ATOM   8751  C  CG2 . THR E  1 81  ? -60.330  53.139  30.562  1.00 14.39 ? 90  THR E CG2 1 
ATOM   8752  N  N   . LEU E  1 82  ? -57.982  54.978  31.721  1.00 12.87 ? 91  LEU E N   1 
ATOM   8753  C  CA  . LEU E  1 82  ? -58.226  56.293  32.286  1.00 12.96 ? 91  LEU E CA  1 
ATOM   8754  C  C   . LEU E  1 82  ? -59.422  56.976  31.633  1.00 12.88 ? 91  LEU E C   1 
ATOM   8755  O  O   . LEU E  1 82  ? -59.477  57.118  30.426  1.00 12.23 ? 91  LEU E O   1 
ATOM   8756  C  CB  . LEU E  1 82  ? -57.018  57.202  32.083  1.00 13.61 ? 91  LEU E CB  1 
ATOM   8757  C  CG  . LEU E  1 82  ? -57.186  58.620  32.584  1.00 13.95 ? 91  LEU E CG  1 
ATOM   8758  C  CD1 . LEU E  1 82  ? -57.369  58.693  34.093  1.00 14.18 ? 91  LEU E CD1 1 
ATOM   8759  C  CD2 . LEU E  1 82  ? -56.017  59.481  32.164  1.00 14.06 ? 91  LEU E CD2 1 
ATOM   8760  N  N   . VAL E  1 83  ? -60.366  57.389  32.471  1.00 12.93 ? 92  VAL E N   1 
ATOM   8761  C  CA  . VAL E  1 83  ? -61.533  58.146  32.037  1.00 13.06 ? 92  VAL E CA  1 
ATOM   8762  C  C   . VAL E  1 83  ? -61.605  59.503  32.758  1.00 13.03 ? 92  VAL E C   1 
ATOM   8763  O  O   . VAL E  1 83  ? -61.592  59.576  34.010  1.00 11.95 ? 92  VAL E O   1 
ATOM   8764  C  CB  . VAL E  1 83  ? -62.865  57.426  32.303  1.00 13.61 ? 92  VAL E CB  1 
ATOM   8765  C  CG1 . VAL E  1 83  ? -63.996  58.203  31.622  1.00 13.77 ? 92  VAL E CG1 1 
ATOM   8766  C  CG2 . VAL E  1 83  ? -62.837  55.978  31.802  1.00 13.26 ? 92  VAL E CG2 1 
ATOM   8767  N  N   . VAL E  1 84  ? -61.643  60.542  31.943  1.00 12.63 ? 93  VAL E N   1 
ATOM   8768  C  CA  . VAL E  1 84  ? -61.796  61.925  32.386  1.00 14.45 ? 93  VAL E CA  1 
ATOM   8769  C  C   . VAL E  1 84  ? -63.151  62.445  31.873  1.00 14.47 ? 93  VAL E C   1 
ATOM   8770  O  O   . VAL E  1 84  ? -63.404  62.469  30.650  1.00 15.32 ? 93  VAL E O   1 
ATOM   8771  C  CB  . VAL E  1 84  ? -60.731  62.832  31.779  1.00 15.32 ? 93  VAL E CB  1 
ATOM   8772  C  CG1 . VAL E  1 84  ? -60.833  64.201  32.380  1.00 15.77 ? 93  VAL E CG1 1 
ATOM   8773  C  CG2 . VAL E  1 84  ? -59.356  62.286  32.101  1.00 17.20 ? 93  VAL E CG2 1 
ATOM   8774  N  N   . GLN E  1 85  ? -63.978  62.908  32.781  1.00 13.02 ? 94  GLN E N   1 
ATOM   8775  C  CA  . GLN E  1 85  ? -65.319  63.370  32.411  1.00 12.87 ? 94  GLN E CA  1 
ATOM   8776  C  C   . GLN E  1 85  ? -65.743  64.611  33.234  1.00 12.49 ? 94  GLN E C   1 
ATOM   8777  O  O   . GLN E  1 85  ? -65.437  64.733  34.407  1.00 11.24 ? 94  GLN E O   1 
ATOM   8778  C  CB  . GLN E  1 85  ? -66.272  62.202  32.590  1.00 12.27 ? 94  GLN E CB  1 
ATOM   8779  C  CG  . GLN E  1 85  ? -67.722  62.511  32.392  1.00 12.41 ? 94  GLN E CG  1 
ATOM   8780  C  CD  . GLN E  1 85  ? -68.578  61.267  32.371  1.00 12.51 ? 94  GLN E CD  1 
ATOM   8781  O  OE1 . GLN E  1 85  ? -68.469  60.442  31.447  1.00 13.52 ? 94  GLN E OE1 1 
ATOM   8782  N  NE2 . GLN E  1 85  ? -69.375  61.089  33.389  1.00 11.53 ? 94  GLN E NE2 1 
ATOM   8783  N  N   . PHE E  1 86  ? -66.501  65.503  32.597  1.00 13.53 ? 95  PHE E N   1 
ATOM   8784  C  CA  . PHE E  1 86  ? -67.103  66.666  33.291  1.00 13.61 ? 95  PHE E CA  1 
ATOM   8785  C  C   . PHE E  1 86  ? -68.210  67.278  32.436  1.00 15.38 ? 95  PHE E C   1 
ATOM   8786  O  O   . PHE E  1 86  ? -68.319  66.983  31.224  1.00 16.81 ? 95  PHE E O   1 
ATOM   8787  C  CB  . PHE E  1 86  ? -66.023  67.713  33.616  1.00 13.35 ? 95  PHE E CB  1 
ATOM   8788  C  CG  . PHE E  1 86  ? -65.257  68.168  32.435  1.00 13.40 ? 95  PHE E CG  1 
ATOM   8789  C  CD1 . PHE E  1 86  ? -64.308  67.380  31.876  1.00 14.20 ? 95  PHE E CD1 1 
ATOM   8790  C  CD2 . PHE E  1 86  ? -65.534  69.381  31.824  1.00 15.05 ? 95  PHE E CD2 1 
ATOM   8791  C  CE1 . PHE E  1 86  ? -63.612  67.773  30.746  1.00 14.41 ? 95  PHE E CE1 1 
ATOM   8792  C  CE2 . PHE E  1 86  ? -64.850  69.788  30.690  1.00 14.18 ? 95  PHE E CE2 1 
ATOM   8793  C  CZ  . PHE E  1 86  ? -63.902  68.978  30.145  1.00 14.66 ? 95  PHE E CZ  1 
ATOM   8794  N  N   . THR E  1 87  ? -69.033  68.136  33.047  1.00 16.43 ? 96  THR E N   1 
ATOM   8795  C  CA  . THR E  1 87  ? -70.037  68.902  32.288  1.00 15.93 ? 96  THR E CA  1 
ATOM   8796  C  C   . THR E  1 87  ? -69.565  70.334  32.092  1.00 18.24 ? 96  THR E C   1 
ATOM   8797  O  O   . THR E  1 87  ? -68.888  70.926  32.928  1.00 17.56 ? 96  THR E O   1 
ATOM   8798  C  CB  . THR E  1 87  ? -71.444  68.876  32.887  1.00 15.22 ? 96  THR E CB  1 
ATOM   8799  O  OG1 . THR E  1 87  ? -71.426  69.428  34.218  1.00 15.88 ? 96  THR E OG1 1 
ATOM   8800  C  CG2 . THR E  1 87  ? -72.000  67.499  32.927  1.00 14.31 ? 96  THR E CG2 1 
ATOM   8801  N  N   . VAL E  1 88  ? -69.892  70.865  30.912  1.00 20.75 ? 97  VAL E N   1 
ATOM   8802  C  CA  . VAL E  1 88  ? -69.650  72.260  30.537  1.00 21.23 ? 97  VAL E CA  1 
ATOM   8803  C  C   . VAL E  1 88  ? -70.959  72.887  30.019  1.00 23.40 ? 97  VAL E C   1 
ATOM   8804  O  O   . VAL E  1 88  ? -71.660  72.331  29.153  1.00 22.42 ? 97  VAL E O   1 
ATOM   8805  C  CB  . VAL E  1 88  ? -68.605  72.388  29.435  1.00 20.49 ? 97  VAL E CB  1 
ATOM   8806  C  CG1 . VAL E  1 88  ? -68.289  73.819  29.163  1.00 20.85 ? 97  VAL E CG1 1 
ATOM   8807  C  CG2 . VAL E  1 88  ? -67.345  71.705  29.874  1.00 21.54 ? 97  VAL E CG2 1 
ATOM   8808  N  N   . LYS E  1 89  ? -71.241  74.092  30.527  1.00 23.84 ? 98  LYS E N   1 
ATOM   8809  C  CA  . LYS E  1 89  ? -72.413  74.877  30.134  1.00 22.44 ? 98  LYS E CA  1 
ATOM   8810  C  C   . LYS E  1 89  ? -72.020  76.310  29.813  1.00 21.42 ? 98  LYS E C   1 
ATOM   8811  O  O   . LYS E  1 89  ? -71.744  77.104  30.706  1.00 21.94 ? 98  LYS E O   1 
ATOM   8812  C  CB  . LYS E  1 89  ? -73.405  74.848  31.256  1.00 24.49 ? 98  LYS E CB  1 
ATOM   8813  C  CG  . LYS E  1 89  ? -74.628  75.726  31.061  1.00 24.38 ? 98  LYS E CG  1 
ATOM   8814  C  CD  . LYS E  1 89  ? -75.507  75.509  32.252  1.00 26.40 ? 98  LYS E CD  1 
ATOM   8815  C  CE  . LYS E  1 89  ? -76.676  76.421  32.355  1.00 29.56 ? 98  LYS E CE  1 
ATOM   8816  N  NZ  . LYS E  1 89  ? -77.190  76.409  33.750  1.00 36.53 ? 98  LYS E NZ  1 
ATOM   8817  N  N   . HIS E  1 90  ? -72.009  76.652  28.537  1.00 20.26 ? 99  HIS E N   1 
ATOM   8818  C  CA  . HIS E  1 90  ? -71.748  78.004  28.124  1.00 20.44 ? 99  HIS E CA  1 
ATOM   8819  C  C   . HIS E  1 90  ? -73.081  78.790  28.067  1.00 21.17 ? 99  HIS E C   1 
ATOM   8820  O  O   . HIS E  1 90  ? -73.539  79.155  27.003  1.00 18.94 ? 99  HIS E O   1 
ATOM   8821  C  CB  . HIS E  1 90  ? -71.115  78.047  26.759  1.00 20.66 ? 99  HIS E CB  1 
ATOM   8822  C  CG  . HIS E  1 90  ? -69.786  77.412  26.681  1.00 22.93 ? 99  HIS E CG  1 
ATOM   8823  N  ND1 . HIS E  1 90  ? -68.726  77.807  27.472  1.00 22.93 ? 99  HIS E ND1 1 
ATOM   8824  C  CD2 . HIS E  1 90  ? -69.326  76.395  25.897  1.00 24.51 ? 99  HIS E CD2 1 
ATOM   8825  C  CE1 . HIS E  1 90  ? -67.662  77.079  27.160  1.00 23.45 ? 99  HIS E CE1 1 
ATOM   8826  N  NE2 . HIS E  1 90  ? -67.996  76.221  26.206  1.00 24.90 ? 99  HIS E NE2 1 
ATOM   8827  N  N   . GLU E  1 91  ? -73.654  79.028  29.247  1.00 22.43 ? 100 GLU E N   1 
ATOM   8828  C  CA  . GLU E  1 91  ? -74.865  79.802  29.481  1.00 24.49 ? 100 GLU E CA  1 
ATOM   8829  C  C   . GLU E  1 91  ? -74.909  81.162  28.791  1.00 24.09 ? 100 GLU E C   1 
ATOM   8830  O  O   . GLU E  1 91  ? -75.932  81.582  28.309  1.00 28.30 ? 100 GLU E O   1 
ATOM   8831  C  CB  . GLU E  1 91  ? -75.065  79.970  30.989  1.00 27.09 ? 100 GLU E CB  1 
ATOM   8832  C  CG  . GLU E  1 91  ? -76.254  80.777  31.462  1.00 31.33 ? 100 GLU E CG  1 
ATOM   8833  C  CD  . GLU E  1 91  ? -76.630  80.528  32.911  1.00 32.99 ? 100 GLU E CD  1 
ATOM   8834  O  OE1 . GLU E  1 91  ? -76.019  79.649  33.576  1.00 39.31 ? 100 GLU E OE1 1 
ATOM   8835  O  OE2 . GLU E  1 91  ? -77.541  81.236  33.391  1.00 30.80 ? 100 GLU E OE2 1 
ATOM   8836  N  N   . GLN E  1 92  ? -73.771  81.797  28.653  1.00 23.21 ? 101 GLN E N   1 
ATOM   8837  C  CA  . GLN E  1 92  ? -73.694  83.133  28.097  1.00 23.25 ? 101 GLN E CA  1 
ATOM   8838  C  C   . GLN E  1 92  ? -73.716  83.217  26.580  1.00 25.03 ? 101 GLN E C   1 
ATOM   8839  O  O   . GLN E  1 92  ? -73.503  84.287  26.003  1.00 26.77 ? 101 GLN E O   1 
ATOM   8840  C  CB  . GLN E  1 92  ? -72.394  83.773  28.574  1.00 22.18 ? 101 GLN E CB  1 
ATOM   8841  C  CG  . GLN E  1 92  ? -71.115  83.253  27.886  1.00 21.86 ? 101 GLN E CG  1 
ATOM   8842  C  CD  . GLN E  1 92  ? -70.525  81.984  28.556  1.00 21.06 ? 101 GLN E CD  1 
ATOM   8843  O  OE1 . GLN E  1 92  ? -71.260  81.073  28.922  1.00 18.06 ? 101 GLN E OE1 1 
ATOM   8844  N  NE2 . GLN E  1 92  ? -69.202  81.938  28.700  1.00 19.85 ? 101 GLN E NE2 1 
ATOM   8845  N  N   . ASN E  1 93  ? -73.841  82.087  25.904  1.00 29.07 ? 102 ASN E N   1 
ATOM   8846  C  CA  . ASN E  1 93  ? -73.592  82.036  24.429  1.00 26.87 ? 102 ASN E CA  1 
ATOM   8847  C  C   . ASN E  1 93  ? -72.237  82.592  24.093  1.00 25.19 ? 102 ASN E C   1 
ATOM   8848  O  O   . ASN E  1 93  ? -72.088  83.731  23.625  1.00 25.88 ? 102 ASN E O   1 
ATOM   8849  C  CB  . ASN E  1 93  ? -74.673  82.812  23.680  1.00 28.83 ? 102 ASN E CB  1 
ATOM   8850  C  CG  . ASN E  1 93  ? -75.993  82.101  23.709  1.00 30.69 ? 102 ASN E CG  1 
ATOM   8851  O  OD1 . ASN E  1 93  ? -76.931  82.600  24.308  1.00 28.89 ? 102 ASN E OD1 1 
ATOM   8852  N  ND2 . ASN E  1 93  ? -76.052  80.879  23.139  1.00 31.10 ? 102 ASN E ND2 1 
ATOM   8853  N  N   . ILE E  1 94  ? -71.233  81.763  24.316  1.00 24.23 ? 103 ILE E N   1 
ATOM   8854  C  CA  . ILE E  1 94  ? -69.860  82.220  24.306  1.00 23.76 ? 103 ILE E CA  1 
ATOM   8855  C  C   . ILE E  1 94  ? -69.425  82.607  22.891  1.00 22.65 ? 103 ILE E C   1 
ATOM   8856  O  O   . ILE E  1 94  ? -69.823  81.985  21.937  1.00 23.65 ? 103 ILE E O   1 
ATOM   8857  C  CB  . ILE E  1 94  ? -68.910  81.186  24.967  1.00 23.75 ? 103 ILE E CB  1 
ATOM   8858  C  CG1 . ILE E  1 94  ? -67.521  81.756  25.166  1.00 23.95 ? 103 ILE E CG1 1 
ATOM   8859  C  CG2 . ILE E  1 94  ? -68.814  79.889  24.140  1.00 23.67 ? 103 ILE E CG2 1 
ATOM   8860  C  CD1 . ILE E  1 94  ? -66.715  81.032  26.241  1.00 25.77 ? 103 ILE E CD1 1 
ATOM   8861  N  N   . ASP E  1 95  ? -68.594  83.632  22.786  1.00 22.40 ? 104 ASP E N   1 
ATOM   8862  C  CA  . ASP E  1 95  ? -68.021  84.060  21.501  1.00 23.38 ? 104 ASP E CA  1 
ATOM   8863  C  C   . ASP E  1 95  ? -66.638  83.438  21.304  1.00 23.19 ? 104 ASP E C   1 
ATOM   8864  O  O   . ASP E  1 95  ? -66.312  82.895  20.259  1.00 22.21 ? 104 ASP E O   1 
ATOM   8865  C  CB  . ASP E  1 95  ? -67.943  85.624  21.397  1.00 25.24 ? 104 ASP E CB  1 
ATOM   8866  C  CG  . ASP E  1 95  ? -67.346  86.331  22.694  1.00 28.62 ? 104 ASP E CG  1 
ATOM   8867  O  OD1 . ASP E  1 95  ? -66.951  85.658  23.687  1.00 27.71 ? 104 ASP E OD1 1 
ATOM   8868  O  OD2 . ASP E  1 95  ? -67.276  87.582  22.715  1.00 29.60 ? 104 ASP E OD2 1 
ATOM   8869  N  N   . CYS E  1 96  ? -65.823  83.543  22.341  1.00 23.83 ? 105 CYS E N   1 
ATOM   8870  C  CA  . CYS E  1 96  ? -64.467  83.030  22.333  1.00 25.90 ? 105 CYS E CA  1 
ATOM   8871  C  C   . CYS E  1 96  ? -64.058  82.694  23.768  1.00 25.35 ? 105 CYS E C   1 
ATOM   8872  O  O   . CYS E  1 96  ? -64.119  83.534  24.667  1.00 21.58 ? 105 CYS E O   1 
ATOM   8873  C  CB  . CYS E  1 96  ? -63.516  84.006  21.692  1.00 28.69 ? 105 CYS E CB  1 
ATOM   8874  S  SG  . CYS E  1 96  ? -61.810  83.446  21.586  1.00 38.30 ? 105 CYS E SG  1 
ATOM   8875  N  N   . GLY E  1 97  ? -63.679  81.425  23.981  1.00 25.10 ? 106 GLY E N   1 
ATOM   8876  C  CA  . GLY E  1 97  ? -63.204  80.937  25.299  1.00 23.11 ? 106 GLY E CA  1 
ATOM   8877  C  C   . GLY E  1 97  ? -63.130  79.422  25.442  1.00 20.94 ? 106 GLY E C   1 
ATOM   8878  O  O   . GLY E  1 97  ? -63.818  78.699  24.740  1.00 19.97 ? 106 GLY E O   1 
ATOM   8879  N  N   . GLY E  1 98  ? -62.233  78.968  26.315  1.00 18.24 ? 107 GLY E N   1 
ATOM   8880  C  CA  . GLY E  1 98  ? -61.974  77.564  26.524  1.00 16.72 ? 107 GLY E CA  1 
ATOM   8881  C  C   . GLY E  1 98  ? -62.953  76.983  27.491  1.00 16.98 ? 107 GLY E C   1 
ATOM   8882  O  O   . GLY E  1 98  ? -63.557  77.700  28.324  1.00 17.52 ? 107 GLY E O   1 
ATOM   8883  N  N   . GLY E  1 99  ? -63.132  75.679  27.390  1.00 16.64 ? 108 GLY E N   1 
ATOM   8884  C  CA  . GLY E  1 99  ? -63.965  74.918  28.349  1.00 17.07 ? 108 GLY E CA  1 
ATOM   8885  C  C   . GLY E  1 99  ? -63.330  73.578  28.682  1.00 16.89 ? 108 GLY E C   1 
ATOM   8886  O  O   . GLY E  1 99  ? -64.004  72.628  29.036  1.00 16.84 ? 108 GLY E O   1 
ATOM   8887  N  N   . TYR E  1 100 ? -62.011  73.555  28.666  1.00 17.59 ? 109 TYR E N   1 
ATOM   8888  C  CA  . TYR E  1 100 ? -61.265  72.313  28.820  1.00 18.66 ? 109 TYR E CA  1 
ATOM   8889  C  C   . TYR E  1 100 ? -60.600  72.193  30.185  1.00 18.39 ? 109 TYR E C   1 
ATOM   8890  O  O   . TYR E  1 100 ? -60.290  73.193  30.828  1.00 20.63 ? 109 TYR E O   1 
ATOM   8891  C  CB  . TYR E  1 100 ? -60.232  72.151  27.695  1.00 17.83 ? 109 TYR E CB  1 
ATOM   8892  C  CG  . TYR E  1 100 ? -59.456  73.373  27.431  1.00 17.96 ? 109 TYR E CG  1 
ATOM   8893  C  CD1 . TYR E  1 100 ? -58.407  73.721  28.246  1.00 18.20 ? 109 TYR E CD1 1 
ATOM   8894  C  CD2 . TYR E  1 100 ? -59.762  74.202  26.353  1.00 19.16 ? 109 TYR E CD2 1 
ATOM   8895  C  CE1 . TYR E  1 100 ? -57.651  74.857  27.994  1.00 18.96 ? 109 TYR E CE1 1 
ATOM   8896  C  CE2 . TYR E  1 100 ? -59.038  75.369  26.108  1.00 19.24 ? 109 TYR E CE2 1 
ATOM   8897  C  CZ  . TYR E  1 100 ? -57.988  75.688  26.938  1.00 19.64 ? 109 TYR E CZ  1 
ATOM   8898  O  OH  . TYR E  1 100 ? -57.243  76.826  26.707  1.00 21.74 ? 109 TYR E OH  1 
ATOM   8899  N  N   . VAL E  1 101 ? -60.299  70.960  30.551  1.00 17.94 ? 110 VAL E N   1 
ATOM   8900  C  CA  . VAL E  1 101 ? -59.505  70.658  31.729  1.00 17.92 ? 110 VAL E CA  1 
ATOM   8901  C  C   . VAL E  1 101 ? -58.100  70.220  31.387  1.00 17.54 ? 110 VAL E C   1 
ATOM   8902  O  O   . VAL E  1 101 ? -57.767  69.861  30.277  1.00 18.59 ? 110 VAL E O   1 
ATOM   8903  C  CB  . VAL E  1 101 ? -60.171  69.614  32.634  1.00 18.53 ? 110 VAL E CB  1 
ATOM   8904  C  CG1 . VAL E  1 101 ? -61.586  70.053  33.026  1.00 18.96 ? 110 VAL E CG1 1 
ATOM   8905  C  CG2 . VAL E  1 101 ? -60.207  68.236  31.991  1.00 19.33 ? 110 VAL E CG2 1 
ATOM   8906  N  N   . LYS E  1 102 ? -57.258  70.245  32.404  1.00 18.70 ? 111 LYS E N   1 
ATOM   8907  C  CA  . LYS E  1 102 ? -55.912  69.706  32.327  1.00 16.71 ? 111 LYS E CA  1 
ATOM   8908  C  C   . LYS E  1 102 ? -55.625  68.838  33.512  1.00 17.06 ? 111 LYS E C   1 
ATOM   8909  O  O   . LYS E  1 102 ? -55.950  69.172  34.645  1.00 14.29 ? 111 LYS E O   1 
ATOM   8910  C  CB  . LYS E  1 102 ? -54.914  70.783  32.349  1.00 17.14 ? 111 LYS E CB  1 
ATOM   8911  C  CG  . LYS E  1 102 ? -55.038  71.687  31.172  1.00 17.87 ? 111 LYS E CG  1 
ATOM   8912  C  CD  . LYS E  1 102 ? -53.889  72.674  31.190  1.00 19.89 ? 111 LYS E CD  1 
ATOM   8913  C  CE  . LYS E  1 102 ? -54.263  73.901  30.400  1.00 21.68 ? 111 LYS E CE  1 
ATOM   8914  N  NZ  . LYS E  1 102 ? -53.125  74.354  29.584  1.00 22.56 ? 111 LYS E NZ  1 
ATOM   8915  N  N   . LEU E  1 103 ? -54.983  67.709  33.218  1.00 18.21 ? 112 LEU E N   1 
ATOM   8916  C  CA  . LEU E  1 103 ? -54.510  66.796  34.239  1.00 16.81 ? 112 LEU E CA  1 
ATOM   8917  C  C   . LEU E  1 103 ? -53.015  66.953  34.362  1.00 15.91 ? 112 LEU E C   1 
ATOM   8918  O  O   . LEU E  1 103 ? -52.276  66.797  33.369  1.00 16.05 ? 112 LEU E O   1 
ATOM   8919  C  CB  . LEU E  1 103 ? -54.831  65.368  33.876  1.00 17.77 ? 112 LEU E CB  1 
ATOM   8920  C  CG  . LEU E  1 103 ? -56.282  64.959  33.771  1.00 19.22 ? 112 LEU E CG  1 
ATOM   8921  C  CD1 . LEU E  1 103 ? -56.632  63.475  33.490  1.00 20.23 ? 112 LEU E CD1 1 
ATOM   8922  C  CD2 . LEU E  1 103 ? -56.921  65.349  35.079  1.00 20.26 ? 112 LEU E CD2 1 
ATOM   8923  N  N   . PHE E  1 104 ? -52.585  67.204  35.587  1.00 15.38 ? 113 PHE E N   1 
ATOM   8924  C  CA  . PHE E  1 104 ? -51.182  67.526  35.896  1.00 16.70 ? 113 PHE E CA  1 
ATOM   8925  C  C   . PHE E  1 104 ? -50.531  66.468  36.785  1.00 17.19 ? 113 PHE E C   1 
ATOM   8926  O  O   . PHE E  1 104 ? -51.221  65.833  37.622  1.00 15.40 ? 113 PHE E O   1 
ATOM   8927  C  CB  . PHE E  1 104 ? -51.098  68.838  36.700  1.00 17.13 ? 113 PHE E CB  1 
ATOM   8928  C  CG  . PHE E  1 104 ? -51.427  70.055  35.905  1.00 16.99 ? 113 PHE E CG  1 
ATOM   8929  C  CD1 . PHE E  1 104 ? -50.447  70.706  35.179  1.00 15.27 ? 113 PHE E CD1 1 
ATOM   8930  C  CD2 . PHE E  1 104 ? -52.727  70.580  35.908  1.00 15.60 ? 113 PHE E CD2 1 
ATOM   8931  C  CE1 . PHE E  1 104 ? -50.745  71.864  34.489  1.00 15.49 ? 113 PHE E CE1 1 
ATOM   8932  C  CE2 . PHE E  1 104 ? -53.000  71.742  35.224  1.00 15.47 ? 113 PHE E CE2 1 
ATOM   8933  C  CZ  . PHE E  1 104 ? -52.016  72.376  34.500  1.00 14.42 ? 113 PHE E CZ  1 
ATOM   8934  N  N   . PRO E  1 105 ? -49.199  66.317  36.653  1.00 17.94 ? 114 PRO E N   1 
ATOM   8935  C  CA  . PRO E  1 105 ? -48.449  65.573  37.645  1.00 19.86 ? 114 PRO E CA  1 
ATOM   8936  C  C   . PRO E  1 105 ? -48.533  66.221  39.003  1.00 22.93 ? 114 PRO E C   1 
ATOM   8937  O  O   . PRO E  1 105 ? -48.727  67.438  39.112  1.00 25.74 ? 114 PRO E O   1 
ATOM   8938  C  CB  . PRO E  1 105 ? -47.000  65.653  37.164  1.00 19.42 ? 114 PRO E CB  1 
ATOM   8939  C  CG  . PRO E  1 105 ? -46.952  66.643  36.072  1.00 18.98 ? 114 PRO E CG  1 
ATOM   8940  C  CD  . PRO E  1 105 ? -48.340  66.991  35.665  1.00 19.26 ? 114 PRO E CD  1 
ATOM   8941  N  N   . ASN E  1 106 ? -48.385  65.414  40.041  1.00 25.26 ? 115 ASN E N   1 
ATOM   8942  C  CA  . ASN E  1 106 ? -48.372  65.917  41.413  1.00 27.29 ? 115 ASN E CA  1 
ATOM   8943  C  C   . ASN E  1 106 ? -47.240  66.868  41.743  1.00 25.58 ? 115 ASN E C   1 
ATOM   8944  O  O   . ASN E  1 106 ? -47.257  67.512  42.773  1.00 26.80 ? 115 ASN E O   1 
ATOM   8945  C  CB  . ASN E  1 106 ? -48.303  64.780  42.405  1.00 31.25 ? 115 ASN E CB  1 
ATOM   8946  C  CG  . ASN E  1 106 ? -48.907  65.159  43.742  1.00 36.60 ? 115 ASN E CG  1 
ATOM   8947  O  OD1 . ASN E  1 106 ? -49.979  65.802  43.816  1.00 40.57 ? 115 ASN E OD1 1 
ATOM   8948  N  ND2 . ASN E  1 106 ? -48.258  64.719  44.816  1.00 37.38 ? 115 ASN E ND2 1 
ATOM   8949  N  N   . SER E  1 107 ? -46.256  66.979  40.878  1.00 24.04 ? 116 SER E N   1 
ATOM   8950  C  CA  . SER E  1 107 ? -45.186  67.951  41.081  1.00 24.99 ? 116 SER E CA  1 
ATOM   8951  C  C   . SER E  1 107 ? -45.602  69.394  40.796  1.00 24.08 ? 116 SER E C   1 
ATOM   8952  O  O   . SER E  1 107 ? -44.808  70.314  40.970  1.00 26.65 ? 116 SER E O   1 
ATOM   8953  C  CB  . SER E  1 107 ? -44.016  67.602  40.171  1.00 24.85 ? 116 SER E CB  1 
ATOM   8954  O  OG  . SER E  1 107 ? -44.452  67.646  38.825  1.00 24.99 ? 116 SER E OG  1 
ATOM   8955  N  N   . LEU E  1 108 ? -46.806  69.600  40.275  1.00 22.28 ? 117 LEU E N   1 
ATOM   8956  C  CA  . LEU E  1 108 ? -47.276  70.964  40.005  1.00 21.73 ? 117 LEU E CA  1 
ATOM   8957  C  C   . LEU E  1 108 ? -47.487  71.744  41.302  1.00 21.59 ? 117 LEU E C   1 
ATOM   8958  O  O   . LEU E  1 108 ? -48.170  71.273  42.238  1.00 18.87 ? 117 LEU E O   1 
ATOM   8959  C  CB  . LEU E  1 108 ? -48.593  70.954  39.234  1.00 22.01 ? 117 LEU E CB  1 
ATOM   8960  C  CG  . LEU E  1 108 ? -49.233  72.335  39.022  1.00 21.88 ? 117 LEU E CG  1 
ATOM   8961  C  CD1 . LEU E  1 108 ? -48.578  73.078  37.872  1.00 22.38 ? 117 LEU E CD1 1 
ATOM   8962  C  CD2 . LEU E  1 108 ? -50.728  72.236  38.802  1.00 21.90 ? 117 LEU E CD2 1 
ATOM   8963  N  N   . ASP E  1 109 ? -46.911  72.939  41.347  1.00 20.40 ? 118 ASP E N   1 
ATOM   8964  C  CA  . ASP E  1 109 ? -47.238  73.909  42.408  1.00 21.44 ? 118 ASP E CA  1 
ATOM   8965  C  C   . ASP E  1 109 ? -48.536  74.625  42.023  1.00 19.47 ? 118 ASP E C   1 
ATOM   8966  O  O   . ASP E  1 109 ? -48.565  75.457  41.114  1.00 18.11 ? 118 ASP E O   1 
ATOM   8967  C  CB  . ASP E  1 109 ? -46.084  74.904  42.551  1.00 25.32 ? 118 ASP E CB  1 
ATOM   8968  C  CG  . ASP E  1 109 ? -46.330  75.976  43.631  1.00 28.56 ? 118 ASP E CG  1 
ATOM   8969  O  OD1 . ASP E  1 109 ? -47.360  75.945  44.351  1.00 30.03 ? 118 ASP E OD1 1 
ATOM   8970  O  OD2 . ASP E  1 109 ? -45.478  76.884  43.706  1.00 36.82 ? 118 ASP E OD2 1 
ATOM   8971  N  N   . GLN E  1 110 ? -49.614  74.264  42.707  1.00 20.99 ? 119 GLN E N   1 
ATOM   8972  C  CA  . GLN E  1 110 ? -50.982  74.764  42.403  1.00 20.60 ? 119 GLN E CA  1 
ATOM   8973  C  C   . GLN E  1 110 ? -51.079  76.295  42.510  1.00 21.10 ? 119 GLN E C   1 
ATOM   8974  O  O   . GLN E  1 110 ? -51.852  76.934  41.785  1.00 21.52 ? 119 GLN E O   1 
ATOM   8975  C  CB  . GLN E  1 110 ? -52.005  74.149  43.339  1.00 18.47 ? 119 GLN E CB  1 
ATOM   8976  C  CG  . GLN E  1 110 ? -52.276  72.714  43.039  1.00 19.70 ? 119 GLN E CG  1 
ATOM   8977  C  CD  . GLN E  1 110 ? -53.327  72.129  43.922  1.00 19.40 ? 119 GLN E CD  1 
ATOM   8978  O  OE1 . GLN E  1 110 ? -54.539  72.275  43.680  1.00 20.65 ? 119 GLN E OE1 1 
ATOM   8979  N  NE2 . GLN E  1 110 ? -52.889  71.517  44.979  1.00 18.64 ? 119 GLN E NE2 1 
ATOM   8980  N  N   . THR E  1 111 ? -50.287  76.874  43.417  1.00 22.49 ? 120 THR E N   1 
ATOM   8981  C  CA  . THR E  1 111 ? -50.275  78.345  43.605  1.00 22.84 ? 120 THR E CA  1 
ATOM   8982  C  C   . THR E  1 111 ? -49.461  79.049  42.516  1.00 20.50 ? 120 THR E C   1 
ATOM   8983  O  O   . THR E  1 111 ? -49.431  80.263  42.467  1.00 19.98 ? 120 THR E O   1 
ATOM   8984  C  CB  . THR E  1 111 ? -49.743  78.783  44.980  1.00 23.79 ? 120 THR E CB  1 
ATOM   8985  O  OG1 . THR E  1 111 ? -48.325  78.585  45.014  1.00 26.50 ? 120 THR E OG1 1 
ATOM   8986  C  CG2 . THR E  1 111 ? -50.433  78.027  46.132  1.00 25.09 ? 120 THR E CG2 1 
ATOM   8987  N  N   . ASP E  1 112 ? -48.823  78.293  41.624  1.00 21.90 ? 121 ASP E N   1 
ATOM   8988  C  CA  . ASP E  1 112 ? -48.130  78.908  40.457  1.00 24.61 ? 121 ASP E CA  1 
ATOM   8989  C  C   . ASP E  1 112 ? -48.640  78.405  39.096  1.00 23.62 ? 121 ASP E C   1 
ATOM   8990  O  O   . ASP E  1 112 ? -48.029  78.690  38.042  1.00 26.60 ? 121 ASP E O   1 
ATOM   8991  C  CB  . ASP E  1 112 ? -46.631  78.685  40.535  1.00 26.85 ? 121 ASP E CB  1 
ATOM   8992  C  CG  . ASP E  1 112 ? -45.847  79.580  39.561  1.00 29.63 ? 121 ASP E CG  1 
ATOM   8993  O  OD1 . ASP E  1 112 ? -46.182  80.773  39.433  1.00 33.80 ? 121 ASP E OD1 1 
ATOM   8994  O  OD2 . ASP E  1 112 ? -44.899  79.083  38.932  1.00 33.20 ? 121 ASP E OD2 1 
ATOM   8995  N  N   . MET E  1 113 ? -49.759  77.694  39.105  1.00 21.32 ? 122 MET E N   1 
ATOM   8996  C  CA  . MET E  1 113 ? -50.307  77.164  37.852  1.00 23.14 ? 122 MET E CA  1 
ATOM   8997  C  C   . MET E  1 113 ? -50.545  78.299  36.860  1.00 23.32 ? 122 MET E C   1 
ATOM   8998  O  O   . MET E  1 113 ? -51.112  79.351  37.211  1.00 22.28 ? 122 MET E O   1 
ATOM   8999  C  CB  . MET E  1 113 ? -51.627  76.408  38.076  1.00 21.84 ? 122 MET E CB  1 
ATOM   9000  C  CG  . MET E  1 113 ? -52.196  75.781  36.817  1.00 20.81 ? 122 MET E CG  1 
ATOM   9001  S  SD  . MET E  1 113 ? -53.722  74.874  37.103  1.00 24.88 ? 122 MET E SD  1 
ATOM   9002  C  CE  . MET E  1 113 ? -54.998  76.114  37.321  1.00 23.53 ? 122 MET E CE  1 
ATOM   9003  N  N   . HIS E  1 114 ? -50.143  78.056  35.621  1.00 24.38 ? 123 HIS E N   1 
ATOM   9004  C  CA  . HIS E  1 114 ? -50.497  78.951  34.510  1.00 25.69 ? 123 HIS E CA  1 
ATOM   9005  C  C   . HIS E  1 114 ? -50.462  78.245  33.129  1.00 27.15 ? 123 HIS E C   1 
ATOM   9006  O  O   . HIS E  1 114 ? -50.148  77.072  33.026  1.00 28.41 ? 123 HIS E O   1 
ATOM   9007  C  CB  . HIS E  1 114 ? -49.608  80.166  34.539  1.00 23.95 ? 123 HIS E CB  1 
ATOM   9008  C  CG  . HIS E  1 114 ? -48.163  79.844  34.382  1.00 24.90 ? 123 HIS E CG  1 
ATOM   9009  N  ND1 . HIS E  1 114 ? -47.421  79.246  35.388  1.00 24.01 ? 123 HIS E ND1 1 
ATOM   9010  C  CD2 . HIS E  1 114 ? -47.307  80.072  33.359  1.00 23.65 ? 123 HIS E CD2 1 
ATOM   9011  C  CE1 . HIS E  1 114 ? -46.168  79.140  34.995  1.00 22.78 ? 123 HIS E CE1 1 
ATOM   9012  N  NE2 . HIS E  1 114 ? -46.073  79.625  33.767  1.00 25.25 ? 123 HIS E NE2 1 
ATOM   9013  N  N   . GLY E  1 115 ? -50.756  79.002  32.079  1.00 27.84 ? 124 GLY E N   1 
ATOM   9014  C  CA  . GLY E  1 115 ? -50.789  78.499  30.732  1.00 26.20 ? 124 GLY E CA  1 
ATOM   9015  C  C   . GLY E  1 115 ? -49.590  77.669  30.340  1.00 28.00 ? 124 GLY E C   1 
ATOM   9016  O  O   . GLY E  1 115 ? -49.689  76.822  29.479  1.00 32.63 ? 124 GLY E O   1 
ATOM   9017  N  N   . ASP E  1 116 ? -48.435  77.920  30.910  1.00 28.06 ? 125 ASP E N   1 
ATOM   9018  C  CA  . ASP E  1 116 ? -47.226  77.195  30.477  1.00 28.79 ? 125 ASP E CA  1 
ATOM   9019  C  C   . ASP E  1 116 ? -46.777  76.150  31.448  1.00 28.56 ? 125 ASP E C   1 
ATOM   9020  O  O   . ASP E  1 116 ? -45.714  75.601  31.288  1.00 24.22 ? 125 ASP E O   1 
ATOM   9021  C  CB  . ASP E  1 116 ? -46.079  78.159  30.219  1.00 33.04 ? 125 ASP E CB  1 
ATOM   9022  C  CG  . ASP E  1 116 ? -46.300  78.985  28.973  1.00 37.35 ? 125 ASP E CG  1 
ATOM   9023  O  OD1 . ASP E  1 116 ? -47.386  78.881  28.354  1.00 38.27 ? 125 ASP E OD1 1 
ATOM   9024  O  OD2 . ASP E  1 116 ? -45.380  79.760  28.621  1.00 49.18 ? 125 ASP E OD2 1 
ATOM   9025  N  N   . SER E  1 117 ? -47.560  75.913  32.498  1.00 28.32 ? 126 SER E N   1 
ATOM   9026  C  CA  . SER E  1 117 ? -47.242  74.817  33.404  1.00 30.20 ? 126 SER E CA  1 
ATOM   9027  C  C   . SER E  1 117 ? -47.334  73.468  32.624  1.00 30.74 ? 126 SER E C   1 
ATOM   9028  O  O   . SER E  1 117 ? -48.160  73.329  31.689  1.00 29.78 ? 126 SER E O   1 
ATOM   9029  C  CB  . SER E  1 117 ? -48.176  74.814  34.627  1.00 32.01 ? 126 SER E CB  1 
ATOM   9030  O  OG  . SER E  1 117 ? -48.163  76.061  35.300  1.00 33.43 ? 126 SER E OG  1 
ATOM   9031  N  N   . GLU E  1 118 ? -46.474  72.519  32.991  1.00 26.29 ? 127 GLU E N   1 
ATOM   9032  C  CA  . GLU E  1 118 ? -46.379  71.243  32.286  1.00 28.44 ? 127 GLU E CA  1 
ATOM   9033  C  C   . GLU E  1 118 ? -47.479  70.286  32.753  1.00 25.01 ? 127 GLU E C   1 
ATOM   9034  O  O   . GLU E  1 118 ? -47.521  69.856  33.906  1.00 25.29 ? 127 GLU E O   1 
ATOM   9035  C  CB  . GLU E  1 118 ? -45.001  70.623  32.475  1.00 33.54 ? 127 GLU E CB  1 
ATOM   9036  C  CG  . GLU E  1 118 ? -44.749  69.406  31.596  1.00 38.03 ? 127 GLU E CG  1 
ATOM   9037  C  CD  . GLU E  1 118 ? -43.432  68.688  31.913  1.00 42.84 ? 127 GLU E CD  1 
ATOM   9038  O  OE1 . GLU E  1 118 ? -43.064  68.474  33.096  1.00 55.68 ? 127 GLU E OE1 1 
ATOM   9039  O  OE2 . GLU E  1 118 ? -42.738  68.323  30.963  1.00 43.20 ? 127 GLU E OE2 1 
ATOM   9040  N  N   . TYR E  1 119 ? -48.408  69.984  31.859  1.00 20.26 ? 128 TYR E N   1 
ATOM   9041  C  CA  . TYR E  1 119 ? -49.463  69.032  32.168  1.00 17.83 ? 128 TYR E CA  1 
ATOM   9042  C  C   . TYR E  1 119 ? -49.194  67.702  31.442  1.00 15.90 ? 128 TYR E C   1 
ATOM   9043  O  O   . TYR E  1 119 ? -48.358  67.634  30.548  1.00 13.84 ? 128 TYR E O   1 
ATOM   9044  C  CB  . TYR E  1 119 ? -50.847  69.607  31.795  1.00 18.25 ? 128 TYR E CB  1 
ATOM   9045  C  CG  . TYR E  1 119 ? -50.912  70.032  30.348  1.00 17.36 ? 128 TYR E CG  1 
ATOM   9046  C  CD1 . TYR E  1 119 ? -51.141  69.089  29.345  1.00 17.22 ? 128 TYR E CD1 1 
ATOM   9047  C  CD2 . TYR E  1 119 ? -50.683  71.363  29.968  1.00 17.48 ? 128 TYR E CD2 1 
ATOM   9048  C  CE1 . TYR E  1 119 ? -51.182  69.465  28.025  1.00 16.88 ? 128 TYR E CE1 1 
ATOM   9049  C  CE2 . TYR E  1 119 ? -50.748  71.751  28.635  1.00 16.21 ? 128 TYR E CE2 1 
ATOM   9050  C  CZ  . TYR E  1 119 ? -50.986  70.791  27.680  1.00 16.20 ? 128 TYR E CZ  1 
ATOM   9051  O  OH  . TYR E  1 119 ? -51.056  71.073  26.368  1.00 15.97 ? 128 TYR E OH  1 
ATOM   9052  N  N   . ASN E  1 120 ? -49.942  66.675  31.827  1.00 13.86 ? 129 ASN E N   1 
ATOM   9053  C  CA  . ASN E  1 120 ? -49.894  65.387  31.137  1.00 13.84 ? 129 ASN E CA  1 
ATOM   9054  C  C   . ASN E  1 120 ? -50.851  65.323  29.946  1.00 13.15 ? 129 ASN E C   1 
ATOM   9055  O  O   . ASN E  1 120 ? -50.490  64.910  28.856  1.00 12.10 ? 129 ASN E O   1 
ATOM   9056  C  CB  . ASN E  1 120 ? -50.223  64.242  32.125  1.00 13.37 ? 129 ASN E CB  1 
ATOM   9057  C  CG  . ASN E  1 120 ? -49.123  64.037  33.140  1.00 13.58 ? 129 ASN E CG  1 
ATOM   9058  O  OD1 . ASN E  1 120 ? -47.972  64.424  32.907  1.00 13.91 ? 129 ASN E OD1 1 
ATOM   9059  N  ND2 . ASN E  1 120 ? -49.459  63.437  34.272  1.00 14.24 ? 129 ASN E ND2 1 
ATOM   9060  N  N   . ILE E  1 121 ? -52.109  65.664  30.235  1.00 13.56 ? 130 ILE E N   1 
ATOM   9061  C  CA  . ILE E  1 121 ? -53.205  65.616  29.280  1.00 14.26 ? 130 ILE E CA  1 
ATOM   9062  C  C   . ILE E  1 121 ? -54.085  66.865  29.394  1.00 15.15 ? 130 ILE E C   1 
ATOM   9063  O  O   . ILE E  1 121 ? -54.379  67.323  30.485  1.00 14.89 ? 130 ILE E O   1 
ATOM   9064  C  CB  . ILE E  1 121 ? -54.106  64.384  29.520  1.00 14.21 ? 130 ILE E CB  1 
ATOM   9065  C  CG1 . ILE E  1 121 ? -53.338  63.096  29.303  1.00 14.52 ? 130 ILE E CG1 1 
ATOM   9066  C  CG2 . ILE E  1 121 ? -55.294  64.389  28.584  1.00 14.60 ? 130 ILE E CG2 1 
ATOM   9067  C  CD1 . ILE E  1 121 ? -54.051  61.879  29.836  1.00 15.26 ? 130 ILE E CD1 1 
ATOM   9068  N  N   . MET E  1 122 ? -54.516  67.375  28.247  1.00 17.70 ? 131 MET E N   1 
ATOM   9069  C  CA  . MET E  1 122 ? -55.543  68.419  28.165  1.00 19.02 ? 131 MET E CA  1 
ATOM   9070  C  C   . MET E  1 122 ? -56.716  67.944  27.334  1.00 17.19 ? 131 MET E C   1 
ATOM   9071  O  O   . MET E  1 122 ? -56.541  67.393  26.258  1.00 17.14 ? 131 MET E O   1 
ATOM   9072  C  CB  . MET E  1 122 ? -54.979  69.687  27.535  1.00 23.21 ? 131 MET E CB  1 
ATOM   9073  C  CG  . MET E  1 122 ? -56.042  70.747  27.279  1.00 28.17 ? 131 MET E CG  1 
ATOM   9074  S  SD  . MET E  1 122 ? -55.225  72.237  26.654  1.00 36.91 ? 131 MET E SD  1 
ATOM   9075  C  CE  . MET E  1 122 ? -56.344  72.727  25.348  1.00 38.85 ? 131 MET E CE  1 
ATOM   9076  N  N   . PHE E  1 123 ? -57.917  68.208  27.821  1.00 14.90 ? 132 PHE E N   1 
ATOM   9077  C  CA  . PHE E  1 123 ? -59.084  67.710  27.165  1.00 12.93 ? 132 PHE E CA  1 
ATOM   9078  C  C   . PHE E  1 123 ? -60.275  68.622  27.294  1.00 12.37 ? 132 PHE E C   1 
ATOM   9079  O  O   . PHE E  1 123 ? -60.668  68.976  28.405  1.00 12.83 ? 132 PHE E O   1 
ATOM   9080  C  CB  . PHE E  1 123 ? -59.469  66.360  27.749  1.00 11.38 ? 132 PHE E CB  1 
ATOM   9081  C  CG  . PHE E  1 123 ? -60.791  65.872  27.266  1.00 10.38 ? 132 PHE E CG  1 
ATOM   9082  C  CD1 . PHE E  1 123 ? -60.996  65.636  25.920  1.00 10.56 ? 132 PHE E CD1 1 
ATOM   9083  C  CD2 . PHE E  1 123 ? -61.813  65.624  28.151  1.00 10.04 ? 132 PHE E CD2 1 
ATOM   9084  C  CE1 . PHE E  1 123 ? -62.205  65.165  25.463  1.00 9.98  ? 132 PHE E CE1 1 
ATOM   9085  C  CE2 . PHE E  1 123 ? -63.024  65.145  27.700  1.00 9.96  ? 132 PHE E CE2 1 
ATOM   9086  C  CZ  . PHE E  1 123 ? -63.218  64.932  26.350  1.00 9.69  ? 132 PHE E CZ  1 
ATOM   9087  N  N   . GLY E  1 124 ? -60.900  68.935  26.169  1.00 12.32 ? 133 GLY E N   1 
ATOM   9088  C  CA  . GLY E  1 124 ? -62.249  69.532  26.212  1.00 13.11 ? 133 GLY E CA  1 
ATOM   9089  C  C   . GLY E  1 124 ? -62.530  70.608  25.173  1.00 12.83 ? 133 GLY E C   1 
ATOM   9090  O  O   . GLY E  1 124 ? -61.680  70.886  24.334  1.00 12.04 ? 133 GLY E O   1 
ATOM   9091  N  N   . PRO E  1 125 ? -63.726  71.203  25.229  1.00 13.42 ? 134 PRO E N   1 
ATOM   9092  C  CA  . PRO E  1 125 ? -64.177  72.155  24.181  1.00 15.05 ? 134 PRO E CA  1 
ATOM   9093  C  C   . PRO E  1 125 ? -63.423  73.479  24.160  1.00 16.59 ? 134 PRO E C   1 
ATOM   9094  O  O   . PRO E  1 125 ? -63.023  74.004  25.213  1.00 16.30 ? 134 PRO E O   1 
ATOM   9095  C  CB  . PRO E  1 125 ? -65.641  72.370  24.485  1.00 14.08 ? 134 PRO E CB  1 
ATOM   9096  C  CG  . PRO E  1 125 ? -65.775  72.047  25.935  1.00 14.72 ? 134 PRO E CG  1 
ATOM   9097  C  CD  . PRO E  1 125 ? -64.766  70.960  26.229  1.00 13.91 ? 134 PRO E CD  1 
ATOM   9098  N  N   . ASP E  1 126 ? -63.176  73.968  22.950  1.00 18.92 ? 135 ASP E N   1 
ATOM   9099  C  CA  . ASP E  1 126 ? -62.568  75.263  22.734  1.00 21.57 ? 135 ASP E CA  1 
ATOM   9100  C  C   . ASP E  1 126 ? -63.294  76.005  21.590  1.00 21.78 ? 135 ASP E C   1 
ATOM   9101  O  O   . ASP E  1 126 ? -63.441  75.482  20.475  1.00 20.77 ? 135 ASP E O   1 
ATOM   9102  C  CB  . ASP E  1 126 ? -61.105  75.144  22.396  1.00 24.09 ? 135 ASP E CB  1 
ATOM   9103  C  CG  . ASP E  1 126 ? -60.344  76.494  22.525  1.00 28.35 ? 135 ASP E CG  1 
ATOM   9104  O  OD1 . ASP E  1 126 ? -60.882  77.475  23.136  1.00 30.63 ? 135 ASP E OD1 1 
ATOM   9105  O  OD2 . ASP E  1 126 ? -59.187  76.543  22.044  1.00 31.40 ? 135 ASP E OD2 1 
ATOM   9106  N  N   . ILE E  1 127 ? -63.750  77.211  21.907  1.00 20.11 ? 136 ILE E N   1 
ATOM   9107  C  CA  . ILE E  1 127 ? -64.545  77.998  20.996  1.00 20.70 ? 136 ILE E CA  1 
ATOM   9108  C  C   . ILE E  1 127 ? -63.856  79.298  20.765  1.00 22.14 ? 136 ILE E C   1 
ATOM   9109  O  O   . ILE E  1 127 ? -63.423  79.966  21.711  1.00 22.40 ? 136 ILE E O   1 
ATOM   9110  C  CB  . ILE E  1 127 ? -65.945  78.254  21.556  1.00 19.92 ? 136 ILE E CB  1 
ATOM   9111  C  CG1 . ILE E  1 127 ? -66.606  76.916  21.864  1.00 19.19 ? 136 ILE E CG1 1 
ATOM   9112  C  CG2 . ILE E  1 127 ? -66.767  79.080  20.565  1.00 21.44 ? 136 ILE E CG2 1 
ATOM   9113  C  CD1 . ILE E  1 127 ? -68.100  76.837  22.069  1.00 18.74 ? 136 ILE E CD1 1 
ATOM   9114  N  N   . CYS E  1 128 ? -63.726  79.660  19.511  1.00 24.21 ? 137 CYS E N   1 
ATOM   9115  C  CA  . CYS E  1 128 ? -63.288  81.007  19.182  1.00 29.07 ? 137 CYS E CA  1 
ATOM   9116  C  C   . CYS E  1 128 ? -63.864  81.459  17.839  1.00 30.35 ? 137 CYS E C   1 
ATOM   9117  O  O   . CYS E  1 128 ? -63.408  81.081  16.782  1.00 23.24 ? 137 CYS E O   1 
ATOM   9118  C  CB  . CYS E  1 128 ? -61.785  81.166  19.249  1.00 31.35 ? 137 CYS E CB  1 
ATOM   9119  S  SG  . CYS E  1 128 ? -61.383  82.933  19.528  1.00 39.34 ? 137 CYS E SG  1 
ATOM   9120  N  N   . GLY E  1 129 ? -64.941  82.231  17.933  1.00 38.39 ? 138 GLY E N   1 
ATOM   9121  C  CA  . GLY E  1 129 ? -65.648  82.746  16.759  1.00 43.43 ? 138 GLY E CA  1 
ATOM   9122  C  C   . GLY E  1 129 ? -66.440  81.662  16.016  1.00 51.12 ? 138 GLY E C   1 
ATOM   9123  O  O   . GLY E  1 129 ? -66.414  80.502  16.409  1.00 49.27 ? 138 GLY E O   1 
ATOM   9124  N  N   . PRO E  1 130 ? -67.239  82.036  14.994  1.00 55.38 ? 139 PRO E N   1 
ATOM   9125  C  CA  . PRO E  1 130 ? -67.928  81.003  14.163  1.00 54.11 ? 139 PRO E CA  1 
ATOM   9126  C  C   . PRO E  1 130 ? -66.989  79.903  13.565  1.00 44.67 ? 139 PRO E C   1 
ATOM   9127  O  O   . PRO E  1 130 ? -67.396  78.732  13.474  1.00 39.92 ? 139 PRO E O   1 
ATOM   9128  C  CB  . PRO E  1 130 ? -68.593  81.824  13.057  1.00 56.44 ? 139 PRO E CB  1 
ATOM   9129  C  CG  . PRO E  1 130 ? -68.398  83.287  13.361  1.00 61.94 ? 139 PRO E CG  1 
ATOM   9130  C  CD  . PRO E  1 130 ? -67.559  83.427  14.600  1.00 59.20 ? 139 PRO E CD  1 
ATOM   9131  N  N   . GLY E  1 131 ? -65.733  80.245  13.299  1.00 41.38 ? 140 GLY E N   1 
ATOM   9132  C  CA  . GLY E  1 131 ? -64.761  79.318  12.695  1.00 41.03 ? 140 GLY E CA  1 
ATOM   9133  C  C   . GLY E  1 131 ? -64.187  78.148  13.519  1.00 41.23 ? 140 GLY E C   1 
ATOM   9134  O  O   . GLY E  1 131 ? -63.816  77.138  12.952  1.00 38.92 ? 140 GLY E O   1 
ATOM   9135  N  N   . THR E  1 132 ? -64.098  78.283  14.846  1.00 41.72 ? 141 THR E N   1 
ATOM   9136  C  CA  . THR E  1 132 ? -63.539  77.240  15.737  1.00 35.09 ? 141 THR E CA  1 
ATOM   9137  C  C   . THR E  1 132 ? -64.504  76.760  16.808  1.00 31.73 ? 141 THR E C   1 
ATOM   9138  O  O   . THR E  1 132 ? -64.888  77.503  17.709  1.00 27.10 ? 141 THR E O   1 
ATOM   9139  C  CB  . THR E  1 132 ? -62.303  77.740  16.486  1.00 38.73 ? 141 THR E CB  1 
ATOM   9140  O  OG1 . THR E  1 132 ? -62.457  79.142  16.742  1.00 49.34 ? 141 THR E OG1 1 
ATOM   9141  C  CG2 . THR E  1 132 ? -61.055  77.541  15.665  1.00 38.09 ? 141 THR E CG2 1 
ATOM   9142  N  N   . LYS E  1 133 ? -64.905  75.508  16.674  1.00 29.29 ? 142 LYS E N   1 
ATOM   9143  C  CA  . LYS E  1 133 ? -65.746  74.825  17.648  1.00 29.97 ? 142 LYS E CA  1 
ATOM   9144  C  C   . LYS E  1 133 ? -65.186  73.392  17.743  1.00 27.79 ? 142 LYS E C   1 
ATOM   9145  O  O   . LYS E  1 133 ? -65.613  72.483  17.060  1.00 23.09 ? 142 LYS E O   1 
ATOM   9146  C  CB  . LYS E  1 133 ? -67.233  74.807  17.250  1.00 32.21 ? 142 LYS E CB  1 
ATOM   9147  C  CG  . LYS E  1 133 ? -68.078  76.068  17.509  1.00 38.25 ? 142 LYS E CG  1 
ATOM   9148  C  CD  . LYS E  1 133 ? -68.349  76.731  16.186  1.00 40.67 ? 142 LYS E CD  1 
ATOM   9149  C  CE  . LYS E  1 133 ? -69.329  77.849  16.205  1.00 44.61 ? 142 LYS E CE  1 
ATOM   9150  N  NZ  . LYS E  1 133 ? -70.256  77.894  15.041  1.00 46.15 ? 142 LYS E NZ  1 
ATOM   9151  N  N   . LYS E  1 134 ? -64.217  73.214  18.611  1.00 26.93 ? 143 LYS E N   1 
ATOM   9152  C  CA  . LYS E  1 134 ? -63.306  72.075  18.545  1.00 27.34 ? 143 LYS E CA  1 
ATOM   9153  C  C   . LYS E  1 134 ? -63.176  71.429  19.896  1.00 24.08 ? 143 LYS E C   1 
ATOM   9154  O  O   . LYS E  1 134 ? -63.173  72.136  20.899  1.00 24.96 ? 143 LYS E O   1 
ATOM   9155  C  CB  . LYS E  1 134 ? -61.936  72.662  18.303  1.00 30.01 ? 143 LYS E CB  1 
ATOM   9156  C  CG  . LYS E  1 134 ? -60.932  72.152  17.261  1.00 35.04 ? 143 LYS E CG  1 
ATOM   9157  C  CD  . LYS E  1 134 ? -59.442  72.649  17.422  1.00 37.86 ? 143 LYS E CD  1 
ATOM   9158  C  CE  . LYS E  1 134 ? -58.550  71.517  17.990  1.00 42.05 ? 143 LYS E CE  1 
ATOM   9159  N  NZ  . LYS E  1 134 ? -57.808  70.687  17.012  1.00 44.19 ? 143 LYS E NZ  1 
ATOM   9160  N  N   . VAL E  1 135 ? -63.001  70.104  19.912  1.00 21.88 ? 144 VAL E N   1 
ATOM   9161  C  CA  . VAL E  1 135 ? -62.586  69.390  21.107  1.00 19.98 ? 144 VAL E CA  1 
ATOM   9162  C  C   . VAL E  1 135 ? -61.095  69.051  21.086  1.00 19.61 ? 144 VAL E C   1 
ATOM   9163  O  O   . VAL E  1 135 ? -60.604  68.289  20.247  1.00 20.00 ? 144 VAL E O   1 
ATOM   9164  C  CB  . VAL E  1 135 ? -63.381  68.125  21.356  1.00 19.28 ? 144 VAL E CB  1 
ATOM   9165  C  CG1 . VAL E  1 135 ? -63.021  67.543  22.712  1.00 18.45 ? 144 VAL E CG1 1 
ATOM   9166  C  CG2 . VAL E  1 135 ? -64.876  68.407  21.303  1.00 20.43 ? 144 VAL E CG2 1 
ATOM   9167  N  N   . HIS E  1 136 ? -60.378  69.660  22.012  1.00 19.08 ? 145 HIS E N   1 
ATOM   9168  C  CA  . HIS E  1 136 ? -58.968  69.373  22.155  1.00 20.33 ? 145 HIS E CA  1 
ATOM   9169  C  C   . HIS E  1 136 ? -58.751  68.052  22.845  1.00 19.26 ? 145 HIS E C   1 
ATOM   9170  O  O   . HIS E  1 136 ? -59.348  67.777  23.877  1.00 21.98 ? 145 HIS E O   1 
ATOM   9171  C  CB  . HIS E  1 136 ? -58.280  70.422  23.002  1.00 22.90 ? 145 HIS E CB  1 
ATOM   9172  C  CG  . HIS E  1 136 ? -57.986  71.694  22.278  1.00 25.57 ? 145 HIS E CG  1 
ATOM   9173  N  ND1 . HIS E  1 136 ? -57.149  71.745  21.189  1.00 27.56 ? 145 HIS E ND1 1 
ATOM   9174  C  CD2 . HIS E  1 136 ? -58.428  72.956  22.483  1.00 25.97 ? 145 HIS E CD2 1 
ATOM   9175  C  CE1 . HIS E  1 136 ? -57.079  72.990  20.756  1.00 27.40 ? 145 HIS E CE1 1 
ATOM   9176  N  NE2 . HIS E  1 136 ? -57.846  73.742  21.527  1.00 26.67 ? 145 HIS E NE2 1 
ATOM   9177  N  N   . VAL E  1 137 ? -57.836  67.264  22.310  1.00 17.91 ? 146 VAL E N   1 
ATOM   9178  C  CA  . VAL E  1 137 ? -57.246  66.155  23.046  1.00 16.09 ? 146 VAL E CA  1 
ATOM   9179  C  C   . VAL E  1 137 ? -55.747  66.309  22.843  1.00 15.89 ? 146 VAL E C   1 
ATOM   9180  O  O   . VAL E  1 137 ? -55.223  66.072  21.758  1.00 13.81 ? 146 VAL E O   1 
ATOM   9181  C  CB  . VAL E  1 137 ? -57.736  64.808  22.535  1.00 16.14 ? 146 VAL E CB  1 
ATOM   9182  C  CG1 . VAL E  1 137 ? -57.339  63.717  23.501  1.00 16.51 ? 146 VAL E CG1 1 
ATOM   9183  C  CG2 . VAL E  1 137 ? -59.236  64.825  22.383  1.00 14.93 ? 146 VAL E CG2 1 
ATOM   9184  N  N   . ILE E  1 138 ? -55.061  66.705  23.922  1.00 16.38 ? 147 ILE E N   1 
ATOM   9185  C  CA  . ILE E  1 138 ? -53.617  66.900  23.886  1.00 16.18 ? 147 ILE E CA  1 
ATOM   9186  C  C   . ILE E  1 138 ? -52.871  65.970  24.848  1.00 16.19 ? 147 ILE E C   1 
ATOM   9187  O  O   . ILE E  1 138 ? -53.202  65.880  26.028  1.00 15.11 ? 147 ILE E O   1 
ATOM   9188  C  CB  . ILE E  1 138 ? -53.242  68.357  24.196  1.00 17.06 ? 147 ILE E CB  1 
ATOM   9189  C  CG1 . ILE E  1 138 ? -54.029  69.302  23.279  1.00 17.16 ? 147 ILE E CG1 1 
ATOM   9190  C  CG2 . ILE E  1 138 ? -51.754  68.598  24.006  1.00 16.51 ? 147 ILE E CG2 1 
ATOM   9191  C  CD1 . ILE E  1 138 ? -53.775  70.778  23.515  1.00 17.25 ? 147 ILE E CD1 1 
ATOM   9192  N  N   . PHE E  1 139 ? -51.848  65.307  24.311  1.00 15.31 ? 148 PHE E N   1 
ATOM   9193  C  CA  . PHE E  1 139 ? -50.978  64.468  25.108  1.00 17.23 ? 148 PHE E CA  1 
ATOM   9194  C  C   . PHE E  1 139 ? -49.602  65.085  25.177  1.00 16.67 ? 148 PHE E C   1 
ATOM   9195  O  O   . PHE E  1 139 ? -49.049  65.499  24.150  1.00 16.53 ? 148 PHE E O   1 
ATOM   9196  C  CB  . PHE E  1 139 ? -50.840  63.039  24.505  1.00 18.64 ? 148 PHE E CB  1 
ATOM   9197  C  CG  . PHE E  1 139 ? -51.990  62.140  24.790  1.00 18.64 ? 148 PHE E CG  1 
ATOM   9198  C  CD1 . PHE E  1 139 ? -52.019  61.397  25.942  1.00 20.71 ? 148 PHE E CD1 1 
ATOM   9199  C  CD2 . PHE E  1 139 ? -53.057  62.077  23.930  1.00 20.09 ? 148 PHE E CD2 1 
ATOM   9200  C  CE1 . PHE E  1 139 ? -53.100  60.589  26.246  1.00 21.95 ? 148 PHE E CE1 1 
ATOM   9201  C  CE2 . PHE E  1 139 ? -54.142  61.286  24.205  1.00 20.96 ? 148 PHE E CE2 1 
ATOM   9202  C  CZ  . PHE E  1 139 ? -54.177  60.535  25.368  1.00 21.63 ? 148 PHE E CZ  1 
ATOM   9203  N  N   . ASN E  1 140 ? -49.075  65.193  26.396  1.00 18.06 ? 149 ASN E N   1 
ATOM   9204  C  CA  . ASN E  1 140 ? -47.675  65.570  26.569  1.00 19.65 ? 149 ASN E CA  1 
ATOM   9205  C  C   . ASN E  1 140 ? -46.750  64.346  26.405  1.00 19.43 ? 149 ASN E C   1 
ATOM   9206  O  O   . ASN E  1 140 ? -46.870  63.356  27.135  1.00 16.82 ? 149 ASN E O   1 
ATOM   9207  C  CB  . ASN E  1 140 ? -47.436  66.199  27.924  1.00 20.37 ? 149 ASN E CB  1 
ATOM   9208  C  CG  . ASN E  1 140 ? -45.998  66.678  28.092  1.00 22.13 ? 149 ASN E CG  1 
ATOM   9209  O  OD1 . ASN E  1 140 ? -45.260  66.142  28.883  1.00 21.19 ? 149 ASN E OD1 1 
ATOM   9210  N  ND2 . ASN E  1 140 ? -45.594  67.670  27.301  1.00 23.68 ? 149 ASN E ND2 1 
ATOM   9211  N  N   . TYR E  1 141 ? -45.825  64.449  25.462  1.00 21.37 ? 150 TYR E N   1 
ATOM   9212  C  CA  . TYR E  1 141 ? -44.897  63.377  25.151  1.00 23.67 ? 150 TYR E CA  1 
ATOM   9213  C  C   . TYR E  1 141 ? -43.555  63.921  24.690  1.00 23.99 ? 150 TYR E C   1 
ATOM   9214  O  O   . TYR E  1 141 ? -43.494  64.758  23.794  1.00 23.51 ? 150 TYR E O   1 
ATOM   9215  C  CB  . TYR E  1 141 ? -45.497  62.509  24.044  1.00 25.80 ? 150 TYR E CB  1 
ATOM   9216  C  CG  . TYR E  1 141 ? -44.683  61.290  23.629  1.00 25.85 ? 150 TYR E CG  1 
ATOM   9217  C  CD1 . TYR E  1 141 ? -44.542  60.176  24.503  1.00 29.87 ? 150 TYR E CD1 1 
ATOM   9218  C  CD2 . TYR E  1 141 ? -44.067  61.230  22.398  1.00 25.85 ? 150 TYR E CD2 1 
ATOM   9219  C  CE1 . TYR E  1 141 ? -43.798  59.060  24.127  1.00 29.50 ? 150 TYR E CE1 1 
ATOM   9220  C  CE2 . TYR E  1 141 ? -43.321  60.123  22.009  1.00 26.42 ? 150 TYR E CE2 1 
ATOM   9221  C  CZ  . TYR E  1 141 ? -43.201  59.045  22.861  1.00 29.65 ? 150 TYR E CZ  1 
ATOM   9222  O  OH  . TYR E  1 141 ? -42.480  57.951  22.458  1.00 35.47 ? 150 TYR E OH  1 
ATOM   9223  N  N   . LYS E  1 142 ? -42.477  63.428  25.294  1.00 26.51 ? 151 LYS E N   1 
ATOM   9224  C  CA  . LYS E  1 142 ? -41.109  63.877  24.982  1.00 29.52 ? 151 LYS E CA  1 
ATOM   9225  C  C   . LYS E  1 142 ? -41.027  65.397  24.954  1.00 27.65 ? 151 LYS E C   1 
ATOM   9226  O  O   . LYS E  1 142 ? -40.526  65.965  23.998  1.00 25.69 ? 151 LYS E O   1 
ATOM   9227  C  CB  . LYS E  1 142 ? -40.634  63.355  23.623  1.00 32.12 ? 151 LYS E CB  1 
ATOM   9228  C  CG  . LYS E  1 142 ? -40.534  61.850  23.480  1.00 37.02 ? 151 LYS E CG  1 
ATOM   9229  C  CD  . LYS E  1 142 ? -39.549  61.224  24.444  1.00 39.74 ? 151 LYS E CD  1 
ATOM   9230  C  CE  . LYS E  1 142 ? -38.988  59.924  23.880  1.00 44.49 ? 151 LYS E CE  1 
ATOM   9231  N  NZ  . LYS E  1 142 ? -39.761  58.715  24.167  1.00 46.33 ? 151 LYS E NZ  1 
ATOM   9232  N  N   . GLY E  1 143 ? -41.578  66.032  25.982  1.00 28.58 ? 152 GLY E N   1 
ATOM   9233  C  CA  . GLY E  1 143 ? -41.494  67.481  26.140  1.00 29.28 ? 152 GLY E CA  1 
ATOM   9234  C  C   . GLY E  1 143 ? -42.179  68.285  25.050  1.00 29.04 ? 152 GLY E C   1 
ATOM   9235  O  O   . GLY E  1 143 ? -41.939  69.470  24.917  1.00 28.69 ? 152 GLY E O   1 
ATOM   9236  N  N   . LYS E  1 144 ? -43.094  67.647  24.338  1.00 29.48 ? 153 LYS E N   1 
ATOM   9237  C  CA  . LYS E  1 144 ? -43.996  68.336  23.429  1.00 29.01 ? 153 LYS E CA  1 
ATOM   9238  C  C   . LYS E  1 144 ? -45.446  68.072  23.802  1.00 25.34 ? 153 LYS E C   1 
ATOM   9239  O  O   . LYS E  1 144 ? -45.799  67.012  24.295  1.00 25.57 ? 153 LYS E O   1 
ATOM   9240  C  CB  . LYS E  1 144 ? -43.822  67.855  21.995  1.00 35.77 ? 153 LYS E CB  1 
ATOM   9241  C  CG  . LYS E  1 144 ? -42.607  68.345  21.269  1.00 39.85 ? 153 LYS E CG  1 
ATOM   9242  C  CD  . LYS E  1 144 ? -42.521  67.876  19.797  1.00 48.02 ? 153 LYS E CD  1 
ATOM   9243  C  CE  . LYS E  1 144 ? -43.388  68.819  18.922  1.00 52.90 ? 153 LYS E CE  1 
ATOM   9244  N  NZ  . LYS E  1 144 ? -42.568  69.525  17.892  1.00 51.29 ? 153 LYS E NZ  1 
ATOM   9245  N  N   . ASN E  1 145 ? -46.280  69.057  23.547  1.00 21.57 ? 154 ASN E N   1 
ATOM   9246  C  CA  . ASN E  1 145 ? -47.713  68.963  23.705  1.00 20.67 ? 154 ASN E CA  1 
ATOM   9247  C  C   . ASN E  1 145 ? -48.313  68.639  22.362  1.00 20.58 ? 154 ASN E C   1 
ATOM   9248  O  O   . ASN E  1 145 ? -48.337  69.475  21.491  1.00 22.52 ? 154 ASN E O   1 
ATOM   9249  C  CB  . ASN E  1 145 ? -48.282  70.259  24.243  1.00 20.63 ? 154 ASN E CB  1 
ATOM   9250  C  CG  . ASN E  1 145 ? -47.945  70.468  25.709  1.00 21.71 ? 154 ASN E CG  1 
ATOM   9251  O  OD1 . ASN E  1 145 ? -47.890  69.522  26.496  1.00 22.82 ? 154 ASN E OD1 1 
ATOM   9252  N  ND2 . ASN E  1 145 ? -47.780  71.706  26.090  1.00 21.80 ? 154 ASN E ND2 1 
ATOM   9253  N  N   . VAL E  1 146 ? -48.753  67.391  22.192  1.00 20.01 ? 155 VAL E N   1 
ATOM   9254  C  CA  . VAL E  1 146 ? -49.120  66.906  20.881  1.00 20.25 ? 155 VAL E CA  1 
ATOM   9255  C  C   . VAL E  1 146 ? -50.628  66.920  20.716  1.00 19.27 ? 155 VAL E C   1 
ATOM   9256  O  O   . VAL E  1 146 ? -51.363  66.415  21.569  1.00 17.18 ? 155 VAL E O   1 
ATOM   9257  C  CB  . VAL E  1 146 ? -48.556  65.496  20.619  1.00 19.92 ? 155 VAL E CB  1 
ATOM   9258  C  CG1 . VAL E  1 146 ? -48.681  65.167  19.126  1.00 19.48 ? 155 VAL E CG1 1 
ATOM   9259  C  CG2 . VAL E  1 146 ? -47.111  65.413  21.032  1.00 19.52 ? 155 VAL E CG2 1 
ATOM   9260  N  N   . LEU E  1 147 ? -51.069  67.546  19.635  1.00 19.59 ? 156 LEU E N   1 
ATOM   9261  C  CA  . LEU E  1 147 ? -52.482  67.848  19.419  1.00 21.39 ? 156 LEU E CA  1 
ATOM   9262  C  C   . LEU E  1 147 ? -53.102  66.794  18.545  1.00 19.88 ? 156 LEU E C   1 
ATOM   9263  O  O   . LEU E  1 147 ? -52.499  66.347  17.590  1.00 17.05 ? 156 LEU E O   1 
ATOM   9264  C  CB  . LEU E  1 147 ? -52.680  69.216  18.736  1.00 25.38 ? 156 LEU E CB  1 
ATOM   9265  C  CG  . LEU E  1 147 ? -52.672  70.454  19.655  1.00 29.99 ? 156 LEU E CG  1 
ATOM   9266  C  CD1 . LEU E  1 147 ? -51.262  70.734  20.151  1.00 29.34 ? 156 LEU E CD1 1 
ATOM   9267  C  CD2 . LEU E  1 147 ? -53.255  71.670  18.916  1.00 31.11 ? 156 LEU E CD2 1 
ATOM   9268  N  N   . ILE E  1 148 ? -54.322  66.405  18.863  1.00 19.38 ? 157 ILE E N   1 
ATOM   9269  C  CA  . ILE E  1 148 ? -54.966  65.355  18.059  1.00 21.19 ? 157 ILE E CA  1 
ATOM   9270  C  C   . ILE E  1 148 ? -55.131  65.869  16.642  1.00 20.02 ? 157 ILE E C   1 
ATOM   9271  O  O   . ILE E  1 148 ? -55.339  67.044  16.442  1.00 23.22 ? 157 ILE E O   1 
ATOM   9272  C  CB  . ILE E  1 148 ? -56.313  64.910  18.654  1.00 20.59 ? 157 ILE E CB  1 
ATOM   9273  C  CG1 . ILE E  1 148 ? -56.764  63.594  18.021  1.00 19.38 ? 157 ILE E CG1 1 
ATOM   9274  C  CG2 . ILE E  1 148 ? -57.346  66.039  18.507  1.00 21.82 ? 157 ILE E CG2 1 
ATOM   9275  C  CD1 . ILE E  1 148 ? -58.070  63.058  18.586  1.00 19.71 ? 157 ILE E CD1 1 
ATOM   9276  N  N   . ASN E  1 149 ? -55.003  64.990  15.672  1.00 20.92 ? 158 ASN E N   1 
ATOM   9277  C  CA  . ASN E  1 149 ? -55.056  65.354  14.218  1.00 24.09 ? 158 ASN E CA  1 
ATOM   9278  C  C   . ASN E  1 149 ? -56.446  65.160  13.630  1.00 24.32 ? 158 ASN E C   1 
ATOM   9279  O  O   . ASN E  1 149 ? -56.713  65.542  12.526  1.00 24.29 ? 158 ASN E O   1 
ATOM   9280  C  CB  . ASN E  1 149 ? -53.918  64.594  13.476  1.00 25.98 ? 158 ASN E CB  1 
ATOM   9281  C  CG  . ASN E  1 149 ? -54.208  63.114  13.298  1.00 27.90 ? 158 ASN E CG  1 
ATOM   9282  O  OD1 . ASN E  1 149 ? -55.333  62.659  13.504  1.00 29.26 ? 158 ASN E OD1 1 
ATOM   9283  N  ND2 . ASN E  1 149 ? -53.178  62.346  12.931  1.00 27.61 ? 158 ASN E ND2 1 
ATOM   9284  N  N   . LYS E  1 150 ? -57.374  64.634  14.422  1.00 24.81 ? 159 LYS E N   1 
ATOM   9285  C  CA  . LYS E  1 150 ? -58.767  64.604  14.016  1.00 25.06 ? 159 LYS E CA  1 
ATOM   9286  C  C   . LYS E  1 150 ? -59.517  65.836  14.406  1.00 25.86 ? 159 LYS E C   1 
ATOM   9287  O  O   . LYS E  1 150 ? -59.268  66.401  15.451  1.00 29.30 ? 159 LYS E O   1 
ATOM   9288  C  CB  . LYS E  1 150 ? -59.475  63.406  14.598  1.00 26.48 ? 159 LYS E CB  1 
ATOM   9289  C  CG  . LYS E  1 150 ? -59.152  62.280  13.670  1.00 30.02 ? 159 LYS E CG  1 
ATOM   9290  C  CD  . LYS E  1 150 ? -59.204  60.998  14.394  1.00 31.06 ? 159 LYS E CD  1 
ATOM   9291  C  CE  . LYS E  1 150 ? -59.495  59.911  13.457  1.00 28.13 ? 159 LYS E CE  1 
ATOM   9292  N  NZ  . LYS E  1 150 ? -59.905  58.631  14.079  1.00 26.31 ? 159 LYS E NZ  1 
ATOM   9293  N  N   . ASP E  1 151 ? -60.511  66.169  13.605  1.00 24.49 ? 160 ASP E N   1 
ATOM   9294  C  CA  . ASP E  1 151 ? -61.337  67.296  13.866  1.00 26.91 ? 160 ASP E CA  1 
ATOM   9295  C  C   . ASP E  1 151 ? -62.653  66.911  14.555  1.00 23.41 ? 160 ASP E C   1 
ATOM   9296  O  O   . ASP E  1 151 ? -63.494  66.288  13.971  1.00 25.90 ? 160 ASP E O   1 
ATOM   9297  C  CB  . ASP E  1 151 ? -61.601  68.051  12.565  1.00 29.86 ? 160 ASP E CB  1 
ATOM   9298  C  CG  . ASP E  1 151 ? -62.481  69.236  12.792  1.00 35.41 ? 160 ASP E CG  1 
ATOM   9299  O  OD1 . ASP E  1 151 ? -62.156  70.070  13.668  1.00 36.06 ? 160 ASP E OD1 1 
ATOM   9300  O  OD2 . ASP E  1 151 ? -63.546  69.280  12.151  1.00 39.39 ? 160 ASP E OD2 1 
ATOM   9301  N  N   . ILE E  1 152 ? -62.787  67.282  15.816  1.00 21.22 ? 161 ILE E N   1 
ATOM   9302  C  CA  . ILE E  1 152 ? -63.928  66.941  16.604  1.00 19.71 ? 161 ILE E CA  1 
ATOM   9303  C  C   . ILE E  1 152 ? -64.687  68.225  16.921  1.00 21.61 ? 161 ILE E C   1 
ATOM   9304  O  O   . ILE E  1 152 ? -64.151  69.141  17.520  1.00 20.81 ? 161 ILE E O   1 
ATOM   9305  C  CB  . ILE E  1 152 ? -63.531  66.248  17.920  1.00 20.30 ? 161 ILE E CB  1 
ATOM   9306  C  CG1 . ILE E  1 152 ? -62.633  65.033  17.658  1.00 18.99 ? 161 ILE E CG1 1 
ATOM   9307  C  CG2 . ILE E  1 152 ? -64.777  65.796  18.696  1.00 19.39 ? 161 ILE E CG2 1 
ATOM   9308  C  CD1 . ILE E  1 152 ? -62.023  64.464  18.911  1.00 18.49 ? 161 ILE E CD1 1 
ATOM   9309  N  N   . ARG E  1 153 ? -65.928  68.292  16.497  1.00 20.80 ? 162 ARG E N   1 
ATOM   9310  C  CA  . ARG E  1 153 ? -66.729  69.442  16.731  1.00 21.98 ? 162 ARG E CA  1 
ATOM   9311  C  C   . ARG E  1 153 ? -67.283  69.435  18.150  1.00 20.16 ? 162 ARG E C   1 
ATOM   9312  O  O   . ARG E  1 153 ? -67.749  68.416  18.637  1.00 19.83 ? 162 ARG E O   1 
ATOM   9313  C  CB  . ARG E  1 153 ? -67.832  69.552  15.684  1.00 27.23 ? 162 ARG E CB  1 
ATOM   9314  C  CG  . ARG E  1 153 ? -69.012  70.420  16.099  1.00 34.34 ? 162 ARG E CG  1 
ATOM   9315  C  CD  . ARG E  1 153 ? -69.860  70.991  14.998  1.00 38.01 ? 162 ARG E CD  1 
ATOM   9316  N  NE  . ARG E  1 153 ? -69.098  71.938  14.173  1.00 42.38 ? 162 ARG E NE  1 
ATOM   9317  C  CZ  . ARG E  1 153 ? -69.326  73.251  14.017  1.00 44.79 ? 162 ARG E CZ  1 
ATOM   9318  N  NH1 . ARG E  1 153 ? -70.393  73.849  14.550  1.00 50.22 ? 162 ARG E NH1 1 
ATOM   9319  N  NH2 . ARG E  1 153 ? -68.492  73.971  13.270  1.00 42.13 ? 162 ARG E NH2 1 
ATOM   9320  N  N   . CYS E  1 154 ? -67.213  70.575  18.828  1.00 17.98 ? 163 CYS E N   1 
ATOM   9321  C  CA  . CYS E  1 154 ? -67.773  70.654  20.150  1.00 19.36 ? 163 CYS E CA  1 
ATOM   9322  C  C   . CYS E  1 154 ? -69.186  71.221  20.079  1.00 21.80 ? 163 CYS E C   1 
ATOM   9323  O  O   . CYS E  1 154 ? -69.625  71.609  19.043  1.00 21.30 ? 163 CYS E O   1 
ATOM   9324  C  CB  . CYS E  1 154 ? -66.904  71.488  21.062  1.00 18.98 ? 163 CYS E CB  1 
ATOM   9325  S  SG  . CYS E  1 154 ? -66.924  73.258  20.756  1.00 18.92 ? 163 CYS E SG  1 
ATOM   9326  N  N   . LYS E  1 155 ? -69.905  71.214  21.194  1.00 25.16 ? 164 LYS E N   1 
ATOM   9327  C  CA  . LYS E  1 155 ? -71.215  71.889  21.272  1.00 25.30 ? 164 LYS E CA  1 
ATOM   9328  C  C   . LYS E  1 155 ? -71.025  73.377  21.541  1.00 26.32 ? 164 LYS E C   1 
ATOM   9329  O  O   . LYS E  1 155 ? -70.034  73.787  22.145  1.00 27.35 ? 164 LYS E O   1 
ATOM   9330  C  CB  . LYS E  1 155 ? -72.054  71.312  22.407  1.00 25.19 ? 164 LYS E CB  1 
ATOM   9331  C  CG  . LYS E  1 155 ? -72.298  69.823  22.280  1.00 25.66 ? 164 LYS E CG  1 
ATOM   9332  C  CD  . LYS E  1 155 ? -73.241  69.504  21.135  1.00 25.45 ? 164 LYS E CD  1 
ATOM   9333  C  CE  . LYS E  1 155 ? -73.867  68.182  21.408  1.00 27.37 ? 164 LYS E CE  1 
ATOM   9334  N  NZ  . LYS E  1 155 ? -74.648  67.688  20.259  1.00 30.89 ? 164 LYS E NZ  1 
ATOM   9335  N  N   . ASP E  1 156 ? -71.961  74.182  21.073  1.00 28.23 ? 165 ASP E N   1 
ATOM   9336  C  CA  . ASP E  1 156 ? -71.837  75.641  21.209  1.00 32.32 ? 165 ASP E CA  1 
ATOM   9337  C  C   . ASP E  1 156 ? -73.112  76.359  21.676  1.00 30.68 ? 165 ASP E C   1 
ATOM   9338  O  O   . ASP E  1 156 ? -73.086  77.558  21.838  1.00 32.83 ? 165 ASP E O   1 
ATOM   9339  C  CB  . ASP E  1 156 ? -71.385  76.281  19.910  1.00 35.43 ? 165 ASP E CB  1 
ATOM   9340  C  CG  . ASP E  1 156 ? -72.399  76.096  18.803  1.00 43.59 ? 165 ASP E CG  1 
ATOM   9341  O  OD1 . ASP E  1 156 ? -73.409  75.388  19.060  1.00 46.38 ? 165 ASP E OD1 1 
ATOM   9342  O  OD2 . ASP E  1 156 ? -72.198  76.673  17.691  1.00 55.06 ? 165 ASP E OD2 1 
ATOM   9343  N  N   . ASP E  1 157 ? -74.205  75.636  21.910  1.00 28.40 ? 166 ASP E N   1 
ATOM   9344  C  CA  . ASP E  1 157 ? -75.410  76.270  22.443  1.00 24.84 ? 166 ASP E CA  1 
ATOM   9345  C  C   . ASP E  1 157 ? -75.234  76.681  23.933  1.00 21.90 ? 166 ASP E C   1 
ATOM   9346  O  O   . ASP E  1 157 ? -74.156  76.633  24.487  1.00 23.55 ? 166 ASP E O   1 
ATOM   9347  C  CB  . ASP E  1 157 ? -76.619  75.356  22.185  1.00 23.83 ? 166 ASP E CB  1 
ATOM   9348  C  CG  . ASP E  1 157 ? -76.572  74.063  22.973  1.00 25.51 ? 166 ASP E CG  1 
ATOM   9349  O  OD1 . ASP E  1 157 ? -75.733  73.928  23.902  1.00 27.25 ? 166 ASP E OD1 1 
ATOM   9350  O  OD2 . ASP E  1 157 ? -77.422  73.189  22.715  1.00 24.93 ? 166 ASP E OD2 1 
ATOM   9351  N  N   . GLU E  1 158 ? -76.321  76.995  24.598  1.00 20.06 ? 167 GLU E N   1 
ATOM   9352  C  CA  . GLU E  1 158 ? -76.266  77.453  25.972  1.00 18.57 ? 167 GLU E CA  1 
ATOM   9353  C  C   . GLU E  1 158 ? -76.462  76.370  27.030  1.00 16.69 ? 167 GLU E C   1 
ATOM   9354  O  O   . GLU E  1 158 ? -76.468  76.656  28.211  1.00 16.85 ? 167 GLU E O   1 
ATOM   9355  C  CB  . GLU E  1 158 ? -77.293  78.586  26.173  1.00 19.05 ? 167 GLU E CB  1 
ATOM   9356  C  CG  . GLU E  1 158 ? -78.764  78.208  26.172  1.00 19.83 ? 167 GLU E CG  1 
ATOM   9357  C  CD  . GLU E  1 158 ? -79.426  78.245  24.782  1.00 21.45 ? 167 GLU E CD  1 
ATOM   9358  O  OE1 . GLU E  1 158 ? -78.868  77.668  23.830  1.00 20.11 ? 167 GLU E OE1 1 
ATOM   9359  O  OE2 . GLU E  1 158 ? -80.563  78.804  24.651  1.00 24.64 ? 167 GLU E OE2 1 
ATOM   9360  N  N   . PHE E  1 159 ? -76.692  75.134  26.610  1.00 15.84 ? 168 PHE E N   1 
ATOM   9361  C  CA  . PHE E  1 159 ? -77.101  74.063  27.549  1.00 14.94 ? 168 PHE E CA  1 
ATOM   9362  C  C   . PHE E  1 159 ? -75.906  73.286  28.101  1.00 13.26 ? 168 PHE E C   1 
ATOM   9363  O  O   . PHE E  1 159 ? -74.786  73.512  27.689  1.00 11.12 ? 168 PHE E O   1 
ATOM   9364  C  CB  . PHE E  1 159 ? -78.144  73.161  26.894  1.00 15.03 ? 168 PHE E CB  1 
ATOM   9365  C  CG  . PHE E  1 159 ? -79.401  73.912  26.491  1.00 15.16 ? 168 PHE E CG  1 
ATOM   9366  C  CD1 . PHE E  1 159 ? -80.345  74.243  27.448  1.00 15.14 ? 168 PHE E CD1 1 
ATOM   9367  C  CD2 . PHE E  1 159 ? -79.606  74.311  25.178  1.00 14.72 ? 168 PHE E CD2 1 
ATOM   9368  C  CE1 . PHE E  1 159 ? -81.479  74.976  27.100  1.00 15.89 ? 168 PHE E CE1 1 
ATOM   9369  C  CE2 . PHE E  1 159 ? -80.744  75.072  24.808  1.00 15.88 ? 168 PHE E CE2 1 
ATOM   9370  C  CZ  . PHE E  1 159 ? -81.690  75.379  25.776  1.00 15.84 ? 168 PHE E CZ  1 
ATOM   9371  N  N   . THR E  1 160 ? -76.179  72.445  29.094  1.00 13.09 ? 169 THR E N   1 
ATOM   9372  C  CA  . THR E  1 160 ? -75.149  71.648  29.747  1.00 13.32 ? 169 THR E CA  1 
ATOM   9373  C  C   . THR E  1 160 ? -74.756  70.443  28.846  1.00 13.54 ? 169 THR E C   1 
ATOM   9374  O  O   . THR E  1 160 ? -75.606  69.650  28.447  1.00 13.15 ? 169 THR E O   1 
ATOM   9375  C  CB  . THR E  1 160 ? -75.643  71.125  31.110  1.00 13.51 ? 169 THR E CB  1 
ATOM   9376  O  OG1 . THR E  1 160 ? -75.910  72.225  31.966  1.00 15.82 ? 169 THR E OG1 1 
ATOM   9377  C  CG2 . THR E  1 160 ? -74.611  70.273  31.818  1.00 13.91 ? 169 THR E CG2 1 
ATOM   9378  N  N   . HIS E  1 161 ? -73.475  70.301  28.552  1.00 14.27 ? 170 HIS E N   1 
ATOM   9379  C  CA  . HIS E  1 161 ? -72.995  69.131  27.784  1.00 15.40 ? 170 HIS E CA  1 
ATOM   9380  C  C   . HIS E  1 161 ? -71.906  68.341  28.492  1.00 14.74 ? 170 HIS E C   1 
ATOM   9381  O  O   . HIS E  1 161 ? -71.096  68.908  29.199  1.00 13.68 ? 170 HIS E O   1 
ATOM   9382  C  CB  . HIS E  1 161 ? -72.554  69.539  26.388  1.00 14.98 ? 170 HIS E CB  1 
ATOM   9383  C  CG  . HIS E  1 161 ? -73.673  70.124  25.609  1.00 17.54 ? 170 HIS E CG  1 
ATOM   9384  N  ND1 . HIS E  1 161 ? -74.772  69.378  25.214  1.00 18.17 ? 170 HIS E ND1 1 
ATOM   9385  C  CD2 . HIS E  1 161 ? -73.925  71.394  25.220  1.00 18.08 ? 170 HIS E CD2 1 
ATOM   9386  C  CE1 . HIS E  1 161 ? -75.624  70.160  24.576  1.00 17.83 ? 170 HIS E CE1 1 
ATOM   9387  N  NE2 . HIS E  1 161 ? -75.120  71.376  24.546  1.00 18.26 ? 170 HIS E NE2 1 
ATOM   9388  N  N   . LEU E  1 162 ? -72.008  67.022  28.358  1.00 14.58 ? 171 LEU E N   1 
ATOM   9389  C  CA  . LEU E  1 162 ? -71.121  66.058  28.977  1.00 13.89 ? 171 LEU E CA  1 
ATOM   9390  C  C   . LEU E  1 162 ? -69.952  65.744  28.036  1.00 13.39 ? 171 LEU E C   1 
ATOM   9391  O  O   . LEU E  1 162 ? -70.172  65.378  26.908  1.00 14.88 ? 171 LEU E O   1 
ATOM   9392  C  CB  . LEU E  1 162 ? -71.883  64.758  29.321  1.00 14.15 ? 171 LEU E CB  1 
ATOM   9393  C  CG  . LEU E  1 162 ? -71.057  63.722  30.128  1.00 14.01 ? 171 LEU E CG  1 
ATOM   9394  C  CD1 . LEU E  1 162 ? -70.847  64.171  31.578  1.00 14.34 ? 171 LEU E CD1 1 
ATOM   9395  C  CD2 . LEU E  1 162 ? -71.757  62.390  30.126  1.00 14.13 ? 171 LEU E CD2 1 
ATOM   9396  N  N   . TYR E  1 163 ? -68.732  65.951  28.513  1.00 13.26 ? 172 TYR E N   1 
ATOM   9397  C  CA  . TYR E  1 163 ? -67.505  65.624  27.784  1.00 13.74 ? 172 TYR E CA  1 
ATOM   9398  C  C   . TYR E  1 163 ? -66.713  64.489  28.478  1.00 13.28 ? 172 TYR E C   1 
ATOM   9399  O  O   . TYR E  1 163 ? -66.482  64.507  29.668  1.00 13.53 ? 172 TYR E O   1 
ATOM   9400  C  CB  . TYR E  1 163 ? -66.617  66.825  27.642  1.00 14.17 ? 172 TYR E CB  1 
ATOM   9401  C  CG  . TYR E  1 163 ? -67.151  67.823  26.631  1.00 15.41 ? 172 TYR E CG  1 
ATOM   9402  C  CD1 . TYR E  1 163 ? -66.836  67.722  25.276  1.00 15.05 ? 172 TYR E CD1 1 
ATOM   9403  C  CD2 . TYR E  1 163 ? -68.037  68.816  27.027  1.00 15.06 ? 172 TYR E CD2 1 
ATOM   9404  C  CE1 . TYR E  1 163 ? -67.357  68.605  24.358  1.00 15.68 ? 172 TYR E CE1 1 
ATOM   9405  C  CE2 . TYR E  1 163 ? -68.577  69.687  26.114  1.00 15.84 ? 172 TYR E CE2 1 
ATOM   9406  C  CZ  . TYR E  1 163 ? -68.225  69.598  24.785  1.00 16.58 ? 172 TYR E CZ  1 
ATOM   9407  O  OH  . TYR E  1 163 ? -68.771  70.497  23.879  1.00 17.32 ? 172 TYR E OH  1 
ATOM   9408  N  N   . THR E  1 164 ? -66.369  63.478  27.707  1.00 13.51 ? 173 THR E N   1 
ATOM   9409  C  CA  . THR E  1 164 ? -65.760  62.248  28.233  1.00 13.27 ? 173 THR E CA  1 
ATOM   9410  C  C   . THR E  1 164 ? -64.602  61.850  27.354  1.00 12.59 ? 173 THR E C   1 
ATOM   9411  O  O   . THR E  1 164 ? -64.737  61.702  26.112  1.00 14.81 ? 173 THR E O   1 
ATOM   9412  C  CB  . THR E  1 164 ? -66.752  61.049  28.237  1.00 14.39 ? 173 THR E CB  1 
ATOM   9413  O  OG1 . THR E  1 164 ? -67.978  61.391  28.901  1.00 13.69 ? 173 THR E OG1 1 
ATOM   9414  C  CG2 . THR E  1 164 ? -66.135  59.796  28.943  1.00 13.80 ? 173 THR E CG2 1 
ATOM   9415  N  N   . LEU E  1 165 ? -63.444  61.707  27.971  1.00 12.56 ? 174 LEU E N   1 
ATOM   9416  C  CA  . LEU E  1 165 ? -62.245  61.140  27.293  1.00 12.12 ? 174 LEU E CA  1 
ATOM   9417  C  C   . LEU E  1 165 ? -61.848  59.817  27.925  1.00 12.07 ? 174 LEU E C   1 
ATOM   9418  O  O   . LEU E  1 165 ? -61.744  59.692  29.157  1.00 12.50 ? 174 LEU E O   1 
ATOM   9419  C  CB  . LEU E  1 165 ? -61.069  62.057  27.378  1.00 12.32 ? 174 LEU E CB  1 
ATOM   9420  C  CG  . LEU E  1 165 ? -59.727  61.464  26.906  1.00 12.26 ? 174 LEU E CG  1 
ATOM   9421  C  CD1 . LEU E  1 165 ? -59.701  61.315  25.390  1.00 12.19 ? 174 LEU E CD1 1 
ATOM   9422  C  CD2 . LEU E  1 165 ? -58.584  62.354  27.326  1.00 12.25 ? 174 LEU E CD2 1 
ATOM   9423  N  N   . ILE E  1 166 ? -61.698  58.808  27.067  1.00 11.91 ? 175 ILE E N   1 
ATOM   9424  C  CA  . ILE E  1 166 ? -61.337  57.449  27.451  1.00 12.01 ? 175 ILE E CA  1 
ATOM   9425  C  C   . ILE E  1 166 ? -60.029  57.109  26.823  1.00 11.75 ? 175 ILE E C   1 
ATOM   9426  O  O   . ILE E  1 166 ? -59.901  57.168  25.602  1.00 11.97 ? 175 ILE E O   1 
ATOM   9427  C  CB  . ILE E  1 166 ? -62.363  56.398  26.979  1.00 12.60 ? 175 ILE E CB  1 
ATOM   9428  C  CG1 . ILE E  1 166 ? -63.675  56.697  27.684  1.00 13.02 ? 175 ILE E CG1 1 
ATOM   9429  C  CG2 . ILE E  1 166 ? -61.980  54.995  27.422  1.00 12.72 ? 175 ILE E CG2 1 
ATOM   9430  C  CD1 . ILE E  1 166 ? -64.904  55.894  27.352  1.00 13.73 ? 175 ILE E CD1 1 
ATOM   9431  N  N   . VAL E  1 167 ? -59.081  56.719  27.669  1.00 11.35 ? 176 VAL E N   1 
ATOM   9432  C  CA  . VAL E  1 167 ? -57.768  56.295  27.228  1.00 11.86 ? 176 VAL E CA  1 
ATOM   9433  C  C   . VAL E  1 167 ? -57.434  54.910  27.757  1.00 12.01 ? 176 VAL E C   1 
ATOM   9434  O  O   . VAL E  1 167 ? -57.447  54.685  28.964  1.00 12.87 ? 176 VAL E O   1 
ATOM   9435  C  CB  . VAL E  1 167 ? -56.665  57.256  27.721  1.00 11.71 ? 176 VAL E CB  1 
ATOM   9436  C  CG1 . VAL E  1 167 ? -55.290  56.778  27.211  1.00 11.56 ? 176 VAL E CG1 1 
ATOM   9437  C  CG2 . VAL E  1 167 ? -56.951  58.666  27.263  1.00 11.16 ? 176 VAL E CG2 1 
ATOM   9438  N  N   . ARG E  1 168 ? -57.116  53.986  26.868  1.00 12.93 ? 177 ARG E N   1 
ATOM   9439  C  CA  . ARG E  1 168 ? -56.934  52.555  27.247  1.00 13.84 ? 177 ARG E CA  1 
ATOM   9440  C  C   . ARG E  1 168 ? -55.470  52.078  27.090  1.00 14.24 ? 177 ARG E C   1 
ATOM   9441  O  O   . ARG E  1 168 ? -54.767  52.575  26.228  1.00 14.31 ? 177 ARG E O   1 
ATOM   9442  C  CB  . ARG E  1 168 ? -57.825  51.655  26.411  1.00 13.82 ? 177 ARG E CB  1 
ATOM   9443  C  CG  . ARG E  1 168 ? -59.282  51.975  26.540  1.00 15.06 ? 177 ARG E CG  1 
ATOM   9444  C  CD  . ARG E  1 168 ? -60.129  50.947  25.806  1.00 15.42 ? 177 ARG E CD  1 
ATOM   9445  N  NE  . ARG E  1 168 ? -61.513  51.361  25.637  1.00 14.94 ? 177 ARG E NE  1 
ATOM   9446  C  CZ  . ARG E  1 168 ? -61.957  52.004  24.566  1.00 15.69 ? 177 ARG E CZ  1 
ATOM   9447  N  NH1 . ARG E  1 168 ? -61.134  52.325  23.564  1.00 14.89 ? 177 ARG E NH1 1 
ATOM   9448  N  NH2 . ARG E  1 168 ? -63.241  52.318  24.485  1.00 15.91 ? 177 ARG E NH2 1 
ATOM   9449  N  N   . PRO E  1 169 ? -55.053  51.055  27.870  1.00 15.09 ? 178 PRO E N   1 
ATOM   9450  C  CA  . PRO E  1 169 ? -53.676  50.582  27.882  1.00 15.93 ? 178 PRO E CA  1 
ATOM   9451  C  C   . PRO E  1 169 ? -53.225  49.859  26.614  1.00 16.13 ? 178 PRO E C   1 
ATOM   9452  O  O   . PRO E  1 169 ? -52.074  49.560  26.502  1.00 17.88 ? 178 PRO E O   1 
ATOM   9453  C  CB  . PRO E  1 169 ? -53.602  49.681  29.102  1.00 16.20 ? 178 PRO E CB  1 
ATOM   9454  C  CG  . PRO E  1 169 ? -54.985  49.371  29.501  1.00 16.03 ? 178 PRO E CG  1 
ATOM   9455  C  CD  . PRO E  1 169 ? -55.920  50.237  28.730  1.00 16.60 ? 178 PRO E CD  1 
ATOM   9456  N  N   . ASP E  1 170 ? -54.108  49.620  25.649  1.00 15.50 ? 179 ASP E N   1 
ATOM   9457  C  CA  . ASP E  1 170 ? -53.680  49.243  24.290  1.00 15.52 ? 179 ASP E CA  1 
ATOM   9458  C  C   . ASP E  1 170 ? -53.513  50.436  23.362  1.00 14.34 ? 179 ASP E C   1 
ATOM   9459  O  O   . ASP E  1 170 ? -53.421  50.285  22.178  1.00 12.29 ? 179 ASP E O   1 
ATOM   9460  C  CB  . ASP E  1 170 ? -54.647  48.222  23.660  1.00 16.94 ? 179 ASP E CB  1 
ATOM   9461  C  CG  . ASP E  1 170 ? -56.082  48.725  23.563  1.00 19.35 ? 179 ASP E CG  1 
ATOM   9462  O  OD1 . ASP E  1 170 ? -56.343  49.916  23.862  1.00 22.06 ? 179 ASP E OD1 1 
ATOM   9463  O  OD2 . ASP E  1 170 ? -56.987  47.924  23.247  1.00 20.74 ? 179 ASP E OD2 1 
ATOM   9464  N  N   . ASN E  1 171 ? -53.452  51.637  23.939  1.00 15.41 ? 180 ASN E N   1 
ATOM   9465  C  CA  . ASN E  1 171 ? -53.275  52.871  23.183  1.00 15.27 ? 180 ASN E CA  1 
ATOM   9466  C  C   . ASN E  1 171 ? -54.439  53.169  22.254  1.00 14.74 ? 180 ASN E C   1 
ATOM   9467  O  O   . ASN E  1 171 ? -54.286  53.864  21.294  1.00 15.85 ? 180 ASN E O   1 
ATOM   9468  C  CB  . ASN E  1 171 ? -52.010  52.852  22.362  1.00 15.11 ? 180 ASN E CB  1 
ATOM   9469  C  CG  . ASN E  1 171 ? -50.761  53.116  23.227  1.00 17.91 ? 180 ASN E CG  1 
ATOM   9470  O  OD1 . ASN E  1 171 ? -50.703  54.048  24.021  1.00 18.33 ? 180 ASN E OD1 1 
ATOM   9471  N  ND2 . ASN E  1 171 ? -49.731  52.339  23.014  1.00 19.33 ? 180 ASN E ND2 1 
ATOM   9472  N  N   . THR E  1 172 ? -55.608  52.680  22.581  1.00 14.14 ? 181 THR E N   1 
ATOM   9473  C  CA  . THR E  1 172 ? -56.811  53.166  21.968  1.00 14.46 ? 181 THR E CA  1 
ATOM   9474  C  C   . THR E  1 172 ? -57.428  54.308  22.806  1.00 14.11 ? 181 THR E C   1 
ATOM   9475  O  O   . THR E  1 172 ? -57.224  54.407  24.019  1.00 13.98 ? 181 THR E O   1 
ATOM   9476  C  CB  . THR E  1 172 ? -57.861  52.057  21.783  1.00 14.75 ? 181 THR E CB  1 
ATOM   9477  O  OG1 . THR E  1 172 ? -58.171  51.443  23.025  1.00 14.39 ? 181 THR E OG1 1 
ATOM   9478  C  CG2 . THR E  1 172 ? -57.364  51.015  20.805  1.00 15.97 ? 181 THR E CG2 1 
ATOM   9479  N  N   . TYR E  1 173 ? -58.230  55.129  22.164  1.00 13.52 ? 182 TYR E N   1 
ATOM   9480  C  CA  . TYR E  1 173 ? -58.960  56.189  22.895  1.00 12.69 ? 182 TYR E CA  1 
ATOM   9481  C  C   . TYR E  1 173 ? -60.337  56.361  22.277  1.00 13.36 ? 182 TYR E C   1 
ATOM   9482  O  O   . TYR E  1 173 ? -60.606  55.995  21.146  1.00 12.65 ? 182 TYR E O   1 
ATOM   9483  C  CB  . TYR E  1 173 ? -58.202  57.514  22.809  1.00 11.91 ? 182 TYR E CB  1 
ATOM   9484  C  CG  . TYR E  1 173 ? -58.412  58.169  21.461  1.00 11.04 ? 182 TYR E CG  1 
ATOM   9485  C  CD1 . TYR E  1 173 ? -57.700  57.758  20.372  1.00 10.17 ? 182 TYR E CD1 1 
ATOM   9486  C  CD2 . TYR E  1 173 ? -59.389  59.172  21.281  1.00 11.03 ? 182 TYR E CD2 1 
ATOM   9487  C  CE1 . TYR E  1 173 ? -57.925  58.305  19.131  1.00 10.69 ? 182 TYR E CE1 1 
ATOM   9488  C  CE2 . TYR E  1 173 ? -59.615  59.737  20.018  1.00 10.44 ? 182 TYR E CE2 1 
ATOM   9489  C  CZ  . TYR E  1 173 ? -58.887  59.286  18.949  1.00 10.23 ? 182 TYR E CZ  1 
ATOM   9490  O  OH  . TYR E  1 173 ? -59.069  59.793  17.690  1.00 10.08 ? 182 TYR E OH  1 
ATOM   9491  N  N   . GLU E  1 174 ? -61.201  56.962  23.042  1.00 15.42 ? 183 GLU E N   1 
ATOM   9492  C  CA  . GLU E  1 174 ? -62.521  57.291  22.587  1.00 17.57 ? 183 GLU E CA  1 
ATOM   9493  C  C   . GLU E  1 174 ? -62.910  58.649  23.193  1.00 16.76 ? 183 GLU E C   1 
ATOM   9494  O  O   . GLU E  1 174 ? -62.620  58.938  24.362  1.00 17.82 ? 183 GLU E O   1 
ATOM   9495  C  CB  . GLU E  1 174 ? -63.480  56.187  23.047  1.00 20.18 ? 183 GLU E CB  1 
ATOM   9496  C  CG  . GLU E  1 174 ? -64.889  56.298  22.552  1.00 23.21 ? 183 GLU E CG  1 
ATOM   9497  C  CD  . GLU E  1 174 ? -65.727  55.044  22.896  1.00 27.59 ? 183 GLU E CD  1 
ATOM   9498  O  OE1 . GLU E  1 174 ? -65.175  53.937  23.120  1.00 26.78 ? 183 GLU E OE1 1 
ATOM   9499  O  OE2 . GLU E  1 174 ? -66.977  55.177  22.929  1.00 26.63 ? 183 GLU E OE2 1 
ATOM   9500  N  N   . VAL E  1 175 ? -63.591  59.463  22.405  1.00 16.07 ? 184 VAL E N   1 
ATOM   9501  C  CA  . VAL E  1 175 ? -64.188  60.733  22.894  1.00 14.59 ? 184 VAL E CA  1 
ATOM   9502  C  C   . VAL E  1 175 ? -65.709  60.698  22.737  1.00 13.68 ? 184 VAL E C   1 
ATOM   9503  O  O   . VAL E  1 175 ? -66.240  60.320  21.703  1.00 13.49 ? 184 VAL E O   1 
ATOM   9504  C  CB  . VAL E  1 175 ? -63.636  61.953  22.159  1.00 14.33 ? 184 VAL E CB  1 
ATOM   9505  C  CG1 . VAL E  1 175 ? -64.323  63.230  22.620  1.00 15.39 ? 184 VAL E CG1 1 
ATOM   9506  C  CG2 . VAL E  1 175 ? -62.146  62.068  22.357  1.00 13.55 ? 184 VAL E CG2 1 
ATOM   9507  N  N   . LYS E  1 176 ? -66.376  61.030  23.826  1.00 14.19 ? 185 LYS E N   1 
ATOM   9508  C  CA  . LYS E  1 176 ? -67.813  61.131  23.868  1.00 14.46 ? 185 LYS E CA  1 
ATOM   9509  C  C   . LYS E  1 176 ? -68.291  62.537  24.215  1.00 14.60 ? 185 LYS E C   1 
ATOM   9510  O  O   . LYS E  1 176 ? -67.756  63.193  25.089  1.00 13.35 ? 185 LYS E O   1 
ATOM   9511  C  CB  . LYS E  1 176 ? -68.378  60.180  24.916  1.00 14.85 ? 185 LYS E CB  1 
ATOM   9512  C  CG  . LYS E  1 176 ? -68.087  58.729  24.667  1.00 15.92 ? 185 LYS E CG  1 
ATOM   9513  C  CD  . LYS E  1 176 ? -68.483  57.900  25.870  1.00 16.08 ? 185 LYS E CD  1 
ATOM   9514  C  CE  . LYS E  1 176 ? -69.163  56.636  25.443  1.00 17.06 ? 185 LYS E CE  1 
ATOM   9515  N  NZ  . LYS E  1 176 ? -69.177  55.555  26.446  1.00 18.47 ? 185 LYS E NZ  1 
ATOM   9516  N  N   . ILE E  1 177 ? -69.392  62.917  23.579  1.00 15.00 ? 186 ILE E N   1 
ATOM   9517  C  CA  . ILE E  1 177 ? -70.186  64.084  23.965  1.00 14.29 ? 186 ILE E CA  1 
ATOM   9518  C  C   . ILE E  1 177 ? -71.585  63.633  24.281  1.00 14.29 ? 186 ILE E C   1 
ATOM   9519  O  O   . ILE E  1 177 ? -72.201  62.842  23.539  1.00 15.39 ? 186 ILE E O   1 
ATOM   9520  C  CB  . ILE E  1 177 ? -70.176  65.128  22.865  1.00 14.94 ? 186 ILE E CB  1 
ATOM   9521  C  CG1 . ILE E  1 177 ? -68.750  65.529  22.590  1.00 14.22 ? 186 ILE E CG1 1 
ATOM   9522  C  CG2 . ILE E  1 177 ? -70.974  66.351  23.323  1.00 15.33 ? 186 ILE E CG2 1 
ATOM   9523  C  CD1 . ILE E  1 177 ? -68.555  66.463  21.420  1.00 14.58 ? 186 ILE E CD1 1 
ATOM   9524  N  N   . ASP E  1 178 ? -72.092  64.081  25.414  1.00 14.86 ? 187 ASP E N   1 
ATOM   9525  C  CA  . ASP E  1 178 ? -73.428  63.679  25.875  1.00 15.13 ? 187 ASP E CA  1 
ATOM   9526  C  C   . ASP E  1 178 ? -73.613  62.186  25.858  1.00 15.74 ? 187 ASP E C   1 
ATOM   9527  O  O   . ASP E  1 178 ? -74.653  61.681  25.449  1.00 17.52 ? 187 ASP E O   1 
ATOM   9528  C  CB  . ASP E  1 178 ? -74.519  64.398  25.070  1.00 16.41 ? 187 ASP E CB  1 
ATOM   9529  C  CG  . ASP E  1 178 ? -74.495  65.912  25.288  1.00 18.11 ? 187 ASP E CG  1 
ATOM   9530  O  OD1 . ASP E  1 178 ? -73.853  66.342  26.264  1.00 17.73 ? 187 ASP E OD1 1 
ATOM   9531  O  OD2 . ASP E  1 178 ? -75.070  66.684  24.484  1.00 19.11 ? 187 ASP E OD2 1 
ATOM   9532  N  N   . ASN E  1 179 ? -72.606  61.490  26.386  1.00 15.99 ? 188 ASN E N   1 
ATOM   9533  C  CA  . ASN E  1 179 ? -72.575  60.026  26.566  1.00 15.81 ? 188 ASN E CA  1 
ATOM   9534  C  C   . ASN E  1 179 ? -72.704  59.233  25.279  1.00 16.21 ? 188 ASN E C   1 
ATOM   9535  O  O   . ASN E  1 179 ? -73.204  58.137  25.270  1.00 15.12 ? 188 ASN E O   1 
ATOM   9536  C  CB  . ASN E  1 179 ? -73.621  59.543  27.573  1.00 16.00 ? 188 ASN E CB  1 
ATOM   9537  C  CG  . ASN E  1 179 ? -73.007  59.060  28.883  1.00 15.59 ? 188 ASN E CG  1 
ATOM   9538  O  OD1 . ASN E  1 179 ? -71.821  58.718  28.941  1.00 15.25 ? 188 ASN E OD1 1 
ATOM   9539  N  ND2 . ASN E  1 179 ? -73.835  58.958  29.921  1.00 15.14 ? 188 ASN E ND2 1 
ATOM   9540  N  N   . SER E  1 180 ? -72.242  59.812  24.187  1.00 17.34 ? 189 SER E N   1 
ATOM   9541  C  CA  . SER E  1 180 ? -72.349  59.168  22.912  1.00 16.42 ? 189 SER E CA  1 
ATOM   9542  C  C   . SER E  1 180 ? -71.116  59.452  22.149  1.00 14.73 ? 189 SER E C   1 
ATOM   9543  O  O   . SER E  1 180 ? -70.653  60.580  22.092  1.00 14.08 ? 189 SER E O   1 
ATOM   9544  C  CB  . SER E  1 180 ? -73.609  59.667  22.198  1.00 18.83 ? 189 SER E CB  1 
ATOM   9545  O  OG  . SER E  1 180 ? -73.570  59.244  20.857  1.00 17.92 ? 189 SER E OG  1 
ATOM   9546  N  N   . GLN E  1 181 ? -70.558  58.401  21.568  1.00 15.51 ? 190 GLN E N   1 
ATOM   9547  C  CA  . GLN E  1 181 ? -69.263  58.448  20.932  1.00 15.50 ? 190 GLN E CA  1 
ATOM   9548  C  C   . GLN E  1 181 ? -69.277  59.397  19.781  1.00 15.24 ? 190 GLN E C   1 
ATOM   9549  O  O   . GLN E  1 181 ? -70.165  59.355  18.980  1.00 15.23 ? 190 GLN E O   1 
ATOM   9550  C  CB  . GLN E  1 181 ? -68.853  57.068  20.396  1.00 16.71 ? 190 GLN E CB  1 
ATOM   9551  C  CG  . GLN E  1 181 ? -67.520  57.087  19.657  1.00 18.48 ? 190 GLN E CG  1 
ATOM   9552  C  CD  . GLN E  1 181 ? -67.068  55.713  19.145  1.00 21.50 ? 190 GLN E CD  1 
ATOM   9553  O  OE1 . GLN E  1 181 ? -66.643  55.590  18.009  1.00 22.63 ? 190 GLN E OE1 1 
ATOM   9554  N  NE2 . GLN E  1 181 ? -67.071  54.715  20.005  1.00 21.61 ? 190 GLN E NE2 1 
ATOM   9555  N  N   . VAL E  1 182 ? -68.227  60.193  19.654  1.00 14.63 ? 191 VAL E N   1 
ATOM   9556  C  CA  . VAL E  1 182 ? -68.070  61.078  18.494  1.00 14.48 ? 191 VAL E CA  1 
ATOM   9557  C  C   . VAL E  1 182 ? -66.759  60.874  17.790  1.00 14.47 ? 191 VAL E C   1 
ATOM   9558  O  O   . VAL E  1 182 ? -66.585  61.327  16.684  1.00 13.84 ? 191 VAL E O   1 
ATOM   9559  C  CB  . VAL E  1 182 ? -68.215  62.615  18.876  1.00 14.43 ? 191 VAL E CB  1 
ATOM   9560  C  CG1 . VAL E  1 182 ? -69.629  62.934  19.372  1.00 14.01 ? 191 VAL E CG1 1 
ATOM   9561  C  CG2 . VAL E  1 182 ? -67.208  63.014  19.946  1.00 14.61 ? 191 VAL E CG2 1 
ATOM   9562  N  N   . GLU E  1 183 ? -65.799  60.274  18.472  1.00 14.97 ? 192 GLU E N   1 
ATOM   9563  C  CA  . GLU E  1 183 ? -64.515  59.995  17.861  1.00 14.61 ? 192 GLU E CA  1 
ATOM   9564  C  C   . GLU E  1 183 ? -63.817  58.793  18.539  1.00 14.15 ? 192 GLU E C   1 
ATOM   9565  O  O   . GLU E  1 183 ? -63.963  58.551  19.739  1.00 14.50 ? 192 GLU E O   1 
ATOM   9566  C  CB  . GLU E  1 183 ? -63.632  61.228  17.945  1.00 16.07 ? 192 GLU E CB  1 
ATOM   9567  C  CG  . GLU E  1 183 ? -62.462  61.282  16.951  1.00 18.08 ? 192 GLU E CG  1 
ATOM   9568  C  CD  . GLU E  1 183 ? -62.839  60.722  15.556  1.00 21.33 ? 192 GLU E CD  1 
ATOM   9569  O  OE1 . GLU E  1 183 ? -63.556  61.437  14.808  1.00 23.21 ? 192 GLU E OE1 1 
ATOM   9570  O  OE2 . GLU E  1 183 ? -62.537  59.524  15.239  1.00 23.70 ? 192 GLU E OE2 1 
ATOM   9571  N  N   . SER E  1 184 ? -63.035  58.077  17.776  1.00 14.07 ? 193 SER E N   1 
ATOM   9572  C  CA  . SER E  1 184 ? -62.234  56.978  18.326  1.00 15.36 ? 193 SER E CA  1 
ATOM   9573  C  C   . SER E  1 184 ? -61.052  56.577  17.421  1.00 13.53 ? 193 SER E C   1 
ATOM   9574  O  O   . SER E  1 184 ? -61.026  56.917  16.273  1.00 12.67 ? 193 SER E O   1 
ATOM   9575  C  CB  . SER E  1 184 ? -63.083  55.714  18.614  1.00 15.37 ? 193 SER E CB  1 
ATOM   9576  O  OG  . SER E  1 184 ? -63.704  55.248  17.428  1.00 17.21 ? 193 SER E OG  1 
ATOM   9577  N  N   . GLY E  1 185 ? -60.089  55.885  18.004  1.00 12.63 ? 194 GLY E N   1 
ATOM   9578  C  CA  . GLY E  1 185 ? -58.970  55.383  17.267  1.00 12.98 ? 194 GLY E CA  1 
ATOM   9579  C  C   . GLY E  1 185 ? -57.813  54.955  18.138  1.00 13.08 ? 194 GLY E C   1 
ATOM   9580  O  O   . GLY E  1 185 ? -57.980  54.651  19.299  1.00 14.92 ? 194 GLY E O   1 
ATOM   9581  N  N   . SER E  1 186 ? -56.617  55.038  17.582  1.00 14.82 ? 195 SER E N   1 
ATOM   9582  C  CA  . SER E  1 186 ? -55.380  54.743  18.287  1.00 16.24 ? 195 SER E CA  1 
ATOM   9583  C  C   . SER E  1 186 ? -54.482  55.953  18.353  1.00 16.91 ? 195 SER E C   1 
ATOM   9584  O  O   . SER E  1 186 ? -54.404  56.745  17.402  1.00 17.31 ? 195 SER E O   1 
ATOM   9585  C  CB  . SER E  1 186 ? -54.625  53.598  17.597  1.00 17.38 ? 195 SER E CB  1 
ATOM   9586  O  OG  . SER E  1 186 ? -55.388  52.423  17.725  1.00 19.92 ? 195 SER E OG  1 
ATOM   9587  N  N   . LEU E  1 187 ? -53.757  56.050  19.468  1.00 17.74 ? 196 LEU E N   1 
ATOM   9588  C  CA  . LEU E  1 187 ? -52.829  57.137  19.704  1.00 19.29 ? 196 LEU E CA  1 
ATOM   9589  C  C   . LEU E  1 187 ? -51.796  57.227  18.588  1.00 21.05 ? 196 LEU E C   1 
ATOM   9590  O  O   . LEU E  1 187 ? -51.495  58.306  18.120  1.00 21.31 ? 196 LEU E O   1 
ATOM   9591  C  CB  . LEU E  1 187 ? -52.140  56.997  21.045  1.00 19.73 ? 196 LEU E CB  1 
ATOM   9592  C  CG  . LEU E  1 187 ? -52.882  57.603  22.256  1.00 21.69 ? 196 LEU E CG  1 
ATOM   9593  C  CD1 . LEU E  1 187 ? -54.129  56.824  22.557  1.00 23.03 ? 196 LEU E CD1 1 
ATOM   9594  C  CD2 . LEU E  1 187 ? -52.108  57.706  23.572  1.00 23.34 ? 196 LEU E CD2 1 
ATOM   9595  N  N   . GLU E  1 188 ? -51.309  56.095  18.118  1.00 22.19 ? 197 GLU E N   1 
ATOM   9596  C  CA  . GLU E  1 188 ? -50.240  56.126  17.122  1.00 26.47 ? 197 GLU E CA  1 
ATOM   9597  C  C   . GLU E  1 188 ? -50.717  56.691  15.797  1.00 25.25 ? 197 GLU E C   1 
ATOM   9598  O  O   . GLU E  1 188 ? -49.920  57.287  15.107  1.00 25.96 ? 197 GLU E O   1 
ATOM   9599  C  CB  . GLU E  1 188 ? -49.607  54.756  16.856  1.00 28.26 ? 197 GLU E CB  1 
ATOM   9600  C  CG  . GLU E  1 188 ? -49.180  53.963  18.092  1.00 32.07 ? 197 GLU E CG  1 
ATOM   9601  C  CD  . GLU E  1 188 ? -50.267  53.142  18.742  1.00 35.34 ? 197 GLU E CD  1 
ATOM   9602  O  OE1 . GLU E  1 188 ? -51.480  53.438  18.614  1.00 33.73 ? 197 GLU E OE1 1 
ATOM   9603  O  OE2 . GLU E  1 188 ? -49.842  52.183  19.417  1.00 41.10 ? 197 GLU E OE2 1 
ATOM   9604  N  N   . ASP E  1 189 ? -51.985  56.514  15.461  1.00 22.30 ? 198 ASP E N   1 
ATOM   9605  C  CA  . ASP E  1 189 ? -52.491  56.992  14.191  1.00 22.10 ? 198 ASP E CA  1 
ATOM   9606  C  C   . ASP E  1 189 ? -53.002  58.426  14.259  1.00 21.40 ? 198 ASP E C   1 
ATOM   9607  O  O   . ASP E  1 189 ? -52.874  59.176  13.330  1.00 18.83 ? 198 ASP E O   1 
ATOM   9608  C  CB  . ASP E  1 189 ? -53.647  56.119  13.665  1.00 24.72 ? 198 ASP E CB  1 
ATOM   9609  C  CG  . ASP E  1 189 ? -53.324  54.598  13.638  1.00 26.62 ? 198 ASP E CG  1 
ATOM   9610  O  OD1 . ASP E  1 189 ? -52.260  54.208  13.142  1.00 26.01 ? 198 ASP E OD1 1 
ATOM   9611  O  OD2 . ASP E  1 189 ? -54.170  53.785  14.097  1.00 27.99 ? 198 ASP E OD2 1 
ATOM   9612  N  N   . ASP E  1 190 ? -53.624  58.793  15.368  1.00 22.69 ? 199 ASP E N   1 
ATOM   9613  C  CA  . ASP E  1 190 ? -54.365  60.071  15.448  1.00 20.85 ? 199 ASP E CA  1 
ATOM   9614  C  C   . ASP E  1 190 ? -53.549  61.254  16.055  1.00 22.17 ? 199 ASP E C   1 
ATOM   9615  O  O   . ASP E  1 190 ? -54.023  62.387  16.097  1.00 20.16 ? 199 ASP E O   1 
ATOM   9616  C  CB  . ASP E  1 190 ? -55.664  59.856  16.189  1.00 19.68 ? 199 ASP E CB  1 
ATOM   9617  C  CG  . ASP E  1 190 ? -56.641  58.938  15.417  1.00 20.49 ? 199 ASP E CG  1 
ATOM   9618  O  OD1 . ASP E  1 190 ? -56.373  58.632  14.241  1.00 19.47 ? 199 ASP E OD1 1 
ATOM   9619  O  OD2 . ASP E  1 190 ? -57.698  58.575  15.967  1.00 18.90 ? 199 ASP E OD2 1 
ATOM   9620  N  N   . TRP E  1 191 ? -52.313  60.976  16.450  1.00 21.05 ? 200 TRP E N   1 
ATOM   9621  C  CA  . TRP E  1 191 ? -51.346  62.006  16.805  1.00 22.77 ? 200 TRP E CA  1 
ATOM   9622  C  C   . TRP E  1 191 ? -50.009  61.700  16.120  1.00 25.47 ? 200 TRP E C   1 
ATOM   9623  O  O   . TRP E  1 191 ? -49.679  60.531  15.890  1.00 29.29 ? 200 TRP E O   1 
ATOM   9624  C  CB  . TRP E  1 191 ? -51.080  61.991  18.312  1.00 20.61 ? 200 TRP E CB  1 
ATOM   9625  C  CG  . TRP E  1 191 ? -52.205  62.485  19.207  1.00 19.46 ? 200 TRP E CG  1 
ATOM   9626  C  CD1 . TRP E  1 191 ? -52.284  63.708  19.828  1.00 17.75 ? 200 TRP E CD1 1 
ATOM   9627  C  CD2 . TRP E  1 191 ? -53.389  61.770  19.595  1.00 16.49 ? 200 TRP E CD2 1 
ATOM   9628  N  NE1 . TRP E  1 191 ? -53.420  63.776  20.568  1.00 15.63 ? 200 TRP E NE1 1 
ATOM   9629  C  CE2 . TRP E  1 191 ? -54.137  62.623  20.409  1.00 15.28 ? 200 TRP E CE2 1 
ATOM   9630  C  CE3 . TRP E  1 191 ? -53.895  60.495  19.297  1.00 15.21 ? 200 TRP E CE3 1 
ATOM   9631  C  CZ2 . TRP E  1 191 ? -55.341  62.235  20.972  1.00 14.38 ? 200 TRP E CZ2 1 
ATOM   9632  C  CZ3 . TRP E  1 191 ? -55.074  60.124  19.811  1.00 13.57 ? 200 TRP E CZ3 1 
ATOM   9633  C  CH2 . TRP E  1 191 ? -55.792  60.977  20.667  1.00 14.11 ? 200 TRP E CH2 1 
ATOM   9634  N  N   . ASP E  1 192 ? -49.210  62.730  15.876  1.00 29.25 ? 201 ASP E N   1 
ATOM   9635  C  CA  . ASP E  1 192 ? -47.821  62.572  15.408  1.00 33.00 ? 201 ASP E CA  1 
ATOM   9636  C  C   . ASP E  1 192 ? -46.872  62.517  16.573  1.00 31.03 ? 201 ASP E C   1 
ATOM   9637  O  O   . ASP E  1 192 ? -46.169  63.472  16.832  1.00 31.24 ? 201 ASP E O   1 
ATOM   9638  C  CB  . ASP E  1 192 ? -47.365  63.756  14.524  1.00 38.08 ? 201 ASP E CB  1 
ATOM   9639  C  CG  . ASP E  1 192 ? -48.156  63.881  13.230  1.00 47.18 ? 201 ASP E CG  1 
ATOM   9640  O  OD1 . ASP E  1 192 ? -48.830  62.917  12.815  1.00 54.38 ? 201 ASP E OD1 1 
ATOM   9641  O  OD2 . ASP E  1 192 ? -48.138  64.985  12.641  1.00 53.19 ? 201 ASP E OD2 1 
ATOM   9642  N  N   . PHE E  1 193 ? -46.797  61.401  17.250  1.00 30.15 ? 202 PHE E N   1 
ATOM   9643  C  CA  . PHE E  1 193 ? -45.814  61.267  18.325  1.00 31.58 ? 202 PHE E CA  1 
ATOM   9644  C  C   . PHE E  1 193 ? -44.385  61.056  17.830  1.00 34.48 ? 202 PHE E C   1 
ATOM   9645  O  O   . PHE E  1 193 ? -44.211  60.351  16.886  1.00 35.76 ? 202 PHE E O   1 
ATOM   9646  C  CB  . PHE E  1 193 ? -46.220  60.105  19.207  1.00 30.08 ? 202 PHE E CB  1 
ATOM   9647  C  CG  . PHE E  1 193 ? -47.436  60.377  20.018  1.00 29.78 ? 202 PHE E CG  1 
ATOM   9648  C  CD1 . PHE E  1 193 ? -47.423  61.355  21.003  1.00 29.94 ? 202 PHE E CD1 1 
ATOM   9649  C  CD2 . PHE E  1 193 ? -48.610  59.691  19.771  1.00 28.53 ? 202 PHE E CD2 1 
ATOM   9650  C  CE1 . PHE E  1 193 ? -48.553  61.625  21.741  1.00 31.07 ? 202 PHE E CE1 1 
ATOM   9651  C  CE2 . PHE E  1 193 ? -49.739  59.958  20.511  1.00 28.40 ? 202 PHE E CE2 1 
ATOM   9652  C  CZ  . PHE E  1 193 ? -49.716  60.915  21.501  1.00 27.19 ? 202 PHE E CZ  1 
ATOM   9653  N  N   . LEU E  1 194 ? -43.365  61.616  18.478  1.00 38.92 ? 203 LEU E N   1 
ATOM   9654  C  CA  . LEU E  1 194 ? -41.977  61.473  17.920  1.00 44.04 ? 203 LEU E CA  1 
ATOM   9655  C  C   . LEU E  1 194 ? -41.708  60.170  17.093  1.00 44.92 ? 203 LEU E C   1 
ATOM   9656  O  O   . LEU E  1 194 ? -41.173  59.147  17.551  1.00 48.32 ? 203 LEU E O   1 
ATOM   9657  C  CB  . LEU E  1 194 ? -40.910  61.638  19.049  1.00 50.35 ? 203 LEU E CB  1 
ATOM   9658  C  CG  . LEU E  1 194 ? -40.329  62.959  19.705  1.00 57.92 ? 203 LEU E CG  1 
ATOM   9659  C  CD1 . LEU E  1 194 ? -38.866  62.917  20.246  1.00 55.21 ? 203 LEU E CD1 1 
ATOM   9660  C  CD2 . LEU E  1 194 ? -40.421  64.057  18.648  1.00 55.76 ? 203 LEU E CD2 1 
ATOM   9661  N  N   . PRO E  1 200 ? -43.968  51.773  23.736  1.00 33.60 ? 303 PRO E N   1 
ATOM   9662  C  CA  . PRO E  1 200 ? -45.328  51.493  23.283  1.00 31.77 ? 303 PRO E CA  1 
ATOM   9663  C  C   . PRO E  1 200 ? -46.345  52.200  24.203  1.00 30.66 ? 303 PRO E C   1 
ATOM   9664  O  O   . PRO E  1 200 ? -47.421  52.620  23.767  1.00 33.38 ? 303 PRO E O   1 
ATOM   9665  C  CB  . PRO E  1 200 ? -45.380  49.933  23.290  1.00 32.42 ? 303 PRO E CB  1 
ATOM   9666  C  CG  . PRO E  1 200 ? -44.358  49.493  24.285  1.00 30.45 ? 303 PRO E CG  1 
ATOM   9667  C  CD  . PRO E  1 200 ? -43.376  50.633  24.480  1.00 31.52 ? 303 PRO E CD  1 
ATOM   9668  N  N   . SER E  1 201 ? -45.954  52.469  25.455  1.00 31.70 ? 304 SER E N   1 
ATOM   9669  C  CA  . SER E  1 201 ? -46.854  53.154  26.449  1.00 29.79 ? 304 SER E CA  1 
ATOM   9670  C  C   . SER E  1 201 ? -46.977  54.689  26.409  1.00 25.59 ? 304 SER E C   1 
ATOM   9671  O  O   . SER E  1 201 ? -46.958  55.391  27.438  1.00 23.31 ? 304 SER E O   1 
ATOM   9672  C  CB  . SER E  1 201 ? -46.562  52.669  27.866  1.00 32.69 ? 304 SER E CB  1 
ATOM   9673  O  OG  . SER E  1 201 ? -46.746  51.281  27.833  1.00 36.35 ? 304 SER E OG  1 
ATOM   9674  N  N   . ILE E  1 202 ? -47.217  55.182  25.204  1.00 23.35 ? 305 ILE E N   1 
ATOM   9675  C  CA  . ILE E  1 202 ? -47.537  56.604  25.012  1.00 23.73 ? 305 ILE E CA  1 
ATOM   9676  C  C   . ILE E  1 202 ? -48.680  57.067  25.917  1.00 19.58 ? 305 ILE E C   1 
ATOM   9677  O  O   . ILE E  1 202 ? -48.650  58.141  26.457  1.00 21.25 ? 305 ILE E O   1 
ATOM   9678  C  CB  . ILE E  1 202 ? -47.872  56.878  23.549  1.00 25.67 ? 305 ILE E CB  1 
ATOM   9679  C  CG1 . ILE E  1 202 ? -46.596  56.608  22.739  1.00 28.34 ? 305 ILE E CG1 1 
ATOM   9680  C  CG2 . ILE E  1 202 ? -48.267  58.338  23.352  1.00 25.02 ? 305 ILE E CG2 1 
ATOM   9681  C  CD1 . ILE E  1 202 ? -46.635  56.821  21.235  1.00 31.87 ? 305 ILE E CD1 1 
ATOM   9682  N  N   . TYR E  1 203 ? -49.661  56.217  26.089  1.00 17.00 ? 306 TYR E N   1 
ATOM   9683  C  CA  . TYR E  1 203 ? -50.841  56.521  26.856  1.00 16.65 ? 306 TYR E CA  1 
ATOM   9684  C  C   . TYR E  1 203 ? -50.581  56.760  28.333  1.00 18.02 ? 306 TYR E C   1 
ATOM   9685  O  O   . TYR E  1 203 ? -51.419  57.334  29.035  1.00 16.21 ? 306 TYR E O   1 
ATOM   9686  C  CB  . TYR E  1 203 ? -51.824  55.347  26.742  1.00 17.28 ? 306 TYR E CB  1 
ATOM   9687  C  CG  . TYR E  1 203 ? -51.473  54.198  27.675  1.00 17.41 ? 306 TYR E CG  1 
ATOM   9688  C  CD1 . TYR E  1 203 ? -50.544  53.208  27.314  1.00 17.29 ? 306 TYR E CD1 1 
ATOM   9689  C  CD2 . TYR E  1 203 ? -52.042  54.127  28.924  1.00 18.06 ? 306 TYR E CD2 1 
ATOM   9690  C  CE1 . TYR E  1 203 ? -50.193  52.192  28.204  1.00 16.71 ? 306 TYR E CE1 1 
ATOM   9691  C  CE2 . TYR E  1 203 ? -51.734  53.104  29.808  1.00 18.35 ? 306 TYR E CE2 1 
ATOM   9692  C  CZ  . TYR E  1 203 ? -50.799  52.142  29.450  1.00 17.98 ? 306 TYR E CZ  1 
ATOM   9693  O  OH  . TYR E  1 203 ? -50.514  51.184  30.388  1.00 16.54 ? 306 TYR E OH  1 
ATOM   9694  N  N   . ALA E  1 204 ? -49.428  56.284  28.835  1.00 17.80 ? 307 ALA E N   1 
ATOM   9695  C  CA  . ALA E  1 204 ? -49.217  56.143  30.292  1.00 16.58 ? 307 ALA E CA  1 
ATOM   9696  C  C   . ALA E  1 204 ? -48.401  57.282  30.952  1.00 15.28 ? 307 ALA E C   1 
ATOM   9697  O  O   . ALA E  1 204 ? -47.498  57.819  30.362  1.00 13.70 ? 307 ALA E O   1 
ATOM   9698  C  CB  . ALA E  1 204 ? -48.538  54.822  30.588  1.00 18.03 ? 307 ALA E CB  1 
ATOM   9699  N  N   . TYR E  1 205 ? -48.801  57.656  32.164  1.00 15.45 ? 308 TYR E N   1 
ATOM   9700  C  CA  . TYR E  1 205 ? -48.167  58.709  32.938  1.00 16.46 ? 308 TYR E CA  1 
ATOM   9701  C  C   . TYR E  1 205 ? -47.939  58.169  34.310  1.00 19.27 ? 308 TYR E C   1 
ATOM   9702  O  O   . TYR E  1 205 ? -48.798  57.480  34.900  1.00 18.78 ? 308 TYR E O   1 
ATOM   9703  C  CB  . TYR E  1 205 ? -49.001  60.035  32.976  1.00 16.60 ? 308 TYR E CB  1 
ATOM   9704  C  CG  . TYR E  1 205 ? -49.069  60.680  31.608  1.00 15.21 ? 308 TYR E CG  1 
ATOM   9705  C  CD1 . TYR E  1 205 ? -48.036  61.473  31.162  1.00 14.66 ? 308 TYR E CD1 1 
ATOM   9706  C  CD2 . TYR E  1 205 ? -50.123  60.407  30.734  1.00 14.79 ? 308 TYR E CD2 1 
ATOM   9707  C  CE1 . TYR E  1 205 ? -48.050  61.995  29.893  1.00 15.74 ? 308 TYR E CE1 1 
ATOM   9708  C  CE2 . TYR E  1 205 ? -50.148  60.929  29.432  1.00 15.70 ? 308 TYR E CE2 1 
ATOM   9709  C  CZ  . TYR E  1 205 ? -49.134  61.719  29.030  1.00 15.81 ? 308 TYR E CZ  1 
ATOM   9710  O  OH  . TYR E  1 205 ? -49.096  62.231  27.773  1.00 16.72 ? 308 TYR E OH  1 
ATOM   9711  N  N   . ASP E  1 206 ? -46.776  58.496  34.841  1.00 22.49 ? 309 ASP E N   1 
ATOM   9712  C  CA  . ASP E  1 206 ? -46.375  57.979  36.133  1.00 28.18 ? 309 ASP E CA  1 
ATOM   9713  C  C   . ASP E  1 206 ? -47.251  58.504  37.239  1.00 28.07 ? 309 ASP E C   1 
ATOM   9714  O  O   . ASP E  1 206 ? -47.522  57.829  38.225  1.00 28.16 ? 309 ASP E O   1 
ATOM   9715  C  CB  . ASP E  1 206 ? -44.934  58.385  36.426  1.00 33.43 ? 309 ASP E CB  1 
ATOM   9716  C  CG  . ASP E  1 206 ? -43.942  57.591  35.596  1.00 39.10 ? 309 ASP E CG  1 
ATOM   9717  O  OD1 . ASP E  1 206 ? -44.179  56.372  35.414  1.00 44.13 ? 309 ASP E OD1 1 
ATOM   9718  O  OD2 . ASP E  1 206 ? -42.938  58.185  35.124  1.00 43.73 ? 309 ASP E OD2 1 
ATOM   9719  N  N   . ASN E  1 207 ? -47.703  59.721  37.057  1.00 30.01 ? 310 ASN E N   1 
ATOM   9720  C  CA  . ASN E  1 207 ? -48.352  60.413  38.121  1.00 31.93 ? 310 ASN E CA  1 
ATOM   9721  C  C   . ASN E  1 207 ? -49.366  61.476  37.668  1.00 28.63 ? 310 ASN E C   1 
ATOM   9722  O  O   . ASN E  1 207 ? -49.093  62.341  36.825  1.00 27.54 ? 310 ASN E O   1 
ATOM   9723  C  CB  . ASN E  1 207 ? -47.244  60.991  39.007  1.00 36.56 ? 310 ASN E CB  1 
ATOM   9724  C  CG  . ASN E  1 207 ? -47.780  61.750  40.182  1.00 39.59 ? 310 ASN E CG  1 
ATOM   9725  O  OD1 . ASN E  1 207 ? -48.778  62.472  40.082  1.00 32.73 ? 310 ASN E OD1 1 
ATOM   9726  N  ND2 . ASN E  1 207 ? -47.117  61.577  41.328  1.00 42.22 ? 310 ASN E ND2 1 
ATOM   9727  N  N   . PHE E  1 208 ? -50.559  61.347  38.217  1.00 24.50 ? 311 PHE E N   1 
ATOM   9728  C  CA  . PHE E  1 208 ? -51.611  62.335  38.100  1.00 22.15 ? 311 PHE E CA  1 
ATOM   9729  C  C   . PHE E  1 208 ? -51.925  62.765  39.531  1.00 22.51 ? 311 PHE E C   1 
ATOM   9730  O  O   . PHE E  1 208 ? -52.146  61.908  40.376  1.00 23.29 ? 311 PHE E O   1 
ATOM   9731  C  CB  . PHE E  1 208 ? -52.867  61.741  37.496  1.00 21.92 ? 311 PHE E CB  1 
ATOM   9732  C  CG  . PHE E  1 208 ? -52.745  61.431  36.029  1.00 22.44 ? 311 PHE E CG  1 
ATOM   9733  C  CD1 . PHE E  1 208 ? -52.679  62.461  35.101  1.00 22.84 ? 311 PHE E CD1 1 
ATOM   9734  C  CD2 . PHE E  1 208 ? -52.729  60.121  35.587  1.00 22.00 ? 311 PHE E CD2 1 
ATOM   9735  C  CE1 . PHE E  1 208 ? -52.586  62.194  33.755  1.00 23.29 ? 311 PHE E CE1 1 
ATOM   9736  C  CE2 . PHE E  1 208 ? -52.654  59.839  34.243  1.00 24.61 ? 311 PHE E CE2 1 
ATOM   9737  C  CZ  . PHE E  1 208 ? -52.575  60.879  33.315  1.00 23.43 ? 311 PHE E CZ  1 
ATOM   9738  N  N   . GLY E  1 209 ? -51.894  64.074  39.794  1.00 21.05 ? 312 GLY E N   1 
ATOM   9739  C  CA  . GLY E  1 209 ? -52.186  64.602  41.120  1.00 19.79 ? 312 GLY E CA  1 
ATOM   9740  C  C   . GLY E  1 209 ? -53.094  65.814  41.179  1.00 20.18 ? 312 GLY E C   1 
ATOM   9741  O  O   . GLY E  1 209 ? -53.681  66.098  42.225  1.00 21.32 ? 312 GLY E O   1 
ATOM   9742  N  N   . VAL E  1 210 ? -53.212  66.533  40.071  1.00 18.90 ? 313 VAL E N   1 
ATOM   9743  C  CA  . VAL E  1 210 ? -54.038  67.732  40.023  1.00 19.74 ? 313 VAL E CA  1 
ATOM   9744  C  C   . VAL E  1 210 ? -54.857  67.856  38.724  1.00 19.53 ? 313 VAL E C   1 
ATOM   9745  O  O   . VAL E  1 210 ? -54.336  67.612  37.622  1.00 17.03 ? 313 VAL E O   1 
ATOM   9746  C  CB  . VAL E  1 210 ? -53.195  69.023  40.150  1.00 20.13 ? 313 VAL E CB  1 
ATOM   9747  C  CG1 . VAL E  1 210 ? -54.070  70.261  40.121  1.00 20.50 ? 313 VAL E CG1 1 
ATOM   9748  C  CG2 . VAL E  1 210 ? -52.392  69.013  41.442  1.00 20.66 ? 313 VAL E CG2 1 
ATOM   9749  N  N   . LEU E  1 211 ? -56.124  68.247  38.891  1.00 18.24 ? 314 LEU E N   1 
ATOM   9750  C  CA  . LEU E  1 211 ? -56.975  68.695  37.788  1.00 17.91 ? 314 LEU E CA  1 
ATOM   9751  C  C   . LEU E  1 211 ? -57.107  70.211  37.811  1.00 17.71 ? 314 LEU E C   1 
ATOM   9752  O  O   . LEU E  1 211 ? -57.600  70.780  38.774  1.00 18.60 ? 314 LEU E O   1 
ATOM   9753  C  CB  . LEU E  1 211 ? -58.353  68.074  37.869  1.00 18.14 ? 314 LEU E CB  1 
ATOM   9754  C  CG  . LEU E  1 211 ? -59.225  68.375  36.624  1.00 20.36 ? 314 LEU E CG  1 
ATOM   9755  C  CD1 . LEU E  1 211 ? -60.125  67.216  36.234  1.00 20.74 ? 314 LEU E CD1 1 
ATOM   9756  C  CD2 . LEU E  1 211 ? -60.085  69.624  36.824  1.00 20.11 ? 314 LEU E CD2 1 
ATOM   9757  N  N   . GLY E  1 212 ? -56.705  70.861  36.733  1.00 17.45 ? 315 GLY E N   1 
ATOM   9758  C  CA  . GLY E  1 212 ? -56.816  72.306  36.629  1.00 17.52 ? 315 GLY E CA  1 
ATOM   9759  C  C   . GLY E  1 212 ? -57.756  72.835  35.550  1.00 18.09 ? 315 GLY E C   1 
ATOM   9760  O  O   . GLY E  1 212 ? -57.861  72.288  34.434  1.00 17.36 ? 315 GLY E O   1 
ATOM   9761  N  N   . LEU E  1 213 ? -58.422  73.925  35.897  1.00 17.70 ? 316 LEU E N   1 
ATOM   9762  C  CA  . LEU E  1 213 ? -59.124  74.762  34.943  1.00 18.83 ? 316 LEU E CA  1 
ATOM   9763  C  C   . LEU E  1 213 ? -58.207  75.922  34.709  1.00 20.82 ? 316 LEU E C   1 
ATOM   9764  O  O   . LEU E  1 213 ? -58.059  76.841  35.558  1.00 21.04 ? 316 LEU E O   1 
ATOM   9765  C  CB  . LEU E  1 213 ? -60.459  75.253  35.505  1.00 20.02 ? 316 LEU E CB  1 
ATOM   9766  C  CG  . LEU E  1 213 ? -61.395  74.124  35.918  1.00 20.46 ? 316 LEU E CG  1 
ATOM   9767  C  CD1 . LEU E  1 213 ? -62.553  74.631  36.745  1.00 20.67 ? 316 LEU E CD1 1 
ATOM   9768  C  CD2 . LEU E  1 213 ? -61.924  73.423  34.678  1.00 21.95 ? 316 LEU E CD2 1 
ATOM   9769  N  N   . ASP E  1 214 ? -57.587  75.918  33.551  1.00 19.56 ? 317 ASP E N   1 
ATOM   9770  C  CA  . ASP E  1 214 ? -56.567  76.891  33.229  1.00 21.64 ? 317 ASP E CA  1 
ATOM   9771  C  C   . ASP E  1 214 ? -56.825  77.314  31.795  1.00 20.81 ? 317 ASP E C   1 
ATOM   9772  O  O   . ASP E  1 214 ? -56.528  76.573  30.862  1.00 21.29 ? 317 ASP E O   1 
ATOM   9773  C  CB  . ASP E  1 214 ? -55.182  76.247  33.358  1.00 25.13 ? 317 ASP E CB  1 
ATOM   9774  C  CG  . ASP E  1 214 ? -54.052  77.202  32.936  1.00 29.30 ? 317 ASP E CG  1 
ATOM   9775  O  OD1 . ASP E  1 214 ? -53.993  78.296  33.548  1.00 31.81 ? 317 ASP E OD1 1 
ATOM   9776  O  OD2 . ASP E  1 214 ? -53.205  76.872  32.047  1.00 37.38 ? 317 ASP E OD2 1 
ATOM   9777  N  N   . LEU E  1 215 ? -57.363  78.516  31.620  1.00 21.44 ? 318 LEU E N   1 
ATOM   9778  C  CA  . LEU E  1 215 ? -57.966  78.896  30.356  1.00 23.13 ? 318 LEU E CA  1 
ATOM   9779  C  C   . LEU E  1 215 ? -58.274  80.372  30.220  1.00 23.48 ? 318 LEU E C   1 
ATOM   9780  O  O   . LEU E  1 215 ? -58.174  81.149  31.179  1.00 27.53 ? 318 LEU E O   1 
ATOM   9781  C  CB  . LEU E  1 215 ? -59.273  78.078  30.144  1.00 22.35 ? 318 LEU E CB  1 
ATOM   9782  C  CG  . LEU E  1 215 ? -60.320  78.045  31.255  1.00 21.46 ? 318 LEU E CG  1 
ATOM   9783  C  CD1 . LEU E  1 215 ? -61.319  79.150  31.070  1.00 20.89 ? 318 LEU E CD1 1 
ATOM   9784  C  CD2 . LEU E  1 215 ? -61.052  76.722  31.275  1.00 22.67 ? 318 LEU E CD2 1 
ATOM   9785  N  N   . TRP E  1 216 ? -58.692  80.742  29.019  1.00 22.25 ? 319 TRP E N   1 
ATOM   9786  C  CA  . TRP E  1 216 ? -58.993  82.118  28.688  1.00 22.24 ? 319 TRP E CA  1 
ATOM   9787  C  C   . TRP E  1 216 ? -60.467  82.228  28.302  1.00 19.35 ? 319 TRP E C   1 
ATOM   9788  O  O   . TRP E  1 216 ? -60.988  81.353  27.656  1.00 19.82 ? 319 TRP E O   1 
ATOM   9789  C  CB  . TRP E  1 216 ? -58.105  82.566  27.542  1.00 22.15 ? 319 TRP E CB  1 
ATOM   9790  C  CG  . TRP E  1 216 ? -58.599  83.828  26.876  1.00 26.01 ? 319 TRP E CG  1 
ATOM   9791  C  CD1 . TRP E  1 216 ? -59.265  83.914  25.683  1.00 26.49 ? 319 TRP E CD1 1 
ATOM   9792  C  CD2 . TRP E  1 216 ? -58.429  85.189  27.347  1.00 27.50 ? 319 TRP E CD2 1 
ATOM   9793  N  NE1 . TRP E  1 216 ? -59.480  85.222  25.373  1.00 29.05 ? 319 TRP E NE1 1 
ATOM   9794  C  CE2 . TRP E  1 216 ? -59.001  86.030  26.378  1.00 29.64 ? 319 TRP E CE2 1 
ATOM   9795  C  CE3 . TRP E  1 216 ? -57.836  85.767  28.486  1.00 27.64 ? 319 TRP E CE3 1 
ATOM   9796  C  CZ2 . TRP E  1 216 ? -59.023  87.438  26.514  1.00 28.90 ? 319 TRP E CZ2 1 
ATOM   9797  C  CZ3 . TRP E  1 216 ? -57.859  87.150  28.627  1.00 30.04 ? 319 TRP E CZ3 1 
ATOM   9798  C  CH2 . TRP E  1 216 ? -58.447  87.973  27.645  1.00 30.02 ? 319 TRP E CH2 1 
ATOM   9799  N  N   . GLN E  1 217 ? -61.084  83.352  28.620  1.00 18.32 ? 320 GLN E N   1 
ATOM   9800  C  CA  . GLN E  1 217 ? -62.461  83.637  28.215  1.00 18.56 ? 320 GLN E CA  1 
ATOM   9801  C  C   . GLN E  1 217 ? -62.699  85.099  27.909  1.00 19.51 ? 320 GLN E C   1 
ATOM   9802  O  O   . GLN E  1 217 ? -62.265  85.968  28.655  1.00 18.59 ? 320 GLN E O   1 
ATOM   9803  C  CB  . GLN E  1 217 ? -63.467  83.218  29.303  1.00 18.43 ? 320 GLN E CB  1 
ATOM   9804  C  CG  . GLN E  1 217 ? -63.712  81.753  29.255  1.00 17.49 ? 320 GLN E CG  1 
ATOM   9805  C  CD  . GLN E  1 217 ? -65.003  81.263  29.825  1.00 17.30 ? 320 GLN E CD  1 
ATOM   9806  O  OE1 . GLN E  1 217 ? -65.710  81.914  30.624  1.00 16.57 ? 320 GLN E OE1 1 
ATOM   9807  N  NE2 . GLN E  1 217 ? -65.240  80.022  29.539  1.00 17.22 ? 320 GLN E NE2 1 
ATOM   9808  N  N   . VAL E  1 218 ? -63.381  85.370  26.791  1.00 20.48 ? 321 VAL E N   1 
ATOM   9809  C  CA  . VAL E  1 218 ? -63.886  86.717  26.492  1.00 20.29 ? 321 VAL E CA  1 
ATOM   9810  C  C   . VAL E  1 218 ? -65.192  86.815  27.280  1.00 21.59 ? 321 VAL E C   1 
ATOM   9811  O  O   . VAL E  1 218 ? -65.148  87.130  28.475  1.00 22.52 ? 321 VAL E O   1 
ATOM   9812  C  CB  . VAL E  1 218 ? -63.991  86.998  24.991  1.00 19.78 ? 321 VAL E CB  1 
ATOM   9813  C  CG1 . VAL E  1 218 ? -64.488  88.414  24.742  1.00 20.61 ? 321 VAL E CG1 1 
ATOM   9814  C  CG2 . VAL E  1 218 ? -62.603  86.863  24.327  1.00 18.39 ? 321 VAL E CG2 1 
ATOM   9815  N  N   . LYS E  1 219 ? -66.319  86.465  26.685  1.00 20.98 ? 322 LYS E N   1 
ATOM   9816  C  CA  . LYS E  1 219 ? -67.572  86.488  27.420  1.00 22.14 ? 322 LYS E CA  1 
ATOM   9817  C  C   . LYS E  1 219 ? -67.635  85.366  28.423  1.00 22.83 ? 322 LYS E C   1 
ATOM   9818  O  O   . LYS E  1 219 ? -67.507  84.224  28.072  1.00 27.54 ? 322 LYS E O   1 
ATOM   9819  C  CB  . LYS E  1 219 ? -68.768  86.343  26.509  1.00 26.59 ? 322 LYS E CB  1 
ATOM   9820  C  CG  . LYS E  1 219 ? -69.153  87.583  25.719  1.00 31.91 ? 322 LYS E CG  1 
ATOM   9821  C  CD  . LYS E  1 219 ? -70.304  87.283  24.745  1.00 35.25 ? 322 LYS E CD  1 
ATOM   9822  C  CE  . LYS E  1 219 ? -71.567  86.899  25.493  1.00 35.24 ? 322 LYS E CE  1 
ATOM   9823  N  NZ  . LYS E  1 219 ? -72.640  86.582  24.519  1.00 39.59 ? 322 LYS E NZ  1 
ATOM   9824  N  N   . SER E  1 220 ? -67.845  85.721  29.673  1.00 21.21 ? 323 SER E N   1 
ATOM   9825  C  CA  . SER E  1 220 ? -67.754  84.827  30.798  1.00 19.08 ? 323 SER E CA  1 
ATOM   9826  C  C   . SER E  1 220 ? -69.112  84.265  31.115  1.00 18.54 ? 323 SER E C   1 
ATOM   9827  O  O   . SER E  1 220 ? -70.082  84.683  30.526  1.00 19.16 ? 323 SER E O   1 
ATOM   9828  C  CB  . SER E  1 220 ? -67.212  85.598  32.029  1.00 19.74 ? 323 SER E CB  1 
ATOM   9829  O  OG  . SER E  1 220 ? -68.080  86.676  32.455  1.00 18.40 ? 323 SER E OG  1 
ATOM   9830  N  N   . GLY E  1 221 ? -69.189  83.361  32.084  1.00 17.08 ? 324 GLY E N   1 
ATOM   9831  C  CA  . GLY E  1 221 ? -70.476  82.736  32.488  1.00 16.97 ? 324 GLY E CA  1 
ATOM   9832  C  C   . GLY E  1 221 ? -70.544  81.224  32.304  1.00 15.97 ? 324 GLY E C   1 
ATOM   9833  O  O   . GLY E  1 221 ? -71.525  80.594  32.653  1.00 15.42 ? 324 GLY E O   1 
ATOM   9834  N  N   . THR E  1 222 ? -69.481  80.639  31.789  1.00 15.90 ? 325 THR E N   1 
ATOM   9835  C  CA  . THR E  1 222 ? -69.385  79.182  31.663  1.00 15.95 ? 325 THR E CA  1 
ATOM   9836  C  C   . THR E  1 222 ? -69.454  78.517  33.045  1.00 16.25 ? 325 THR E C   1 
ATOM   9837  O  O   . THR E  1 222 ? -68.733  78.914  33.968  1.00 17.14 ? 325 THR E O   1 
ATOM   9838  C  CB  . THR E  1 222 ? -68.097  78.779  30.968  1.00 15.40 ? 325 THR E CB  1 
ATOM   9839  O  OG1 . THR E  1 222 ? -68.067  79.340  29.654  1.00 15.03 ? 325 THR E OG1 1 
ATOM   9840  C  CG2 . THR E  1 222 ? -68.009  77.282  30.867  1.00 17.16 ? 325 THR E CG2 1 
ATOM   9841  N  N   . ILE E  1 223 ? -70.268  77.474  33.160  1.00 15.27 ? 326 ILE E N   1 
ATOM   9842  C  CA  . ILE E  1 223 ? -70.346  76.674  34.394  1.00 14.58 ? 326 ILE E CA  1 
ATOM   9843  C  C   . ILE E  1 223 ? -69.829  75.244  34.198  1.00 14.67 ? 326 ILE E C   1 
ATOM   9844  O  O   . ILE E  1 223 ? -70.281  74.482  33.320  1.00 15.22 ? 326 ILE E O   1 
ATOM   9845  C  CB  . ILE E  1 223 ? -71.778  76.591  34.924  1.00 15.14 ? 326 ILE E CB  1 
ATOM   9846  C  CG1 . ILE E  1 223 ? -72.374  77.995  35.110  1.00 14.17 ? 326 ILE E CG1 1 
ATOM   9847  C  CG2 . ILE E  1 223 ? -71.840  75.757  36.220  1.00 14.84 ? 326 ILE E CG2 1 
ATOM   9848  C  CD1 . ILE E  1 223 ? -73.717  77.995  35.782  1.00 15.22 ? 326 ILE E CD1 1 
ATOM   9849  N  N   . PHE E  1 224 ? -68.874  74.879  35.039  1.00 14.85 ? 327 PHE E N   1 
ATOM   9850  C  CA  . PHE E  1 224 ? -68.282  73.511  35.075  1.00 13.81 ? 327 PHE E CA  1 
ATOM   9851  C  C   . PHE E  1 224 ? -68.813  72.739  36.267  1.00 13.29 ? 327 PHE E C   1 
ATOM   9852  O  O   . PHE E  1 224 ? -68.816  73.237  37.374  1.00 13.79 ? 327 PHE E O   1 
ATOM   9853  C  CB  . PHE E  1 224 ? -66.777  73.595  35.190  1.00 13.80 ? 327 PHE E CB  1 
ATOM   9854  C  CG  . PHE E  1 224 ? -66.112  74.357  34.082  1.00 13.82 ? 327 PHE E CG  1 
ATOM   9855  C  CD1 . PHE E  1 224 ? -65.651  73.709  32.946  1.00 14.80 ? 327 PHE E CD1 1 
ATOM   9856  C  CD2 . PHE E  1 224 ? -65.844  75.691  34.220  1.00 13.88 ? 327 PHE E CD2 1 
ATOM   9857  C  CE1 . PHE E  1 224 ? -64.969  74.399  31.935  1.00 15.11 ? 327 PHE E CE1 1 
ATOM   9858  C  CE2 . PHE E  1 224 ? -65.206  76.397  33.205  1.00 14.43 ? 327 PHE E CE2 1 
ATOM   9859  C  CZ  . PHE E  1 224 ? -64.776  75.754  32.055  1.00 14.56 ? 327 PHE E CZ  1 
ATOM   9860  N  N   . ASP E  1 225 ? -69.279  71.517  36.060  1.00 12.69 ? 328 ASP E N   1 
ATOM   9861  C  CA  . ASP E  1 225 ? -69.816  70.715  37.165  1.00 12.95 ? 328 ASP E CA  1 
ATOM   9862  C  C   . ASP E  1 225 ? -69.398  69.231  36.906  1.00 12.72 ? 328 ASP E C   1 
ATOM   9863  O  O   . ASP E  1 225 ? -68.871  68.857  35.852  1.00 11.27 ? 328 ASP E O   1 
ATOM   9864  C  CB  . ASP E  1 225 ? -71.380  70.907  37.252  1.00 13.62 ? 328 ASP E CB  1 
ATOM   9865  C  CG  . ASP E  1 225 ? -72.088  70.526  38.678  1.00 14.76 ? 328 ASP E CG  1 
ATOM   9866  O  OD1 . ASP E  1 225 ? -71.383  70.035  39.563  1.00 15.64 ? 328 ASP E OD1 1 
ATOM   9867  O  OD2 . ASP E  1 225 ? -73.315  70.618  38.573  1.00 15.68 ? 328 ASP E OD2 1 
ATOM   9868  N  N   . ASN E  1 226 ? -69.716  68.426  37.897  1.00 11.80 ? 329 ASN E N   1 
ATOM   9869  C  CA  . ASN E  1 226 ? -69.750  66.971  37.798  1.00 12.03 ? 329 ASN E CA  1 
ATOM   9870  C  C   . ASN E  1 226 ? -68.479  66.325  37.226  1.00 11.63 ? 329 ASN E C   1 
ATOM   9871  O  O   . ASN E  1 226 ? -68.518  65.495  36.320  1.00 10.53 ? 329 ASN E O   1 
ATOM   9872  C  CB  . ASN E  1 226 ? -70.955  66.561  36.989  1.00 12.07 ? 329 ASN E CB  1 
ATOM   9873  C  CG  . ASN E  1 226 ? -72.239  67.019  37.632  1.00 12.10 ? 329 ASN E CG  1 
ATOM   9874  O  OD1 . ASN E  1 226 ? -72.555  66.633  38.792  1.00 12.59 ? 329 ASN E OD1 1 
ATOM   9875  N  ND2 . ASN E  1 226 ? -72.975  67.841  36.924  1.00 11.76 ? 329 ASN E ND2 1 
ATOM   9876  N  N   . PHE E  1 227 ? -67.364  66.725  37.804  1.00 11.87 ? 330 PHE E N   1 
ATOM   9877  C  CA  . PHE E  1 227 ? -66.048  66.214  37.403  1.00 12.43 ? 330 PHE E CA  1 
ATOM   9878  C  C   . PHE E  1 227 ? -65.893  64.798  37.906  1.00 13.31 ? 330 PHE E C   1 
ATOM   9879  O  O   . PHE E  1 227 ? -66.319  64.482  39.021  1.00 14.93 ? 330 PHE E O   1 
ATOM   9880  C  CB  . PHE E  1 227 ? -64.933  67.047  37.997  1.00 11.83 ? 330 PHE E CB  1 
ATOM   9881  C  CG  . PHE E  1 227 ? -64.857  68.471  37.496  1.00 11.21 ? 330 PHE E CG  1 
ATOM   9882  C  CD1 . PHE E  1 227 ? -65.551  69.472  38.140  1.00 11.16 ? 330 PHE E CD1 1 
ATOM   9883  C  CD2 . PHE E  1 227 ? -64.044  68.799  36.442  1.00 11.30 ? 330 PHE E CD2 1 
ATOM   9884  C  CE1 . PHE E  1 227 ? -65.438  70.779  37.718  1.00 11.54 ? 330 PHE E CE1 1 
ATOM   9885  C  CE2 . PHE E  1 227 ? -63.936  70.097  35.991  1.00 11.13 ? 330 PHE E CE2 1 
ATOM   9886  C  CZ  . PHE E  1 227 ? -64.639  71.092  36.625  1.00 11.22 ? 330 PHE E CZ  1 
ATOM   9887  N  N   . LEU E  1 228 ? -65.322  63.933  37.068  1.00 14.18 ? 331 LEU E N   1 
ATOM   9888  C  CA  . LEU E  1 228 ? -65.056  62.527  37.434  1.00 14.35 ? 331 LEU E CA  1 
ATOM   9889  C  C   . LEU E  1 228 ? -63.782  62.031  36.764  1.00 14.72 ? 331 LEU E C   1 
ATOM   9890  O  O   . LEU E  1 228 ? -63.593  62.206  35.552  1.00 15.23 ? 331 LEU E O   1 
ATOM   9891  C  CB  . LEU E  1 228 ? -66.202  61.614  37.022  1.00 15.20 ? 331 LEU E CB  1 
ATOM   9892  C  CG  . LEU E  1 228 ? -65.953  60.127  37.255  1.00 15.16 ? 331 LEU E CG  1 
ATOM   9893  C  CD1 . LEU E  1 228 ? -66.023  59.794  38.732  1.00 15.96 ? 331 LEU E CD1 1 
ATOM   9894  C  CD2 . LEU E  1 228 ? -66.954  59.314  36.491  1.00 16.02 ? 331 LEU E CD2 1 
ATOM   9895  N  N   . ILE E  1 229 ? -62.894  61.480  37.576  1.00 14.24 ? 332 ILE E N   1 
ATOM   9896  C  CA  . ILE E  1 229 ? -61.729  60.731  37.070  1.00 14.96 ? 332 ILE E CA  1 
ATOM   9897  C  C   . ILE E  1 229 ? -61.784  59.346  37.636  1.00 14.78 ? 332 ILE E C   1 
ATOM   9898  O  O   . ILE E  1 229 ? -61.872  59.158  38.851  1.00 15.68 ? 332 ILE E O   1 
ATOM   9899  C  CB  . ILE E  1 229 ? -60.419  61.360  37.413  1.00 14.57 ? 332 ILE E CB  1 
ATOM   9900  C  CG1 . ILE E  1 229 ? -60.551  62.846  37.108  1.00 15.27 ? 332 ILE E CG1 1 
ATOM   9901  C  CG2 . ILE E  1 229 ? -59.310  60.711  36.653  1.00 14.18 ? 332 ILE E CG2 1 
ATOM   9902  C  CD1 . ILE E  1 229 ? -59.282  63.564  36.835  1.00 15.27 ? 332 ILE E CD1 1 
ATOM   9903  N  N   . THR E  1 230 ? -61.847  58.381  36.720  1.00 15.10 ? 333 THR E N   1 
ATOM   9904  C  CA  . THR E  1 230 ? -62.102  56.982  37.060  1.00 14.85 ? 333 THR E CA  1 
ATOM   9905  C  C   . THR E  1 230 ? -61.343  56.060  36.106  1.00 16.00 ? 333 THR E C   1 
ATOM   9906  O  O   . THR E  1 230 ? -60.696  56.501  35.117  1.00 15.51 ? 333 THR E O   1 
ATOM   9907  C  CB  . THR E  1 230 ? -63.622  56.671  37.066  1.00 14.96 ? 333 THR E CB  1 
ATOM   9908  O  OG1 . THR E  1 230 ? -63.884  55.360  37.592  1.00 14.90 ? 333 THR E OG1 1 
ATOM   9909  C  CG2 . THR E  1 230 ? -64.221  56.765  35.674  1.00 14.81 ? 333 THR E CG2 1 
ATOM   9910  N  N   . ASN E  1 231 ? -61.387  54.768  36.404  1.00 16.39 ? 334 ASN E N   1 
ATOM   9911  C  CA  . ASN E  1 231 ? -60.742  53.775  35.550  1.00 16.57 ? 334 ASN E CA  1 
ATOM   9912  C  C   . ASN E  1 231 ? -61.756  52.853  34.900  1.00 17.12 ? 334 ASN E C   1 
ATOM   9913  O  O   . ASN E  1 231 ? -61.385  51.844  34.301  1.00 16.19 ? 334 ASN E O   1 
ATOM   9914  C  CB  . ASN E  1 231 ? -59.698  52.964  36.321  1.00 17.09 ? 334 ASN E CB  1 
ATOM   9915  C  CG  . ASN E  1 231 ? -60.317  52.028  37.352  1.00 17.21 ? 334 ASN E CG  1 
ATOM   9916  O  OD1 . ASN E  1 231 ? -61.522  52.061  37.630  1.00 16.06 ? 334 ASN E OD1 1 
ATOM   9917  N  ND2 . ASN E  1 231 ? -59.495  51.171  37.907  1.00 17.59 ? 334 ASN E ND2 1 
ATOM   9918  N  N   . ASP E  1 232 ? -63.032  53.206  35.011  1.00 18.55 ? 335 ASP E N   1 
ATOM   9919  C  CA  . ASP E  1 232 ? -64.151  52.337  34.575  1.00 21.25 ? 335 ASP E CA  1 
ATOM   9920  C  C   . ASP E  1 232 ? -65.107  53.112  33.627  1.00 20.62 ? 335 ASP E C   1 
ATOM   9921  O  O   . ASP E  1 232 ? -65.773  54.053  34.039  1.00 20.83 ? 335 ASP E O   1 
ATOM   9922  C  CB  . ASP E  1 232 ? -64.893  51.817  35.809  1.00 21.58 ? 335 ASP E CB  1 
ATOM   9923  C  CG  . ASP E  1 232 ? -65.786  50.580  35.519  1.00 28.12 ? 335 ASP E CG  1 
ATOM   9924  O  OD1 . ASP E  1 232 ? -65.171  49.499  35.490  1.00 35.09 ? 335 ASP E OD1 1 
ATOM   9925  O  OD2 . ASP E  1 232 ? -67.051  50.589  35.415  1.00 29.95 ? 335 ASP E OD2 1 
ATOM   9926  N  N   . GLU E  1 233 ? -65.131  52.703  32.372  1.00 21.97 ? 336 GLU E N   1 
ATOM   9927  C  CA  . GLU E  1 233 ? -65.945  53.339  31.314  1.00 23.30 ? 336 GLU E CA  1 
ATOM   9928  C  C   . GLU E  1 233 ? -67.418  53.237  31.612  1.00 21.07 ? 336 GLU E C   1 
ATOM   9929  O  O   . GLU E  1 233 ? -68.149  54.166  31.411  1.00 19.64 ? 336 GLU E O   1 
ATOM   9930  C  CB  . GLU E  1 233 ? -65.749  52.684  29.945  1.00 25.47 ? 336 GLU E CB  1 
ATOM   9931  C  CG  . GLU E  1 233 ? -64.321  52.662  29.429  1.00 29.99 ? 336 GLU E CG  1 
ATOM   9932  C  CD  . GLU E  1 233 ? -64.190  52.059  28.010  1.00 31.96 ? 336 GLU E CD  1 
ATOM   9933  O  OE1 . GLU E  1 233 ? -65.088  52.260  27.170  1.00 32.44 ? 336 GLU E OE1 1 
ATOM   9934  O  OE2 . GLU E  1 233 ? -63.180  51.373  27.736  1.00 32.00 ? 336 GLU E OE2 1 
ATOM   9935  N  N   . ALA E  1 234 ? -67.837  52.060  32.052  1.00 19.36 ? 337 ALA E N   1 
ATOM   9936  C  CA  . ALA E  1 234 ? -69.209  51.830  32.386  1.00 17.25 ? 337 ALA E CA  1 
ATOM   9937  C  C   . ALA E  1 234 ? -69.642  52.734  33.560  1.00 17.16 ? 337 ALA E C   1 
ATOM   9938  O  O   . ALA E  1 234 ? -70.708  53.328  33.521  1.00 17.97 ? 337 ALA E O   1 
ATOM   9939  C  CB  . ALA E  1 234 ? -69.434  50.379  32.753  1.00 17.28 ? 337 ALA E CB  1 
ATOM   9940  N  N   . TYR E  1 235 ? -68.817  52.845  34.590  1.00 16.07 ? 338 TYR E N   1 
ATOM   9941  C  CA  . TYR E  1 235 ? -69.121  53.730  35.712  1.00 16.54 ? 338 TYR E CA  1 
ATOM   9942  C  C   . TYR E  1 235 ? -69.194  55.208  35.280  1.00 15.48 ? 338 TYR E C   1 
ATOM   9943  O  O   . TYR E  1 235 ? -70.138  55.933  35.635  1.00 14.61 ? 338 TYR E O   1 
ATOM   9944  C  CB  . TYR E  1 235 ? -68.127  53.581  36.845  1.00 17.34 ? 338 TYR E CB  1 
ATOM   9945  C  CG  . TYR E  1 235 ? -68.528  54.430  38.001  1.00 18.56 ? 338 TYR E CG  1 
ATOM   9946  C  CD1 . TYR E  1 235 ? -69.723  54.183  38.654  1.00 21.13 ? 338 TYR E CD1 1 
ATOM   9947  C  CD2 . TYR E  1 235 ? -67.781  55.538  38.377  1.00 19.33 ? 338 TYR E CD2 1 
ATOM   9948  C  CE1 . TYR E  1 235 ? -70.153  55.009  39.676  1.00 23.05 ? 338 TYR E CE1 1 
ATOM   9949  C  CE2 . TYR E  1 235 ? -68.186  56.354  39.410  1.00 21.18 ? 338 TYR E CE2 1 
ATOM   9950  C  CZ  . TYR E  1 235 ? -69.379  56.096  40.033  1.00 23.06 ? 338 TYR E CZ  1 
ATOM   9951  O  OH  . TYR E  1 235 ? -69.798  56.902  41.072  1.00 28.84 ? 338 TYR E OH  1 
ATOM   9952  N  N   . ALA E  1 236 ? -68.262  55.624  34.444  1.00 14.96 ? 339 ALA E N   1 
ATOM   9953  C  CA  . ALA E  1 236 ? -68.344  56.965  33.864  1.00 15.53 ? 339 ALA E CA  1 
ATOM   9954  C  C   . ALA E  1 236 ? -69.692  57.211  33.174  1.00 15.85 ? 339 ALA E C   1 
ATOM   9955  O  O   . ALA E  1 236 ? -70.287  58.278  33.293  1.00 15.81 ? 339 ALA E O   1 
ATOM   9956  C  CB  . ALA E  1 236 ? -67.224  57.190  32.882  1.00 15.52 ? 339 ALA E CB  1 
ATOM   9957  N  N   . GLU E  1 237 ? -70.154  56.237  32.411  1.00 16.68 ? 340 GLU E N   1 
ATOM   9958  C  CA  . GLU E  1 237 ? -71.418  56.373  31.686  1.00 18.68 ? 340 GLU E CA  1 
ATOM   9959  C  C   . GLU E  1 237 ? -72.606  56.464  32.656  1.00 17.77 ? 340 GLU E C   1 
ATOM   9960  O  O   . GLU E  1 237 ? -73.516  57.250  32.447  1.00 17.93 ? 340 GLU E O   1 
ATOM   9961  C  CB  . GLU E  1 237 ? -71.628  55.187  30.707  1.00 20.46 ? 340 GLU E CB  1 
ATOM   9962  C  CG  . GLU E  1 237 ? -72.859  55.380  29.850  1.00 22.52 ? 340 GLU E CG  1 
ATOM   9963  C  CD  . GLU E  1 237 ? -72.976  54.426  28.663  1.00 25.18 ? 340 GLU E CD  1 
ATOM   9964  O  OE1 . GLU E  1 237 ? -74.087  54.198  28.093  1.00 28.93 ? 340 GLU E OE1 1 
ATOM   9965  O  OE2 . GLU E  1 237 ? -71.946  53.883  28.287  1.00 25.11 ? 340 GLU E OE2 1 
ATOM   9966  N  N   . GLU E  1 238 ? -72.586  55.637  33.692  1.00 17.31 ? 341 GLU E N   1 
ATOM   9967  C  CA  . GLU E  1 238 ? -73.589  55.692  34.740  1.00 19.55 ? 341 GLU E CA  1 
ATOM   9968  C  C   . GLU E  1 238 ? -73.670  57.054  35.391  1.00 18.61 ? 341 GLU E C   1 
ATOM   9969  O  O   . GLU E  1 238 ? -74.746  57.615  35.552  1.00 19.45 ? 341 GLU E O   1 
ATOM   9970  C  CB  . GLU E  1 238 ? -73.308  54.708  35.852  1.00 21.77 ? 341 GLU E CB  1 
ATOM   9971  C  CG  . GLU E  1 238 ? -73.487  53.254  35.444  1.00 25.86 ? 341 GLU E CG  1 
ATOM   9972  C  CD  . GLU E  1 238 ? -72.898  52.242  36.456  1.00 29.55 ? 341 GLU E CD  1 
ATOM   9973  O  OE1 . GLU E  1 238 ? -72.825  52.593  37.679  1.00 31.08 ? 341 GLU E OE1 1 
ATOM   9974  O  OE2 . GLU E  1 238 ? -72.554  51.092  36.036  1.00 27.03 ? 341 GLU E OE2 1 
ATOM   9975  N  N   . PHE E  1 239 ? -72.528  57.549  35.800  1.00 17.38 ? 342 PHE E N   1 
ATOM   9976  C  CA  . PHE E  1 239 ? -72.429  58.817  36.497  1.00 16.47 ? 342 PHE E CA  1 
ATOM   9977  C  C   . PHE E  1 239 ? -72.882  59.964  35.568  1.00 16.43 ? 342 PHE E C   1 
ATOM   9978  O  O   . PHE E  1 239 ? -73.505  60.921  36.007  1.00 17.09 ? 342 PHE E O   1 
ATOM   9979  C  CB  . PHE E  1 239 ? -70.969  59.033  36.938  1.00 16.39 ? 342 PHE E CB  1 
ATOM   9980  C  CG  . PHE E  1 239 ? -70.756  60.202  37.837  1.00 16.04 ? 342 PHE E CG  1 
ATOM   9981  C  CD1 . PHE E  1 239 ? -71.398  60.250  39.068  1.00 17.35 ? 342 PHE E CD1 1 
ATOM   9982  C  CD2 . PHE E  1 239 ? -69.909  61.228  37.494  1.00 16.17 ? 342 PHE E CD2 1 
ATOM   9983  C  CE1 . PHE E  1 239 ? -71.229  61.342  39.908  1.00 17.26 ? 342 PHE E CE1 1 
ATOM   9984  C  CE2 . PHE E  1 239 ? -69.754  62.340  38.342  1.00 17.03 ? 342 PHE E CE2 1 
ATOM   9985  C  CZ  . PHE E  1 239 ? -70.405  62.389  39.553  1.00 15.75 ? 342 PHE E CZ  1 
ATOM   9986  N  N   . GLY E  1 240 ? -72.541  59.857  34.304  1.00 14.65 ? 343 GLY E N   1 
ATOM   9987  C  CA  . GLY E  1 240 ? -72.973  60.797  33.310  1.00 14.03 ? 343 GLY E CA  1 
ATOM   9988  C  C   . GLY E  1 240 ? -74.491  60.844  33.272  1.00 14.05 ? 343 GLY E C   1 
ATOM   9989  O  O   . GLY E  1 240 ? -75.084  61.920  33.190  1.00 12.67 ? 343 GLY E O   1 
ATOM   9990  N  N   . ASN E  1 241 ? -75.125  59.688  33.288  1.00 13.99 ? 344 ASN E N   1 
ATOM   9991  C  CA  . ASN E  1 241 ? -76.594  59.642  33.236  1.00 15.39 ? 344 ASN E CA  1 
ATOM   9992  C  C   . ASN E  1 241 ? -77.274  60.113  34.517  1.00 17.33 ? 344 ASN E C   1 
ATOM   9993  O  O   . ASN E  1 241 ? -78.444  60.525  34.472  1.00 19.00 ? 344 ASN E O   1 
ATOM   9994  C  CB  . ASN E  1 241 ? -77.112  58.244  32.789  1.00 14.45 ? 344 ASN E CB  1 
ATOM   9995  C  CG  . ASN E  1 241 ? -76.868  58.001  31.292  1.00 13.73 ? 344 ASN E CG  1 
ATOM   9996  O  OD1 . ASN E  1 241 ? -76.714  58.939  30.545  1.00 12.37 ? 344 ASN E OD1 1 
ATOM   9997  N  ND2 . ASN E  1 241 ? -76.804  56.749  30.883  1.00 13.17 ? 344 ASN E ND2 1 
ATOM   9998  N  N   . GLU E  1 242 ? -76.559  60.009  35.633  1.00 18.92 ? 345 GLU E N   1 
ATOM   9999  C  CA  . GLU E  1 242 ? -77.043  60.407  36.939  1.00 20.61 ? 345 GLU E CA  1 
ATOM   10000 C  C   . GLU E  1 242 ? -76.776  61.884  37.175  1.00 19.23 ? 345 GLU E C   1 
ATOM   10001 O  O   . GLU E  1 242 ? -77.356  62.468  38.082  1.00 18.71 ? 345 GLU E O   1 
ATOM   10002 C  CB  . GLU E  1 242 ? -76.356  59.628  38.081  1.00 25.53 ? 345 GLU E CB  1 
ATOM   10003 C  CG  . GLU E  1 242 ? -76.974  58.276  38.439  1.00 28.85 ? 345 GLU E CG  1 
ATOM   10004 C  CD  . GLU E  1 242 ? -76.031  57.344  39.247  1.00 32.86 ? 345 GLU E CD  1 
ATOM   10005 O  OE1 . GLU E  1 242 ? -74.793  57.543  39.243  1.00 35.03 ? 345 GLU E OE1 1 
ATOM   10006 O  OE2 . GLU E  1 242 ? -76.526  56.341  39.839  1.00 36.19 ? 345 GLU E OE2 1 
ATOM   10007 N  N   . THR E  1 243 ? -75.957  62.498  36.336  1.00 17.56 ? 346 THR E N   1 
ATOM   10008 C  CA  . THR E  1 243 ? -75.660  63.937  36.462  1.00 15.90 ? 346 THR E CA  1 
ATOM   10009 C  C   . THR E  1 243 ? -76.209  64.767  35.272  1.00 15.90 ? 346 THR E C   1 
ATOM   10010 O  O   . THR E  1 243 ? -77.329  65.279  35.329  1.00 15.81 ? 346 THR E O   1 
ATOM   10011 C  CB  . THR E  1 243 ? -74.155  64.163  36.645  1.00 16.24 ? 346 THR E CB  1 
ATOM   10012 O  OG1 . THR E  1 243 ? -73.437  63.587  35.552  1.00 15.11 ? 346 THR E OG1 1 
ATOM   10013 C  CG2 . THR E  1 243 ? -73.691  63.548  37.943  1.00 17.05 ? 346 THR E CG2 1 
ATOM   10014 N  N   . TRP E  1 244 ? -75.473  64.831  34.168  1.00 15.85 ? 347 TRP E N   1 
ATOM   10015 C  CA  . TRP E  1 244 ? -75.976  65.419  32.906  1.00 15.30 ? 347 TRP E CA  1 
ATOM   10016 C  C   . TRP E  1 244 ? -77.361  64.914  32.521  1.00 14.93 ? 347 TRP E C   1 
ATOM   10017 O  O   . TRP E  1 244 ? -78.258  65.671  32.126  1.00 15.19 ? 347 TRP E O   1 
ATOM   10018 C  CB  . TRP E  1 244 ? -74.999  65.164  31.755  1.00 14.73 ? 347 TRP E CB  1 
ATOM   10019 C  CG  . TRP E  1 244 ? -75.591  65.405  30.422  1.00 15.76 ? 347 TRP E CG  1 
ATOM   10020 C  CD1 . TRP E  1 244 ? -75.749  66.618  29.806  1.00 17.27 ? 347 TRP E CD1 1 
ATOM   10021 C  CD2 . TRP E  1 244 ? -76.082  64.434  29.502  1.00 17.06 ? 347 TRP E CD2 1 
ATOM   10022 N  NE1 . TRP E  1 244 ? -76.358  66.463  28.587  1.00 17.59 ? 347 TRP E NE1 1 
ATOM   10023 C  CE2 . TRP E  1 244 ? -76.555  65.132  28.366  1.00 18.36 ? 347 TRP E CE2 1 
ATOM   10024 C  CE3 . TRP E  1 244 ? -76.213  63.044  29.540  1.00 17.71 ? 347 TRP E CE3 1 
ATOM   10025 C  CZ2 . TRP E  1 244 ? -77.135  64.485  27.275  1.00 19.92 ? 347 TRP E CZ2 1 
ATOM   10026 C  CZ3 . TRP E  1 244 ? -76.751  62.393  28.461  1.00 19.25 ? 347 TRP E CZ3 1 
ATOM   10027 C  CH2 . TRP E  1 244 ? -77.218  63.114  27.329  1.00 20.45 ? 347 TRP E CH2 1 
ATOM   10028 N  N   . GLY E  1 245 ? -77.548  63.624  32.648  1.00 14.43 ? 348 GLY E N   1 
ATOM   10029 C  CA  . GLY E  1 245 ? -78.776  63.004  32.208  1.00 15.37 ? 348 GLY E CA  1 
ATOM   10030 C  C   . GLY E  1 245 ? -79.965  63.399  33.036  1.00 15.19 ? 348 GLY E C   1 
ATOM   10031 O  O   . GLY E  1 245 ? -81.100  63.159  32.633  1.00 15.30 ? 348 GLY E O   1 
ATOM   10032 N  N   . VAL E  1 246 ? -79.707  63.872  34.245  1.00 16.54 ? 349 VAL E N   1 
ATOM   10033 C  CA  . VAL E  1 246 ? -80.756  64.284  35.177  1.00 16.74 ? 349 VAL E CA  1 
ATOM   10034 C  C   . VAL E  1 246 ? -80.980  65.791  35.065  1.00 16.79 ? 349 VAL E C   1 
ATOM   10035 O  O   . VAL E  1 246 ? -82.090  66.263  35.275  1.00 19.29 ? 349 VAL E O   1 
ATOM   10036 C  CB  . VAL E  1 246 ? -80.393  63.903  36.623  1.00 18.02 ? 349 VAL E CB  1 
ATOM   10037 C  CG1 . VAL E  1 246 ? -81.259  64.621  37.655  1.00 17.37 ? 349 VAL E CG1 1 
ATOM   10038 C  CG2 . VAL E  1 246 ? -80.553  62.389  36.813  1.00 18.23 ? 349 VAL E CG2 1 
ATOM   10039 N  N   . THR E  1 247 ? -79.966  66.522  34.644  1.00 15.99 ? 350 THR E N   1 
ATOM   10040 C  CA  . THR E  1 247 ? -80.052  67.947  34.390  1.00 16.64 ? 350 THR E CA  1 
ATOM   10041 C  C   . THR E  1 247 ? -80.868  68.306  33.154  1.00 18.10 ? 350 THR E C   1 
ATOM   10042 O  O   . THR E  1 247 ? -81.710  69.195  33.155  1.00 18.02 ? 350 THR E O   1 
ATOM   10043 C  CB  . THR E  1 247 ? -78.632  68.488  34.149  1.00 15.99 ? 350 THR E CB  1 
ATOM   10044 O  OG1 . THR E  1 247 ? -77.861  68.303  35.341  1.00 15.34 ? 350 THR E OG1 1 
ATOM   10045 C  CG2 . THR E  1 247 ? -78.654  69.984  33.820  1.00 16.74 ? 350 THR E CG2 1 
ATOM   10046 N  N   . LYS E  1 248 ? -80.561  67.571  32.100  1.00 19.42 ? 351 LYS E N   1 
ATOM   10047 C  CA  . LYS E  1 248 ? -80.895  67.875  30.711  1.00 19.79 ? 351 LYS E CA  1 
ATOM   10048 C  C   . LYS E  1 248 ? -82.325  68.416  30.392  1.00 18.10 ? 351 LYS E C   1 
ATOM   10049 O  O   . LYS E  1 248 ? -82.471  69.502  29.875  1.00 17.92 ? 351 LYS E O   1 
ATOM   10050 C  CB  . LYS E  1 248 ? -80.622  66.575  29.967  1.00 22.27 ? 351 LYS E CB  1 
ATOM   10051 C  CG  . LYS E  1 248 ? -80.979  66.443  28.540  1.00 27.07 ? 351 LYS E CG  1 
ATOM   10052 C  CD  . LYS E  1 248 ? -80.634  64.998  28.179  1.00 32.31 ? 351 LYS E CD  1 
ATOM   10053 C  CE  . LYS E  1 248 ? -81.314  64.673  26.887  1.00 33.01 ? 351 LYS E CE  1 
ATOM   10054 N  NZ  . LYS E  1 248 ? -80.614  63.630  26.115  1.00 39.04 ? 351 LYS E NZ  1 
ATOM   10055 N  N   . ALA E  1 249 ? -83.353  67.626  30.686  1.00 16.84 ? 352 ALA E N   1 
ATOM   10056 C  CA  . ALA E  1 249 ? -84.728  67.913  30.231  1.00 17.31 ? 352 ALA E CA  1 
ATOM   10057 C  C   . ALA E  1 249 ? -85.351  69.108  30.966  1.00 17.47 ? 352 ALA E C   1 
ATOM   10058 O  O   . ALA E  1 249 ? -85.974  69.954  30.355  1.00 18.46 ? 352 ALA E O   1 
ATOM   10059 C  CB  . ALA E  1 249 ? -85.614  66.664  30.364  1.00 15.95 ? 352 ALA E CB  1 
ATOM   10060 N  N   . ALA E  1 250 ? -85.195  69.127  32.295  1.00 18.87 ? 353 ALA E N   1 
ATOM   10061 C  CA  . ALA E  1 250 ? -85.700  70.222  33.142  1.00 18.79 ? 353 ALA E CA  1 
ATOM   10062 C  C   . ALA E  1 250 ? -84.975  71.544  32.837  1.00 17.77 ? 353 ALA E C   1 
ATOM   10063 O  O   . ALA E  1 250 ? -85.597  72.560  32.715  1.00 16.78 ? 353 ALA E O   1 
ATOM   10064 C  CB  . ALA E  1 250 ? -85.574  69.865  34.603  1.00 18.91 ? 353 ALA E CB  1 
ATOM   10065 N  N   . GLU E  1 251 ? -83.676  71.477  32.585  1.00 17.37 ? 354 GLU E N   1 
ATOM   10066 C  CA  . GLU E  1 251 ? -82.919  72.657  32.122  1.00 17.31 ? 354 GLU E CA  1 
ATOM   10067 C  C   . GLU E  1 251 ? -83.474  73.283  30.829  1.00 17.43 ? 354 GLU E C   1 
ATOM   10068 O  O   . GLU E  1 251 ? -83.696  74.480  30.733  1.00 16.17 ? 354 GLU E O   1 
ATOM   10069 C  CB  . GLU E  1 251 ? -81.449  72.288  31.925  1.00 17.55 ? 354 GLU E CB  1 
ATOM   10070 C  CG  . GLU E  1 251 ? -80.548  73.397  31.418  1.00 17.11 ? 354 GLU E CG  1 
ATOM   10071 C  CD  . GLU E  1 251 ? -79.094  72.943  31.225  1.00 19.02 ? 354 GLU E CD  1 
ATOM   10072 O  OE1 . GLU E  1 251 ? -78.783  72.327  30.183  1.00 19.12 ? 354 GLU E OE1 1 
ATOM   10073 O  OE2 . GLU E  1 251 ? -78.214  73.283  32.092  1.00 20.44 ? 354 GLU E OE2 1 
ATOM   10074 N  N   . LYS E  1 252 ? -83.673  72.441  29.843  1.00 17.94 ? 355 LYS E N   1 
ATOM   10075 C  CA  . LYS E  1 252 ? -84.207  72.832  28.570  1.00 19.58 ? 355 LYS E CA  1 
ATOM   10076 C  C   . LYS E  1 252 ? -85.650  73.406  28.719  1.00 19.06 ? 355 LYS E C   1 
ATOM   10077 O  O   . LYS E  1 252 ? -86.013  74.388  28.082  1.00 20.07 ? 355 LYS E O   1 
ATOM   10078 C  CB  . LYS E  1 252 ? -84.218  71.586  27.645  1.00 21.56 ? 355 LYS E CB  1 
ATOM   10079 C  CG  . LYS E  1 252 ? -84.865  71.753  26.275  1.00 23.84 ? 355 LYS E CG  1 
ATOM   10080 C  CD  . LYS E  1 252 ? -83.935  72.588  25.413  1.00 27.54 ? 355 LYS E CD  1 
ATOM   10081 C  CE  . LYS E  1 252 ? -84.330  73.215  24.102  1.00 30.91 ? 355 LYS E CE  1 
ATOM   10082 N  NZ  . LYS E  1 252 ? -85.177  72.314  23.351  1.00 32.96 ? 355 LYS E NZ  1 
ATOM   10083 N  N   . GLN E  1 253 ? -86.462  72.777  29.539  1.00 17.91 ? 356 GLN E N   1 
ATOM   10084 C  CA  . GLN E  1 253 ? -87.817  73.252  29.790  1.00 20.63 ? 356 GLN E CA  1 
ATOM   10085 C  C   . GLN E  1 253 ? -87.840  74.651  30.450  1.00 21.09 ? 356 GLN E C   1 
ATOM   10086 O  O   . GLN E  1 253 ? -88.583  75.544  30.036  1.00 22.80 ? 356 GLN E O   1 
ATOM   10087 C  CB  . GLN E  1 253 ? -88.501  72.225  30.658  1.00 23.27 ? 356 GLN E CB  1 
ATOM   10088 C  CG  . GLN E  1 253 ? -89.978  72.352  30.853  1.00 26.76 ? 356 GLN E CG  1 
ATOM   10089 C  CD  . GLN E  1 253 ? -90.472  71.292  31.850  1.00 30.68 ? 356 GLN E CD  1 
ATOM   10090 O  OE1 . GLN E  1 253 ? -90.387  70.098  31.626  1.00 31.78 ? 356 GLN E OE1 1 
ATOM   10091 N  NE2 . GLN E  1 253 ? -90.991  71.747  32.955  1.00 36.97 ? 356 GLN E NE2 1 
ATOM   10092 N  N   . MET E  1 254 ? -87.017  74.852  31.469  1.00 19.26 ? 357 MET E N   1 
ATOM   10093 C  CA  . MET E  1 254 ? -86.946  76.153  32.123  1.00 20.27 ? 357 MET E CA  1 
ATOM   10094 C  C   . MET E  1 254 ? -86.429  77.232  31.181  1.00 18.80 ? 357 MET E C   1 
ATOM   10095 O  O   . MET E  1 254 ? -86.918  78.346  31.174  1.00 17.27 ? 357 MET E O   1 
ATOM   10096 C  CB  . MET E  1 254 ? -86.047  76.086  33.352  1.00 21.03 ? 357 MET E CB  1 
ATOM   10097 C  CG  . MET E  1 254 ? -85.876  77.417  34.046  1.00 22.44 ? 357 MET E CG  1 
ATOM   10098 S  SD  . MET E  1 254 ? -85.034  77.226  35.632  1.00 22.98 ? 357 MET E SD  1 
ATOM   10099 C  CE  . MET E  1 254 ? -86.273  76.375  36.603  1.00 28.51 ? 357 MET E CE  1 
ATOM   10100 N  N   . LYS E  1 255 ? -85.490  76.872  30.329  1.00 19.04 ? 358 LYS E N   1 
ATOM   10101 C  CA  . LYS E  1 255 ? -84.963  77.840  29.364  1.00 20.73 ? 358 LYS E CA  1 
ATOM   10102 C  C   . LYS E  1 255 ? -85.964  78.195  28.228  1.00 22.85 ? 358 LYS E C   1 
ATOM   10103 O  O   . LYS E  1 255 ? -86.089  79.358  27.844  1.00 24.91 ? 358 LYS E O   1 
ATOM   10104 C  CB  . LYS E  1 255 ? -83.666  77.351  28.798  1.00 19.10 ? 358 LYS E CB  1 
ATOM   10105 C  CG  . LYS E  1 255 ? -83.116  78.178  27.667  1.00 20.45 ? 358 LYS E CG  1 
ATOM   10106 C  CD  . LYS E  1 255 ? -82.631  79.543  28.098  1.00 22.00 ? 358 LYS E CD  1 
ATOM   10107 C  CE  . LYS E  1 255 ? -82.047  80.191  26.860  1.00 24.19 ? 358 LYS E CE  1 
ATOM   10108 N  NZ  . LYS E  1 255 ? -81.215  81.362  27.104  1.00 27.56 ? 358 LYS E NZ  1 
ATOM   10109 N  N   . ASP E  1 256 ? -86.676  77.207  27.703  1.00 21.86 ? 359 ASP E N   1 
ATOM   10110 C  CA  . ASP E  1 256 ? -87.725  77.495  26.731  1.00 23.63 ? 359 ASP E CA  1 
ATOM   10111 C  C   . ASP E  1 256 ? -88.765  78.485  27.290  1.00 23.60 ? 359 ASP E C   1 
ATOM   10112 O  O   . ASP E  1 256 ? -89.237  79.367  26.593  1.00 22.42 ? 359 ASP E O   1 
ATOM   10113 C  CB  . ASP E  1 256 ? -88.452  76.204  26.325  1.00 24.99 ? 359 ASP E CB  1 
ATOM   10114 C  CG  . ASP E  1 256 ? -87.566  75.258  25.512  1.00 28.59 ? 359 ASP E CG  1 
ATOM   10115 O  OD1 . ASP E  1 256 ? -86.482  75.671  25.003  1.00 30.31 ? 359 ASP E OD1 1 
ATOM   10116 O  OD2 . ASP E  1 256 ? -87.953  74.067  25.407  1.00 36.72 ? 359 ASP E OD2 1 
ATOM   10117 N  N   . LYS E  1 257 ? -89.108  78.314  28.562  1.00 23.54 ? 360 LYS E N   1 
ATOM   10118 C  CA  . LYS E  1 257 ? -90.076  79.141  29.207  1.00 26.49 ? 360 LYS E CA  1 
ATOM   10119 C  C   . LYS E  1 257 ? -89.568  80.578  29.289  1.00 27.35 ? 360 LYS E C   1 
ATOM   10120 O  O   . LYS E  1 257 ? -90.298  81.503  28.957  1.00 25.39 ? 360 LYS E O   1 
ATOM   10121 C  CB  . LYS E  1 257 ? -90.404  78.629  30.578  1.00 27.92 ? 360 LYS E CB  1 
ATOM   10122 C  CG  . LYS E  1 257 ? -91.499  79.457  31.208  1.00 32.81 ? 360 LYS E CG  1 
ATOM   10123 C  CD  . LYS E  1 257 ? -92.368  78.621  32.122  1.00 38.71 ? 360 LYS E CD  1 
ATOM   10124 C  CE  . LYS E  1 257 ? -93.834  79.019  32.049  1.00 43.89 ? 360 LYS E CE  1 
ATOM   10125 N  NZ  . LYS E  1 257 ? -94.097  80.473  32.276  1.00 45.44 ? 360 LYS E NZ  1 
ATOM   10126 N  N   . GLN E  1 258 ? -88.324  80.746  29.698  1.00 25.81 ? 361 GLN E N   1 
ATOM   10127 C  CA  . GLN E  1 258 ? -87.706  82.082  29.780  1.00 25.45 ? 361 GLN E CA  1 
ATOM   10128 C  C   . GLN E  1 258 ? -87.528  82.745  28.428  1.00 26.19 ? 361 GLN E C   1 
ATOM   10129 O  O   . GLN E  1 258 ? -87.708  83.955  28.323  1.00 27.15 ? 361 GLN E O   1 
ATOM   10130 C  CB  . GLN E  1 258 ? -86.329  82.034  30.434  1.00 23.45 ? 361 GLN E CB  1 
ATOM   10131 C  CG  . GLN E  1 258 ? -86.319  81.540  31.880  1.00 22.50 ? 361 GLN E CG  1 
ATOM   10132 C  CD  . GLN E  1 258 ? -84.928  81.502  32.470  1.00 21.91 ? 361 GLN E CD  1 
ATOM   10133 O  OE1 . GLN E  1 258 ? -83.917  81.570  31.754  1.00 23.93 ? 361 GLN E OE1 1 
ATOM   10134 N  NE2 . GLN E  1 258 ? -84.858  81.370  33.771  1.00 21.53 ? 361 GLN E NE2 1 
ATOM   10135 N  N   . ASP E  1 259 ? -87.234  81.965  27.400  1.00 24.95 ? 362 ASP E N   1 
ATOM   10136 C  CA  . ASP E  1 259 ? -87.166  82.498  26.019  1.00 28.19 ? 362 ASP E CA  1 
ATOM   10137 C  C   . ASP E  1 259 ? -88.520  83.032  25.545  1.00 28.85 ? 362 ASP E C   1 
ATOM   10138 O  O   . ASP E  1 259 ? -88.598  84.111  24.977  1.00 26.84 ? 362 ASP E O   1 
ATOM   10139 C  CB  . ASP E  1 259 ? -86.706  81.432  25.017  1.00 29.04 ? 362 ASP E CB  1 
ATOM   10140 C  CG  . ASP E  1 259 ? -85.217  81.109  25.133  1.00 34.63 ? 362 ASP E CG  1 
ATOM   10141 O  OD1 . ASP E  1 259 ? -84.506  81.814  25.888  1.00 40.53 ? 362 ASP E OD1 1 
ATOM   10142 O  OD2 . ASP E  1 259 ? -84.769  80.132  24.488  1.00 37.38 ? 362 ASP E OD2 1 
ATOM   10143 N  N   . GLU E  1 260 ? -89.577  82.266  25.784  1.00 30.95 ? 363 GLU E N   1 
ATOM   10144 C  CA  . GLU E  1 260 ? -90.939  82.723  25.468  1.00 37.57 ? 363 GLU E CA  1 
ATOM   10145 C  C   . GLU E  1 260 ? -91.317  84.000  26.187  1.00 35.19 ? 363 GLU E C   1 
ATOM   10146 O  O   . GLU E  1 260 ? -91.819  84.912  25.570  1.00 36.11 ? 363 GLU E O   1 
ATOM   10147 C  CB  . GLU E  1 260 ? -91.978  81.647  25.773  1.00 45.22 ? 363 GLU E CB  1 
ATOM   10148 C  CG  . GLU E  1 260 ? -92.205  80.719  24.579  1.00 54.34 ? 363 GLU E CG  1 
ATOM   10149 C  CD  . GLU E  1 260 ? -93.457  81.099  23.728  1.00 66.99 ? 363 GLU E CD  1 
ATOM   10150 O  OE1 . GLU E  1 260 ? -94.544  81.251  24.331  1.00 75.31 ? 363 GLU E OE1 1 
ATOM   10151 O  OE2 . GLU E  1 260 ? -93.401  81.234  22.465  1.00 65.15 ? 363 GLU E OE2 1 
ATOM   10152 N  N   . GLU E  1 261 ? -91.068  84.079  27.481  1.00 36.29 ? 364 GLU E N   1 
ATOM   10153 C  CA  . GLU E  1 261 ? -91.383  85.326  28.214  1.00 41.78 ? 364 GLU E CA  1 
ATOM   10154 C  C   . GLU E  1 261 ? -90.574  86.532  27.677  1.00 41.22 ? 364 GLU E C   1 
ATOM   10155 O  O   . GLU E  1 261 ? -91.069  87.640  27.574  1.00 39.21 ? 364 GLU E O   1 
ATOM   10156 C  CB  . GLU E  1 261 ? -91.162  85.198  29.726  1.00 43.63 ? 364 GLU E CB  1 
ATOM   10157 C  CG  . GLU E  1 261 ? -91.797  83.957  30.388  1.00 49.45 ? 364 GLU E CG  1 
ATOM   10158 C  CD  . GLU E  1 261 ? -93.318  84.010  30.518  1.00 54.74 ? 364 GLU E CD  1 
ATOM   10159 O  OE1 . GLU E  1 261 ? -93.902  85.079  30.327  1.00 60.46 ? 364 GLU E OE1 1 
ATOM   10160 O  OE2 . GLU E  1 261 ? -93.928  82.967  30.816  1.00 56.34 ? 364 GLU E OE2 1 
ATOM   10161 N  N   . GLN E  1 262 ? -89.322  86.289  27.331  1.00 42.88 ? 365 GLN E N   1 
ATOM   10162 C  CA  . GLN E  1 262 ? -88.467  87.310  26.773  1.00 42.69 ? 365 GLN E CA  1 
ATOM   10163 C  C   . GLN E  1 262 ? -89.074  87.881  25.513  1.00 42.17 ? 365 GLN E C   1 
ATOM   10164 O  O   . GLN E  1 262 ? -89.098  89.089  25.330  1.00 45.01 ? 365 GLN E O   1 
ATOM   10165 C  CB  . GLN E  1 262 ? -87.093  86.725  26.465  1.00 45.17 ? 365 GLN E CB  1 
ATOM   10166 C  CG  . GLN E  1 262 ? -86.025  87.734  26.083  1.00 49.89 ? 365 GLN E CG  1 
ATOM   10167 C  CD  . GLN E  1 262 ? -85.831  88.839  27.113  1.00 56.89 ? 365 GLN E CD  1 
ATOM   10168 O  OE1 . GLN E  1 262 ? -85.561  89.973  26.746  1.00 57.60 ? 365 GLN E OE1 1 
ATOM   10169 N  NE2 . GLN E  1 262 ? -85.987  88.522  28.408  1.00 61.90 ? 365 GLN E NE2 1 
ATOM   10170 N  N   . ARG E  1 263 ? -89.568  87.021  24.639  1.00 41.06 ? 366 ARG E N   1 
ATOM   10171 C  CA  . ARG E  1 263 ? -90.225  87.520  23.441  1.00 43.36 ? 366 ARG E CA  1 
ATOM   10172 C  C   . ARG E  1 263 ? -91.662  88.023  23.687  1.00 42.56 ? 366 ARG E C   1 
ATOM   10173 O  O   . ARG E  1 263 ? -92.125  88.971  23.050  1.00 40.66 ? 366 ARG E O   1 
ATOM   10174 C  CB  . ARG E  1 263 ? -90.179  86.506  22.320  1.00 44.42 ? 366 ARG E CB  1 
ATOM   10175 C  CG  . ARG E  1 263 ? -90.983  85.257  22.535  1.00 50.85 ? 366 ARG E CG  1 
ATOM   10176 C  CD  . ARG E  1 263 ? -90.995  84.385  21.273  1.00 56.57 ? 366 ARG E CD  1 
ATOM   10177 N  NE  . ARG E  1 263 ? -90.878  82.938  21.558  1.00 61.00 ? 366 ARG E NE  1 
ATOM   10178 C  CZ  . ARG E  1 263 ? -89.731  82.252  21.695  1.00 64.84 ? 366 ARG E CZ  1 
ATOM   10179 N  NH1 . ARG E  1 263 ? -88.534  82.833  21.563  1.00 64.81 ? 366 ARG E NH1 1 
ATOM   10180 N  NH2 . ARG E  1 263 ? -89.778  80.951  21.963  1.00 65.90 ? 366 ARG E NH2 1 
ATOM   10181 N  N   . PRO F  1 10  ? -10.017  54.392  5.848   1.00 43.39 ? 19  PRO F N   1 
ATOM   10182 C  CA  . PRO F  1 10  ? -11.289  54.391  5.092   1.00 41.22 ? 19  PRO F CA  1 
ATOM   10183 C  C   . PRO F  1 10  ? -12.368  55.019  5.907   1.00 34.44 ? 19  PRO F C   1 
ATOM   10184 O  O   . PRO F  1 10  ? -12.686  54.554  6.980   1.00 33.12 ? 19  PRO F O   1 
ATOM   10185 C  CB  . PRO F  1 10  ? -11.598  52.907  4.825   1.00 43.96 ? 19  PRO F CB  1 
ATOM   10186 C  CG  . PRO F  1 10  ? -10.557  52.112  5.556   1.00 46.31 ? 19  PRO F CG  1 
ATOM   10187 C  CD  . PRO F  1 10  ? -9.465   53.040  6.047   1.00 47.23 ? 19  PRO F CD  1 
ATOM   10188 N  N   . ALA F  1 11  ? -12.899  56.123  5.420   1.00 30.78 ? 20  ALA F N   1 
ATOM   10189 C  CA  . ALA F  1 11  ? -13.877  56.882  6.188   1.00 28.62 ? 20  ALA F CA  1 
ATOM   10190 C  C   . ALA F  1 11  ? -15.267  56.354  5.869   1.00 29.12 ? 20  ALA F C   1 
ATOM   10191 O  O   . ALA F  1 11  ? -15.633  56.184  4.707   1.00 27.18 ? 20  ALA F O   1 
ATOM   10192 C  CB  . ALA F  1 11  ? -13.772  58.357  5.844   1.00 29.57 ? 20  ALA F CB  1 
ATOM   10193 N  N   . VAL F  1 12  ? -16.039  56.095  6.908   1.00 28.25 ? 21  VAL F N   1 
ATOM