data_5LPN
# 
_entry.id   5LPN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LPN         
WWPDB D_1200001091 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LPN 
_pdbx_database_status.recvd_initial_deposition_date   2016-08-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rai, A.'       1 
'Oprisko, A.'   2 
'Campos, J.'    3 
'Fu, Y.'        4 
'Friese, T.'    5 
'Itzen, A.'     6 
'Goody, R.S.'   7 
'Mueller, M.P.' 8 
'Gazdag, E.M.'  9 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.18675 
_citation.pdbx_database_id_PubMed   27552051 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rai, A.'      1 
primary 'Oprisko, A.'  2 
primary 'Campos, J.'   3 
primary 'Fu, Y.'       4 
primary 'Friese, T.'   5 
primary 'Itzen, A.'    6 
primary 'Goody, R.S.'  7 
primary 'Gazdag, E.M.' 8 
primary 'Muller, M.P.' 9 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LPN 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     58.390 
_cell.length_a_esd                 ? 
_cell.length_b                     59.000 
_cell.length_b_esd                 ? 
_cell.length_c                     198.180 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LPN 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related protein Rab-10'                  20202.314 2 ?         ? ?                       ? 
2 polymer     man 'Protein-methionine sulfoxide oxidase MICAL1' 17852.303 1 1.14.13.- ? 'UNP residues 918-1067' ? 
3 non-polymer syn 'MAGNESIUM ION'                               24.305    2 ?         ? ?                       ? 
4 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' 522.196   2 ?         ? ?                       ? 
5 water       nat water                                         18.015    4 ?         ? ?                       ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'Molecule interacting with CasL protein 1,MICAL-1,NEDD9-interacting protein with calponin homology and LIM domains' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GHMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSY
YRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANIN
IEKAFLTLAEDILRKTP
;
;GHMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSY
YRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANIN
IEKAFLTLAEDILRKTP
;
A,C ? 
2 'polypeptide(L)' no no 
;GHMKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQLLQLVDKKNSLVAEEAELMIT
VQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG
;
;GHMKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQLLQLVDKKNSLVAEEAELMIT
VQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG
;
B   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   ALA n 
1 5   LYS n 
1 6   LYS n 
1 7   THR n 
1 8   TYR n 
1 9   ASP n 
1 10  LEU n 
1 11  LEU n 
1 12  PHE n 
1 13  LYS n 
1 14  LEU n 
1 15  LEU n 
1 16  LEU n 
1 17  ILE n 
1 18  GLY n 
1 19  ASP n 
1 20  SER n 
1 21  GLY n 
1 22  VAL n 
1 23  GLY n 
1 24  LYS n 
1 25  THR n 
1 26  CYS n 
1 27  VAL n 
1 28  LEU n 
1 29  PHE n 
1 30  ARG n 
1 31  PHE n 
1 32  SER n 
1 33  ASP n 
1 34  ASP n 
1 35  ALA n 
1 36  PHE n 
1 37  ASN n 
1 38  THR n 
1 39  THR n 
1 40  PHE n 
1 41  ILE n 
1 42  SER n 
1 43  THR n 
1 44  ILE n 
1 45  GLY n 
1 46  ILE n 
1 47  ASP n 
1 48  PHE n 
1 49  LYS n 
1 50  ILE n 
1 51  LYS n 
1 52  THR n 
1 53  VAL n 
1 54  GLU n 
1 55  LEU n 
1 56  GLN n 
1 57  GLY n 
1 58  LYS n 
1 59  LYS n 
1 60  ILE n 
1 61  LYS n 
1 62  LEU n 
1 63  GLN n 
1 64  ILE n 
1 65  TRP n 
1 66  ASP n 
1 67  THR n 
1 68  ALA n 
1 69  GLY n 
1 70  GLN n 
1 71  GLU n 
1 72  ARG n 
1 73  PHE n 
1 74  HIS n 
1 75  THR n 
1 76  ILE n 
1 77  THR n 
1 78  THR n 
1 79  SER n 
1 80  TYR n 
1 81  TYR n 
1 82  ARG n 
1 83  GLY n 
1 84  ALA n 
1 85  MET n 
1 86  GLY n 
1 87  ILE n 
1 88  MET n 
1 89  LEU n 
1 90  VAL n 
1 91  TYR n 
1 92  ASP n 
1 93  ILE n 
1 94  THR n 
1 95  ASN n 
1 96  GLY n 
1 97  LYS n 
1 98  SER n 
1 99  PHE n 
1 100 GLU n 
1 101 ASN n 
1 102 ILE n 
1 103 SER n 
1 104 LYS n 
1 105 TRP n 
1 106 LEU n 
1 107 ARG n 
1 108 ASN n 
1 109 ILE n 
1 110 ASP n 
1 111 GLU n 
1 112 HIS n 
1 113 ALA n 
1 114 ASN n 
1 115 GLU n 
1 116 ASP n 
1 117 VAL n 
1 118 GLU n 
1 119 ARG n 
1 120 MET n 
1 121 LEU n 
1 122 LEU n 
1 123 GLY n 
1 124 ASN n 
1 125 LYS n 
1 126 CYS n 
1 127 ASP n 
1 128 MET n 
1 129 ASP n 
1 130 ASP n 
1 131 LYS n 
1 132 ARG n 
1 133 VAL n 
1 134 VAL n 
1 135 PRO n 
1 136 LYS n 
1 137 GLY n 
1 138 LYS n 
1 139 GLY n 
1 140 GLU n 
1 141 GLN n 
1 142 ILE n 
1 143 ALA n 
1 144 ARG n 
1 145 GLU n 
1 146 HIS n 
1 147 GLY n 
1 148 ILE n 
1 149 ARG n 
1 150 PHE n 
1 151 PHE n 
1 152 GLU n 
1 153 THR n 
1 154 SER n 
1 155 ALA n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 ILE n 
1 160 ASN n 
1 161 ILE n 
1 162 GLU n 
1 163 LYS n 
1 164 ALA n 
1 165 PHE n 
1 166 LEU n 
1 167 THR n 
1 168 LEU n 
1 169 ALA n 
1 170 GLU n 
1 171 ASP n 
1 172 ILE n 
1 173 LEU n 
1 174 ARG n 
1 175 LYS n 
1 176 THR n 
1 177 PRO n 
2 1   GLY n 
2 2   HIS n 
2 3   MET n 
2 4   LYS n 
2 5   GLU n 
2 6   GLU n 
2 7   GLU n 
2 8   MET n 
2 9   LYS n 
2 10  ARG n 
2 11  PHE n 
2 12  CYS n 
2 13  LYS n 
2 14  ALA n 
2 15  GLN n 
2 16  THR n 
2 17  ILE n 
2 18  GLN n 
2 19  ARG n 
2 20  ARG n 
2 21  LEU n 
2 22  ASN n 
2 23  GLU n 
2 24  ILE n 
2 25  GLU n 
2 26  ALA n 
2 27  ALA n 
2 28  LEU n 
2 29  ARG n 
2 30  GLU n 
2 31  LEU n 
2 32  GLU n 
2 33  ALA n 
2 34  GLU n 
2 35  GLY n 
2 36  VAL n 
2 37  LYS n 
2 38  LEU n 
2 39  GLU n 
2 40  LEU n 
2 41  ALA n 
2 42  LEU n 
2 43  ARG n 
2 44  ARG n 
2 45  GLN n 
2 46  SER n 
2 47  SER n 
2 48  SER n 
2 49  PRO n 
2 50  GLU n 
2 51  GLN n 
2 52  GLN n 
2 53  LYS n 
2 54  LYS n 
2 55  LEU n 
2 56  TRP n 
2 57  VAL n 
2 58  GLY n 
2 59  GLN n 
2 60  LEU n 
2 61  LEU n 
2 62  GLN n 
2 63  LEU n 
2 64  VAL n 
2 65  ASP n 
2 66  LYS n 
2 67  LYS n 
2 68  ASN n 
2 69  SER n 
2 70  LEU n 
2 71  VAL n 
2 72  ALA n 
2 73  GLU n 
2 74  GLU n 
2 75  ALA n 
2 76  GLU n 
2 77  LEU n 
2 78  MET n 
2 79  ILE n 
2 80  THR n 
2 81  VAL n 
2 82  GLN n 
2 83  GLU n 
2 84  LEU n 
2 85  ASN n 
2 86  LEU n 
2 87  GLU n 
2 88  GLU n 
2 89  LYS n 
2 90  GLN n 
2 91  TRP n 
2 92  GLN n 
2 93  LEU n 
2 94  ASP n 
2 95  GLN n 
2 96  GLU n 
2 97  LEU n 
2 98  ARG n 
2 99  GLY n 
2 100 TYR n 
2 101 MET n 
2 102 ASN n 
2 103 ARG n 
2 104 GLU n 
2 105 GLU n 
2 106 ASN n 
2 107 LEU n 
2 108 LYS n 
2 109 THR n 
2 110 ALA n 
2 111 ALA n 
2 112 ASP n 
2 113 ARG n 
2 114 GLN n 
2 115 ALA n 
2 116 GLU n 
2 117 ASP n 
2 118 GLN n 
2 119 VAL n 
2 120 LEU n 
2 121 ARG n 
2 122 LYS n 
2 123 LEU n 
2 124 VAL n 
2 125 ASP n 
2 126 LEU n 
2 127 VAL n 
2 128 ASN n 
2 129 GLN n 
2 130 ARG n 
2 131 ASP n 
2 132 ALA n 
2 133 LEU n 
2 134 ILE n 
2 135 ARG n 
2 136 PHE n 
2 137 GLN n 
2 138 GLU n 
2 139 GLU n 
2 140 ARG n 
2 141 ARG n 
2 142 LEU n 
2 143 SER n 
2 144 GLU n 
2 145 LEU n 
2 146 ALA n 
2 147 LEU n 
2 148 GLY n 
2 149 THR n 
2 150 GLY n 
2 151 ALA n 
2 152 GLN n 
2 153 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 177 Human ? RAB10                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 153 Human ? 'MICAL1, MICAL, NICAL' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RAB10_HUMAN P61026 ? 1 
;MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYR
GAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIE
KAFLTLAEDILRKTP
;
1   
2 UNP MICA1_HUMAN Q8TDZ2 ? 2 
;KEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQE
LNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG
;
918 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5LPN A 3 ? 177 ? P61026 1   ? 175  ? 1   175  
2 2 5LPN B 4 ? 153 ? Q8TDZ2 918 ? 1067 ? 918 1067 
3 1 5LPN C 3 ? 177 ? P61026 1   ? 175  ? 1   175  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5LPN GLY A 1 ? UNP P61026 ? ? 'expression tag' -1  1 
1 5LPN HIS A 2 ? UNP P61026 ? ? 'expression tag' 0   2 
2 5LPN GLY B 1 ? UNP Q8TDZ2 ? ? 'expression tag' 915 3 
2 5LPN HIS B 2 ? UNP Q8TDZ2 ? ? 'expression tag' 916 4 
2 5LPN MET B 3 ? UNP Q8TDZ2 ? ? 'expression tag' 917 5 
3 5LPN GLY C 1 ? UNP P61026 ? ? 'expression tag' -1  6 
3 5LPN HIS C 2 ? UNP P61026 ? ? 'expression tag' 0   7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ? 'C10 H17 N6 O13 P3' 522.196 
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LPN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.93 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.07 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;6%-10% PEG8000
0.1M Imidazole
;
_exptl_crystal_grow.pdbx_pH_range   7.6-8.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-09-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99997 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99997 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5LPN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 44.004 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17508 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.63 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.7 
_reflns.pdbx_Rmerge_I_obs                0.118 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.123 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.12 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.9 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.25 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.723 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             12.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.803 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5LPN 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             44.004 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     17499 
_refine.ls_number_reflns_R_free                  875 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.58 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2462 
_refine.ls_R_factor_R_free                       0.2866 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2440 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.39 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4lhw and 5szg' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.75 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.42 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3677 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             4 
_refine_hist.number_atoms_total               3747 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        44.004 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 3793 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.118  ? 5125 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 20.515 ? 2282 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.060  ? 589  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 644  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8001 2.9755  . . 143 2705 99.00  . . . 0.3662 . 0.3052 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9755 3.2051  . . 143 2713 99.00  . . . 0.3729 . 0.2927 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2051 3.5276  . . 141 2709 99.00  . . . 0.3281 . 0.2692 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5276 4.0377  . . 145 2757 100.00 . . . 0.2762 . 0.2508 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0377 5.0859  . . 147 2792 100.00 . . . 0.2747 . 0.2153 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0859 44.0098 . . 156 2948 100.00 . . . 0.2546 . 0.2306 . . . . . . . . . . 
# 
_struct.entry_id                     5LPN 
_struct.title                        'Structure of human Rab10 in complex with the bMERB domain of Mical-1' 
_struct.pdbx_descriptor              'Ras-related protein Rab-10, Protein-methionine sulfoxide oxidase MICAL1 (E.C.1.14.13.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LPN 
_struct_keywords.text            'Mical-1, DUF3585, Mical, Rab effector, Rab10, oxidoreductase, endocytosis' 
_struct_keywords.pdbx_keywords   ENDOCYTOSIS 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 3 ? 
E N N 4 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 23  ? ASP A 34  ? GLY A 21   ASP A 32   1 ? 12 
HELX_P HELX_P2  AA2 GLN A 70  ? ARG A 72  ? GLN A 68   ARG A 70   5 ? 3  
HELX_P HELX_P3  AA3 PHE A 73  ? SER A 79  ? PHE A 71   SER A 77   1 ? 7  
HELX_P HELX_P4  AA4 TYR A 80  ? ALA A 84  ? TYR A 78   ALA A 82   5 ? 5  
HELX_P HELX_P5  AA5 ASN A 95  ? ASN A 101 ? ASN A 93   ASN A 99   1 ? 7  
HELX_P HELX_P6  AA6 ASN A 101 ? ALA A 113 ? ASN A 99   ALA A 111  1 ? 13 
HELX_P HELX_P7  AA7 PRO A 135 ? GLY A 147 ? PRO A 133  GLY A 145  1 ? 13 
HELX_P HELX_P8  AA8 ASN A 160 ? LYS A 175 ? ASN A 158  LYS A 173  1 ? 16 
HELX_P HELX_P9  AA9 GLU B 5   ? SER B 46  ? GLU B 919  SER B 960  1 ? 42 
HELX_P HELX_P10 AB1 SER B 48  ? GLN B 59  ? SER B 962  GLN B 973  1 ? 12 
HELX_P HELX_P11 AB2 GLN B 59  ? TYR B 100 ? GLN B 973  TYR B 1014 1 ? 42 
HELX_P HELX_P12 AB3 ARG B 113 ? ALA B 146 ? ARG B 1027 ALA B 1060 1 ? 34 
HELX_P HELX_P13 AB4 GLY C 23  ? ASP C 34  ? GLY C 21   ASP C 32   1 ? 12 
HELX_P HELX_P14 AB5 GLU C 54  ? LYS C 58  ? GLU C 52   LYS C 56   5 ? 5  
HELX_P HELX_P15 AB6 GLN C 70  ? ARG C 82  ? GLN C 68   ARG C 80   5 ? 13 
HELX_P HELX_P16 AB7 ASN C 101 ? ALA C 113 ? ASN C 99   ALA C 111  1 ? 13 
HELX_P HELX_P17 AB8 PRO C 135 ? GLY C 147 ? PRO C 133  GLY C 145  1 ? 13 
HELX_P HELX_P18 AB9 ASN C 160 ? ARG C 174 ? ASN C 158  ARG C 172  1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 25 OG1 ? ? ? 1_555 D MG  . MG  ? ? A THR 23  A MG  201 1_555 ? ? ? ? ? ? ? 1.937 ? 
metalc2  metalc ? ? A THR 43 OG1 ? ? ? 1_555 D MG  . MG  ? ? A THR 41  A MG  201 1_555 ? ? ? ? ? ? ? 1.987 ? 
metalc3  metalc ? ? C THR 25 OG1 ? ? ? 1_555 F MG  . MG  ? ? C THR 23  C MG  201 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc4  metalc ? ? C THR 43 OG1 ? ? ? 1_555 F MG  . MG  ? ? C THR 41  C MG  201 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc5  metalc ? ? D MG  .  MG  ? ? ? 1_555 E GNP . O3G ? ? A MG  201 A GNP 202 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc6  metalc ? ? D MG  .  MG  ? ? ? 1_555 E GNP . O2B ? ? A MG  201 A GNP 202 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc7  metalc ? ? D MG  .  MG  ? ? ? 1_555 H HOH . O   ? ? A MG  201 A HOH 301 1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc8  metalc ? ? D MG  .  MG  ? ? ? 1_555 H HOH . O   ? ? A MG  201 A HOH 302 1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc9  metalc ? ? F MG  .  MG  ? ? ? 1_555 I HOH . O   ? ? C MG  201 C HOH 302 1_555 ? ? ? ? ? ? ? 2.011 ? 
metalc10 metalc ? ? F MG  .  MG  ? ? ? 1_555 G GNP . O2G ? ? C MG  201 C GNP 202 1_555 ? ? ? ? ? ? ? 1.916 ? 
metalc11 metalc ? ? F MG  .  MG  ? ? ? 1_555 G GNP . O1B ? ? C MG  201 C GNP 202 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc12 metalc ? ? F MG  .  MG  ? ? ? 1_555 I HOH . O   ? ? C MG  201 C HOH 301 1_555 ? ? ? ? ? ? ? 2.385 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 46  ? LEU A 55  ? ILE A 44  LEU A 53  
AA1 2 LYS A 58  ? THR A 67  ? LYS A 56  THR A 65  
AA1 3 LEU A 10  ? GLY A 18  ? LEU A 8   GLY A 16  
AA1 4 GLY A 86  ? ASP A 92  ? GLY A 84  ASP A 90  
AA1 5 GLU A 118 ? ASN A 124 ? GLU A 116 ASN A 122 
AA1 6 ARG A 149 ? THR A 153 ? ARG A 147 THR A 151 
AA2 1 ILE C 46  ? VAL C 53  ? ILE C 44  VAL C 51  
AA2 2 ILE C 60  ? THR C 67  ? ILE C 58  THR C 65  
AA2 3 LEU C 10  ? ILE C 17  ? LEU C 8   ILE C 15  
AA2 4 GLY C 86  ? ASP C 92  ? GLY C 84  ASP C 90  
AA2 5 MET C 120 ? ASN C 124 ? MET C 118 ASN C 122 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 55  ? N LEU A 53  O LYS A 58  ? O LYS A 56  
AA1 2 3 O LYS A 61  ? O LYS A 59  N LEU A 10  ? N LEU A 8   
AA1 3 4 N LEU A 15  ? N LEU A 13  O MET A 88  ? O MET A 86  
AA1 4 5 N LEU A 89  ? N LEU A 87  O LEU A 122 ? O LEU A 120 
AA1 5 6 N GLY A 123 ? N GLY A 121 O PHE A 151 ? O PHE A 149 
AA2 1 2 N VAL C 53  ? N VAL C 51  O ILE C 60  ? O ILE C 58  
AA2 2 3 O TRP C 65  ? O TRP C 63  N LEU C 14  ? N LEU C 12  
AA2 3 4 N ILE C 17  ? N ILE C 15  O VAL C 90  ? O VAL C 88  
AA2 4 5 N TYR C 91  ? N TYR C 89  O ASN C 124 ? O ASN C 122 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  201 ? 6  'binding site for residue MG A 201'  
AC2 Software A GNP 202 ? 25 'binding site for residue GNP A 202' 
AC3 Software C MG  201 ? 5  'binding site for residue MG C 201'  
AC4 Software C GNP 202 ? 24 'binding site for residue GNP C 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  THR A 25  ? THR A 23  . ? 1_555 ? 
2  AC1 6  THR A 43  ? THR A 41  . ? 1_555 ? 
3  AC1 6  ASP A 66  ? ASP A 64  . ? 1_555 ? 
4  AC1 6  GNP E .   ? GNP A 202 . ? 1_555 ? 
5  AC1 6  HOH H .   ? HOH A 301 . ? 1_555 ? 
6  AC1 6  HOH H .   ? HOH A 302 . ? 1_555 ? 
7  AC2 25 ASP A 19  ? ASP A 17  . ? 1_555 ? 
8  AC2 25 SER A 20  ? SER A 18  . ? 1_555 ? 
9  AC2 25 GLY A 21  ? GLY A 19  . ? 1_555 ? 
10 AC2 25 VAL A 22  ? VAL A 20  . ? 1_555 ? 
11 AC2 25 GLY A 23  ? GLY A 21  . ? 1_555 ? 
12 AC2 25 LYS A 24  ? LYS A 22  . ? 1_555 ? 
13 AC2 25 THR A 25  ? THR A 23  . ? 1_555 ? 
14 AC2 25 CYS A 26  ? CYS A 24  . ? 1_555 ? 
15 AC2 25 PHE A 36  ? PHE A 34  . ? 1_555 ? 
16 AC2 25 ASN A 37  ? ASN A 35  . ? 1_555 ? 
17 AC2 25 THR A 38  ? THR A 36  . ? 1_555 ? 
18 AC2 25 PHE A 40  ? PHE A 38  . ? 1_555 ? 
19 AC2 25 SER A 42  ? SER A 40  . ? 1_555 ? 
20 AC2 25 THR A 43  ? THR A 41  . ? 1_555 ? 
21 AC2 25 GLY A 69  ? GLY A 67  . ? 1_555 ? 
22 AC2 25 ASN A 124 ? ASN A 122 . ? 1_555 ? 
23 AC2 25 LYS A 125 ? LYS A 123 . ? 1_555 ? 
24 AC2 25 ASP A 127 ? ASP A 125 . ? 1_555 ? 
25 AC2 25 MET A 128 ? MET A 126 . ? 1_555 ? 
26 AC2 25 SER A 154 ? SER A 152 . ? 1_555 ? 
27 AC2 25 ALA A 155 ? ALA A 153 . ? 1_555 ? 
28 AC2 25 LYS A 156 ? LYS A 154 . ? 1_555 ? 
29 AC2 25 MG  D .   ? MG  A 201 . ? 1_555 ? 
30 AC2 25 HOH H .   ? HOH A 301 . ? 1_555 ? 
31 AC2 25 HOH H .   ? HOH A 302 . ? 1_555 ? 
32 AC3 5  THR C 25  ? THR C 23  . ? 1_555 ? 
33 AC3 5  THR C 43  ? THR C 41  . ? 1_555 ? 
34 AC3 5  GNP G .   ? GNP C 202 . ? 1_555 ? 
35 AC3 5  HOH I .   ? HOH C 301 . ? 1_555 ? 
36 AC3 5  HOH I .   ? HOH C 302 . ? 1_555 ? 
37 AC4 24 ASP C 19  ? ASP C 17  . ? 1_555 ? 
38 AC4 24 SER C 20  ? SER C 18  . ? 1_555 ? 
39 AC4 24 GLY C 21  ? GLY C 19  . ? 1_555 ? 
40 AC4 24 VAL C 22  ? VAL C 20  . ? 1_555 ? 
41 AC4 24 GLY C 23  ? GLY C 21  . ? 1_555 ? 
42 AC4 24 LYS C 24  ? LYS C 22  . ? 1_555 ? 
43 AC4 24 THR C 25  ? THR C 23  . ? 1_555 ? 
44 AC4 24 CYS C 26  ? CYS C 24  . ? 1_555 ? 
45 AC4 24 PHE C 36  ? PHE C 34  . ? 1_555 ? 
46 AC4 24 ASN C 37  ? ASN C 35  . ? 1_555 ? 
47 AC4 24 THR C 38  ? THR C 36  . ? 1_555 ? 
48 AC4 24 PHE C 40  ? PHE C 38  . ? 1_555 ? 
49 AC4 24 THR C 43  ? THR C 41  . ? 1_555 ? 
50 AC4 24 GLY C 69  ? GLY C 67  . ? 1_555 ? 
51 AC4 24 ASN C 124 ? ASN C 122 . ? 1_555 ? 
52 AC4 24 LYS C 125 ? LYS C 123 . ? 1_555 ? 
53 AC4 24 ASP C 127 ? ASP C 125 . ? 1_555 ? 
54 AC4 24 MET C 128 ? MET C 126 . ? 1_555 ? 
55 AC4 24 SER C 154 ? SER C 152 . ? 1_555 ? 
56 AC4 24 ALA C 155 ? ALA C 153 . ? 1_555 ? 
57 AC4 24 LYS C 156 ? LYS C 154 . ? 1_555 ? 
58 AC4 24 MG  F .   ? MG  C 201 . ? 1_555 ? 
59 AC4 24 HOH I .   ? HOH C 301 . ? 1_555 ? 
60 AC4 24 HOH I .   ? HOH C 302 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5LPN 
_atom_sites.fract_transf_matrix[1][1]   0.017126 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016949 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005046 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 7   ? 5.624   56.350  219.218 1.00 48.31  ?  5    THR A N     1 
ATOM   2    C  CA    . THR A 1 7   ? 5.452   57.775  219.473 1.00 54.73  ?  5    THR A CA    1 
ATOM   3    C  C     . THR A 1 7   ? 6.092   58.640  218.377 1.00 64.83  ?  5    THR A C     1 
ATOM   4    O  O     . THR A 1 7   ? 6.996   58.193  217.679 1.00 71.74  ?  5    THR A O     1 
ATOM   5    C  CB    . THR A 1 7   ? 6.026   58.161  220.861 1.00 58.05  ?  5    THR A CB    1 
ATOM   6    O  OG1   . THR A 1 7   ? 7.436   57.908  220.901 1.00 72.35  ?  5    THR A OG1   1 
ATOM   7    C  CG2   . THR A 1 7   ? 5.331   57.371  221.955 1.00 50.65  ?  5    THR A CG2   1 
ATOM   8    N  N     . TYR A 1 8   ? 5.590   59.867  218.228 1.00 66.43  ?  6    TYR A N     1 
ATOM   9    C  CA    . TYR A 1 8   ? 6.024   60.814  217.208 1.00 58.46  ?  6    TYR A CA    1 
ATOM   10   C  C     . TYR A 1 8   ? 6.001   62.218  217.799 1.00 56.64  ?  6    TYR A C     1 
ATOM   11   O  O     . TYR A 1 8   ? 5.271   62.500  218.751 1.00 57.75  ?  6    TYR A O     1 
ATOM   12   C  CB    . TYR A 1 8   ? 5.132   60.757  215.960 1.00 48.21  ?  6    TYR A CB    1 
ATOM   13   C  CG    . TYR A 1 8   ? 3.672   61.089  216.219 1.00 51.50  ?  6    TYR A CG    1 
ATOM   14   C  CD1   . TYR A 1 8   ? 2.764   60.097  216.568 1.00 57.51  ?  6    TYR A CD1   1 
ATOM   15   C  CD2   . TYR A 1 8   ? 3.203   62.396  216.116 1.00 38.56  ?  6    TYR A CD2   1 
ATOM   16   C  CE1   . TYR A 1 8   ? 1.432   60.394  216.808 1.00 58.53  ?  6    TYR A CE1   1 
ATOM   17   C  CE2   . TYR A 1 8   ? 1.872   62.701  216.354 1.00 47.53  ?  6    TYR A CE2   1 
ATOM   18   C  CZ    . TYR A 1 8   ? 0.992   61.693  216.700 1.00 52.35  ?  6    TYR A CZ    1 
ATOM   19   O  OH    . TYR A 1 8   ? -0.334  61.976  216.937 1.00 49.00  ?  6    TYR A OH    1 
ATOM   20   N  N     . ASP A 1 9   ? 6.793   63.110  217.204 1.00 61.70  ?  7    ASP A N     1 
ATOM   21   C  CA    . ASP A 1 9   ? 6.911   64.463  217.738 1.00 67.71  ?  7    ASP A CA    1 
ATOM   22   C  C     . ASP A 1 9   ? 5.804   65.387  217.234 1.00 73.21  ?  7    ASP A C     1 
ATOM   23   O  O     . ASP A 1 9   ? 5.219   66.137  218.022 1.00 82.75  ?  7    ASP A O     1 
ATOM   24   C  CB    . ASP A 1 9   ? 8.280   65.051  217.391 1.00 71.91  ?  7    ASP A CB    1 
ATOM   25   C  CG    . ASP A 1 9   ? 9.414   64.410  218.172 1.00 77.21  ?  7    ASP A CG    1 
ATOM   26   O  OD1   . ASP A 1 9   ? 9.502   64.638  219.398 1.00 80.88  ?  7    ASP A OD1   1 
ATOM   27   O  OD2   . ASP A 1 9   ? 10.231  63.693  217.556 1.00 90.63  -1 7    ASP A OD2   1 
ATOM   28   N  N     . LEU A 1 10  ? 5.506   65.368  215.934 1.00 71.75  ?  8    LEU A N     1 
ATOM   29   C  CA    . LEU A 1 10  ? 4.590   66.344  215.355 1.00 54.48  ?  8    LEU A CA    1 
ATOM   30   C  C     . LEU A 1 10  ? 3.614   65.664  214.406 1.00 44.52  ?  8    LEU A C     1 
ATOM   31   O  O     . LEU A 1 10  ? 3.842   64.547  213.946 1.00 52.73  ?  8    LEU A O     1 
ATOM   32   C  CB    . LEU A 1 10  ? 5.345   67.445  214.606 1.00 54.86  ?  8    LEU A CB    1 
ATOM   33   C  CG    . LEU A 1 10  ? 6.319   68.263  215.449 1.00 57.75  ?  8    LEU A CG    1 
ATOM   34   C  CD1   . LEU A 1 10  ? 7.201   69.108  214.537 1.00 39.25  ?  8    LEU A CD1   1 
ATOM   35   C  CD2   . LEU A 1 10  ? 5.555   69.129  216.449 1.00 40.67  ?  8    LEU A CD2   1 
ATOM   36   N  N     . LEU A 1 11  ? 2.522   66.366  214.108 1.00 38.21  ?  9    LEU A N     1 
ATOM   37   C  CA    . LEU A 1 11  ? 1.479   65.873  213.213 1.00 36.47  ?  9    LEU A CA    1 
ATOM   38   C  C     . LEU A 1 11  ? 1.312   66.855  212.068 1.00 48.57  ?  9    LEU A C     1 
ATOM   39   O  O     . LEU A 1 11  ? 1.015   68.033  212.301 1.00 53.44  ?  9    LEU A O     1 
ATOM   40   C  CB    . LEU A 1 11  ? 0.145   65.701  213.946 1.00 38.87  ?  9    LEU A CB    1 
ATOM   41   C  CG    . LEU A 1 11  ? -1.026  65.214  213.083 1.00 39.33  ?  9    LEU A CG    1 
ATOM   42   C  CD1   . LEU A 1 11  ? -0.929  63.726  212.813 1.00 52.00  ?  9    LEU A CD1   1 
ATOM   43   C  CD2   . LEU A 1 11  ? -2.363  65.556  213.705 1.00 31.63  ?  9    LEU A CD2   1 
ATOM   44   N  N     . PHE A 1 12  ? 1.496   66.375  210.838 1.00 50.19  ?  10   PHE A N     1 
ATOM   45   C  CA    . PHE A 1 12  ? 1.287   67.177  209.643 1.00 32.80  ?  10   PHE A CA    1 
ATOM   46   C  C     . PHE A 1 12  ? 0.032   66.716  208.917 1.00 44.47  ?  10   PHE A C     1 
ATOM   47   O  O     . PHE A 1 12  ? -0.195  65.510  208.740 1.00 50.79  ?  10   PHE A O     1 
ATOM   48   C  CB    . PHE A 1 12  ? 2.474   67.091  208.675 1.00 40.68  ?  10   PHE A CB    1 
ATOM   49   C  CG    . PHE A 1 12  ? 3.753   67.673  209.208 1.00 49.11  ?  10   PHE A CG    1 
ATOM   50   C  CD1   . PHE A 1 12  ? 3.768   68.422  210.370 1.00 37.53  ?  10   PHE A CD1   1 
ATOM   51   C  CD2   . PHE A 1 12  ? 4.942   67.496  208.516 1.00 51.20  ?  10   PHE A CD2   1 
ATOM   52   C  CE1   . PHE A 1 12  ? 4.945   68.960  210.842 1.00 44.85  ?  10   PHE A CE1   1 
ATOM   53   C  CE2   . PHE A 1 12  ? 6.126   68.030  208.990 1.00 40.71  ?  10   PHE A CE2   1 
ATOM   54   C  CZ    . PHE A 1 12  ? 6.126   68.766  210.151 1.00 37.07  ?  10   PHE A CZ    1 
ATOM   55   N  N     . LYS A 1 13  ? -0.766  67.685  208.474 1.00 64.73  ?  11   LYS A N     1 
ATOM   56   C  CA    . LYS A 1 13  ? -1.938  67.417  207.654 1.00 64.36  ?  11   LYS A CA    1 
ATOM   57   C  C     . LYS A 1 13  ? -1.564  67.618  206.189 1.00 59.97  ?  11   LYS A C     1 
ATOM   58   O  O     . LYS A 1 13  ? -1.094  68.699  205.787 1.00 58.52  ?  11   LYS A O     1 
ATOM   59   C  CB    . LYS A 1 13  ? -3.123  68.292  208.067 1.00 63.06  ?  11   LYS A CB    1 
ATOM   60   C  CG    . LYS A 1 13  ? -3.391  68.264  209.582 1.00 88.08  ?  11   LYS A CG    1 
ATOM   61   C  CD    . LYS A 1 13  ? -4.763  67.685  209.955 1.00 93.96  ?  11   LYS A CD    1 
ATOM   62   C  CE    . LYS A 1 13  ? -5.138  68.061  211.393 1.00 89.89  ?  11   LYS A CE    1 
ATOM   63   N  NZ    . LYS A 1 13  ? -6.047  67.083  212.064 1.00 90.11  ?  11   LYS A NZ    1 
ATOM   64   N  N     . LEU A 1 14  ? -1.734  66.554  205.412 1.00 57.72  ?  12   LEU A N     1 
ATOM   65   C  CA    . LEU A 1 14  ? -1.466  66.531  203.988 1.00 50.02  ?  12   LEU A CA    1 
ATOM   66   C  C     . LEU A 1 14  ? -2.755  66.188  203.260 1.00 51.86  ?  12   LEU A C     1 
ATOM   67   O  O     . LEU A 1 14  ? -3.675  65.597  203.833 1.00 53.06  ?  12   LEU A O     1 
ATOM   68   C  CB    . LEU A 1 14  ? -0.374  65.511  203.646 1.00 49.53  ?  12   LEU A CB    1 
ATOM   69   C  CG    . LEU A 1 14  ? 0.996   65.744  204.281 1.00 43.79  ?  12   LEU A CG    1 
ATOM   70   C  CD1   . LEU A 1 14  ? 1.974   64.666  203.849 1.00 37.66  ?  12   LEU A CD1   1 
ATOM   71   C  CD2   . LEU A 1 14  ? 1.510   67.110  203.902 1.00 41.78  ?  12   LEU A CD2   1 
ATOM   72   N  N     . LEU A 1 15  ? -2.814  66.558  201.984 1.00 47.92  ?  13   LEU A N     1 
ATOM   73   C  CA    . LEU A 1 15  ? -4.054  66.460  201.232 1.00 52.95  ?  13   LEU A CA    1 
ATOM   74   C  C     . LEU A 1 15  ? -3.715  66.251  199.765 1.00 50.70  ?  13   LEU A C     1 
ATOM   75   O  O     . LEU A 1 15  ? -2.789  66.880  199.248 1.00 49.35  ?  13   LEU A O     1 
ATOM   76   C  CB    . LEU A 1 15  ? -4.897  67.728  201.421 1.00 36.73  ?  13   LEU A CB    1 
ATOM   77   C  CG    . LEU A 1 15  ? -6.242  67.838  200.709 1.00 46.32  ?  13   LEU A CG    1 
ATOM   78   C  CD1   . LEU A 1 15  ? -7.286  67.137  201.525 1.00 47.20  ?  13   LEU A CD1   1 
ATOM   79   C  CD2   . LEU A 1 15  ? -6.634  69.286  200.508 1.00 61.08  ?  13   LEU A CD2   1 
ATOM   80   N  N     . LEU A 1 16  ? -4.456  65.367  199.098 1.00 35.31  ?  14   LEU A N     1 
ATOM   81   C  CA    . LEU A 1 16  ? -4.240  65.111  197.678 1.00 43.03  ?  14   LEU A CA    1 
ATOM   82   C  C     . LEU A 1 16  ? -5.463  65.555  196.892 1.00 42.16  ?  14   LEU A C     1 
ATOM   83   O  O     . LEU A 1 16  ? -6.585  65.129  197.189 1.00 32.23  ?  14   LEU A O     1 
ATOM   84   C  CB    . LEU A 1 16  ? -3.952  63.633  197.406 1.00 35.64  ?  14   LEU A CB    1 
ATOM   85   C  CG    . LEU A 1 16  ? -3.082  62.897  198.426 1.00 48.68  ?  14   LEU A CG    1 
ATOM   86   C  CD1   . LEU A 1 16  ? -3.158  61.404  198.185 1.00 51.26  ?  14   LEU A CD1   1 
ATOM   87   C  CD2   . LEU A 1 16  ? -1.647  63.367  198.371 1.00 40.10  ?  14   LEU A CD2   1 
ATOM   88   N  N     . ILE A 1 17  ? -5.243  66.409  195.889 1.00 48.56  ?  15   ILE A N     1 
ATOM   89   C  CA    . ILE A 1 17  ? -6.309  66.894  195.025 1.00 52.77  ?  15   ILE A CA    1 
ATOM   90   C  C     . ILE A 1 17  ? -5.902  66.664  193.575 1.00 50.21  ?  15   ILE A C     1 
ATOM   91   O  O     . ILE A 1 17  ? -4.729  66.457  193.261 1.00 50.75  ?  15   ILE A O     1 
ATOM   92   C  CB    . ILE A 1 17  ? -6.634  68.384  195.271 1.00 45.84  ?  15   ILE A CB    1 
ATOM   93   C  CG1   . ILE A 1 17  ? -5.474  69.269  194.817 1.00 41.65  ?  15   ILE A CG1   1 
ATOM   94   C  CG2   . ILE A 1 17  ? -6.935  68.624  196.734 1.00 39.53  ?  15   ILE A CG2   1 
ATOM   95   C  CD1   . ILE A 1 17  ? -5.679  70.732  195.125 1.00 42.32  ?  15   ILE A CD1   1 
ATOM   96   N  N     . GLY A 1 18  ? -6.896  66.699  192.689 1.00 33.06  ?  16   GLY A N     1 
ATOM   97   C  CA    . GLY A 1 18  ? -6.697  66.343  191.296 1.00 39.04  ?  16   GLY A CA    1 
ATOM   98   C  C     . GLY A 1 18  ? -7.937  65.673  190.740 1.00 53.90  ?  16   GLY A C     1 
ATOM   99   O  O     . GLY A 1 18  ? -8.771  65.193  191.514 1.00 50.78  ?  16   GLY A O     1 
ATOM   100  N  N     . ASP A 1 19  ? -8.081  65.635  189.415 1.00 48.16  ?  17   ASP A N     1 
ATOM   101  C  CA    . ASP A 1 19  ? -9.325  65.167  188.817 1.00 46.47  ?  17   ASP A CA    1 
ATOM   102  C  C     . ASP A 1 19  ? -9.523  63.670  189.052 1.00 51.16  ?  17   ASP A C     1 
ATOM   103  O  O     . ASP A 1 19  ? -8.582  62.921  189.336 1.00 53.06  ?  17   ASP A O     1 
ATOM   104  C  CB    . ASP A 1 19  ? -9.357  65.476  187.318 1.00 60.22  ?  17   ASP A CB    1 
ATOM   105  C  CG    . ASP A 1 19  ? -9.046  66.930  187.015 1.00 76.92  ?  17   ASP A CG    1 
ATOM   106  O  OD1   . ASP A 1 19  ? -8.771  67.680  187.969 1.00 92.78  ?  17   ASP A OD1   1 
ATOM   107  O  OD2   . ASP A 1 19  ? -9.076  67.320  185.829 1.00 77.36  -1 17   ASP A OD2   1 
ATOM   108  N  N     . SER A 1 20  ? -10.780 63.242  188.939 1.00 58.11  ?  18   SER A N     1 
ATOM   109  C  CA    . SER A 1 20  ? -11.134 61.843  189.138 1.00 54.30  ?  18   SER A CA    1 
ATOM   110  C  C     . SER A 1 20  ? -10.433 60.978  188.099 1.00 70.57  ?  18   SER A C     1 
ATOM   111  O  O     . SER A 1 20  ? -10.650 61.143  186.894 1.00 84.91  ?  18   SER A O     1 
ATOM   112  C  CB    . SER A 1 20  ? -12.648 61.669  189.049 1.00 59.06  ?  18   SER A CB    1 
ATOM   113  O  OG    . SER A 1 20  ? -13.018 60.304  189.122 1.00 62.04  ?  18   SER A OG    1 
ATOM   114  N  N     . GLY A 1 21  ? -9.574  60.072  188.561 1.00 74.78  ?  19   GLY A N     1 
ATOM   115  C  CA    . GLY A 1 21  ? -8.944  59.101  187.689 1.00 73.63  ?  19   GLY A CA    1 
ATOM   116  C  C     . GLY A 1 21  ? -7.439  59.201  187.562 1.00 71.95  ?  19   GLY A C     1 
ATOM   117  O  O     . GLY A 1 21  ? -6.833  58.296  186.976 1.00 89.49  ?  19   GLY A O     1 
ATOM   118  N  N     . VAL A 1 22  ? -6.804  60.252  188.087 1.00 40.84  ?  20   VAL A N     1 
ATOM   119  C  CA    . VAL A 1 22  ? -5.370  60.414  187.861 1.00 38.12  ?  20   VAL A CA    1 
ATOM   120  C  C     . VAL A 1 22  ? -4.528  59.547  188.791 1.00 37.35  ?  20   VAL A C     1 
ATOM   121  O  O     . VAL A 1 22  ? -3.315  59.419  188.567 1.00 39.52  ?  20   VAL A O     1 
ATOM   122  C  CB    . VAL A 1 22  ? -4.946  61.888  187.987 1.00 35.05  ?  20   VAL A CB    1 
ATOM   123  C  CG1   . VAL A 1 22  ? -5.904  62.787  187.230 1.00 34.77  ?  20   VAL A CG1   1 
ATOM   124  C  CG2   . VAL A 1 22  ? -4.850  62.307  189.445 1.00 52.65  ?  20   VAL A CG2   1 
ATOM   125  N  N     . GLY A 1 23  ? -5.124  58.952  189.827 1.00 32.65  ?  21   GLY A N     1 
ATOM   126  C  CA    . GLY A 1 23  ? -4.414  57.965  190.622 1.00 51.05  ?  21   GLY A CA    1 
ATOM   127  C  C     . GLY A 1 23  ? -4.159  58.284  192.086 1.00 51.46  ?  21   GLY A C     1 
ATOM   128  O  O     . GLY A 1 23  ? -3.349  57.607  192.731 1.00 49.05  ?  21   GLY A O     1 
ATOM   129  N  N     . LYS A 1 24  ? -4.859  59.285  192.631 1.00 56.08  ?  22   LYS A N     1 
ATOM   130  C  CA    . LYS A 1 24  ? -4.571  59.760  193.985 1.00 60.67  ?  22   LYS A CA    1 
ATOM   131  C  C     . LYS A 1 24  ? -4.670  58.640  195.018 1.00 46.59  ?  22   LYS A C     1 
ATOM   132  O  O     . LYS A 1 24  ? -3.736  58.413  195.798 1.00 52.94  ?  22   LYS A O     1 
ATOM   133  C  CB    . LYS A 1 24  ? -5.514  60.908  194.346 1.00 54.55  ?  22   LYS A CB    1 
ATOM   134  C  CG    . LYS A 1 24  ? -5.488  62.061  193.360 1.00 49.62  ?  22   LYS A CG    1 
ATOM   135  C  CD    . LYS A 1 24  ? -6.308  63.240  193.858 1.00 47.80  ?  22   LYS A CD    1 
ATOM   136  C  CE    . LYS A 1 24  ? -7.778  62.886  193.973 1.00 52.14  ?  22   LYS A CE    1 
ATOM   137  N  NZ    . LYS A 1 24  ? -8.410  62.702  192.638 1.00 54.94  ?  22   LYS A NZ    1 
ATOM   138  N  N     . THR A 1 25  ? -5.804  57.931  195.036 1.00 42.53  ?  23   THR A N     1 
ATOM   139  C  CA    . THR A 1 25  ? -5.986  56.804  195.946 1.00 46.74  ?  23   THR A CA    1 
ATOM   140  C  C     . THR A 1 25  ? -4.855  55.791  195.830 1.00 57.83  ?  23   THR A C     1 
ATOM   141  O  O     . THR A 1 25  ? -4.457  55.185  196.833 1.00 57.37  ?  23   THR A O     1 
ATOM   142  C  CB    . THR A 1 25  ? -7.324  56.118  195.658 1.00 45.31  ?  23   THR A CB    1 
ATOM   143  O  OG1   . THR A 1 25  ? -8.367  57.097  195.636 1.00 55.40  ?  23   THR A OG1   1 
ATOM   144  C  CG2   . THR A 1 25  ? -7.645  55.075  196.718 1.00 46.25  ?  23   THR A CG2   1 
ATOM   145  N  N     . CYS A 1 26  ? -4.320  55.602  194.622 1.00 59.98  ?  24   CYS A N     1 
ATOM   146  C  CA    . CYS A 1 26  ? -3.289  54.600  194.380 1.00 66.04  ?  24   CYS A CA    1 
ATOM   147  C  C     . CYS A 1 26  ? -1.881  55.106  194.665 1.00 65.42  ?  24   CYS A C     1 
ATOM   148  O  O     . CYS A 1 26  ? -1.017  54.308  195.051 1.00 76.22  ?  24   CYS A O     1 
ATOM   149  C  CB    . CYS A 1 26  ? -3.379  54.096  192.938 1.00 72.05  ?  24   CYS A CB    1 
ATOM   150  S  SG    . CYS A 1 26  ? -4.641  52.821  192.688 1.00 76.62  ?  24   CYS A SG    1 
ATOM   151  N  N     . VAL A 1 27  ? -1.618  56.402  194.468 1.00 50.36  ?  25   VAL A N     1 
ATOM   152  C  CA    . VAL A 1 27  ? -0.399  56.994  195.015 1.00 54.68  ?  25   VAL A CA    1 
ATOM   153  C  C     . VAL A 1 27  ? -0.371  56.813  196.527 1.00 51.75  ?  25   VAL A C     1 
ATOM   154  O  O     . VAL A 1 27  ? 0.616   56.333  197.102 1.00 52.41  ?  25   VAL A O     1 
ATOM   155  C  CB    . VAL A 1 27  ? -0.294  58.481  194.633 1.00 47.41  ?  25   VAL A CB    1 
ATOM   156  C  CG1   . VAL A 1 27  ? 0.771   59.174  195.487 1.00 36.32  ?  25   VAL A CG1   1 
ATOM   157  C  CG2   . VAL A 1 27  ? 0.023   58.633  193.157 1.00 47.01  ?  25   VAL A CG2   1 
ATOM   158  N  N     . LEU A 1 28  ? -1.472  57.178  197.189 1.00 37.67  ?  26   LEU A N     1 
ATOM   159  C  CA    . LEU A 1 28  ? -1.530  57.052  198.638 1.00 52.30  ?  26   LEU A CA    1 
ATOM   160  C  C     . LEU A 1 28  ? -1.434  55.597  199.071 1.00 65.90  ?  26   LEU A C     1 
ATOM   161  O  O     . LEU A 1 28  ? -0.826  55.292  200.100 1.00 75.22  ?  26   LEU A O     1 
ATOM   162  C  CB    . LEU A 1 28  ? -2.812  57.683  199.180 1.00 39.60  ?  26   LEU A CB    1 
ATOM   163  C  CG    . LEU A 1 28  ? -2.921  57.582  200.706 1.00 52.25  ?  26   LEU A CG    1 
ATOM   164  C  CD1   . LEU A 1 28  ? -1.716  58.233  201.377 1.00 52.17  ?  26   LEU A CD1   1 
ATOM   165  C  CD2   . LEU A 1 28  ? -4.216  58.187  201.218 1.00 58.51  ?  26   LEU A CD2   1 
ATOM   166  N  N     . PHE A 1 29  ? -2.029  54.681  198.305 1.00 64.97  ?  27   PHE A N     1 
ATOM   167  C  CA    . PHE A 1 29  ? -1.987  53.279  198.706 1.00 69.47  ?  27   PHE A CA    1 
ATOM   168  C  C     . PHE A 1 29  ? -0.593  52.699  198.532 1.00 75.64  ?  27   PHE A C     1 
ATOM   169  O  O     . PHE A 1 29  ? -0.133  51.924  199.381 1.00 57.92  ?  27   PHE A O     1 
ATOM   170  C  CB    . PHE A 1 29  ? -3.007  52.468  197.913 1.00 79.61  ?  27   PHE A CB    1 
ATOM   171  C  CG    . PHE A 1 29  ? -3.523  51.265  198.646 1.00 77.78  ?  27   PHE A CG    1 
ATOM   172  C  CD1   . PHE A 1 29  ? -4.451  51.411  199.664 1.00 88.53  ?  27   PHE A CD1   1 
ATOM   173  C  CD2   . PHE A 1 29  ? -3.093  49.990  198.313 1.00 73.45  ?  27   PHE A CD2   1 
ATOM   174  C  CE1   . PHE A 1 29  ? -4.936  50.310  200.345 1.00 90.09  ?  27   PHE A CE1   1 
ATOM   175  C  CE2   . PHE A 1 29  ? -3.575  48.885  198.988 1.00 78.21  ?  27   PHE A CE2   1 
ATOM   176  C  CZ    . PHE A 1 29  ? -4.498  49.045  200.007 1.00 85.37  ?  27   PHE A CZ    1 
ATOM   177  N  N     . ARG A 1 30  ? 0.089   53.059  197.442 1.00 87.60  ?  28   ARG A N     1 
ATOM   178  C  CA    . ARG A 1 30  ? 1.499   52.717  197.306 1.00 82.81  ?  28   ARG A CA    1 
ATOM   179  C  C     . ARG A 1 30  ? 2.302   53.237  198.489 1.00 78.27  ?  28   ARG A C     1 
ATOM   180  O  O     . ARG A 1 30  ? 3.118   52.509  199.065 1.00 76.61  ?  28   ARG A O     1 
ATOM   181  C  CB    . ARG A 1 30  ? 2.056   53.286  196.003 1.00 74.46  ?  28   ARG A CB    1 
ATOM   182  C  CG    . ARG A 1 30  ? 3.556   53.489  196.036 1.00 69.94  ?  28   ARG A CG    1 
ATOM   183  C  CD    . ARG A 1 30  ? 4.262   52.153  196.039 1.00 75.35  ?  28   ARG A CD    1 
ATOM   184  N  NE    . ARG A 1 30  ? 4.327   51.591  194.695 1.00 82.97  ?  28   ARG A NE    1 
ATOM   185  C  CZ    . ARG A 1 30  ? 4.300   50.290  194.426 1.00 79.23  ?  28   ARG A CZ    1 
ATOM   186  N  NH1   . ARG A 1 30  ? 4.192   49.408  195.412 1.00 82.64  ?  28   ARG A NH1   1 
ATOM   187  N  NH2   . ARG A 1 30  ? 4.370   49.875  193.168 1.00 66.18  ?  28   ARG A NH2   1 
ATOM   188  N  N     . PHE A 1 31  ? 2.087   54.498  198.868 1.00 76.37  ?  29   PHE A N     1 
ATOM   189  C  CA    . PHE A 1 31  ? 2.879   55.073  199.949 1.00 63.77  ?  29   PHE A CA    1 
ATOM   190  C  C     . PHE A 1 31  ? 2.580   54.400  201.282 1.00 53.82  ?  29   PHE A C     1 
ATOM   191  O  O     . PHE A 1 31  ? 3.500   54.087  202.042 1.00 56.56  ?  29   PHE A O     1 
ATOM   192  C  CB    . PHE A 1 31  ? 2.636   56.579  200.038 1.00 68.55  ?  29   PHE A CB    1 
ATOM   193  C  CG    . PHE A 1 31  ? 3.423   57.253  201.123 1.00 65.74  ?  29   PHE A CG    1 
ATOM   194  C  CD1   . PHE A 1 31  ? 4.808   57.187  201.137 1.00 66.74  ?  29   PHE A CD1   1 
ATOM   195  C  CD2   . PHE A 1 31  ? 2.777   57.955  202.129 1.00 60.54  ?  29   PHE A CD2   1 
ATOM   196  C  CE1   . PHE A 1 31  ? 5.533   57.804  202.140 1.00 70.70  ?  29   PHE A CE1   1 
ATOM   197  C  CE2   . PHE A 1 31  ? 3.498   58.576  203.134 1.00 54.61  ?  29   PHE A CE2   1 
ATOM   198  C  CZ    . PHE A 1 31  ? 4.877   58.500  203.140 1.00 54.74  ?  29   PHE A CZ    1 
ATOM   199  N  N     . SER A 1 32  ? 1.308   54.153  201.576 1.00 61.28  ?  30   SER A N     1 
ATOM   200  C  CA    . SER A 1 32  ? 0.903   53.616  202.868 1.00 55.53  ?  30   SER A CA    1 
ATOM   201  C  C     . SER A 1 32  ? 1.207   52.133  203.029 1.00 63.67  ?  30   SER A C     1 
ATOM   202  O  O     . SER A 1 32  ? 1.706   51.725  204.084 1.00 80.44  ?  30   SER A O     1 
ATOM   203  C  CB    . SER A 1 32  ? -0.594  53.847  203.089 1.00 63.79  ?  30   SER A CB    1 
ATOM   204  O  OG    . SER A 1 32  ? -1.320  53.716  201.879 1.00 90.53  ?  30   SER A OG    1 
ATOM   205  N  N     . ASP A 1 33  ? 0.897   51.308  202.026 1.00 72.33  ?  31   ASP A N     1 
ATOM   206  C  CA    . ASP A 1 33  ? 1.008   49.859  202.167 1.00 73.02  ?  31   ASP A CA    1 
ATOM   207  C  C     . ASP A 1 33  ? 1.891   49.197  201.107 1.00 74.97  ?  31   ASP A C     1 
ATOM   208  O  O     . ASP A 1 33  ? 1.863   47.966  200.987 1.00 63.54  ?  31   ASP A O     1 
ATOM   209  C  CB    . ASP A 1 33  ? -0.384  49.206  202.148 1.00 69.99  ?  31   ASP A CB    1 
ATOM   210  C  CG    . ASP A 1 33  ? -1.342  49.773  203.204 1.00 85.16  ?  31   ASP A CG    1 
ATOM   211  O  OD1   . ASP A 1 33  ? -0.978  50.680  203.979 1.00 102.67 ?  31   ASP A OD1   1 
ATOM   212  O  OD2   . ASP A 1 33  ? -2.487  49.280  203.268 1.00 70.76  -1 31   ASP A OD2   1 
ATOM   213  N  N     . ASP A 1 34  ? 2.656   49.970  200.335 1.00 92.75  ?  32   ASP A N     1 
ATOM   214  C  CA    . ASP A 1 34  ? 3.619   49.455  199.352 1.00 100.43 ?  32   ASP A CA    1 
ATOM   215  C  C     . ASP A 1 34  ? 2.997   48.384  198.454 1.00 106.69 ?  32   ASP A C     1 
ATOM   216  O  O     . ASP A 1 34  ? 3.495   47.262  198.320 1.00 104.92 ?  32   ASP A O     1 
ATOM   217  C  CB    . ASP A 1 34  ? 4.877   48.925  200.043 1.00 95.02  ?  32   ASP A CB    1 
ATOM   218  C  CG    . ASP A 1 34  ? 5.964   48.550  199.056 1.00 90.47  ?  32   ASP A CG    1 
ATOM   219  O  OD1   . ASP A 1 34  ? 6.189   49.327  198.102 1.00 84.21  ?  32   ASP A OD1   1 
ATOM   220  O  OD2   . ASP A 1 34  ? 6.582   47.478  199.225 1.00 101.99 -1 32   ASP A OD2   1 
ATOM   221  N  N     . ALA A 1 35  ? 1.885   48.757  197.832 1.00 109.11 ?  33   ALA A N     1 
ATOM   222  C  CA    . ALA A 1 35  ? 1.151   47.850  196.967 1.00 110.30 ?  33   ALA A CA    1 
ATOM   223  C  C     . ALA A 1 35  ? 0.434   48.672  195.904 1.00 113.21 ?  33   ALA A C     1 
ATOM   224  O  O     . ALA A 1 35  ? 0.530   49.902  195.867 1.00 116.70 ?  33   ALA A O     1 
ATOM   225  C  CB    . ALA A 1 35  ? 0.180   46.985  197.776 1.00 107.20 ?  33   ALA A CB    1 
ATOM   226  N  N     . PHE A 1 36  ? -0.288  47.977  195.032 1.00 104.03 ?  34   PHE A N     1 
ATOM   227  C  CA    . PHE A 1 36  ? -0.988  48.613  193.928 1.00 99.28  ?  34   PHE A CA    1 
ATOM   228  C  C     . PHE A 1 36  ? -2.068  47.657  193.452 1.00 96.65  ?  34   PHE A C     1 
ATOM   229  O  O     . PHE A 1 36  ? -1.845  46.446  193.387 1.00 99.25  ?  34   PHE A O     1 
ATOM   230  C  CB    . PHE A 1 36  ? -0.018  48.972  192.788 1.00 102.13 ?  34   PHE A CB    1 
ATOM   231  C  CG    . PHE A 1 36  ? -0.694  49.483  191.536 1.00 105.56 ?  34   PHE A CG    1 
ATOM   232  C  CD1   . PHE A 1 36  ? -1.272  48.609  190.626 1.00 105.99 ?  34   PHE A CD1   1 
ATOM   233  C  CD2   . PHE A 1 36  ? -0.755  50.843  191.278 1.00 103.04 ?  34   PHE A CD2   1 
ATOM   234  C  CE1   . PHE A 1 36  ? -1.891  49.079  189.489 1.00 106.74 ?  34   PHE A CE1   1 
ATOM   235  C  CE2   . PHE A 1 36  ? -1.371  51.320  190.137 1.00 94.00  ?  34   PHE A CE2   1 
ATOM   236  C  CZ    . PHE A 1 36  ? -1.941  50.436  189.241 1.00 94.39  ?  34   PHE A CZ    1 
ATOM   237  N  N     . ASN A 1 37  ? -3.241  48.204  193.147 1.00 96.17  ?  35   ASN A N     1 
ATOM   238  C  CA    . ASN A 1 37  ? -4.342  47.450  192.564 1.00 104.38 ?  35   ASN A CA    1 
ATOM   239  C  C     . ASN A 1 37  ? -4.808  48.147  191.292 1.00 106.87 ?  35   ASN A C     1 
ATOM   240  O  O     . ASN A 1 37  ? -4.864  49.380  191.232 1.00 108.58 ?  35   ASN A O     1 
ATOM   241  C  CB    . ASN A 1 37  ? -5.531  47.297  193.544 1.00 104.88 ?  35   ASN A CB    1 
ATOM   242  C  CG    . ASN A 1 37  ? -5.197  46.455  194.780 1.00 110.03 ?  35   ASN A CG    1 
ATOM   243  O  OD1   . ASN A 1 37  ? -6.051  46.253  195.641 1.00 119.30 ?  35   ASN A OD1   1 
ATOM   244  N  ND2   . ASN A 1 37  ? -3.970  45.959  194.866 1.00 101.75 ?  35   ASN A ND2   1 
ATOM   245  N  N     . THR A 1 38  ? -5.122  47.352  190.267 1.00 103.55 ?  36   THR A N     1 
ATOM   246  C  CA    . THR A 1 38  ? -5.741  47.879  189.058 1.00 98.09  ?  36   THR A CA    1 
ATOM   247  C  C     . THR A 1 38  ? -7.253  47.984  189.184 1.00 101.70 ?  36   THR A C     1 
ATOM   248  O  O     . THR A 1 38  ? -7.892  48.657  188.365 1.00 99.41  ?  36   THR A O     1 
ATOM   249  C  CB    . THR A 1 38  ? -5.389  47.007  187.851 1.00 96.75  ?  36   THR A CB    1 
ATOM   250  O  OG1   . THR A 1 38  ? -5.774  45.651  188.111 1.00 100.87 ?  36   THR A OG1   1 
ATOM   251  C  CG2   . THR A 1 38  ? -3.899  47.065  187.559 1.00 86.60  ?  36   THR A CG2   1 
ATOM   252  N  N     . THR A 1 39  ? -7.835  47.322  190.182 1.00 120.98 ?  37   THR A N     1 
ATOM   253  C  CA    . THR A 1 39  ? -9.230  47.546  190.533 1.00 127.83 ?  37   THR A CA    1 
ATOM   254  C  C     . THR A 1 39  ? -9.454  49.022  190.825 1.00 122.38 ?  37   THR A C     1 
ATOM   255  O  O     . THR A 1 39  ? -8.811  49.596  191.709 1.00 121.62 ?  37   THR A O     1 
ATOM   256  C  CB    . THR A 1 39  ? -9.616  46.699  191.751 1.00 134.80 ?  37   THR A CB    1 
ATOM   257  O  OG1   . THR A 1 39  ? -9.216  47.370  192.953 1.00 140.83 ?  37   THR A OG1   1 
ATOM   258  C  CG2   . THR A 1 39  ? -8.956  45.324  191.699 1.00 132.80 ?  37   THR A CG2   1 
ATOM   259  N  N     . PHE A 1 40  ? -10.358 49.639  190.072 1.00 115.89 ?  38   PHE A N     1 
ATOM   260  C  CA    . PHE A 1 40  ? -10.628 51.067  190.180 1.00 103.03 ?  38   PHE A CA    1 
ATOM   261  C  C     . PHE A 1 40  ? -11.922 51.265  190.961 1.00 94.11  ?  38   PHE A C     1 
ATOM   262  O  O     . PHE A 1 40  ? -13.012 50.980  190.454 1.00 96.99  ?  38   PHE A O     1 
ATOM   263  C  CB    . PHE A 1 40  ? -10.718 51.706  188.795 1.00 100.07 ?  38   PHE A CB    1 
ATOM   264  C  CG    . PHE A 1 40  ? -11.067 53.177  188.810 1.00 105.78 ?  38   PHE A CG    1 
ATOM   265  C  CD1   . PHE A 1 40  ? -10.832 53.970  189.928 1.00 108.82 ?  38   PHE A CD1   1 
ATOM   266  C  CD2   . PHE A 1 40  ? -11.643 53.762  187.694 1.00 102.08 ?  38   PHE A CD2   1 
ATOM   267  C  CE1   . PHE A 1 40  ? -11.165 55.316  189.928 1.00 102.21 ?  38   PHE A CE1   1 
ATOM   268  C  CE2   . PHE A 1 40  ? -11.975 55.105  187.687 1.00 103.68 ?  38   PHE A CE2   1 
ATOM   269  C  CZ    . PHE A 1 40  ? -11.736 55.883  188.805 1.00 100.56 ?  38   PHE A CZ    1 
ATOM   270  N  N     . ILE A 1 41  ? -11.799 51.764  192.184 1.00 80.70  ?  39   ILE A N     1 
ATOM   271  C  CA    . ILE A 1 41  ? -12.939 52.223  192.965 1.00 79.43  ?  39   ILE A CA    1 
ATOM   272  C  C     . ILE A 1 41  ? -12.785 53.726  193.130 1.00 79.85  ?  39   ILE A C     1 
ATOM   273  O  O     . ILE A 1 41  ? -11.895 54.191  193.853 1.00 89.70  ?  39   ILE A O     1 
ATOM   274  C  CB    . ILE A 1 41  ? -13.031 51.532  194.331 1.00 82.04  ?  39   ILE A CB    1 
ATOM   275  C  CG1   . ILE A 1 41  ? -12.660 50.098  194.250 1.00 84.98  ?  39   ILE A CG1   1 
ATOM   276  C  CG2   . ILE A 1 41  ? -14.390 51.649  194.875 1.00 73.82  ?  39   ILE A CG2   1 
ATOM   277  C  CD1   . ILE A 1 41  ? -12.272 49.522  195.499 1.00 76.10  ?  39   ILE A CD1   1 
ATOM   278  N  N     . SER A 1 42  ? -13.642 54.488  192.458 1.00 72.52  ?  40   SER A N     1 
ATOM   279  C  CA    . SER A 1 42  ? -13.626 55.933  192.621 1.00 70.24  ?  40   SER A CA    1 
ATOM   280  C  C     . SER A 1 42  ? -13.972 56.314  194.059 1.00 73.21  ?  40   SER A C     1 
ATOM   281  O  O     . SER A 1 42  ? -14.791 55.669  194.721 1.00 70.50  ?  40   SER A O     1 
ATOM   282  C  CB    . SER A 1 42  ? -14.604 56.587  191.646 1.00 52.10  ?  40   SER A CB    1 
ATOM   283  O  OG    . SER A 1 42  ? -14.786 57.959  191.948 1.00 61.02  ?  40   SER A OG    1 
ATOM   284  N  N     . THR A 1 43  ? -13.327 57.374  194.540 1.00 68.05  ?  41   THR A N     1 
ATOM   285  C  CA    . THR A 1 43  ? -13.524 57.863  195.899 1.00 68.82  ?  41   THR A CA    1 
ATOM   286  C  C     . THR A 1 43  ? -14.840 58.635  196.007 1.00 72.59  ?  41   THR A C     1 
ATOM   287  O  O     . THR A 1 43  ? -15.271 59.293  195.057 1.00 77.78  ?  41   THR A O     1 
ATOM   288  C  CB    . THR A 1 43  ? -12.340 58.752  196.303 1.00 64.94  ?  41   THR A CB    1 
ATOM   289  O  OG1   . THR A 1 43  ? -11.144 57.964  196.330 1.00 64.82  ?  41   THR A OG1   1 
ATOM   290  C  CG2   . THR A 1 43  ? -12.546 59.371  197.678 1.00 64.88  ?  41   THR A CG2   1 
ATOM   291  N  N     . ILE A 1 44  ? -15.491 58.524  197.171 1.00 73.29  ?  42   ILE A N     1 
ATOM   292  C  CA    . ILE A 1 44  ? -16.712 59.264  197.501 1.00 64.71  ?  42   ILE A CA    1 
ATOM   293  C  C     . ILE A 1 44  ? -16.436 60.065  198.764 1.00 58.87  ?  42   ILE A C     1 
ATOM   294  O  O     . ILE A 1 44  ? -16.205 59.488  199.836 1.00 66.81  ?  42   ILE A O     1 
ATOM   295  C  CB    . ILE A 1 44  ? -17.922 58.345  197.716 1.00 57.01  ?  42   ILE A CB    1 
ATOM   296  C  CG1   . ILE A 1 44  ? -18.078 57.359  196.570 1.00 69.84  ?  42   ILE A CG1   1 
ATOM   297  C  CG2   . ILE A 1 44  ? -19.198 59.144  197.962 1.00 64.53  ?  42   ILE A CG2   1 
ATOM   298  C  CD1   . ILE A 1 44  ? -17.602 56.058  196.941 1.00 72.75  ?  42   ILE A CD1   1 
ATOM   299  N  N     . GLY A 1 45  ? -16.486 61.385  198.653 1.00 53.50  ?  43   GLY A N     1 
ATOM   300  C  CA    . GLY A 1 45  ? -16.252 62.223  199.804 1.00 51.94  ?  43   GLY A CA    1 
ATOM   301  C  C     . GLY A 1 45  ? -14.775 62.358  200.075 1.00 60.91  ?  43   GLY A C     1 
ATOM   302  O  O     . GLY A 1 45  ? -13.999 62.696  199.177 1.00 68.30  ?  43   GLY A O     1 
ATOM   303  N  N     . ILE A 1 46  ? -14.366 62.046  201.302 1.00 61.15  ?  44   ILE A N     1 
ATOM   304  C  CA    . ILE A 1 46  ? -13.020 62.352  201.751 1.00 54.01  ?  44   ILE A CA    1 
ATOM   305  C  C     . ILE A 1 46  ? -12.700 61.414  202.896 1.00 62.09  ?  44   ILE A C     1 
ATOM   306  O  O     . ILE A 1 46  ? -13.588 61.017  203.657 1.00 76.00  ?  44   ILE A O     1 
ATOM   307  C  CB    . ILE A 1 46  ? -12.915 63.841  202.168 1.00 46.80  ?  44   ILE A CB    1 
ATOM   308  C  CG1   . ILE A 1 46  ? -11.460 64.291  202.223 1.00 46.49  ?  44   ILE A CG1   1 
ATOM   309  C  CG2   . ILE A 1 46  ? -13.630 64.088  203.495 1.00 42.16  ?  44   ILE A CG2   1 
ATOM   310  C  CD1   . ILE A 1 46  ? -11.315 65.761  202.499 1.00 52.83  ?  44   ILE A CD1   1 
ATOM   311  N  N     . ASP A 1 47  ? -11.436 61.031  203.001 1.00 54.56  ?  45   ASP A N     1 
ATOM   312  C  CA    . ASP A 1 47  ? -11.004 60.257  204.162 1.00 60.65  ?  45   ASP A CA    1 
ATOM   313  C  C     . ASP A 1 47  ? -9.493  60.399  204.228 1.00 60.05  ?  45   ASP A C     1 
ATOM   314  O  O     . ASP A 1 47  ? -8.896  61.118  203.426 1.00 68.25  ?  45   ASP A O     1 
ATOM   315  C  CB    . ASP A 1 47  ? -11.460 58.798  204.078 1.00 72.31  ?  45   ASP A CB    1 
ATOM   316  C  CG    . ASP A 1 47  ? -11.458 58.106  205.426 1.00 80.64  ?  45   ASP A CG    1 
ATOM   317  O  OD1   . ASP A 1 47  ? -11.874 58.735  206.422 1.00 82.61  ?  45   ASP A OD1   1 
ATOM   318  O  OD2   . ASP A 1 47  ? -11.042 56.930  205.490 1.00 89.55  -1 45   ASP A OD2   1 
ATOM   319  N  N     . PHE A 1 48  ? -8.870  59.734  205.192 1.00 53.35  ?  46   PHE A N     1 
ATOM   320  C  CA    . PHE A 1 48  ? -7.431  59.874  205.332 1.00 57.18  ?  46   PHE A CA    1 
ATOM   321  C  C     . PHE A 1 48  ? -6.815  58.574  205.816 1.00 58.82  ?  46   PHE A C     1 
ATOM   322  O  O     . PHE A 1 48  ? -7.466  57.746  206.459 1.00 56.80  ?  46   PHE A O     1 
ATOM   323  C  CB    . PHE A 1 48  ? -7.058  61.017  206.288 1.00 59.40  ?  46   PHE A CB    1 
ATOM   324  C  CG    . PHE A 1 48  ? -7.672  60.901  207.653 1.00 61.37  ?  46   PHE A CG    1 
ATOM   325  C  CD1   . PHE A 1 48  ? -7.034  60.196  208.662 1.00 58.32  ?  46   PHE A CD1   1 
ATOM   326  C  CD2   . PHE A 1 48  ? -8.880  61.516  207.932 1.00 60.35  ?  46   PHE A CD2   1 
ATOM   327  C  CE1   . PHE A 1 48  ? -7.598  60.098  209.921 1.00 59.91  ?  46   PHE A CE1   1 
ATOM   328  C  CE2   . PHE A 1 48  ? -9.449  61.424  209.189 1.00 65.63  ?  46   PHE A CE2   1 
ATOM   329  C  CZ    . PHE A 1 48  ? -8.808  60.714  210.184 1.00 64.03  ?  46   PHE A CZ    1 
ATOM   330  N  N     . LYS A 1 49  ? -5.537  58.416  205.492 1.00 55.49  ?  47   LYS A N     1 
ATOM   331  C  CA    . LYS A 1 49  ? -4.718  57.346  206.028 1.00 55.45  ?  47   LYS A CA    1 
ATOM   332  C  C     . LYS A 1 49  ? -3.580  57.956  206.837 1.00 53.01  ?  47   LYS A C     1 
ATOM   333  O  O     . LYS A 1 49  ? -3.261  59.143  206.707 1.00 53.90  ?  47   LYS A O     1 
ATOM   334  C  CB    . LYS A 1 49  ? -4.168  56.449  204.911 1.00 52.04  ?  47   LYS A CB    1 
ATOM   335  C  CG    . LYS A 1 49  ? -5.214  55.970  203.916 1.00 49.95  ?  47   LYS A CG    1 
ATOM   336  C  CD    . LYS A 1 49  ? -6.372  55.254  204.588 1.00 54.74  ?  47   LYS A CD    1 
ATOM   337  C  CE    . LYS A 1 49  ? -7.438  54.884  203.566 1.00 69.44  ?  47   LYS A CE    1 
ATOM   338  N  NZ    . LYS A 1 49  ? -8.756  54.583  204.185 1.00 67.45  ?  47   LYS A NZ    1 
ATOM   339  N  N     . ILE A 1 50  ? -2.971  57.125  207.677 1.00 49.01  ?  48   ILE A N     1 
ATOM   340  C  CA    . ILE A 1 50  ? -1.941  57.548  208.618 1.00 49.15  ?  48   ILE A CA    1 
ATOM   341  C  C     . ILE A 1 50  ? -0.636  56.861  208.249 1.00 57.01  ?  48   ILE A C     1 
ATOM   342  O  O     . ILE A 1 50  ? -0.628  55.660  207.950 1.00 63.43  ?  48   ILE A O     1 
ATOM   343  C  CB    . ILE A 1 50  ? -2.335  57.204  210.066 1.00 48.31  ?  48   ILE A CB    1 
ATOM   344  C  CG1   . ILE A 1 50  ? -3.520  58.055  210.526 1.00 48.43  ?  48   ILE A CG1   1 
ATOM   345  C  CG2   . ILE A 1 50  ? -1.146  57.354  210.990 1.00 55.07  ?  48   ILE A CG2   1 
ATOM   346  C  CD1   . ILE A 1 50  ? -3.309  59.534  210.345 1.00 43.48  ?  48   ILE A CD1   1 
ATOM   347  N  N     . LYS A 1 51  ? 0.466   57.611  208.276 1.00 57.72  ?  49   LYS A N     1 
ATOM   348  C  CA    . LYS A 1 51  ? 1.776   56.968  208.212 1.00 54.60  ?  49   LYS A CA    1 
ATOM   349  C  C     . LYS A 1 51  ? 2.822   57.863  208.858 1.00 57.63  ?  49   LYS A C     1 
ATOM   350  O  O     . LYS A 1 51  ? 2.951   59.036  208.496 1.00 54.93  ?  49   LYS A O     1 
ATOM   351  C  CB    . LYS A 1 51  ? 2.169   56.630  206.775 1.00 47.29  ?  49   LYS A CB    1 
ATOM   352  C  CG    . LYS A 1 51  ? 3.573   56.088  206.687 1.00 52.98  ?  49   LYS A CG    1 
ATOM   353  C  CD    . LYS A 1 51  ? 3.684   54.943  205.709 1.00 58.43  ?  49   LYS A CD    1 
ATOM   354  C  CE    . LYS A 1 51  ? 4.986   55.027  204.949 1.00 68.37  ?  49   LYS A CE    1 
ATOM   355  N  NZ    . LYS A 1 51  ? 4.903   54.326  203.651 1.00 91.08  ?  49   LYS A NZ    1 
ATOM   356  N  N     . THR A 1 52  ? 3.568   57.298  209.804 1.00 66.31  ?  50   THR A N     1 
ATOM   357  C  CA    . THR A 1 52  ? 4.605   58.013  210.532 1.00 64.12  ?  50   THR A CA    1 
ATOM   358  C  C     . THR A 1 52  ? 5.937   57.885  209.796 1.00 63.28  ?  50   THR A C     1 
ATOM   359  O  O     . THR A 1 52  ? 6.183   56.905  209.088 1.00 76.03  ?  50   THR A O     1 
ATOM   360  C  CB    . THR A 1 52  ? 4.716   57.466  211.960 1.00 62.47  ?  50   THR A CB    1 
ATOM   361  O  OG1   . THR A 1 52  ? 3.416   57.444  212.565 1.00 63.10  ?  50   THR A OG1   1 
ATOM   362  C  CG2   . THR A 1 52  ? 5.638   58.326  212.814 1.00 63.59  ?  50   THR A CG2   1 
ATOM   363  N  N     . VAL A 1 53  ? 6.793   58.896  209.951 1.00 52.31  ?  51   VAL A N     1 
ATOM   364  C  CA    . VAL A 1 53  ? 8.040   58.981  209.206 1.00 49.47  ?  51   VAL A CA    1 
ATOM   365  C  C     . VAL A 1 53  ? 9.125   59.500  210.141 1.00 60.95  ?  51   VAL A C     1 
ATOM   366  O  O     . VAL A 1 53  ? 8.835   60.014  211.223 1.00 66.15  ?  51   VAL A O     1 
ATOM   367  C  CB    . VAL A 1 53  ? 7.898   59.899  207.962 1.00 48.97  ?  51   VAL A CB    1 
ATOM   368  C  CG1   . VAL A 1 53  ? 7.039   59.239  206.901 1.00 47.27  ?  51   VAL A CG1   1 
ATOM   369  C  CG2   . VAL A 1 53  ? 7.369   61.282  208.357 1.00 54.34  ?  51   VAL A CG2   1 
ATOM   370  N  N     . GLU A 1 54  ? 10.375  59.372  209.716 1.00 68.22  ?  52   GLU A N     1 
ATOM   371  C  CA    . GLU A 1 54  ? 11.511  59.954  210.421 1.00 69.02  ?  52   GLU A CA    1 
ATOM   372  C  C     . GLU A 1 54  ? 12.297  60.825  209.456 1.00 66.55  ?  52   GLU A C     1 
ATOM   373  O  O     . GLU A 1 54  ? 12.842  60.329  208.465 1.00 70.23  ?  52   GLU A O     1 
ATOM   374  C  CB    . GLU A 1 54  ? 12.419  58.885  211.032 1.00 94.16  ?  52   GLU A CB    1 
ATOM   375  C  CG    . GLU A 1 54  ? 11.721  57.887  211.941 1.00 102.38 ?  52   GLU A CG    1 
ATOM   376  C  CD    . GLU A 1 54  ? 12.714  57.025  212.697 1.00 107.56 ?  52   GLU A CD    1 
ATOM   377  O  OE1   . GLU A 1 54  ? 13.781  57.551  213.093 1.00 98.72  ?  52   GLU A OE1   1 
ATOM   378  O  OE2   . GLU A 1 54  ? 12.436  55.822  212.885 1.00 113.42 -1 52   GLU A OE2   1 
ATOM   379  N  N     . LEU A 1 55  ? 12.345  62.116  209.747 1.00 68.12  ?  53   LEU A N     1 
ATOM   380  C  CA    . LEU A 1 55  ? 13.121  63.090  208.993 1.00 76.79  ?  53   LEU A CA    1 
ATOM   381  C  C     . LEU A 1 55  ? 14.200  63.620  209.932 1.00 89.64  ?  53   LEU A C     1 
ATOM   382  O  O     . LEU A 1 55  ? 13.914  64.408  210.840 1.00 86.11  ?  53   LEU A O     1 
ATOM   383  C  CB    . LEU A 1 55  ? 12.215  64.199  208.463 1.00 79.86  ?  53   LEU A CB    1 
ATOM   384  C  CG    . LEU A 1 55  ? 10.980  63.653  207.735 1.00 83.78  ?  53   LEU A CG    1 
ATOM   385  C  CD1   . LEU A 1 55  ? 9.775   64.574  207.851 1.00 82.34  ?  53   LEU A CD1   1 
ATOM   386  C  CD2   . LEU A 1 55  ? 11.296  63.358  206.278 1.00 86.34  ?  53   LEU A CD2   1 
ATOM   387  N  N     . GLN A 1 56  ? 15.425  63.136  209.732 1.00 123.84 ?  54   GLN A N     1 
ATOM   388  C  CA    . GLN A 1 56  ? 16.619  63.607  210.432 1.00 140.74 ?  54   GLN A CA    1 
ATOM   389  C  C     . GLN A 1 56  ? 16.367  63.819  211.925 1.00 140.59 ?  54   GLN A C     1 
ATOM   390  O  O     . GLN A 1 56  ? 16.682  64.865  212.496 1.00 150.77 ?  54   GLN A O     1 
ATOM   391  C  CB    . GLN A 1 56  ? 17.154  64.883  209.782 1.00 146.59 ?  54   GLN A CB    1 
ATOM   392  N  N     . GLY A 1 57  ? 15.777  62.810  212.563 1.00 122.75 ?  55   GLY A N     1 
ATOM   393  C  CA    . GLY A 1 57  ? 15.634  62.787  214.001 1.00 110.04 ?  55   GLY A CA    1 
ATOM   394  C  C     . GLY A 1 57  ? 14.286  63.236  214.530 1.00 94.95  ?  55   GLY A C     1 
ATOM   395  O  O     . GLY A 1 57  ? 13.953  62.912  215.676 1.00 102.02 ?  55   GLY A O     1 
ATOM   396  N  N     . LYS A 1 58  ? 13.517  63.993  213.755 1.00 72.60  ?  56   LYS A N     1 
ATOM   397  C  CA    . LYS A 1 58  ? 12.131  64.262  214.110 1.00 60.91  ?  56   LYS A CA    1 
ATOM   398  C  C     . LYS A 1 58  ? 11.268  63.189  213.467 1.00 66.43  ?  56   LYS A C     1 
ATOM   399  O  O     . LYS A 1 58  ? 11.340  62.982  212.254 1.00 86.35  ?  56   LYS A O     1 
ATOM   400  C  CB    . LYS A 1 58  ? 11.690  65.649  213.637 1.00 51.97  ?  56   LYS A CB    1 
ATOM   401  C  CG    . LYS A 1 58  ? 11.875  66.780  214.642 1.00 52.29  ?  56   LYS A CG    1 
ATOM   402  C  CD    . LYS A 1 58  ? 10.719  66.826  215.627 1.00 52.36  ?  56   LYS A CD    1 
ATOM   403  C  CE    . LYS A 1 58  ? 10.836  67.994  216.600 1.00 47.16  ?  56   LYS A CE    1 
ATOM   404  N  NZ    . LYS A 1 58  ? 12.062  67.908  217.430 1.00 49.29  ?  56   LYS A NZ    1 
ATOM   405  N  N     . LYS A 1 59  ? 10.477  62.485  214.267 1.00 53.48  ?  57   LYS A N     1 
ATOM   406  C  CA    . LYS A 1 59  ? 9.543   61.515  213.715 1.00 57.47  ?  57   LYS A CA    1 
ATOM   407  C  C     . LYS A 1 59  ? 8.153   62.134  213.712 1.00 64.04  ?  57   LYS A C     1 
ATOM   408  O  O     . LYS A 1 59  ? 7.631   62.522  214.764 1.00 55.77  ?  57   LYS A O     1 
ATOM   409  C  CB    . LYS A 1 59  ? 9.569   60.181  214.460 1.00 63.81  ?  57   LYS A CB    1 
ATOM   410  C  CG    . LYS A 1 59  ? 9.770   60.231  215.950 1.00 80.35  ?  57   LYS A CG    1 
ATOM   411  C  CD    . LYS A 1 59  ? 10.074  58.824  216.463 1.00 81.79  ?  57   LYS A CD    1 
ATOM   412  C  CE    . LYS A 1 59  ? 9.248   57.774  215.721 1.00 80.17  ?  57   LYS A CE    1 
ATOM   413  N  NZ    . LYS A 1 59  ? 9.230   56.455  216.413 1.00 96.28  ?  57   LYS A NZ    1 
ATOM   414  N  N     . ILE A 1 60  ? 7.577   62.231  212.518 1.00 69.62  ?  58   ILE A N     1 
ATOM   415  C  CA    . ILE A 1 60  ? 6.403   63.041  212.234 1.00 63.53  ?  58   ILE A CA    1 
ATOM   416  C  C     . ILE A 1 60  ? 5.308   62.123  211.720 1.00 58.60  ?  58   ILE A C     1 
ATOM   417  O  O     . ILE A 1 60  ? 5.568   61.239  210.903 1.00 68.25  ?  58   ILE A O     1 
ATOM   418  C  CB    . ILE A 1 60  ? 6.738   64.142  211.210 1.00 52.76  ?  58   ILE A CB    1 
ATOM   419  C  CG1   . ILE A 1 60  ? 7.790   65.084  211.801 1.00 60.85  ?  58   ILE A CG1   1 
ATOM   420  C  CG2   . ILE A 1 60  ? 5.489   64.886  210.759 1.00 42.52  ?  58   ILE A CG2   1 
ATOM   421  C  CD1   . ILE A 1 60  ? 8.477   65.957  210.797 1.00 79.00  ?  58   ILE A CD1   1 
ATOM   422  N  N     . LYS A 1 61  ? 4.095   62.314  212.214 1.00 54.16  ?  59   LYS A N     1 
ATOM   423  C  CA    . LYS A 1 61  ? 2.962   61.570  211.696 1.00 57.42  ?  59   LYS A CA    1 
ATOM   424  C  C     . LYS A 1 61  ? 2.317   62.339  210.555 1.00 66.68  ?  59   LYS A C     1 
ATOM   425  O  O     . LYS A 1 61  ? 1.976   63.518  210.701 1.00 60.06  ?  59   LYS A O     1 
ATOM   426  C  CB    . LYS A 1 61  ? 1.931   61.301  212.787 1.00 43.57  ?  59   LYS A CB    1 
ATOM   427  C  CG    . LYS A 1 61  ? 0.683   60.643  212.234 1.00 43.99  ?  59   LYS A CG    1 
ATOM   428  C  CD    . LYS A 1 61  ? -0.269  60.184  213.316 1.00 44.90  ?  59   LYS A CD    1 
ATOM   429  C  CE    . LYS A 1 61  ? 0.172   58.852  213.892 1.00 55.87  ?  59   LYS A CE    1 
ATOM   430  N  NZ    . LYS A 1 61  ? -0.646  58.460  215.068 1.00 66.28  ?  59   LYS A NZ    1 
ATOM   431  N  N     . LEU A 1 62  ? 2.150   61.666  209.420 1.00 65.43  ?  60   LEU A N     1 
ATOM   432  C  CA    . LEU A 1 62  ? 1.458   62.222  208.269 1.00 42.69  ?  60   LEU A CA    1 
ATOM   433  C  C     . LEU A 1 62  ? 0.021   61.722  208.267 1.00 49.48  ?  60   LEU A C     1 
ATOM   434  O  O     . LEU A 1 62  ? -0.220  60.511  208.151 1.00 65.27  ?  60   LEU A O     1 
ATOM   435  C  CB    . LEU A 1 62  ? 2.163   61.838  206.971 1.00 46.81  ?  60   LEU A CB    1 
ATOM   436  C  CG    . LEU A 1 62  ? 3.675   62.050  206.959 1.00 49.07  ?  60   LEU A CG    1 
ATOM   437  C  CD1   . LEU A 1 62  ? 4.264   61.679  205.601 1.00 40.34  ?  60   LEU A CD1   1 
ATOM   438  C  CD2   . LEU A 1 62  ? 4.006   63.487  207.326 1.00 46.24  ?  60   LEU A CD2   1 
ATOM   439  N  N     . GLN A 1 63  ? -0.925  62.652  208.427 1.00 41.77  ?  61   GLN A N     1 
ATOM   440  C  CA    . GLN A 1 63  ? -2.343  62.376  208.225 1.00 45.85  ?  61   GLN A CA    1 
ATOM   441  C  C     . GLN A 1 63  ? -2.691  62.878  206.830 1.00 56.44  ?  61   GLN A C     1 
ATOM   442  O  O     . GLN A 1 63  ? -2.756  64.091  206.598 1.00 56.14  ?  61   GLN A O     1 
ATOM   443  C  CB    . GLN A 1 63  ? -3.205  63.047  209.293 1.00 44.19  ?  61   GLN A CB    1 
ATOM   444  C  CG    . GLN A 1 63  ? -4.706  62.879  209.077 1.00 50.22  ?  61   GLN A CG    1 
ATOM   445  C  CD    . GLN A 1 63  ? -5.536  63.563  210.149 1.00 51.65  ?  61   GLN A CD    1 
ATOM   446  O  OE1   . GLN A 1 63  ? -4.997  64.195  211.055 1.00 74.45  ?  61   GLN A OE1   1 
ATOM   447  N  NE2   . GLN A 1 63  ? -6.855  63.434  210.054 1.00 42.73  ?  61   GLN A NE2   1 
ATOM   448  N  N     . ILE A 1 64  ? -2.889  61.951  205.895 1.00 61.13  ?  62   ILE A N     1 
ATOM   449  C  CA    . ILE A 1 64  ? -2.999  62.288  204.479 1.00 55.21  ?  62   ILE A CA    1 
ATOM   450  C  C     . ILE A 1 64  ? -4.428  62.044  204.022 1.00 46.11  ?  62   ILE A C     1 
ATOM   451  O  O     . ILE A 1 64  ? -4.926  60.912  204.082 1.00 51.57  ?  62   ILE A O     1 
ATOM   452  C  CB    . ILE A 1 64  ? -2.003  61.490  203.628 1.00 59.19  ?  62   ILE A CB    1 
ATOM   453  C  CG1   . ILE A 1 64  ? -0.584  61.706  204.156 1.00 59.50  ?  62   ILE A CG1   1 
ATOM   454  C  CG2   . ILE A 1 64  ? -2.097  61.915  202.173 1.00 59.65  ?  62   ILE A CG2   1 
ATOM   455  C  CD1   . ILE A 1 64  ? 0.422   60.721  203.618 1.00 59.44  ?  62   ILE A CD1   1 
ATOM   456  N  N     . TRP A 1 65  ? -5.075  63.106  203.546 1.00 44.84  ?  63   TRP A N     1 
ATOM   457  C  CA    . TRP A 1 65  ? -6.473  63.062  203.143 1.00 55.91  ?  63   TRP A CA    1 
ATOM   458  C  C     . TRP A 1 65  ? -6.580  62.814  201.641 1.00 51.85  ?  63   TRP A C     1 
ATOM   459  O  O     . TRP A 1 65  ? -6.122  63.628  200.826 1.00 65.31  ?  63   TRP A O     1 
ATOM   460  C  CB    . TRP A 1 65  ? -7.190  64.356  203.519 1.00 56.65  ?  63   TRP A CB    1 
ATOM   461  C  CG    . TRP A 1 65  ? -7.242  64.635  204.979 1.00 43.54  ?  63   TRP A CG    1 
ATOM   462  C  CD1   . TRP A 1 65  ? -6.198  64.987  205.783 1.00 54.79  ?  63   TRP A CD1   1 
ATOM   463  C  CD2   . TRP A 1 65  ? -8.404  64.616  205.814 1.00 42.81  ?  63   TRP A CD2   1 
ATOM   464  N  NE1   . TRP A 1 65  ? -6.635  65.172  207.073 1.00 46.47  ?  63   TRP A NE1   1 
ATOM   465  C  CE2   . TRP A 1 65  ? -7.987  64.951  207.118 1.00 44.21  ?  63   TRP A CE2   1 
ATOM   466  C  CE3   . TRP A 1 65  ? -9.755  64.337  205.590 1.00 51.25  ?  63   TRP A CE3   1 
ATOM   467  C  CZ2   . TRP A 1 65  ? -8.871  65.019  208.190 1.00 52.75  ?  63   TRP A CZ2   1 
ATOM   468  C  CZ3   . TRP A 1 65  ? -10.634 64.404  206.662 1.00 56.70  ?  63   TRP A CZ3   1 
ATOM   469  C  CH2   . TRP A 1 65  ? -10.187 64.743  207.942 1.00 55.02  ?  63   TRP A CH2   1 
ATOM   470  N  N     . ASP A 1 66  ? -7.164  61.673  201.294 1.00 53.09  ?  64   ASP A N     1 
ATOM   471  C  CA    . ASP A 1 66  ? -7.598  61.373  199.941 1.00 63.20  ?  64   ASP A CA    1 
ATOM   472  C  C     . ASP A 1 66  ? -8.949  62.035  199.698 1.00 56.61  ?  64   ASP A C     1 
ATOM   473  O  O     . ASP A 1 66  ? -9.929  61.763  200.416 1.00 66.75  ?  64   ASP A O     1 
ATOM   474  C  CB    . ASP A 1 66  ? -7.688  59.862  199.748 1.00 70.09  ?  64   ASP A CB    1 
ATOM   475  C  CG    . ASP A 1 66  ? -7.543  59.446  198.305 1.00 64.66  ?  64   ASP A CG    1 
ATOM   476  O  OD1   . ASP A 1 66  ? -7.197  60.304  197.466 1.00 78.15  ?  64   ASP A OD1   1 
ATOM   477  O  OD2   . ASP A 1 66  ? -7.766  58.253  198.013 1.00 55.07  -1 64   ASP A OD2   1 
ATOM   478  N  N     . THR A 1 67  ? -8.977  62.923  198.707 1.00 50.27  ?  65   THR A N     1 
ATOM   479  C  CA    . THR A 1 67  ? -10.171 63.610  198.251 1.00 44.13  ?  65   THR A CA    1 
ATOM   480  C  C     . THR A 1 67  ? -10.793 62.863  197.079 1.00 55.96  ?  65   THR A C     1 
ATOM   481  O  O     . THR A 1 67  ? -10.171 62.006  196.446 1.00 70.02  ?  65   THR A O     1 
ATOM   482  C  CB    . THR A 1 67  ? -9.848  65.044  197.825 1.00 46.01  ?  65   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 67  ? -8.885  65.026  196.760 1.00 52.97  ?  65   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 67  ? -9.308  65.849  198.991 1.00 39.44  ?  65   THR A CG2   1 
ATOM   485  N  N     . ALA A 1 68  ? -12.039 63.207  196.786 1.00 45.62  ?  66   ALA A N     1 
ATOM   486  C  CA    . ALA A 1 68  ? -12.727 62.713  195.607 1.00 53.92  ?  66   ALA A CA    1 
ATOM   487  C  C     . ALA A 1 68  ? -12.503 63.670  194.443 1.00 62.64  ?  66   ALA A C     1 
ATOM   488  O  O     . ALA A 1 68  ? -12.668 64.886  194.586 1.00 60.40  ?  66   ALA A O     1 
ATOM   489  C  CB    . ALA A 1 68  ? -14.224 62.551  195.875 1.00 53.31  ?  66   ALA A CB    1 
ATOM   490  N  N     . GLY A 1 69  ? -12.148 63.107  193.283 1.00 55.76  ?  67   GLY A N     1 
ATOM   491  C  CA    . GLY A 1 69  ? -11.832 63.924  192.123 1.00 62.31  ?  67   GLY A CA    1 
ATOM   492  C  C     . GLY A 1 69  ? -13.024 64.515  191.391 1.00 67.75  ?  67   GLY A C     1 
ATOM   493  O  O     . GLY A 1 69  ? -12.924 65.625  190.859 1.00 60.85  ?  67   GLY A O     1 
ATOM   494  N  N     . GLN A 1 70  ? -14.151 63.795  191.329 1.00 73.28  ?  68   GLN A N     1 
ATOM   495  C  CA    . GLN A 1 70  ? -15.310 64.289  190.587 1.00 77.61  ?  68   GLN A CA    1 
ATOM   496  C  C     . GLN A 1 70  ? -15.871 65.532  191.265 1.00 74.22  ?  68   GLN A C     1 
ATOM   497  O  O     . GLN A 1 70  ? -15.978 65.601  192.493 1.00 70.08  ?  68   GLN A O     1 
ATOM   498  C  CB    . GLN A 1 70  ? -16.401 63.212  190.464 1.00 86.98  ?  68   GLN A CB    1 
ATOM   499  C  CG    . GLN A 1 70  ? -17.406 63.400  189.272 1.00 95.81  ?  68   GLN A CG    1 
ATOM   500  C  CD    . GLN A 1 70  ? -18.547 64.417  189.476 1.00 101.55 ?  68   GLN A CD    1 
ATOM   501  O  OE1   . GLN A 1 70  ? -18.487 65.281  190.335 1.00 106.14 ?  68   GLN A OE1   1 
ATOM   502  N  NE2   . GLN A 1 70  ? -19.565 64.337  188.620 1.00 105.44 ?  68   GLN A NE2   1 
ATOM   503  N  N     . GLU A 1 71  ? -16.282 66.496  190.438 1.00 71.12  ?  69   GLU A N     1 
ATOM   504  C  CA    . GLU A 1 71  ? -16.566 67.860  190.862 1.00 77.32  ?  69   GLU A CA    1 
ATOM   505  C  C     . GLU A 1 71  ? -17.819 67.983  191.713 1.00 71.51  ?  69   GLU A C     1 
ATOM   506  O  O     . GLU A 1 71  ? -17.977 68.987  192.417 1.00 80.24  ?  69   GLU A O     1 
ATOM   507  C  CB    . GLU A 1 71  ? -16.688 68.739  189.621 1.00 89.35  ?  69   GLU A CB    1 
ATOM   508  C  CG    . GLU A 1 71  ? -17.424 68.054  188.477 1.00 108.19 ?  69   GLU A CG    1 
ATOM   509  C  CD    . GLU A 1 71  ? -17.502 68.914  187.237 1.00 130.04 ?  69   GLU A CD    1 
ATOM   510  O  OE1   . GLU A 1 71  ? -16.852 69.968  187.226 1.00 135.60 ?  69   GLU A OE1   1 
ATOM   511  O  OE2   . GLU A 1 71  ? -18.211 68.541  186.278 1.00 135.90 -1 69   GLU A OE2   1 
ATOM   512  N  N     . ARG A 1 72  ? -18.725 67.005  191.649 1.00 64.83  ?  70   ARG A N     1 
ATOM   513  C  CA    . ARG A 1 72  ? -19.894 67.044  192.515 1.00 50.15  ?  70   ARG A CA    1 
ATOM   514  C  C     . ARG A 1 72  ? -19.509 66.970  193.985 1.00 57.63  ?  70   ARG A C     1 
ATOM   515  O  O     . ARG A 1 72  ? -20.343 67.280  194.842 1.00 64.78  ?  70   ARG A O     1 
ATOM   516  C  CB    . ARG A 1 72  ? -20.871 65.914  192.154 1.00 49.42  ?  70   ARG A CB    1 
ATOM   517  C  CG    . ARG A 1 72  ? -20.845 64.713  193.091 1.00 54.05  ?  70   ARG A CG    1 
ATOM   518  C  CD    . ARG A 1 72  ? -21.781 63.599  192.627 1.00 71.65  ?  70   ARG A CD    1 
ATOM   519  N  NE    . ARG A 1 72  ? -21.164 62.752  191.609 1.00 89.57  ?  70   ARG A NE    1 
ATOM   520  C  CZ    . ARG A 1 72  ? -21.577 62.669  190.349 1.00 85.93  ?  70   ARG A CZ    1 
ATOM   521  N  NH1   . ARG A 1 72  ? -22.626 63.371  189.944 1.00 77.67  ?  70   ARG A NH1   1 
ATOM   522  N  NH2   . ARG A 1 72  ? -20.947 61.871  189.496 1.00 83.28  ?  70   ARG A NH2   1 
ATOM   523  N  N     . PHE A 1 73  ? -18.262 66.597  194.289 1.00 54.35  ?  71   PHE A N     1 
ATOM   524  C  CA    . PHE A 1 73  ? -17.722 66.616  195.643 1.00 51.49  ?  71   PHE A CA    1 
ATOM   525  C  C     . PHE A 1 73  ? -16.879 67.845  195.940 1.00 58.43  ?  71   PHE A C     1 
ATOM   526  O  O     . PHE A 1 73  ? -16.448 68.015  197.086 1.00 63.93  ?  71   PHE A O     1 
ATOM   527  C  CB    . PHE A 1 73  ? -16.882 65.361  195.892 1.00 48.76  ?  71   PHE A CB    1 
ATOM   528  C  CG    . PHE A 1 73  ? -17.706 64.143  196.050 1.00 57.79  ?  71   PHE A CG    1 
ATOM   529  C  CD1   . PHE A 1 73  ? -18.448 63.961  197.201 1.00 58.57  ?  71   PHE A CD1   1 
ATOM   530  C  CD2   . PHE A 1 73  ? -17.791 63.209  195.038 1.00 55.57  ?  71   PHE A CD2   1 
ATOM   531  C  CE1   . PHE A 1 73  ? -19.236 62.860  197.352 1.00 52.19  ?  71   PHE A CE1   1 
ATOM   532  C  CE2   . PHE A 1 73  ? -18.580 62.102  195.186 1.00 57.18  ?  71   PHE A CE2   1 
ATOM   533  C  CZ    . PHE A 1 73  ? -19.308 61.933  196.340 1.00 55.52  ?  71   PHE A CZ    1 
ATOM   534  N  N     . HIS A 1 74  ? -16.635 68.687  194.936 1.00 66.08  ?  72   HIS A N     1 
ATOM   535  C  CA    . HIS A 1 74  ? -15.806 69.878  195.062 1.00 62.11  ?  72   HIS A CA    1 
ATOM   536  C  C     . HIS A 1 74  ? -16.105 70.642  196.347 1.00 52.51  ?  72   HIS A C     1 
ATOM   537  O  O     . HIS A 1 74  ? -15.247 70.751  197.234 1.00 50.93  ?  72   HIS A O     1 
ATOM   538  C  CB    . HIS A 1 74  ? -16.021 70.744  193.811 1.00 77.17  ?  72   HIS A CB    1 
ATOM   539  C  CG    . HIS A 1 74  ? -15.600 72.172  193.961 1.00 80.63  ?  72   HIS A CG    1 
ATOM   540  N  ND1   . HIS A 1 74  ? -16.477 73.224  193.803 1.00 97.07  ?  72   HIS A ND1   1 
ATOM   541  C  CD2   . HIS A 1 74  ? -14.393 72.726  194.224 1.00 82.35  ?  72   HIS A CD2   1 
ATOM   542  C  CE1   . HIS A 1 74  ? -15.831 74.363  193.974 1.00 90.96  ?  72   HIS A CE1   1 
ATOM   543  N  NE2   . HIS A 1 74  ? -14.565 74.089  194.231 1.00 85.86  ?  72   HIS A NE2   1 
ATOM   544  N  N     . THR A 1 75  ? -17.350 71.111  196.483 1.00 43.01  ?  73   THR A N     1 
ATOM   545  C  CA    . THR A 1 75  ? -17.738 71.902  197.648 1.00 35.02  ?  73   THR A CA    1 
ATOM   546  C  C     . THR A 1 75  ? -17.350 71.214  198.950 1.00 43.05  ?  73   THR A C     1 
ATOM   547  O  O     . THR A 1 75  ? -16.830 71.856  199.870 1.00 41.04  ?  73   THR A O     1 
ATOM   548  C  CB    . THR A 1 75  ? -19.243 72.169  197.632 1.00 29.49  ?  73   THR A CB    1 
ATOM   549  O  OG1   . THR A 1 75  ? -19.596 72.906  196.456 1.00 52.39  ?  73   THR A OG1   1 
ATOM   550  C  CG2   . THR A 1 75  ? -19.652 72.957  198.867 1.00 32.19  ?  73   THR A CG2   1 
ATOM   551  N  N     . ILE A 1 76  ? -17.571 69.901  199.035 1.00 42.60  ?  74   ILE A N     1 
ATOM   552  C  CA    . ILE A 1 76  ? -17.263 69.183  200.264 1.00 41.57  ?  74   ILE A CA    1 
ATOM   553  C  C     . ILE A 1 76  ? -15.757 69.086  200.458 1.00 41.69  ?  74   ILE A C     1 
ATOM   554  O  O     . ILE A 1 76  ? -15.237 69.388  201.541 1.00 52.47  ?  74   ILE A O     1 
ATOM   555  C  CB    . ILE A 1 76  ? -17.928 67.795  200.261 1.00 51.84  ?  74   ILE A CB    1 
ATOM   556  C  CG1   . ILE A 1 76  ? -19.411 67.918  200.628 1.00 64.27  ?  74   ILE A CG1   1 
ATOM   557  C  CG2   . ILE A 1 76  ? -17.215 66.859  201.221 1.00 50.64  ?  74   ILE A CG2   1 
ATOM   558  C  CD1   . ILE A 1 76  ? -20.247 66.691  200.274 1.00 59.22  ?  74   ILE A CD1   1 
ATOM   559  N  N     . THR A 1 77  ? -15.027 68.690  199.412 1.00 41.62  ?  75   THR A N     1 
ATOM   560  C  CA    . THR A 1 77  ? -13.601 68.433  199.595 1.00 52.26  ?  75   THR A CA    1 
ATOM   561  C  C     . THR A 1 77  ? -12.857 69.725  199.899 1.00 45.62  ?  75   THR A C     1 
ATOM   562  O  O     . THR A 1 77  ? -11.988 69.764  200.781 1.00 31.84  ?  75   THR A O     1 
ATOM   563  C  CB    . THR A 1 77  ? -13.014 67.743  198.361 1.00 53.51  ?  75   THR A CB    1 
ATOM   564  O  OG1   . THR A 1 77  ? -13.516 68.368  197.175 1.00 55.42  ?  75   THR A OG1   1 
ATOM   565  C  CG2   . THR A 1 77  ? -13.373 66.263  198.350 1.00 50.91  ?  75   THR A CG2   1 
ATOM   566  N  N     . THR A 1 78  ? -13.208 70.801  199.188 1.00 39.78  ?  76   THR A N     1 
ATOM   567  C  CA    . THR A 1 78  ? -12.653 72.118  199.481 1.00 49.41  ?  76   THR A CA    1 
ATOM   568  C  C     . THR A 1 78  ? -12.863 72.505  200.939 1.00 53.76  ?  76   THR A C     1 
ATOM   569  O  O     . THR A 1 78  ? -12.013 73.187  201.532 1.00 68.43  ?  76   THR A O     1 
ATOM   570  C  CB    . THR A 1 78  ? -13.280 73.159  198.550 1.00 55.95  ?  76   THR A CB    1 
ATOM   571  O  OG1   . THR A 1 78  ? -14.684 72.900  198.416 1.00 70.36  ?  76   THR A OG1   1 
ATOM   572  C  CG2   . THR A 1 78  ? -12.638 73.099  197.176 1.00 41.28  ?  76   THR A CG2   1 
ATOM   573  N  N     . SER A 1 79  ? -13.959 72.038  201.544 1.00 40.97  ?  77   SER A N     1 
ATOM   574  C  CA    . SER A 1 79  ? -14.233 72.236  202.964 1.00 43.89  ?  77   SER A CA    1 
ATOM   575  C  C     . SER A 1 79  ? -13.012 71.963  203.836 1.00 50.26  ?  77   SER A C     1 
ATOM   576  O  O     . SER A 1 79  ? -12.841 72.581  204.892 1.00 54.70  ?  77   SER A O     1 
ATOM   577  C  CB    . SER A 1 79  ? -15.388 71.332  203.397 1.00 42.70  ?  77   SER A CB    1 
ATOM   578  O  OG    . SER A 1 79  ? -15.285 71.012  204.772 1.00 87.82  ?  77   SER A OG    1 
ATOM   579  N  N     . TYR A 1 80  ? -12.145 71.059  203.386 1.00 39.26  ?  78   TYR A N     1 
ATOM   580  C  CA    . TYR A 1 80  ? -11.062 70.538  204.204 1.00 35.30  ?  78   TYR A CA    1 
ATOM   581  C  C     . TYR A 1 80  ? -9.700  71.127  203.877 1.00 57.58  ?  78   TYR A C     1 
ATOM   582  O  O     . TYR A 1 80  ? -8.709  70.714  204.490 1.00 61.27  ?  78   TYR A O     1 
ATOM   583  C  CB    . TYR A 1 80  ? -11.005 69.018  204.068 1.00 40.74  ?  78   TYR A CB    1 
ATOM   584  C  CG    . TYR A 1 80  ? -12.217 68.363  204.657 1.00 42.39  ?  78   TYR A CG    1 
ATOM   585  C  CD1   . TYR A 1 80  ? -13.402 68.280  203.942 1.00 37.36  ?  78   TYR A CD1   1 
ATOM   586  C  CD2   . TYR A 1 80  ? -12.190 67.857  205.945 1.00 58.92  ?  78   TYR A CD2   1 
ATOM   587  C  CE1   . TYR A 1 80  ? -14.516 67.699  204.487 1.00 51.08  ?  78   TYR A CE1   1 
ATOM   588  C  CE2   . TYR A 1 80  ? -13.299 67.274  206.497 1.00 56.63  ?  78   TYR A CE2   1 
ATOM   589  C  CZ    . TYR A 1 80  ? -14.458 67.198  205.765 1.00 50.16  ?  78   TYR A CZ    1 
ATOM   590  O  OH    . TYR A 1 80  ? -15.565 66.617  206.318 1.00 57.95  ?  78   TYR A OH    1 
ATOM   591  N  N     . TYR A 1 81  ? -9.611  72.079  202.943 1.00 50.79  ?  79   TYR A N     1 
ATOM   592  C  CA    . TYR A 1 81  ? -8.293  72.652  202.682 1.00 44.40  ?  79   TYR A CA    1 
ATOM   593  C  C     . TYR A 1 81  ? -7.755  73.433  203.879 1.00 41.08  ?  79   TYR A C     1 
ATOM   594  O  O     . TYR A 1 81  ? -6.548  73.696  203.932 1.00 52.37  ?  79   TYR A O     1 
ATOM   595  C  CB    . TYR A 1 81  ? -8.322  73.568  201.449 1.00 34.89  ?  79   TYR A CB    1 
ATOM   596  C  CG    . TYR A 1 81  ? -8.535  72.878  200.114 1.00 37.99  ?  79   TYR A CG    1 
ATOM   597  C  CD1   . TYR A 1 81  ? -9.144  71.626  200.027 1.00 50.23  ?  79   TYR A CD1   1 
ATOM   598  C  CD2   . TYR A 1 81  ? -8.114  73.477  198.932 1.00 51.23  ?  79   TYR A CD2   1 
ATOM   599  C  CE1   . TYR A 1 81  ? -9.336  70.999  198.792 1.00 41.27  ?  79   TYR A CE1   1 
ATOM   600  C  CE2   . TYR A 1 81  ? -8.300  72.857  197.703 1.00 43.19  ?  79   TYR A CE2   1 
ATOM   601  C  CZ    . TYR A 1 81  ? -8.909  71.620  197.643 1.00 32.45  ?  79   TYR A CZ    1 
ATOM   602  O  OH    . TYR A 1 81  ? -9.094  71.005  196.419 1.00 42.04  ?  79   TYR A OH    1 
ATOM   603  N  N     . ARG A 1 82  ? -8.614  73.749  204.855 1.00 59.57  ?  80   ARG A N     1 
ATOM   604  C  CA    . ARG A 1 82  ? -8.307  74.744  205.883 1.00 54.87  ?  80   ARG A CA    1 
ATOM   605  C  C     . ARG A 1 82  ? -7.116  74.350  206.749 1.00 59.17  ?  80   ARG A C     1 
ATOM   606  O  O     . ARG A 1 82  ? -6.315  75.210  207.129 1.00 79.52  ?  80   ARG A O     1 
ATOM   607  C  CB    . ARG A 1 82  ? -9.533  74.973  206.768 1.00 47.41  ?  80   ARG A CB    1 
ATOM   608  N  N     . GLY A 1 83  ? -6.994  73.078  207.103 1.00 44.86  ?  81   GLY A N     1 
ATOM   609  C  CA    . GLY A 1 83  ? -5.965  72.709  208.058 1.00 53.20  ?  81   GLY A CA    1 
ATOM   610  C  C     . GLY A 1 83  ? -4.671  72.216  207.445 1.00 47.88  ?  81   GLY A C     1 
ATOM   611  O  O     . GLY A 1 83  ? -3.653  72.105  208.137 1.00 51.31  ?  81   GLY A O     1 
ATOM   612  N  N     . ALA A 1 84  ? -4.699  71.941  206.143 1.00 50.99  ?  82   ALA A N     1 
ATOM   613  C  CA    . ALA A 1 84  ? -3.636  71.177  205.506 1.00 45.14  ?  82   ALA A CA    1 
ATOM   614  C  C     . ALA A 1 84  ? -2.305  71.915  205.548 1.00 47.83  ?  82   ALA A C     1 
ATOM   615  O  O     . ALA A 1 84  ? -2.223  73.112  205.262 1.00 39.92  ?  82   ALA A O     1 
ATOM   616  C  CB    . ALA A 1 84  ? -4.015  70.869  204.058 1.00 48.76  ?  82   ALA A CB    1 
ATOM   617  N  N     . MET A 1 85  ? -1.252  71.184  205.905 1.00 41.67  ?  83   MET A N     1 
ATOM   618  C  CA    . MET A 1 85  ? 0.092   71.730  205.836 1.00 36.88  ?  83   MET A CA    1 
ATOM   619  C  C     . MET A 1 85  ? 0.743   71.507  204.480 1.00 49.08  ?  83   MET A C     1 
ATOM   620  O  O     . MET A 1 85  ? 1.625   72.288  204.099 1.00 46.64  ?  83   MET A O     1 
ATOM   621  C  CB    . MET A 1 85  ? 0.957   71.131  206.946 1.00 42.06  ?  83   MET A CB    1 
ATOM   622  C  CG    . MET A 1 85  ? 0.350   71.326  208.338 1.00 48.96  ?  83   MET A CG    1 
ATOM   623  S  SD    . MET A 1 85  ? 1.370   70.726  209.692 1.00 57.76  ?  83   MET A SD    1 
ATOM   624  C  CE    . MET A 1 85  ? 2.619   72.004  209.790 1.00 57.17  ?  83   MET A CE    1 
ATOM   625  N  N     . GLY A 1 86  ? 0.329   70.486  203.737 1.00 41.21  ?  84   GLY A N     1 
ATOM   626  C  CA    . GLY A 1 86  ? 0.849   70.298  202.389 1.00 34.60  ?  84   GLY A CA    1 
ATOM   627  C  C     . GLY A 1 86  ? -0.171  69.651  201.481 1.00 44.21  ?  84   GLY A C     1 
ATOM   628  O  O     . GLY A 1 86  ? -0.939  68.778  201.904 1.00 41.54  ?  84   GLY A O     1 
ATOM   629  N  N     . ILE A 1 87  ? -0.183  70.074  200.212 1.00 38.60  ?  85   ILE A N     1 
ATOM   630  C  CA    . ILE A 1 87  ? -1.135  69.559  199.232 1.00 38.48  ?  85   ILE A CA    1 
ATOM   631  C  C     . ILE A 1 87  ? -0.384  69.075  197.998 1.00 45.64  ?  85   ILE A C     1 
ATOM   632  O  O     . ILE A 1 87  ? 0.470   69.790  197.460 1.00 43.80  ?  85   ILE A O     1 
ATOM   633  C  CB    . ILE A 1 87  ? -2.190  70.607  198.828 1.00 31.61  ?  85   ILE A CB    1 
ATOM   634  C  CG1   . ILE A 1 87  ? -2.874  71.206  200.051 1.00 50.40  ?  85   ILE A CG1   1 
ATOM   635  C  CG2   . ILE A 1 87  ? -3.264  69.961  197.991 1.00 38.56  ?  85   ILE A CG2   1 
ATOM   636  C  CD1   . ILE A 1 87  ? -3.862  72.305  199.705 1.00 32.44  ?  85   ILE A CD1   1 
ATOM   637  N  N     . MET A 1 88  ? -0.709  67.868  197.544 1.00 44.80  ?  86   MET A N     1 
ATOM   638  C  CA    . MET A 1 88  ? -0.236  67.352  196.266 1.00 42.02  ?  86   MET A CA    1 
ATOM   639  C  C     . MET A 1 88  ? -1.340  67.569  195.241 1.00 42.70  ?  86   MET A C     1 
ATOM   640  O  O     . MET A 1 88  ? -2.415  66.964  195.338 1.00 54.82  ?  86   MET A O     1 
ATOM   641  C  CB    . MET A 1 88  ? 0.113   65.870  196.356 1.00 51.48  ?  86   MET A CB    1 
ATOM   642  C  CG    . MET A 1 88  ? 0.954   65.492  197.553 1.00 51.94  ?  86   MET A CG    1 
ATOM   643  S  SD    . MET A 1 88  ? 2.716   65.625  197.244 1.00 65.29  ?  86   MET A SD    1 
ATOM   644  C  CE    . MET A 1 88  ? 3.301   64.263  198.252 1.00 52.94  ?  86   MET A CE    1 
ATOM   645  N  N     . LEU A 1 89  ? -1.088  68.441  194.275 1.00 49.49  ?  87   LEU A N     1 
ATOM   646  C  CA    . LEU A 1 89  ? -1.916  68.458  193.080 1.00 40.04  ?  87   LEU A CA    1 
ATOM   647  C  C     . LEU A 1 89  ? -1.435  67.355  192.161 1.00 45.97  ?  87   LEU A C     1 
ATOM   648  O  O     . LEU A 1 89  ? -0.230  67.186  191.965 1.00 49.34  ?  87   LEU A O     1 
ATOM   649  C  CB    . LEU A 1 89  ? -1.848  69.797  192.358 1.00 31.99  ?  87   LEU A CB    1 
ATOM   650  C  CG    . LEU A 1 89  ? -2.189  71.047  193.150 1.00 44.37  ?  87   LEU A CG    1 
ATOM   651  C  CD1   . LEU A 1 89  ? -0.990  71.597  193.931 1.00 39.00  ?  87   LEU A CD1   1 
ATOM   652  C  CD2   . LEU A 1 89  ? -2.754  72.051  192.185 1.00 56.69  ?  87   LEU A CD2   1 
ATOM   653  N  N     . VAL A 1 90  ? -2.365  66.588  191.615 1.00 45.26  ?  88   VAL A N     1 
ATOM   654  C  CA    . VAL A 1 90  ? -2.007  65.418  190.833 1.00 62.25  ?  88   VAL A CA    1 
ATOM   655  C  C     . VAL A 1 90  ? -2.705  65.500  189.487 1.00 68.33  ?  88   VAL A C     1 
ATOM   656  O  O     . VAL A 1 90  ? -3.900  65.812  189.421 1.00 76.31  ?  88   VAL A O     1 
ATOM   657  C  CB    . VAL A 1 90  ? -2.377  64.113  191.562 1.00 53.59  ?  88   VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1 90  ? -1.568  62.956  191.003 1.00 56.55  ?  88   VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1 90  ? -2.146  64.255  193.052 1.00 40.72  ?  88   VAL A CG2   1 
ATOM   660  N  N     . TYR A 1 91  ? -1.957  65.242  188.421 1.00 67.99  ?  89   TYR A N     1 
ATOM   661  C  CA    . TYR A 1 91  ? -2.515  65.010  187.096 1.00 58.27  ?  89   TYR A CA    1 
ATOM   662  C  C     . TYR A 1 91  ? -1.994  63.682  186.558 1.00 54.08  ?  89   TYR A C     1 
ATOM   663  O  O     . TYR A 1 91  ? -1.202  62.987  187.200 1.00 55.54  ?  89   TYR A O     1 
ATOM   664  C  CB    . TYR A 1 91  ? -2.194  66.161  186.133 1.00 61.96  ?  89   TYR A CB    1 
ATOM   665  C  CG    . TYR A 1 91  ? -0.730  66.330  185.779 1.00 64.20  ?  89   TYR A CG    1 
ATOM   666  C  CD1   . TYR A 1 91  ? 0.149   66.949  186.656 1.00 73.99  ?  89   TYR A CD1   1 
ATOM   667  C  CD2   . TYR A 1 91  ? -0.231  65.884  184.561 1.00 53.86  ?  89   TYR A CD2   1 
ATOM   668  C  CE1   . TYR A 1 91  ? 1.485   67.113  186.333 1.00 72.37  ?  89   TYR A CE1   1 
ATOM   669  C  CE2   . TYR A 1 91  ? 1.105   66.042  184.232 1.00 48.14  ?  89   TYR A CE2   1 
ATOM   670  C  CZ    . TYR A 1 91  ? 1.956   66.659  185.121 1.00 58.17  ?  89   TYR A CZ    1 
ATOM   671  O  OH    . TYR A 1 91  ? 3.283   66.822  184.803 1.00 72.47  ?  89   TYR A OH    1 
ATOM   672  N  N     . ASP A 1 92  ? -2.458  63.336  185.363 1.00 68.05  ?  90   ASP A N     1 
ATOM   673  C  CA    . ASP A 1 92  ? -2.140  62.076  184.703 1.00 69.76  ?  90   ASP A CA    1 
ATOM   674  C  C     . ASP A 1 92  ? -1.382  62.407  183.426 1.00 67.00  ?  90   ASP A C     1 
ATOM   675  O  O     . ASP A 1 92  ? -1.867  63.195  182.608 1.00 71.35  ?  90   ASP A O     1 
ATOM   676  C  CB    . ASP A 1 92  ? -3.428  61.301  184.406 1.00 70.12  ?  90   ASP A CB    1 
ATOM   677  C  CG    . ASP A 1 92  ? -3.179  59.919  183.842 1.00 76.79  ?  90   ASP A CG    1 
ATOM   678  O  OD1   . ASP A 1 92  ? -2.098  59.673  183.270 1.00 80.86  ?  90   ASP A OD1   1 
ATOM   679  O  OD2   . ASP A 1 92  ? -4.083  59.067  183.970 1.00 74.01  -1 90   ASP A OD2   1 
ATOM   680  N  N     . ILE A 1 93  ? -0.195  61.817  183.252 1.00 63.38  ?  91   ILE A N     1 
ATOM   681  C  CA    . ILE A 1 93  ? 0.614   62.208  182.099 1.00 68.80  ?  91   ILE A CA    1 
ATOM   682  C  C     . ILE A 1 93  ? -0.039  61.759  180.794 1.00 67.23  ?  91   ILE A C     1 
ATOM   683  O  O     . ILE A 1 93  ? 0.103   62.427  179.764 1.00 53.42  ?  91   ILE A O     1 
ATOM   684  C  CB    . ILE A 1 93  ? 2.061   61.685  182.220 1.00 66.85  ?  91   ILE A CB    1 
ATOM   685  C  CG1   . ILE A 1 93  ? 2.167   60.214  181.812 1.00 59.22  ?  91   ILE A CG1   1 
ATOM   686  C  CG2   . ILE A 1 93  ? 2.605   61.905  183.624 1.00 60.64  ?  91   ILE A CG2   1 
ATOM   687  C  CD1   . ILE A 1 93  ? 3.579   59.799  181.465 1.00 66.15  ?  91   ILE A CD1   1 
ATOM   688  N  N     . THR A 1 94  ? -0.779  60.646  180.814 1.00 67.12  ?  92   THR A N     1 
ATOM   689  C  CA    . THR A 1 94  ? -1.480  60.187  179.622 1.00 56.72  ?  92   THR A CA    1 
ATOM   690  C  C     . THR A 1 94  ? -2.714  61.025  179.318 1.00 64.99  ?  92   THR A C     1 
ATOM   691  O  O     . THR A 1 94  ? -3.245  60.943  178.207 1.00 86.00  ?  92   THR A O     1 
ATOM   692  C  CB    . THR A 1 94  ? -1.899  58.727  179.785 1.00 65.90  ?  92   THR A CB    1 
ATOM   693  O  OG1   . THR A 1 94  ? -3.040  58.654  180.649 1.00 72.15  ?  92   THR A OG1   1 
ATOM   694  C  CG2   . THR A 1 94  ? -0.771  57.916  180.391 1.00 74.95  ?  92   THR A CG2   1 
ATOM   695  N  N     . ASN A 1 95  ? -3.180  61.819  180.275 1.00 66.79  ?  93   ASN A N     1 
ATOM   696  C  CA    . ASN A 1 95  ? -4.441  62.540  180.170 1.00 60.98  ?  93   ASN A CA    1 
ATOM   697  C  C     . ASN A 1 95  ? -4.150  64.034  180.110 1.00 69.55  ?  93   ASN A C     1 
ATOM   698  O  O     . ASN A 1 95  ? -3.704  64.623  181.100 1.00 87.30  ?  93   ASN A O     1 
ATOM   699  C  CB    . ASN A 1 95  ? -5.348  62.198  181.354 1.00 52.01  ?  93   ASN A CB    1 
ATOM   700  C  CG    . ASN A 1 95  ? -6.688  62.911  181.305 1.00 57.32  ?  93   ASN A CG    1 
ATOM   701  O  OD1   . ASN A 1 95  ? -6.866  63.898  180.597 1.00 70.73  ?  93   ASN A OD1   1 
ATOM   702  N  ND2   . ASN A 1 95  ? -7.647  62.397  182.061 1.00 71.16  ?  93   ASN A ND2   1 
ATOM   703  N  N     . GLY A 1 96  ? -4.426  64.646  178.958 1.00 57.73  ?  94   GLY A N     1 
ATOM   704  C  CA    . GLY A 1 96  ? -4.243  66.080  178.833 1.00 53.15  ?  94   GLY A CA    1 
ATOM   705  C  C     . GLY A 1 96  ? -5.225  66.892  179.655 1.00 70.00  ?  94   GLY A C     1 
ATOM   706  O  O     . GLY A 1 96  ? -4.886  67.980  180.128 1.00 69.05  ?  94   GLY A O     1 
ATOM   707  N  N     . LYS A 1 97  ? -6.448  66.382  179.839 1.00 80.01  ?  95   LYS A N     1 
ATOM   708  C  CA    . LYS A 1 97  ? -7.473  67.117  180.579 1.00 68.27  ?  95   LYS A CA    1 
ATOM   709  C  C     . LYS A 1 97  ? -7.042  67.367  182.023 1.00 67.72  ?  95   LYS A C     1 
ATOM   710  O  O     . LYS A 1 97  ? -7.168  68.485  182.551 1.00 51.03  ?  95   LYS A O     1 
ATOM   711  C  CB    . LYS A 1 97  ? -8.792  66.342  180.529 1.00 60.41  ?  95   LYS A CB    1 
ATOM   712  C  CG    . LYS A 1 97  ? -10.018 67.126  180.937 1.00 63.89  ?  95   LYS A CG    1 
ATOM   713  C  CD    . LYS A 1 97  ? -10.196 68.364  180.086 1.00 73.23  ?  95   LYS A CD    1 
ATOM   714  C  CE    . LYS A 1 97  ? -11.326 69.224  180.628 1.00 90.23  ?  95   LYS A CE    1 
ATOM   715  N  NZ    . LYS A 1 97  ? -11.339 70.589  180.033 1.00 99.20  ?  95   LYS A NZ    1 
ATOM   716  N  N     . SER A 1 98  ? -6.521  66.327  182.677 1.00 71.49  ?  96   SER A N     1 
ATOM   717  C  CA    . SER A 1 98  ? -6.067  66.473  184.054 1.00 63.75  ?  96   SER A CA    1 
ATOM   718  C  C     . SER A 1 98  ? -4.981  67.534  184.167 1.00 64.91  ?  96   SER A C     1 
ATOM   719  O  O     . SER A 1 98  ? -4.966  68.316  185.125 1.00 86.36  ?  96   SER A O     1 
ATOM   720  C  CB    . SER A 1 98  ? -5.562  65.131  184.577 1.00 64.79  ?  96   SER A CB    1 
ATOM   721  O  OG    . SER A 1 98  ? -4.608  64.574  183.689 1.00 57.53  ?  96   SER A OG    1 
ATOM   722  N  N     . PHE A 1 99  ? -4.070  67.589  183.194 1.00 44.86  ?  97   PHE A N     1 
ATOM   723  C  CA    . PHE A 1 99  ? -3.001  68.575  183.272 1.00 55.65  ?  97   PHE A CA    1 
ATOM   724  C  C     . PHE A 1 99  ? -3.484  69.976  182.925 1.00 62.36  ?  97   PHE A C     1 
ATOM   725  O  O     . PHE A 1 99  ? -2.934  70.955  183.442 1.00 73.75  ?  97   PHE A O     1 
ATOM   726  C  CB    . PHE A 1 99  ? -1.832  68.194  182.363 1.00 56.85  ?  97   PHE A CB    1 
ATOM   727  C  CG    . PHE A 1 99  ? -0.707  69.197  182.380 1.00 55.68  ?  97   PHE A CG    1 
ATOM   728  C  CD1   . PHE A 1 99  ? 0.234   69.180  183.398 1.00 55.03  ?  97   PHE A CD1   1 
ATOM   729  C  CD2   . PHE A 1 99  ? -0.596  70.161  181.389 1.00 46.99  ?  97   PHE A CD2   1 
ATOM   730  C  CE1   . PHE A 1 99  ? 1.269   70.100  183.427 1.00 56.08  ?  97   PHE A CE1   1 
ATOM   731  C  CE2   . PHE A 1 99  ? 0.438   71.085  181.412 1.00 46.68  ?  97   PHE A CE2   1 
ATOM   732  C  CZ    . PHE A 1 99  ? 1.371   71.052  182.430 1.00 52.40  ?  97   PHE A CZ    1 
ATOM   733  N  N     . GLU A 1 100 ? -4.487  70.114  182.057 1.00 61.49  ?  98   GLU A N     1 
ATOM   734  C  CA    . GLU A 1 100 ? -4.978  71.461  181.804 1.00 72.46  ?  98   GLU A CA    1 
ATOM   735  C  C     . GLU A 1 100 ? -5.810  71.990  182.968 1.00 63.17  ?  98   GLU A C     1 
ATOM   736  O  O     . GLU A 1 100 ? -5.904  73.213  183.127 1.00 55.15  ?  98   GLU A O     1 
ATOM   737  C  CB    . GLU A 1 100 ? -5.768  71.532  180.483 1.00 87.46  ?  98   GLU A CB    1 
ATOM   738  C  CG    . GLU A 1 100 ? -6.792  70.437  180.260 1.00 106.30 ?  98   GLU A CG    1 
ATOM   739  C  CD    . GLU A 1 100 ? -7.030  70.106  178.786 1.00 113.87 ?  98   GLU A CD    1 
ATOM   740  O  OE1   . GLU A 1 100 ? -7.786  70.842  178.115 1.00 110.85 ?  98   GLU A OE1   1 
ATOM   741  O  OE2   . GLU A 1 100 ? -6.459  69.104  178.302 1.00 121.58 -1 98   GLU A OE2   1 
ATOM   742  N  N     . ASN A 1 101 ? -6.374  71.111  183.811 1.00 55.26  ?  99   ASN A N     1 
ATOM   743  C  CA    . ASN A 1 101 ? -7.156  71.558  184.970 1.00 41.01  ?  99   ASN A CA    1 
ATOM   744  C  C     . ASN A 1 101 ? -6.316  71.888  186.211 1.00 49.83  ?  99   ASN A C     1 
ATOM   745  O  O     . ASN A 1 101 ? -6.887  72.257  187.257 1.00 54.94  ?  99   ASN A O     1 
ATOM   746  C  CB    . ASN A 1 101 ? -8.196  70.502  185.337 1.00 33.37  ?  99   ASN A CB    1 
ATOM   747  C  CG    . ASN A 1 101 ? -9.325  70.436  184.344 1.00 49.28  ?  99   ASN A CG    1 
ATOM   748  O  OD1   . ASN A 1 101 ? -9.811  71.464  183.869 1.00 73.79  ?  99   ASN A OD1   1 
ATOM   749  N  ND2   . ASN A 1 101 ? -9.753  69.224  184.020 1.00 55.07  ?  99   ASN A ND2   1 
ATOM   750  N  N     . ILE A 1 102 ? -4.988  71.767  186.131 1.00 49.19  ?  100  ILE A N     1 
ATOM   751  C  CA    . ILE A 1 102 ? -4.131  72.141  187.254 1.00 50.94  ?  100  ILE A CA    1 
ATOM   752  C  C     . ILE A 1 102 ? -4.383  73.583  187.675 1.00 50.04  ?  100  ILE A C     1 
ATOM   753  O  O     . ILE A 1 102 ? -4.357  73.901  188.869 1.00 57.93  ?  100  ILE A O     1 
ATOM   754  C  CB    . ILE A 1 102 ? -2.651  71.911  186.888 1.00 56.91  ?  100  ILE A CB    1 
ATOM   755  C  CG1   . ILE A 1 102 ? -2.338  70.414  186.828 1.00 67.98  ?  100  ILE A CG1   1 
ATOM   756  C  CG2   . ILE A 1 102 ? -1.734  72.614  187.876 1.00 37.36  ?  100  ILE A CG2   1 
ATOM   757  C  CD1   . ILE A 1 102 ? -2.554  69.695  188.142 1.00 71.76  ?  100  ILE A CD1   1 
ATOM   758  N  N     . SER A 1 103 ? -4.642  74.470  186.713 1.00 50.53  ?  101  SER A N     1 
ATOM   759  C  CA    . SER A 1 103 ? -4.894  75.875  187.024 1.00 58.25  ?  101  SER A CA    1 
ATOM   760  C  C     . SER A 1 103 ? -6.086  76.026  187.962 1.00 57.71  ?  101  SER A C     1 
ATOM   761  O  O     . SER A 1 103 ? -6.023  76.760  188.962 1.00 72.73  ?  101  SER A O     1 
ATOM   762  C  CB    . SER A 1 103 ? -5.124  76.656  185.728 1.00 74.35  ?  101  SER A CB    1 
ATOM   763  O  OG    . SER A 1 103 ? -6.117  76.031  184.929 1.00 90.50  ?  101  SER A OG    1 
ATOM   764  N  N     . LYS A 1 104 ? -7.179  75.313  187.663 1.00 45.74  ?  102  LYS A N     1 
ATOM   765  C  CA    . LYS A 1 104 ? -8.388  75.389  188.475 1.00 66.55  ?  102  LYS A CA    1 
ATOM   766  C  C     . LYS A 1 104 ? -8.167  74.766  189.853 1.00 62.21  ?  102  LYS A C     1 
ATOM   767  O  O     . LYS A 1 104 ? -8.594  75.323  190.872 1.00 49.91  ?  102  LYS A O     1 
ATOM   768  C  CB    . LYS A 1 104 ? -9.560  74.739  187.730 1.00 65.28  ?  102  LYS A CB    1 
ATOM   769  C  CG    . LYS A 1 104 ? -10.824 74.588  188.551 1.00 95.11  ?  102  LYS A CG    1 
ATOM   770  C  CD    . LYS A 1 104 ? -11.782 73.632  187.825 1.00 111.43 ?  102  LYS A CD    1 
ATOM   771  C  CE    . LYS A 1 104 ? -11.274 72.214  187.919 1.00 117.27 ?  102  LYS A CE    1 
ATOM   772  N  NZ    . LYS A 1 104 ? -12.232 71.238  187.493 1.00 120.98 ?  102  LYS A NZ    1 
ATOM   773  N  N     . TRP A 1 105 ? -7.459  73.633  189.910 1.00 55.44  ?  103  TRP A N     1 
ATOM   774  C  CA    . TRP A 1 105 ? -7.119  73.062  191.217 1.00 52.43  ?  103  TRP A CA    1 
ATOM   775  C  C     . TRP A 1 105 ? -6.335  74.048  192.079 1.00 55.82  ?  103  TRP A C     1 
ATOM   776  O  O     . TRP A 1 105 ? -6.672  74.283  193.256 1.00 69.26  ?  103  TRP A O     1 
ATOM   777  C  CB    . TRP A 1 105 ? -6.328  71.766  191.040 1.00 46.76  ?  103  TRP A CB    1 
ATOM   778  C  CG    . TRP A 1 105 ? -7.181  70.628  190.634 1.00 50.75  ?  103  TRP A CG    1 
ATOM   779  C  CD1   . TRP A 1 105 ? -7.089  69.902  189.485 1.00 44.11  ?  103  TRP A CD1   1 
ATOM   780  C  CD2   . TRP A 1 105 ? -8.286  70.091  191.366 1.00 43.61  ?  103  TRP A CD2   1 
ATOM   781  N  NE1   . TRP A 1 105 ? -8.061  68.932  189.465 1.00 45.39  ?  103  TRP A NE1   1 
ATOM   782  C  CE2   . TRP A 1 105 ? -8.812  69.030  190.607 1.00 50.62  ?  103  TRP A CE2   1 
ATOM   783  C  CE3   . TRP A 1 105 ? -8.878  70.400  192.590 1.00 50.79  ?  103  TRP A CE3   1 
ATOM   784  C  CZ2   . TRP A 1 105 ? -9.904  68.277  191.035 1.00 44.35  ?  103  TRP A CZ2   1 
ATOM   785  C  CZ3   . TRP A 1 105 ? -9.957  69.652  193.013 1.00 59.59  ?  103  TRP A CZ3   1 
ATOM   786  C  CH2   . TRP A 1 105 ? -10.458 68.602  192.240 1.00 54.11  ?  103  TRP A CH2   1 
ATOM   787  N  N     . LEU A 1 106 ? -5.274  74.632  191.511 1.00 49.96  ?  104  LEU A N     1 
ATOM   788  C  CA    . LEU A 1 106 ? -4.494  75.617  192.253 1.00 55.61  ?  104  LEU A CA    1 
ATOM   789  C  C     . LEU A 1 106 ? -5.360  76.767  192.731 1.00 60.01  ?  104  LEU A C     1 
ATOM   790  O  O     . LEU A 1 106 ? -5.148  77.295  193.831 1.00 62.88  ?  104  LEU A O     1 
ATOM   791  C  CB    . LEU A 1 106 ? -3.335  76.159  191.415 1.00 42.02  ?  104  LEU A CB    1 
ATOM   792  C  CG    . LEU A 1 106 ? -2.191  75.262  190.960 1.00 43.35  ?  104  LEU A CG    1 
ATOM   793  C  CD1   . LEU A 1 106 ? -1.572  75.807  189.700 1.00 51.75  ?  104  LEU A CD1   1 
ATOM   794  C  CD2   . LEU A 1 106 ? -1.155  75.176  192.069 1.00 37.33  ?  104  LEU A CD2   1 
ATOM   795  N  N     . ARG A 1 107 ? -6.346  77.167  191.922 1.00 47.41  ?  105  ARG A N     1 
ATOM   796  C  CA    . ARG A 1 107 ? -7.202  78.274  192.331 1.00 48.76  ?  105  ARG A CA    1 
ATOM   797  C  C     . ARG A 1 107 ? -8.088  77.878  193.505 1.00 55.52  ?  105  ARG A C     1 
ATOM   798  O  O     . ARG A 1 107 ? -8.362  78.705  194.378 1.00 56.36  ?  105  ARG A O     1 
ATOM   799  C  CB    . ARG A 1 107 ? -8.043  78.794  191.162 1.00 44.38  ?  105  ARG A CB    1 
ATOM   800  C  CG    . ARG A 1 107 ? -9.472  78.333  191.128 1.00 57.65  ?  105  ARG A CG    1 
ATOM   801  C  CD    . ARG A 1 107 ? -10.361 79.373  190.448 1.00 85.30  ?  105  ARG A CD    1 
ATOM   802  N  NE    . ARG A 1 107 ? -10.437 80.558  191.194 1.00 96.87  ?  105  ARG A NE    1 
ATOM   803  C  CZ    . ARG A 1 107 ? -10.679 81.682  190.738 1.00 112.46 ?  105  ARG A CZ    1 
ATOM   804  N  NH1   . ARG A 1 107 ? -10.859 81.797  189.523 1.00 118.64 ?  105  ARG A NH1   1 
ATOM   805  N  NH2   . ARG A 1 107 ? -10.738 82.701  191.500 1.00 93.90  ?  105  ARG A NH2   1 
ATOM   806  N  N     . ASN A 1 108 ? -8.549  76.615  193.540 1.00 43.12  ?  106  ASN A N     1 
ATOM   807  C  CA    . ASN A 1 108 ? -9.228  76.117  194.740 1.00 50.43  ?  106  ASN A CA    1 
ATOM   808  C  C     . ASN A 1 108 ? -8.341  76.239  195.954 1.00 50.88  ?  106  ASN A C     1 
ATOM   809  O  O     . ASN A 1 108 ? -8.818  76.515  197.060 1.00 44.84  ?  106  ASN A O     1 
ATOM   810  C  CB    . ASN A 1 108 ? -9.590  74.641  194.638 1.00 57.91  ?  106  ASN A CB    1 
ATOM   811  C  CG    . ASN A 1 108 ? -10.469 74.326  193.496 1.00 52.24  ?  106  ASN A CG    1 
ATOM   812  O  OD1   . ASN A 1 108 ? -11.366 75.088  193.133 1.00 64.60  ?  106  ASN A OD1   1 
ATOM   813  N  ND2   . ASN A 1 108 ? -10.242 73.160  192.924 1.00 53.47  ?  106  ASN A ND2   1 
ATOM   814  N  N     . ILE A 1 109 ? -7.064  75.910  195.787 1.00 46.95  ?  107  ILE A N     1 
ATOM   815  C  CA    . ILE A 1 109 ? -6.123  76.077  196.885 1.00 40.88  ?  107  ILE A CA    1 
ATOM   816  C  C     . ILE A 1 109 ? -6.101  77.534  197.333 1.00 48.40  ?  107  ILE A C     1 
ATOM   817  O  O     . ILE A 1 109 ? -6.262  77.840  198.522 1.00 59.80  ?  107  ILE A O     1 
ATOM   818  C  CB    . ILE A 1 109 ? -4.731  75.574  196.469 1.00 28.28  ?  107  ILE A CB    1 
ATOM   819  C  CG1   . ILE A 1 109 ? -4.710  74.043  196.436 1.00 28.80  ?  107  ILE A CG1   1 
ATOM   820  C  CG2   . ILE A 1 109 ? -3.676  76.102  197.402 1.00 28.31  ?  107  ILE A CG2   1 
ATOM   821  C  CD1   . ILE A 1 109 ? -3.428  73.464  195.876 1.00 34.83  ?  107  ILE A CD1   1 
ATOM   822  N  N     . ASP A 1 110 ? -5.955  78.460  196.381 1.00 44.77  ?  108  ASP A N     1 
ATOM   823  C  CA    . ASP A 1 110 ? -5.941  79.881  196.721 1.00 45.97  ?  108  ASP A CA    1 
ATOM   824  C  C     . ASP A 1 110 ? -7.213  80.283  197.458 1.00 45.64  ?  108  ASP A C     1 
ATOM   825  O  O     . ASP A 1 110 ? -7.166  81.022  198.449 1.00 41.38  ?  108  ASP A O     1 
ATOM   826  C  CB    . ASP A 1 110 ? -5.779  80.719  195.454 1.00 60.17  ?  108  ASP A CB    1 
ATOM   827  C  CG    . ASP A 1 110 ? -4.353  80.733  194.937 1.00 83.28  ?  108  ASP A CG    1 
ATOM   828  O  OD1   . ASP A 1 110 ? -4.169  80.587  193.710 1.00 84.00  ?  108  ASP A OD1   1 
ATOM   829  O  OD2   . ASP A 1 110 ? -3.416  80.908  195.747 1.00 95.02  ?  108  ASP A OD2   1 
ATOM   830  N  N     . GLU A 1 111 ? -8.356  79.775  196.996 1.00 48.30  ?  109  GLU A N     1 
ATOM   831  C  CA    . GLU A 1 111 ? -9.644  80.096  197.593 1.00 41.23  ?  109  GLU A CA    1 
ATOM   832  C  C     . GLU A 1 111 ? -9.760  79.549  199.007 1.00 40.83  ?  109  GLU A C     1 
ATOM   833  O  O     . GLU A 1 111 ? -10.209 80.256  199.919 1.00 48.67  ?  109  GLU A O     1 
ATOM   834  C  CB    . GLU A 1 111 ? -10.765 79.527  196.726 1.00 44.76  ?  109  GLU A CB    1 
ATOM   835  C  CG    . GLU A 1 111 ? -11.281 80.469  195.660 1.00 70.70  ?  109  GLU A CG    1 
ATOM   836  C  CD    . GLU A 1 111 ? -11.970 81.676  196.252 1.00 93.14  ?  109  GLU A CD    1 
ATOM   837  O  OE1   . GLU A 1 111 ? -11.375 82.772  196.219 1.00 108.27 ?  109  GLU A OE1   1 
ATOM   838  O  OE2   . GLU A 1 111 ? -13.100 81.527  196.764 1.00 96.31  -1 109  GLU A OE2   1 
ATOM   839  N  N     . HIS A 1 112 ? -9.354  78.298  199.213 1.00 33.05  ?  110  HIS A N     1 
ATOM   840  C  CA    . HIS A 1 112 ? -9.789  77.546  200.379 1.00 39.12  ?  110  HIS A CA    1 
ATOM   841  C  C     . HIS A 1 112 ? -8.666  77.017  201.254 1.00 45.41  ?  110  HIS A C     1 
ATOM   842  O  O     . HIS A 1 112 ? -8.949  76.571  202.373 1.00 59.97  ?  110  HIS A O     1 
ATOM   843  C  CB    . HIS A 1 112 ? -10.684 76.378  199.937 1.00 48.32  ?  110  HIS A CB    1 
ATOM   844  C  CG    . HIS A 1 112 ? -11.960 76.824  199.293 1.00 53.02  ?  110  HIS A CG    1 
ATOM   845  N  ND1   . HIS A 1 112 ? -12.263 76.556  197.975 1.00 49.60  ?  110  HIS A ND1   1 
ATOM   846  C  CD2   . HIS A 1 112 ? -13.003 77.537  199.781 1.00 42.45  ?  110  HIS A CD2   1 
ATOM   847  C  CE1   . HIS A 1 112 ? -13.439 77.083  197.679 1.00 38.83  ?  110  HIS A CE1   1 
ATOM   848  N  NE2   . HIS A 1 112 ? -13.911 77.679  198.759 1.00 44.63  ?  110  HIS A NE2   1 
ATOM   849  N  N     . ALA A 1 113 ? -7.418  77.054  200.804 1.00 44.28  ?  111  ALA A N     1 
ATOM   850  C  CA    . ALA A 1 113 ? -6.311  76.649  201.653 1.00 40.71  ?  111  ALA A CA    1 
ATOM   851  C  C     . ALA A 1 113 ? -5.831  77.824  202.496 1.00 50.74  ?  111  ALA A C     1 
ATOM   852  O  O     . ALA A 1 113 ? -6.237  78.973  202.305 1.00 51.01  ?  111  ALA A O     1 
ATOM   853  C  CB    . ALA A 1 113 ? -5.157  76.098  200.815 1.00 40.63  ?  111  ALA A CB    1 
ATOM   854  N  N     . ASN A 1 114 ? -4.967  77.518  203.460 1.00 57.26  ?  112  ASN A N     1 
ATOM   855  C  CA    . ASN A 1 114 ? -4.162  78.564  204.065 1.00 55.38  ?  112  ASN A CA    1 
ATOM   856  C  C     . ASN A 1 114 ? -3.250  79.169  203.009 1.00 57.33  ?  112  ASN A C     1 
ATOM   857  O  O     . ASN A 1 114 ? -2.795  78.485  202.087 1.00 71.23  ?  112  ASN A O     1 
ATOM   858  C  CB    . ASN A 1 114 ? -3.317  78.016  205.215 1.00 61.89  ?  112  ASN A CB    1 
ATOM   859  C  CG    . ASN A 1 114 ? -4.149  77.504  206.369 1.00 52.74  ?  112  ASN A CG    1 
ATOM   860  O  OD1   . ASN A 1 114 ? -3.993  76.360  206.798 1.00 58.68  ?  112  ASN A OD1   1 
ATOM   861  N  ND2   . ASN A 1 114 ? -5.033  78.353  206.888 1.00 47.99  ?  112  ASN A ND2   1 
ATOM   862  N  N     . GLU A 1 115 ? -2.997  80.471  203.132 1.00 54.82  ?  113  GLU A N     1 
ATOM   863  C  CA    . GLU A 1 115 ? -1.974  81.090  202.299 1.00 56.57  ?  113  GLU A CA    1 
ATOM   864  C  C     . GLU A 1 115 ? -0.637  80.389  202.490 1.00 58.50  ?  113  GLU A C     1 
ATOM   865  O  O     . GLU A 1 115 ? 0.144   80.236  201.544 1.00 71.84  ?  113  GLU A O     1 
ATOM   866  C  CB    . GLU A 1 115 ? -1.856  82.572  202.649 1.00 61.21  ?  113  GLU A CB    1 
ATOM   867  C  CG    . GLU A 1 115 ? -1.930  82.806  204.146 1.00 72.03  ?  113  GLU A CG    1 
ATOM   868  C  CD    . GLU A 1 115 ? -1.268  84.090  204.577 1.00 77.65  ?  113  GLU A CD    1 
ATOM   869  O  OE1   . GLU A 1 115 ? -0.773  84.142  205.721 1.00 76.91  ?  113  GLU A OE1   1 
ATOM   870  O  OE2   . GLU A 1 115 ? -1.239  85.045  203.777 1.00 92.57  ?  113  GLU A OE2   1 
ATOM   871  N  N     . ASP A 1 116 ? -0.392  79.905  203.707 1.00 58.77  ?  114  ASP A N     1 
ATOM   872  C  CA    . ASP A 1 116 ? 0.921   79.409  204.100 1.00 61.75  ?  114  ASP A CA    1 
ATOM   873  C  C     . ASP A 1 116 ? 1.328   78.148  203.343 1.00 54.31  ?  114  ASP A C     1 
ATOM   874  O  O     . ASP A 1 116 ? 2.526   77.872  203.209 1.00 65.88  ?  114  ASP A O     1 
ATOM   875  C  CB    . ASP A 1 116 ? 0.908   79.129  205.603 1.00 53.56  ?  114  ASP A CB    1 
ATOM   876  C  CG    . ASP A 1 116 ? 2.223   79.435  206.262 1.00 85.82  ?  114  ASP A CG    1 
ATOM   877  O  OD1   . ASP A 1 116 ? 2.961   80.303  205.754 1.00 105.88 ?  114  ASP A OD1   1 
ATOM   878  O  OD2   . ASP A 1 116 ? 2.525   78.798  207.290 1.00 96.03  ?  114  ASP A OD2   1 
ATOM   879  N  N     . VAL A 1 117 ? 0.356   77.390  202.822 1.00 30.86  ?  115  VAL A N     1 
ATOM   880  C  CA    . VAL A 1 117 ? 0.559   75.965  202.563 1.00 39.59  ?  115  VAL A CA    1 
ATOM   881  C  C     . VAL A 1 117 ? 1.609   75.722  201.476 1.00 50.25  ?  115  VAL A C     1 
ATOM   882  O  O     . VAL A 1 117 ? 1.878   76.572  200.615 1.00 50.32  ?  115  VAL A O     1 
ATOM   883  C  CB    . VAL A 1 117 ? -0.779  75.305  202.186 1.00 40.11  ?  115  VAL A CB    1 
ATOM   884  C  CG1   . VAL A 1 117 ? -1.283  75.841  200.861 1.00 31.69  ?  115  VAL A CG1   1 
ATOM   885  C  CG2   . VAL A 1 117 ? -0.668  73.772  202.156 1.00 27.15  ?  115  VAL A CG2   1 
ATOM   886  N  N     . GLU A 1 118 ? 2.222   74.540  201.541 1.00 40.41  ?  116  GLU A N     1 
ATOM   887  C  CA    . GLU A 1 118 ? 3.095   74.038  200.492 1.00 41.88  ?  116  GLU A CA    1 
ATOM   888  C  C     . GLU A 1 118 ? 2.282   73.273  199.455 1.00 65.96  ?  116  GLU A C     1 
ATOM   889  O  O     . GLU A 1 118 ? 1.380   72.499  199.794 1.00 74.24  ?  116  GLU A O     1 
ATOM   890  C  CB    . GLU A 1 118 ? 4.176   73.126  201.074 1.00 29.08  ?  116  GLU A CB    1 
ATOM   891  C  CG    . GLU A 1 118 ? 5.210   73.838  201.922 1.00 39.48  ?  116  GLU A CG    1 
ATOM   892  C  CD    . GLU A 1 118 ? 6.098   74.772  201.120 1.00 67.51  ?  116  GLU A CD    1 
ATOM   893  O  OE1   . GLU A 1 118 ? 6.840   74.281  200.239 1.00 59.18  ?  116  GLU A OE1   1 
ATOM   894  O  OE2   . GLU A 1 118 ? 6.050   75.997  201.369 1.00 64.48  -1 116  GLU A OE2   1 
ATOM   895  N  N     . ARG A 1 119 ? 2.607   73.498  198.187 1.00 64.36  ?  117  ARG A N     1 
ATOM   896  C  CA    . ARG A 1 119 ? 1.994   72.786  197.078 1.00 47.02  ?  117  ARG A CA    1 
ATOM   897  C  C     . ARG A 1 119 ? 3.079   72.020  196.342 1.00 39.25  ?  117  ARG A C     1 
ATOM   898  O  O     . ARG A 1 119 ? 4.139   72.577  196.045 1.00 49.12  ?  117  ARG A O     1 
ATOM   899  C  CB    . ARG A 1 119 ? 1.289   73.748  196.126 1.00 54.42  ?  117  ARG A CB    1 
ATOM   900  C  CG    . ARG A 1 119 ? 0.487   74.829  196.817 1.00 54.08  ?  117  ARG A CG    1 
ATOM   901  C  CD    . ARG A 1 119 ? 0.522   76.105  196.003 1.00 62.76  ?  117  ARG A CD    1 
ATOM   902  N  NE    . ARG A 1 119 ? 0.032   77.248  196.765 1.00 94.46  ?  117  ARG A NE    1 
ATOM   903  C  CZ    . ARG A 1 119 ? -1.005  77.997  196.404 1.00 107.73 ?  117  ARG A CZ    1 
ATOM   904  N  NH1   . ARG A 1 119 ? -1.667  77.730  195.285 1.00 104.93 ?  117  ARG A NH1   1 
ATOM   905  N  NH2   . ARG A 1 119 ? -1.381  79.017  197.163 1.00 109.00 ?  117  ARG A NH2   1 
ATOM   906  N  N     . MET A 1 120 ? 2.823   70.748  196.069 1.00 44.10  ?  118  MET A N     1 
ATOM   907  C  CA    . MET A 1 120 ? 3.715   69.911  195.283 1.00 41.31  ?  118  MET A CA    1 
ATOM   908  C  C     . MET A 1 120 ? 2.932   69.303  194.129 1.00 43.06  ?  118  MET A C     1 
ATOM   909  O  O     . MET A 1 120 ? 1.804   68.827  194.312 1.00 57.91  ?  118  MET A O     1 
ATOM   910  C  CB    . MET A 1 120 ? 4.340   68.815  196.145 1.00 51.73  ?  118  MET A CB    1 
ATOM   911  C  CG    . MET A 1 120 ? 5.262   67.882  195.388 1.00 56.09  ?  118  MET A CG    1 
ATOM   912  S  SD    . MET A 1 120 ? 6.089   66.738  196.508 1.00 58.38  ?  118  MET A SD    1 
ATOM   913  C  CE    . MET A 1 120 ? 7.323   67.827  197.206 1.00 46.85  ?  118  MET A CE    1 
ATOM   914  N  N     . LEU A 1 121 ? 3.522   69.335  192.939 1.00 45.89  ?  119  LEU A N     1 
ATOM   915  C  CA    . LEU A 1 121 ? 2.853   68.887  191.724 1.00 41.70  ?  119  LEU A CA    1 
ATOM   916  C  C     . LEU A 1 121 ? 3.339   67.494  191.342 1.00 33.68  ?  119  LEU A C     1 
ATOM   917  O  O     . LEU A 1 121 ? 4.548   67.246  191.282 1.00 35.01  ?  119  LEU A O     1 
ATOM   918  C  CB    . LEU A 1 121 ? 3.101   69.870  190.581 1.00 40.09  ?  119  LEU A CB    1 
ATOM   919  C  CG    . LEU A 1 121 ? 2.515   69.532  189.211 1.00 49.30  ?  119  LEU A CG    1 
ATOM   920  C  CD1   . LEU A 1 121 ? 1.018   69.805  189.148 1.00 48.52  ?  119  LEU A CD1   1 
ATOM   921  C  CD2   . LEU A 1 121 ? 3.250   70.321  188.157 1.00 43.99  ?  119  LEU A CD2   1 
ATOM   922  N  N     . LEU A 1 122 ? 2.394   66.596  191.074 1.00 32.28  ?  120  LEU A N     1 
ATOM   923  C  CA    . LEU A 1 122 ? 2.684   65.205  190.747 1.00 36.71  ?  120  LEU A CA    1 
ATOM   924  C  C     . LEU A 1 122 ? 2.059   64.851  189.404 1.00 51.98  ?  120  LEU A C     1 
ATOM   925  O  O     . LEU A 1 122 ? 0.841   64.974  189.228 1.00 61.73  ?  120  LEU A O     1 
ATOM   926  C  CB    . LEU A 1 122 ? 2.160   64.266  191.835 1.00 38.56  ?  120  LEU A CB    1 
ATOM   927  C  CG    . LEU A 1 122 ? 2.690   64.457  193.254 1.00 45.14  ?  120  LEU A CG    1 
ATOM   928  C  CD1   . LEU A 1 122 ? 2.327   63.255  194.114 1.00 35.57  ?  120  LEU A CD1   1 
ATOM   929  C  CD2   . LEU A 1 122 ? 4.194   64.691  193.253 1.00 36.75  ?  120  LEU A CD2   1 
ATOM   930  N  N     . GLY A 1 123 ? 2.898   64.422  188.462 1.00 63.08  ?  121  GLY A N     1 
ATOM   931  C  CA    . GLY A 1 123 ? 2.453   63.808  187.227 1.00 40.29  ?  121  GLY A CA    1 
ATOM   932  C  C     . GLY A 1 123 ? 2.505   62.301  187.352 1.00 49.02  ?  121  GLY A C     1 
ATOM   933  O  O     . GLY A 1 123 ? 3.576   61.699  187.237 1.00 54.86  ?  121  GLY A O     1 
ATOM   934  N  N     . ASN A 1 124 ? 1.354   61.684  187.601 1.00 54.71  ?  122  ASN A N     1 
ATOM   935  C  CA    . ASN A 1 124 ? 1.291   60.261  187.892 1.00 62.17  ?  122  ASN A CA    1 
ATOM   936  C  C     . ASN A 1 124 ? 1.282   59.437  186.603 1.00 65.85  ?  122  ASN A C     1 
ATOM   937  O  O     . ASN A 1 124 ? 0.993   59.939  185.513 1.00 63.30  ?  122  ASN A O     1 
ATOM   938  C  CB    . ASN A 1 124 ? 0.049   59.951  188.729 1.00 53.00  ?  122  ASN A CB    1 
ATOM   939  C  CG    . ASN A 1 124 ? 0.125   58.600  189.411 1.00 55.70  ?  122  ASN A CG    1 
ATOM   940  O  OD1   . ASN A 1 124 ? 1.211   58.109  189.725 1.00 61.23  ?  122  ASN A OD1   1 
ATOM   941  N  ND2   . ASN A 1 124 ? -1.032  57.986  189.638 1.00 57.92  ?  122  ASN A ND2   1 
ATOM   942  N  N     . LYS A 1 125 ? 1.607   58.148  186.752 1.00 68.02  ?  123  LYS A N     1 
ATOM   943  C  CA    . LYS A 1 125 ? 1.611   57.171  185.656 1.00 71.19  ?  123  LYS A CA    1 
ATOM   944  C  C     . LYS A 1 125 ? 2.751   57.427  184.668 1.00 72.04  ?  123  LYS A C     1 
ATOM   945  O  O     . LYS A 1 125 ? 2.557   57.375  183.454 1.00 64.93  ?  123  LYS A O     1 
ATOM   946  C  CB    . LYS A 1 125 ? 0.264   57.127  184.924 1.00 64.83  ?  123  LYS A CB    1 
ATOM   947  C  CG    . LYS A 1 125 ? -0.940  57.012  185.841 1.00 65.12  ?  123  LYS A CG    1 
ATOM   948  C  CD    . LYS A 1 125 ? -2.241  56.941  185.062 1.00 63.75  ?  123  LYS A CD    1 
ATOM   949  C  CE    . LYS A 1 125 ? -3.404  56.584  185.974 1.00 58.90  ?  123  LYS A CE    1 
ATOM   950  N  NZ    . LYS A 1 125 ? -4.712  56.940  185.370 1.00 56.91  ?  123  LYS A NZ    1 
ATOM   951  N  N     . CYS A 1 126 ? 3.954   57.687  185.187 1.00 83.91  ?  124  CYS A N     1 
ATOM   952  C  CA    . CYS A 1 126 ? 5.109   57.894  184.320 1.00 89.56  ?  124  CYS A CA    1 
ATOM   953  C  C     . CYS A 1 126 ? 5.659   56.591  183.757 1.00 91.03  ?  124  CYS A C     1 
ATOM   954  O  O     . CYS A 1 126 ? 6.564   56.630  182.917 1.00 97.78  ?  124  CYS A O     1 
ATOM   955  C  CB    . CYS A 1 126 ? 6.216   58.636  185.074 1.00 79.67  ?  124  CYS A CB    1 
ATOM   956  S  SG    . CYS A 1 126 ? 6.738   57.845  186.612 1.00 78.77  ?  124  CYS A SG    1 
ATOM   957  N  N     . ASP A 1 127 ? 5.138   55.447  184.206 1.00 91.83  ?  125  ASP A N     1 
ATOM   958  C  CA    . ASP A 1 127 ? 5.578   54.162  183.676 1.00 98.00  ?  125  ASP A CA    1 
ATOM   959  C  C     . ASP A 1 127 ? 5.183   54.003  182.214 1.00 106.74 ?  125  ASP A C     1 
ATOM   960  O  O     . ASP A 1 127 ? 5.933   53.427  181.417 1.00 121.39 ?  125  ASP A O     1 
ATOM   961  C  CB    . ASP A 1 127 ? 4.980   53.032  184.510 1.00 101.50 ?  125  ASP A CB    1 
ATOM   962  C  CG    . ASP A 1 127 ? 3.473   53.152  184.648 1.00 101.06 ?  125  ASP A CG    1 
ATOM   963  O  OD1   . ASP A 1 127 ? 2.975   54.294  184.735 1.00 100.98 ?  125  ASP A OD1   1 
ATOM   964  O  OD2   . ASP A 1 127 ? 2.785   52.110  184.652 1.00 104.46 -1 125  ASP A OD2   1 
ATOM   965  N  N     . MET A 1 128 ? 4.007   54.514  181.844 1.00 98.36  ?  126  MET A N     1 
ATOM   966  C  CA    . MET A 1 128 ? 3.447   54.318  180.506 1.00 102.90 ?  126  MET A CA    1 
ATOM   967  C  C     . MET A 1 128 ? 3.877   55.481  179.616 1.00 98.50  ?  126  MET A C     1 
ATOM   968  O  O     . MET A 1 128 ? 3.138   56.443  179.392 1.00 89.18  ?  126  MET A O     1 
ATOM   969  C  CB    . MET A 1 128 ? 1.930   54.207  180.575 1.00 91.02  ?  126  MET A CB    1 
ATOM   970  C  CG    . MET A 1 128 ? 1.410   53.648  181.884 1.00 89.58  ?  126  MET A CG    1 
ATOM   971  S  SD    . MET A 1 128 ? -0.192  52.859  181.677 1.00 92.15  ?  126  MET A SD    1 
ATOM   972  C  CE    . MET A 1 128 ? 0.311   51.320  180.920 1.00 94.96  ?  126  MET A CE    1 
ATOM   973  N  N     . ASP A 1 129 ? 5.104   55.376  179.094 1.00 105.20 ?  127  ASP A N     1 
ATOM   974  C  CA    . ASP A 1 129 ? 5.626   56.418  178.216 1.00 109.51 ?  127  ASP A CA    1 
ATOM   975  C  C     . ASP A 1 129 ? 4.944   56.409  176.853 1.00 112.84 ?  127  ASP A C     1 
ATOM   976  O  O     . ASP A 1 129 ? 4.929   57.435  176.163 1.00 109.00 ?  127  ASP A O     1 
ATOM   977  C  CB    . ASP A 1 129 ? 7.140   56.265  178.051 1.00 103.87 ?  127  ASP A CB    1 
ATOM   978  C  CG    . ASP A 1 129 ? 7.846   55.945  179.357 1.00 113.37 ?  127  ASP A CG    1 
ATOM   979  O  OD1   . ASP A 1 129 ? 7.803   54.773  179.793 1.00 110.73 ?  127  ASP A OD1   1 
ATOM   980  O  OD2   . ASP A 1 129 ? 8.435   56.876  179.952 1.00 123.02 -1 127  ASP A OD2   1 
ATOM   981  N  N     . ASP A 1 130 ? 4.391   55.265  176.441 1.00 123.08 ?  128  ASP A N     1 
ATOM   982  C  CA    . ASP A 1 130 ? 3.771   55.192  175.122 1.00 120.16 ?  128  ASP A CA    1 
ATOM   983  C  C     . ASP A 1 130 ? 2.540   56.087  175.016 1.00 115.93 ?  128  ASP A C     1 
ATOM   984  O  O     . ASP A 1 130 ? 2.282   56.648  173.946 1.00 125.58 ?  128  ASP A O     1 
ATOM   985  C  CB    . ASP A 1 130 ? 3.415   53.743  174.769 1.00 120.75 ?  128  ASP A CB    1 
ATOM   986  C  CG    . ASP A 1 130 ? 2.571   53.062  175.834 1.00 123.12 ?  128  ASP A CG    1 
ATOM   987  O  OD1   . ASP A 1 130 ? 1.958   53.764  176.663 1.00 126.51 ?  128  ASP A OD1   1 
ATOM   988  O  OD2   . ASP A 1 130 ? 2.505   51.814  175.832 1.00 122.85 -1 128  ASP A OD2   1 
ATOM   989  N  N     . LYS A 1 131 ? 1.774   56.241  176.098 1.00 101.32 ?  129  LYS A N     1 
ATOM   990  C  CA    . LYS A 1 131 ? 0.573   57.069  176.073 1.00 88.52  ?  129  LYS A CA    1 
ATOM   991  C  C     . LYS A 1 131 ? 0.802   58.488  176.579 1.00 71.88  ?  129  LYS A C     1 
ATOM   992  O  O     . LYS A 1 131 ? -0.170  59.241  176.704 1.00 48.78  ?  129  LYS A O     1 
ATOM   993  C  CB    . LYS A 1 131 ? -0.554  56.425  176.892 1.00 95.78  ?  129  LYS A CB    1 
ATOM   994  C  CG    . LYS A 1 131 ? -0.846  54.972  176.563 1.00 111.14 ?  129  LYS A CG    1 
ATOM   995  C  CD    . LYS A 1 131 ? -1.195  54.764  175.098 1.00 117.03 ?  129  LYS A CD    1 
ATOM   996  C  CE    . LYS A 1 131 ? -2.057  53.520  174.929 1.00 118.86 ?  129  LYS A CE    1 
ATOM   997  N  NZ    . LYS A 1 131 ? -1.390  52.309  175.511 1.00 125.46 ?  129  LYS A NZ    1 
ATOM   998  N  N     . ARG A 1 132 ? 2.046   58.868  176.875 1.00 84.35  ?  130  ARG A N     1 
ATOM   999  C  CA    . ARG A 1 132 ? 2.339   60.219  177.342 1.00 85.02  ?  130  ARG A CA    1 
ATOM   1000 C  C     . ARG A 1 132 ? 1.715   61.257  176.422 1.00 71.81  ?  130  ARG A C     1 
ATOM   1001 O  O     . ARG A 1 132 ? 1.987   61.280  175.219 1.00 91.28  ?  130  ARG A O     1 
ATOM   1002 C  CB    . ARG A 1 132 ? 3.852   60.441  177.427 1.00 94.49  ?  130  ARG A CB    1 
ATOM   1003 C  CG    . ARG A 1 132 ? 4.244   61.918  177.375 1.00 91.93  ?  130  ARG A CG    1 
ATOM   1004 C  CD    . ARG A 1 132 ? 5.747   62.131  177.493 1.00 89.40  ?  130  ARG A CD    1 
ATOM   1005 N  NE    . ARG A 1 132 ? 6.299   61.571  178.722 1.00 101.05 ?  130  ARG A NE    1 
ATOM   1006 C  CZ    . ARG A 1 132 ? 6.208   62.151  179.915 1.00 95.09  ?  130  ARG A CZ    1 
ATOM   1007 N  NH1   . ARG A 1 132 ? 5.584   63.310  180.045 1.00 97.96  ?  130  ARG A NH1   1 
ATOM   1008 N  NH2   . ARG A 1 132 ? 6.741   61.572  180.981 1.00 90.23  ?  130  ARG A NH2   1 
ATOM   1009 N  N     . VAL A 1 133 ? 0.851   62.092  176.992 1.00 56.01  ?  131  VAL A N     1 
ATOM   1010 C  CA    . VAL A 1 133 ? 0.299   63.241  176.278 1.00 58.03  ?  131  VAL A CA    1 
ATOM   1011 C  C     . VAL A 1 133 ? 0.938   64.526  176.760 1.00 62.49  ?  131  VAL A C     1 
ATOM   1012 O  O     . VAL A 1 133 ? 0.984   65.518  175.994 1.00 63.38  ?  131  VAL A O     1 
ATOM   1013 C  CB    . VAL A 1 133 ? -1.238  63.284  176.439 1.00 50.80  ?  131  VAL A CB    1 
ATOM   1014 C  CG1   . VAL A 1 133 ? -1.821  64.609  175.956 1.00 50.48  ?  131  VAL A CG1   1 
ATOM   1015 C  CG2   . VAL A 1 133 ? -1.866  62.125  175.695 1.00 53.30  ?  131  VAL A CG2   1 
ATOM   1016 N  N     . VAL A 1 134 ? 1.478   64.564  177.969 1.00 60.55  ?  132  VAL A N     1 
ATOM   1017 C  CA    . VAL A 1 134 ? 2.092   65.730  178.566 1.00 64.02  ?  132  VAL A CA    1 
ATOM   1018 C  C     . VAL A 1 134 ? 3.580   65.464  178.709 1.00 69.91  ?  132  VAL A C     1 
ATOM   1019 O  O     . VAL A 1 134 ? 3.964   64.490  179.366 1.00 86.74  ?  132  VAL A O     1 
ATOM   1020 C  CB    . VAL A 1 134 ? 1.459   66.048  179.932 1.00 66.44  ?  132  VAL A CB    1 
ATOM   1021 C  CG1   . VAL A 1 134 ? 1.840   67.450  180.391 1.00 52.80  ?  132  VAL A CG1   1 
ATOM   1022 C  CG2   . VAL A 1 134 ? -0.050  65.888  179.855 1.00 74.43  ?  132  VAL A CG2   1 
ATOM   1023 N  N     . PRO A 1 135 ? 4.455   66.254  178.085 1.00 56.57  ?  133  PRO A N     1 
ATOM   1024 C  CA    . PRO A 1 135 ? 5.890   66.133  178.367 1.00 73.32  ?  133  PRO A CA    1 
ATOM   1025 C  C     . PRO A 1 135 ? 6.215   66.453  179.817 1.00 84.52  ?  133  PRO A C     1 
ATOM   1026 O  O     . PRO A 1 135 ? 5.604   67.325  180.442 1.00 93.83  ?  133  PRO A O     1 
ATOM   1027 C  CB    . PRO A 1 135 ? 6.530   67.151  177.413 1.00 77.00  ?  133  PRO A CB    1 
ATOM   1028 C  CG    . PRO A 1 135 ? 5.538   67.380  176.348 1.00 78.92  ?  133  PRO A CG    1 
ATOM   1029 C  CD    . PRO A 1 135 ? 4.181   66.989  176.848 1.00 68.14  ?  133  PRO A CD    1 
ATOM   1030 N  N     . LYS A 1 136 ? 7.201   65.725  180.348 1.00 79.42  ?  134  LYS A N     1 
ATOM   1031 C  CA    . LYS A 1 136 ? 7.716   65.992  181.686 1.00 71.51  ?  134  LYS A CA    1 
ATOM   1032 C  C     . LYS A 1 136 ? 8.135   67.451  181.835 1.00 76.94  ?  134  LYS A C     1 
ATOM   1033 O  O     . LYS A 1 136 ? 7.945   68.061  182.897 1.00 84.68  ?  134  LYS A O     1 
ATOM   1034 C  CB    . LYS A 1 136 ? 8.892   65.056  181.951 1.00 63.69  ?  134  LYS A CB    1 
ATOM   1035 C  CG    . LYS A 1 136 ? 9.432   65.076  183.350 1.00 71.51  ?  134  LYS A CG    1 
ATOM   1036 C  CD    . LYS A 1 136 ? 10.535  64.044  183.471 1.00 82.23  ?  134  LYS A CD    1 
ATOM   1037 C  CE    . LYS A 1 136 ? 11.375  64.283  184.705 1.00 75.79  ?  134  LYS A CE    1 
ATOM   1038 N  NZ    . LYS A 1 136 ? 12.726  63.679  184.554 1.00 75.95  ?  134  LYS A NZ    1 
ATOM   1039 N  N     . GLY A 1 137 ? 8.688   68.033  180.768 1.00 65.15  ?  135  GLY A N     1 
ATOM   1040 C  CA    . GLY A 1 137 ? 9.172   69.401  180.813 1.00 58.20  ?  135  GLY A CA    1 
ATOM   1041 C  C     . GLY A 1 137 ? 8.087   70.454  180.904 1.00 63.75  ?  135  GLY A C     1 
ATOM   1042 O  O     . GLY A 1 137 ? 8.378   71.590  181.294 1.00 63.81  ?  135  GLY A O     1 
ATOM   1043 N  N     . LYS A 1 138 ? 6.848   70.120  180.534 1.00 70.57  ?  136  LYS A N     1 
ATOM   1044 C  CA    . LYS A 1 138 ? 5.765   71.082  180.721 1.00 87.76  ?  136  LYS A CA    1 
ATOM   1045 C  C     . LYS A 1 138 ? 5.301   71.125  182.174 1.00 88.62  ?  136  LYS A C     1 
ATOM   1046 O  O     . LYS A 1 138 ? 5.018   72.208  182.710 1.00 101.28 ?  136  LYS A O     1 
ATOM   1047 C  CB    . LYS A 1 138 ? 4.598   70.778  179.774 1.00 93.88  ?  136  LYS A CB    1 
ATOM   1048 C  CG    . LYS A 1 138 ? 4.877   71.073  178.299 1.00 96.78  ?  136  LYS A CG    1 
ATOM   1049 C  CD    . LYS A 1 138 ? 3.570   71.312  177.517 1.00 109.67 ?  136  LYS A CD    1 
ATOM   1050 C  CE    . LYS A 1 138 ? 3.216   70.166  176.571 1.00 114.01 ?  136  LYS A CE    1 
ATOM   1051 N  NZ    . LYS A 1 138 ? 1.776   70.153  176.168 1.00 113.71 ?  136  LYS A NZ    1 
ATOM   1052 N  N     . GLY A 1 139 ? 5.233   69.964  182.829 1.00 69.05  ?  137  GLY A N     1 
ATOM   1053 C  CA    . GLY A 1 139 ? 5.001   69.956  184.264 1.00 58.86  ?  137  GLY A CA    1 
ATOM   1054 C  C     . GLY A 1 139 ? 6.107   70.668  185.017 1.00 62.30  ?  137  GLY A C     1 
ATOM   1055 O  O     . GLY A 1 139 ? 5.849   71.504  185.892 1.00 56.65  ?  137  GLY A O     1 
ATOM   1056 N  N     . GLU A 1 140 ? 7.361   70.351  184.678 1.00 54.63  ?  138  GLU A N     1 
ATOM   1057 C  CA    . GLU A 1 140 ? 8.481   71.135  185.187 1.00 50.04  ?  138  GLU A CA    1 
ATOM   1058 C  C     . GLU A 1 140 ? 8.252   72.620  184.966 1.00 55.16  ?  138  GLU A C     1 
ATOM   1059 O  O     . GLU A 1 140 ? 8.461   73.433  185.872 1.00 63.03  ?  138  GLU A O     1 
ATOM   1060 C  CB    . GLU A 1 140 ? 9.782   70.714  184.510 1.00 52.36  ?  138  GLU A CB    1 
ATOM   1061 C  CG    . GLU A 1 140 ? 10.264  69.335  184.861 1.00 64.29  ?  138  GLU A CG    1 
ATOM   1062 C  CD    . GLU A 1 140 ? 11.612  69.034  184.248 1.00 72.99  ?  138  GLU A CD    1 
ATOM   1063 O  OE1   . GLU A 1 140 ? 12.308  69.989  183.832 1.00 78.31  ?  138  GLU A OE1   1 
ATOM   1064 O  OE2   . GLU A 1 140 ? 11.980  67.843  184.192 1.00 68.86  -1 138  GLU A OE2   1 
ATOM   1065 N  N     . GLN A 1 141 ? 7.829   72.996  183.755 1.00 62.62  ?  139  GLN A N     1 
ATOM   1066 C  CA    . GLN A 1 141 ? 7.676   74.410  183.440 1.00 60.56  ?  139  GLN A CA    1 
ATOM   1067 C  C     . GLN A 1 141 ? 6.713   75.074  184.418 1.00 50.05  ?  139  GLN A C     1 
ATOM   1068 O  O     . GLN A 1 141 ? 7.077   76.034  185.101 1.00 50.38  ?  139  GLN A O     1 
ATOM   1069 C  CB    . GLN A 1 141 ? 7.203   74.600  181.995 1.00 62.68  ?  139  GLN A CB    1 
ATOM   1070 C  CG    . GLN A 1 141 ? 7.363   76.039  181.510 1.00 62.65  ?  139  GLN A CG    1 
ATOM   1071 C  CD    . GLN A 1 141 ? 6.643   76.333  180.202 1.00 84.49  ?  139  GLN A CD    1 
ATOM   1072 O  OE1   . GLN A 1 141 ? 5.964   75.475  179.636 1.00 94.56  ?  139  GLN A OE1   1 
ATOM   1073 N  NE2   . GLN A 1 141 ? 6.777   77.566  179.726 1.00 92.54  ?  139  GLN A NE2   1 
ATOM   1074 N  N     . ILE A 1 142 ? 5.499   74.530  184.542 1.00 55.16  ?  140  ILE A N     1 
ATOM   1075 C  CA    . ILE A 1 142 ? 4.500   75.185  185.392 1.00 57.18  ?  140  ILE A CA    1 
ATOM   1076 C  C     . ILE A 1 142 ? 4.965   75.205  186.836 1.00 56.58  ?  140  ILE A C     1 
ATOM   1077 O  O     . ILE A 1 142 ? 4.773   76.197  187.558 1.00 66.90  ?  140  ILE A O     1 
ATOM   1078 C  CB    . ILE A 1 142 ? 3.125   74.508  185.233 1.00 57.68  ?  140  ILE A CB    1 
ATOM   1079 C  CG1   . ILE A 1 142 ? 2.072   75.318  185.983 1.00 83.82  ?  140  ILE A CG1   1 
ATOM   1080 C  CG2   . ILE A 1 142 ? 3.162   73.067  185.739 1.00 62.25  ?  140  ILE A CG2   1 
ATOM   1081 C  CD1   . ILE A 1 142 ? 1.530   76.474  185.144 1.00 84.45  ?  140  ILE A CD1   1 
ATOM   1082 N  N     . ALA A 1 143 ? 5.597   74.114  187.280 1.00 60.37  ?  141  ALA A N     1 
ATOM   1083 C  CA    . ALA A 1 143 ? 6.152   74.055  188.626 1.00 45.51  ?  141  ALA A CA    1 
ATOM   1084 C  C     . ALA A 1 143 ? 7.123   75.207  188.867 1.00 43.86  ?  141  ALA A C     1 
ATOM   1085 O  O     . ALA A 1 143 ? 6.988   75.965  189.834 1.00 46.81  ?  141  ALA A O     1 
ATOM   1086 C  CB    . ALA A 1 143 ? 6.846   72.710  188.843 1.00 35.34  ?  141  ALA A CB    1 
ATOM   1087 N  N     . ARG A 1 144 ? 8.101   75.354  187.972 1.00 47.45  ?  142  ARG A N     1 
ATOM   1088 C  CA    . ARG A 1 144 ? 9.032   76.476  188.035 1.00 56.58  ?  142  ARG A CA    1 
ATOM   1089 C  C     . ARG A 1 144 ? 8.289   77.804  188.100 1.00 52.19  ?  142  ARG A C     1 
ATOM   1090 O  O     . ARG A 1 144 ? 8.604   78.668  188.927 1.00 59.70  ?  142  ARG A O     1 
ATOM   1091 C  CB    . ARG A 1 144 ? 9.962   76.445  186.818 1.00 68.54  ?  142  ARG A CB    1 
ATOM   1092 C  CG    . ARG A 1 144 ? 11.303  77.136  187.022 1.00 79.28  ?  142  ARG A CG    1 
ATOM   1093 C  CD    . ARG A 1 144 ? 11.959  77.477  185.689 1.00 93.96  ?  142  ARG A CD    1 
ATOM   1094 N  NE    . ARG A 1 144 ? 11.786  76.413  184.704 1.00 105.87 ?  142  ARG A NE    1 
ATOM   1095 C  CZ    . ARG A 1 144 ? 11.221  76.576  183.511 1.00 100.47 ?  142  ARG A CZ    1 
ATOM   1096 N  NH1   . ARG A 1 144 ? 10.780  77.771  183.136 1.00 99.63  ?  142  ARG A NH1   1 
ATOM   1097 N  NH2   . ARG A 1 144 ? 11.107  75.543  182.687 1.00 93.14  ?  142  ARG A NH2   1 
ATOM   1098 N  N     . GLU A 1 145 ? 7.277   77.975  187.243 1.00 48.69  ?  143  GLU A N     1 
ATOM   1099 C  CA    . GLU A 1 145 ? 6.563   79.248  187.180 1.00 61.34  ?  143  GLU A CA    1 
ATOM   1100 C  C     . GLU A 1 145 ? 5.793   79.547  188.459 1.00 51.11  ?  143  GLU A C     1 
ATOM   1101 O  O     . GLU A 1 145 ? 5.520   80.717  188.752 1.00 51.72  ?  143  GLU A O     1 
ATOM   1102 C  CB    . GLU A 1 145 ? 5.617   79.276  185.975 1.00 67.67  ?  143  GLU A CB    1 
ATOM   1103 C  CG    . GLU A 1 145 ? 6.250   78.839  184.664 1.00 70.38  ?  143  GLU A CG    1 
ATOM   1104 C  CD    . GLU A 1 145 ? 5.300   78.911  183.478 1.00 90.08  ?  143  GLU A CD    1 
ATOM   1105 O  OE1   . GLU A 1 145 ? 5.754   78.659  182.338 1.00 98.63  ?  143  GLU A OE1   1 
ATOM   1106 O  OE2   . GLU A 1 145 ? 4.112   79.240  183.686 1.00 99.84  -1 143  GLU A OE2   1 
ATOM   1107 N  N     . HIS A 1 146 ? 5.416   78.517  189.218 1.00 54.24  ?  144  HIS A N     1 
ATOM   1108 C  CA    . HIS A 1 146 ? 4.766   78.701  190.510 1.00 58.60  ?  144  HIS A CA    1 
ATOM   1109 C  C     . HIS A 1 146 ? 5.715   78.509  191.683 1.00 55.94  ?  144  HIS A C     1 
ATOM   1110 O  O     . HIS A 1 146 ? 5.285   78.626  192.836 1.00 45.00  ?  144  HIS A O     1 
ATOM   1111 C  CB    . HIS A 1 146 ? 3.570   77.756  190.649 1.00 48.79  ?  144  HIS A CB    1 
ATOM   1112 C  CG    . HIS A 1 146 ? 2.400   78.149  189.806 1.00 49.56  ?  144  HIS A CG    1 
ATOM   1113 N  ND1   . HIS A 1 146 ? 2.174   77.627  188.551 1.00 67.61  ?  144  HIS A ND1   1 
ATOM   1114 C  CD2   . HIS A 1 146 ? 1.402   79.035  190.031 1.00 46.69  ?  144  HIS A CD2   1 
ATOM   1115 C  CE1   . HIS A 1 146 ? 1.078   78.163  188.045 1.00 75.81  ?  144  HIS A CE1   1 
ATOM   1116 N  NE2   . HIS A 1 146 ? 0.590   79.022  188.923 1.00 58.55  ?  144  HIS A NE2   1 
ATOM   1117 N  N     . GLY A 1 147 ? 6.987   78.231  191.417 1.00 53.36  ?  145  GLY A N     1 
ATOM   1118 C  CA    . GLY A 1 147 ? 7.967   78.073  192.478 1.00 54.56  ?  145  GLY A CA    1 
ATOM   1119 C  C     . GLY A 1 147 ? 7.646   76.954  193.443 1.00 55.90  ?  145  GLY A C     1 
ATOM   1120 O  O     . GLY A 1 147 ? 7.727   77.144  194.663 1.00 51.04  ?  145  GLY A O     1 
ATOM   1121 N  N     . ILE A 1 148 ? 7.261   75.790  192.924 1.00 45.93  ?  146  ILE A N     1 
ATOM   1122 C  CA    . ILE A 1 148 ? 6.953   74.631  193.746 1.00 43.50  ?  146  ILE A CA    1 
ATOM   1123 C  C     . ILE A 1 148 ? 7.674   73.424  193.167 1.00 46.76  ?  146  ILE A C     1 
ATOM   1124 O  O     . ILE A 1 148 ? 8.216   73.462  192.062 1.00 56.26  ?  146  ILE A O     1 
ATOM   1125 C  CB    . ILE A 1 148 ? 5.442   74.351  193.836 1.00 49.72  ?  146  ILE A CB    1 
ATOM   1126 C  CG1   . ILE A 1 148 ? 4.906   73.919  192.468 1.00 48.08  ?  146  ILE A CG1   1 
ATOM   1127 C  CG2   . ILE A 1 148 ? 4.699   75.560  194.389 1.00 35.62  ?  146  ILE A CG2   1 
ATOM   1128 C  CD1   . ILE A 1 148 ? 3.440   73.521  192.483 1.00 46.07  ?  146  ILE A CD1   1 
ATOM   1129 N  N     . ARG A 1 149 ? 7.662   72.338  193.933 1.00 56.12  ?  147  ARG A N     1 
ATOM   1130 C  CA    . ARG A 1 149 ? 8.322   71.114  193.515 1.00 48.57  ?  147  ARG A CA    1 
ATOM   1131 C  C     . ARG A 1 149 ? 7.459   70.346  192.523 1.00 42.91  ?  147  ARG A C     1 
ATOM   1132 O  O     . ARG A 1 149 ? 6.225   70.405  192.554 1.00 54.06  ?  147  ARG A O     1 
ATOM   1133 C  CB    . ARG A 1 149 ? 8.634   70.231  194.721 1.00 40.52  ?  147  ARG A CB    1 
ATOM   1134 C  CG    . ARG A 1 149 ? 9.353   70.956  195.839 1.00 46.96  ?  147  ARG A CG    1 
ATOM   1135 C  CD    . ARG A 1 149 ? 10.744  70.390  196.069 1.00 47.73  ?  147  ARG A CD    1 
ATOM   1136 N  NE    . ARG A 1 149 ? 11.327  70.913  197.301 1.00 56.76  ?  147  ARG A NE    1 
ATOM   1137 C  CZ    . ARG A 1 149 ? 12.301  71.816  197.351 1.00 53.58  ?  147  ARG A CZ    1 
ATOM   1138 N  NH1   . ARG A 1 149 ? 12.758  72.231  198.525 1.00 62.35  ?  147  ARG A NH1   1 
ATOM   1139 N  NH2   . ARG A 1 149 ? 12.823  72.301  196.233 1.00 52.12  ?  147  ARG A NH2   1 
ATOM   1140 N  N     . PHE A 1 150 ? 8.130   69.618  191.639 1.00 47.37  ?  148  PHE A N     1 
ATOM   1141 C  CA    . PHE A 1 150 ? 7.479   68.771  190.654 1.00 55.69  ?  148  PHE A CA    1 
ATOM   1142 C  C     . PHE A 1 150 ? 8.069   67.371  190.726 1.00 58.47  ?  148  PHE A C     1 
ATOM   1143 O  O     . PHE A 1 150 ? 9.262   67.196  190.984 1.00 68.43  ?  148  PHE A O     1 
ATOM   1144 C  CB    . PHE A 1 150 ? 7.642   69.333  189.237 1.00 56.97  ?  148  PHE A CB    1 
ATOM   1145 C  CG    . PHE A 1 150 ? 7.172   68.403  188.157 1.00 68.43  ?  148  PHE A CG    1 
ATOM   1146 C  CD1   . PHE A 1 150 ? 5.886   67.889  188.178 1.00 77.78  ?  148  PHE A CD1   1 
ATOM   1147 C  CD2   . PHE A 1 150 ? 8.010   68.056  187.109 1.00 71.59  ?  148  PHE A CD2   1 
ATOM   1148 C  CE1   . PHE A 1 150 ? 5.450   67.032  187.183 1.00 84.31  ?  148  PHE A CE1   1 
ATOM   1149 C  CE2   . PHE A 1 150 ? 7.582   67.204  186.108 1.00 73.64  ?  148  PHE A CE2   1 
ATOM   1150 C  CZ    . PHE A 1 150 ? 6.300   66.691  186.145 1.00 78.94  ?  148  PHE A CZ    1 
ATOM   1151 N  N     . PHE A 1 151 ? 7.220   66.373  190.505 1.00 56.70  ?  149  PHE A N     1 
ATOM   1152 C  CA    . PHE A 1 151 ? 7.676   64.995  190.413 1.00 47.07  ?  149  PHE A CA    1 
ATOM   1153 C  C     . PHE A 1 151 ? 6.837   64.266  189.383 1.00 52.45  ?  149  PHE A C     1 
ATOM   1154 O  O     . PHE A 1 151 ? 5.643   64.536  189.248 1.00 63.11  ?  149  PHE A O     1 
ATOM   1155 C  CB    . PHE A 1 151 ? 7.574   64.265  191.752 1.00 51.38  ?  149  PHE A CB    1 
ATOM   1156 C  CG    . PHE A 1 151 ? 8.723   64.529  192.675 1.00 64.31  ?  149  PHE A CG    1 
ATOM   1157 C  CD1   . PHE A 1 151 ? 10.020  64.229  192.291 1.00 72.76  ?  149  PHE A CD1   1 
ATOM   1158 C  CD2   . PHE A 1 151 ? 8.508   65.072  193.930 1.00 65.81  ?  149  PHE A CD2   1 
ATOM   1159 C  CE1   . PHE A 1 151 ? 11.083  64.470  193.143 1.00 67.80  ?  149  PHE A CE1   1 
ATOM   1160 C  CE2   . PHE A 1 151 ? 9.566   65.315  194.786 1.00 63.48  ?  149  PHE A CE2   1 
ATOM   1161 C  CZ    . PHE A 1 151 ? 10.855  65.014  194.391 1.00 57.65  ?  149  PHE A CZ    1 
ATOM   1162 N  N     . GLU A 1 152 ? 7.471   63.357  188.653 1.00 67.50  ?  150  GLU A N     1 
ATOM   1163 C  CA    . GLU A 1 152 ? 6.767   62.348  187.877 1.00 60.85  ?  150  GLU A CA    1 
ATOM   1164 C  C     . GLU A 1 152 ? 6.779   61.054  188.676 1.00 61.82  ?  150  GLU A C     1 
ATOM   1165 O  O     . GLU A 1 152 ? 7.841   60.599  189.113 1.00 68.53  ?  150  GLU A O     1 
ATOM   1166 C  CB    . GLU A 1 152 ? 7.406   62.139  186.505 1.00 66.81  ?  150  GLU A CB    1 
ATOM   1167 C  CG    . GLU A 1 152 ? 6.765   62.957  185.404 1.00 72.34  ?  150  GLU A CG    1 
ATOM   1168 C  CD    . GLU A 1 152 ? 7.244   62.554  184.022 1.00 85.39  ?  150  GLU A CD    1 
ATOM   1169 O  OE1   . GLU A 1 152 ? 6.695   63.090  183.034 1.00 74.51  ?  150  GLU A OE1   1 
ATOM   1170 O  OE2   . GLU A 1 152 ? 8.163   61.707  183.922 1.00 90.12  -1 150  GLU A OE2   1 
ATOM   1171 N  N     . THR A 1 153 ? 5.598   60.481  188.887 1.00 54.06  ?  151  THR A N     1 
ATOM   1172 C  CA    . THR A 1 153 ? 5.430   59.378  189.817 1.00 57.25  ?  151  THR A CA    1 
ATOM   1173 C  C     . THR A 1 153 ? 4.640   58.254  189.168 1.00 63.83  ?  151  THR A C     1 
ATOM   1174 O  O     . THR A 1 153 ? 3.890   58.457  188.210 1.00 70.99  ?  151  THR A O     1 
ATOM   1175 C  CB    . THR A 1 153 ? 4.704   59.815  191.096 1.00 62.62  ?  151  THR A CB    1 
ATOM   1176 O  OG1   . THR A 1 153 ? 3.345   60.138  190.780 1.00 63.01  ?  151  THR A OG1   1 
ATOM   1177 C  CG2   . THR A 1 153 ? 5.380   61.029  191.712 1.00 55.06  ?  151  THR A CG2   1 
ATOM   1178 N  N     . SER A 1 154 ? 4.815   57.058  189.718 1.00 64.51  ?  152  SER A N     1 
ATOM   1179 C  CA    . SER A 1 154 ? 4.053   55.891  189.290 1.00 64.92  ?  152  SER A CA    1 
ATOM   1180 C  C     . SER A 1 154 ? 3.673   55.100  190.529 1.00 54.87  ?  152  SER A C     1 
ATOM   1181 O  O     . SER A 1 154 ? 4.543   54.524  191.191 1.00 63.02  ?  152  SER A O     1 
ATOM   1182 C  CB    . SER A 1 154 ? 4.846   55.021  188.317 1.00 66.30  ?  152  SER A CB    1 
ATOM   1183 O  OG    . SER A 1 154 ? 4.196   53.773  188.144 1.00 63.99  ?  152  SER A OG    1 
ATOM   1184 N  N     . ALA A 1 155 ? 2.379   55.090  190.847 1.00 49.74  ?  153  ALA A N     1 
ATOM   1185 C  CA    . ALA A 1 155 ? 1.886   54.208  191.896 1.00 55.22  ?  153  ALA A CA    1 
ATOM   1186 C  C     . ALA A 1 155 ? 2.176   52.753  191.557 1.00 60.06  ?  153  ALA A C     1 
ATOM   1187 O  O     . ALA A 1 155 ? 2.497   51.949  192.439 1.00 64.86  ?  153  ALA A O     1 
ATOM   1188 C  CB    . ALA A 1 155 ? 0.387   54.426  192.098 1.00 55.76  ?  153  ALA A CB    1 
ATOM   1189 N  N     . LYS A 1 156 ? 2.085   52.404  190.274 1.00 80.44  ?  154  LYS A N     1 
ATOM   1190 C  CA    . LYS A 1 156 ? 2.305   51.028  189.846 1.00 88.85  ?  154  LYS A CA    1 
ATOM   1191 C  C     . LYS A 1 156 ? 3.776   50.647  189.958 1.00 76.71  ?  154  LYS A C     1 
ATOM   1192 O  O     . LYS A 1 156 ? 4.135   49.700  190.667 1.00 77.27  ?  154  LYS A O     1 
ATOM   1193 C  CB    . LYS A 1 156 ? 1.798   50.856  188.414 1.00 94.17  ?  154  LYS A CB    1 
ATOM   1194 C  CG    . LYS A 1 156 ? 1.793   49.436  187.889 1.00 95.13  ?  154  LYS A CG    1 
ATOM   1195 C  CD    . LYS A 1 156 ? 1.339   49.433  186.436 1.00 93.84  ?  154  LYS A CD    1 
ATOM   1196 C  CE    . LYS A 1 156 ? 1.611   48.106  185.758 1.00 83.88  ?  154  LYS A CE    1 
ATOM   1197 N  NZ    . LYS A 1 156 ? 2.093   48.315  184.366 1.00 81.33  ?  154  LYS A NZ    1 
ATOM   1198 N  N     . ALA A 1 157 ? 4.645   51.387  189.272 1.00 60.73  ?  155  ALA A N     1 
ATOM   1199 C  CA    . ALA A 1 157 ? 6.066   51.071  189.240 1.00 58.31  ?  155  ALA A CA    1 
ATOM   1200 C  C     . ALA A 1 157 ? 6.812   51.514  190.493 1.00 67.00  ?  155  ALA A C     1 
ATOM   1201 O  O     . ALA A 1 157 ? 8.027   51.298  190.572 1.00 58.62  ?  155  ALA A O     1 
ATOM   1202 C  CB    . ALA A 1 157 ? 6.712   51.704  188.006 1.00 60.58  ?  155  ALA A CB    1 
ATOM   1203 N  N     . ASN A 1 158 ? 6.119   52.116  191.465 1.00 71.36  ?  156  ASN A N     1 
ATOM   1204 C  CA    . ASN A 1 158 ? 6.740   52.633  192.687 1.00 73.06  ?  156  ASN A CA    1 
ATOM   1205 C  C     . ASN A 1 158 ? 7.809   53.672  192.364 1.00 66.01  ?  156  ASN A C     1 
ATOM   1206 O  O     . ASN A 1 158 ? 8.867   53.723  192.995 1.00 79.06  ?  156  ASN A O     1 
ATOM   1207 C  CB    . ASN A 1 158 ? 7.323   51.506  193.542 1.00 77.95  ?  156  ASN A CB    1 
ATOM   1208 C  CG    . ASN A 1 158 ? 7.441   51.886  195.003 1.00 85.03  ?  156  ASN A CG    1 
ATOM   1209 O  OD1   . ASN A 1 158 ? 7.641   53.054  195.342 1.00 98.55  ?  156  ASN A OD1   1 
ATOM   1210 N  ND2   . ASN A 1 158 ? 7.306   50.899  195.882 1.00 93.62  ?  156  ASN A ND2   1 
ATOM   1211 N  N     . ILE A 1 159 ? 7.536   54.508  191.370 1.00 56.31  ?  157  ILE A N     1 
ATOM   1212 C  CA    . ILE A 1 159 ? 8.457   55.565  190.975 1.00 57.69  ?  157  ILE A CA    1 
ATOM   1213 C  C     . ILE A 1 159 ? 8.099   56.830  191.744 1.00 71.80  ?  157  ILE A C     1 
ATOM   1214 O  O     . ILE A 1 159 ? 6.972   57.326  191.644 1.00 71.69  ?  157  ILE A O     1 
ATOM   1215 C  CB    . ILE A 1 159 ? 8.414   55.810  189.459 1.00 66.17  ?  157  ILE A CB    1 
ATOM   1216 C  CG1   . ILE A 1 159 ? 8.812   54.544  188.689 1.00 58.05  ?  157  ILE A CG1   1 
ATOM   1217 C  CG2   . ILE A 1 159 ? 9.314   56.982  189.085 1.00 56.80  ?  157  ILE A CG2   1 
ATOM   1218 C  CD1   . ILE A 1 159 ? 8.588   54.641  187.196 1.00 65.91  ?  157  ILE A CD1   1 
ATOM   1219 N  N     . ASN A 1 160 ? 9.046   57.324  192.544 1.00 84.08  ?  158  ASN A N     1 
ATOM   1220 C  CA    . ASN A 1 160 ? 9.055   58.661  193.138 1.00 70.35  ?  158  ASN A CA    1 
ATOM   1221 C  C     . ASN A 1 160 ? 7.961   58.917  194.166 1.00 58.80  ?  158  ASN A C     1 
ATOM   1222 O  O     . ASN A 1 160 ? 7.755   60.074  194.550 1.00 52.14  ?  158  ASN A O     1 
ATOM   1223 C  CB    . ASN A 1 160 ? 8.964   59.750  192.068 1.00 66.17  ?  158  ASN A CB    1 
ATOM   1224 C  CG    . ASN A 1 160 ? 10.316  60.185  191.577 1.00 69.22  ?  158  ASN A CG    1 
ATOM   1225 O  OD1   . ASN A 1 160 ? 11.341  59.811  192.149 1.00 64.90  ?  158  ASN A OD1   1 
ATOM   1226 N  ND2   . ASN A 1 160 ? 10.336  60.975  190.509 1.00 80.20  ?  158  ASN A ND2   1 
ATOM   1227 N  N     . ILE A 1 161 ? 7.257   57.889  194.632 1.00 59.55  ?  159  ILE A N     1 
ATOM   1228 C  CA    . ILE A 1 161 ? 6.190   58.105  195.609 1.00 50.28  ?  159  ILE A CA    1 
ATOM   1229 C  C     . ILE A 1 161 ? 6.778   58.545  196.947 1.00 59.21  ?  159  ILE A C     1 
ATOM   1230 O  O     . ILE A 1 161 ? 6.522   59.658  197.440 1.00 57.86  ?  159  ILE A O     1 
ATOM   1231 C  CB    . ILE A 1 161 ? 5.351   56.824  195.763 1.00 59.19  ?  159  ILE A CB    1 
ATOM   1232 C  CG1   . ILE A 1 161 ? 4.711   56.433  194.427 1.00 55.81  ?  159  ILE A CG1   1 
ATOM   1233 C  CG2   . ILE A 1 161 ? 4.314   56.990  196.859 1.00 51.23  ?  159  ILE A CG2   1 
ATOM   1234 C  CD1   . ILE A 1 161 ? 3.568   57.315  194.016 1.00 56.82  ?  159  ILE A CD1   1 
ATOM   1235 N  N     . GLU A 1 162 ? 7.584   57.667  197.550 1.00 61.76  ?  160  GLU A N     1 
ATOM   1236 C  CA    . GLU A 1 162 ? 8.172   57.946  198.854 1.00 56.08  ?  160  GLU A CA    1 
ATOM   1237 C  C     . GLU A 1 162 ? 8.933   59.263  198.855 1.00 60.39  ?  160  GLU A C     1 
ATOM   1238 O  O     . GLU A 1 162 ? 8.803   60.057  199.793 1.00 71.54  ?  160  GLU A O     1 
ATOM   1239 C  CB    . GLU A 1 162 ? 9.088   56.795  199.270 1.00 55.06  ?  160  GLU A CB    1 
ATOM   1240 C  CG    . GLU A 1 162 ? 9.897   57.066  200.527 1.00 75.43  ?  160  GLU A CG    1 
ATOM   1241 C  CD    . GLU A 1 162 ? 10.119  55.815  201.365 1.00 89.42  ?  160  GLU A CD    1 
ATOM   1242 O  OE1   . GLU A 1 162 ? 9.139   55.313  201.957 1.00 81.28  ?  160  GLU A OE1   1 
ATOM   1243 O  OE2   . GLU A 1 162 ? 11.272  55.336  201.434 1.00 94.82  -1 160  GLU A OE2   1 
ATOM   1244 N  N     . LYS A 1 163 ? 9.718   59.522  197.805 1.00 64.24  ?  161  LYS A N     1 
ATOM   1245 C  CA    . LYS A 1 163 ? 10.568  60.708  197.805 1.00 72.32  ?  161  LYS A CA    1 
ATOM   1246 C  C     . LYS A 1 163 ? 9.737   61.978  197.724 1.00 75.27  ?  161  LYS A C     1 
ATOM   1247 O  O     . LYS A 1 163 ? 10.073  62.989  198.348 1.00 71.46  ?  161  LYS A O     1 
ATOM   1248 C  CB    . LYS A 1 163 ? 11.566  60.663  196.649 1.00 67.64  ?  161  LYS A CB    1 
ATOM   1249 C  CG    . LYS A 1 163 ? 12.437  61.914  196.606 1.00 81.78  ?  161  LYS A CG    1 
ATOM   1250 C  CD    . LYS A 1 163 ? 12.992  62.220  195.234 1.00 93.39  ?  161  LYS A CD    1 
ATOM   1251 C  CE    . LYS A 1 163 ? 14.505  62.353  195.282 1.00 90.82  ?  161  LYS A CE    1 
ATOM   1252 N  NZ    . LYS A 1 163 ? 14.980  63.406  194.340 1.00 87.89  ?  161  LYS A NZ    1 
ATOM   1253 N  N     . ALA A 1 164 ? 8.665   61.950  196.933 1.00 65.84  ?  162  ALA A N     1 
ATOM   1254 C  CA    . ALA A 1 164 ? 7.756   63.088  196.879 1.00 63.11  ?  162  ALA A CA    1 
ATOM   1255 C  C     . ALA A 1 164 ? 7.166   63.367  198.252 1.00 60.75  ?  162  ALA A C     1 
ATOM   1256 O  O     . ALA A 1 164 ? 7.169   64.513  198.725 1.00 60.85  ?  162  ALA A O     1 
ATOM   1257 C  CB    . ALA A 1 164 ? 6.650   62.825  195.854 1.00 64.99  ?  162  ALA A CB    1 
ATOM   1258 N  N     . PHE A 1 165 ? 6.685   62.320  198.927 1.00 57.86  ?  163  PHE A N     1 
ATOM   1259 C  CA    . PHE A 1 165 ? 6.044   62.536  200.221 1.00 52.28  ?  163  PHE A CA    1 
ATOM   1260 C  C     . PHE A 1 165 ? 7.035   63.040  201.266 1.00 62.59  ?  163  PHE A C     1 
ATOM   1261 O  O     . PHE A 1 165 ? 6.762   64.017  201.975 1.00 71.81  ?  163  PHE A O     1 
ATOM   1262 C  CB    . PHE A 1 165 ? 5.354   61.257  200.678 1.00 44.12  ?  163  PHE A CB    1 
ATOM   1263 C  CG    . PHE A 1 165 ? 3.935   61.168  200.224 1.00 49.58  ?  163  PHE A CG    1 
ATOM   1264 C  CD1   . PHE A 1 165 ? 2.962   61.933  200.835 1.00 47.54  ?  163  PHE A CD1   1 
ATOM   1265 C  CD2   . PHE A 1 165 ? 3.576   60.354  199.164 1.00 44.05  ?  163  PHE A CD2   1 
ATOM   1266 C  CE1   . PHE A 1 165 ? 1.654   61.876  200.413 1.00 46.68  ?  163  PHE A CE1   1 
ATOM   1267 C  CE2   . PHE A 1 165 ? 2.265   60.289  198.744 1.00 28.86  ?  163  PHE A CE2   1 
ATOM   1268 C  CZ    . PHE A 1 165 ? 1.303   61.053  199.368 1.00 31.53  ?  163  PHE A CZ    1 
ATOM   1269 N  N     . LEU A 1 166 ? 8.198   62.391  201.374 1.00 60.76  ?  164  LEU A N     1 
ATOM   1270 C  CA    . LEU A 1 166 ? 9.201   62.846  202.332 1.00 54.77  ?  164  LEU A CA    1 
ATOM   1271 C  C     . LEU A 1 166 ? 9.711   64.238  201.996 1.00 56.09  ?  164  LEU A C     1 
ATOM   1272 O  O     . LEU A 1 166 ? 10.066  64.998  202.901 1.00 51.72  ?  164  LEU A O     1 
ATOM   1273 C  CB    . LEU A 1 166 ? 10.374  61.870  202.391 1.00 53.72  ?  164  LEU A CB    1 
ATOM   1274 C  CG    . LEU A 1 166 ? 10.066  60.419  202.745 1.00 58.83  ?  164  LEU A CG    1 
ATOM   1275 C  CD1   . LEU A 1 166 ? 11.364  59.677  203.028 1.00 61.61  ?  164  LEU A CD1   1 
ATOM   1276 C  CD2   . LEU A 1 166 ? 9.114   60.349  203.937 1.00 56.37  ?  164  LEU A CD2   1 
ATOM   1277 N  N     . THR A 1 167 ? 9.784   64.580  200.709 1.00 57.27  ?  165  THR A N     1 
ATOM   1278 C  CA    . THR A 1 167 ? 10.188  65.928  200.327 1.00 50.43  ?  165  THR A CA    1 
ATOM   1279 C  C     . THR A 1 167 ? 9.176   66.952  200.820 1.00 59.16  ?  165  THR A C     1 
ATOM   1280 O  O     . THR A 1 167 ? 9.550   67.977  201.401 1.00 58.66  ?  165  THR A O     1 
ATOM   1281 C  CB    . THR A 1 167 ? 10.355  66.021  198.811 1.00 43.29  ?  165  THR A CB    1 
ATOM   1282 O  OG1   . THR A 1 167 ? 11.441  65.180  198.398 1.00 54.09  ?  165  THR A OG1   1 
ATOM   1283 C  CG2   . THR A 1 167 ? 10.651  67.456  198.390 1.00 34.19  ?  165  THR A CG2   1 
ATOM   1284 N  N     . LEU A 1 168 ? 7.885   66.684  200.602 1.00 56.27  ?  166  LEU A N     1 
ATOM   1285 C  CA    . LEU A 1 168 ? 6.850   67.560  201.139 1.00 39.50  ?  166  LEU A CA    1 
ATOM   1286 C  C     . LEU A 1 168 ? 6.974   67.693  202.657 1.00 50.64  ?  166  LEU A C     1 
ATOM   1287 O  O     . LEU A 1 168 ? 6.949   68.804  203.203 1.00 43.72  ?  166  LEU A O     1 
ATOM   1288 C  CB    . LEU A 1 168 ? 5.470   67.028  200.744 1.00 26.86  ?  166  LEU A CB    1 
ATOM   1289 C  CG    . LEU A 1 168 ? 4.284   67.941  201.057 1.00 38.59  ?  166  LEU A CG    1 
ATOM   1290 C  CD1   . LEU A 1 168 ? 4.502   69.338  200.487 1.00 33.88  ?  166  LEU A CD1   1 
ATOM   1291 C  CD2   . LEU A 1 168 ? 2.978   67.340  200.557 1.00 31.06  ?  166  LEU A CD2   1 
ATOM   1292 N  N     . ALA A 1 169 ? 7.130   66.563  203.355 1.00 53.28  ?  167  ALA A N     1 
ATOM   1293 C  CA    . ALA A 1 169 ? 7.209   66.602  204.815 1.00 48.25  ?  167  ALA A CA    1 
ATOM   1294 C  C     . ALA A 1 169 ? 8.438   67.369  205.286 1.00 32.18  ?  167  ALA A C     1 
ATOM   1295 O  O     . ALA A 1 169 ? 8.364   68.133  206.250 1.00 44.05  ?  167  ALA A O     1 
ATOM   1296 C  CB    . ALA A 1 169 ? 7.213   65.184  205.385 1.00 44.26  ?  167  ALA A CB    1 
ATOM   1297 N  N     . GLU A 1 170 ? 9.578   67.169  204.626 1.00 38.26  ?  168  GLU A N     1 
ATOM   1298 C  CA    . GLU A 1 170 ? 10.775  67.941  204.945 1.00 62.74  ?  168  GLU A CA    1 
ATOM   1299 C  C     . GLU A 1 170 ? 10.553  69.427  204.701 1.00 59.52  ?  168  GLU A C     1 
ATOM   1300 O  O     . GLU A 1 170 ? 11.015  70.268  205.481 1.00 61.13  ?  168  GLU A O     1 
ATOM   1301 C  CB    . GLU A 1 170 ? 11.960  67.450  204.111 1.00 76.24  ?  168  GLU A CB    1 
ATOM   1302 C  CG    . GLU A 1 170 ? 12.757  66.312  204.717 1.00 92.02  ?  168  GLU A CG    1 
ATOM   1303 C  CD    . GLU A 1 170 ? 14.190  66.286  204.215 1.00 89.28  ?  168  GLU A CD    1 
ATOM   1304 O  OE1   . GLU A 1 170 ? 14.923  67.271  204.453 1.00 86.48  ?  168  GLU A OE1   1 
ATOM   1305 O  OE2   . GLU A 1 170 ? 14.579  65.290  203.568 1.00 83.12  -1 168  GLU A OE2   1 
ATOM   1306 N  N     . ASP A 1 171 ? 9.862   69.768  203.612 1.00 41.71  ?  169  ASP A N     1 
ATOM   1307 C  CA    . ASP A 1 171 ? 9.612   71.171  203.300 1.00 51.18  ?  169  ASP A CA    1 
ATOM   1308 C  C     . ASP A 1 171 ? 8.764   71.817  204.383 1.00 53.42  ?  169  ASP A C     1 
ATOM   1309 O  O     . ASP A 1 171 ? 9.108   72.882  204.910 1.00 56.76  ?  169  ASP A O     1 
ATOM   1310 C  CB    . ASP A 1 171 ? 8.929   71.294  201.938 1.00 51.74  ?  169  ASP A CB    1 
ATOM   1311 C  CG    . ASP A 1 171 ? 9.849   70.943  200.789 1.00 52.68  ?  169  ASP A CG    1 
ATOM   1312 O  OD1   . ASP A 1 171 ? 11.057  70.728  201.029 1.00 59.90  ?  169  ASP A OD1   1 
ATOM   1313 O  OD2   . ASP A 1 171 ? 9.360   70.880  199.642 1.00 60.99  -1 169  ASP A OD2   1 
ATOM   1314 N  N     . ILE A 1 172 ? 7.651   71.171  204.733 1.00 51.71  ?  170  ILE A N     1 
ATOM   1315 C  CA    . ILE A 1 172 ? 6.809   71.651  205.825 1.00 48.81  ?  170  ILE A CA    1 
ATOM   1316 C  C     . ILE A 1 172 ? 7.617   71.760  207.108 1.00 46.69  ?  170  ILE A C     1 
ATOM   1317 O  O     . ILE A 1 172 ? 7.630   72.803  207.773 1.00 44.98  ?  170  ILE A O     1 
ATOM   1318 C  CB    . ILE A 1 172 ? 5.606   70.715  206.011 1.00 44.17  ?  170  ILE A CB    1 
ATOM   1319 C  CG1   . ILE A 1 172 ? 4.822   70.596  204.707 1.00 51.93  ?  170  ILE A CG1   1 
ATOM   1320 C  CG2   . ILE A 1 172 ? 4.729   71.218  207.104 1.00 45.28  ?  170  ILE A CG2   1 
ATOM   1321 C  CD1   . ILE A 1 172 ? 3.618   69.708  204.827 1.00 65.31  ?  170  ILE A CD1   1 
ATOM   1322 N  N     . LEU A 1 173 ? 8.303   70.672  207.470 1.00 43.38  ?  171  LEU A N     1 
ATOM   1323 C  CA    . LEU A 1 173 ? 9.067   70.623  208.712 1.00 42.62  ?  171  LEU A CA    1 
ATOM   1324 C  C     . LEU A 1 173 ? 10.078  71.751  208.800 1.00 36.76  ?  171  LEU A C     1 
ATOM   1325 O  O     . LEU A 1 173 ? 10.304  72.300  209.884 1.00 34.56  ?  171  LEU A O     1 
ATOM   1326 C  CB    . LEU A 1 173 ? 9.782   69.277  208.845 1.00 41.65  ?  171  LEU A CB    1 
ATOM   1327 C  CG    . LEU A 1 173 ? 10.730  69.223  210.053 1.00 45.08  ?  171  LEU A CG    1 
ATOM   1328 C  CD1   . LEU A 1 173 ? 9.933   69.205  211.339 1.00 31.84  ?  171  LEU A CD1   1 
ATOM   1329 C  CD2   . LEU A 1 173 ? 11.697  68.042  209.990 1.00 49.31  ?  171  LEU A CD2   1 
ATOM   1330 N  N     . ARG A 1 174 ? 10.693  72.114  207.677 1.00 37.99  ?  172  ARG A N     1 
ATOM   1331 C  CA    . ARG A 1 174 ? 11.764  73.096  207.727 1.00 47.35  ?  172  ARG A CA    1 
ATOM   1332 C  C     . ARG A 1 174 ? 11.271  74.453  208.196 1.00 42.69  ?  172  ARG A C     1 
ATOM   1333 O  O     . ARG A 1 174 ? 11.997  75.152  208.903 1.00 56.53  ?  172  ARG A O     1 
ATOM   1334 C  CB    . ARG A 1 174 ? 12.421  73.214  206.367 1.00 41.96  ?  172  ARG A CB    1 
ATOM   1335 C  CG    . ARG A 1 174 ? 13.059  74.541  206.105 1.00 62.54  ?  172  ARG A CG    1 
ATOM   1336 C  CD    . ARG A 1 174 ? 14.412  74.261  205.534 1.00 81.63  ?  172  ARG A CD    1 
ATOM   1337 N  NE    . ARG A 1 174 ? 15.297  75.412  205.528 1.00 103.66 ?  172  ARG A NE    1 
ATOM   1338 C  CZ    . ARG A 1 174 ? 16.604  75.281  205.365 1.00 104.14 ?  172  ARG A CZ    1 
ATOM   1339 N  NH1   . ARG A 1 174 ? 17.111  74.073  205.276 1.00 99.10  ?  172  ARG A NH1   1 
ATOM   1340 N  NH2   . ARG A 1 174 ? 17.400  76.329  205.328 1.00 103.37 ?  172  ARG A NH2   1 
ATOM   1341 N  N     . LYS A 1 175 ? 10.047  74.829  207.836 1.00 30.31  ?  173  LYS A N     1 
ATOM   1342 C  CA    . LYS A 1 175 ? 9.442   76.079  208.290 1.00 58.67  ?  173  LYS A CA    1 
ATOM   1343 C  C     . LYS A 1 175 ? 8.527   75.875  209.497 1.00 60.08  ?  173  LYS A C     1 
ATOM   1344 O  O     . LYS A 1 175 ? 7.490   76.538  209.603 1.00 48.38  ?  173  LYS A O     1 
ATOM   1345 C  CB    . LYS A 1 175 ? 8.671   76.752  207.152 1.00 47.70  ?  173  LYS A CB    1 
ATOM   1346 C  CG    . LYS A 1 175 ? 7.883   75.817  206.248 1.00 53.34  ?  173  LYS A CG    1 
ATOM   1347 C  CD    . LYS A 1 175 ? 7.159   76.608  205.159 1.00 53.44  ?  173  LYS A CD    1 
ATOM   1348 C  CE    . LYS A 1 175 ? 5.883   75.910  204.706 1.00 46.38  ?  173  LYS A CE    1 
ATOM   1349 N  NZ    . LYS A 1 175 ? 5.049   76.792  203.841 1.00 49.57  ?  173  LYS A NZ    1 
ATOM   1350 N  N     . THR A 1 176 ? 8.883   74.989  210.437 1.00 66.80  ?  174  THR A N     1 
ATOM   1351 C  CA    . THR A 1 176 ? 7.950   74.665  211.518 1.00 67.95  ?  174  THR A CA    1 
ATOM   1352 C  C     . THR A 1 176 ? 8.135   75.425  212.830 1.00 84.22  ?  174  THR A C     1 
ATOM   1353 O  O     . THR A 1 176 ? 7.147   75.588  213.557 1.00 92.67  ?  174  THR A O     1 
ATOM   1354 C  CB    . THR A 1 176 ? 7.977   73.172  211.854 1.00 61.07  ?  174  THR A CB    1 
ATOM   1355 O  OG1   . THR A 1 176 ? 9.317   72.665  211.775 1.00 73.76  ?  174  THR A OG1   1 
ATOM   1356 C  CG2   . THR A 1 176 ? 7.041   72.398  210.942 1.00 66.44  ?  174  THR A CG2   1 
ATOM   1357 N  N     . PRO A 1 177 ? 9.351   75.872  213.209 1.00 99.67  ?  175  PRO A N     1 
ATOM   1358 C  CA    . PRO A 1 177 ? 9.383   76.559  214.511 1.00 106.15 ?  175  PRO A CA    1 
ATOM   1359 C  C     . PRO A 1 177 ? 8.499   77.806  214.576 1.00 110.02 ?  175  PRO A C     1 
ATOM   1360 O  O     . PRO A 1 177 ? 7.413   77.724  215.151 1.00 116.60 ?  175  PRO A O     1 
ATOM   1361 C  CB    . PRO A 1 177 ? 10.853  76.949  214.668 1.00 110.14 ?  175  PRO A CB    1 
ATOM   1362 C  CG    . PRO A 1 177 ? 11.602  75.980  213.841 1.00 116.02 ?  175  PRO A CG    1 
ATOM   1363 C  CD    . PRO A 1 177 ? 10.709  75.663  212.671 1.00 107.92 ?  175  PRO A CD    1 
ATOM   1364 N  N     . LYS B 2 4   ? 12.218  64.127  245.636 1.00 139.91 ?  918  LYS B N     1 
ATOM   1365 C  CA    . LYS B 2 4   ? 11.892  63.452  244.386 1.00 132.14 ?  918  LYS B CA    1 
ATOM   1366 C  C     . LYS B 2 4   ? 10.476  62.877  244.404 1.00 133.27 ?  918  LYS B C     1 
ATOM   1367 O  O     . LYS B 2 4   ? 10.197  61.883  243.737 1.00 136.71 ?  918  LYS B O     1 
ATOM   1368 C  CB    . LYS B 2 4   ? 12.904  62.340  244.099 1.00 125.74 ?  918  LYS B CB    1 
ATOM   1369 N  N     . GLU B 2 5   ? 9.585   63.495  245.182 1.00 130.29 ?  919  GLU B N     1 
ATOM   1370 C  CA    . GLU B 2 5   ? 8.171   63.135  245.107 1.00 120.34 ?  919  GLU B CA    1 
ATOM   1371 C  C     . GLU B 2 5   ? 7.567   63.601  243.785 1.00 120.79 ?  919  GLU B C     1 
ATOM   1372 O  O     . GLU B 2 5   ? 6.762   62.888  243.157 1.00 112.01 ?  919  GLU B O     1 
ATOM   1373 C  CB    . GLU B 2 5   ? 7.420   63.742  246.293 1.00 114.47 ?  919  GLU B CB    1 
ATOM   1374 N  N     . GLU B 2 6   ? 7.956   64.800  243.345 1.00 122.08 ?  920  GLU B N     1 
ATOM   1375 C  CA    . GLU B 2 6   ? 7.555   65.291  242.034 1.00 120.28 ?  920  GLU B CA    1 
ATOM   1376 C  C     . GLU B 2 6   ? 7.883   64.279  240.945 1.00 119.10 ?  920  GLU B C     1 
ATOM   1377 O  O     . GLU B 2 6   ? 7.131   64.133  239.974 1.00 123.74 ?  920  GLU B O     1 
ATOM   1378 C  CB    . GLU B 2 6   ? 8.243   66.627  241.749 1.00 121.91 ?  920  GLU B CB    1 
ATOM   1379 N  N     . GLU B 2 7   ? 9.002   63.564  241.099 1.00 111.05 ?  921  GLU B N     1 
ATOM   1380 C  CA    . GLU B 2 7   ? 9.373   62.530  240.139 1.00 96.22  ?  921  GLU B CA    1 
ATOM   1381 C  C     . GLU B 2 7   ? 8.256   61.507  239.973 1.00 109.53 ?  921  GLU B C     1 
ATOM   1382 O  O     . GLU B 2 7   ? 7.916   61.117  238.851 1.00 111.14 ?  921  GLU B O     1 
ATOM   1383 C  CB    . GLU B 2 7   ? 10.669  61.849  240.582 1.00 88.81  ?  921  GLU B CB    1 
ATOM   1384 N  N     . MET B 2 8   ? 7.664   61.066  241.087 1.00 115.99 ?  922  MET B N     1 
ATOM   1385 C  CA    . MET B 2 8   ? 6.526   60.154  241.004 1.00 115.08 ?  922  MET B CA    1 
ATOM   1386 C  C     . MET B 2 8   ? 5.321   60.835  240.360 1.00 122.92 ?  922  MET B C     1 
ATOM   1387 O  O     . MET B 2 8   ? 4.583   60.213  239.576 1.00 115.00 ?  922  MET B O     1 
ATOM   1388 C  CB    . MET B 2 8   ? 6.173   59.632  242.397 1.00 100.79 ?  922  MET B CB    1 
ATOM   1389 N  N     . LYS B 2 9   ? 5.107   62.119  240.675 1.00 128.81 ?  923  LYS B N     1 
ATOM   1390 C  CA    . LYS B 2 9   ? 4.013   62.846  240.029 1.00 121.04 ?  923  LYS B CA    1 
ATOM   1391 C  C     . LYS B 2 9   ? 4.124   62.788  238.504 1.00 118.05 ?  923  LYS B C     1 
ATOM   1392 O  O     . LYS B 2 9   ? 3.122   62.562  237.801 1.00 124.27 ?  923  LYS B O     1 
ATOM   1393 C  CB    . LYS B 2 9   ? 3.990   64.296  240.514 1.00 115.70 ?  923  LYS B CB    1 
ATOM   1394 N  N     . ARG B 2 10  ? 5.340   62.976  237.976 1.00 105.76 ?  924  ARG B N     1 
ATOM   1395 C  CA    . ARG B 2 10  ? 5.558   62.865  236.535 1.00 86.49  ?  924  ARG B CA    1 
ATOM   1396 C  C     . ARG B 2 10  ? 5.117   61.503  236.014 1.00 86.52  ?  924  ARG B C     1 
ATOM   1397 O  O     . ARG B 2 10  ? 4.611   61.391  234.888 1.00 79.66  ?  924  ARG B O     1 
ATOM   1398 C  CB    . ARG B 2 10  ? 7.031   63.114  236.207 1.00 78.45  ?  924  ARG B CB    1 
ATOM   1399 N  N     . PHE B 2 11  ? 5.295   60.455  236.825 1.00 91.80  ?  925  PHE B N     1 
ATOM   1400 C  CA    . PHE B 2 11  ? 4.797   59.137  236.451 1.00 80.46  ?  925  PHE B CA    1 
ATOM   1401 C  C     . PHE B 2 11  ? 3.282   59.143  236.323 1.00 81.85  ?  925  PHE B C     1 
ATOM   1402 O  O     . PHE B 2 11  ? 2.740   58.710  235.305 1.00 90.40  ?  925  PHE B O     1 
ATOM   1403 C  CB    . PHE B 2 11  ? 5.244   58.085  237.466 1.00 76.35  ?  925  PHE B CB    1 
ATOM   1404 N  N     . CYS B 2 12  ? 2.576   59.636  237.346 1.00 87.12  ?  926  CYS B N     1 
ATOM   1405 C  CA    . CYS B 2 12  ? 1.112   59.609  237.281 1.00 92.65  ?  926  CYS B CA    1 
ATOM   1406 C  C     . CYS B 2 12  ? 0.583   60.343  236.049 1.00 91.64  ?  926  CYS B C     1 
ATOM   1407 O  O     . CYS B 2 12  ? -0.342  59.858  235.373 1.00 101.09 ?  926  CYS B O     1 
ATOM   1408 C  CB    . CYS B 2 12  ? 0.519   60.185  238.563 1.00 92.72  ?  926  CYS B CB    1 
ATOM   1409 S  SG    . CYS B 2 12  ? 0.770   59.098  239.972 1.00 92.25  ?  926  CYS B SG    1 
ATOM   1410 N  N     . LYS B 2 13  ? 1.172   61.498  235.723 1.00 89.22  ?  927  LYS B N     1 
ATOM   1411 C  CA    . LYS B 2 13  ? 0.815   62.171  234.475 1.00 96.75  ?  927  LYS B CA    1 
ATOM   1412 C  C     . LYS B 2 13  ? 1.078   61.267  233.271 1.00 85.62  ?  927  LYS B C     1 
ATOM   1413 O  O     . LYS B 2 13  ? 0.169   60.969  232.479 1.00 80.82  ?  927  LYS B O     1 
ATOM   1414 C  CB    . LYS B 2 13  ? 1.594   63.482  234.344 1.00 102.26 ?  927  LYS B CB    1 
ATOM   1415 N  N     . ALA B 2 14  ? 2.326   60.801  233.139 1.00 81.43  ?  928  ALA B N     1 
ATOM   1416 C  CA    . ALA B 2 14  ? 2.727   60.006  231.981 1.00 81.56  ?  928  ALA B CA    1 
ATOM   1417 C  C     . ALA B 2 14  ? 1.834   58.785  231.788 1.00 87.50  ?  928  ALA B C     1 
ATOM   1418 O  O     . ALA B 2 14  ? 1.519   58.405  230.653 1.00 90.13  ?  928  ALA B O     1 
ATOM   1419 C  CB    . ALA B 2 14  ? 4.188   59.577  232.136 1.00 69.28  ?  928  ALA B CB    1 
ATOM   1420 N  N     . GLN B 2 15  ? 1.403   58.172  232.889 1.00 80.04  ?  929  GLN B N     1 
ATOM   1421 C  CA    . GLN B 2 15  ? 0.642   56.931  232.835 1.00 81.70  ?  929  GLN B CA    1 
ATOM   1422 C  C     . GLN B 2 15  ? -0.814  57.174  232.474 1.00 78.94  ?  929  GLN B C     1 
ATOM   1423 O  O     . GLN B 2 15  ? -1.393  56.409  231.690 1.00 89.04  ?  929  GLN B O     1 
ATOM   1424 C  CB    . GLN B 2 15  ? 0.737   56.203  234.171 1.00 92.96  ?  929  GLN B CB    1 
ATOM   1425 C  CG    . GLN B 2 15  ? 1.873   55.212  234.251 1.00 102.33 ?  929  GLN B CG    1 
ATOM   1426 C  CD    . GLN B 2 15  ? 1.838   54.420  235.534 1.00 112.65 ?  929  GLN B CD    1 
ATOM   1427 O  OE1   . GLN B 2 15  ? 0.767   54.060  236.022 1.00 113.66 ?  929  GLN B OE1   1 
ATOM   1428 N  NE2   . GLN B 2 15  ? 3.010   54.149  236.096 1.00 119.00 ?  929  GLN B NE2   1 
ATOM   1429 N  N     . THR B 2 16  ? -1.436  58.214  233.044 1.00 66.80  ?  930  THR B N     1 
ATOM   1430 C  CA    . THR B 2 16  ? -2.758  58.588  232.549 1.00 82.44  ?  930  THR B CA    1 
ATOM   1431 C  C     . THR B 2 16  ? -2.711  58.837  231.046 1.00 82.60  ?  930  THR B C     1 
ATOM   1432 O  O     . THR B 2 16  ? -3.608  58.411  230.300 1.00 92.41  ?  930  THR B O     1 
ATOM   1433 C  CB    . THR B 2 16  ? -3.280  59.823  233.284 1.00 88.17  ?  930  THR B CB    1 
ATOM   1434 O  OG1   . THR B 2 16  ? -2.246  60.813  233.353 1.00 97.79  ?  930  THR B OG1   1 
ATOM   1435 C  CG2   . THR B 2 16  ? -3.737  59.461  234.689 1.00 73.43  ?  930  THR B CG2   1 
ATOM   1436 N  N     . ILE B 2 17  ? -1.642  59.488  230.580 1.00 77.59  ?  931  ILE B N     1 
ATOM   1437 C  CA    . ILE B 2 17  ? -1.510  59.774  229.153 1.00 79.06  ?  931  ILE B CA    1 
ATOM   1438 C  C     . ILE B 2 17  ? -1.416  58.480  228.349 1.00 78.49  ?  931  ILE B C     1 
ATOM   1439 O  O     . ILE B 2 17  ? -2.132  58.296  227.356 1.00 82.25  ?  931  ILE B O     1 
ATOM   1440 C  CB    . ILE B 2 17  ? -0.302  60.692  228.903 1.00 79.33  ?  931  ILE B CB    1 
ATOM   1441 C  CG1   . ILE B 2 17  ? -0.592  62.095  229.448 1.00 76.00  ?  931  ILE B CG1   1 
ATOM   1442 C  CG2   . ILE B 2 17  ? 0.034   60.737  227.422 1.00 64.96  ?  931  ILE B CG2   1 
ATOM   1443 C  CD1   . ILE B 2 17  ? 0.499   63.102  229.178 1.00 71.68  ?  931  ILE B CD1   1 
ATOM   1444 N  N     . GLN B 2 18  ? -0.542  57.559  228.771 1.00 64.73  ?  932  GLN B N     1 
ATOM   1445 C  CA    . GLN B 2 18  ? -0.384  56.294  228.051 1.00 70.64  ?  932  GLN B CA    1 
ATOM   1446 C  C     . GLN B 2 18  ? -1.707  55.537  227.963 1.00 64.39  ?  932  GLN B C     1 
ATOM   1447 O  O     . GLN B 2 18  ? -2.112  55.075  226.882 1.00 77.98  ?  932  GLN B O     1 
ATOM   1448 C  CB    . GLN B 2 18  ? 0.682   55.434  228.733 1.00 73.79  ?  932  GLN B CB    1 
ATOM   1449 C  CG    . GLN B 2 18  ? 1.876   55.115  227.850 1.00 88.84  ?  932  GLN B CG    1 
ATOM   1450 C  CD    . GLN B 2 18  ? 1.479   54.466  226.534 1.00 91.52  ?  932  GLN B CD    1 
ATOM   1451 O  OE1   . GLN B 2 18  ? 0.522   53.692  226.469 1.00 99.36  ?  932  GLN B OE1   1 
ATOM   1452 N  NE2   . GLN B 2 18  ? 2.212   54.786  225.475 1.00 92.17  ?  932  GLN B NE2   1 
ATOM   1453 N  N     . ARG B 2 19  ? -2.386  55.391  229.104 1.00 69.82  ?  933  ARG B N     1 
ATOM   1454 C  CA    . ARG B 2 19  ? -3.735  54.832  229.116 1.00 82.69  ?  933  ARG B CA    1 
ATOM   1455 C  C     . ARG B 2 19  ? -4.599  55.462  228.032 1.00 77.70  ?  933  ARG B C     1 
ATOM   1456 O  O     . ARG B 2 19  ? -5.211  54.760  227.213 1.00 73.47  ?  933  ARG B O     1 
ATOM   1457 C  CB    . ARG B 2 19  ? -4.362  55.050  230.492 1.00 87.63  ?  933  ARG B CB    1 
ATOM   1458 C  CG    . ARG B 2 19  ? -5.670  54.326  230.735 1.00 98.33  ?  933  ARG B CG    1 
ATOM   1459 C  CD    . ARG B 2 19  ? -6.105  54.518  232.186 1.00 115.33 ?  933  ARG B CD    1 
ATOM   1460 N  NE    . ARG B 2 19  ? -5.015  55.045  233.004 1.00 121.15 ?  933  ARG B NE    1 
ATOM   1461 C  CZ    . ARG B 2 19  ? -4.280  54.311  233.836 1.00 128.72 ?  933  ARG B CZ    1 
ATOM   1462 N  NH1   . ARG B 2 19  ? -4.517  53.013  233.967 1.00 133.29 ?  933  ARG B NH1   1 
ATOM   1463 N  NH2   . ARG B 2 19  ? -3.303  54.873  234.539 1.00 130.08 ?  933  ARG B NH2   1 
ATOM   1464 N  N     . ARG B 2 20  ? -4.635  56.799  227.993 1.00 71.71  ?  934  ARG B N     1 
ATOM   1465 C  CA    . ARG B 2 20  ? -5.517  57.473  227.045 1.00 70.28  ?  934  ARG B CA    1 
ATOM   1466 C  C     . ARG B 2 20  ? -5.134  57.168  225.601 1.00 77.09  ?  934  ARG B C     1 
ATOM   1467 O  O     . ARG B 2 20  ? -6.010  57.022  224.743 1.00 75.34  ?  934  ARG B O     1 
ATOM   1468 C  CB    . ARG B 2 20  ? -5.512  58.979  227.285 1.00 60.39  ?  934  ARG B CB    1 
ATOM   1469 C  CG    . ARG B 2 20  ? -6.454  59.725  226.354 1.00 60.52  ?  934  ARG B CG    1 
ATOM   1470 C  CD    . ARG B 2 20  ? -7.902  59.320  226.586 1.00 65.58  ?  934  ARG B CD    1 
ATOM   1471 N  NE    . ARG B 2 20  ? -8.744  59.597  225.426 1.00 69.51  ?  934  ARG B NE    1 
ATOM   1472 C  CZ    . ARG B 2 20  ? -10.065 59.738  225.475 1.00 75.70  ?  934  ARG B CZ    1 
ATOM   1473 N  NH1   . ARG B 2 20  ? -10.747 59.987  224.366 1.00 68.59  ?  934  ARG B NH1   1 
ATOM   1474 N  NH2   . ARG B 2 20  ? -10.705 59.641  226.632 1.00 87.99  ?  934  ARG B NH2   1 
ATOM   1475 N  N     . LEU B 2 21  ? -3.832  57.075  225.311 1.00 67.79  ?  935  LEU B N     1 
ATOM   1476 C  CA    . LEU B 2 21  ? -3.401  56.753  223.953 1.00 64.92  ?  935  LEU B CA    1 
ATOM   1477 C  C     . LEU B 2 21  ? -3.848  55.362  223.533 1.00 85.55  ?  935  LEU B C     1 
ATOM   1478 O  O     . LEU B 2 21  ? -4.160  55.131  222.358 1.00 93.21  ?  935  LEU B O     1 
ATOM   1479 C  CB    . LEU B 2 21  ? -1.886  56.874  223.825 1.00 56.85  ?  935  LEU B CB    1 
ATOM   1480 C  CG    . LEU B 2 21  ? -1.238  58.139  224.366 1.00 63.37  ?  935  LEU B CG    1 
ATOM   1481 C  CD1   . LEU B 2 21  ? 0.271   57.975  224.477 1.00 75.31  ?  935  LEU B CD1   1 
ATOM   1482 C  CD2   . LEU B 2 21  ? -1.608  59.308  223.476 1.00 67.33  ?  935  LEU B CD2   1 
ATOM   1483 N  N     . ASN B 2 22  ? -3.862  54.414  224.472 1.00 76.89  ?  936  ASN B N     1 
ATOM   1484 C  CA    . ASN B 2 22  ? -4.398  53.096  224.139 1.00 75.94  ?  936  ASN B CA    1 
ATOM   1485 C  C     . ASN B 2 22  ? -5.907  53.148  223.923 1.00 74.20  ?  936  ASN B C     1 
ATOM   1486 O  O     . ASN B 2 22  ? -6.436  52.485  223.017 1.00 76.38  ?  936  ASN B O     1 
ATOM   1487 C  CB    . ASN B 2 22  ? -4.033  52.092  225.228 1.00 82.96  ?  936  ASN B CB    1 
ATOM   1488 C  CG    . ASN B 2 22  ? -2.548  52.071  225.513 1.00 92.31  ?  936  ASN B CG    1 
ATOM   1489 O  OD1   . ASN B 2 22  ? -1.731  52.312  224.620 1.00 95.79  ?  936  ASN B OD1   1 
ATOM   1490 N  ND2   . ASN B 2 22  ? -2.185  51.766  226.753 1.00 95.63  ?  936  ASN B ND2   1 
ATOM   1491 N  N     . GLU B 2 23  ? -6.617  53.937  224.736 1.00 73.36  ?  937  GLU B N     1 
ATOM   1492 C  CA    . GLU B 2 23  ? -8.040  54.160  224.489 1.00 70.98  ?  937  GLU B CA    1 
ATOM   1493 C  C     . GLU B 2 23  ? -8.273  54.719  223.091 1.00 77.81  ?  937  GLU B C     1 
ATOM   1494 O  O     . GLU B 2 23  ? -9.199  54.296  222.385 1.00 88.07  ?  937  GLU B O     1 
ATOM   1495 C  CB    . GLU B 2 23  ? -8.616  55.114  225.537 1.00 72.47  ?  937  GLU B CB    1 
ATOM   1496 C  CG    . GLU B 2 23  ? -8.604  54.585  226.962 1.00 85.67  ?  937  GLU B CG    1 
ATOM   1497 C  CD    . GLU B 2 23  ? -9.231  55.559  227.940 1.00 92.62  ?  937  GLU B CD    1 
ATOM   1498 O  OE1   . GLU B 2 23  ? -9.723  56.616  227.488 1.00 88.97  ?  937  GLU B OE1   1 
ATOM   1499 O  OE2   . GLU B 2 23  ? -9.234  55.271  229.157 1.00 94.47  -1 937  GLU B OE2   1 
ATOM   1500 N  N     . ILE B 2 24  ? -7.425  55.658  222.668 1.00 69.42  ?  938  ILE B N     1 
ATOM   1501 C  CA    . ILE B 2 24  ? -7.622  56.339  221.393 1.00 71.37  ?  938  ILE B CA    1 
ATOM   1502 C  C     . ILE B 2 24  ? -7.310  55.405  220.233 1.00 64.87  ?  938  ILE B C     1 
ATOM   1503 O  O     . ILE B 2 24  ? -8.062  55.342  219.254 1.00 54.63  ?  938  ILE B O     1 
ATOM   1504 C  CB    . ILE B 2 24  ? -6.767  57.617  221.328 1.00 81.94  ?  938  ILE B CB    1 
ATOM   1505 C  CG1   . ILE B 2 24  ? -7.372  58.710  222.211 1.00 70.12  ?  938  ILE B CG1   1 
ATOM   1506 C  CG2   . ILE B 2 24  ? -6.621  58.091  219.883 1.00 72.92  ?  938  ILE B CG2   1 
ATOM   1507 C  CD1   . ILE B 2 24  ? -6.464  59.901  222.406 1.00 56.30  ?  938  ILE B CD1   1 
ATOM   1508 N  N     . GLU B 2 25  ? -6.181  54.693  220.309 1.00 57.98  ?  939  GLU B N     1 
ATOM   1509 C  CA    . GLU B 2 25  ? -5.912  53.646  219.331 1.00 61.72  ?  939  GLU B CA    1 
ATOM   1510 C  C     . GLU B 2 25  ? -7.141  52.756  219.177 1.00 74.22  ?  939  GLU B C     1 
ATOM   1511 O  O     . GLU B 2 25  ? -7.683  52.612  218.073 1.00 82.64  ?  939  GLU B O     1 
ATOM   1512 C  CB    . GLU B 2 25  ? -4.680  52.838  219.753 1.00 63.88  ?  939  GLU B CB    1 
ATOM   1513 C  CG    . GLU B 2 25  ? -4.059  51.961  218.665 1.00 82.69  ?  939  GLU B CG    1 
ATOM   1514 C  CD    . GLU B 2 25  ? -3.204  52.747  217.679 1.00 110.73 ?  939  GLU B CD    1 
ATOM   1515 O  OE1   . GLU B 2 25  ? -3.406  52.588  216.453 1.00 117.57 ?  939  GLU B OE1   1 
ATOM   1516 O  OE2   . GLU B 2 25  ? -2.334  53.526  218.127 1.00 114.47 -1 939  GLU B OE2   1 
ATOM   1517 N  N     . ALA B 2 26  ? -7.658  52.248  220.302 1.00 73.69  ?  940  ALA B N     1 
ATOM   1518 C  CA    . ALA B 2 26  ? -8.828  51.370  220.283 1.00 76.12  ?  940  ALA B CA    1 
ATOM   1519 C  C     . ALA B 2 26  ? -10.002 51.997  219.530 1.00 77.14  ?  940  ALA B C     1 
ATOM   1520 O  O     . ALA B 2 26  ? -10.493 51.441  218.533 1.00 87.50  ?  940  ALA B O     1 
ATOM   1521 C  CB    . ALA B 2 26  ? -9.233  51.030  221.718 1.00 81.50  ?  940  ALA B CB    1 
ATOM   1522 N  N     . ALA B 2 27  ? -10.477 53.153  220.009 1.00 64.73  ?  941  ALA B N     1 
ATOM   1523 C  CA    . ALA B 2 27  ? -11.625 53.805  219.384 1.00 67.21  ?  941  ALA B CA    1 
ATOM   1524 C  C     . ALA B 2 27  ? -11.401 54.013  217.891 1.00 80.93  ?  941  ALA B C     1 
ATOM   1525 O  O     . ALA B 2 27  ? -12.318 53.817  217.081 1.00 86.03  ?  941  ALA B O     1 
ATOM   1526 C  CB    . ALA B 2 27  ? -11.910 55.140  220.073 1.00 58.57  ?  941  ALA B CB    1 
ATOM   1527 N  N     . LEU B 2 28  ? -10.176 54.387  217.509 1.00 72.22  ?  942  LEU B N     1 
ATOM   1528 C  CA    . LEU B 2 28  ? -9.863  54.582  216.096 1.00 71.65  ?  942  LEU B CA    1 
ATOM   1529 C  C     . LEU B 2 28  ? -10.049 53.299  215.298 1.00 79.53  ?  942  LEU B C     1 
ATOM   1530 O  O     . LEU B 2 28  ? -10.550 53.338  214.170 1.00 83.99  ?  942  LEU B O     1 
ATOM   1531 C  CB    . LEU B 2 28  ? -8.437  55.109  215.930 1.00 69.36  ?  942  LEU B CB    1 
ATOM   1532 C  CG    . LEU B 2 28  ? -8.236  56.613  216.122 1.00 67.86  ?  942  LEU B CG    1 
ATOM   1533 C  CD1   . LEU B 2 28  ? -6.768  56.990  215.983 1.00 62.20  ?  942  LEU B CD1   1 
ATOM   1534 C  CD2   . LEU B 2 28  ? -9.083  57.381  215.121 1.00 71.52  ?  942  LEU B CD2   1 
ATOM   1535 N  N     . ARG B 2 29  ? -9.649  52.152  215.857 1.00 85.80  ?  943  ARG B N     1 
ATOM   1536 C  CA    . ARG B 2 29  ? -9.853  50.892  215.142 1.00 84.33  ?  943  ARG B CA    1 
ATOM   1537 C  C     . ARG B 2 29  ? -11.332 50.582  214.985 1.00 82.60  ?  943  ARG B C     1 
ATOM   1538 O  O     . ARG B 2 29  ? -11.786 50.213  213.895 1.00 80.95  ?  943  ARG B O     1 
ATOM   1539 C  CB    . ARG B 2 29  ? -9.161  49.742  215.860 1.00 88.44  ?  943  ARG B CB    1 
ATOM   1540 C  CG    . ARG B 2 29  ? -7.998  50.183  216.652 1.00 97.04  ?  943  ARG B CG    1 
ATOM   1541 C  CD    . ARG B 2 29  ? -7.128  49.040  217.101 1.00 107.81 ?  943  ARG B CD    1 
ATOM   1542 N  NE    . ARG B 2 29  ? -5.960  48.979  216.240 1.00 115.40 ?  943  ARG B NE    1 
ATOM   1543 C  CZ    . ARG B 2 29  ? -4.852  48.318  216.546 1.00 120.12 ?  943  ARG B CZ    1 
ATOM   1544 N  NH1   . ARG B 2 29  ? -4.759  47.674  217.703 1.00 122.20 ?  943  ARG B NH1   1 
ATOM   1545 N  NH2   . ARG B 2 29  ? -3.829  48.307  215.703 1.00 117.54 ?  943  ARG B NH2   1 
ATOM   1546 N  N     . GLU B 2 30  ? -12.098 50.699  216.074 1.00 92.58  ?  944  GLU B N     1 
ATOM   1547 C  CA    . GLU B 2 30  ? -13.535 50.458  215.966 1.00 96.35  ?  944  GLU B CA    1 
ATOM   1548 C  C     . GLU B 2 30  ? -14.153 51.336  214.883 1.00 92.47  ?  944  GLU B C     1 
ATOM   1549 O  O     . GLU B 2 30  ? -14.971 50.868  214.075 1.00 81.09  ?  944  GLU B O     1 
ATOM   1550 C  CB    . GLU B 2 30  ? -14.212 50.697  217.317 1.00 99.86  ?  944  GLU B CB    1 
ATOM   1551 C  CG    . GLU B 2 30  ? -13.649 49.844  218.442 1.00 102.05 ?  944  GLU B CG    1 
ATOM   1552 C  CD    . GLU B 2 30  ? -14.731 49.279  219.340 1.00 112.97 ?  944  GLU B CD    1 
ATOM   1553 O  OE1   . GLU B 2 30  ? -15.854 49.826  219.335 1.00 115.67 ?  944  GLU B OE1   1 
ATOM   1554 O  OE2   . GLU B 2 30  ? -14.463 48.282  220.043 1.00 117.49 -1 944  GLU B OE2   1 
ATOM   1555 N  N     . LEU B 2 31  ? -13.724 52.599  214.817 1.00 96.83  ?  945  LEU B N     1 
ATOM   1556 C  CA    . LEU B 2 31  ? -14.274 53.524  213.834 1.00 96.22  ?  945  LEU B CA    1 
ATOM   1557 C  C     . LEU B 2 31  ? -13.856 53.151  212.417 1.00 92.71  ?  945  LEU B C     1 
ATOM   1558 O  O     . LEU B 2 31  ? -14.676 53.190  211.496 1.00 109.43 ?  945  LEU B O     1 
ATOM   1559 C  CB    . LEU B 2 31  ? -13.852 54.954  214.165 1.00 91.23  ?  945  LEU B CB    1 
ATOM   1560 C  CG    . LEU B 2 31  ? -14.506 55.557  215.410 1.00 85.09  ?  945  LEU B CG    1 
ATOM   1561 C  CD1   . LEU B 2 31  ? -14.455 57.070  215.353 1.00 76.05  ?  945  LEU B CD1   1 
ATOM   1562 C  CD2   . LEU B 2 31  ? -15.940 55.070  215.560 1.00 94.88  ?  945  LEU B CD2   1 
ATOM   1563 N  N     . GLU B 2 32  ? -12.582 52.811  212.215 1.00 80.12  ?  946  GLU B N     1 
ATOM   1564 C  CA    . GLU B 2 32  ? -12.137 52.341  210.904 1.00 76.64  ?  946  GLU B CA    1 
ATOM   1565 C  C     . GLU B 2 32  ? -12.977 51.155  210.441 1.00 83.63  ?  946  GLU B C     1 
ATOM   1566 O  O     . GLU B 2 32  ? -13.494 51.138  209.315 1.00 85.90  ?  946  GLU B O     1 
ATOM   1567 C  CB    . GLU B 2 32  ? -10.654 51.964  210.966 1.00 78.71  ?  946  GLU B CB    1 
ATOM   1568 C  CG    . GLU B 2 32  ? -9.682  53.076  210.590 1.00 89.64  ?  946  GLU B CG    1 
ATOM   1569 C  CD    . GLU B 2 32  ? -9.361  53.095  209.105 1.00 105.28 ?  946  GLU B CD    1 
ATOM   1570 O  OE1   . GLU B 2 32  ? -8.465  53.867  208.696 1.00 105.70 ?  946  GLU B OE1   1 
ATOM   1571 O  OE2   . GLU B 2 32  ? -10.000 52.333  208.349 1.00 110.30 -1 946  GLU B OE2   1 
ATOM   1572 N  N     . ALA B 2 33  ? -13.146 50.166  211.324 1.00 93.21  ?  947  ALA B N     1 
ATOM   1573 C  CA    . ALA B 2 33  ? -13.935 48.978  211.014 1.00 99.92  ?  947  ALA B CA    1 
ATOM   1574 C  C     . ALA B 2 33  ? -15.344 49.348  210.564 1.00 98.04  ?  947  ALA B C     1 
ATOM   1575 O  O     . ALA B 2 33  ? -15.767 49.020  209.438 1.00 107.32 ?  947  ALA B O     1 
ATOM   1576 C  CB    . ALA B 2 33  ? -13.985 48.064  212.241 1.00 102.96 ?  947  ALA B CB    1 
ATOM   1577 N  N     . GLU B 2 34  ? -16.093 50.028  211.443 1.00 91.48  ?  948  GLU B N     1 
ATOM   1578 C  CA    . GLU B 2 34  ? -17.427 50.469  211.056 1.00 82.94  ?  948  GLU B CA    1 
ATOM   1579 C  C     . GLU B 2 34  ? -17.382 51.181  209.714 1.00 86.86  ?  948  GLU B C     1 
ATOM   1580 O  O     . GLU B 2 34  ? -18.153 50.852  208.813 1.00 92.01  ?  948  GLU B O     1 
ATOM   1581 C  CB    . GLU B 2 34  ? -18.045 51.375  212.125 1.00 79.64  ?  948  GLU B CB    1 
ATOM   1582 C  CG    . GLU B 2 34  ? -19.549 51.143  212.306 1.00 86.31  ?  948  GLU B CG    1 
ATOM   1583 C  CD    . GLU B 2 34  ? -20.321 52.399  212.673 1.00 90.71  ?  948  GLU B CD    1 
ATOM   1584 O  OE1   . GLU B 2 34  ? -21.497 52.512  212.259 1.00 86.24  ?  948  GLU B OE1   1 
ATOM   1585 O  OE2   . GLU B 2 34  ? -19.760 53.268  213.374 1.00 96.10  -1 948  GLU B OE2   1 
ATOM   1586 N  N     . GLY B 2 35  ? -16.429 52.101  209.541 1.00 87.75  ?  949  GLY B N     1 
ATOM   1587 C  CA    . GLY B 2 35  ? -16.362 52.890  208.318 1.00 81.72  ?  949  GLY B CA    1 
ATOM   1588 C  C     . GLY B 2 35  ? -16.285 52.052  207.054 1.00 82.80  ?  949  GLY B C     1 
ATOM   1589 O  O     . GLY B 2 35  ? -16.994 52.319  206.078 1.00 97.93  ?  949  GLY B O     1 
ATOM   1590 N  N     . VAL B 2 36  ? -15.426 51.028  207.050 1.00 66.53  ?  950  VAL B N     1 
ATOM   1591 C  CA    . VAL B 2 36  ? -15.361 50.136  205.890 1.00 69.41  ?  950  VAL B CA    1 
ATOM   1592 C  C     . VAL B 2 36  ? -16.713 49.460  205.663 1.00 74.31  ?  950  VAL B C     1 
ATOM   1593 O  O     . VAL B 2 36  ? -17.255 49.449  204.536 1.00 78.41  ?  950  VAL B O     1 
ATOM   1594 C  CB    . VAL B 2 36  ? -14.232 49.105  206.069 1.00 69.83  ?  950  VAL B CB    1 
ATOM   1595 C  CG1   . VAL B 2 36  ? -14.007 48.348  204.775 1.00 70.69  ?  950  VAL B CG1   1 
ATOM   1596 C  CG2   . VAL B 2 36  ? -12.944 49.789  206.520 1.00 67.61  ?  950  VAL B CG2   1 
ATOM   1597 N  N     . LYS B 2 37  ? -17.291 48.907  206.739 1.00 72.95  ?  951  LYS B N     1 
ATOM   1598 C  CA    . LYS B 2 37  ? -18.599 48.261  206.624 1.00 67.72  ?  951  LYS B CA    1 
ATOM   1599 C  C     . LYS B 2 37  ? -19.633 49.202  206.003 1.00 69.93  ?  951  LYS B C     1 
ATOM   1600 O  O     . LYS B 2 37  ? -20.342 48.843  205.045 1.00 80.59  ?  951  LYS B O     1 
ATOM   1601 C  CB    . LYS B 2 37  ? -19.062 47.779  208.002 1.00 70.81  ?  951  LYS B CB    1 
ATOM   1602 N  N     . LEU B 2 38  ? -19.702 50.432  206.522 1.00 73.23  ?  952  LEU B N     1 
ATOM   1603 C  CA    . LEU B 2 38  ? -20.674 51.407  206.044 1.00 78.37  ?  952  LEU B CA    1 
ATOM   1604 C  C     . LEU B 2 38  ? -20.480 51.729  204.574 1.00 78.94  ?  952  LEU B C     1 
ATOM   1605 O  O     . LEU B 2 38  ? -21.448 51.752  203.805 1.00 71.59  ?  952  LEU B O     1 
ATOM   1606 C  CB    . LEU B 2 38  ? -20.614 52.700  206.854 1.00 66.28  ?  952  LEU B CB    1 
ATOM   1607 C  CG    . LEU B 2 38  ? -21.056 52.708  208.307 1.00 64.84  ?  952  LEU B CG    1 
ATOM   1608 C  CD1   . LEU B 2 38  ? -19.972 53.160  209.267 1.00 69.55  ?  952  LEU B CD1   1 
ATOM   1609 C  CD2   . LEU B 2 38  ? -22.267 53.574  208.365 1.00 53.94  ?  952  LEU B CD2   1 
ATOM   1610 N  N     . GLU B 2 39  ? -19.235 51.989  204.163 1.00 87.69  ?  953  GLU B N     1 
ATOM   1611 C  CA    . GLU B 2 39  ? -19.022 52.407  202.782 1.00 91.90  ?  953  GLU B CA    1 
ATOM   1612 C  C     . GLU B 2 39  ? -19.454 51.324  201.800 1.00 92.91  ?  953  GLU B C     1 
ATOM   1613 O  O     . GLU B 2 39  ? -20.007 51.638  200.736 1.00 91.78  ?  953  GLU B O     1 
ATOM   1614 C  CB    . GLU B 2 39  ? -17.566 52.857  202.559 1.00 105.79 ?  953  GLU B CB    1 
ATOM   1615 C  CG    . GLU B 2 39  ? -16.455 51.789  202.564 1.00 126.56 ?  953  GLU B CG    1 
ATOM   1616 C  CD    . GLU B 2 39  ? -16.448 50.818  201.382 1.00 138.19 ?  953  GLU B CD    1 
ATOM   1617 O  OE1   . GLU B 2 39  ? -16.978 51.144  200.299 1.00 140.82 ?  953  GLU B OE1   1 
ATOM   1618 O  OE2   . GLU B 2 39  ? -15.916 49.707  201.552 1.00 142.93 -1 953  GLU B OE2   1 
ATOM   1619 N  N     . LEU B 2 40  ? -19.255 50.041  202.130 1.00 88.95  ?  954  LEU B N     1 
ATOM   1620 C  CA    . LEU B 2 40  ? -19.775 49.068  201.169 1.00 88.11  ?  954  LEU B CA    1 
ATOM   1621 C  C     . LEU B 2 40  ? -21.301 49.055  201.200 1.00 93.89  ?  954  LEU B C     1 
ATOM   1622 O  O     . LEU B 2 40  ? -21.937 49.174  200.148 1.00 101.02 ?  954  LEU B O     1 
ATOM   1623 C  CB    . LEU B 2 40  ? -19.188 47.668  201.375 1.00 88.65  ?  954  LEU B CB    1 
ATOM   1624 C  CG    . LEU B 2 40  ? -19.437 46.613  200.264 1.00 103.68 ?  954  LEU B CG    1 
ATOM   1625 C  CD1   . LEU B 2 40  ? -20.257 47.049  199.017 1.00 105.80 ?  954  LEU B CD1   1 
ATOM   1626 C  CD2   . LEU B 2 40  ? -18.108 46.016  199.789 1.00 101.99 ?  954  LEU B CD2   1 
ATOM   1627 N  N     . ALA B 2 41  ? -21.909 48.938  202.387 1.00 89.24  ?  955  ALA B N     1 
ATOM   1628 C  CA    . ALA B 2 41  ? -23.370 49.066  202.458 1.00 85.81  ?  955  ALA B CA    1 
ATOM   1629 C  C     . ALA B 2 41  ? -23.869 50.156  201.508 1.00 80.16  ?  955  ALA B C     1 
ATOM   1630 O  O     . ALA B 2 41  ? -24.858 49.978  200.768 1.00 73.52  ?  955  ALA B O     1 
ATOM   1631 C  CB    . ALA B 2 41  ? -23.790 49.370  203.901 1.00 91.68  ?  955  ALA B CB    1 
ATOM   1632 N  N     . LEU B 2 42  ? -23.093 51.237  201.430 1.00 84.86  ?  956  LEU B N     1 
ATOM   1633 C  CA    . LEU B 2 42  ? -23.384 52.392  200.595 1.00 82.42  ?  956  LEU B CA    1 
ATOM   1634 C  C     . LEU B 2 42  ? -23.315 52.071  199.107 1.00 93.62  ?  956  LEU B C     1 
ATOM   1635 O  O     . LEU B 2 42  ? -24.255 52.356  198.356 1.00 100.15 ?  956  LEU B O     1 
ATOM   1636 C  CB    . LEU B 2 42  ? -22.390 53.497  200.933 1.00 77.52  ?  956  LEU B CB    1 
ATOM   1637 C  CG    . LEU B 2 42  ? -22.952 54.731  200.290 1.00 83.40  ?  956  LEU B CG    1 
ATOM   1638 C  CD1   . LEU B 2 42  ? -24.080 54.973  201.231 1.00 86.90  ?  956  LEU B CD1   1 
ATOM   1639 C  CD2   . LEU B 2 42  ? -22.012 55.931  200.266 1.00 77.08  ?  956  LEU B CD2   1 
ATOM   1640 N  N     . ARG B 2 43  ? -22.165 51.554  198.661 1.00 96.26  ?  957  ARG B N     1 
ATOM   1641 C  CA    . ARG B 2 43  ? -21.953 51.241  197.245 1.00 101.55 ?  957  ARG B CA    1 
ATOM   1642 C  C     . ARG B 2 43  ? -23.148 50.534  196.638 1.00 111.08 ?  957  ARG B C     1 
ATOM   1643 O  O     . ARG B 2 43  ? -23.728 50.989  195.643 1.00 103.36 ?  957  ARG B O     1 
ATOM   1644 C  CB    . ARG B 2 43  ? -20.717 50.358  197.092 1.00 103.21 ?  957  ARG B CB    1 
ATOM   1645 C  CG    . ARG B 2 43  ? -19.498 50.924  197.730 1.00 106.25 ?  957  ARG B CG    1 
ATOM   1646 C  CD    . ARG B 2 43  ? -18.746 51.757  196.693 1.00 110.26 ?  957  ARG B CD    1 
ATOM   1647 N  NE    . ARG B 2 43  ? -17.464 52.212  197.202 1.00 108.23 ?  957  ARG B NE    1 
ATOM   1648 C  CZ    . ARG B 2 43  ? -16.655 53.058  196.573 1.00 107.68 ?  957  ARG B CZ    1 
ATOM   1649 N  NH1   . ARG B 2 43  ? -16.958 53.537  195.372 1.00 110.47 ?  957  ARG B NH1   1 
ATOM   1650 N  NH2   . ARG B 2 43  ? -15.517 53.420  197.146 1.00 109.97 ?  957  ARG B NH2   1 
ATOM   1651 N  N     . ARG B 2 44  ? -23.523 49.409  197.238 1.00 123.95 ?  958  ARG B N     1 
ATOM   1652 C  CA    . ARG B 2 44  ? -24.644 48.637  196.731 1.00 104.93 ?  958  ARG B CA    1 
ATOM   1653 C  C     . ARG B 2 44  ? -25.945 49.417  196.823 1.00 104.66 ?  958  ARG B C     1 
ATOM   1654 O  O     . ARG B 2 44  ? -26.739 49.398  195.874 1.00 103.58 ?  958  ARG B O     1 
ATOM   1655 C  CB    . ARG B 2 44  ? -24.766 47.313  197.488 1.00 102.29 ?  958  ARG B CB    1 
ATOM   1656 C  CG    . ARG B 2 44  ? -23.517 46.441  197.492 1.00 103.35 ?  958  ARG B CG    1 
ATOM   1657 C  CD    . ARG B 2 44  ? -23.697 45.282  198.467 1.00 115.47 ?  958  ARG B CD    1 
ATOM   1658 N  NE    . ARG B 2 44  ? -22.424 44.805  198.992 1.00 125.43 ?  958  ARG B NE    1 
ATOM   1659 C  CZ    . ARG B 2 44  ? -22.291 43.937  199.989 1.00 128.88 ?  958  ARG B CZ    1 
ATOM   1660 N  NH1   . ARG B 2 44  ? -23.360 43.429  200.590 1.00 137.62 ?  958  ARG B NH1   1 
ATOM   1661 N  NH2   . ARG B 2 44  ? -21.077 43.584  200.388 1.00 122.09 ?  958  ARG B NH2   1 
ATOM   1662 N  N     . GLN B 2 45  ? -26.178 50.127  197.940 1.00 108.97 ?  959  GLN B N     1 
ATOM   1663 C  CA    . GLN B 2 45  ? -27.538 50.600  198.211 1.00 119.86 ?  959  GLN B CA    1 
ATOM   1664 C  C     . GLN B 2 45  ? -28.137 51.436  197.074 1.00 119.70 ?  959  GLN B C     1 
ATOM   1665 O  O     . GLN B 2 45  ? -29.319 51.276  196.749 1.00 126.34 ?  959  GLN B O     1 
ATOM   1666 C  CB    . GLN B 2 45  ? -27.588 51.362  199.533 1.00 124.85 ?  959  GLN B CB    1 
ATOM   1667 C  CG    . GLN B 2 45  ? -27.927 50.430  200.690 1.00 137.53 ?  959  GLN B CG    1 
ATOM   1668 C  CD    . GLN B 2 45  ? -28.482 51.143  201.905 1.00 144.32 ?  959  GLN B CD    1 
ATOM   1669 O  OE1   . GLN B 2 45  ? -28.444 52.369  201.994 1.00 150.84 ?  959  GLN B OE1   1 
ATOM   1670 N  NE2   . GLN B 2 45  ? -29.009 50.370  202.853 1.00 139.22 ?  959  GLN B NE2   1 
ATOM   1671 N  N     . SER B 2 46  ? -27.355 52.319  196.445 1.00 116.13 ?  960  SER B N     1 
ATOM   1672 C  CA    . SER B 2 46  ? -27.919 53.152  195.385 1.00 115.99 ?  960  SER B CA    1 
ATOM   1673 C  C     . SER B 2 46  ? -26.918 53.374  194.260 1.00 126.68 ?  960  SER B C     1 
ATOM   1674 O  O     . SER B 2 46  ? -25.729 53.598  194.508 1.00 112.42 ?  960  SER B O     1 
ATOM   1675 C  CB    . SER B 2 46  ? -28.379 54.517  195.914 1.00 106.44 ?  960  SER B CB    1 
ATOM   1676 O  OG    . SER B 2 46  ? -27.294 55.258  196.435 1.00 105.33 ?  960  SER B OG    1 
ATOM   1677 N  N     . SER B 2 47  ? -27.424 53.348  193.021 1.00 142.59 ?  961  SER B N     1 
ATOM   1678 C  CA    . SER B 2 47  ? -26.580 53.585  191.854 1.00 145.00 ?  961  SER B CA    1 
ATOM   1679 C  C     . SER B 2 47  ? -26.299 55.067  191.641 1.00 142.39 ?  961  SER B C     1 
ATOM   1680 O  O     . SER B 2 47  ? -25.224 55.424  191.147 1.00 143.87 ?  961  SER B O     1 
ATOM   1681 C  CB    . SER B 2 47  ? -27.240 53.009  190.602 1.00 149.03 ?  961  SER B CB    1 
ATOM   1682 O  OG    . SER B 2 47  ? -28.276 53.860  190.139 1.00 148.06 ?  961  SER B OG    1 
ATOM   1683 N  N     . SER B 2 48  ? -27.247 55.933  191.991 1.00 117.29 ?  962  SER B N     1 
ATOM   1684 C  CA    . SER B 2 48  ? -27.132 57.349  191.653 1.00 94.67  ?  962  SER B CA    1 
ATOM   1685 C  C     . SER B 2 48  ? -25.915 57.970  192.329 1.00 74.03  ?  962  SER B C     1 
ATOM   1686 O  O     . SER B 2 48  ? -25.748 57.830  193.545 1.00 75.87  ?  962  SER B O     1 
ATOM   1687 C  CB    . SER B 2 48  ? -28.397 58.097  192.054 1.00 98.36  ?  962  SER B CB    1 
ATOM   1688 O  OG    . SER B 2 48  ? -28.222 59.495  191.904 1.00 104.58 ?  962  SER B OG    1 
ATOM   1689 N  N     . PRO B 2 49  ? -25.051 58.660  191.581 1.00 61.64  ?  963  PRO B N     1 
ATOM   1690 C  CA    . PRO B 2 49  ? -23.822 59.201  192.192 1.00 68.55  ?  963  PRO B CA    1 
ATOM   1691 C  C     . PRO B 2 49  ? -24.068 60.275  193.245 1.00 74.27  ?  963  PRO B C     1 
ATOM   1692 O  O     . PRO B 2 49  ? -23.499 60.202  194.347 1.00 71.17  ?  963  PRO B O     1 
ATOM   1693 C  CB    . PRO B 2 49  ? -23.047 59.733  190.976 1.00 60.90  ?  963  PRO B CB    1 
ATOM   1694 C  CG    . PRO B 2 49  ? -24.081 59.932  189.909 1.00 63.39  ?  963  PRO B CG    1 
ATOM   1695 C  CD    . PRO B 2 49  ? -25.083 58.851  190.123 1.00 59.28  ?  963  PRO B CD    1 
ATOM   1696 N  N     . GLU B 2 50  ? -24.897 61.282  192.947 1.00 80.64  ?  964  GLU B N     1 
ATOM   1697 C  CA    . GLU B 2 50  ? -25.175 62.300  193.958 1.00 93.75  ?  964  GLU B CA    1 
ATOM   1698 C  C     . GLU B 2 50  ? -25.986 61.722  195.112 1.00 88.55  ?  964  GLU B C     1 
ATOM   1699 O  O     . GLU B 2 50  ? -25.871 62.183  196.252 1.00 81.08  ?  964  GLU B O     1 
ATOM   1700 C  CB    . GLU B 2 50  ? -25.878 63.515  193.339 1.00 85.20  ?  964  GLU B CB    1 
ATOM   1701 C  CG    . GLU B 2 50  ? -26.295 64.582  194.377 1.00 82.94  ?  964  GLU B CG    1 
ATOM   1702 C  CD    . GLU B 2 50  ? -25.480 65.868  194.276 1.00 88.40  ?  964  GLU B CD    1 
ATOM   1703 O  OE1   . GLU B 2 50  ? -25.545 66.699  195.217 1.00 90.75  ?  964  GLU B OE1   1 
ATOM   1704 O  OE2   . GLU B 2 50  ? -24.775 66.038  193.259 1.00 88.96  -1 964  GLU B OE2   1 
ATOM   1705 N  N     . GLN B 2 51  ? -26.808 60.709  194.839 1.00 85.91  ?  965  GLN B N     1 
ATOM   1706 C  CA    . GLN B 2 51  ? -27.449 59.974  195.925 1.00 82.02  ?  965  GLN B CA    1 
ATOM   1707 C  C     . GLN B 2 51  ? -26.407 59.352  196.844 1.00 73.06  ?  965  GLN B C     1 
ATOM   1708 O  O     . GLN B 2 51  ? -26.538 59.402  198.076 1.00 84.00  ?  965  GLN B O     1 
ATOM   1709 C  CB    . GLN B 2 51  ? -28.375 58.897  195.363 1.00 86.77  ?  965  GLN B CB    1 
ATOM   1710 C  CG    . GLN B 2 51  ? -29.035 58.041  196.423 1.00 100.38 ?  965  GLN B CG    1 
ATOM   1711 C  CD    . GLN B 2 51  ? -29.932 58.837  197.342 1.00 105.10 ?  965  GLN B CD    1 
ATOM   1712 O  OE1   . GLN B 2 51  ? -30.592 59.786  196.917 1.00 104.61 ?  965  GLN B OE1   1 
ATOM   1713 N  NE2   . GLN B 2 51  ? -29.964 58.452  198.611 1.00 100.16 ?  965  GLN B NE2   1 
ATOM   1714 N  N     . GLN B 2 52  ? -25.367 58.749  196.259 1.00 64.00  ?  966  GLN B N     1 
ATOM   1715 C  CA    . GLN B 2 52  ? -24.217 58.317  197.045 1.00 74.27  ?  966  GLN B CA    1 
ATOM   1716 C  C     . GLN B 2 52  ? -23.700 59.457  197.908 1.00 76.22  ?  966  GLN B C     1 
ATOM   1717 O  O     . GLN B 2 52  ? -23.459 59.282  199.104 1.00 71.32  ?  966  GLN B O     1 
ATOM   1718 C  CB    . GLN B 2 52  ? -23.093 57.815  196.139 1.00 87.26  ?  966  GLN B CB    1 
ATOM   1719 C  CG    . GLN B 2 52  ? -23.213 56.401  195.623 1.00 92.17  ?  966  GLN B CG    1 
ATOM   1720 C  CD    . GLN B 2 52  ? -22.065 56.057  194.691 1.00 102.16 ?  966  GLN B CD    1 
ATOM   1721 O  OE1   . GLN B 2 52  ? -21.421 56.945  194.124 1.00 103.83 ?  966  GLN B OE1   1 
ATOM   1722 N  NE2   . GLN B 2 52  ? -21.790 54.767  194.540 1.00 104.82 ?  966  GLN B NE2   1 
ATOM   1723 N  N     . LYS B 2 53  ? -23.522 60.637  197.307 1.00 70.21  ?  967  LYS B N     1 
ATOM   1724 C  CA    . LYS B 2 53  ? -23.015 61.795  198.045 1.00 60.04  ?  967  LYS B CA    1 
ATOM   1725 C  C     . LYS B 2 53  ? -23.884 62.112  199.261 1.00 65.97  ?  967  LYS B C     1 
ATOM   1726 O  O     . LYS B 2 53  ? -23.379 62.263  200.383 1.00 71.20  ?  967  LYS B O     1 
ATOM   1727 C  CB    . LYS B 2 53  ? -22.929 62.992  197.093 1.00 58.48  ?  967  LYS B CB    1 
ATOM   1728 C  CG    . LYS B 2 53  ? -22.815 64.373  197.723 1.00 47.40  ?  967  LYS B CG    1 
ATOM   1729 C  CD    . LYS B 2 53  ? -22.777 65.414  196.606 1.00 43.18  ?  967  LYS B CD    1 
ATOM   1730 C  CE    . LYS B 2 53  ? -22.942 66.836  197.099 1.00 50.01  ?  967  LYS B CE    1 
ATOM   1731 N  NZ    . LYS B 2 53  ? -23.235 67.758  195.960 1.00 49.30  ?  967  LYS B NZ    1 
ATOM   1732 N  N     . LYS B 2 54  ? -25.202 62.203  199.055 1.00 69.23  ?  968  LYS B N     1 
ATOM   1733 C  CA    . LYS B 2 54  ? -26.120 62.457  200.163 1.00 64.21  ?  968  LYS B CA    1 
ATOM   1734 C  C     . LYS B 2 54  ? -25.972 61.407  201.253 1.00 60.03  ?  968  LYS B C     1 
ATOM   1735 O  O     . LYS B 2 54  ? -25.917 61.735  202.444 1.00 71.60  ?  968  LYS B O     1 
ATOM   1736 C  CB    . LYS B 2 54  ? -27.563 62.477  199.658 1.00 59.82  ?  968  LYS B CB    1 
ATOM   1737 C  CG    . LYS B 2 54  ? -27.772 63.292  198.405 1.00 66.12  ?  968  LYS B CG    1 
ATOM   1738 C  CD    . LYS B 2 54  ? -28.949 64.233  198.532 1.00 68.89  ?  968  LYS B CD    1 
ATOM   1739 C  CE    . LYS B 2 54  ? -29.213 64.943  197.218 1.00 77.70  ?  968  LYS B CE    1 
ATOM   1740 N  NZ    . LYS B 2 54  ? -29.840 66.278  197.420 1.00 87.50  ?  968  LYS B NZ    1 
ATOM   1741 N  N     . LEU B 2 55  ? -25.907 60.134  200.863 1.00 63.63  ?  969  LEU B N     1 
ATOM   1742 C  CA    . LEU B 2 55  ? -25.774 59.068  201.849 1.00 64.57  ?  969  LEU B CA    1 
ATOM   1743 C  C     . LEU B 2 55  ? -24.450 59.170  202.605 1.00 64.60  ?  969  LEU B C     1 
ATOM   1744 O  O     . LEU B 2 55  ? -24.388 58.913  203.813 1.00 66.65  ?  969  LEU B O     1 
ATOM   1745 C  CB    . LEU B 2 55  ? -25.915 57.721  201.149 1.00 65.57  ?  969  LEU B CB    1 
ATOM   1746 C  CG    . LEU B 2 55  ? -27.329 57.296  200.745 1.00 78.20  ?  969  LEU B CG    1 
ATOM   1747 C  CD1   . LEU B 2 55  ? -27.315 55.965  200.006 1.00 75.31  ?  969  LEU B CD1   1 
ATOM   1748 C  CD2   . LEU B 2 55  ? -28.235 57.207  201.966 1.00 77.43  ?  969  LEU B CD2   1 
ATOM   1749 N  N     . TRP B 2 56  ? -23.377 59.545  201.906 1.00 60.12  ?  970  TRP B N     1 
ATOM   1750 C  CA    . TRP B 2 56  ? -22.072 59.685  202.544 1.00 63.08  ?  970  TRP B CA    1 
ATOM   1751 C  C     . TRP B 2 56  ? -22.100 60.789  203.589 1.00 69.52  ?  970  TRP B C     1 
ATOM   1752 O  O     . TRP B 2 56  ? -21.621 60.607  204.715 1.00 58.65  ?  970  TRP B O     1 
ATOM   1753 C  CB    . TRP B 2 56  ? -21.000 59.967  201.491 1.00 50.13  ?  970  TRP B CB    1 
ATOM   1754 C  CG    . TRP B 2 56  ? -19.598 60.075  202.036 1.00 53.08  ?  970  TRP B CG    1 
ATOM   1755 C  CD1   . TRP B 2 56  ? -18.673 59.074  202.123 1.00 62.65  ?  970  TRP B CD1   1 
ATOM   1756 C  CD2   . TRP B 2 56  ? -18.963 61.253  202.555 1.00 58.19  ?  970  TRP B CD2   1 
ATOM   1757 N  NE1   . TRP B 2 56  ? -17.504 59.554  202.668 1.00 67.33  ?  970  TRP B NE1   1 
ATOM   1758 C  CE2   . TRP B 2 56  ? -17.657 60.888  202.942 1.00 74.60  ?  970  TRP B CE2   1 
ATOM   1759 C  CE3   . TRP B 2 56  ? -19.371 62.578  202.732 1.00 53.42  ?  970  TRP B CE3   1 
ATOM   1760 C  CZ2   . TRP B 2 56  ? -16.758 61.801  203.496 1.00 80.81  ?  970  TRP B CZ2   1 
ATOM   1761 C  CZ3   . TRP B 2 56  ? -18.478 63.482  203.281 1.00 62.05  ?  970  TRP B CZ3   1 
ATOM   1762 C  CH2   . TRP B 2 56  ? -17.188 63.090  203.657 1.00 69.02  ?  970  TRP B CH2   1 
ATOM   1763 N  N     . VAL B 2 57  ? -22.654 61.951  203.229 1.00 71.53  ?  971  VAL B N     1 
ATOM   1764 C  CA    . VAL B 2 57  ? -22.876 62.989  204.231 1.00 55.32  ?  971  VAL B CA    1 
ATOM   1765 C  C     . VAL B 2 57  ? -23.690 62.428  205.387 1.00 54.59  ?  971  VAL B C     1 
ATOM   1766 O  O     . VAL B 2 57  ? -23.441 62.746  206.556 1.00 70.74  ?  971  VAL B O     1 
ATOM   1767 C  CB    . VAL B 2 57  ? -23.561 64.212  203.593 1.00 44.44  ?  971  VAL B CB    1 
ATOM   1768 C  CG1   . VAL B 2 57  ? -23.900 65.254  204.649 1.00 41.67  ?  971  VAL B CG1   1 
ATOM   1769 C  CG2   . VAL B 2 57  ? -22.673 64.806  202.520 1.00 54.87  ?  971  VAL B CG2   1 
ATOM   1770 N  N     . GLY B 2 58  ? -24.647 61.550  205.076 1.00 61.21  ?  972  GLY B N     1 
ATOM   1771 C  CA    . GLY B 2 58  ? -25.501 60.983  206.105 1.00 74.56  ?  972  GLY B CA    1 
ATOM   1772 C  C     . GLY B 2 58  ? -24.728 60.357  207.253 1.00 85.36  ?  972  GLY B C     1 
ATOM   1773 O  O     . GLY B 2 58  ? -24.879 60.761  208.405 1.00 89.42  ?  972  GLY B O     1 
ATOM   1774 N  N     . GLN B 2 59  ? -23.884 59.369  206.959 1.00 84.42  ?  973  GLN B N     1 
ATOM   1775 C  CA    . GLN B 2 59  ? -23.269 58.613  208.042 1.00 81.34  ?  973  GLN B CA    1 
ATOM   1776 C  C     . GLN B 2 59  ? -21.748 58.586  207.987 1.00 75.97  ?  973  GLN B C     1 
ATOM   1777 O  O     . GLN B 2 59  ? -21.110 58.812  209.018 1.00 94.00  ?  973  GLN B O     1 
ATOM   1778 C  CB    . GLN B 2 59  ? -23.833 57.191  208.079 1.00 96.29  ?  973  GLN B CB    1 
ATOM   1779 C  CG    . GLN B 2 59  ? -23.471 56.461  209.354 1.00 108.36 ?  973  GLN B CG    1 
ATOM   1780 C  CD    . GLN B 2 59  ? -24.608 55.588  209.867 1.00 115.88 ?  973  GLN B CD    1 
ATOM   1781 O  OE1   . GLN B 2 59  ? -25.251 54.876  209.097 1.00 115.41 ?  973  GLN B OE1   1 
ATOM   1782 N  NE2   . GLN B 2 59  ? -24.836 55.615  211.174 1.00 112.89 ?  973  GLN B NE2   1 
ATOM   1783 N  N     . LEU B 2 60  ? -21.142 58.304  206.831 1.00 61.15  ?  974  LEU B N     1 
ATOM   1784 C  CA    . LEU B 2 60  ? -19.688 58.139  206.795 1.00 70.29  ?  974  LEU B CA    1 
ATOM   1785 C  C     . LEU B 2 60  ? -18.941 59.392  207.261 1.00 77.02  ?  974  LEU B C     1 
ATOM   1786 O  O     . LEU B 2 60  ? -17.868 59.282  207.876 1.00 79.08  ?  974  LEU B O     1 
ATOM   1787 C  CB    . LEU B 2 60  ? -19.238 57.739  205.388 1.00 55.73  ?  974  LEU B CB    1 
ATOM   1788 N  N     . LEU B 2 61  ? -19.509 60.577  207.023 1.00 67.11  ?  975  LEU B N     1 
ATOM   1789 C  CA    . LEU B 2 61  ? -18.808 61.827  207.302 1.00 62.91  ?  975  LEU B CA    1 
ATOM   1790 C  C     . LEU B 2 61  ? -18.599 62.034  208.802 1.00 63.76  ?  975  LEU B C     1 
ATOM   1791 O  O     . LEU B 2 61  ? -17.471 62.266  209.258 1.00 67.30  ?  975  LEU B O     1 
ATOM   1792 C  CB    . LEU B 2 61  ? -19.577 63.000  206.686 1.00 60.88  ?  975  LEU B CB    1 
ATOM   1793 C  CG    . LEU B 2 61  ? -19.352 64.393  207.274 1.00 69.27  ?  975  LEU B CG    1 
ATOM   1794 C  CD1   . LEU B 2 61  ? -17.922 64.806  207.053 1.00 80.48  ?  975  LEU B CD1   1 
ATOM   1795 C  CD2   . LEU B 2 61  ? -20.273 65.398  206.609 1.00 70.43  ?  975  LEU B CD2   1 
ATOM   1796 N  N     . GLN B 2 62  ? -19.688 61.978  209.578 1.00 75.00  ?  976  GLN B N     1 
ATOM   1797 C  CA    . GLN B 2 62  ? -19.586 62.141  211.030 1.00 66.15  ?  976  GLN B CA    1 
ATOM   1798 C  C     . GLN B 2 62  ? -18.551 61.191  211.617 1.00 52.25  ?  976  GLN B C     1 
ATOM   1799 O  O     . GLN B 2 62  ? -17.748 61.580  212.478 1.00 56.58  ?  976  GLN B O     1 
ATOM   1800 C  CB    . GLN B 2 62  ? -20.949 61.914  211.694 1.00 70.33  ?  976  GLN B CB    1 
ATOM   1801 C  CG    . GLN B 2 62  ? -22.082 62.765  211.136 1.00 79.61  ?  976  GLN B CG    1 
ATOM   1802 C  CD    . GLN B 2 62  ? -23.080 63.173  212.204 1.00 86.81  ?  976  GLN B CD    1 
ATOM   1803 O  OE1   . GLN B 2 62  ? -23.641 62.327  212.905 1.00 95.65  ?  976  GLN B OE1   1 
ATOM   1804 N  NE2   . GLN B 2 62  ? -23.304 64.477  212.335 1.00 81.03  ?  976  GLN B NE2   1 
ATOM   1805 N  N     . LEU B 2 63  ? -18.546 59.945  211.143 1.00 56.40  ?  977  LEU B N     1 
ATOM   1806 C  CA    . LEU B 2 63  ? -17.509 58.993  211.522 1.00 60.83  ?  977  LEU B CA    1 
ATOM   1807 C  C     . LEU B 2 63  ? -16.122 59.541  211.214 1.00 61.14  ?  977  LEU B C     1 
ATOM   1808 O  O     . LEU B 2 63  ? -15.220 59.495  212.063 1.00 68.48  ?  977  LEU B O     1 
ATOM   1809 C  CB    . LEU B 2 63  ? -17.748 57.669  210.796 1.00 64.46  ?  977  LEU B CB    1 
ATOM   1810 C  CG    . LEU B 2 63  ? -16.825 56.482  211.068 1.00 58.12  ?  977  LEU B CG    1 
ATOM   1811 C  CD1   . LEU B 2 63  ? -17.608 55.191  210.976 1.00 63.80  ?  977  LEU B CD1   1 
ATOM   1812 C  CD2   . LEU B 2 63  ? -15.638 56.453  210.122 1.00 52.25  ?  977  LEU B CD2   1 
ATOM   1813 N  N     . VAL B 2 64  ? -15.933 60.066  209.997 1.00 65.37  ?  978  VAL B N     1 
ATOM   1814 C  CA    . VAL B 2 64  ? -14.627 60.594  209.601 1.00 56.14  ?  978  VAL B CA    1 
ATOM   1815 C  C     . VAL B 2 64  ? -14.161 61.671  210.573 1.00 43.19  ?  978  VAL B C     1 
ATOM   1816 O  O     . VAL B 2 64  ? -12.978 61.731  210.935 1.00 51.52  ?  978  VAL B O     1 
ATOM   1817 C  CB    . VAL B 2 64  ? -14.673 61.118  208.153 1.00 51.90  ?  978  VAL B CB    1 
ATOM   1818 C  CG1   . VAL B 2 64  ? -13.449 61.975  207.852 1.00 43.08  ?  978  VAL B CG1   1 
ATOM   1819 C  CG2   . VAL B 2 64  ? -14.750 59.960  207.175 1.00 56.41  ?  978  VAL B CG2   1 
ATOM   1820 N  N     . ASP B 2 65  ? -15.079 62.528  211.025 1.00 42.37  ?  979  ASP B N     1 
ATOM   1821 C  CA    . ASP B 2 65  ? -14.670 63.602  211.927 1.00 59.25  ?  979  ASP B CA    1 
ATOM   1822 C  C     . ASP B 2 65  ? -14.379 63.080  213.332 1.00 64.94  ?  979  ASP B C     1 
ATOM   1823 O  O     . ASP B 2 65  ? -13.453 63.556  213.997 1.00 52.00  ?  979  ASP B O     1 
ATOM   1824 C  CB    . ASP B 2 65  ? -15.724 64.707  211.954 1.00 78.09  ?  979  ASP B CB    1 
ATOM   1825 C  CG    . ASP B 2 65  ? -16.026 65.247  210.574 1.00 112.71 ?  979  ASP B CG    1 
ATOM   1826 O  OD1   . ASP B 2 65  ? -16.079 66.489  210.429 1.00 126.03 ?  979  ASP B OD1   1 
ATOM   1827 O  OD2   . ASP B 2 65  ? -16.219 64.437  209.642 1.00 119.83 -1 979  ASP B OD2   1 
ATOM   1828 N  N     . LYS B 2 66  ? -15.177 62.126  213.812 1.00 57.05  ?  980  LYS B N     1 
ATOM   1829 C  CA    . LYS B 2 66  ? -14.823 61.456  215.060 1.00 51.33  ?  980  LYS B CA    1 
ATOM   1830 C  C     . LYS B 2 66  ? -13.393 60.924  214.991 1.00 53.48  ?  980  LYS B C     1 
ATOM   1831 O  O     . LYS B 2 66  ? -12.578 61.152  215.903 1.00 60.53  ?  980  LYS B O     1 
ATOM   1832 C  CB    . LYS B 2 66  ? -15.821 60.331  215.353 1.00 47.92  ?  980  LYS B CB    1 
ATOM   1833 N  N     . LYS B 2 67  ? -13.061 60.244  213.890 1.00 44.49  ?  981  LYS B N     1 
ATOM   1834 C  CA    . LYS B 2 67  ? -11.680 59.844  213.633 1.00 62.64  ?  981  LYS B CA    1 
ATOM   1835 C  C     . LYS B 2 67  ? -10.728 61.027  213.783 1.00 58.74  ?  981  LYS B C     1 
ATOM   1836 O  O     . LYS B 2 67  ? -9.716  60.957  214.498 1.00 57.36  ?  981  LYS B O     1 
ATOM   1837 C  CB    . LYS B 2 67  ? -11.554 59.261  212.222 1.00 56.98  ?  981  LYS B CB    1 
ATOM   1838 C  CG    . LYS B 2 67  ? -12.229 57.925  211.985 1.00 54.88  ?  981  LYS B CG    1 
ATOM   1839 C  CD    . LYS B 2 67  ? -12.264 57.646  210.492 1.00 63.23  ?  981  LYS B CD    1 
ATOM   1840 C  CE    . LYS B 2 67  ? -11.789 56.246  210.154 1.00 75.31  ?  981  LYS B CE    1 
ATOM   1841 N  NZ    . LYS B 2 67  ? -11.789 56.022  208.678 1.00 76.79  ?  981  LYS B NZ    1 
ATOM   1842 N  N     . ASN B 2 68  ? -11.047 62.132  213.107 1.00 47.01  ?  982  ASN B N     1 
ATOM   1843 C  CA    . ASN B 2 68  ? -10.104 63.241  213.036 1.00 52.73  ?  982  ASN B CA    1 
ATOM   1844 C  C     . ASN B 2 68  ? -9.833  63.829  214.414 1.00 53.63  ?  982  ASN B C     1 
ATOM   1845 O  O     . ASN B 2 68  ? -8.675  64.032  214.794 1.00 43.71  ?  982  ASN B O     1 
ATOM   1846 C  CB    . ASN B 2 68  ? -10.618 64.319  212.087 1.00 53.27  ?  982  ASN B CB    1 
ATOM   1847 C  CG    . ASN B 2 68  ? -9.678  65.498  212.003 1.00 60.71  ?  982  ASN B CG    1 
ATOM   1848 O  OD1   . ASN B 2 68  ? -8.462  65.327  211.921 1.00 72.47  ?  982  ASN B OD1   1 
ATOM   1849 N  ND2   . ASN B 2 68  ? -10.230 66.703  212.046 1.00 70.53  ?  982  ASN B ND2   1 
ATOM   1850 N  N     . SER B 2 69  ? -10.893 64.111  215.179 1.00 59.90  ?  983  SER B N     1 
ATOM   1851 C  CA    . SER B 2 69  ? -10.716 64.675  216.513 1.00 49.73  ?  983  SER B CA    1 
ATOM   1852 C  C     . SER B 2 69  ? -9.986  63.708  217.434 1.00 46.60  ?  983  SER B C     1 
ATOM   1853 O  O     . SER B 2 69  ? -9.250  64.141  218.336 1.00 55.65  ?  983  SER B O     1 
ATOM   1854 C  CB    . SER B 2 69  ? -12.071 65.073  217.098 1.00 57.84  ?  983  SER B CB    1 
ATOM   1855 O  OG    . SER B 2 69  ? -13.032 64.050  216.917 1.00 74.68  ?  983  SER B OG    1 
ATOM   1856 N  N     . LEU B 2 70  ? -10.157 62.399  217.215 1.00 52.82  ?  984  LEU B N     1 
ATOM   1857 C  CA    . LEU B 2 70  ? -9.332  61.432  217.935 1.00 53.80  ?  984  LEU B CA    1 
ATOM   1858 C  C     . LEU B 2 70  ? -7.849  61.644  217.639 1.00 51.32  ?  984  LEU B C     1 
ATOM   1859 O  O     . LEU B 2 70  ? -7.023  61.729  218.561 1.00 53.29  ?  984  LEU B O     1 
ATOM   1860 C  CB    . LEU B 2 70  ? -9.761  60.009  217.579 1.00 60.28  ?  984  LEU B CB    1 
ATOM   1861 C  CG    . LEU B 2 70  ? -10.843 59.413  218.482 1.00 58.50  ?  984  LEU B CG    1 
ATOM   1862 C  CD1   . LEU B 2 70  ? -11.342 58.080  217.955 1.00 69.77  ?  984  LEU B CD1   1 
ATOM   1863 C  CD2   . LEU B 2 70  ? -10.295 59.248  219.881 1.00 66.75  ?  984  LEU B CD2   1 
ATOM   1864 N  N     . VAL B 2 71  ? -7.493  61.747  216.353 1.00 59.59  ?  985  VAL B N     1 
ATOM   1865 C  CA    . VAL B 2 71  ? -6.090  61.953  215.985 1.00 53.35  ?  985  VAL B CA    1 
ATOM   1866 C  C     . VAL B 2 71  ? -5.563  63.262  216.566 1.00 52.88  ?  985  VAL B C     1 
ATOM   1867 O  O     . VAL B 2 71  ? -4.435  63.327  217.075 1.00 53.51  ?  985  VAL B O     1 
ATOM   1868 C  CB    . VAL B 2 71  ? -5.929  61.912  214.454 1.00 41.81  ?  985  VAL B CB    1 
ATOM   1869 C  CG1   . VAL B 2 71  ? -4.484  62.173  214.065 1.00 36.84  ?  985  VAL B CG1   1 
ATOM   1870 C  CG2   . VAL B 2 71  ? -6.406  60.577  213.905 1.00 37.62  ?  985  VAL B CG2   1 
ATOM   1871 N  N     . ALA B 2 72  ? -6.367  64.326  216.487 1.00 49.77  ?  986  ALA B N     1 
ATOM   1872 C  CA    . ALA B 2 72  ? -5.978  65.615  217.049 1.00 31.98  ?  986  ALA B CA    1 
ATOM   1873 C  C     . ALA B 2 72  ? -5.622  65.482  218.522 1.00 44.24  ?  986  ALA B C     1 
ATOM   1874 O  O     . ALA B 2 72  ? -4.559  65.943  218.963 1.00 52.90  ?  986  ALA B O     1 
ATOM   1875 C  CB    . ALA B 2 72  ? -7.108  66.625  216.860 1.00 32.44  ?  986  ALA B CB    1 
ATOM   1876 N  N     . GLU B 2 73  ? -6.504  64.841  219.301 1.00 55.54  ?  987  GLU B N     1 
ATOM   1877 C  CA    . GLU B 2 73  ? -6.198  64.597  220.709 1.00 63.83  ?  987  GLU B CA    1 
ATOM   1878 C  C     . GLU B 2 73  ? -4.891  63.826  220.864 1.00 63.20  ?  987  GLU B C     1 
ATOM   1879 O  O     . GLU B 2 73  ? -4.054  64.167  221.716 1.00 53.06  ?  987  GLU B O     1 
ATOM   1880 C  CB    . GLU B 2 73  ? -7.350  63.846  221.375 1.00 63.12  ?  987  GLU B CB    1 
ATOM   1881 C  CG    . GLU B 2 73  ? -7.086  63.459  222.819 1.00 79.99  ?  987  GLU B CG    1 
ATOM   1882 C  CD    . GLU B 2 73  ? -8.336  62.977  223.539 1.00 96.19  ?  987  GLU B CD    1 
ATOM   1883 O  OE1   . GLU B 2 73  ? -8.376  63.069  224.784 1.00 99.43  ?  987  GLU B OE1   1 
ATOM   1884 O  OE2   . GLU B 2 73  ? -9.278  62.508  222.863 1.00 104.57 -1 987  GLU B OE2   1 
ATOM   1885 N  N     . GLU B 2 74  ? -4.692  62.795  220.034 1.00 64.01  ?  988  GLU B N     1 
ATOM   1886 C  CA    . GLU B 2 74  ? -3.454  62.024  220.099 1.00 59.32  ?  988  GLU B CA    1 
ATOM   1887 C  C     . GLU B 2 74  ? -2.240  62.936  219.967 1.00 57.11  ?  988  GLU B C     1 
ATOM   1888 O  O     . GLU B 2 74  ? -1.309  62.870  220.778 1.00 58.03  ?  988  GLU B O     1 
ATOM   1889 C  CB    . GLU B 2 74  ? -3.448  60.944  219.014 1.00 62.36  ?  988  GLU B CB    1 
ATOM   1890 C  CG    . GLU B 2 74  ? -2.609  59.720  219.349 1.00 71.28  ?  988  GLU B CG    1 
ATOM   1891 C  CD    . GLU B 2 74  ? -2.253  58.903  218.118 1.00 79.55  ?  988  GLU B CD    1 
ATOM   1892 O  OE1   . GLU B 2 74  ? -2.796  57.788  217.959 1.00 85.37  ?  988  GLU B OE1   1 
ATOM   1893 O  OE2   . GLU B 2 74  ? -1.424  59.376  217.311 1.00 69.59  -1 988  GLU B OE2   1 
ATOM   1894 N  N     . ALA B 2 75  ? -2.265  63.844  218.986 1.00 57.40  ?  989  ALA B N     1 
ATOM   1895 C  CA    . ALA B 2 75  ? -1.118  64.720  218.753 1.00 57.03  ?  989  ALA B CA    1 
ATOM   1896 C  C     . ALA B 2 75  ? -0.905  65.696  219.908 1.00 60.83  ?  989  ALA B C     1 
ATOM   1897 O  O     . ALA B 2 75  ? 0.243   65.960  220.303 1.00 53.36  ?  989  ALA B O     1 
ATOM   1898 C  CB    . ALA B 2 75  ? -1.299  65.475  217.435 1.00 62.10  ?  989  ALA B CB    1 
ATOM   1899 N  N     . GLU B 2 76  ? -1.994  66.249  220.458 1.00 55.26  ?  990  GLU B N     1 
ATOM   1900 C  CA    . GLU B 2 76  ? -1.867  67.128  221.619 1.00 62.11  ?  990  GLU B CA    1 
ATOM   1901 C  C     . GLU B 2 76  ? -1.157  66.419  222.769 1.00 60.03  ?  990  GLU B C     1 
ATOM   1902 O  O     . GLU B 2 76  ? -0.267  66.986  223.425 1.00 57.80  ?  990  GLU B O     1 
ATOM   1903 C  CB    . GLU B 2 76  ? -3.248  67.618  222.059 1.00 75.41  ?  990  GLU B CB    1 
ATOM   1904 C  CG    . GLU B 2 76  ? -3.827  68.739  221.209 1.00 98.24  ?  990  GLU B CG    1 
ATOM   1905 C  CD    . GLU B 2 76  ? -2.797  69.788  220.833 1.00 112.03 ?  990  GLU B CD    1 
ATOM   1906 O  OE1   . GLU B 2 76  ? -2.822  70.257  219.675 1.00 124.55 ?  990  GLU B OE1   1 
ATOM   1907 O  OE2   . GLU B 2 76  ? -1.961  70.138  221.693 1.00 116.66 -1 990  GLU B OE2   1 
ATOM   1908 N  N     . LEU B 2 77  ? -1.536  65.162  223.013 1.00 65.34  ?  991  LEU B N     1 
ATOM   1909 C  CA    . LEU B 2 77  ? -0.886  64.390  224.070 1.00 69.80  ?  991  LEU B CA    1 
ATOM   1910 C  C     . LEU B 2 77  ? 0.594   64.189  223.773 1.00 64.77  ?  991  LEU B C     1 
ATOM   1911 O  O     . LEU B 2 77  ? 1.452   64.421  224.634 1.00 68.42  ?  991  LEU B O     1 
ATOM   1912 C  CB    . LEU B 2 77  ? -1.600  63.048  224.255 1.00 62.74  ?  991  LEU B CB    1 
ATOM   1913 C  CG    . LEU B 2 77  ? -3.093  63.195  224.566 1.00 66.78  ?  991  LEU B CG    1 
ATOM   1914 C  CD1   . LEU B 2 77  ? -3.903  61.917  224.337 1.00 63.64  ?  991  LEU B CD1   1 
ATOM   1915 C  CD2   . LEU B 2 77  ? -3.262  63.705  225.988 1.00 72.14  ?  991  LEU B CD2   1 
ATOM   1916 N  N     . MET B 2 78  ? 0.917   63.784  222.545 1.00 61.23  ?  992  MET B N     1 
ATOM   1917 C  CA    . MET B 2 78  ? 2.313   63.565  222.189 1.00 61.23  ?  992  MET B CA    1 
ATOM   1918 C  C     . MET B 2 78  ? 3.156   64.832  222.276 1.00 64.77  ?  992  MET B C     1 
ATOM   1919 O  O     . MET B 2 78  ? 4.387   64.734  222.359 1.00 58.92  ?  992  MET B O     1 
ATOM   1920 C  CB    . MET B 2 78  ? 2.388   62.980  220.793 1.00 61.95  ?  992  MET B CB    1 
ATOM   1921 C  CG    . MET B 2 78  ? 1.356   61.911  220.564 1.00 79.15  ?  992  MET B CG    1 
ATOM   1922 S  SD    . MET B 2 78  ? 2.008   60.348  221.104 1.00 88.27  ?  992  MET B SD    1 
ATOM   1923 C  CE    . MET B 2 78  ? 3.584   60.526  220.356 1.00 79.73  ?  992  MET B CE    1 
ATOM   1924 N  N     . ILE B 2 79  ? 2.532   66.013  222.243 1.00 66.20  ?  993  ILE B N     1 
ATOM   1925 C  CA    . ILE B 2 79  ? 3.281   67.229  222.552 1.00 62.84  ?  993  ILE B CA    1 
ATOM   1926 C  C     . ILE B 2 79  ? 3.477   67.379  224.057 1.00 63.16  ?  993  ILE B C     1 
ATOM   1927 O  O     . ILE B 2 79  ? 4.580   67.714  224.517 1.00 68.84  ?  993  ILE B O     1 
ATOM   1928 C  CB    . ILE B 2 79  ? 2.595   68.470  221.954 1.00 60.84  ?  993  ILE B CB    1 
ATOM   1929 C  CG1   . ILE B 2 79  ? 2.567   68.399  220.430 1.00 54.23  ?  993  ILE B CG1   1 
ATOM   1930 C  CG2   . ILE B 2 79  ? 3.306   69.737  222.407 1.00 62.34  ?  993  ILE B CG2   1 
ATOM   1931 C  CD1   . ILE B 2 79  ? 1.877   69.587  219.795 1.00 62.06  ?  993  ILE B CD1   1 
ATOM   1932 N  N     . THR B 2 80  ? 2.419   67.157  224.854 1.00 72.99  ?  994  THR B N     1 
ATOM   1933 C  CA    . THR B 2 80  ? 2.598   67.241  226.306 1.00 80.05  ?  994  THR B CA    1 
ATOM   1934 C  C     . THR B 2 80  ? 3.715   66.313  226.777 1.00 79.83  ?  994  THR B C     1 
ATOM   1935 O  O     . THR B 2 80  ? 4.493   66.671  227.666 1.00 77.61  ?  994  THR B O     1 
ATOM   1936 C  CB    . THR B 2 80  ? 1.304   66.912  227.060 1.00 70.61  ?  994  THR B CB    1 
ATOM   1937 O  OG1   . THR B 2 80  ? 1.102   65.494  227.077 1.00 78.72  ?  994  THR B OG1   1 
ATOM   1938 C  CG2   . THR B 2 80  ? 0.100   67.597  226.434 1.00 69.20  ?  994  THR B CG2   1 
ATOM   1939 N  N     . VAL B 2 81  ? 3.801   65.116  226.191 1.00 71.73  ?  995  VAL B N     1 
ATOM   1940 C  CA    . VAL B 2 81  ? 4.910   64.201  226.470 1.00 52.95  ?  995  VAL B CA    1 
ATOM   1941 C  C     . VAL B 2 81  ? 6.246   64.902  226.246 1.00 53.64  ?  995  VAL B C     1 
ATOM   1942 O  O     . VAL B 2 81  ? 7.140   64.893  227.109 1.00 63.48  ?  995  VAL B O     1 
ATOM   1943 C  CB    . VAL B 2 81  ? 4.782   62.943  225.589 1.00 42.37  ?  995  VAL B CB    1 
ATOM   1944 C  CG1   . VAL B 2 81  ? 6.053   62.117  225.624 1.00 34.28  ?  995  VAL B CG1   1 
ATOM   1945 C  CG2   . VAL B 2 81  ? 3.578   62.108  226.004 1.00 34.48  ?  995  VAL B CG2   1 
ATOM   1946 N  N     . GLN B 2 82  ? 6.393   65.528  225.074 1.00 65.69  ?  996  GLN B N     1 
ATOM   1947 C  CA    . GLN B 2 82  ? 7.618   66.248  224.748 1.00 63.64  ?  996  GLN B CA    1 
ATOM   1948 C  C     . GLN B 2 82  ? 7.959   67.273  225.822 1.00 64.60  ?  996  GLN B C     1 
ATOM   1949 O  O     . GLN B 2 82  ? 9.112   67.363  226.259 1.00 56.86  ?  996  GLN B O     1 
ATOM   1950 C  CB    . GLN B 2 82  ? 7.476   66.925  223.384 1.00 58.11  ?  996  GLN B CB    1 
ATOM   1951 C  CG    . GLN B 2 82  ? 7.968   66.097  222.207 1.00 62.43  ?  996  GLN B CG    1 
ATOM   1952 C  CD    . GLN B 2 82  ? 7.508   66.647  220.867 1.00 66.58  ?  996  GLN B CD    1 
ATOM   1953 O  OE1   . GLN B 2 82  ? 8.284   67.269  220.141 1.00 90.20  ?  996  GLN B OE1   1 
ATOM   1954 N  NE2   . GLN B 2 82  ? 6.244   66.408  220.527 1.00 45.81  ?  996  GLN B NE2   1 
ATOM   1955 N  N     . GLU B 2 83  ? 6.966   68.047  226.268 1.00 59.51  ?  997  GLU B N     1 
ATOM   1956 C  CA    . GLU B 2 83  ? 7.225   69.008  227.336 1.00 68.21  ?  997  GLU B CA    1 
ATOM   1957 C  C     . GLU B 2 83  ? 7.625   68.298  228.627 1.00 72.31  ?  997  GLU B C     1 
ATOM   1958 O  O     . GLU B 2 83  ? 8.519   68.758  229.351 1.00 64.71  ?  997  GLU B O     1 
ATOM   1959 C  CB    . GLU B 2 83  ? 5.992   69.887  227.542 1.00 71.65  ?  997  GLU B CB    1 
ATOM   1960 C  CG    . GLU B 2 83  ? 5.585   70.636  226.283 1.00 77.47  ?  997  GLU B CG    1 
ATOM   1961 C  CD    . GLU B 2 83  ? 4.342   71.484  226.464 1.00 86.80  ?  997  GLU B CD    1 
ATOM   1962 O  OE1   . GLU B 2 83  ? 3.408   71.043  227.166 1.00 90.43  ?  997  GLU B OE1   1 
ATOM   1963 O  OE2   . GLU B 2 83  ? 4.301   72.597  225.899 1.00 90.93  -1 997  GLU B OE2   1 
ATOM   1964 N  N     . LEU B 2 84  ? 6.994   67.153  228.899 1.00 81.81  ?  998  LEU B N     1 
ATOM   1965 C  CA    . LEU B 2 84  ? 7.268   66.372  230.099 1.00 73.05  ?  998  LEU B CA    1 
ATOM   1966 C  C     . LEU B 2 84  ? 8.724   65.946  230.180 1.00 84.56  ?  998  LEU B C     1 
ATOM   1967 O  O     . LEU B 2 84  ? 9.272   65.833  231.283 1.00 112.23 ?  998  LEU B O     1 
ATOM   1968 C  CB    . LEU B 2 84  ? 6.371   65.135  230.126 1.00 70.72  ?  998  LEU B CB    1 
ATOM   1969 C  CG    . LEU B 2 84  ? 5.727   64.694  231.433 1.00 67.14  ?  998  LEU B CG    1 
ATOM   1970 C  CD1   . LEU B 2 84  ? 4.686   65.706  231.860 1.00 61.01  ?  998  LEU B CD1   1 
ATOM   1971 C  CD2   . LEU B 2 84  ? 5.107   63.313  231.265 1.00 72.12  ?  998  LEU B CD2   1 
ATOM   1972 N  N     . ASN B 2 85  ? 9.363   65.680  229.039 1.00 71.19  ?  999  ASN B N     1 
ATOM   1973 C  CA    . ASN B 2 85  ? 10.771  65.288  229.112 1.00 73.36  ?  999  ASN B CA    1 
ATOM   1974 C  C     . ASN B 2 85  ? 11.732  66.462  228.941 1.00 67.63  ?  999  ASN B C     1 
ATOM   1975 O  O     . ASN B 2 85  ? 12.812  66.481  229.557 1.00 83.35  ?  999  ASN B O     1 
ATOM   1976 C  CB    . ASN B 2 85  ? 11.062  64.197  228.084 1.00 91.68  ?  999  ASN B CB    1 
ATOM   1977 C  CG    . ASN B 2 85  ? 9.998   63.125  228.078 1.00 109.30 ?  999  ASN B CG    1 
ATOM   1978 O  OD1   . ASN B 2 85  ? 9.300   62.936  229.075 1.00 116.40 ?  999  ASN B OD1   1 
ATOM   1979 N  ND2   . ASN B 2 85  ? 9.900   62.382  226.983 1.00 111.15 ?  999  ASN B ND2   1 
ATOM   1980 N  N     . LEU B 2 86  ? 11.357  67.443  228.117 1.00 60.10  ?  1000 LEU B N     1 
ATOM   1981 C  CA    . LEU B 2 86  ? 12.129  68.679  228.042 1.00 73.74  ?  1000 LEU B CA    1 
ATOM   1982 C  C     . LEU B 2 86  ? 12.299  69.302  229.422 1.00 87.22  ?  1000 LEU B C     1 
ATOM   1983 O  O     . LEU B 2 86  ? 13.338  69.909  229.718 1.00 96.64  ?  1000 LEU B O     1 
ATOM   1984 C  CB    . LEU B 2 86  ? 11.455  69.668  227.088 1.00 68.37  ?  1000 LEU B CB    1 
ATOM   1985 C  CG    . LEU B 2 86  ? 11.517  69.314  225.606 1.00 60.56  ?  1000 LEU B CG    1 
ATOM   1986 C  CD1   . LEU B 2 86  ? 10.861  70.392  224.754 1.00 62.00  ?  1000 LEU B CD1   1 
ATOM   1987 C  CD2   . LEU B 2 86  ? 12.960  69.103  225.197 1.00 51.93  ?  1000 LEU B CD2   1 
ATOM   1988 N  N     . GLU B 2 87  ? 11.293  69.141  230.288 1.00 89.79  ?  1001 GLU B N     1 
ATOM   1989 C  CA    . GLU B 2 87  ? 11.386  69.679  231.641 1.00 92.55  ?  1001 GLU B CA    1 
ATOM   1990 C  C     . GLU B 2 87  ? 12.425  68.934  232.472 1.00 85.97  ?  1001 GLU B C     1 
ATOM   1991 O  O     . GLU B 2 87  ? 13.240  69.562  233.158 1.00 87.23  ?  1001 GLU B O     1 
ATOM   1992 C  CB    . GLU B 2 87  ? 10.021  69.639  232.323 1.00 98.24  ?  1001 GLU B CB    1 
ATOM   1993 C  CG    . GLU B 2 87  ? 9.061   70.702  231.827 1.00 107.71 ?  1001 GLU B CG    1 
ATOM   1994 C  CD    . GLU B 2 87  ? 7.810   70.780  232.670 1.00 124.70 ?  1001 GLU B CD    1 
ATOM   1995 O  OE1   . GLU B 2 87  ? 7.321   69.716  233.103 1.00 129.29 ?  1001 GLU B OE1   1 
ATOM   1996 O  OE2   . GLU B 2 87  ? 7.323   71.905  232.909 1.00 128.80 -1 1001 GLU B OE2   1 
ATOM   1997 N  N     . GLU B 2 88  ? 12.402  67.595  232.446 1.00 86.27  ?  1002 GLU B N     1 
ATOM   1998 C  CA    . GLU B 2 88  ? 13.416  66.839  233.179 1.00 90.05  ?  1002 GLU B CA    1 
ATOM   1999 C  C     . GLU B 2 88  ? 14.813  67.251  232.737 1.00 91.20  ?  1002 GLU B C     1 
ATOM   2000 O  O     . GLU B 2 88  ? 15.707  67.455  233.572 1.00 94.70  ?  1002 GLU B O     1 
ATOM   2001 C  CB    . GLU B 2 88  ? 13.205  65.327  233.003 1.00 100.14 ?  1002 GLU B CB    1 
ATOM   2002 C  CG    . GLU B 2 88  ? 13.947  64.679  231.836 1.00 119.39 ?  1002 GLU B CG    1 
ATOM   2003 C  CD    . GLU B 2 88  ? 14.092  63.179  231.964 1.00 130.93 ?  1002 GLU B CD    1 
ATOM   2004 O  OE1   . GLU B 2 88  ? 13.495  62.600  232.835 1.00 130.84 ?  1002 GLU B OE1   1 
ATOM   2005 O  OE2   . GLU B 2 88  ? 14.808  62.579  231.194 1.00 131.77 -1 1002 GLU B OE2   1 
ATOM   2006 N  N     . LYS B 2 89  ? 15.003  67.430  231.426 1.00 83.82  ?  1003 LYS B N     1 
ATOM   2007 C  CA    . LYS B 2 89  ? 16.298  67.887  230.942 1.00 82.91  ?  1003 LYS B CA    1 
ATOM   2008 C  C     . LYS B 2 89  ? 16.643  69.257  231.518 1.00 85.76  ?  1003 LYS B C     1 
ATOM   2009 O  O     . LYS B 2 89  ? 17.739  69.454  232.060 1.00 98.86  ?  1003 LYS B O     1 
ATOM   2010 C  CB    . LYS B 2 89  ? 16.300  67.898  229.416 1.00 85.16  ?  1003 LYS B CB    1 
ATOM   2011 C  CG    . LYS B 2 89  ? 16.968  66.682  228.783 1.00 86.94  ?  1003 LYS B CG    1 
ATOM   2012 C  CD    . LYS B 2 89  ? 16.370  66.326  227.426 1.00 83.74  ?  1003 LYS B CD    1 
ATOM   2013 C  CE    . LYS B 2 89  ? 15.253  65.303  227.563 1.00 91.63  ?  1003 LYS B CE    1 
ATOM   2014 N  NZ    . LYS B 2 89  ? 14.744  64.842  226.241 1.00 96.18  ?  1003 LYS B NZ    1 
ATOM   2015 N  N     . GLN B 2 90  ? 15.698  70.202  231.460 1.00 88.64  ?  1004 GLN B N     1 
ATOM   2016 C  CA    . GLN B 2 90  ? 15.914  71.507  232.084 1.00 89.64  ?  1004 GLN B CA    1 
ATOM   2017 C  C     . GLN B 2 90  ? 16.312  71.379  233.554 1.00 93.36  ?  1004 GLN B C     1 
ATOM   2018 O  O     . GLN B 2 90  ? 17.104  72.187  234.056 1.00 84.63  ?  1004 GLN B O     1 
ATOM   2019 C  CB    . GLN B 2 90  ? 14.652  72.359  231.948 1.00 79.48  ?  1004 GLN B CB    1 
ATOM   2020 C  CG    . GLN B 2 90  ? 14.911  73.847  231.805 1.00 79.78  ?  1004 GLN B CG    1 
ATOM   2021 C  CD    . GLN B 2 90  ? 13.629  74.655  231.758 1.00 84.22  ?  1004 GLN B CD    1 
ATOM   2022 O  OE1   . GLN B 2 90  ? 13.614  75.791  231.289 1.00 81.99  ?  1004 GLN B OE1   1 
ATOM   2023 N  NE2   . GLN B 2 90  ? 12.545  74.073  232.257 1.00 95.99  ?  1004 GLN B NE2   1 
ATOM   2024 N  N     . TRP B 2 91  ? 15.785  70.369  234.251 1.00 97.85  ?  1005 TRP B N     1 
ATOM   2025 C  CA    . TRP B 2 91  ? 16.134  70.157  235.652 1.00 99.81  ?  1005 TRP B CA    1 
ATOM   2026 C  C     . TRP B 2 91  ? 17.589  69.724  235.796 1.00 103.43 ?  1005 TRP B C     1 
ATOM   2027 O  O     . TRP B 2 91  ? 18.356  70.336  236.554 1.00 114.84 ?  1005 TRP B O     1 
ATOM   2028 C  CB    . TRP B 2 91  ? 15.181  69.127  236.268 1.00 105.46 ?  1005 TRP B CB    1 
ATOM   2029 C  CG    . TRP B 2 91  ? 15.581  68.588  237.617 1.00 95.60  ?  1005 TRP B CG    1 
ATOM   2030 C  CD1   . TRP B 2 91  ? 16.035  67.330  237.892 1.00 92.74  ?  1005 TRP B CD1   1 
ATOM   2031 C  CD2   . TRP B 2 91  ? 15.537  69.280  238.872 1.00 102.71 ?  1005 TRP B CD2   1 
ATOM   2032 N  NE1   . TRP B 2 91  ? 16.288  67.199  239.235 1.00 103.63 ?  1005 TRP B NE1   1 
ATOM   2033 C  CE2   . TRP B 2 91  ? 15.988  68.380  239.862 1.00 106.84 ?  1005 TRP B CE2   1 
ATOM   2034 C  CE3   . TRP B 2 91  ? 15.174  70.577  239.255 1.00 98.31  ?  1005 TRP B CE3   1 
ATOM   2035 C  CZ2   . TRP B 2 91  ? 16.090  68.735  241.208 1.00 104.02 ?  1005 TRP B CZ2   1 
ATOM   2036 C  CZ3   . TRP B 2 91  ? 15.268  70.926  240.594 1.00 102.34 ?  1005 TRP B CZ3   1 
ATOM   2037 C  CH2   . TRP B 2 91  ? 15.723  70.008  241.554 1.00 103.58 ?  1005 TRP B CH2   1 
ATOM   2038 N  N     . GLN B 2 92  ? 17.994  68.678  235.065 1.00 89.08  ?  1006 GLN B N     1 
ATOM   2039 C  CA    . GLN B 2 92  ? 19.381  68.223  235.154 1.00 91.10  ?  1006 GLN B CA    1 
ATOM   2040 C  C     . GLN B 2 92  ? 20.352  69.355  234.846 1.00 87.00  ?  1006 GLN B C     1 
ATOM   2041 O  O     . GLN B 2 92  ? 21.306  69.601  235.600 1.00 95.57  ?  1006 GLN B O     1 
ATOM   2042 C  CB    . GLN B 2 92  ? 19.636  67.048  234.203 1.00 99.07  ?  1006 GLN B CB    1 
ATOM   2043 C  CG    . GLN B 2 92  ? 18.433  66.188  233.857 1.00 99.54  ?  1006 GLN B CG    1 
ATOM   2044 C  CD    . GLN B 2 92  ? 17.874  65.403  235.033 1.00 101.92 ?  1006 GLN B CD    1 
ATOM   2045 O  OE1   . GLN B 2 92  ? 18.223  65.639  236.191 1.00 100.75 ?  1006 GLN B OE1   1 
ATOM   2046 N  NE2   . GLN B 2 92  ? 16.993  64.458  234.734 1.00 107.19 ?  1006 GLN B NE2   1 
ATOM   2047 N  N     . LEU B 2 93  ? 20.118  70.067  233.741 1.00 81.33  ?  1007 LEU B N     1 
ATOM   2048 C  CA    . LEU B 2 93  ? 21.040  71.131  233.358 1.00 81.38  ?  1007 LEU B CA    1 
ATOM   2049 C  C     . LEU B 2 93  ? 21.014  72.277  234.363 1.00 83.42  ?  1007 LEU B C     1 
ATOM   2050 O  O     . LEU B 2 93  ? 22.039  72.938  234.588 1.00 91.58  ?  1007 LEU B O     1 
ATOM   2051 C  CB    . LEU B 2 93  ? 20.732  71.622  231.942 1.00 84.32  ?  1007 LEU B CB    1 
ATOM   2052 C  CG    . LEU B 2 93  ? 21.174  70.699  230.795 1.00 77.85  ?  1007 LEU B CG    1 
ATOM   2053 C  CD1   . LEU B 2 93  ? 22.603  70.223  231.031 1.00 81.12  ?  1007 LEU B CD1   1 
ATOM   2054 C  CD2   . LEU B 2 93  ? 20.263  69.511  230.545 1.00 83.45  ?  1007 LEU B CD2   1 
ATOM   2055 N  N     . ASP B 2 94  ? 19.857  72.518  234.985 1.00 89.28  ?  1008 ASP B N     1 
ATOM   2056 C  CA    . ASP B 2 94  ? 19.796  73.447  236.108 1.00 102.29 ?  1008 ASP B CA    1 
ATOM   2057 C  C     . ASP B 2 94  ? 20.798  73.054  237.188 1.00 111.18 ?  1008 ASP B C     1 
ATOM   2058 O  O     . ASP B 2 94  ? 21.679  73.844  237.552 1.00 116.34 ?  1008 ASP B O     1 
ATOM   2059 C  CB    . ASP B 2 94  ? 18.373  73.490  236.671 1.00 102.62 ?  1008 ASP B CB    1 
ATOM   2060 C  CG    . ASP B 2 94  ? 18.046  74.811  237.329 1.00 108.25 ?  1008 ASP B CG    1 
ATOM   2061 O  OD1   . ASP B 2 94  ? 16.919  75.307  237.130 1.00 108.50 ?  1008 ASP B OD1   1 
ATOM   2062 O  OD2   . ASP B 2 94  ? 18.911  75.350  238.053 1.00 116.33 -1 1008 ASP B OD2   1 
ATOM   2063 N  N     . GLN B 2 95  ? 20.696  71.814  237.683 1.00 108.83 ?  1009 GLN B N     1 
ATOM   2064 C  CA    . GLN B 2 95  ? 21.613  71.330  238.715 1.00 104.61 ?  1009 GLN B CA    1 
ATOM   2065 C  C     . GLN B 2 95  ? 23.069  71.518  238.315 1.00 113.79 ?  1009 GLN B C     1 
ATOM   2066 O  O     . GLN B 2 95  ? 23.862  72.121  239.052 1.00 119.79 ?  1009 GLN B O     1 
ATOM   2067 C  CB    . GLN B 2 95  ? 21.354  69.853  239.012 1.00 100.49 ?  1009 GLN B CB    1 
ATOM   2068 C  CG    . GLN B 2 95  ? 20.499  69.635  240.223 1.00 109.10 ?  1009 GLN B CG    1 
ATOM   2069 C  CD    . GLN B 2 95  ? 19.134  70.224  240.031 1.00 108.11 ?  1009 GLN B CD    1 
ATOM   2070 O  OE1   . GLN B 2 95  ? 18.368  69.750  239.204 1.00 105.76 ?  1009 GLN B OE1   1 
ATOM   2071 N  NE2   . GLN B 2 95  ? 18.830  71.284  240.768 1.00 102.76 ?  1009 GLN B NE2   1 
ATOM   2072 N  N     . GLU B 2 96  ? 23.442  70.978  237.151 1.00 112.96 ?  1010 GLU B N     1 
ATOM   2073 C  CA    . GLU B 2 96  ? 24.831  71.066  236.712 1.00 118.91 ?  1010 GLU B CA    1 
ATOM   2074 C  C     . GLU B 2 96  ? 25.317  72.508  236.719 1.00 118.81 ?  1010 GLU B C     1 
ATOM   2075 O  O     . GLU B 2 96  ? 26.429  72.798  237.177 1.00 127.35 ?  1010 GLU B O     1 
ATOM   2076 C  CB    . GLU B 2 96  ? 24.987  70.449  235.324 1.00 121.20 ?  1010 GLU B CB    1 
ATOM   2077 C  CG    . GLU B 2 96  ? 24.462  69.035  235.223 1.00 127.37 ?  1010 GLU B CG    1 
ATOM   2078 C  CD    . GLU B 2 96  ? 24.979  68.317  233.996 1.00 136.94 ?  1010 GLU B CD    1 
ATOM   2079 O  OE1   . GLU B 2 96  ? 25.534  68.989  233.100 1.00 133.27 ?  1010 GLU B OE1   1 
ATOM   2080 O  OE2   . GLU B 2 96  ? 24.831  67.079  233.928 1.00 146.79 -1 1010 GLU B OE2   1 
ATOM   2081 N  N     . LEU B 2 97  ? 24.482  73.434  236.237 1.00 105.20 ?  1011 LEU B N     1 
ATOM   2082 C  CA    . LEU B 2 97  ? 24.867  74.841  236.274 1.00 99.03  ?  1011 LEU B CA    1 
ATOM   2083 C  C     . LEU B 2 97  ? 25.068  75.323  237.709 1.00 98.76  ?  1011 LEU B C     1 
ATOM   2084 O  O     . LEU B 2 97  ? 25.999  76.090  237.988 1.00 87.88  ?  1011 LEU B O     1 
ATOM   2085 C  CB    . LEU B 2 97  ? 23.819  75.687  235.554 1.00 102.32 ?  1011 LEU B CB    1 
ATOM   2086 C  CG    . LEU B 2 97  ? 24.334  76.916  234.799 1.00 104.82 ?  1011 LEU B CG    1 
ATOM   2087 C  CD1   . LEU B 2 97  ? 24.733  78.032  235.754 1.00 116.92 ?  1011 LEU B CD1   1 
ATOM   2088 C  CD2   . LEU B 2 97  ? 25.493  76.539  233.884 1.00 104.62 ?  1011 LEU B CD2   1 
ATOM   2089 N  N     . ARG B 2 98  ? 24.204  74.881  238.633 1.00 108.74 ?  1012 ARG B N     1 
ATOM   2090 C  CA    . ARG B 2 98  ? 24.361  75.244  240.042 1.00 104.39 ?  1012 ARG B CA    1 
ATOM   2091 C  C     . ARG B 2 98  ? 25.725  74.826  240.568 1.00 108.37 ?  1012 ARG B C     1 
ATOM   2092 O  O     . ARG B 2 98  ? 26.434  75.626  241.192 1.00 122.27 ?  1012 ARG B O     1 
ATOM   2093 C  CB    . ARG B 2 98  ? 23.267  74.599  240.895 1.00 100.28 ?  1012 ARG B CB    1 
ATOM   2094 C  CG    . ARG B 2 98  ? 21.870  74.777  240.381 1.00 96.97  ?  1012 ARG B CG    1 
ATOM   2095 C  CD    . ARG B 2 98  ? 21.354  76.188  240.667 1.00 98.68  ?  1012 ARG B CD    1 
ATOM   2096 N  NE    . ARG B 2 98  ? 19.935  76.274  240.362 1.00 98.62  ?  1012 ARG B NE    1 
ATOM   2097 C  CZ    . ARG B 2 98  ? 19.255  77.413  240.266 1.00 99.02  ?  1012 ARG B CZ    1 
ATOM   2098 N  NH1   . ARG B 2 98  ? 19.857  78.580  240.462 1.00 105.93 ?  1012 ARG B NH1   1 
ATOM   2099 N  NH2   . ARG B 2 98  ? 17.962  77.395  239.973 1.00 94.64  ?  1012 ARG B NH2   1 
ATOM   2100 N  N     . GLY B 2 99  ? 26.099  73.562  240.347 1.00 100.42 ?  1013 GLY B N     1 
ATOM   2101 C  CA    . GLY B 2 99  ? 27.385  73.087  240.837 1.00 107.93 ?  1013 GLY B CA    1 
ATOM   2102 C  C     . GLY B 2 99  ? 28.535  73.962  240.383 1.00 123.52 ?  1013 GLY B C     1 
ATOM   2103 O  O     . GLY B 2 99  ? 29.429  74.297  241.163 1.00 122.21 ?  1013 GLY B O     1 
ATOM   2104 N  N     . TYR B 2 100 ? 28.511  74.364  239.118 1.00 131.32 ?  1014 TYR B N     1 
ATOM   2105 C  CA    . TYR B 2 100 ? 29.509  75.274  238.580 1.00 130.86 ?  1014 TYR B CA    1 
ATOM   2106 C  C     . TYR B 2 100 ? 29.475  76.631  239.283 1.00 125.23 ?  1014 TYR B C     1 
ATOM   2107 O  O     . TYR B 2 100 ? 28.440  77.052  239.799 1.00 118.40 ?  1014 TYR B O     1 
ATOM   2108 C  CB    . TYR B 2 100 ? 29.298  75.477  237.080 1.00 132.63 ?  1014 TYR B CB    1 
ATOM   2109 C  CG    . TYR B 2 100 ? 29.759  74.353  236.173 1.00 128.13 ?  1014 TYR B CG    1 
ATOM   2110 C  CD1   . TYR B 2 100 ? 29.400  73.032  236.395 1.00 130.24 ?  1014 TYR B CD1   1 
ATOM   2111 C  CD2   . TYR B 2 100 ? 30.560  74.627  235.084 1.00 120.05 ?  1014 TYR B CD2   1 
ATOM   2112 C  CE1   . TYR B 2 100 ? 29.829  72.023  235.536 1.00 128.96 ?  1014 TYR B CE1   1 
ATOM   2113 C  CE2   . TYR B 2 100 ? 30.990  73.640  234.225 1.00 117.43 ?  1014 TYR B CE2   1 
ATOM   2114 C  CZ    . TYR B 2 100 ? 30.628  72.338  234.453 1.00 123.51 ?  1014 TYR B CZ    1 
ATOM   2115 O  OH    . TYR B 2 100 ? 31.068  71.359  233.590 1.00 118.82 ?  1014 TYR B OH    1 
ATOM   2116 N  N     . ASP B 2 112 ? 37.693  74.052  231.080 1.00 118.88 ?  1026 ASP B N     1 
ATOM   2117 C  CA    . ASP B 2 112 ? 37.397  74.589  232.402 1.00 128.57 ?  1026 ASP B CA    1 
ATOM   2118 C  C     . ASP B 2 112 ? 36.379  75.723  232.321 1.00 140.60 ?  1026 ASP B C     1 
ATOM   2119 O  O     . ASP B 2 112 ? 35.188  75.519  232.558 1.00 124.96 ?  1026 ASP B O     1 
ATOM   2120 C  CB    . ASP B 2 112 ? 38.677  75.080  233.082 1.00 126.52 ?  1026 ASP B CB    1 
ATOM   2121 N  N     . ARG B 2 113 ? 36.861  76.923  231.986 1.00 156.04 ?  1027 ARG B N     1 
ATOM   2122 C  CA    . ARG B 2 113 ? 35.976  78.081  231.911 1.00 156.14 ?  1027 ARG B CA    1 
ATOM   2123 C  C     . ARG B 2 113 ? 35.004  77.965  230.743 1.00 155.04 ?  1027 ARG B C     1 
ATOM   2124 O  O     . ARG B 2 113 ? 33.843  78.376  230.850 1.00 153.66 ?  1027 ARG B O     1 
ATOM   2125 C  CB    . ARG B 2 113 ? 36.802  79.364  231.797 1.00 155.36 ?  1027 ARG B CB    1 
ATOM   2126 N  N     . GLN B 2 114 ? 35.456  77.394  229.624 1.00 155.82 ?  1028 GLN B N     1 
ATOM   2127 C  CA    . GLN B 2 114 ? 34.645  77.373  228.412 1.00 147.83 ?  1028 GLN B CA    1 
ATOM   2128 C  C     . GLN B 2 114 ? 33.522  76.342  228.468 1.00 146.04 ?  1028 GLN B C     1 
ATOM   2129 O  O     . GLN B 2 114 ? 32.513  76.502  227.772 1.00 150.02 ?  1028 GLN B O     1 
ATOM   2130 C  CB    . GLN B 2 114 ? 35.535  77.107  227.196 1.00 143.99 ?  1028 GLN B CB    1 
ATOM   2131 N  N     . ALA B 2 115 ? 33.669  75.286  229.274 1.00 129.36 ?  1029 ALA B N     1 
ATOM   2132 C  CA    . ALA B 2 115 ? 32.685  74.203  229.261 1.00 113.90 ?  1029 ALA B CA    1 
ATOM   2133 C  C     . ALA B 2 115 ? 31.344  74.654  229.838 1.00 124.99 ?  1029 ALA B C     1 
ATOM   2134 O  O     . ALA B 2 115 ? 30.268  74.263  229.342 1.00 126.15 ?  1029 ALA B O     1 
ATOM   2135 C  CB    . ALA B 2 115 ? 33.231  73.000  230.032 1.00 101.92 ?  1029 ALA B CB    1 
ATOM   2136 N  N     . GLU B 2 116 ? 31.384  75.493  230.876 1.00 135.99 ?  1030 GLU B N     1 
ATOM   2137 C  CA    . GLU B 2 116 ? 30.149  75.912  231.525 1.00 129.51 ?  1030 GLU B CA    1 
ATOM   2138 C  C     . GLU B 2 116 ? 29.257  76.693  230.574 1.00 124.92 ?  1030 GLU B C     1 
ATOM   2139 O  O     . GLU B 2 116 ? 28.037  76.505  230.561 1.00 128.44 ?  1030 GLU B O     1 
ATOM   2140 C  CB    . GLU B 2 116 ? 30.429  76.755  232.765 1.00 131.17 ?  1030 GLU B CB    1 
ATOM   2141 C  CG    . GLU B 2 116 ? 29.260  77.695  233.094 1.00 128.09 ?  1030 GLU B CG    1 
ATOM   2142 C  CD    . GLU B 2 116 ? 29.437  78.489  234.372 1.00 128.73 ?  1030 GLU B CD    1 
ATOM   2143 O  OE1   . GLU B 2 116 ? 30.046  77.963  235.326 1.00 129.00 ?  1030 GLU B OE1   1 
ATOM   2144 O  OE2   . GLU B 2 116 ? 28.955  79.640  234.421 1.00 132.95 -1 1030 GLU B OE2   1 
ATOM   2145 N  N     . ASP B 2 117 ? 29.837  77.604  229.800 1.00 113.78 ?  1031 ASP B N     1 
ATOM   2146 C  CA    . ASP B 2 117 ? 29.013  78.342  228.854 1.00 108.72 ?  1031 ASP B CA    1 
ATOM   2147 C  C     . ASP B 2 117 ? 28.272  77.395  227.918 1.00 95.48  ?  1031 ASP B C     1 
ATOM   2148 O  O     . ASP B 2 117 ? 27.107  77.641  227.572 1.00 89.68  ?  1031 ASP B O     1 
ATOM   2149 C  CB    . ASP B 2 117 ? 29.875  79.323  228.067 1.00 115.72 ?  1031 ASP B CB    1 
ATOM   2150 C  CG    . ASP B 2 117 ? 29.052  80.327  227.309 1.00 124.97 ?  1031 ASP B CG    1 
ATOM   2151 O  OD1   . ASP B 2 117 ? 28.396  81.172  227.963 1.00 123.99 ?  1031 ASP B OD1   1 
ATOM   2152 O  OD2   . ASP B 2 117 ? 29.056  80.282  226.061 1.00 136.00 -1 1031 ASP B OD2   1 
ATOM   2153 N  N     . GLN B 2 118 ? 28.917  76.287  227.544 1.00 90.69  ?  1032 GLN B N     1 
ATOM   2154 C  CA    . GLN B 2 118 ? 28.248  75.269  226.746 1.00 95.21  ?  1032 GLN B CA    1 
ATOM   2155 C  C     . GLN B 2 118 ? 27.037  74.698  227.476 1.00 96.76  ?  1032 GLN B C     1 
ATOM   2156 O  O     . GLN B 2 118 ? 25.939  74.635  226.904 1.00 91.56  ?  1032 GLN B O     1 
ATOM   2157 C  CB    . GLN B 2 118 ? 29.234  74.158  226.376 1.00 100.65 ?  1032 GLN B CB    1 
ATOM   2158 N  N     . VAL B 2 119 ? 27.201  74.291  228.744 1.00 102.58 ?  1033 VAL B N     1 
ATOM   2159 C  CA    . VAL B 2 119 ? 26.049  73.692  229.432 1.00 101.05 ?  1033 VAL B CA    1 
ATOM   2160 C  C     . VAL B 2 119 ? 24.921  74.715  229.608 1.00 91.15  ?  1033 VAL B C     1 
ATOM   2161 O  O     . VAL B 2 119 ? 23.732  74.389  229.443 1.00 85.32  ?  1033 VAL B O     1 
ATOM   2162 C  CB    . VAL B 2 119 ? 26.462  73.048  230.775 1.00 101.97 ?  1033 VAL B CB    1 
ATOM   2163 C  CG1   . VAL B 2 119 ? 27.231  73.990  231.654 1.00 105.33 ?  1033 VAL B CG1   1 
ATOM   2164 C  CG2   . VAL B 2 119 ? 25.246  72.547  231.526 1.00 99.49  ?  1033 VAL B CG2   1 
ATOM   2165 N  N     . LEU B 2 120 ? 25.269  75.970  229.911 1.00 92.71  ?  1034 LEU B N     1 
ATOM   2166 C  CA    . LEU B 2 120 ? 24.262  77.020  230.050 1.00 88.90  ?  1034 LEU B CA    1 
ATOM   2167 C  C     . LEU B 2 120 ? 23.464  77.186  228.761 1.00 87.08  ?  1034 LEU B C     1 
ATOM   2168 O  O     . LEU B 2 120 ? 22.229  77.304  228.785 1.00 87.24  ?  1034 LEU B O     1 
ATOM   2169 C  CB    . LEU B 2 120 ? 24.940  78.334  230.464 1.00 89.08  ?  1034 LEU B CB    1 
ATOM   2170 C  CG    . LEU B 2 120 ? 24.234  79.702  230.558 1.00 86.19  ?  1034 LEU B CG    1 
ATOM   2171 C  CD1   . LEU B 2 120 ? 24.283  80.498  229.254 1.00 100.48 ?  1034 LEU B CD1   1 
ATOM   2172 C  CD2   . LEU B 2 120 ? 22.807  79.595  231.100 1.00 88.17  ?  1034 LEU B CD2   1 
ATOM   2173 N  N     . ARG B 2 121 ? 24.159  77.169  227.618 1.00 89.39  ?  1035 ARG B N     1 
ATOM   2174 C  CA    . ARG B 2 121 ? 23.473  77.324  226.339 1.00 75.57  ?  1035 ARG B CA    1 
ATOM   2175 C  C     . ARG B 2 121 ? 22.646  76.094  225.982 1.00 58.31  ?  1035 ARG B C     1 
ATOM   2176 O  O     . ARG B 2 121 ? 21.656  76.201  225.248 1.00 62.17  ?  1035 ARG B O     1 
ATOM   2177 C  CB    . ARG B 2 121 ? 24.473  77.648  225.229 1.00 78.49  ?  1035 ARG B CB    1 
ATOM   2178 C  CG    . ARG B 2 121 ? 25.202  78.956  225.439 1.00 97.00  ?  1035 ARG B CG    1 
ATOM   2179 C  CD    . ARG B 2 121 ? 24.739  80.020  224.417 1.00 116.51 ?  1035 ARG B CD    1 
ATOM   2180 N  NE    . ARG B 2 121 ? 25.335  81.318  224.705 1.00 132.08 ?  1035 ARG B NE    1 
ATOM   2181 C  CZ    . ARG B 2 121 ? 25.322  82.355  223.868 1.00 134.44 ?  1035 ARG B CZ    1 
ATOM   2182 N  NH1   . ARG B 2 121 ? 25.894  83.498  224.224 1.00 129.18 ?  1035 ARG B NH1   1 
ATOM   2183 N  NH2   . ARG B 2 121 ? 24.752  82.261  222.671 1.00 136.51 ?  1035 ARG B NH2   1 
ATOM   2184 N  N     . LYS B 2 122 ? 23.029  74.919  226.485 1.00 51.94  ?  1036 LYS B N     1 
ATOM   2185 C  CA    . LYS B 2 122 ? 22.152  73.762  226.319 1.00 63.66  ?  1036 LYS B CA    1 
ATOM   2186 C  C     . LYS B 2 122 ? 20.839  73.965  227.073 1.00 84.19  ?  1036 LYS B C     1 
ATOM   2187 O  O     . LYS B 2 122 ? 19.750  73.726  226.520 1.00 101.35 ?  1036 LYS B O     1 
ATOM   2188 C  CB    . LYS B 2 122 ? 22.858  72.486  226.781 1.00 58.07  ?  1036 LYS B CB    1 
ATOM   2189 N  N     . LEU B 2 123 ? 20.921  74.442  228.320 1.00 70.96  ?  1037 LEU B N     1 
ATOM   2190 C  CA    . LEU B 2 123 ? 19.714  74.791  229.070 1.00 75.67  ?  1037 LEU B CA    1 
ATOM   2191 C  C     . LEU B 2 123 ? 18.829  75.760  228.284 1.00 62.98  ?  1037 LEU B C     1 
ATOM   2192 O  O     . LEU B 2 123 ? 17.622  75.525  228.101 1.00 64.66  ?  1037 LEU B O     1 
ATOM   2193 C  CB    . LEU B 2 123 ? 20.115  75.381  230.431 1.00 90.73  ?  1037 LEU B CB    1 
ATOM   2194 C  CG    . LEU B 2 123 ? 19.103  75.973  231.423 1.00 86.74  ?  1037 LEU B CG    1 
ATOM   2195 C  CD1   . LEU B 2 123 ? 19.680  75.934  232.823 1.00 86.71  ?  1037 LEU B CD1   1 
ATOM   2196 C  CD2   . LEU B 2 123 ? 18.711  77.405  231.075 1.00 93.66  ?  1037 LEU B CD2   1 
ATOM   2197 N  N     . VAL B 2 124 ? 19.425  76.858  227.804 1.00 62.05  ?  1038 VAL B N     1 
ATOM   2198 C  CA    . VAL B 2 124 ? 18.665  77.868  227.061 1.00 72.75  ?  1038 VAL B CA    1 
ATOM   2199 C  C     . VAL B 2 124 ? 17.991  77.251  225.835 1.00 66.27  ?  1038 VAL B C     1 
ATOM   2200 O  O     . VAL B 2 124 ? 16.795  77.474  225.572 1.00 67.16  ?  1038 VAL B O     1 
ATOM   2201 C  CB    . VAL B 2 124 ? 19.586  79.034  226.661 1.00 73.27  ?  1038 VAL B CB    1 
ATOM   2202 C  CG1   . VAL B 2 124 ? 18.928  79.885  225.586 1.00 71.07  ?  1038 VAL B CG1   1 
ATOM   2203 C  CG2   . VAL B 2 124 ? 19.947  79.870  227.882 1.00 68.78  ?  1038 VAL B CG2   1 
ATOM   2204 N  N     . ASP B 2 125 ? 18.755  76.479  225.058 1.00 48.99  ?  1039 ASP B N     1 
ATOM   2205 C  CA    . ASP B 2 125 ? 18.188  75.819  223.889 1.00 50.81  ?  1039 ASP B CA    1 
ATOM   2206 C  C     . ASP B 2 125 ? 16.956  75.009  224.257 1.00 52.44  ?  1039 ASP B C     1 
ATOM   2207 O  O     . ASP B 2 125 ? 15.960  75.009  223.521 1.00 51.43  ?  1039 ASP B O     1 
ATOM   2208 C  CB    . ASP B 2 125 ? 19.231  74.919  223.225 1.00 64.83  ?  1039 ASP B CB    1 
ATOM   2209 C  CG    . ASP B 2 125 ? 18.724  74.296  221.934 1.00 61.25  ?  1039 ASP B CG    1 
ATOM   2210 O  OD1   . ASP B 2 125 ? 18.764  74.981  220.892 1.00 63.37  ?  1039 ASP B OD1   1 
ATOM   2211 O  OD2   . ASP B 2 125 ? 18.274  73.129  221.963 1.00 53.41  -1 1039 ASP B OD2   1 
ATOM   2212 N  N     . LEU B 2 126 ? 16.997  74.320  225.400 1.00 56.45  ?  1040 LEU B N     1 
ATOM   2213 C  CA    . LEU B 2 126 ? 15.836  73.532  225.808 1.00 65.94  ?  1040 LEU B CA    1 
ATOM   2214 C  C     . LEU B 2 126 ? 14.631  74.414  226.105 1.00 63.34  ?  1040 LEU B C     1 
ATOM   2215 O  O     . LEU B 2 126 ? 13.497  74.087  225.707 1.00 65.28  ?  1040 LEU B O     1 
ATOM   2216 C  CB    . LEU B 2 126 ? 16.195  72.678  227.011 1.00 53.95  ?  1040 LEU B CB    1 
ATOM   2217 C  CG    . LEU B 2 126 ? 16.975  71.475  226.508 1.00 59.06  ?  1040 LEU B CG    1 
ATOM   2218 C  CD1   . LEU B 2 126 ? 17.210  70.548  227.642 1.00 58.15  ?  1040 LEU B CD1   1 
ATOM   2219 C  CD2   . LEU B 2 126 ? 16.199  70.785  225.392 1.00 67.37  ?  1040 LEU B CD2   1 
ATOM   2220 N  N     . VAL B 2 127 ? 14.854  75.534  226.804 1.00 56.56  ?  1041 VAL B N     1 
ATOM   2221 C  CA    . VAL B 2 127 ? 13.785  76.522  226.946 1.00 48.02  ?  1041 VAL B CA    1 
ATOM   2222 C  C     . VAL B 2 127 ? 13.150  76.807  225.593 1.00 57.57  ?  1041 VAL B C     1 
ATOM   2223 O  O     . VAL B 2 127 ? 11.917  76.864  225.460 1.00 61.38  ?  1041 VAL B O     1 
ATOM   2224 C  CB    . VAL B 2 127 ? 14.321  77.815  227.591 1.00 58.71  ?  1041 VAL B CB    1 
ATOM   2225 C  CG1   . VAL B 2 127 ? 13.225  78.870  227.645 1.00 58.93  ?  1041 VAL B CG1   1 
ATOM   2226 C  CG2   . VAL B 2 127 ? 14.863  77.537  228.980 1.00 55.72  ?  1041 VAL B CG2   1 
ATOM   2227 N  N     . ASN B 2 128 ? 13.986  76.943  224.554 1.00 73.80  ?  1042 ASN B N     1 
ATOM   2228 C  CA    . ASN B 2 128 ? 13.470  77.314  223.236 1.00 64.82  ?  1042 ASN B CA    1 
ATOM   2229 C  C     . ASN B 2 128 ? 12.811  76.153  222.497 1.00 44.75  ?  1042 ASN B C     1 
ATOM   2230 O  O     . ASN B 2 128 ? 12.006  76.390  221.595 1.00 39.09  ?  1042 ASN B O     1 
ATOM   2231 C  CB    . ASN B 2 128 ? 14.582  77.912  222.383 1.00 60.84  ?  1042 ASN B CB    1 
ATOM   2232 C  CG    . ASN B 2 128 ? 15.121  79.189  222.968 1.00 74.57  ?  1042 ASN B CG    1 
ATOM   2233 O  OD1   . ASN B 2 128 ? 14.355  80.038  223.420 1.00 70.93  ?  1042 ASN B OD1   1 
ATOM   2234 N  ND2   . ASN B 2 128 ? 16.438  79.347  222.946 1.00 82.88  ?  1042 ASN B ND2   1 
ATOM   2235 N  N     . GLN B 2 129 ? 13.140  74.906  222.827 1.00 48.37  ?  1043 GLN B N     1 
ATOM   2236 C  CA    . GLN B 2 129 ? 12.378  73.803  222.247 1.00 50.44  ?  1043 GLN B CA    1 
ATOM   2237 C  C     . GLN B 2 129 ? 10.979  73.726  222.850 1.00 58.60  ?  1043 GLN B C     1 
ATOM   2238 O  O     . GLN B 2 129 ? 9.993   73.538  222.116 1.00 49.90  ?  1043 GLN B O     1 
ATOM   2239 C  CB    . GLN B 2 129 ? 13.126  72.483  222.419 1.00 60.89  ?  1043 GLN B CB    1 
ATOM   2240 C  CG    . GLN B 2 129 ? 14.495  72.489  221.774 1.00 57.39  ?  1043 GLN B CG    1 
ATOM   2241 C  CD    . GLN B 2 129 ? 15.202  71.157  221.886 1.00 74.95  ?  1043 GLN B CD    1 
ATOM   2242 O  OE1   . GLN B 2 129 ? 14.574  70.097  221.848 1.00 73.96  ?  1043 GLN B OE1   1 
ATOM   2243 N  NE2   . GLN B 2 129 ? 16.521  71.204  222.025 1.00 80.82  ?  1043 GLN B NE2   1 
ATOM   2244 N  N     . ARG B 2 130 ? 10.873  73.879  224.181 1.00 46.56  ?  1044 ARG B N     1 
ATOM   2245 C  CA    . ARG B 2 130 ? 9.560   74.060  224.803 1.00 40.62  ?  1044 ARG B CA    1 
ATOM   2246 C  C     . ARG B 2 130 ? 8.782   75.173  224.109 1.00 42.38  ?  1044 ARG B C     1 
ATOM   2247 O  O     . ARG B 2 130 ? 7.625   74.997  223.688 1.00 43.47  ?  1044 ARG B O     1 
ATOM   2248 C  CB    . ARG B 2 130 ? 9.713   74.399  226.291 1.00 55.36  ?  1044 ARG B CB    1 
ATOM   2249 C  CG    . ARG B 2 130 ? 10.392  73.365  227.176 1.00 48.14  ?  1044 ARG B CG    1 
ATOM   2250 C  CD    . ARG B 2 130 ? 9.518   73.039  228.384 1.00 53.43  ?  1044 ARG B CD    1 
ATOM   2251 N  NE    . ARG B 2 130 ? 8.919   74.230  228.992 1.00 65.24  ?  1044 ARG B NE    1 
ATOM   2252 C  CZ    . ARG B 2 130 ? 9.565   75.099  229.767 1.00 69.27  ?  1044 ARG B CZ    1 
ATOM   2253 N  NH1   . ARG B 2 130 ? 10.851  74.929  230.042 1.00 74.22  ?  1044 ARG B NH1   1 
ATOM   2254 N  NH2   . ARG B 2 130 ? 8.922   76.146  230.266 1.00 57.85  ?  1044 ARG B NH2   1 
ATOM   2255 N  N     . ASP B 2 131 ? 9.421   76.338  223.986 1.00 44.99  ?  1045 ASP B N     1 
ATOM   2256 C  CA    . ASP B 2 131 ? 8.785   77.482  223.346 1.00 60.55  ?  1045 ASP B CA    1 
ATOM   2257 C  C     . ASP B 2 131 ? 8.333   77.146  221.932 1.00 62.88  ?  1045 ASP B C     1 
ATOM   2258 O  O     . ASP B 2 131 ? 7.202   77.452  221.542 1.00 70.98  ?  1045 ASP B O     1 
ATOM   2259 C  CB    . ASP B 2 131 ? 9.746   78.668  223.332 1.00 60.48  ?  1045 ASP B CB    1 
ATOM   2260 C  CG    . ASP B 2 131 ? 9.132   79.895  222.705 1.00 66.51  ?  1045 ASP B CG    1 
ATOM   2261 O  OD1   . ASP B 2 131 ? 7.923   80.122  222.915 1.00 71.57  ?  1045 ASP B OD1   1 
ATOM   2262 O  OD2   . ASP B 2 131 ? 9.853   80.638  222.010 1.00 77.89  -1 1045 ASP B OD2   1 
ATOM   2263 N  N     . ALA B 2 132 ? 9.211   76.511  221.152 1.00 45.76  ?  1046 ALA B N     1 
ATOM   2264 C  CA    . ALA B 2 132 ? 8.888   76.173  219.772 1.00 42.34  ?  1046 ALA B CA    1 
ATOM   2265 C  C     . ALA B 2 132 ? 7.662   75.279  219.697 1.00 51.07  ?  1046 ALA B C     1 
ATOM   2266 O  O     . ALA B 2 132 ? 6.845   75.413  218.779 1.00 50.51  ?  1046 ALA B O     1 
ATOM   2267 C  CB    . ALA B 2 132 ? 10.085  75.496  219.105 1.00 53.50  ?  1046 ALA B CB    1 
ATOM   2268 N  N     . LEU B 2 133 ? 7.516   74.354  220.648 1.00 40.23  ?  1047 LEU B N     1 
ATOM   2269 C  CA    . LEU B 2 133 ? 6.283   73.576  220.713 1.00 46.22  ?  1047 LEU B CA    1 
ATOM   2270 C  C     . LEU B 2 133 ? 5.073   74.484  220.911 1.00 44.10  ?  1047 LEU B C     1 
ATOM   2271 O  O     . LEU B 2 133 ? 4.074   74.383  220.176 1.00 37.28  ?  1047 LEU B O     1 
ATOM   2272 C  CB    . LEU B 2 133 ? 6.379   72.544  221.832 1.00 49.76  ?  1047 LEU B CB    1 
ATOM   2273 C  CG    . LEU B 2 133 ? 7.388   71.439  221.533 1.00 52.63  ?  1047 LEU B CG    1 
ATOM   2274 C  CD1   . LEU B 2 133 ? 7.305   70.342  222.571 1.00 40.52  ?  1047 LEU B CD1   1 
ATOM   2275 C  CD2   . LEU B 2 133 ? 7.151   70.881  220.133 1.00 56.71  ?  1047 LEU B CD2   1 
ATOM   2276 N  N     . ILE B 2 134 ? 5.153   75.395  221.890 1.00 37.21  ?  1048 ILE B N     1 
ATOM   2277 C  CA    . ILE B 2 134 ? 4.026   76.297  222.151 1.00 49.11  ?  1048 ILE B CA    1 
ATOM   2278 C  C     . ILE B 2 134 ? 3.664   77.087  220.888 1.00 51.42  ?  1048 ILE B C     1 
ATOM   2279 O  O     . ILE B 2 134 ? 2.500   77.128  220.461 1.00 53.48  ?  1048 ILE B O     1 
ATOM   2280 C  CB    . ILE B 2 134 ? 4.342   77.225  223.342 1.00 50.86  ?  1048 ILE B CB    1 
ATOM   2281 C  CG1   . ILE B 2 134 ? 3.994   76.557  224.681 1.00 46.05  ?  1048 ILE B CG1   1 
ATOM   2282 C  CG2   . ILE B 2 134 ? 3.586   78.538  223.236 1.00 54.61  ?  1048 ILE B CG2   1 
ATOM   2283 C  CD1   . ILE B 2 134 ? 4.861   75.384  225.064 1.00 56.89  ?  1048 ILE B CD1   1 
ATOM   2284 N  N     . ARG B 2 135 ? 4.671   77.697  220.257 1.00 58.70  ?  1049 ARG B N     1 
ATOM   2285 C  CA    . ARG B 2 135 ? 4.452   78.485  219.046 1.00 56.93  ?  1049 ARG B CA    1 
ATOM   2286 C  C     . ARG B 2 135 ? 3.872   77.632  217.924 1.00 64.79  ?  1049 ARG B C     1 
ATOM   2287 O  O     . ARG B 2 135 ? 3.021   78.095  217.150 1.00 64.65  ?  1049 ARG B O     1 
ATOM   2288 C  CB    . ARG B 2 135 ? 5.771   79.120  218.603 1.00 40.69  ?  1049 ARG B CB    1 
ATOM   2289 C  CG    . ARG B 2 135 ? 5.907   80.600  218.917 1.00 53.62  ?  1049 ARG B CG    1 
ATOM   2290 C  CD    . ARG B 2 135 ? 7.139   81.182  218.225 1.00 58.26  ?  1049 ARG B CD    1 
ATOM   2291 N  NE    . ARG B 2 135 ? 8.317   80.352  218.439 1.00 71.37  ?  1049 ARG B NE    1 
ATOM   2292 C  CZ    . ARG B 2 135 ? 9.254   80.133  217.519 1.00 98.36  ?  1049 ARG B CZ    1 
ATOM   2293 N  NH1   . ARG B 2 135 ? 9.144   80.661  216.303 1.00 87.16  ?  1049 ARG B NH1   1 
ATOM   2294 N  NH2   . ARG B 2 135 ? 10.300  79.369  217.806 1.00 114.29 ?  1049 ARG B NH2   1 
ATOM   2295 N  N     . PHE B 2 136 ? 4.322   76.381  217.823 1.00 62.32  ?  1050 PHE B N     1 
ATOM   2296 C  CA    . PHE B 2 136 ? 3.822   75.490  216.783 1.00 44.04  ?  1050 PHE B CA    1 
ATOM   2297 C  C     . PHE B 2 136 ? 2.324   75.259  216.937 1.00 43.07  ?  1050 PHE B C     1 
ATOM   2298 O  O     . PHE B 2 136 ? 1.555   75.444  215.984 1.00 40.97  ?  1050 PHE B O     1 
ATOM   2299 C  CB    . PHE B 2 136 ? 4.590   74.167  216.819 1.00 37.51  ?  1050 PHE B CB    1 
ATOM   2300 C  CG    . PHE B 2 136 ? 4.013   73.104  215.930 1.00 40.18  ?  1050 PHE B CG    1 
ATOM   2301 C  CD1   . PHE B 2 136 ? 3.168   72.134  216.448 1.00 49.85  ?  1050 PHE B CD1   1 
ATOM   2302 C  CD2   . PHE B 2 136 ? 4.316   73.070  214.578 1.00 52.74  ?  1050 PHE B CD2   1 
ATOM   2303 C  CE1   . PHE B 2 136 ? 2.638   71.152  215.635 1.00 59.83  ?  1050 PHE B CE1   1 
ATOM   2304 C  CE2   . PHE B 2 136 ? 3.787   72.084  213.754 1.00 38.78  ?  1050 PHE B CE2   1 
ATOM   2305 C  CZ    . PHE B 2 136 ? 2.948   71.127  214.285 1.00 50.71  ?  1050 PHE B CZ    1 
ATOM   2306 N  N     . GLN B 2 137 ? 1.880   74.882  218.143 1.00 44.47  ?  1051 GLN B N     1 
ATOM   2307 C  CA    . GLN B 2 137 ? 0.440   74.692  218.292 1.00 53.03  ?  1051 GLN B CA    1 
ATOM   2308 C  C     . GLN B 2 137 ? -0.333  75.998  218.138 1.00 50.32  ?  1051 GLN B C     1 
ATOM   2309 O  O     . GLN B 2 137 ? -1.486  75.969  217.677 1.00 56.05  ?  1051 GLN B O     1 
ATOM   2310 C  CB    . GLN B 2 137 ? 0.104   73.998  219.619 1.00 39.17  ?  1051 GLN B CB    1 
ATOM   2311 C  CG    . GLN B 2 137 ? 0.814   74.484  220.857 1.00 54.59  ?  1051 GLN B CG    1 
ATOM   2312 C  CD    . GLN B 2 137 ? 0.793   73.429  221.954 1.00 62.06  ?  1051 GLN B CD    1 
ATOM   2313 O  OE1   . GLN B 2 137 ? 0.641   72.238  221.676 1.00 60.82  ?  1051 GLN B OE1   1 
ATOM   2314 N  NE2   . GLN B 2 137 ? 0.926   73.862  223.203 1.00 56.25  ?  1051 GLN B NE2   1 
ATOM   2315 N  N     . GLU B 2 138 ? 0.284   77.139  218.459 1.00 33.11  ?  1052 GLU B N     1 
ATOM   2316 C  CA    . GLU B 2 138 ? -0.352  78.417  218.146 1.00 51.06  ?  1052 GLU B CA    1 
ATOM   2317 C  C     . GLU B 2 138 ? -0.629  78.552  216.645 1.00 51.66  ?  1052 GLU B C     1 
ATOM   2318 O  O     . GLU B 2 138 ? -1.753  78.881  216.235 1.00 44.50  ?  1052 GLU B O     1 
ATOM   2319 C  CB    . GLU B 2 138 ? 0.514   79.572  218.655 1.00 44.83  ?  1052 GLU B CB    1 
ATOM   2320 C  CG    . GLU B 2 138 ? 0.128   80.933  218.091 1.00 60.88  ?  1052 GLU B CG    1 
ATOM   2321 C  CD    . GLU B 2 138 ? -1.227  81.419  218.567 1.00 70.50  ?  1052 GLU B CD    1 
ATOM   2322 O  OE1   . GLU B 2 138 ? -1.821  80.782  219.464 1.00 71.37  ?  1052 GLU B OE1   1 
ATOM   2323 O  OE2   . GLU B 2 138 ? -1.710  82.436  218.023 1.00 89.55  -1 1052 GLU B OE2   1 
ATOM   2324 N  N     . GLU B 2 139 ? 0.377   78.279  215.801 1.00 53.14  ?  1053 GLU B N     1 
ATOM   2325 C  CA    . GLU B 2 139 ? 0.171   78.423  214.357 1.00 63.22  ?  1053 GLU B CA    1 
ATOM   2326 C  C     . GLU B 2 139 ? -0.792  77.380  213.798 1.00 48.76  ?  1053 GLU B C     1 
ATOM   2327 O  O     . GLU B 2 139 ? -1.471  77.636  212.796 1.00 48.09  ?  1053 GLU B O     1 
ATOM   2328 C  CB    . GLU B 2 139 ? 1.498   78.385  213.592 1.00 61.90  ?  1053 GLU B CB    1 
ATOM   2329 C  CG    . GLU B 2 139 ? 2.637   79.107  214.277 1.00 100.45 ?  1053 GLU B CG    1 
ATOM   2330 C  CD    . GLU B 2 139 ? 3.922   79.084  213.471 1.00 109.60 ?  1053 GLU B CD    1 
ATOM   2331 O  OE1   . GLU B 2 139 ? 4.734   80.022  213.637 1.00 119.49 ?  1053 GLU B OE1   1 
ATOM   2332 O  OE2   . GLU B 2 139 ? 4.106   78.153  212.658 1.00 114.69 -1 1053 GLU B OE2   1 
ATOM   2333 N  N     . ARG B 2 140 ? -0.853  76.196  214.405 1.00 51.51  ?  1054 ARG B N     1 
ATOM   2334 C  CA    . ARG B 2 140 ? -1.881  75.239  213.995 1.00 56.67  ?  1054 ARG B CA    1 
ATOM   2335 C  C     . ARG B 2 140 ? -3.276  75.800  214.256 1.00 62.13  ?  1054 ARG B C     1 
ATOM   2336 O  O     . ARG B 2 140 ? -4.137  75.826  213.359 1.00 59.51  ?  1054 ARG B O     1 
ATOM   2337 C  CB    . ARG B 2 140 ? -1.704  73.903  214.722 1.00 54.24  ?  1054 ARG B CB    1 
ATOM   2338 C  CG    . ARG B 2 140 ? -0.304  73.331  214.722 1.00 61.46  ?  1054 ARG B CG    1 
ATOM   2339 C  CD    . ARG B 2 140 ? 0.256   73.124  213.318 1.00 77.82  ?  1054 ARG B CD    1 
ATOM   2340 N  NE    . ARG B 2 140 ? -0.718  72.584  212.375 1.00 87.88  ?  1054 ARG B NE    1 
ATOM   2341 C  CZ    . ARG B 2 140 ? -1.108  73.217  211.273 1.00 92.66  ?  1054 ARG B CZ    1 
ATOM   2342 N  NH1   . ARG B 2 140 ? -0.597  74.406  210.980 1.00 87.62  ?  1054 ARG B NH1   1 
ATOM   2343 N  NH2   . ARG B 2 140 ? -1.999  72.664  210.462 1.00 81.37  ?  1054 ARG B NH2   1 
ATOM   2344 N  N     . ARG B 2 141 ? -3.517  76.239  215.496 1.00 64.32  ?  1055 ARG B N     1 
ATOM   2345 C  CA    . ARG B 2 141 ? -4.759  76.912  215.862 1.00 67.80  ?  1055 ARG B CA    1 
ATOM   2346 C  C     . ARG B 2 141 ? -5.148  77.956  214.821 1.00 70.86  ?  1055 ARG B C     1 
ATOM   2347 O  O     . ARG B 2 141 ? -6.262  77.942  214.265 1.00 84.56  ?  1055 ARG B O     1 
ATOM   2348 C  CB    . ARG B 2 141 ? -4.580  77.569  217.235 1.00 69.18  ?  1055 ARG B CB    1 
ATOM   2349 C  CG    . ARG B 2 141 ? -5.823  77.625  218.088 1.00 58.18  ?  1055 ARG B CG    1 
ATOM   2350 C  CD    . ARG B 2 141 ? -5.844  78.880  218.944 1.00 53.16  ?  1055 ARG B CD    1 
ATOM   2351 N  NE    . ARG B 2 141 ? -6.188  80.073  218.172 1.00 62.39  ?  1055 ARG B NE    1 
ATOM   2352 C  CZ    . ARG B 2 141 ? -5.415  81.150  218.065 1.00 66.02  ?  1055 ARG B CZ    1 
ATOM   2353 N  NH1   . ARG B 2 141 ? -4.247  81.192  218.688 1.00 60.44  ?  1055 ARG B NH1   1 
ATOM   2354 N  NH2   . ARG B 2 141 ? -5.816  82.188  217.342 1.00 67.44  ?  1055 ARG B NH2   1 
ATOM   2355 N  N     . LEU B 2 142 ? -4.203  78.862  214.546 1.00 66.33  ?  1056 LEU B N     1 
ATOM   2356 C  CA    . LEU B 2 142 ? -4.397  79.882  213.521 1.00 55.86  ?  1056 LEU B CA    1 
ATOM   2357 C  C     . LEU B 2 142 ? -4.857  79.273  212.208 1.00 64.45  ?  1056 LEU B C     1 
ATOM   2358 O  O     . LEU B 2 142 ? -5.820  79.746  211.593 1.00 71.88  ?  1056 LEU B O     1 
ATOM   2359 C  CB    . LEU B 2 142 ? -3.100  80.659  213.302 1.00 58.96  ?  1056 LEU B CB    1 
ATOM   2360 C  CG    . LEU B 2 142 ? -2.864  81.932  214.107 1.00 64.68  ?  1056 LEU B CG    1 
ATOM   2361 C  CD1   . LEU B 2 142 ? -1.479  82.487  213.816 1.00 62.40  ?  1056 LEU B CD1   1 
ATOM   2362 C  CD2   . LEU B 2 142 ? -3.930  82.956  213.772 1.00 60.15  ?  1056 LEU B CD2   1 
ATOM   2363 N  N     . SER B 2 143 ? -4.166  78.222  211.758 1.00 65.51  ?  1057 SER B N     1 
ATOM   2364 C  CA    . SER B 2 143 ? -4.491  77.618  210.471 1.00 62.87  ?  1057 SER B CA    1 
ATOM   2365 C  C     . SER B 2 143 ? -5.945  77.170  210.420 1.00 64.88  ?  1057 SER B C     1 
ATOM   2366 O  O     . SER B 2 143 ? -6.671  77.488  209.470 1.00 70.32  ?  1057 SER B O     1 
ATOM   2367 C  CB    . SER B 2 143 ? -3.558  76.441  210.196 1.00 66.16  ?  1057 SER B CB    1 
ATOM   2368 O  OG    . SER B 2 143 ? -3.694  75.453  211.199 1.00 85.54  ?  1057 SER B OG    1 
ATOM   2369 N  N     . GLU B 2 144 ? -6.397  76.440  211.445 1.00 66.01  ?  1058 GLU B N     1 
ATOM   2370 C  CA    . GLU B 2 144 ? -7.758  75.912  211.393 1.00 56.39  ?  1058 GLU B CA    1 
ATOM   2371 C  C     . GLU B 2 144 ? -8.826  76.987  211.576 1.00 61.41  ?  1058 GLU B C     1 
ATOM   2372 O  O     . GLU B 2 144 ? -9.966  76.773  211.149 1.00 62.40  ?  1058 GLU B O     1 
ATOM   2373 C  CB    . GLU B 2 144 ? -7.943  74.812  212.439 1.00 48.43  ?  1058 GLU B CB    1 
ATOM   2374 N  N     . LEU B 2 145 ? -8.502  78.126  212.201 1.00 74.82  ?  1059 LEU B N     1 
ATOM   2375 C  CA    . LEU B 2 145 ? -9.497  79.194  212.327 1.00 84.20  ?  1059 LEU B CA    1 
ATOM   2376 C  C     . LEU B 2 145 ? -9.964  79.691  210.961 1.00 100.09 ?  1059 LEU B C     1 
ATOM   2377 O  O     . LEU B 2 145 ? -11.151 79.602  210.625 1.00 91.15  ?  1059 LEU B O     1 
ATOM   2378 C  CB    . LEU B 2 145 ? -8.938  80.372  213.124 1.00 83.34  ?  1059 LEU B CB    1 
ATOM   2379 C  CG    . LEU B 2 145 ? -8.939  80.456  214.648 1.00 80.00  ?  1059 LEU B CG    1 
ATOM   2380 C  CD1   . LEU B 2 145 ? -8.902  81.931  215.026 1.00 65.22  ?  1059 LEU B CD1   1 
ATOM   2381 C  CD2   . LEU B 2 145 ? -10.133 79.759  215.281 1.00 76.85  ?  1059 LEU B CD2   1 
ATOM   2382 N  N     . ALA B 2 146 ? -9.030  80.240  210.179 1.00 115.31 ?  1060 ALA B N     1 
ATOM   2383 C  CA    . ALA B 2 146 ? -9.250  80.971  208.917 1.00 118.53 ?  1060 ALA B CA    1 
ATOM   2384 C  C     . ALA B 2 146 ? -10.698 81.074  208.430 1.00 114.11 ?  1060 ALA B C     1 
ATOM   2385 O  O     . ALA B 2 146 ? -11.472 81.901  208.918 1.00 101.54 ?  1060 ALA B O     1 
ATOM   2386 C  CB    . ALA B 2 146 ? -8.388  80.350  207.817 1.00 114.96 ?  1060 ALA B CB    1 
ATOM   2387 N  N     . TYR C 1 8   ? -8.190  76.208  222.591 1.00 70.70  ?  6    TYR C N     1 
ATOM   2388 C  CA    . TYR C 1 8   ? -8.177  77.476  223.315 1.00 69.42  ?  6    TYR C CA    1 
ATOM   2389 C  C     . TYR C 1 8   ? -8.336  78.628  222.331 1.00 63.46  ?  6    TYR C C     1 
ATOM   2390 O  O     . TYR C 1 8   ? -8.136  78.452  221.132 1.00 59.66  ?  6    TYR C O     1 
ATOM   2391 C  CB    . TYR C 1 8   ? -6.883  77.631  224.117 1.00 63.22  ?  6    TYR C CB    1 
ATOM   2392 C  CG    . TYR C 1 8   ? -5.676  77.894  223.250 1.00 69.54  ?  6    TYR C CG    1 
ATOM   2393 C  CD1   . TYR C 1 8   ? -4.975  76.847  222.668 1.00 74.97  ?  6    TYR C CD1   1 
ATOM   2394 C  CD2   . TYR C 1 8   ? -5.245  79.189  223.003 1.00 71.70  ?  6    TYR C CD2   1 
ATOM   2395 C  CE1   . TYR C 1 8   ? -3.874  77.083  221.869 1.00 76.26  ?  6    TYR C CE1   1 
ATOM   2396 C  CE2   . TYR C 1 8   ? -4.147  79.437  222.205 1.00 77.11  ?  6    TYR C CE2   1 
ATOM   2397 C  CZ    . TYR C 1 8   ? -3.464  78.380  221.638 1.00 75.44  ?  6    TYR C CZ    1 
ATOM   2398 O  OH    . TYR C 1 8   ? -2.367  78.618  220.836 1.00 51.47  ?  6    TYR C OH    1 
ATOM   2399 N  N     . ASP C 1 9   ? -8.665  79.813  222.841 1.00 78.13  ?  7    ASP C N     1 
ATOM   2400 C  CA    . ASP C 1 9   ? -9.049  80.923  221.977 1.00 78.99  ?  7    ASP C CA    1 
ATOM   2401 C  C     . ASP C 1 9   ? -7.869  81.789  221.543 1.00 81.51  ?  7    ASP C C     1 
ATOM   2402 O  O     . ASP C 1 9   ? -7.762  82.132  220.362 1.00 102.63 ?  7    ASP C O     1 
ATOM   2403 C  CB    . ASP C 1 9   ? -10.111 81.778  222.673 1.00 81.67  ?  7    ASP C CB    1 
ATOM   2404 C  CG    . ASP C 1 9   ? -11.425 81.043  222.832 1.00 98.38  ?  7    ASP C CG    1 
ATOM   2405 O  OD1   . ASP C 1 9   ? -11.660 80.090  222.059 1.00 96.63  ?  7    ASP C OD1   1 
ATOM   2406 O  OD2   . ASP C 1 9   ? -12.219 81.407  223.724 1.00 113.28 -1 7    ASP C OD2   1 
ATOM   2407 N  N     . LEU C 1 10  ? -6.981  82.161  222.463 1.00 72.08  ?  8    LEU C N     1 
ATOM   2408 C  CA    . LEU C 1 10  ? -5.914  83.091  222.116 1.00 69.91  ?  8    LEU C CA    1 
ATOM   2409 C  C     . LEU C 1 10  ? -4.680  82.814  222.967 1.00 75.44  ?  8    LEU C C     1 
ATOM   2410 O  O     . LEU C 1 10  ? -4.696  81.974  223.866 1.00 87.19  ?  8    LEU C O     1 
ATOM   2411 C  CB    . LEU C 1 10  ? -6.373  84.545  222.272 1.00 76.89  ?  8    LEU C CB    1 
ATOM   2412 C  CG    . LEU C 1 10  ? -6.389  85.338  220.961 1.00 93.01  ?  8    LEU C CG    1 
ATOM   2413 C  CD1   . LEU C 1 10  ? -6.654  86.817  221.212 1.00 104.91 ?  8    LEU C CD1   1 
ATOM   2414 C  CD2   . LEU C 1 10  ? -5.091  85.144  220.180 1.00 87.06  ?  8    LEU C CD2   1 
ATOM   2415 N  N     . LEU C 1 11  ? -3.605  83.547  222.676 1.00 69.60  ?  9    LEU C N     1 
ATOM   2416 C  CA    . LEU C 1 11  ? -2.296  83.289  223.270 1.00 55.36  ?  9    LEU C CA    1 
ATOM   2417 C  C     . LEU C 1 11  ? -1.616  84.615  223.582 1.00 57.23  ?  9    LEU C C     1 
ATOM   2418 O  O     . LEU C 1 11  ? -1.313  85.389  222.669 1.00 63.74  ?  9    LEU C O     1 
ATOM   2419 C  CB    . LEU C 1 11  ? -1.437  82.439  222.322 1.00 43.29  ?  9    LEU C CB    1 
ATOM   2420 C  CG    . LEU C 1 11  ? -0.046  81.887  222.679 1.00 49.48  ?  9    LEU C CG    1 
ATOM   2421 C  CD1   . LEU C 1 11  ? 1.063   82.931  222.568 1.00 42.51  ?  9    LEU C CD1   1 
ATOM   2422 C  CD2   . LEU C 1 11  ? -0.035  81.201  224.043 1.00 55.32  ?  9    LEU C CD2   1 
ATOM   2423 N  N     . PHE C 1 12  ? -1.376  84.881  224.865 1.00 76.91  ?  10   PHE C N     1 
ATOM   2424 C  CA    . PHE C 1 12  ? -0.691  86.095  225.296 1.00 77.63  ?  10   PHE C CA    1 
ATOM   2425 C  C     . PHE C 1 12  ? 0.638   85.712  225.934 1.00 70.28  ?  10   PHE C C     1 
ATOM   2426 O  O     . PHE C 1 12  ? 0.702   84.760  226.717 1.00 70.88  ?  10   PHE C O     1 
ATOM   2427 C  CB    . PHE C 1 12  ? -1.524  86.906  226.305 1.00 82.01  ?  10   PHE C CB    1 
ATOM   2428 C  CG    . PHE C 1 12  ? -2.896  87.315  225.811 1.00 86.88  ?  10   PHE C CG    1 
ATOM   2429 C  CD1   . PHE C 1 12  ? -3.238  87.256  224.467 1.00 91.64  ?  10   PHE C CD1   1 
ATOM   2430 C  CD2   . PHE C 1 12  ? -3.844  87.772  226.713 1.00 87.75  ?  10   PHE C CD2   1 
ATOM   2431 C  CE1   . PHE C 1 12  ? -4.504  87.633  224.040 1.00 97.23  ?  10   PHE C CE1   1 
ATOM   2432 C  CE2   . PHE C 1 12  ? -5.105  88.154  226.294 1.00 88.18  ?  10   PHE C CE2   1 
ATOM   2433 C  CZ    . PHE C 1 12  ? -5.437  88.085  224.957 1.00 94.54  ?  10   PHE C CZ    1 
ATOM   2434 N  N     . LYS C 1 13  ? 1.697   86.459  225.612 1.00 54.00  ?  11   LYS C N     1 
ATOM   2435 C  CA    . LYS C 1 13  ? 3.051   86.170  226.099 1.00 61.79  ?  11   LYS C CA    1 
ATOM   2436 C  C     . LYS C 1 13  ? 3.533   87.323  226.974 1.00 68.08  ?  11   LYS C C     1 
ATOM   2437 O  O     . LYS C 1 13  ? 3.847   88.403  226.467 1.00 67.61  ?  11   LYS C O     1 
ATOM   2438 C  CB    . LYS C 1 13  ? 4.033   85.940  224.953 1.00 60.47  ?  11   LYS C CB    1 
ATOM   2439 C  CG    . LYS C 1 13  ? 3.444   85.359  223.694 1.00 74.52  ?  11   LYS C CG    1 
ATOM   2440 C  CD    . LYS C 1 13  ? 4.493   85.324  222.594 1.00 77.40  ?  11   LYS C CD    1 
ATOM   2441 C  CE    . LYS C 1 13  ? 3.856   85.168  221.226 1.00 74.99  ?  11   LYS C CE    1 
ATOM   2442 N  NZ    . LYS C 1 13  ? 3.886   83.749  220.767 1.00 83.36  ?  11   LYS C NZ    1 
ATOM   2443 N  N     . LEU C 1 14  ? 3.638   87.087  228.278 1.00 73.01  ?  12   LEU C N     1 
ATOM   2444 C  CA    . LEU C 1 14  ? 4.033   88.117  229.230 1.00 80.45  ?  12   LEU C CA    1 
ATOM   2445 C  C     . LEU C 1 14  ? 5.480   87.928  229.644 1.00 70.25  ?  12   LEU C C     1 
ATOM   2446 O  O     . LEU C 1 14  ? 6.050   86.850  229.478 1.00 60.93  ?  12   LEU C O     1 
ATOM   2447 C  CB    . LEU C 1 14  ? 3.169   88.062  230.479 1.00 69.00  ?  12   LEU C CB    1 
ATOM   2448 C  CG    . LEU C 1 14  ? 1.689   87.868  230.224 1.00 73.03  ?  12   LEU C CG    1 
ATOM   2449 C  CD1   . LEU C 1 14  ? 1.082   87.438  231.533 1.00 65.71  ?  12   LEU C CD1   1 
ATOM   2450 C  CD2   . LEU C 1 14  ? 1.074   89.146  229.685 1.00 74.98  ?  12   LEU C CD2   1 
ATOM   2451 N  N     . LEU C 1 15  ? 6.068   88.970  230.220 1.00 59.95  ?  13   LEU C N     1 
ATOM   2452 C  CA    . LEU C 1 15  ? 7.408   88.822  230.764 1.00 70.87  ?  13   LEU C CA    1 
ATOM   2453 C  C     . LEU C 1 15  ? 7.562   89.612  232.060 1.00 90.22  ?  13   LEU C C     1 
ATOM   2454 O  O     . LEU C 1 15  ? 7.064   90.738  232.195 1.00 101.01 ?  13   LEU C O     1 
ATOM   2455 C  CB    . LEU C 1 15  ? 8.471   89.233  229.740 1.00 56.26  ?  13   LEU C CB    1 
ATOM   2456 C  CG    . LEU C 1 15  ? 9.893   89.476  230.242 1.00 75.73  ?  13   LEU C CG    1 
ATOM   2457 C  CD1   . LEU C 1 15  ? 10.488  88.188  230.806 1.00 86.59  ?  13   LEU C CD1   1 
ATOM   2458 C  CD2   . LEU C 1 15  ? 10.760  89.999  229.113 1.00 71.38  ?  13   LEU C CD2   1 
ATOM   2459 N  N     . LEU C 1 16  ? 8.232   88.981  233.021 1.00 83.29  ?  14   LEU C N     1 
ATOM   2460 C  CA    . LEU C 1 16  ? 8.621   89.578  234.291 1.00 87.68  ?  14   LEU C CA    1 
ATOM   2461 C  C     . LEU C 1 16  ? 10.088  89.955  234.219 1.00 92.57  ?  14   LEU C C     1 
ATOM   2462 O  O     . LEU C 1 16  ? 10.924  89.099  233.892 1.00 102.67 ?  14   LEU C O     1 
ATOM   2463 C  CB    . LEU C 1 16  ? 8.446   88.590  235.439 1.00 74.54  ?  14   LEU C CB    1 
ATOM   2464 C  CG    . LEU C 1 16  ? 7.194   87.744  235.424 1.00 77.95  ?  14   LEU C CG    1 
ATOM   2465 C  CD1   . LEU C 1 16  ? 7.461   86.454  236.122 1.00 75.00  ?  14   LEU C CD1   1 
ATOM   2466 C  CD2   . LEU C 1 16  ? 6.158   88.474  236.161 1.00 72.28  ?  14   LEU C CD2   1 
ATOM   2467 N  N     . ILE C 1 17  ? 10.390  91.199  234.599 1.00 88.61  ?  15   ILE C N     1 
ATOM   2468 C  CA    . ILE C 1 17  ? 11.753  91.701  234.715 1.00 102.42 ?  15   ILE C CA    1 
ATOM   2469 C  C     . ILE C 1 17  ? 12.010  92.191  236.145 1.00 135.37 ?  15   ILE C C     1 
ATOM   2470 O  O     . ILE C 1 17  ? 11.157  92.834  236.780 1.00 123.93 ?  15   ILE C O     1 
ATOM   2471 C  CB    . ILE C 1 17  ? 12.057  92.807  233.674 1.00 102.03 ?  15   ILE C CB    1 
ATOM   2472 C  CG1   . ILE C 1 17  ? 12.575  92.188  232.388 1.00 103.80 ?  15   ILE C CG1   1 
ATOM   2473 C  CG2   . ILE C 1 17  ? 13.039  93.815  234.213 1.00 109.42 ?  15   ILE C CG2   1 
ATOM   2474 C  CD1   . ILE C 1 17  ? 12.879  93.141  231.356 1.00 101.35 ?  15   ILE C CD1   1 
ATOM   2475 N  N     . GLY C 1 18  ? 13.183  91.842  236.656 1.00 167.85 ?  16   GLY C N     1 
ATOM   2476 C  CA    . GLY C 1 18  ? 13.588  92.385  237.942 1.00 177.79 ?  16   GLY C CA    1 
ATOM   2477 C  C     . GLY C 1 18  ? 14.954  91.951  238.424 1.00 181.58 ?  16   GLY C C     1 
ATOM   2478 O  O     . GLY C 1 18  ? 15.648  91.161  237.796 1.00 186.73 ?  16   GLY C O     1 
ATOM   2479 N  N     . ASP C 1 19  ? 15.341  92.532  239.574 1.00 174.54 ?  17   ASP C N     1 
ATOM   2480 C  CA    . ASP C 1 19  ? 16.615  92.319  240.252 1.00 162.12 ?  17   ASP C CA    1 
ATOM   2481 C  C     . ASP C 1 19  ? 16.521  91.064  241.099 1.00 149.37 ?  17   ASP C C     1 
ATOM   2482 O  O     . ASP C 1 19  ? 15.447  90.663  241.530 1.00 150.06 ?  17   ASP C O     1 
ATOM   2483 C  CB    . ASP C 1 19  ? 17.025  93.506  241.153 1.00 161.06 ?  17   ASP C CB    1 
ATOM   2484 C  CG    . ASP C 1 19  ? 17.517  94.728  240.372 1.00 151.96 ?  17   ASP C CG    1 
ATOM   2485 O  OD1   . ASP C 1 19  ? 18.663  94.691  239.881 1.00 139.37 ?  17   ASP C OD1   1 
ATOM   2486 O  OD2   . ASP C 1 19  ? 16.814  95.766  240.339 1.00 153.69 -1 17   ASP C OD2   1 
ATOM   2487 N  N     . SER C 1 20  ? 17.654  90.431  241.339 1.00 127.66 ?  18   SER C N     1 
ATOM   2488 C  CA    . SER C 1 20  ? 17.599  89.146  242.029 1.00 117.88 ?  18   SER C CA    1 
ATOM   2489 C  C     . SER C 1 20  ? 17.312  89.373  243.512 1.00 127.30 ?  18   SER C C     1 
ATOM   2490 O  O     . SER C 1 20  ? 18.170  89.849  244.256 1.00 125.70 ?  18   SER C O     1 
ATOM   2491 C  CB    . SER C 1 20  ? 18.897  88.376  241.824 1.00 116.88 ?  18   SER C CB    1 
ATOM   2492 O  OG    . SER C 1 20  ? 18.819  87.104  242.441 1.00 117.04 ?  18   SER C OG    1 
ATOM   2493 N  N     . GLY C 1 21  ? 16.098  89.033  243.953 1.00 143.28 ?  19   GLY C N     1 
ATOM   2494 C  CA    . GLY C 1 21  ? 15.777  89.053  245.371 1.00 146.35 ?  19   GLY C CA    1 
ATOM   2495 C  C     . GLY C 1 21  ? 14.488  89.774  245.714 1.00 142.64 ?  19   GLY C C     1 
ATOM   2496 O  O     . GLY C 1 21  ? 14.301  90.239  246.845 1.00 145.50 ?  19   GLY C O     1 
ATOM   2497 N  N     . VAL C 1 22  ? 13.582  89.839  244.743 1.00 111.26 ?  20   VAL C N     1 
ATOM   2498 C  CA    . VAL C 1 22  ? 12.411  90.702  244.821 1.00 96.33  ?  20   VAL C CA    1 
ATOM   2499 C  C     . VAL C 1 22  ? 11.092  89.950  244.707 1.00 103.76 ?  20   VAL C C     1 
ATOM   2500 O  O     . VAL C 1 22  ? 10.060  90.484  245.145 1.00 99.96  ?  20   VAL C O     1 
ATOM   2501 C  CB    . VAL C 1 22  ? 12.484  91.800  243.746 1.00 82.94  ?  20   VAL C CB    1 
ATOM   2502 C  CG1   . VAL C 1 22  ? 13.559  92.810  244.087 1.00 91.37  ?  20   VAL C CG1   1 
ATOM   2503 C  CG2   . VAL C 1 22  ? 12.839  91.141  242.473 1.00 90.70  ?  20   VAL C CG2   1 
ATOM   2504 N  N     . GLY C 1 23  ? 11.073  88.765  244.102 1.00 103.78 ?  21   GLY C N     1 
ATOM   2505 C  CA    . GLY C 1 23  ? 9.887   87.934  244.163 1.00 97.67  ?  21   GLY C CA    1 
ATOM   2506 C  C     . GLY C 1 23  ? 9.401   87.302  242.874 1.00 96.73  ?  21   GLY C C     1 
ATOM   2507 O  O     . GLY C 1 23  ? 8.467   86.496  242.920 1.00 96.02  ?  21   GLY C O     1 
ATOM   2508 N  N     . LYS C 1 24  ? 10.028  87.627  241.736 1.00 106.61 ?  22   LYS C N     1 
ATOM   2509 C  CA    . LYS C 1 24  ? 9.575   87.182  240.414 1.00 92.04  ?  22   LYS C CA    1 
ATOM   2510 C  C     . LYS C 1 24  ? 9.156   85.721  240.340 1.00 73.14  ?  22   LYS C C     1 
ATOM   2511 O  O     . LYS C 1 24  ? 8.002   85.404  240.027 1.00 68.41  ?  22   LYS C O     1 
ATOM   2512 C  CB    . LYS C 1 24  ? 10.655  87.371  239.356 1.00 96.37  ?  22   LYS C CB    1 
ATOM   2513 C  CG    . LYS C 1 24  ? 11.383  88.677  239.341 1.00 97.89  ?  22   LYS C CG    1 
ATOM   2514 C  CD    . LYS C 1 24  ? 12.078  88.780  238.003 1.00 84.57  ?  22   LYS C CD    1 
ATOM   2515 C  CE    . LYS C 1 24  ? 13.482  89.310  238.179 1.00 91.48  ?  22   LYS C CE    1 
ATOM   2516 N  NZ    . LYS C 1 24  ? 13.732  89.876  239.535 1.00 117.85 ?  22   LYS C NZ    1 
ATOM   2517 N  N     . THR C 1 25  ? 10.106  84.817  240.566 1.00 60.78  ?  23   THR C N     1 
ATOM   2518 C  CA    . THR C 1 25  ? 9.779   83.403  240.456 1.00 64.03  ?  23   THR C CA    1 
ATOM   2519 C  C     . THR C 1 25  ? 8.720   83.005  241.480 1.00 72.71  ?  23   THR C C     1 
ATOM   2520 O  O     . THR C 1 25  ? 7.956   82.060  241.250 1.00 84.31  ?  23   THR C O     1 
ATOM   2521 C  CB    . THR C 1 25  ? 11.051  82.562  240.604 1.00 77.05  ?  23   THR C CB    1 
ATOM   2522 O  OG1   . THR C 1 25  ? 12.060  83.065  239.720 1.00 78.79  ?  23   THR C OG1   1 
ATOM   2523 C  CG2   . THR C 1 25  ? 10.787  81.103  240.249 1.00 74.49  ?  23   THR C CG2   1 
ATOM   2524 N  N     . CYS C 1 26  ? 8.630   83.736  242.596 1.00 83.44  ?  24   CYS C N     1 
ATOM   2525 C  CA    . CYS C 1 26  ? 7.597   83.461  243.587 1.00 89.90  ?  24   CYS C CA    1 
ATOM   2526 C  C     . CYS C 1 26  ? 6.261   84.116  243.261 1.00 84.83  ?  24   CYS C C     1 
ATOM   2527 O  O     . CYS C 1 26  ? 5.219   83.536  243.578 1.00 82.78  ?  24   CYS C O     1 
ATOM   2528 C  CB    . CYS C 1 26  ? 8.054   83.895  244.985 1.00 86.37  ?  24   CYS C CB    1 
ATOM   2529 S  SG    . CYS C 1 26  ? 9.705   83.318  245.444 1.00 80.31  ?  24   CYS C SG    1 
ATOM   2530 N  N     . VAL C 1 27  ? 6.229   85.301  242.648 1.00 93.72  ?  25   VAL C N     1 
ATOM   2531 C  CA    . VAL C 1 27  ? 4.930   85.823  242.220 1.00 97.63  ?  25   VAL C CA    1 
ATOM   2532 C  C     . VAL C 1 27  ? 4.346   84.914  241.145 1.00 94.37  ?  25   VAL C C     1 
ATOM   2533 O  O     . VAL C 1 27  ? 3.196   84.451  241.241 1.00 97.26  ?  25   VAL C O     1 
ATOM   2534 C  CB    . VAL C 1 27  ? 5.031   87.290  241.752 1.00 103.39 ?  25   VAL C CB    1 
ATOM   2535 C  CG1   . VAL C 1 27  ? 6.079   87.500  240.685 1.00 103.57 ?  25   VAL C CG1   1 
ATOM   2536 C  CG2   . VAL C 1 27  ? 3.693   87.754  241.216 1.00 102.74 ?  25   VAL C CG2   1 
ATOM   2537 N  N     . LEU C 1 28  ? 5.164   84.590  240.137 1.00 86.09  ?  26   LEU C N     1 
ATOM   2538 C  CA    . LEU C 1 28  ? 4.745   83.638  239.118 1.00 71.72  ?  26   LEU C CA    1 
ATOM   2539 C  C     . LEU C 1 28  ? 4.360   82.302  239.734 1.00 64.49  ?  26   LEU C C     1 
ATOM   2540 O  O     . LEU C 1 28  ? 3.376   81.690  239.322 1.00 65.94  ?  26   LEU C O     1 
ATOM   2541 C  CB    . LEU C 1 28  ? 5.855   83.448  238.086 1.00 75.38  ?  26   LEU C CB    1 
ATOM   2542 C  CG    . LEU C 1 28  ? 5.631   82.459  236.933 1.00 62.54  ?  26   LEU C CG    1 
ATOM   2543 C  CD1   . LEU C 1 28  ? 4.194   82.437  236.418 1.00 58.41  ?  26   LEU C CD1   1 
ATOM   2544 C  CD2   . LEU C 1 28  ? 6.583   82.783  235.807 1.00 65.37  ?  26   LEU C CD2   1 
ATOM   2545 N  N     . PHE C 1 29  ? 5.113   81.828  240.724 1.00 75.89  ?  27   PHE C N     1 
ATOM   2546 C  CA    . PHE C 1 29  ? 4.802   80.509  241.264 1.00 77.96  ?  27   PHE C CA    1 
ATOM   2547 C  C     . PHE C 1 29  ? 3.494   80.522  242.043 1.00 86.85  ?  27   PHE C C     1 
ATOM   2548 O  O     . PHE C 1 29  ? 2.720   79.557  241.983 1.00 85.75  ?  27   PHE C O     1 
ATOM   2549 C  CB    . PHE C 1 29  ? 5.939   79.997  242.143 1.00 75.46  ?  27   PHE C CB    1 
ATOM   2550 C  CG    . PHE C 1 29  ? 5.870   78.520  242.399 1.00 69.68  ?  27   PHE C CG    1 
ATOM   2551 C  CD1   . PHE C 1 29  ? 6.213   77.623  241.402 1.00 64.99  ?  27   PHE C CD1   1 
ATOM   2552 C  CD2   . PHE C 1 29  ? 5.458   78.026  243.627 1.00 87.59  ?  27   PHE C CD2   1 
ATOM   2553 C  CE1   . PHE C 1 29  ? 6.151   76.266  241.619 1.00 67.50  ?  27   PHE C CE1   1 
ATOM   2554 C  CE2   . PHE C 1 29  ? 5.395   76.663  243.854 1.00 88.36  ?  27   PHE C CE2   1 
ATOM   2555 C  CZ    . PHE C 1 29  ? 5.742   75.782  242.846 1.00 83.20  ?  27   PHE C CZ    1 
ATOM   2556 N  N     . ARG C 1 30  ? 3.228   81.605  242.776 1.00 90.14  ?  28   ARG C N     1 
ATOM   2557 C  CA    . ARG C 1 30  ? 1.961   81.711  243.488 1.00 96.33  ?  28   ARG C CA    1 
ATOM   2558 C  C     . ARG C 1 30  ? 0.791   81.746  242.520 1.00 98.92  ?  28   ARG C C     1 
ATOM   2559 O  O     . ARG C 1 30  ? -0.279  81.207  242.812 1.00 91.23  ?  28   ARG C O     1 
ATOM   2560 C  CB    . ARG C 1 30  ? 1.953   82.949  244.381 1.00 99.70  ?  28   ARG C CB    1 
ATOM   2561 N  N     . PHE C 1 31  ? 0.964   82.375  241.360 1.00 110.06 ?  29   PHE C N     1 
ATOM   2562 C  CA    . PHE C 1 31  ? -0.147  82.391  240.410 1.00 110.23 ?  29   PHE C CA    1 
ATOM   2563 C  C     . PHE C 1 31  ? -0.271  81.080  239.654 1.00 107.63 ?  29   PHE C C     1 
ATOM   2564 O  O     . PHE C 1 31  ? -1.376  80.556  239.470 1.00 108.13 ?  29   PHE C O     1 
ATOM   2565 C  CB    . PHE C 1 31  ? 0.036   83.514  239.419 1.00 98.29  ?  29   PHE C CB    1 
ATOM   2566 C  CG    . PHE C 1 31  ? -0.988  83.527  238.331 1.00 96.11  ?  29   PHE C CG    1 
ATOM   2567 C  CD1   . PHE C 1 31  ? -0.632  83.234  237.025 1.00 105.66 ?  29   PHE C CD1   1 
ATOM   2568 C  CD2   . PHE C 1 31  ? -2.305  83.851  238.606 1.00 99.20  ?  29   PHE C CD2   1 
ATOM   2569 C  CE1   . PHE C 1 31  ? -1.571  83.257  236.015 1.00 98.01  ?  29   PHE C CE1   1 
ATOM   2570 C  CE2   . PHE C 1 31  ? -3.250  83.877  237.598 1.00 104.35 ?  29   PHE C CE2   1 
ATOM   2571 C  CZ    . PHE C 1 31  ? -2.883  83.578  236.302 1.00 95.85  ?  29   PHE C CZ    1 
ATOM   2572 N  N     . SER C 1 32  ? 0.853   80.570  239.167 1.00 98.63  ?  30   SER C N     1 
ATOM   2573 C  CA    . SER C 1 32  ? 0.861   79.362  238.361 1.00 97.63  ?  30   SER C CA    1 
ATOM   2574 C  C     . SER C 1 32  ? 0.350   78.172  239.154 1.00 103.08 ?  30   SER C C     1 
ATOM   2575 O  O     . SER C 1 32  ? -0.374  77.326  238.619 1.00 100.12 ?  30   SER C O     1 
ATOM   2576 C  CB    . SER C 1 32  ? 2.279   79.103  237.856 1.00 103.25 ?  30   SER C CB    1 
ATOM   2577 O  OG    . SER C 1 32  ? 3.178   78.980  238.947 1.00 114.80 ?  30   SER C OG    1 
ATOM   2578 N  N     . ASP C 1 33  ? 0.712   78.084  240.434 1.00 109.06 ?  31   ASP C N     1 
ATOM   2579 C  CA    . ASP C 1 33  ? 0.357   76.904  241.205 1.00 106.54 ?  31   ASP C CA    1 
ATOM   2580 C  C     . ASP C 1 33  ? -0.235  77.196  242.575 1.00 103.10 ?  31   ASP C C     1 
ATOM   2581 O  O     . ASP C 1 33  ? -0.415  76.252  243.352 1.00 95.89  ?  31   ASP C O     1 
ATOM   2582 C  CB    . ASP C 1 33  ? 1.581   75.988  241.372 1.00 110.84 ?  31   ASP C CB    1 
ATOM   2583 C  CG    . ASP C 1 33  ? 2.302   75.731  240.060 1.00 121.76 ?  31   ASP C CG    1 
ATOM   2584 O  OD1   . ASP C 1 33  ? 2.541   74.549  239.731 1.00 119.28 ?  31   ASP C OD1   1 
ATOM   2585 O  OD2   . ASP C 1 33  ? 2.646   76.711  239.370 1.00 132.22 -1 31   ASP C OD2   1 
ATOM   2586 N  N     . ASP C 1 34  ? -0.528  78.455  242.908 1.00 104.70 ?  32   ASP C N     1 
ATOM   2587 C  CA    . ASP C 1 34  ? -1.235  78.785  244.145 1.00 113.35 ?  32   ASP C CA    1 
ATOM   2588 C  C     . ASP C 1 34  ? -0.428  78.334  245.362 1.00 108.29 ?  32   ASP C C     1 
ATOM   2589 O  O     . ASP C 1 34  ? -0.938  77.666  246.256 1.00 116.88 ?  32   ASP C O     1 
ATOM   2590 C  CB    . ASP C 1 34  ? -2.635  78.166  244.131 1.00 115.31 ?  32   ASP C CB    1 
ATOM   2591 C  CG    . ASP C 1 34  ? -3.605  78.854  245.062 1.00 115.70 ?  32   ASP C CG    1 
ATOM   2592 O  OD1   . ASP C 1 34  ? -3.325  79.986  245.493 1.00 116.21 ?  32   ASP C OD1   1 
ATOM   2593 O  OD2   . ASP C 1 34  ? -4.669  78.263  245.345 1.00 119.72 -1 32   ASP C OD2   1 
ATOM   2594 N  N     . ALA C 1 35  ? 0.855   78.693  245.382 1.00 98.65  ?  33   ALA C N     1 
ATOM   2595 C  CA    . ALA C 1 35  ? 1.757   78.201  246.414 1.00 101.52 ?  33   ALA C CA    1 
ATOM   2596 C  C     . ALA C 1 35  ? 2.878   79.205  246.653 1.00 105.38 ?  33   ALA C C     1 
ATOM   2597 O  O     . ALA C 1 35  ? 3.063   80.157  245.892 1.00 108.37 ?  33   ALA C O     1 
ATOM   2598 C  CB    . ALA C 1 35  ? 2.333   76.831  246.037 1.00 104.82 ?  33   ALA C CB    1 
ATOM   2599 N  N     . PHE C 1 36  ? 3.632   78.976  247.731 1.00 107.60 ?  34   PHE C N     1 
ATOM   2600 C  CA    . PHE C 1 36  ? 4.785   79.797  248.080 1.00 104.31 ?  34   PHE C CA    1 
ATOM   2601 C  C     . PHE C 1 36  ? 5.785   78.961  248.869 1.00 100.26 ?  34   PHE C C     1 
ATOM   2602 O  O     . PHE C 1 36  ? 5.387   78.149  249.709 1.00 102.79 ?  34   PHE C O     1 
ATOM   2603 C  CB    . PHE C 1 36  ? 4.385   81.022  248.910 1.00 99.44  ?  34   PHE C CB    1 
ATOM   2604 C  CG    . PHE C 1 36  ? 5.558   81.830  249.373 1.00 99.66  ?  34   PHE C CG    1 
ATOM   2605 C  CD1   . PHE C 1 36  ? 6.123   82.786  248.550 1.00 102.46 ?  34   PHE C CD1   1 
ATOM   2606 C  CD2   . PHE C 1 36  ? 6.131   81.597  250.613 1.00 97.69  ?  34   PHE C CD2   1 
ATOM   2607 C  CE1   . PHE C 1 36  ? 7.216   83.510  248.966 1.00 97.76  ?  34   PHE C CE1   1 
ATOM   2608 C  CE2   . PHE C 1 36  ? 7.225   82.316  251.032 1.00 93.56  ?  34   PHE C CE2   1 
ATOM   2609 C  CZ    . PHE C 1 36  ? 7.769   83.276  250.209 1.00 97.73  ?  34   PHE C CZ    1 
ATOM   2610 N  N     . ASN C 1 37  ? 7.081   79.167  248.606 1.00 103.57 ?  35   ASN C N     1 
ATOM   2611 C  CA    . ASN C 1 37  ? 8.134   78.477  249.348 1.00 111.60 ?  35   ASN C CA    1 
ATOM   2612 C  C     . ASN C 1 37  ? 9.268   79.433  249.710 1.00 106.38 ?  35   ASN C C     1 
ATOM   2613 O  O     . ASN C 1 37  ? 9.679   80.265  248.896 1.00 97.69  ?  35   ASN C O     1 
ATOM   2614 C  CB    . ASN C 1 37  ? 8.671   77.261  248.574 1.00 110.05 ?  35   ASN C CB    1 
ATOM   2615 C  CG    . ASN C 1 37  ? 7.568   76.288  248.165 1.00 114.03 ?  35   ASN C CG    1 
ATOM   2616 O  OD1   . ASN C 1 37  ? 6.619   76.650  247.479 1.00 122.96 ?  35   ASN C OD1   1 
ATOM   2617 N  ND2   . ASN C 1 37  ? 7.666   75.058  248.649 1.00 117.14 ?  35   ASN C ND2   1 
ATOM   2618 N  N     . THR C 1 38  ? 9.775   79.283  250.942 1.00 113.19 ?  36   THR C N     1 
ATOM   2619 C  CA    . THR C 1 38  ? 10.698  80.241  251.548 1.00 121.57 ?  36   THR C CA    1 
ATOM   2620 C  C     . THR C 1 38  ? 12.077  80.228  250.904 1.00 120.43 ?  36   THR C C     1 
ATOM   2621 O  O     . THR C 1 38  ? 12.726  81.278  250.824 1.00 127.96 ?  36   THR C O     1 
ATOM   2622 C  CB    . THR C 1 38  ? 10.849  79.934  253.034 1.00 116.86 ?  36   THR C CB    1 
ATOM   2623 O  OG1   . THR C 1 38  ? 11.012  78.521  253.204 1.00 116.87 ?  36   THR C OG1   1 
ATOM   2624 C  CG2   . THR C 1 38  ? 9.625   80.387  253.805 1.00 113.54 ?  36   THR C CG2   1 
ATOM   2625 N  N     . THR C 1 39  ? 12.563  79.058  250.494 1.00 109.03 ?  37   THR C N     1 
ATOM   2626 C  CA    . THR C 1 39  ? 13.908  78.970  249.946 1.00 106.03 ?  37   THR C CA    1 
ATOM   2627 C  C     . THR C 1 39  ? 14.027  79.860  248.714 1.00 104.45 ?  37   THR C C     1 
ATOM   2628 O  O     . THR C 1 39  ? 13.078  80.025  247.947 1.00 109.19 ?  37   THR C O     1 
ATOM   2629 C  CB    . THR C 1 39  ? 14.252  77.523  249.583 1.00 106.08 ?  37   THR C CB    1 
ATOM   2630 O  OG1   . THR C 1 39  ? 13.834  77.243  248.252 1.00 104.61 ?  37   THR C OG1   1 
ATOM   2631 C  CG2   . THR C 1 39  ? 13.556  76.566  250.517 1.00 103.15 ?  37   THR C CG2   1 
ATOM   2632 N  N     . PHE C 1 40  ? 15.198  80.462  248.548 1.00 100.25 ?  38   PHE C N     1 
ATOM   2633 C  CA    . PHE C 1 40  ? 15.479  81.331  247.411 1.00 106.04 ?  38   PHE C CA    1 
ATOM   2634 C  C     . PHE C 1 40  ? 16.364  80.542  246.454 1.00 114.50 ?  38   PHE C C     1 
ATOM   2635 O  O     . PHE C 1 40  ? 17.536  80.295  246.737 1.00 114.74 ?  38   PHE C O     1 
ATOM   2636 C  CB    . PHE C 1 40  ? 16.129  82.639  247.858 1.00 116.33 ?  38   PHE C CB    1 
ATOM   2637 C  CG    . PHE C 1 40  ? 16.936  83.307  246.787 1.00 129.15 ?  38   PHE C CG    1 
ATOM   2638 C  CD1   . PHE C 1 40  ? 18.322  83.240  246.779 1.00 131.41 ?  38   PHE C CD1   1 
ATOM   2639 C  CD2   . PHE C 1 40  ? 16.295  83.967  245.755 1.00 137.45 ?  38   PHE C CD2   1 
ATOM   2640 C  CE1   . PHE C 1 40  ? 19.052  83.857  245.779 1.00 138.53 ?  38   PHE C CE1   1 
ATOM   2641 C  CE2   . PHE C 1 40  ? 17.010  84.577  244.752 1.00 139.95 ?  38   PHE C CE2   1 
ATOM   2642 C  CZ    . PHE C 1 40  ? 18.392  84.525  244.760 1.00 144.27 ?  38   PHE C CZ    1 
ATOM   2643 N  N     . ILE C 1 41  ? 15.794  80.131  245.327 1.00 111.42 ?  39   ILE C N     1 
ATOM   2644 C  CA    . ILE C 1 41  ? 16.502  79.392  244.290 1.00 90.76  ?  39   ILE C CA    1 
ATOM   2645 C  C     . ILE C 1 41  ? 16.674  80.354  243.122 1.00 87.63  ?  39   ILE C C     1 
ATOM   2646 O  O     . ILE C 1 41  ? 15.715  80.640  242.396 1.00 103.58 ?  39   ILE C O     1 
ATOM   2647 C  CB    . ILE C 1 41  ? 15.741  78.124  243.884 1.00 89.14  ?  39   ILE C CB    1 
ATOM   2648 C  CG1   . ILE C 1 41  ? 15.581  77.195  245.093 1.00 88.81  ?  39   ILE C CG1   1 
ATOM   2649 C  CG2   . ILE C 1 41  ? 16.452  77.402  242.752 1.00 95.50  ?  39   ILE C CG2   1 
ATOM   2650 C  CD1   . ILE C 1 41  ? 14.523  76.115  244.926 1.00 81.47  ?  39   ILE C CD1   1 
ATOM   2651 N  N     . SER C 1 42  ? 17.886  80.881  242.952 1.00 77.17  ?  40   SER C N     1 
ATOM   2652 C  CA    . SER C 1 42  ? 18.141  81.845  241.887 1.00 86.42  ?  40   SER C CA    1 
ATOM   2653 C  C     . SER C 1 42  ? 17.774  81.259  240.528 1.00 81.66  ?  40   SER C C     1 
ATOM   2654 O  O     . SER C 1 42  ? 18.192  80.151  240.181 1.00 74.85  ?  40   SER C O     1 
ATOM   2655 C  CB    . SER C 1 42  ? 19.612  82.267  241.898 1.00 91.61  ?  40   SER C CB    1 
ATOM   2656 O  OG    . SER C 1 42  ? 20.019  82.736  240.622 1.00 96.33  ?  40   SER C OG    1 
ATOM   2657 N  N     . THR C 1 43  ? 16.969  81.994  239.765 1.00 88.72  ?  41   THR C N     1 
ATOM   2658 C  CA    . THR C 1 43  ? 16.681  81.587  238.395 1.00 94.69  ?  41   THR C CA    1 
ATOM   2659 C  C     . THR C 1 43  ? 17.928  81.769  237.531 1.00 94.76  ?  41   THR C C     1 
ATOM   2660 O  O     . THR C 1 43  ? 18.712  82.701  237.726 1.00 92.05  ?  41   THR C O     1 
ATOM   2661 C  CB    . THR C 1 43  ? 15.510  82.395  237.823 1.00 84.98  ?  41   THR C CB    1 
ATOM   2662 O  OG1   . THR C 1 43  ? 14.358  82.240  238.662 1.00 85.85  ?  41   THR C OG1   1 
ATOM   2663 C  CG2   . THR C 1 43  ? 15.152  81.916  236.425 1.00 82.89  ?  41   THR C CG2   1 
ATOM   2664 N  N     . ILE C 1 44  ? 18.123  80.850  236.583 1.00 95.00  ?  42   ILE C N     1 
ATOM   2665 C  CA    . ILE C 1 44  ? 19.286  80.857  235.698 1.00 95.47  ?  42   ILE C CA    1 
ATOM   2666 C  C     . ILE C 1 44  ? 18.817  81.096  234.267 1.00 94.54  ?  42   ILE C C     1 
ATOM   2667 O  O     . ILE C 1 44  ? 18.080  80.277  233.702 1.00 100.36 ?  42   ILE C O     1 
ATOM   2668 C  CB    . ILE C 1 44  ? 20.094  79.549  235.774 1.00 89.27  ?  42   ILE C CB    1 
ATOM   2669 C  CG1   . ILE C 1 44  ? 20.579  79.257  237.196 1.00 83.83  ?  42   ILE C CG1   1 
ATOM   2670 C  CG2   . ILE C 1 44  ? 21.284  79.614  234.830 1.00 97.73  ?  42   ILE C CG2   1 
ATOM   2671 C  CD1   . ILE C 1 44  ? 20.965  77.794  237.412 1.00 85.05  ?  42   ILE C CD1   1 
ATOM   2672 N  N     . GLY C 1 45  ? 19.267  82.200  233.674 1.00 82.00  ?  43   GLY C N     1 
ATOM   2673 C  CA    . GLY C 1 45  ? 18.981  82.489  232.283 1.00 70.15  ?  43   GLY C CA    1 
ATOM   2674 C  C     . GLY C 1 45  ? 17.565  82.956  232.023 1.00 73.32  ?  43   GLY C C     1 
ATOM   2675 O  O     . GLY C 1 45  ? 17.274  84.152  232.098 1.00 73.75  ?  43   GLY C O     1 
ATOM   2676 N  N     . ILE C 1 46  ? 16.670  82.014  231.728 1.00 80.09  ?  44   ILE C N     1 
ATOM   2677 C  CA    . ILE C 1 46  ? 15.300  82.337  231.341 1.00 78.46  ?  44   ILE C CA    1 
ATOM   2678 C  C     . ILE C 1 46  ? 14.428  81.146  231.705 1.00 77.33  ?  44   ILE C C     1 
ATOM   2679 O  O     . ILE C 1 46  ? 14.903  80.010  231.770 1.00 79.34  ?  44   ILE C O     1 
ATOM   2680 C  CB    . ILE C 1 46  ? 15.217  82.657  229.826 1.00 78.80  ?  44   ILE C CB    1 
ATOM   2681 C  CG1   . ILE C 1 46  ? 13.862  83.266  229.452 1.00 79.71  ?  44   ILE C CG1   1 
ATOM   2682 C  CG2   . ILE C 1 46  ? 15.505  81.409  228.996 1.00 73.13  ?  44   ILE C CG2   1 
ATOM   2683 C  CD1   . ILE C 1 46  ? 13.508  84.505  230.233 1.00 84.31  ?  44   ILE C CD1   1 
ATOM   2684 N  N     . ASP C 1 47  ? 13.142  81.402  231.946 1.00 71.85  ?  45   ASP C N     1 
ATOM   2685 C  CA    . ASP C 1 47  ? 12.193  80.296  232.033 1.00 75.05  ?  45   ASP C CA    1 
ATOM   2686 C  C     . ASP C 1 47  ? 10.813  80.811  231.645 1.00 67.79  ?  45   ASP C C     1 
ATOM   2687 O  O     . ASP C 1 47  ? 10.645  81.982  231.298 1.00 57.96  ?  45   ASP C O     1 
ATOM   2688 C  CB    . ASP C 1 47  ? 12.201  79.668  233.432 1.00 81.58  ?  45   ASP C CB    1 
ATOM   2689 C  CG    . ASP C 1 47  ? 11.641  78.254  233.443 1.00 87.20  ?  45   ASP C CG    1 
ATOM   2690 O  OD1   . ASP C 1 47  ? 10.982  77.861  232.455 1.00 80.39  ?  45   ASP C OD1   1 
ATOM   2691 O  OD2   . ASP C 1 47  ? 11.871  77.533  234.440 1.00 78.13  -1 45   ASP C OD2   1 
ATOM   2692 N  N     . PHE C 1 48  ? 9.824   79.919  231.679 1.00 76.50  ?  46   PHE C N     1 
ATOM   2693 C  CA    . PHE C 1 48  ? 8.441   80.338  231.486 1.00 73.34  ?  46   PHE C CA    1 
ATOM   2694 C  C     . PHE C 1 48  ? 7.510   79.234  231.961 1.00 71.49  ?  46   PHE C C     1 
ATOM   2695 O  O     . PHE C 1 48  ? 7.894   78.061  232.021 1.00 69.25  ?  46   PHE C O     1 
ATOM   2696 C  CB    . PHE C 1 48  ? 8.147   80.709  230.017 1.00 69.87  ?  46   PHE C CB    1 
ATOM   2697 C  CG    . PHE C 1 48  ? 8.001   79.530  229.079 1.00 62.04  ?  46   PHE C CG    1 
ATOM   2698 C  CD1   . PHE C 1 48  ? 6.789   78.862  228.954 1.00 54.29  ?  46   PHE C CD1   1 
ATOM   2699 C  CD2   . PHE C 1 48  ? 9.063   79.125  228.284 1.00 58.14  ?  46   PHE C CD2   1 
ATOM   2700 C  CE1   . PHE C 1 48  ? 6.649   77.794  228.086 1.00 45.85  ?  46   PHE C CE1   1 
ATOM   2701 C  CE2   . PHE C 1 48  ? 8.927   78.057  227.408 1.00 54.28  ?  46   PHE C CE2   1 
ATOM   2702 C  CZ    . PHE C 1 48  ? 7.718   77.392  227.309 1.00 46.74  ?  46   PHE C CZ    1 
ATOM   2703 N  N     . LYS C 1 49  ? 6.285   79.629  232.305 1.00 69.82  ?  47   LYS C N     1 
ATOM   2704 C  CA    . LYS C 1 49  ? 5.221   78.692  232.626 1.00 60.58  ?  47   LYS C CA    1 
ATOM   2705 C  C     . LYS C 1 49  ? 3.982   79.061  231.819 1.00 64.85  ?  47   LYS C C     1 
ATOM   2706 O  O     . LYS C 1 49  ? 3.859   80.175  231.300 1.00 54.17  ?  47   LYS C O     1 
ATOM   2707 C  CB    . LYS C 1 49  ? 4.904   78.672  234.134 1.00 64.41  ?  47   LYS C CB    1 
ATOM   2708 C  CG    . LYS C 1 49  ? 6.110   78.375  235.040 1.00 77.09  ?  47   LYS C CG    1 
ATOM   2709 C  CD    . LYS C 1 49  ? 6.719   76.997  234.763 1.00 87.18  ?  47   LYS C CD    1 
ATOM   2710 C  CE    . LYS C 1 49  ? 8.004   76.761  235.561 1.00 82.19  ?  47   LYS C CE    1 
ATOM   2711 N  NZ    . LYS C 1 49  ? 8.969   75.884  234.822 1.00 77.62  ?  47   LYS C NZ    1 
ATOM   2712 N  N     . ILE C 1 50  ? 3.061   78.106  231.712 1.00 72.43  ?  48   ILE C N     1 
ATOM   2713 C  CA    . ILE C 1 50  ? 1.863   78.234  230.889 1.00 55.17  ?  48   ILE C CA    1 
ATOM   2714 C  C     . ILE C 1 50  ? 0.641   78.148  231.794 1.00 59.17  ?  48   ILE C C     1 
ATOM   2715 O  O     . ILE C 1 50  ? 0.501   77.186  232.556 1.00 66.89  ?  48   ILE C O     1 
ATOM   2716 C  CB    . ILE C 1 50  ? 1.802   77.132  229.816 1.00 49.68  ?  48   ILE C CB    1 
ATOM   2717 C  CG1   . ILE C 1 50  ? 3.049   77.158  228.928 1.00 52.75  ?  48   ILE C CG1   1 
ATOM   2718 C  CG2   . ILE C 1 50  ? 0.527   77.254  228.999 1.00 47.53  ?  48   ILE C CG2   1 
ATOM   2719 C  CD1   . ILE C 1 50  ? 3.188   78.408  228.105 1.00 54.96  ?  48   ILE C CD1   1 
ATOM   2720 N  N     . LYS C 1 51  ? -0.257  79.129  231.694 1.00 67.88  ?  49   LYS C N     1 
ATOM   2721 C  CA    . LYS C 1 51  ? -1.497  79.094  232.469 1.00 84.84  ?  49   LYS C CA    1 
ATOM   2722 C  C     . LYS C 1 51  ? -2.683  79.440  231.577 1.00 89.21  ?  49   LYS C C     1 
ATOM   2723 O  O     . LYS C 1 51  ? -2.771  80.556  231.057 1.00 80.77  ?  49   LYS C O     1 
ATOM   2724 C  CB    . LYS C 1 51  ? -1.435  80.031  233.677 1.00 93.61  ?  49   LYS C CB    1 
ATOM   2725 C  CG    . LYS C 1 51  ? -2.001  79.399  234.949 1.00 97.02  ?  49   LYS C CG    1 
ATOM   2726 C  CD    . LYS C 1 51  ? -3.335  80.004  235.372 1.00 96.45  ?  49   LYS C CD    1 
ATOM   2727 C  CE    . LYS C 1 51  ? -3.805  79.438  236.709 1.00 88.16  ?  49   LYS C CE    1 
ATOM   2728 N  NZ    . LYS C 1 51  ? -4.975  80.185  237.251 1.00 96.33  ?  49   LYS C NZ    1 
ATOM   2729 N  N     . THR C 1 52  ? -3.601  78.489  231.427 1.00 95.63  ?  50   THR C N     1 
ATOM   2730 C  CA    . THR C 1 52  ? -4.831  78.677  230.671 1.00 90.93  ?  50   THR C CA    1 
ATOM   2731 C  C     . THR C 1 52  ? -5.925  79.197  231.601 1.00 97.30  ?  50   THR C C     1 
ATOM   2732 O  O     . THR C 1 52  ? -6.202  78.593  232.643 1.00 99.70  ?  50   THR C O     1 
ATOM   2733 C  CB    . THR C 1 52  ? -5.255  77.356  230.028 1.00 90.20  ?  50   THR C CB    1 
ATOM   2734 O  OG1   . THR C 1 52  ? -4.094  76.664  229.549 1.00 95.90  ?  50   THR C OG1   1 
ATOM   2735 C  CG2   . THR C 1 52  ? -6.206  77.600  228.864 1.00 85.62  ?  50   THR C CG2   1 
ATOM   2736 N  N     . VAL C 1 53  ? -6.536  80.320  231.222 1.00 101.49 ?  51   VAL C N     1 
ATOM   2737 C  CA    . VAL C 1 53  ? -7.540  81.010  232.021 1.00 98.56  ?  51   VAL C CA    1 
ATOM   2738 C  C     . VAL C 1 53  ? -8.769  81.261  231.153 1.00 114.22 ?  51   VAL C C     1 
ATOM   2739 O  O     . VAL C 1 53  ? -8.716  81.182  229.923 1.00 120.94 ?  51   VAL C O     1 
ATOM   2740 C  CB    . VAL C 1 53  ? -6.998  82.333  232.600 1.00 91.06  ?  51   VAL C CB    1 
ATOM   2741 C  CG1   . VAL C 1 53  ? -5.637  82.110  233.249 1.00 90.67  ?  51   VAL C CG1   1 
ATOM   2742 C  CG2   . VAL C 1 53  ? -6.895  83.377  231.509 1.00 95.67  ?  51   VAL C CG2   1 
ATOM   2743 N  N     . GLU C 1 54  ? -9.888  81.586  231.809 1.00 118.52 ?  52   GLU C N     1 
ATOM   2744 C  CA    . GLU C 1 54  ? -11.197 81.590  231.160 1.00 117.25 ?  52   GLU C CA    1 
ATOM   2745 C  C     . GLU C 1 54  ? -11.831 82.981  231.075 1.00 110.44 ?  52   GLU C C     1 
ATOM   2746 O  O     . GLU C 1 54  ? -13.054 83.111  231.156 1.00 105.82 ?  52   GLU C O     1 
ATOM   2747 C  CB    . GLU C 1 54  ? -12.147 80.632  231.878 1.00 128.08 ?  52   GLU C CB    1 
ATOM   2748 C  CG    . GLU C 1 54  ? -11.896 79.151  231.608 1.00 141.03 ?  52   GLU C CG    1 
ATOM   2749 C  CD    . GLU C 1 54  ? -10.821 78.546  232.498 1.00 148.82 ?  52   GLU C CD    1 
ATOM   2750 O  OE1   . GLU C 1 54  ? -11.159 77.656  233.309 1.00 141.04 ?  52   GLU C OE1   1 
ATOM   2751 O  OE2   . GLU C 1 54  ? -9.643  78.939  232.383 1.00 155.06 -1 52   GLU C OE2   1 
ATOM   2752 N  N     . LEU C 1 55  ? -11.027 84.020  230.864 1.00 113.95 ?  53   LEU C N     1 
ATOM   2753 C  CA    . LEU C 1 55  ? -11.534 85.390  230.875 1.00 118.67 ?  53   LEU C CA    1 
ATOM   2754 C  C     . LEU C 1 55  ? -12.453 85.674  229.688 1.00 125.52 ?  53   LEU C C     1 
ATOM   2755 O  O     . LEU C 1 55  ? -12.152 85.315  228.548 1.00 131.94 ?  53   LEU C O     1 
ATOM   2756 C  CB    . LEU C 1 55  ? -10.360 86.367  230.869 1.00 111.69 ?  53   LEU C CB    1 
ATOM   2757 C  CG    . LEU C 1 55  ? -10.548 87.844  230.513 1.00 113.31 ?  53   LEU C CG    1 
ATOM   2758 C  CD1   . LEU C 1 55  ? -11.598 88.544  231.367 1.00 115.22 ?  53   LEU C CD1   1 
ATOM   2759 C  CD2   . LEU C 1 55  ? -9.209  88.524  230.642 1.00 109.22 ?  53   LEU C CD2   1 
ATOM   2760 N  N     . GLN C 1 56  ? -13.577 86.340  229.969 1.00 119.63 ?  54   GLN C N     1 
ATOM   2761 C  CA    . GLN C 1 56  ? -14.499 86.839  228.941 1.00 104.54 ?  54   GLN C CA    1 
ATOM   2762 C  C     . GLN C 1 56  ? -14.959 85.740  227.989 1.00 103.95 ?  54   GLN C C     1 
ATOM   2763 O  O     . GLN C 1 56  ? -15.241 85.987  226.814 1.00 90.38  ?  54   GLN C O     1 
ATOM   2764 C  CB    . GLN C 1 56  ? -13.879 87.993  228.152 1.00 89.54  ?  54   GLN C CB    1 
ATOM   2765 C  CG    . GLN C 1 56  ? -14.305 89.369  228.610 1.00 97.47  ?  54   GLN C CG    1 
ATOM   2766 C  CD    . GLN C 1 56  ? -13.540 90.466  227.903 1.00 106.94 ?  54   GLN C CD    1 
ATOM   2767 O  OE1   . GLN C 1 56  ? -13.465 90.493  226.673 1.00 96.89  ?  54   GLN C OE1   1 
ATOM   2768 N  NE2   . GLN C 1 56  ? -12.961 91.377  228.677 1.00 112.86 ?  54   GLN C NE2   1 
ATOM   2769 N  N     . GLY C 1 57  ? -15.026 84.511  228.488 1.00 111.59 ?  55   GLY C N     1 
ATOM   2770 C  CA    . GLY C 1 57  ? -15.437 83.402  227.650 1.00 119.85 ?  55   GLY C CA    1 
ATOM   2771 C  C     . GLY C 1 57  ? -14.423 83.050  226.583 1.00 132.44 ?  55   GLY C C     1 
ATOM   2772 O  O     . GLY C 1 57  ? -14.459 81.953  226.019 1.00 138.85 ?  55   GLY C O     1 
ATOM   2773 N  N     . LYS C 1 58  ? -13.529 83.985  226.280 1.00 132.80 ?  56   LYS C N     1 
ATOM   2774 C  CA    . LYS C 1 58  ? -12.370 83.705  225.443 1.00 128.35 ?  56   LYS C CA    1 
ATOM   2775 C  C     . LYS C 1 58  ? -11.374 82.946  226.305 1.00 125.51 ?  56   LYS C C     1 
ATOM   2776 O  O     . LYS C 1 58  ? -10.899 83.451  227.320 1.00 130.86 ?  56   LYS C O     1 
ATOM   2777 C  CB    . LYS C 1 58  ? -11.773 84.990  224.882 1.00 122.49 ?  56   LYS C CB    1 
ATOM   2778 N  N     . LYS C 1 59  ? -11.081 81.714  225.924 1.00 104.53 ?  57   LYS C N     1 
ATOM   2779 C  CA    . LYS C 1 59  ? -10.115 80.914  226.659 1.00 90.37  ?  57   LYS C CA    1 
ATOM   2780 C  C     . LYS C 1 59  ? -8.710  81.406  226.319 1.00 84.98  ?  57   LYS C C     1 
ATOM   2781 O  O     . LYS C 1 59  ? -8.210  81.141  225.222 1.00 80.26  ?  57   LYS C O     1 
ATOM   2782 C  CB    . LYS C 1 59  ? -10.319 79.449  226.282 1.00 87.73  ?  57   LYS C CB    1 
ATOM   2783 C  CG    . LYS C 1 59  ? -9.649  78.432  227.189 1.00 98.12  ?  57   LYS C CG    1 
ATOM   2784 C  CD    . LYS C 1 59  ? -10.232 77.029  226.976 1.00 106.06 ?  57   LYS C CD    1 
ATOM   2785 C  CE    . LYS C 1 59  ? -11.479 76.789  227.816 1.00 116.92 ?  57   LYS C CE    1 
ATOM   2786 N  NZ    . LYS C 1 59  ? -11.145 76.148  229.123 1.00 117.94 ?  57   LYS C NZ    1 
ATOM   2787 N  N     . ILE C 1 60  ? -8.064  82.138  227.236 1.00 76.59  ?  58   ILE C N     1 
ATOM   2788 C  CA    . ILE C 1 60  ? -6.722  82.666  226.977 1.00 71.09  ?  58   ILE C CA    1 
ATOM   2789 C  C     . ILE C 1 60  ? -5.679  81.682  227.493 1.00 92.51  ?  58   ILE C C     1 
ATOM   2790 O  O     . ILE C 1 60  ? -5.779  81.188  228.622 1.00 103.75 ?  58   ILE C O     1 
ATOM   2791 C  CB    . ILE C 1 60  ? -6.471  84.050  227.609 1.00 59.89  ?  58   ILE C CB    1 
ATOM   2792 C  CG1   . ILE C 1 60  ? -7.187  85.228  226.928 1.00 65.96  ?  58   ILE C CG1   1 
ATOM   2793 C  CG2   . ILE C 1 60  ? -5.006  84.388  227.442 1.00 68.19  ?  58   ILE C CG2   1 
ATOM   2794 C  CD1   . ILE C 1 60  ? -8.652  85.403  227.121 1.00 75.03  ?  58   ILE C CD1   1 
ATOM   2795 N  N     . LYS C 1 61  ? -4.656  81.428  226.678 1.00 85.40  ?  59   LYS C N     1 
ATOM   2796 C  CA    . LYS C 1 61  ? -3.453  80.723  227.105 1.00 74.25  ?  59   LYS C CA    1 
ATOM   2797 C  C     . LYS C 1 61  ? -2.353  81.741  227.398 1.00 67.78  ?  59   LYS C C     1 
ATOM   2798 O  O     . LYS C 1 61  ? -1.943  82.502  226.509 1.00 53.90  ?  59   LYS C O     1 
ATOM   2799 C  CB    . LYS C 1 61  ? -2.989  79.730  226.043 1.00 79.61  ?  59   LYS C CB    1 
ATOM   2800 C  CG    . LYS C 1 61  ? -1.937  78.744  226.529 1.00 56.51  ?  59   LYS C CG    1 
ATOM   2801 C  CD    . LYS C 1 61  ? -1.371  77.963  225.364 1.00 65.27  ?  59   LYS C CD    1 
ATOM   2802 C  CE    . LYS C 1 61  ? -0.998  76.550  225.753 1.00 73.66  ?  59   LYS C CE    1 
ATOM   2803 N  NZ    . LYS C 1 61  ? -1.016  75.676  224.544 1.00 84.22  ?  59   LYS C NZ    1 
ATOM   2804 N  N     . LEU C 1 62  ? -1.882  81.745  228.642 1.00 67.58  ?  60   LEU C N     1 
ATOM   2805 C  CA    . LEU C 1 62  ? -0.811  82.622  229.083 1.00 63.36  ?  60   LEU C CA    1 
ATOM   2806 C  C     . LEU C 1 62  ? 0.519   81.898  228.984 1.00 60.68  ?  60   LEU C C     1 
ATOM   2807 O  O     . LEU C 1 62  ? 0.645   80.741  229.400 1.00 71.46  ?  60   LEU C O     1 
ATOM   2808 C  CB    . LEU C 1 62  ? -1.020  83.076  230.530 1.00 85.97  ?  60   LEU C CB    1 
ATOM   2809 C  CG    . LEU C 1 62  ? -2.016  84.188  230.881 1.00 101.46 ?  60   LEU C CG    1 
ATOM   2810 C  CD1   . LEU C 1 62  ? -1.493  85.560  230.443 1.00 96.99  ?  60   LEU C CD1   1 
ATOM   2811 C  CD2   . LEU C 1 62  ? -3.419  83.932  230.355 1.00 104.15 ?  60   LEU C CD2   1 
ATOM   2812 N  N     . GLN C 1 63  ? 1.508   82.588  228.434 1.00 54.53  ?  61   GLN C N     1 
ATOM   2813 C  CA    . GLN C 1 63  ? 2.891   82.128  228.452 1.00 58.40  ?  61   GLN C CA    1 
ATOM   2814 C  C     . GLN C 1 63  ? 3.673   83.195  229.203 1.00 58.28  ?  61   GLN C C     1 
ATOM   2815 O  O     . GLN C 1 63  ? 4.052   84.221  228.627 1.00 61.88  ?  61   GLN C O     1 
ATOM   2816 C  CB    . GLN C 1 63  ? 3.437   81.905  227.047 1.00 61.66  ?  61   GLN C CB    1 
ATOM   2817 C  CG    . GLN C 1 63  ? 4.889   81.466  227.035 1.00 64.98  ?  61   GLN C CG    1 
ATOM   2818 C  CD    . GLN C 1 63  ? 5.443   81.362  225.638 1.00 72.35  ?  61   GLN C CD    1 
ATOM   2819 O  OE1   . GLN C 1 63  ? 5.166   82.205  224.791 1.00 74.01  ?  61   GLN C OE1   1 
ATOM   2820 N  NE2   . GLN C 1 63  ? 6.230   80.324  225.385 1.00 83.49  ?  61   GLN C NE2   1 
ATOM   2821 N  N     . ILE C 1 64  ? 3.889   82.968  230.492 1.00 65.54  ?  62   ILE C N     1 
ATOM   2822 C  CA    . ILE C 1 64  ? 4.555   83.946  231.341 1.00 74.57  ?  62   ILE C CA    1 
ATOM   2823 C  C     . ILE C 1 64  ? 6.039   83.611  231.393 1.00 70.21  ?  62   ILE C C     1 
ATOM   2824 O  O     . ILE C 1 64  ? 6.431   82.539  231.870 1.00 66.09  ?  62   ILE C O     1 
ATOM   2825 C  CB    . ILE C 1 64  ? 3.941   83.984  232.749 1.00 71.12  ?  62   ILE C CB    1 
ATOM   2826 C  CG1   . ILE C 1 64  ? 2.417   84.118  232.671 1.00 56.09  ?  62   ILE C CG1   1 
ATOM   2827 C  CG2   . ILE C 1 64  ? 4.524   85.143  233.537 1.00 68.33  ?  62   ILE C CG2   1 
ATOM   2828 C  CD1   . ILE C 1 64  ? 1.667   82.931  233.245 1.00 54.30  ?  62   ILE C CD1   1 
ATOM   2829 N  N     . TRP C 1 65  ? 6.856   84.535  230.891 1.00 66.27  ?  63   TRP C N     1 
ATOM   2830 C  CA    . TRP C 1 65  ? 8.304   84.416  230.891 1.00 57.87  ?  63   TRP C CA    1 
ATOM   2831 C  C     . TRP C 1 65  ? 8.881   85.010  232.172 1.00 73.86  ?  63   TRP C C     1 
ATOM   2832 O  O     . TRP C 1 65  ? 8.517   86.120  232.579 1.00 69.85  ?  63   TRP C O     1 
ATOM   2833 C  CB    . TRP C 1 65  ? 8.902   85.118  229.670 1.00 59.80  ?  63   TRP C CB    1 
ATOM   2834 C  CG    . TRP C 1 65  ? 8.654   84.415  228.352 1.00 61.36  ?  63   TRP C CG    1 
ATOM   2835 C  CD1   . TRP C 1 65  ? 7.607   84.612  227.493 1.00 46.40  ?  63   TRP C CD1   1 
ATOM   2836 C  CD2   . TRP C 1 65  ? 9.482   83.416  227.748 1.00 46.19  ?  63   TRP C CD2   1 
ATOM   2837 N  NE1   . TRP C 1 65  ? 7.732   83.792  226.399 1.00 50.27  ?  63   TRP C NE1   1 
ATOM   2838 C  CE2   . TRP C 1 65  ? 8.875   83.049  226.529 1.00 45.33  ?  63   TRP C CE2   1 
ATOM   2839 C  CE3   . TRP C 1 65  ? 10.677  82.794  228.123 1.00 49.29  ?  63   TRP C CE3   1 
ATOM   2840 C  CZ2   . TRP C 1 65  ? 9.423   82.088  225.682 1.00 39.92  ?  63   TRP C CZ2   1 
ATOM   2841 C  CZ3   . TRP C 1 65  ? 11.220  81.841  227.282 1.00 51.41  ?  63   TRP C CZ3   1 
ATOM   2842 C  CH2   . TRP C 1 65  ? 10.594  81.498  226.075 1.00 53.67  ?  63   TRP C CH2   1 
ATOM   2843 N  N     . ASP C 1 66  ? 9.788   84.265  232.788 1.00 82.46  ?  64   ASP C N     1 
ATOM   2844 C  CA    . ASP C 1 66  ? 10.438  84.616  234.042 1.00 94.76  ?  64   ASP C CA    1 
ATOM   2845 C  C     . ASP C 1 66  ? 11.886  84.982  233.734 1.00 104.78 ?  64   ASP C C     1 
ATOM   2846 O  O     . ASP C 1 66  ? 12.637  84.125  233.236 1.00 100.61 ?  64   ASP C O     1 
ATOM   2847 C  CB    . ASP C 1 66  ? 10.367  83.420  234.996 1.00 95.56  ?  64   ASP C CB    1 
ATOM   2848 C  CG    . ASP C 1 66  ? 10.610  83.791  236.438 1.00 88.16  ?  64   ASP C CG    1 
ATOM   2849 O  OD1   . ASP C 1 66  ? 10.903  84.971  236.713 1.00 91.72  ?  64   ASP C OD1   1 
ATOM   2850 O  OD2   . ASP C 1 66  ? 10.508  82.889  237.299 1.00 82.54  -1 64   ASP C OD2   1 
ATOM   2851 N  N     . THR C 1 67  ? 12.281  86.245  234.005 1.00 121.71 ?  65   THR C N     1 
ATOM   2852 C  CA    . THR C 1 67  ? 13.687  86.588  233.799 1.00 119.53 ?  65   THR C CA    1 
ATOM   2853 C  C     . THR C 1 67  ? 14.523  86.310  235.046 1.00 112.96 ?  65   THR C C     1 
ATOM   2854 O  O     . THR C 1 67  ? 14.021  86.290  236.174 1.00 114.59 ?  65   THR C O     1 
ATOM   2855 C  CB    . THR C 1 67  ? 13.906  88.052  233.425 1.00 128.66 ?  65   THR C CB    1 
ATOM   2856 O  OG1   . THR C 1 67  ? 15.261  88.185  232.970 1.00 135.18 ?  65   THR C OG1   1 
ATOM   2857 C  CG2   . THR C 1 67  ? 13.817  88.945  234.660 1.00 138.20 ?  65   THR C CG2   1 
ATOM   2858 N  N     . ALA C 1 68  ? 15.825  86.131  234.824 1.00 105.14 ?  66   ALA C N     1 
ATOM   2859 C  CA    . ALA C 1 68  ? 16.814  86.016  235.891 1.00 104.29 ?  66   ALA C CA    1 
ATOM   2860 C  C     . ALA C 1 68  ? 17.587  87.331  235.946 1.00 115.84 ?  66   ALA C C     1 
ATOM   2861 O  O     . ALA C 1 68  ? 18.382  87.638  235.052 1.00 97.69  ?  66   ALA C O     1 
ATOM   2862 C  CB    . ALA C 1 68  ? 17.729  84.821  235.652 1.00 97.83  ?  66   ALA C CB    1 
ATOM   2863 N  N     . GLY C 1 69  ? 17.347  88.101  237.009 1.00 130.33 ?  67   GLY C N     1 
ATOM   2864 C  CA    . GLY C 1 69  ? 17.887  89.437  237.169 1.00 138.36 ?  67   GLY C CA    1 
ATOM   2865 C  C     . GLY C 1 69  ? 19.171  89.473  237.962 1.00 145.65 ?  67   GLY C C     1 
ATOM   2866 O  O     . GLY C 1 69  ? 19.222  89.927  239.109 1.00 159.61 ?  67   GLY C O     1 
ATOM   2867 N  N     . GLN C 1 70  ? 20.219  89.001  237.300 1.00 130.52 ?  68   GLN C N     1 
ATOM   2868 C  CA    . GLN C 1 70  ? 21.540  88.742  237.849 1.00 131.34 ?  68   GLN C CA    1 
ATOM   2869 C  C     . GLN C 1 70  ? 22.531  89.213  236.802 1.00 157.86 ?  68   GLN C C     1 
ATOM   2870 O  O     . GLN C 1 70  ? 22.478  88.721  235.673 1.00 143.91 ?  68   GLN C O     1 
ATOM   2871 C  CB    . GLN C 1 70  ? 21.723  87.250  238.101 1.00 122.47 ?  68   GLN C CB    1 
ATOM   2872 C  CG    . GLN C 1 70  ? 21.114  86.671  239.345 1.00 120.72 ?  68   GLN C CG    1 
ATOM   2873 C  CD    . GLN C 1 70  ? 22.193  86.092  240.228 1.00 116.91 ?  68   GLN C CD    1 
ATOM   2874 O  OE1   . GLN C 1 70  ? 23.275  86.660  240.335 1.00 116.74 ?  68   GLN C OE1   1 
ATOM   2875 N  NE2   . GLN C 1 70  ? 21.945  84.916  240.790 1.00 118.11 ?  68   GLN C NE2   1 
ATOM   2876 N  N     . GLU C 1 71  ? 23.435  90.128  237.165 1.00 196.54 ?  69   GLU C N     1 
ATOM   2877 C  CA    . GLU C 1 71  ? 24.095  90.947  236.151 1.00 204.05 ?  69   GLU C CA    1 
ATOM   2878 C  C     . GLU C 1 71  ? 24.693  90.105  235.024 1.00 206.31 ?  69   GLU C C     1 
ATOM   2879 O  O     . GLU C 1 71  ? 24.550  90.471  233.849 1.00 214.77 ?  69   GLU C O     1 
ATOM   2880 C  CB    . GLU C 1 71  ? 25.143  91.867  236.787 1.00 203.93 ?  69   GLU C CB    1 
ATOM   2881 C  CG    . GLU C 1 71  ? 25.650  92.968  235.826 1.00 205.60 ?  69   GLU C CG    1 
ATOM   2882 C  CD    . GLU C 1 71  ? 24.646  93.343  234.726 1.00 205.31 ?  69   GLU C CD    1 
ATOM   2883 O  OE1   . GLU C 1 71  ? 24.885  92.988  233.551 1.00 202.56 ?  69   GLU C OE1   1 
ATOM   2884 O  OE2   . GLU C 1 71  ? 23.613  93.972  235.039 1.00 207.38 -1 69   GLU C OE2   1 
ATOM   2885 N  N     . ARG C 1 72  ? 25.259  88.936  235.355 1.00 191.23 ?  70   ARG C N     1 
ATOM   2886 C  CA    . ARG C 1 72  ? 25.852  88.077  234.329 1.00 171.97 ?  70   ARG C CA    1 
ATOM   2887 C  C     . ARG C 1 72  ? 24.963  87.944  233.093 1.00 175.77 ?  70   ARG C C     1 
ATOM   2888 O  O     . ARG C 1 72  ? 25.454  88.042  231.965 1.00 181.61 ?  70   ARG C O     1 
ATOM   2889 C  CB    . ARG C 1 72  ? 26.120  86.679  234.881 1.00 155.97 ?  70   ARG C CB    1 
ATOM   2890 C  CG    . ARG C 1 72  ? 26.213  86.583  236.369 1.00 153.83 ?  70   ARG C CG    1 
ATOM   2891 C  CD    . ARG C 1 72  ? 26.536  85.161  236.776 1.00 151.79 ?  70   ARG C CD    1 
ATOM   2892 N  NE    . ARG C 1 72  ? 27.844  84.775  236.268 1.00 154.72 ?  70   ARG C NE    1 
ATOM   2893 C  CZ    . ARG C 1 72  ? 28.548  83.760  236.753 1.00 157.42 ?  70   ARG C CZ    1 
ATOM   2894 N  NH1   . ARG C 1 72  ? 28.070  83.058  237.771 1.00 158.71 ?  70   ARG C NH1   1 
ATOM   2895 N  NH2   . ARG C 1 72  ? 29.738  83.462  236.245 1.00 158.05 ?  70   ARG C NH2   1 
ATOM   2896 N  N     . PHE C 1 73  ? 23.656  87.768  233.278 1.00 160.82 ?  71   PHE C N     1 
ATOM   2897 C  CA    . PHE C 1 73  ? 22.763  87.351  232.201 1.00 146.09 ?  71   PHE C CA    1 
ATOM   2898 C  C     . PHE C 1 73  ? 22.237  88.507  231.352 1.00 162.90 ?  71   PHE C C     1 
ATOM   2899 O  O     . PHE C 1 73  ? 21.542  88.254  230.359 1.00 149.75 ?  71   PHE C O     1 
ATOM   2900 C  CB    . PHE C 1 73  ? 21.582  86.572  232.783 1.00 132.23 ?  71   PHE C CB    1 
ATOM   2901 C  CG    . PHE C 1 73  ? 21.989  85.354  233.552 1.00 129.91 ?  71   PHE C CG    1 
ATOM   2902 C  CD1   . PHE C 1 73  ? 21.396  85.064  234.770 1.00 131.90 ?  71   PHE C CD1   1 
ATOM   2903 C  CD2   . PHE C 1 73  ? 22.970  84.507  233.063 1.00 128.70 ?  71   PHE C CD2   1 
ATOM   2904 C  CE1   . PHE C 1 73  ? 21.773  83.948  235.486 1.00 131.93 ?  71   PHE C CE1   1 
ATOM   2905 C  CE2   . PHE C 1 73  ? 23.351  83.388  233.771 1.00 128.48 ?  71   PHE C CE2   1 
ATOM   2906 C  CZ    . PHE C 1 73  ? 22.752  83.107  234.985 1.00 130.88 ?  71   PHE C CZ    1 
ATOM   2907 N  N     . HIS C 1 74  ? 22.560  89.757  231.688 1.00 196.71 ?  72   HIS C N     1 
ATOM   2908 C  CA    . HIS C 1 74  ? 21.818  90.880  231.117 1.00 204.76 ?  72   HIS C CA    1 
ATOM   2909 C  C     . HIS C 1 74  ? 22.005  91.039  229.617 1.00 189.03 ?  72   HIS C C     1 
ATOM   2910 O  O     . HIS C 1 74  ? 21.210  91.733  228.981 1.00 182.62 ?  72   HIS C O     1 
ATOM   2911 C  CB    . HIS C 1 74  ? 22.206  92.147  231.871 1.00 228.29 ?  72   HIS C CB    1 
ATOM   2912 C  CG    . HIS C 1 74  ? 21.771  92.119  233.303 1.00 241.39 ?  72   HIS C CG    1 
ATOM   2913 N  ND1   . HIS C 1 74  ? 21.346  93.235  233.992 1.00 245.23 ?  72   HIS C ND1   1 
ATOM   2914 C  CD2   . HIS C 1 74  ? 21.601  91.074  234.144 1.00 244.13 ?  72   HIS C CD2   1 
ATOM   2915 C  CE1   . HIS C 1 74  ? 20.997  92.887  235.219 1.00 245.49 ?  72   HIS C CE1   1 
ATOM   2916 N  NE2   . HIS C 1 74  ? 21.139  91.580  235.334 1.00 244.89 ?  72   HIS C NE2   1 
ATOM   2917 N  N     . THR C 1 75  ? 23.033  90.421  229.045 1.00 175.89 ?  73   THR C N     1 
ATOM   2918 C  CA    . THR C 1 75  ? 23.076  90.239  227.601 1.00 154.29 ?  73   THR C CA    1 
ATOM   2919 C  C     . THR C 1 75  ? 21.886  89.419  227.118 1.00 143.35 ?  73   THR C C     1 
ATOM   2920 O  O     . THR C 1 75  ? 20.926  89.956  226.544 1.00 156.76 ?  73   THR C O     1 
ATOM   2921 C  CB    . THR C 1 75  ? 24.390  89.564  227.212 1.00 151.02 ?  73   THR C CB    1 
ATOM   2922 O  OG1   . THR C 1 75  ? 24.350  88.195  227.620 1.00 149.43 ?  73   THR C OG1   1 
ATOM   2923 C  CG2   . THR C 1 75  ? 25.556  90.255  227.906 1.00 150.33 ?  73   THR C CG2   1 
ATOM   2924 N  N     . ILE C 1 76  ? 21.892  88.118  227.416 1.00 124.01 ?  74   ILE C N     1 
ATOM   2925 C  CA    . ILE C 1 76  ? 21.063  87.204  226.638 1.00 113.09 ?  74   ILE C CA    1 
ATOM   2926 C  C     . ILE C 1 76  ? 19.575  87.367  226.938 1.00 113.04 ?  74   ILE C C     1 
ATOM   2927 O  O     . ILE C 1 76  ? 18.742  87.177  226.042 1.00 114.55 ?  74   ILE C O     1 
ATOM   2928 C  CB    . ILE C 1 76  ? 21.527  85.750  226.839 1.00 108.64 ?  74   ILE C CB    1 
ATOM   2929 C  CG1   . ILE C 1 76  ? 21.188  85.244  228.244 1.00 102.81 ?  74   ILE C CG1   1 
ATOM   2930 C  CG2   . ILE C 1 76  ? 23.018  85.600  226.537 1.00 109.19 ?  74   ILE C CG2   1 
ATOM   2931 C  CD1   . ILE C 1 76  ? 21.280  83.742  228.367 1.00 103.49 ?  74   ILE C CD1   1 
ATOM   2932 N  N     . THR C 1 77  ? 19.205  87.746  228.164 1.00 115.50 ?  75   THR C N     1 
ATOM   2933 C  CA    . THR C 1 77  ? 17.785  87.921  228.456 1.00 115.37 ?  75   THR C CA    1 
ATOM   2934 C  C     . THR C 1 77  ? 17.171  89.040  227.618 1.00 120.37 ?  75   THR C C     1 
ATOM   2935 O  O     . THR C 1 77  ? 15.963  89.010  227.335 1.00 109.76 ?  75   THR C O     1 
ATOM   2936 C  CB    . THR C 1 77  ? 17.551  88.189  229.948 1.00 114.25 ?  75   THR C CB    1 
ATOM   2937 O  OG1   . THR C 1 77  ? 17.725  89.587  230.219 1.00 115.63 ?  75   THR C OG1   1 
ATOM   2938 C  CG2   . THR C 1 77  ? 18.489  87.376  230.815 1.00 107.62 ?  75   THR C CG2   1 
ATOM   2939 N  N     . THR C 1 78  ? 17.984  90.027  227.187 1.00 137.08 ?  76   THR C N     1 
ATOM   2940 C  CA    . THR C 1 78  ? 17.444  91.039  226.274 1.00 133.86 ?  76   THR C CA    1 
ATOM   2941 C  C     . THR C 1 78  ? 16.728  90.379  225.115 1.00 130.95 ?  76   THR C C     1 
ATOM   2942 O  O     . THR C 1 78  ? 15.672  90.852  224.677 1.00 135.87 ?  76   THR C O     1 
ATOM   2943 C  CB    . THR C 1 78  ? 18.526  91.973  225.710 1.00 135.34 ?  76   THR C CB    1 
ATOM   2944 O  OG1   . THR C 1 78  ? 19.294  91.287  224.707 1.00 138.16 ?  76   THR C OG1   1 
ATOM   2945 C  CG2   . THR C 1 78  ? 19.402  92.584  226.786 1.00 134.75 ?  76   THR C CG2   1 
ATOM   2946 N  N     . SER C 1 79  ? 17.284  89.263  224.631 1.00 122.55 ?  77   SER C N     1 
ATOM   2947 C  CA    . SER C 1 79  ? 16.720  88.530  223.503 1.00 102.96 ?  77   SER C CA    1 
ATOM   2948 C  C     . SER C 1 79  ? 15.200  88.457  223.566 1.00 100.64 ?  77   SER C C     1 
ATOM   2949 O  O     . SER C 1 79  ? 14.519  88.746  222.574 1.00 119.07 ?  77   SER C O     1 
ATOM   2950 C  CB    . SER C 1 79  ? 17.321  87.122  223.459 1.00 103.31 ?  77   SER C CB    1 
ATOM   2951 O  OG    . SER C 1 79  ? 16.953  86.441  222.277 1.00 114.30 ?  77   SER C OG    1 
ATOM   2952 N  N     . TYR C 1 80  ? 14.646  88.132  224.735 1.00 87.81  ?  78   TYR C N     1 
ATOM   2953 C  CA    . TYR C 1 80  ? 13.231  87.783  224.798 1.00 81.49  ?  78   TYR C CA    1 
ATOM   2954 C  C     . TYR C 1 80  ? 12.321  88.997  224.991 1.00 80.66  ?  78   TYR C C     1 
ATOM   2955 O  O     . TYR C 1 80  ? 11.136  88.824  225.301 1.00 84.51  ?  78   TYR C O     1 
ATOM   2956 C  CB    . TYR C 1 80  ? 13.004  86.746  225.906 1.00 76.83  ?  78   TYR C CB    1 
ATOM   2957 C  CG    . TYR C 1 80  ? 13.752  85.441  225.668 1.00 74.80  ?  78   TYR C CG    1 
ATOM   2958 C  CD1   . TYR C 1 80  ? 15.132  85.371  225.829 1.00 82.39  ?  78   TYR C CD1   1 
ATOM   2959 C  CD2   . TYR C 1 80  ? 13.084  84.287  225.272 1.00 62.50  ?  78   TYR C CD2   1 
ATOM   2960 C  CE1   . TYR C 1 80  ? 15.825  84.193  225.603 1.00 84.10  ?  78   TYR C CE1   1 
ATOM   2961 C  CE2   . TYR C 1 80  ? 13.770  83.102  225.047 1.00 61.60  ?  78   TYR C CE2   1 
ATOM   2962 C  CZ    . TYR C 1 80  ? 15.140  83.062  225.213 1.00 77.08  ?  78   TYR C CZ    1 
ATOM   2963 O  OH    . TYR C 1 80  ? 15.827  81.890  224.990 1.00 78.01  ?  78   TYR C OH    1 
ATOM   2964 N  N     . TYR C 1 81  ? 12.834  90.213  224.774 1.00 83.29  ?  79   TYR C N     1 
ATOM   2965 C  CA    . TYR C 1 81  ? 12.056  91.424  225.027 1.00 98.41  ?  79   TYR C CA    1 
ATOM   2966 C  C     . TYR C 1 81  ? 11.105  91.742  223.880 1.00 94.46  ?  79   TYR C C     1 
ATOM   2967 O  O     . TYR C 1 81  ? 9.982   92.203  224.114 1.00 87.20  ?  79   TYR C O     1 
ATOM   2968 C  CB    . TYR C 1 81  ? 12.989  92.614  225.249 1.00 119.65 ?  79   TYR C CB    1 
ATOM   2969 C  CG    . TYR C 1 81  ? 13.728  92.617  226.567 1.00 134.71 ?  79   TYR C CG    1 
ATOM   2970 C  CD1   . TYR C 1 81  ? 14.526  93.699  226.928 1.00 140.91 ?  79   TYR C CD1   1 
ATOM   2971 C  CD2   . TYR C 1 81  ? 13.637  91.540  227.447 1.00 134.33 ?  79   TYR C CD2   1 
ATOM   2972 C  CE1   . TYR C 1 81  ? 15.215  93.712  228.123 1.00 137.63 ?  79   TYR C CE1   1 
ATOM   2973 C  CE2   . TYR C 1 81  ? 14.322  91.544  228.646 1.00 135.21 ?  79   TYR C CE2   1 
ATOM   2974 C  CZ    . TYR C 1 81  ? 15.109  92.631  228.976 1.00 134.57 ?  79   TYR C CZ    1 
ATOM   2975 O  OH    . TYR C 1 81  ? 15.785  92.637  230.176 1.00 132.10 ?  79   TYR C OH    1 
ATOM   2976 N  N     . ARG C 1 82  ? 11.549  91.532  222.637 1.00 100.46 ?  80   ARG C N     1 
ATOM   2977 C  CA    . ARG C 1 82  ? 10.747  91.932  221.485 1.00 97.00  ?  80   ARG C CA    1 
ATOM   2978 C  C     . ARG C 1 82  ? 9.399   91.223  221.477 1.00 82.10  ?  80   ARG C C     1 
ATOM   2979 O  O     . ARG C 1 82  ? 8.362   91.847  221.219 1.00 84.96  ?  80   ARG C O     1 
ATOM   2980 C  CB    . ARG C 1 82  ? 11.514  91.651  220.192 1.00 94.41  ?  80   ARG C CB    1 
ATOM   2981 N  N     . GLY C 1 83  ? 9.389   89.927  221.790 1.00 58.95  ?  81   GLY C N     1 
ATOM   2982 C  CA    . GLY C 1 83  ? 8.153   89.166  221.781 1.00 70.11  ?  81   GLY C CA    1 
ATOM   2983 C  C     . GLY C 1 83  ? 7.178   89.536  222.880 1.00 76.74  ?  81   GLY C C     1 
ATOM   2984 O  O     . GLY C 1 83  ? 5.997   89.187  222.784 1.00 65.76  ?  81   GLY C O     1 
ATOM   2985 N  N     . ALA C 1 84  ? 7.639   90.234  223.915 1.00 94.34  ?  82   ALA C N     1 
ATOM   2986 C  CA    . ALA C 1 84  ? 6.785   90.560  225.050 1.00 90.84  ?  82   ALA C CA    1 
ATOM   2987 C  C     . ALA C 1 84  ? 5.578   91.377  224.614 1.00 91.84  ?  82   ALA C C     1 
ATOM   2988 O  O     . ALA C 1 84  ? 5.721   92.443  224.006 1.00 97.04  ?  82   ALA C O     1 
ATOM   2989 C  CB    . ALA C 1 84  ? 7.587   91.322  226.106 1.00 91.32  ?  82   ALA C CB    1 
ATOM   2990 N  N     . MET C 1 85  ? 4.386   90.860  224.910 1.00 86.07  ?  83   MET C N     1 
ATOM   2991 C  CA    . MET C 1 85  ? 3.146   91.601  224.720 1.00 82.81  ?  83   MET C CA    1 
ATOM   2992 C  C     . MET C 1 85  ? 2.805   92.423  225.954 1.00 108.19 ?  83   MET C C     1 
ATOM   2993 O  O     . MET C 1 85  ? 2.589   93.636  225.866 1.00 105.47 ?  83   MET C O     1 
ATOM   2994 C  CB    . MET C 1 85  ? 1.992   90.643  224.413 1.00 66.75  ?  83   MET C CB    1 
ATOM   2995 C  CG    . MET C 1 85  ? 2.138   89.844  223.141 1.00 64.93  ?  83   MET C CG    1 
ATOM   2996 S  SD    . MET C 1 85  ? 0.871   88.565  223.059 1.00 68.24  ?  83   MET C SD    1 
ATOM   2997 C  CE    . MET C 1 85  ? -0.610  89.571  223.038 1.00 67.96  ?  83   MET C CE    1 
ATOM   2998 N  N     . GLY C 1 86  ? 2.741   91.761  227.103 1.00 121.66 ?  84   GLY C N     1 
ATOM   2999 C  CA    . GLY C 1 86  ? 2.509   92.425  228.366 1.00 119.75 ?  84   GLY C CA    1 
ATOM   3000 C  C     . GLY C 1 86  ? 3.665   92.155  229.308 1.00 113.86 ?  84   GLY C C     1 
ATOM   3001 O  O     . GLY C 1 86  ? 4.349   91.132  229.208 1.00 104.23 ?  84   GLY C O     1 
ATOM   3002 N  N     . ILE C 1 87  ? 3.882   93.088  230.224 1.00 112.96 ?  85   ILE C N     1 
ATOM   3003 C  CA    . ILE C 1 87  ? 5.037   93.046  231.103 1.00 103.80 ?  85   ILE C CA    1 
ATOM   3004 C  C     . ILE C 1 87  ? 4.571   93.353  232.510 1.00 118.45 ?  85   ILE C C     1 
ATOM   3005 O  O     . ILE C 1 87  ? 3.643   94.140  232.717 1.00 122.91 ?  85   ILE C O     1 
ATOM   3006 C  CB    . ILE C 1 87  ? 6.122   94.053  230.668 1.00 84.04  ?  85   ILE C CB    1 
ATOM   3007 C  CG1   . ILE C 1 87  ? 6.774   93.594  229.370 1.00 76.66  ?  85   ILE C CG1   1 
ATOM   3008 C  CG2   . ILE C 1 87  ? 7.171   94.234  231.753 1.00 77.67  ?  85   ILE C CG2   1 
ATOM   3009 C  CD1   . ILE C 1 87  ? 8.060   94.305  229.060 1.00 84.08  ?  85   ILE C CD1   1 
ATOM   3010 N  N     . MET C 1 88  ? 5.215   92.730  233.484 1.00 118.93 ?  86   MET C N     1 
ATOM   3011 C  CA    . MET C 1 88  ? 5.121   93.228  234.844 1.00 96.77  ?  86   MET C CA    1 
ATOM   3012 C  C     . MET C 1 88  ? 6.517   93.275  235.440 1.00 103.97 ?  86   MET C C     1 
ATOM   3013 O  O     . MET C 1 88  ? 7.326   92.364  235.237 1.00 84.53  ?  86   MET C O     1 
ATOM   3014 C  CB    . MET C 1 88  ? 4.190   92.372  235.670 1.00 79.05  ?  86   MET C CB    1 
ATOM   3015 C  CG    . MET C 1 88  ? 2.800   92.247  235.090 1.00 86.35  ?  86   MET C CG    1 
ATOM   3016 S  SD    . MET C 1 88  ? 2.104   90.954  236.076 1.00 84.72  ?  86   MET C SD    1 
ATOM   3017 C  CE    . MET C 1 88  ? 3.199   89.715  235.464 1.00 83.81  ?  86   MET C CE    1 
ATOM   3018 N  N     . LEU C 1 89  ? 6.785   94.369  236.149 1.00 137.10 ?  87   LEU C N     1 
ATOM   3019 C  CA    . LEU C 1 89  ? 8.077   94.688  236.732 1.00 151.04 ?  87   LEU C CA    1 
ATOM   3020 C  C     . LEU C 1 89  ? 7.996   94.480  238.234 1.00 162.68 ?  87   LEU C C     1 
ATOM   3021 O  O     . LEU C 1 89  ? 6.981   94.813  238.872 1.00 163.41 ?  87   LEU C O     1 
ATOM   3022 C  CB    . LEU C 1 89  ? 8.517   96.122  236.397 1.00 152.36 ?  87   LEU C CB    1 
ATOM   3023 C  CG    . LEU C 1 89  ? 8.766   96.355  234.905 1.00 148.42 ?  87   LEU C CG    1 
ATOM   3024 C  CD1   . LEU C 1 89  ? 9.386   95.081  234.323 1.00 142.56 ?  87   LEU C CD1   1 
ATOM   3025 C  CD2   . LEU C 1 89  ? 7.489   96.761  234.205 1.00 147.62 ?  87   LEU C CD2   1 
ATOM   3026 N  N     . VAL C 1 90  ? 9.061   93.915  238.789 1.00 165.36 ?  88   VAL C N     1 
ATOM   3027 C  CA    . VAL C 1 90  ? 9.001   93.359  240.131 1.00 172.24 ?  88   VAL C CA    1 
ATOM   3028 C  C     . VAL C 1 90  ? 9.361   94.457  241.137 1.00 181.27 ?  88   VAL C C     1 
ATOM   3029 O  O     . VAL C 1 90  ? 10.443  95.058  241.086 1.00 169.91 ?  88   VAL C O     1 
ATOM   3030 C  CB    . VAL C 1 90  ? 9.891   92.111  240.228 1.00 174.78 ?  88   VAL C CB    1 
ATOM   3031 C  CG1   . VAL C 1 90  ? 11.312  92.474  240.072 1.00 178.38 ?  88   VAL C CG1   1 
ATOM   3032 C  CG2   . VAL C 1 90  ? 9.582   91.226  241.421 1.00 174.47 ?  88   VAL C CG2   1 
ATOM   3033 N  N     . TYR C 1 91  ? 8.429   94.752  242.041 1.00 197.78 ?  89   TYR C N     1 
ATOM   3034 C  CA    . TYR C 1 91  ? 8.765   95.570  243.189 1.00 191.31 ?  89   TYR C CA    1 
ATOM   3035 C  C     . TYR C 1 91  ? 8.331   94.912  244.490 1.00 174.14 ?  89   TYR C C     1 
ATOM   3036 O  O     . TYR C 1 91  ? 7.170   94.539  244.654 1.00 164.00 ?  89   TYR C O     1 
ATOM   3037 C  CB    . TYR C 1 91  ? 8.199   96.988  243.087 1.00 200.49 ?  89   TYR C CB    1 
ATOM   3038 C  CG    . TYR C 1 91  ? 8.614   97.645  244.292 1.00 216.79 ?  89   TYR C CG    1 
ATOM   3039 C  CD1   . TYR C 1 91  ? 9.911   97.577  244.572 1.00 224.73 ?  89   TYR C CD1   1 
ATOM   3040 C  CD2   . TYR C 1 91  ? 7.799   98.423  245.064 1.00 226.30 ?  89   TYR C CD2   1 
ATOM   3041 C  CE1   . TYR C 1 91  ? 10.463  98.198  245.682 1.00 236.78 ?  89   TYR C CE1   1 
ATOM   3042 C  CE2   . TYR C 1 91  ? 8.276   99.026  246.118 1.00 237.66 ?  89   TYR C CE2   1 
ATOM   3043 C  CZ    . TYR C 1 91  ? 9.600   98.938  246.412 1.00 244.52 ?  89   TYR C CZ    1 
ATOM   3044 O  OH    . TYR C 1 91  ? 10.190  99.495  247.512 1.00 249.37 ?  89   TYR C OH    1 
ATOM   3045 N  N     . ASP C 1 92  ? 9.287   94.717  245.388 1.00 160.67 ?  90   ASP C N     1 
ATOM   3046 C  CA    . ASP C 1 92  ? 8.961   94.300  246.737 1.00 150.64 ?  90   ASP C CA    1 
ATOM   3047 C  C     . ASP C 1 92  ? 8.940   95.509  247.667 1.00 138.77 ?  90   ASP C C     1 
ATOM   3048 O  O     . ASP C 1 92  ? 9.876   96.309  247.684 1.00 141.73 ?  90   ASP C O     1 
ATOM   3049 C  CB    . ASP C 1 92  ? 9.924   93.255  247.271 1.00 142.44 ?  90   ASP C CB    1 
ATOM   3050 C  CG    . ASP C 1 92  ? 9.512   92.786  248.619 1.00 135.69 ?  90   ASP C CG    1 
ATOM   3051 O  OD1   . ASP C 1 92  ? 8.350   93.072  248.995 1.00 135.69 ?  90   ASP C OD1   1 
ATOM   3052 O  OD2   . ASP C 1 92  ? 10.323  92.099  249.261 1.00 131.83 -1 90   ASP C OD2   1 
ATOM   3053 N  N     . ILE C 1 93  ? 7.865   95.616  248.455 1.00 123.75 ?  91   ILE C N     1 
ATOM   3054 C  CA    . ILE C 1 93  ? 7.686   96.709  249.416 1.00 115.60 ?  91   ILE C CA    1 
ATOM   3055 C  C     . ILE C 1 93  ? 8.888   96.837  250.356 1.00 115.48 ?  91   ILE C C     1 
ATOM   3056 O  O     . ILE C 1 93  ? 9.350   97.947  250.658 1.00 106.87 ?  91   ILE C O     1 
ATOM   3057 C  CB    . ILE C 1 93  ? 6.374   96.483  250.188 1.00 100.65 ?  91   ILE C CB    1 
ATOM   3058 C  CG1   . ILE C 1 93  ? 6.377   95.095  250.817 1.00 100.37 ?  91   ILE C CG1   1 
ATOM   3059 C  CG2   . ILE C 1 93  ? 5.186   96.539  249.243 1.00 89.34  ?  91   ILE C CG2   1 
ATOM   3060 C  CD1   . ILE C 1 93  ? 5.535   95.018  252.037 1.00 106.25 ?  91   ILE C CD1   1 
ATOM   3061 N  N     . THR C 1 94  ? 9.421   95.710  250.823 1.00 116.94 ?  92   THR C N     1 
ATOM   3062 C  CA    . THR C 1 94  ? 10.524  95.734  251.776 1.00 112.60 ?  92   THR C CA    1 
ATOM   3063 C  C     . THR C 1 94  ? 11.892  95.779  251.120 1.00 120.81 ?  92   THR C C     1 
ATOM   3064 O  O     . THR C 1 94  ? 12.896  95.845  251.836 1.00 89.28  ?  92   THR C O     1 
ATOM   3065 C  CB    . THR C 1 94  ? 10.487  94.504  252.676 1.00 110.80 ?  92   THR C CB    1 
ATOM   3066 O  OG1   . THR C 1 94  ? 11.156  93.419  252.018 1.00 116.76 ?  92   THR C OG1   1 
ATOM   3067 C  CG2   . THR C 1 94  ? 9.074   94.119  252.959 1.00 108.92 ?  92   THR C CG2   1 
ATOM   3068 N  N     . ASN C 1 95  ? 11.973  95.713  249.800 1.00 161.45 ?  93   ASN C N     1 
ATOM   3069 C  CA    . ASN C 1 95  ? 13.279  95.594  249.178 1.00 160.53 ?  93   ASN C CA    1 
ATOM   3070 C  C     . ASN C 1 95  ? 13.914  96.962  248.973 1.00 159.43 ?  93   ASN C C     1 
ATOM   3071 O  O     . ASN C 1 95  ? 13.239  97.969  248.752 1.00 154.26 ?  93   ASN C O     1 
ATOM   3072 C  CB    . ASN C 1 95  ? 13.188  94.824  247.865 1.00 155.63 ?  93   ASN C CB    1 
ATOM   3073 C  CG    . ASN C 1 95  ? 13.255  93.327  248.083 1.00 149.83 ?  93   ASN C CG    1 
ATOM   3074 O  OD1   . ASN C 1 95  ? 12.596  92.786  248.967 1.00 159.57 ?  93   ASN C OD1   1 
ATOM   3075 N  ND2   . ASN C 1 95  ? 14.103  92.659  247.317 1.00 136.31 ?  93   ASN C ND2   1 
ATOM   3076 N  N     . GLY C 1 96  ? 15.238  96.983  249.069 1.00 149.56 ?  94   GLY C N     1 
ATOM   3077 C  CA    . GLY C 1 96  ? 15.949  98.238  249.163 1.00 145.60 ?  94   GLY C CA    1 
ATOM   3078 C  C     . GLY C 1 96  ? 16.752  98.576  247.931 1.00 150.56 ?  94   GLY C C     1 
ATOM   3079 O  O     . GLY C 1 96  ? 17.561  97.762  247.474 1.00 139.90 ?  94   GLY C O     1 
ATOM   3080 N  N     . LYS C 1 97  ? 16.548  99.764  247.372 1.00 160.88 ?  95   LYS C N     1 
ATOM   3081 C  CA    . LYS C 1 97  ? 17.373  100.202 246.255 1.00 161.14 ?  95   LYS C CA    1 
ATOM   3082 C  C     . LYS C 1 97  ? 17.333  99.177  245.126 1.00 178.07 ?  95   LYS C C     1 
ATOM   3083 O  O     . LYS C 1 97  ? 18.313  98.989  244.432 1.00 222.60 ?  95   LYS C O     1 
ATOM   3084 C  CB    . LYS C 1 97  ? 18.808  100.520 246.777 1.00 162.00 ?  95   LYS C CB    1 
ATOM   3085 C  CG    . LYS C 1 97  ? 20.049  100.860 245.855 1.00 163.30 ?  95   LYS C CG    1 
ATOM   3086 C  CD    . LYS C 1 97  ? 20.833  99.640  245.318 1.00 157.87 ?  95   LYS C CD    1 
ATOM   3087 C  CE    . LYS C 1 97  ? 21.898  99.970  244.273 1.00 151.38 ?  95   LYS C CE    1 
ATOM   3088 N  NZ    . LYS C 1 97  ? 22.677  98.766  243.806 1.00 150.14 ?  95   LYS C NZ    1 
ATOM   3089 N  N     . SER C 1 98  ? 16.237  98.420  245.010 1.00 167.92 ?  96   SER C N     1 
ATOM   3090 C  CA    . SER C 1 98  ? 15.929  97.760  243.748 1.00 161.65 ?  96   SER C CA    1 
ATOM   3091 C  C     . SER C 1 98  ? 15.260  98.762  242.829 1.00 156.35 ?  96   SER C C     1 
ATOM   3092 O  O     . SER C 1 98  ? 15.081  98.526  241.624 1.00 147.85 ?  96   SER C O     1 
ATOM   3093 C  CB    . SER C 1 98  ? 15.029  96.554  243.983 1.00 157.73 ?  96   SER C CB    1 
ATOM   3094 O  OG    . SER C 1 98  ? 13.656  96.919  243.992 1.00 156.67 ?  96   SER C OG    1 
ATOM   3095 N  N     . PHE C 1 99  ? 14.931  99.921  243.388 1.00 165.79 ?  97   PHE C N     1 
ATOM   3096 C  CA    . PHE C 1 99  ? 14.365  100.981 242.578 1.00 165.12 ?  97   PHE C CA    1 
ATOM   3097 C  C     . PHE C 1 99  ? 15.434  101.819 241.882 1.00 186.91 ?  97   PHE C C     1 
ATOM   3098 O  O     . PHE C 1 99  ? 15.201  102.377 240.798 1.00 158.22 ?  97   PHE C O     1 
ATOM   3099 C  CB    . PHE C 1 99  ? 13.410  101.780 243.460 1.00 155.26 ?  97   PHE C CB    1 
ATOM   3100 C  CG    . PHE C 1 99  ? 12.105  101.125 243.598 1.00 154.68 ?  97   PHE C CG    1 
ATOM   3101 C  CD1   . PHE C 1 99  ? 10.927  101.859 243.716 1.00 153.83 ?  97   PHE C CD1   1 
ATOM   3102 C  CD2   . PHE C 1 99  ? 12.055  99.778  243.490 1.00 158.34 ?  97   PHE C CD2   1 
ATOM   3103 C  CE1   . PHE C 1 99  ? 9.685   101.254 243.789 1.00 155.01 ?  97   PHE C CE1   1 
ATOM   3104 C  CE2   . PHE C 1 99  ? 10.885  99.143  243.479 1.00 161.47 ?  97   PHE C CE2   1 
ATOM   3105 C  CZ    . PHE C 1 99  ? 9.661   99.886  243.665 1.00 158.22 ?  97   PHE C CZ    1 
ATOM   3106 N  N     . GLU C 1 100 ? 16.601  101.934 242.493 1.00 230.71 ?  98   GLU C N     1 
ATOM   3107 C  CA    . GLU C 1 100 ? 17.743  102.558 241.835 1.00 233.51 ?  98   GLU C CA    1 
ATOM   3108 C  C     . GLU C 1 100 ? 17.925  102.138 240.360 1.00 230.94 ?  98   GLU C C     1 
ATOM   3109 O  O     . GLU C 1 100 ? 18.405  102.941 239.548 1.00 231.90 ?  98   GLU C O     1 
ATOM   3110 C  CB    . GLU C 1 100 ? 18.979  102.202 242.649 1.00 235.35 ?  98   GLU C CB    1 
ATOM   3111 C  CG    . GLU C 1 100 ? 19.493  100.808 242.381 1.00 231.38 ?  98   GLU C CG    1 
ATOM   3112 C  CD    . GLU C 1 100 ? 18.524  99.656  242.707 1.00 225.57 ?  98   GLU C CD    1 
ATOM   3113 O  OE1   . GLU C 1 100 ? 17.293  99.723  242.454 1.00 227.85 ?  98   GLU C OE1   1 
ATOM   3114 O  OE2   . GLU C 1 100 ? 19.011  98.644  243.237 1.00 226.45 -1 98   GLU C OE2   1 
ATOM   3115 N  N     . ASN C 1 101 ? 17.562  100.902 239.996 1.00 200.37 ?  99   ASN C N     1 
ATOM   3116 C  CA    . ASN C 1 101 ? 17.806  100.338 238.670 1.00 175.56 ?  99   ASN C CA    1 
ATOM   3117 C  C     . ASN C 1 101 ? 16.573  100.355 237.780 1.00 162.62 ?  99   ASN C C     1 
ATOM   3118 O  O     . ASN C 1 101 ? 16.649  99.890  236.637 1.00 165.44 ?  99   ASN C O     1 
ATOM   3119 C  CB    . ASN C 1 101 ? 18.301  98.883  238.748 1.00 172.57 ?  99   ASN C CB    1 
ATOM   3120 C  CG    . ASN C 1 101 ? 19.711  98.748  239.285 1.00 168.56 ?  99   ASN C CG    1 
ATOM   3121 O  OD1   . ASN C 1 101 ? 20.542  99.642  239.133 1.00 165.18 ?  99   ASN C OD1   1 
ATOM   3122 N  ND2   . ASN C 1 101 ? 19.988  97.613  239.921 1.00 167.69 ?  99   ASN C ND2   1 
ATOM   3123 N  N     . ILE C 1 102 ? 15.439  100.862 238.270 1.00 148.12 ?  100  ILE C N     1 
ATOM   3124 C  CA    . ILE C 1 102 ? 14.211  100.790 237.480 1.00 117.34 ?  100  ILE C CA    1 
ATOM   3125 C  C     . ILE C 1 102 ? 14.396  101.479 236.138 1.00 122.70 ?  100  ILE C C     1 
ATOM   3126 O  O     . ILE C 1 102 ? 14.090  100.909 235.082 1.00 111.15 ?  100  ILE C O     1 
ATOM   3127 C  CB    . ILE C 1 102 ? 13.032  101.388 238.258 1.00 87.03  ?  100  ILE C CB    1 
ATOM   3128 C  CG1   . ILE C 1 102 ? 12.778  100.530 239.475 1.00 82.89  ?  100  ILE C CG1   1 
ATOM   3129 C  CG2   . ILE C 1 102 ? 11.790  101.458 237.399 1.00 87.87  ?  100  ILE C CG2   1 
ATOM   3130 C  CD1   . ILE C 1 102 ? 12.246  99.151  239.179 1.00 84.17  ?  100  ILE C CD1   1 
ATOM   3131 N  N     . SER C 1 103 ? 14.922  102.707 236.156 1.00 142.01 ?  101  SER C N     1 
ATOM   3132 C  CA    . SER C 1 103 ? 15.174  103.410 234.907 1.00 145.56 ?  101  SER C CA    1 
ATOM   3133 C  C     . SER C 1 103 ? 16.017  102.543 233.995 1.00 147.26 ?  101  SER C C     1 
ATOM   3134 O  O     . SER C 1 103 ? 15.725  102.410 232.801 1.00 152.26 ?  101  SER C O     1 
ATOM   3135 C  CB    . SER C 1 103 ? 15.869  104.746 235.157 1.00 150.19 ?  101  SER C CB    1 
ATOM   3136 O  OG    . SER C 1 103 ? 16.286  105.309 233.925 1.00 151.64 ?  101  SER C OG    1 
ATOM   3137 N  N     . LYS C 1 104 ? 17.039  101.897 234.563 1.00 144.57 ?  102  LYS C N     1 
ATOM   3138 C  CA    . LYS C 1 104 ? 17.880  101.018 233.766 1.00 143.15 ?  102  LYS C CA    1 
ATOM   3139 C  C     . LYS C 1 104 ? 17.044  99.967  233.043 1.00 147.65 ?  102  LYS C C     1 
ATOM   3140 O  O     . LYS C 1 104 ? 17.099  99.905  231.809 1.00 141.28 ?  102  LYS C O     1 
ATOM   3141 C  CB    . LYS C 1 104 ? 19.001  100.400 234.609 1.00 142.11 ?  102  LYS C CB    1 
ATOM   3142 C  CG    . LYS C 1 104 ? 20.093  101.401 234.974 1.00 146.34 ?  102  LYS C CG    1 
ATOM   3143 C  CD    . LYS C 1 104 ? 21.470  100.758 234.912 1.00 147.96 ?  102  LYS C CD    1 
ATOM   3144 C  CE    . LYS C 1 104 ? 22.234  100.900 236.207 1.00 151.28 ?  102  LYS C CE    1 
ATOM   3145 N  NZ    . LYS C 1 104 ? 22.828  99.601  236.621 1.00 148.57 ?  102  LYS C NZ    1 
ATOM   3146 N  N     . TRP C 1 105 ? 16.196  99.216  233.748 1.00 160.63 ?  103  TRP C N     1 
ATOM   3147 C  CA    . TRP C 1 105 ? 15.365  98.256  233.031 1.00 156.13 ?  103  TRP C CA    1 
ATOM   3148 C  C     . TRP C 1 105 ? 14.457  98.919  232.040 1.00 154.20 ?  103  TRP C C     1 
ATOM   3149 O  O     . TRP C 1 105 ? 14.208  98.396  230.946 1.00 158.27 ?  103  TRP C O     1 
ATOM   3150 C  CB    . TRP C 1 105 ? 14.491  97.479  233.970 1.00 157.03 ?  103  TRP C CB    1 
ATOM   3151 C  CG    . TRP C 1 105 ? 15.203  96.514  234.618 1.00 159.67 ?  103  TRP C CG    1 
ATOM   3152 C  CD1   . TRP C 1 105 ? 16.175  95.722  234.106 1.00 161.63 ?  103  TRP C CD1   1 
ATOM   3153 C  CD2   . TRP C 1 105 ? 15.071  96.198  235.963 1.00 158.64 ?  103  TRP C CD2   1 
ATOM   3154 N  NE1   . TRP C 1 105 ? 16.655  94.893  235.077 1.00 159.56 ?  103  TRP C NE1   1 
ATOM   3155 C  CE2   . TRP C 1 105 ? 15.987  95.172  236.235 1.00 160.67 ?  103  TRP C CE2   1 
ATOM   3156 C  CE3   . TRP C 1 105 ? 14.256  96.677  236.977 1.00 159.76 ?  103  TRP C CE3   1 
ATOM   3157 C  CZ2   . TRP C 1 105 ? 16.104  94.623  237.464 1.00 162.24 ?  103  TRP C CZ2   1 
ATOM   3158 C  CZ3   . TRP C 1 105 ? 14.374  96.125  238.200 1.00 161.00 ?  103  TRP C CZ3   1 
ATOM   3159 C  CH2   . TRP C 1 105 ? 15.270  95.105  238.433 1.00 159.47 ?  103  TRP C CH2   1 
ATOM   3160 N  N     . LEU C 1 106 ? 13.899  100.051 232.445 1.00 146.01 ?  104  LEU C N     1 
ATOM   3161 C  CA    . LEU C 1 106 ? 12.952  100.680 231.555 1.00 128.09 ?  104  LEU C CA    1 
ATOM   3162 C  C     . LEU C 1 106 ? 13.683  101.273 230.372 1.00 132.79 ?  104  LEU C C     1 
ATOM   3163 O  O     . LEU C 1 106 ? 13.161  101.263 229.253 1.00 120.63 ?  104  LEU C O     1 
ATOM   3164 C  CB    . LEU C 1 106 ? 12.071  101.683 232.300 1.00 114.30 ?  104  LEU C CB    1 
ATOM   3165 C  CG    . LEU C 1 106 ? 11.088  101.083 233.277 1.00 111.65 ?  104  LEU C CG    1 
ATOM   3166 C  CD1   . LEU C 1 106 ? 9.887   101.919 233.364 1.00 117.84 ?  104  LEU C CD1   1 
ATOM   3167 C  CD2   . LEU C 1 106 ? 10.706  99.677  232.944 1.00 106.17 ?  104  LEU C CD2   1 
ATOM   3168 N  N     . ARG C 1 107 ? 14.947  101.654 230.568 1.00 147.10 ?  105  ARG C N     1 
ATOM   3169 C  CA    . ARG C 1 107 ? 15.777  101.925 229.405 1.00 147.07 ?  105  ARG C CA    1 
ATOM   3170 C  C     . ARG C 1 107 ? 15.730  100.723 228.481 1.00 143.17 ?  105  ARG C C     1 
ATOM   3171 O  O     . ARG C 1 107 ? 15.274  100.817 227.333 1.00 147.08 ?  105  ARG C O     1 
ATOM   3172 C  CB    . ARG C 1 107 ? 17.217  102.260 229.818 1.00 153.66 ?  105  ARG C CB    1 
ATOM   3173 C  CG    . ARG C 1 107 ? 17.370  103.611 230.507 1.00 158.78 ?  105  ARG C CG    1 
ATOM   3174 C  CD    . ARG C 1 107 ? 18.834  103.959 230.773 1.00 160.40 ?  105  ARG C CD    1 
ATOM   3175 N  NE    . ARG C 1 107 ? 19.399  104.816 229.731 1.00 155.78 ?  105  ARG C NE    1 
ATOM   3176 C  CZ    . ARG C 1 107 ? 20.661  104.758 229.314 1.00 153.09 ?  105  ARG C CZ    1 
ATOM   3177 N  NH1   . ARG C 1 107 ? 21.089  105.576 228.361 1.00 153.66 ?  105  ARG C NH1   1 
ATOM   3178 N  NH2   . ARG C 1 107 ? 21.493  103.870 229.841 1.00 150.13 ?  105  ARG C NH2   1 
ATOM   3179 N  N     . ASN C 1 108 ? 16.088  99.554  229.021 1.00 142.17 ?  106  ASN C N     1 
ATOM   3180 C  CA    . ASN C 1 108 ? 16.118  98.345  228.214 1.00 138.60 ?  106  ASN C CA    1 
ATOM   3181 C  C     . ASN C 1 108 ? 14.791  98.105  227.496 1.00 138.43 ?  106  ASN C C     1 
ATOM   3182 O  O     . ASN C 1 108 ? 14.796  97.683  226.334 1.00 137.81 ?  106  ASN C O     1 
ATOM   3183 C  CB    . ASN C 1 108 ? 16.527  97.138  229.063 1.00 132.26 ?  106  ASN C CB    1 
ATOM   3184 C  CG    . ASN C 1 108 ? 18.037  97.062  229.290 1.00 123.36 ?  106  ASN C CG    1 
ATOM   3185 O  OD1   . ASN C 1 108 ? 18.831  97.516  228.466 1.00 119.09 ?  106  ASN C OD1   1 
ATOM   3186 N  ND2   . ASN C 1 108 ? 18.433  96.454  230.399 1.00 122.84 ?  106  ASN C ND2   1 
ATOM   3187 N  N     . ILE C 1 109 ? 13.640  98.406  228.124 1.00 139.67 ?  107  ILE C N     1 
ATOM   3188 C  CA    . ILE C 1 109 ? 12.394  98.082  227.413 1.00 139.16 ?  107  ILE C CA    1 
ATOM   3189 C  C     . ILE C 1 109 ? 12.248  99.014  226.226 1.00 136.56 ?  107  ILE C C     1 
ATOM   3190 O  O     . ILE C 1 109 ? 12.097  98.573  225.074 1.00 136.15 ?  107  ILE C O     1 
ATOM   3191 C  CB    . ILE C 1 109 ? 11.159  98.096  228.348 1.00 139.88 ?  107  ILE C CB    1 
ATOM   3192 C  CG1   . ILE C 1 109 ? 9.855   97.874  227.576 1.00 145.15 ?  107  ILE C CG1   1 
ATOM   3193 C  CG2   . ILE C 1 109 ? 10.979  99.383  229.068 1.00 145.59 ?  107  ILE C CG2   1 
ATOM   3194 C  CD1   . ILE C 1 109 ? 8.612   97.770  228.475 1.00 147.64 ?  107  ILE C CD1   1 
ATOM   3195 N  N     . ASP C 1 110 ? 12.446  100.309 226.472 1.00 130.29 ?  108  ASP C N     1 
ATOM   3196 C  CA    . ASP C 1 110 ? 12.538  101.268 225.387 1.00 112.15 ?  108  ASP C CA    1 
ATOM   3197 C  C     . ASP C 1 110 ? 13.609  100.851 224.390 1.00 120.13 ?  108  ASP C C     1 
ATOM   3198 O  O     . ASP C 1 110 ? 13.438  101.024 223.178 1.00 119.31 ?  108  ASP C O     1 
ATOM   3199 C  CB    . ASP C 1 110 ? 12.832  102.659 225.948 1.00 98.25  ?  108  ASP C CB    1 
ATOM   3200 N  N     . GLU C 1 111 ? 14.705  100.259 224.874 1.00 127.87 ?  109  GLU C N     1 
ATOM   3201 C  CA    . GLU C 1 111 ? 15.776  99.934  223.941 1.00 130.05 ?  109  GLU C CA    1 
ATOM   3202 C  C     . GLU C 1 111 ? 15.450  98.700  223.112 1.00 147.06 ?  109  GLU C C     1 
ATOM   3203 O  O     . GLU C 1 111 ? 15.915  98.595  221.971 1.00 141.21 ?  109  GLU C O     1 
ATOM   3204 C  CB    . GLU C 1 111 ? 17.119  99.736  224.655 1.00 128.39 ?  109  GLU C CB    1 
ATOM   3205 C  CG    . GLU C 1 111 ? 17.681  100.941 225.392 1.00 140.43 ?  109  GLU C CG    1 
ATOM   3206 C  CD    . GLU C 1 111 ? 18.438  100.544 226.650 1.00 151.00 ?  109  GLU C CD    1 
ATOM   3207 O  OE1   . GLU C 1 111 ? 18.944  101.430 227.366 1.00 156.16 ?  109  GLU C OE1   1 
ATOM   3208 O  OE2   . GLU C 1 111 ? 18.559  99.332  226.903 1.00 153.35 -1 109  GLU C OE2   1 
ATOM   3209 N  N     . HIS C 1 112 ? 14.657  97.762  223.642 1.00 163.63 ?  110  HIS C N     1 
ATOM   3210 C  CA    . HIS C 1 112 ? 14.575  96.458  222.977 1.00 159.42 ?  110  HIS C CA    1 
ATOM   3211 C  C     . HIS C 1 112 ? 13.165  95.938  222.735 1.00 146.04 ?  110  HIS C C     1 
ATOM   3212 O  O     . HIS C 1 112 ? 12.978  95.168  221.785 1.00 138.62 ?  110  HIS C O     1 
ATOM   3213 C  CB    . HIS C 1 112 ? 15.342  95.388  223.770 1.00 162.69 ?  110  HIS C CB    1 
ATOM   3214 C  CG    . HIS C 1 112 ? 16.767  95.744  224.096 1.00 165.85 ?  110  HIS C CG    1 
ATOM   3215 N  ND1   . HIS C 1 112 ? 17.462  95.127  225.118 1.00 163.67 ?  110  HIS C ND1   1 
ATOM   3216 C  CD2   . HIS C 1 112 ? 17.637  96.610  223.517 1.00 169.81 ?  110  HIS C CD2   1 
ATOM   3217 C  CE1   . HIS C 1 112 ? 18.686  95.621  225.175 1.00 166.71 ?  110  HIS C CE1   1 
ATOM   3218 N  NE2   . HIS C 1 112 ? 18.818  96.523  224.216 1.00 169.62 ?  110  HIS C NE2   1 
ATOM   3219 N  N     . ALA C 1 113 ? 12.175  96.292  223.547 1.00 132.63 ?  111  ALA C N     1 
ATOM   3220 C  CA    . ALA C 1 113 ? 10.843  95.719  223.419 1.00 112.58 ?  111  ALA C CA    1 
ATOM   3221 C  C     . ALA C 1 113 ? 10.075  96.351  222.256 1.00 125.34 ?  111  ALA C C     1 
ATOM   3222 O  O     . ALA C 1 113 ? 10.491  97.352  221.669 1.00 116.62 ?  111  ALA C O     1 
ATOM   3223 C  CB    . ALA C 1 113 ? 10.069  95.888  224.724 1.00 98.65  ?  111  ALA C CB    1 
ATOM   3224 N  N     . ASN C 1 114 ? 8.942   95.733  221.915 1.00 145.59 ?  112  ASN C N     1 
ATOM   3225 C  CA    . ASN C 1 114 ? 8.030   96.295  220.925 1.00 147.05 ?  112  ASN C CA    1 
ATOM   3226 C  C     . ASN C 1 114 ? 7.400   97.567  221.486 1.00 151.48 ?  112  ASN C C     1 
ATOM   3227 O  O     . ASN C 1 114 ? 7.173   97.691  222.690 1.00 161.36 ?  112  ASN C O     1 
ATOM   3228 C  CB    . ASN C 1 114 ? 6.961   95.253  220.543 1.00 141.91 ?  112  ASN C CB    1 
ATOM   3229 C  CG    . ASN C 1 114 ? 5.812   95.829  219.701 1.00 139.67 ?  112  ASN C CG    1 
ATOM   3230 O  OD1   . ASN C 1 114 ? 5.862   96.960  219.223 1.00 140.98 ?  112  ASN C OD1   1 
ATOM   3231 N  ND2   . ASN C 1 114 ? 4.778   95.021  219.501 1.00 136.62 ?  112  ASN C ND2   1 
ATOM   3232 N  N     . GLU C 1 115 ? 7.120   98.524  220.596 1.00 132.83 ?  113  GLU C N     1 
ATOM   3233 C  CA    . GLU C 1 115 ? 6.689   99.846  221.045 1.00 116.03 ?  113  GLU C CA    1 
ATOM   3234 C  C     . GLU C 1 115 ? 5.374   99.785  221.818 1.00 106.09 ?  113  GLU C C     1 
ATOM   3235 O  O     . GLU C 1 115 ? 5.206   100.493 222.817 1.00 118.19 ?  113  GLU C O     1 
ATOM   3236 C  CB    . GLU C 1 115 ? 6.567   100.788 219.849 1.00 115.45 ?  113  GLU C CB    1 
ATOM   3237 N  N     . ASP C 1 116 ? 4.435   98.952  221.382 1.00 98.37  ?  114  ASP C N     1 
ATOM   3238 C  CA    . ASP C 1 116 ? 3.117   98.901  221.998 1.00 93.90  ?  114  ASP C CA    1 
ATOM   3239 C  C     . ASP C 1 116 ? 3.036   97.942  223.182 1.00 96.52  ?  114  ASP C C     1 
ATOM   3240 O  O     . ASP C 1 116 ? 1.927   97.623  223.620 1.00 99.37  ?  114  ASP C O     1 
ATOM   3241 C  CB    . ASP C 1 116 ? 2.065   98.518  220.954 1.00 93.73  ?  114  ASP C CB    1 
ATOM   3242 N  N     . VAL C 1 117 ? 4.171   97.482  223.716 1.00 96.46  ?  115  VAL C N     1 
ATOM   3243 C  CA    . VAL C 1 117 ? 4.137   96.525  224.817 1.00 98.34  ?  115  VAL C CA    1 
ATOM   3244 C  C     . VAL C 1 117 ? 3.557   97.192  226.057 1.00 103.07 ?  115  VAL C C     1 
ATOM   3245 O  O     . VAL C 1 117 ? 3.861   98.353  226.364 1.00 101.50 ?  115  VAL C O     1 
ATOM   3246 C  CB    . VAL C 1 117 ? 5.540   95.964  225.108 1.00 95.52  ?  115  VAL C CB    1 
ATOM   3247 C  CG1   . VAL C 1 117 ? 6.495   97.076  225.541 1.00 96.53  ?  115  VAL C CG1   1 
ATOM   3248 C  CG2   . VAL C 1 117 ? 5.471   94.870  226.163 1.00 97.24  ?  115  VAL C CG2   1 
ATOM   3249 N  N     . GLU C 1 118 ? 2.719   96.460  226.783 1.00 109.67 ?  116  GLU C N     1 
ATOM   3250 C  CA    . GLU C 1 118 ? 2.175   97.011  228.011 1.00 116.67 ?  116  GLU C CA    1 
ATOM   3251 C  C     . GLU C 1 118 ? 3.167   96.847  229.161 1.00 116.35 ?  116  GLU C C     1 
ATOM   3252 O  O     . GLU C 1 118 ? 4.125   96.072  229.096 1.00 106.06 ?  116  GLU C O     1 
ATOM   3253 C  CB    . GLU C 1 118 ? 0.834   96.363  228.353 1.00 113.81 ?  116  GLU C CB    1 
ATOM   3254 C  CG    . GLU C 1 118 ? -0.244  96.575  227.300 1.00 107.96 ?  116  GLU C CG    1 
ATOM   3255 C  CD    . GLU C 1 118 ? -0.089  97.883  226.537 1.00 118.10 ?  116  GLU C CD    1 
ATOM   3256 O  OE1   . GLU C 1 118 ? -0.022  98.959  227.172 1.00 122.66 ?  116  GLU C OE1   1 
ATOM   3257 O  OE2   . GLU C 1 118 ? -0.031  97.831  225.291 1.00 123.20 -1 116  GLU C OE2   1 
ATOM   3258 N  N     . ARG C 1 119 ? 2.931   97.619  230.222 1.00 123.62 ?  117  ARG C N     1 
ATOM   3259 C  CA    . ARG C 1 119 ? 3.838   97.698  231.363 1.00 124.81 ?  117  ARG C CA    1 
ATOM   3260 C  C     . ARG C 1 119 ? 2.999   97.833  232.627 1.00 130.73 ?  117  ARG C C     1 
ATOM   3261 O  O     . ARG C 1 119 ? 2.257   98.808  232.770 1.00 137.64 ?  117  ARG C O     1 
ATOM   3262 C  CB    . ARG C 1 119 ? 4.797   98.893  231.217 1.00 113.17 ?  117  ARG C CB    1 
ATOM   3263 C  CG    . ARG C 1 119 ? 5.417   99.057  229.821 1.00 110.51 ?  117  ARG C CG    1 
ATOM   3264 C  CD    . ARG C 1 119 ? 6.445   100.188 229.731 1.00 111.67 ?  117  ARG C CD    1 
ATOM   3265 N  NE    . ARG C 1 119 ? 6.851   100.425 228.344 1.00 115.70 ?  117  ARG C NE    1 
ATOM   3266 C  CZ    . ARG C 1 119 ? 7.897   101.161 227.977 1.00 121.22 ?  117  ARG C CZ    1 
ATOM   3267 N  NH1   . ARG C 1 119 ? 8.661   101.734 228.894 1.00 124.23 ?  117  ARG C NH1   1 
ATOM   3268 N  NH2   . ARG C 1 119 ? 8.190   101.314 226.690 1.00 123.40 ?  117  ARG C NH2   1 
ATOM   3269 N  N     . MET C 1 120 ? 3.099   96.858  233.529 1.00 121.38 ?  118  MET C N     1 
ATOM   3270 C  CA    . MET C 1 120 ? 2.439   96.897  234.827 1.00 98.23  ?  118  MET C CA    1 
ATOM   3271 C  C     . MET C 1 120 ? 3.496   96.727  235.910 1.00 91.06  ?  118  MET C C     1 
ATOM   3272 O  O     . MET C 1 120 ? 4.515   96.068  235.697 1.00 76.22  ?  118  MET C O     1 
ATOM   3273 C  CB    . MET C 1 120 ? 1.367   95.800  234.945 1.00 85.80  ?  118  MET C CB    1 
ATOM   3274 C  CG    . MET C 1 120 ? 0.597   95.800  236.252 1.00 83.31  ?  118  MET C CG    1 
ATOM   3275 S  SD    . MET C 1 120 ? -0.916  94.827  236.172 1.00 99.29  ?  118  MET C SD    1 
ATOM   3276 C  CE    . MET C 1 120 ? -0.379  93.318  236.964 1.00 94.88  ?  118  MET C CE    1 
ATOM   3277 N  N     . LEU C 1 121 ? 3.266   97.338  237.070 1.00 120.29 ?  119  LEU C N     1 
ATOM   3278 C  CA    . LEU C 1 121 ? 4.246   97.355  238.152 1.00 122.02 ?  119  LEU C CA    1 
ATOM   3279 C  C     . LEU C 1 121 ? 3.626   96.765  239.407 1.00 142.68 ?  119  LEU C C     1 
ATOM   3280 O  O     . LEU C 1 121 ? 2.517   97.150  239.793 1.00 130.41 ?  119  LEU C O     1 
ATOM   3281 C  CB    . LEU C 1 121 ? 4.738   98.781  238.415 1.00 101.11 ?  119  LEU C CB    1 
ATOM   3282 C  CG    . LEU C 1 121 ? 5.944   99.050  239.324 1.00 95.93  ?  119  LEU C CG    1 
ATOM   3283 C  CD1   . LEU C 1 121 ? 6.735   97.803  239.681 1.00 106.39 ?  119  LEU C CD1   1 
ATOM   3284 C  CD2   . LEU C 1 121 ? 6.861   100.087 238.698 1.00 97.38  ?  119  LEU C CD2   1 
ATOM   3285 N  N     . LEU C 1 122 ? 4.337   95.841  240.052 1.00 176.87 ?  120  LEU C N     1 
ATOM   3286 C  CA    . LEU C 1 122 ? 3.748   95.126  241.174 1.00 188.25 ?  120  LEU C CA    1 
ATOM   3287 C  C     . LEU C 1 122 ? 4.466   95.466  242.476 1.00 184.08 ?  120  LEU C C     1 
ATOM   3288 O  O     . LEU C 1 122 ? 5.685   95.686  242.486 1.00 194.71 ?  120  LEU C O     1 
ATOM   3289 C  CB    . LEU C 1 122 ? 3.747   93.614  240.895 1.00 202.99 ?  120  LEU C CB    1 
ATOM   3290 C  CG    . LEU C 1 122 ? 5.022   92.925  240.393 1.00 214.57 ?  120  LEU C CG    1 
ATOM   3291 C  CD1   . LEU C 1 122 ? 6.028   92.806  241.521 1.00 222.82 ?  120  LEU C CD1   1 
ATOM   3292 C  CD2   . LEU C 1 122 ? 4.792   91.569  239.710 1.00 216.29 ?  120  LEU C CD2   1 
ATOM   3293 N  N     . GLY C 1 123 ? 3.687   95.564  243.553 1.00 154.06 ?  121  GLY C N     1 
ATOM   3294 C  CA    . GLY C 1 123 ? 4.182   95.503  244.912 1.00 122.61 ?  121  GLY C CA    1 
ATOM   3295 C  C     . GLY C 1 123 ? 3.906   94.123  245.475 1.00 109.02 ?  121  GLY C C     1 
ATOM   3296 O  O     . GLY C 1 123 ? 2.752   93.706  245.596 1.00 104.78 ?  121  GLY C O     1 
ATOM   3297 N  N     . ASN C 1 124 ? 4.961   93.393  245.788 1.00 107.74 ?  122  ASN C N     1 
ATOM   3298 C  CA    . ASN C 1 124 ? 4.890   92.032  246.272 1.00 110.28 ?  122  ASN C CA    1 
ATOM   3299 C  C     . ASN C 1 124 ? 5.255   92.006  247.752 1.00 115.45 ?  122  ASN C C     1 
ATOM   3300 O  O     . ASN C 1 124 ? 5.678   93.010  248.333 1.00 117.35 ?  122  ASN C O     1 
ATOM   3301 C  CB    . ASN C 1 124 ? 5.791   91.103  245.453 1.00 97.27  ?  122  ASN C CB    1 
ATOM   3302 C  CG    . ASN C 1 124 ? 5.672   89.653  245.893 1.00 96.20  ?  122  ASN C CG    1 
ATOM   3303 O  OD1   . ASN C 1 124 ? 4.659   89.259  246.475 1.00 94.93  ?  122  ASN C OD1   1 
ATOM   3304 N  ND2   . ASN C 1 124 ? 6.705   88.861  245.642 1.00 93.76  ?  122  ASN C ND2   1 
ATOM   3305 N  N     . LYS C 1 125 ? 5.058   90.838  248.362 1.00 122.91 ?  123  LYS C N     1 
ATOM   3306 C  CA    . LYS C 1 125 ? 5.381   90.566  249.759 1.00 134.23 ?  123  LYS C CA    1 
ATOM   3307 C  C     . LYS C 1 125 ? 4.635   91.474  250.714 1.00 144.98 ?  123  LYS C C     1 
ATOM   3308 O  O     . LYS C 1 125 ? 5.073   91.662  251.852 1.00 146.91 ?  123  LYS C O     1 
ATOM   3309 C  CB    . LYS C 1 125 ? 6.883   90.683  250.038 1.00 135.26 ?  123  LYS C CB    1 
ATOM   3310 C  CG    . LYS C 1 125 ? 7.783   89.979  249.054 1.00 128.78 ?  123  LYS C CG    1 
ATOM   3311 C  CD    . LYS C 1 125 ? 9.119   89.656  249.702 1.00 127.12 ?  123  LYS C CD    1 
ATOM   3312 C  CE    . LYS C 1 125 ? 10.168  89.301  248.663 1.00 125.30 ?  123  LYS C CE    1 
ATOM   3313 N  NZ    . LYS C 1 125 ? 11.540  89.273  249.243 1.00 128.98 ?  123  LYS C NZ    1 
ATOM   3314 N  N     . CYS C 1 126 ? 3.503   92.035  250.299 1.00 150.32 ?  124  CYS C N     1 
ATOM   3315 C  CA    . CYS C 1 126 ? 2.877   93.072  251.108 1.00 147.74 ?  124  CYS C CA    1 
ATOM   3316 C  C     . CYS C 1 126 ? 2.416   92.538  252.461 1.00 154.85 ?  124  CYS C C     1 
ATOM   3317 O  O     . CYS C 1 126 ? 1.938   93.304  253.303 1.00 160.84 ?  124  CYS C O     1 
ATOM   3318 C  CB    . CYS C 1 126 ? 1.712   93.697  250.360 1.00 131.48 ?  124  CYS C CB    1 
ATOM   3319 S  SG    . CYS C 1 126 ? 0.467   92.504  250.102 1.00 119.09 ?  124  CYS C SG    1 
ATOM   3320 N  N     . ASP C 1 127 ? 2.562   91.229  252.687 1.00 150.51 ?  125  ASP C N     1 
ATOM   3321 C  CA    . ASP C 1 127 ? 2.462   90.706  254.043 1.00 143.01 ?  125  ASP C CA    1 
ATOM   3322 C  C     . ASP C 1 127 ? 3.638   91.148  254.900 1.00 138.05 ?  125  ASP C C     1 
ATOM   3323 O  O     . ASP C 1 127 ? 3.554   91.082  256.129 1.00 142.13 ?  125  ASP C O     1 
ATOM   3324 C  CB    . ASP C 1 127 ? 2.376   89.177  254.030 1.00 140.88 ?  125  ASP C CB    1 
ATOM   3325 C  CG    . ASP C 1 127 ? 3.667   88.515  253.579 1.00 134.95 ?  125  ASP C CG    1 
ATOM   3326 O  OD1   . ASP C 1 127 ? 3.998   88.609  252.379 1.00 136.95 ?  125  ASP C OD1   1 
ATOM   3327 O  OD2   . ASP C 1 127 ? 4.344   87.891  254.425 1.00 129.32 -1 125  ASP C OD2   1 
ATOM   3328 N  N     . MET C 1 128 ? 4.725   91.605  254.281 1.00 133.14 ?  126  MET C N     1 
ATOM   3329 C  CA    . MET C 1 128 ? 5.908   92.042  255.019 1.00 124.95 ?  126  MET C CA    1 
ATOM   3330 C  C     . MET C 1 128 ? 5.799   93.531  255.359 1.00 126.47 ?  126  MET C C     1 
ATOM   3331 O  O     . MET C 1 128 ? 6.629   94.367  255.001 1.00 115.64 ?  126  MET C O     1 
ATOM   3332 C  CB    . MET C 1 128 ? 7.164   91.720  254.223 1.00 124.70 ?  126  MET C CB    1 
ATOM   3333 C  CG    . MET C 1 128 ? 7.350   90.236  253.984 1.00 131.08 ?  126  MET C CG    1 
ATOM   3334 S  SD    . MET C 1 128 ? 7.871   89.372  255.475 1.00 131.69 ?  126  MET C SD    1 
ATOM   3335 C  CE    . MET C 1 128 ? 9.434   90.187  255.781 1.00 127.49 ?  126  MET C CE    1 
ATOM   3336 N  N     . ASP C 1 129 ? 4.718   93.826  256.080 1.00 145.93 ?  127  ASP C N     1 
ATOM   3337 C  CA    . ASP C 1 129 ? 4.394   95.160  256.569 1.00 157.84 ?  127  ASP C CA    1 
ATOM   3338 C  C     . ASP C 1 129 ? 5.436   95.708  257.537 1.00 165.01 ?  127  ASP C C     1 
ATOM   3339 O  O     . ASP C 1 129 ? 5.695   96.914  257.553 1.00 164.74 ?  127  ASP C O     1 
ATOM   3340 C  CB    . ASP C 1 129 ? 3.039   95.099  257.276 1.00 167.43 ?  127  ASP C CB    1 
ATOM   3341 C  CG    . ASP C 1 129 ? 3.108   94.309  258.576 1.00 177.17 ?  127  ASP C CG    1 
ATOM   3342 O  OD1   . ASP C 1 129 ? 2.337   93.345  258.739 1.00 175.58 ?  127  ASP C OD1   1 
ATOM   3343 O  OD2   . ASP C 1 129 ? 3.952   94.645  259.438 1.00 183.56 -1 127  ASP C OD2   1 
ATOM   3344 N  N     . ASP C 1 130 ? 5.995   94.848  258.387 1.00 169.22 ?  128  ASP C N     1 
ATOM   3345 C  CA    . ASP C 1 130 ? 6.873   95.305  259.458 1.00 171.59 ?  128  ASP C CA    1 
ATOM   3346 C  C     . ASP C 1 130 ? 8.151   95.907  258.896 1.00 172.36 ?  128  ASP C C     1 
ATOM   3347 O  O     . ASP C 1 130 ? 8.604   96.970  259.338 1.00 174.85 ?  128  ASP C O     1 
ATOM   3348 C  CB    . ASP C 1 130 ? 7.187   94.127  260.371 1.00 172.31 ?  128  ASP C CB    1 
ATOM   3349 C  CG    . ASP C 1 130 ? 7.620   92.909  259.586 1.00 170.08 ?  128  ASP C CG    1 
ATOM   3350 O  OD1   . ASP C 1 130 ? 6.854   91.926  259.555 1.00 166.46 ?  128  ASP C OD1   1 
ATOM   3351 O  OD2   . ASP C 1 130 ? 8.708   92.946  258.972 1.00 167.81 -1 128  ASP C OD2   1 
ATOM   3352 N  N     . LYS C 1 131 ? 8.756   95.220  257.936 1.00 147.84 ?  129  LYS C N     1 
ATOM   3353 C  CA    . LYS C 1 131 ? 9.879   95.738  257.180 1.00 126.65 ?  129  LYS C CA    1 
ATOM   3354 C  C     . LYS C 1 131 ? 9.430   96.485  255.932 1.00 114.60 ?  129  LYS C C     1 
ATOM   3355 O  O     . LYS C 1 131 ? 10.246  96.708  255.032 1.00 101.75 ?  129  LYS C O     1 
ATOM   3356 C  CB    . LYS C 1 131 ? 10.824  94.595  256.811 1.00 123.11 ?  129  LYS C CB    1 
ATOM   3357 C  CG    . LYS C 1 131 ? 11.326  93.797  258.006 1.00 125.05 ?  129  LYS C CG    1 
ATOM   3358 C  CD    . LYS C 1 131 ? 12.338  94.584  258.822 1.00 136.05 ?  129  LYS C CD    1 
ATOM   3359 C  CE    . LYS C 1 131 ? 12.827  93.773  260.014 1.00 135.29 ?  129  LYS C CE    1 
ATOM   3360 N  NZ    . LYS C 1 131 ? 14.113  94.291  260.563 1.00 133.46 ?  129  LYS C NZ    1 
ATOM   3361 N  N     . ARG C 1 132 ? 8.151   96.855  255.851 1.00 115.50 ?  130  ARG C N     1 
ATOM   3362 C  CA    . ARG C 1 132 ? 7.698   97.765  254.809 1.00 117.70 ?  130  ARG C CA    1 
ATOM   3363 C  C     . ARG C 1 132 ? 8.552   99.020  254.837 1.00 125.22 ?  130  ARG C C     1 
ATOM   3364 O  O     . ARG C 1 132 ? 8.604   99.734  255.842 1.00 135.15 ?  130  ARG C O     1 
ATOM   3365 C  CB    . ARG C 1 132 ? 6.217   98.107  255.004 1.00 117.01 ?  130  ARG C CB    1 
ATOM   3366 C  CG    . ARG C 1 132 ? 5.584   99.126  254.058 1.00 118.43 ?  130  ARG C CG    1 
ATOM   3367 C  CD    . ARG C 1 132 ? 4.085   99.178  254.369 1.00 131.61 ?  130  ARG C CD    1 
ATOM   3368 N  NE    . ARG C 1 132 ? 3.341   100.257 253.720 1.00 146.58 ?  130  ARG C NE    1 
ATOM   3369 C  CZ    . ARG C 1 132 ? 2.058   100.514 253.968 1.00 157.90 ?  130  ARG C CZ    1 
ATOM   3370 N  NH1   . ARG C 1 132 ? 1.437   101.509 253.349 1.00 158.60 ?  130  ARG C NH1   1 
ATOM   3371 N  NH2   . ARG C 1 132 ? 1.394   99.771  254.845 1.00 163.85 ?  130  ARG C NH2   1 
ATOM   3372 N  N     . VAL C 1 133 ? 9.277   99.238  253.749 1.00 117.50 ?  131  VAL C N     1 
ATOM   3373 C  CA    . VAL C 1 133 ? 10.085  100.437 253.585 1.00 104.71 ?  131  VAL C CA    1 
ATOM   3374 C  C     . VAL C 1 133 ? 9.419   101.464 252.680 1.00 106.26 ?  131  VAL C C     1 
ATOM   3375 O  O     . VAL C 1 133 ? 9.757   102.657 252.758 1.00 107.58 ?  131  VAL C O     1 
ATOM   3376 C  CB    . VAL C 1 133 ? 11.490  100.067 253.049 1.00 93.61  ?  131  VAL C CB    1 
ATOM   3377 C  CG1   . VAL C 1 133 ? 12.352  101.292 252.780 1.00 96.61  ?  131  VAL C CG1   1 
ATOM   3378 C  CG2   . VAL C 1 133 ? 12.202  99.112  254.003 1.00 91.46  ?  131  VAL C CG2   1 
ATOM   3379 N  N     . VAL C 1 134 ? 8.436   101.070 251.880 1.00 114.80 ?  132  VAL C N     1 
ATOM   3380 C  CA    . VAL C 1 134 ? 7.994   101.861 250.741 1.00 127.21 ?  132  VAL C CA    1 
ATOM   3381 C  C     . VAL C 1 134 ? 6.467   101.937 250.762 1.00 136.17 ?  132  VAL C C     1 
ATOM   3382 O  O     . VAL C 1 134 ? 5.795   100.912 250.598 1.00 115.99 ?  132  VAL C O     1 
ATOM   3383 C  CB    . VAL C 1 134 ? 8.543   101.248 249.445 1.00 137.89 ?  132  VAL C CB    1 
ATOM   3384 C  CG1   . VAL C 1 134 ? 7.731   101.664 248.234 1.00 133.47 ?  132  VAL C CG1   1 
ATOM   3385 C  CG2   . VAL C 1 134 ? 10.031  101.609 249.292 1.00 144.28 ?  132  VAL C CG2   1 
ATOM   3386 N  N     . PRO C 1 135 ? 5.893   103.117 251.005 1.00 159.37 ?  133  PRO C N     1 
ATOM   3387 C  CA    . PRO C 1 135 ? 4.428   103.244 251.003 1.00 164.67 ?  133  PRO C CA    1 
ATOM   3388 C  C     . PRO C 1 135 ? 3.791   102.814 249.691 1.00 161.97 ?  133  PRO C C     1 
ATOM   3389 O  O     . PRO C 1 135 ? 4.456   102.602 248.675 1.00 162.76 ?  133  PRO C O     1 
ATOM   3390 C  CB    . PRO C 1 135 ? 4.211   104.739 251.248 1.00 166.32 ?  133  PRO C CB    1 
ATOM   3391 C  CG    . PRO C 1 135 ? 5.418   105.188 251.983 1.00 165.84 ?  133  PRO C CG    1 
ATOM   3392 C  CD    . PRO C 1 135 ? 6.556   104.288 251.602 1.00 161.04 ?  133  PRO C CD    1 
ATOM   3393 N  N     . LYS C 1 136 ? 2.462   102.687 249.734 1.00 148.64 ?  134  LYS C N     1 
ATOM   3394 C  CA    . LYS C 1 136 ? 1.695   102.346 248.541 1.00 144.60 ?  134  LYS C CA    1 
ATOM   3395 C  C     . LYS C 1 136 ? 1.874   103.406 247.457 1.00 154.83 ?  134  LYS C C     1 
ATOM   3396 O  O     . LYS C 1 136 ? 2.083   103.088 246.279 1.00 167.37 ?  134  LYS C O     1 
ATOM   3397 C  CB    . LYS C 1 136 ? 0.219   102.187 248.914 1.00 133.13 ?  134  LYS C CB    1 
ATOM   3398 C  CG    . LYS C 1 136 ? -0.510  101.060 248.200 1.00 123.09 ?  134  LYS C CG    1 
ATOM   3399 C  CD    . LYS C 1 136 ? -1.970  100.969 248.638 1.00 119.17 ?  134  LYS C CD    1 
ATOM   3400 C  CE    . LYS C 1 136 ? -2.645  99.722  248.078 1.00 113.59 ?  134  LYS C CE    1 
ATOM   3401 N  NZ    . LYS C 1 136 ? -4.110  99.695  248.353 1.00 111.63 ?  134  LYS C NZ    1 
ATOM   3402 N  N     . GLY C 1 137 ? 1.808   104.678 247.842 1.00 148.71 ?  135  GLY C N     1 
ATOM   3403 C  CA    . GLY C 1 137 ? 1.956   105.756 246.888 1.00 139.02 ?  135  GLY C CA    1 
ATOM   3404 C  C     . GLY C 1 137 ? 3.367   106.207 246.636 1.00 138.95 ?  135  GLY C C     1 
ATOM   3405 O  O     . GLY C 1 137 ? 3.587   106.991 245.704 1.00 145.84 ?  135  GLY C O     1 
ATOM   3406 N  N     . LYS C 1 138 ? 4.318   105.745 247.458 1.00 140.38 ?  136  LYS C N     1 
ATOM   3407 C  CA    . LYS C 1 138 ? 5.735   105.943 247.162 1.00 145.99 ?  136  LYS C CA    1 
ATOM   3408 C  C     . LYS C 1 138 ? 6.022   105.610 245.708 1.00 167.31 ?  136  LYS C C     1 
ATOM   3409 O  O     . LYS C 1 138 ? 6.631   106.402 244.980 1.00 161.84 ?  136  LYS C O     1 
ATOM   3410 C  CB    . LYS C 1 138 ? 6.601   105.073 248.082 1.00 136.94 ?  136  LYS C CB    1 
ATOM   3411 C  CG    . LYS C 1 138 ? 8.119   105.239 247.890 1.00 128.21 ?  136  LYS C CG    1 
ATOM   3412 C  CD    . LYS C 1 138 ? 8.856   105.284 249.229 1.00 120.54 ?  136  LYS C CD    1 
ATOM   3413 C  CE    . LYS C 1 138 ? 10.316  105.701 249.102 1.00 115.69 ?  136  LYS C CE    1 
ATOM   3414 N  NZ    . LYS C 1 138 ? 11.295  104.577 249.222 1.00 108.93 ?  136  LYS C NZ    1 
ATOM   3415 N  N     . GLY C 1 139 ? 5.571   104.442 245.266 1.00 188.98 ?  137  GLY C N     1 
ATOM   3416 C  CA    . GLY C 1 139 ? 5.691   104.069 243.878 1.00 189.05 ?  137  GLY C CA    1 
ATOM   3417 C  C     . GLY C 1 139 ? 4.397   104.265 243.117 1.00 189.64 ?  137  GLY C C     1 
ATOM   3418 O  O     . GLY C 1 139 ? 4.419   104.431 241.895 1.00 192.41 ?  137  GLY C O     1 
ATOM   3419 N  N     . GLU C 1 140 ? 3.256   104.245 243.816 1.00 180.81 ?  138  GLU C N     1 
ATOM   3420 C  CA    . GLU C 1 140 ? 1.988   104.378 243.104 1.00 167.67 ?  138  GLU C CA    1 
ATOM   3421 C  C     . GLU C 1 140 ? 1.866   105.733 242.419 1.00 162.62 ?  138  GLU C C     1 
ATOM   3422 O  O     . GLU C 1 140 ? 1.185   105.847 241.390 1.00 162.84 ?  138  GLU C O     1 
ATOM   3423 C  CB    . GLU C 1 140 ? 0.808   104.148 244.044 1.00 163.31 ?  138  GLU C CB    1 
ATOM   3424 C  CG    . GLU C 1 140 ? -0.516  104.067 243.306 1.00 159.33 ?  138  GLU C CG    1 
ATOM   3425 C  CD    . GLU C 1 140 ? -1.685  103.737 244.205 1.00 162.09 ?  138  GLU C CD    1 
ATOM   3426 O  OE1   . GLU C 1 140 ? -2.526  102.913 243.793 1.00 163.19 ?  138  GLU C OE1   1 
ATOM   3427 O  OE2   . GLU C 1 140 ? -1.767  104.296 245.319 1.00 160.95 -1 138  GLU C OE2   1 
ATOM   3428 N  N     . GLN C 1 141 ? 2.521   106.767 242.956 1.00 158.87 ?  139  GLN C N     1 
ATOM   3429 C  CA    . GLN C 1 141 ? 2.567   108.030 242.230 1.00 162.02 ?  139  GLN C CA    1 
ATOM   3430 C  C     . GLN C 1 141 ? 3.427   107.915 240.979 1.00 178.07 ?  139  GLN C C     1 
ATOM   3431 O  O     . GLN C 1 141 ? 3.158   108.585 239.979 1.00 175.88 ?  139  GLN C O     1 
ATOM   3432 C  CB    . GLN C 1 141 ? 3.058   109.159 243.132 1.00 155.62 ?  139  GLN C CB    1 
ATOM   3433 C  CG    . GLN C 1 141 ? 1.947   110.011 243.711 1.00 156.45 ?  139  GLN C CG    1 
ATOM   3434 C  CD    . GLN C 1 141 ? 0.839   109.221 244.329 1.00 160.97 ?  139  GLN C CD    1 
ATOM   3435 O  OE1   . GLN C 1 141 ? 0.864   108.946 245.487 1.00 170.11 ?  139  GLN C OE1   1 
ATOM   3436 N  NE2   . GLN C 1 141 ? -0.135  108.853 243.559 1.00 152.60 ?  139  GLN C NE2   1 
ATOM   3437 N  N     . ILE C 1 142 ? 4.459   107.067 241.016 1.00 189.68 ?  140  ILE C N     1 
ATOM   3438 C  CA    . ILE C 1 142 ? 5.208   106.752 239.797 1.00 190.48 ?  140  ILE C CA    1 
ATOM   3439 C  C     . ILE C 1 142 ? 4.295   106.057 238.789 1.00 191.93 ?  140  ILE C C     1 
ATOM   3440 O  O     . ILE C 1 142 ? 4.368   106.296 237.568 1.00 191.37 ?  140  ILE C O     1 
ATOM   3441 C  CB    . ILE C 1 142 ? 6.444   105.888 240.127 1.00 185.90 ?  140  ILE C CB    1 
ATOM   3442 C  CG1   . ILE C 1 142 ? 7.036   106.249 241.500 1.00 183.26 ?  140  ILE C CG1   1 
ATOM   3443 C  CG2   . ILE C 1 142 ? 7.495   106.022 239.045 1.00 183.84 ?  140  ILE C CG2   1 
ATOM   3444 C  CD1   . ILE C 1 142 ? 7.520   107.676 241.641 1.00 181.59 ?  140  ILE C CD1   1 
ATOM   3445 N  N     . ALA C 1 143 ? 3.410   105.195 239.291 1.00 190.51 ?  141  ALA C N     1 
ATOM   3446 C  CA    . ALA C 1 143 ? 2.456   104.508 238.429 1.00 182.08 ?  141  ALA C CA    1 
ATOM   3447 C  C     . ALA C 1 143 ? 1.506   105.499 237.770 1.00 180.67 ?  141  ALA C C     1 
ATOM   3448 O  O     . ALA C 1 143 ? 1.223   105.396 236.571 1.00 177.69 ?  141  ALA C O     1 
ATOM   3449 C  CB    . ALA C 1 143 ? 1.684   103.462 239.232 1.00 178.80 ?  141  ALA C CB    1 
ATOM   3450 N  N     . ARG C 1 144 ? 1.005   106.472 238.536 1.00 183.31 ?  142  ARG C N     1 
ATOM   3451 C  CA    . ARG C 1 144 ? 0.222   107.541 237.924 1.00 182.48 ?  142  ARG C CA    1 
ATOM   3452 C  C     . ARG C 1 144 ? 1.064   108.348 236.946 1.00 192.17 ?  142  ARG C C     1 
ATOM   3453 O  O     . ARG C 1 144 ? 0.534   108.882 235.964 1.00 185.06 ?  142  ARG C O     1 
ATOM   3454 C  CB    . ARG C 1 144 ? -0.366  108.455 239.000 1.00 175.75 ?  142  ARG C CB    1 
ATOM   3455 N  N     . GLU C 1 145 ? 2.376   108.439 237.196 1.00 205.37 ?  143  GLU C N     1 
ATOM   3456 C  CA    . GLU C 1 145 ? 3.262   109.161 236.287 1.00 202.52 ?  143  GLU C CA    1 
ATOM   3457 C  C     . GLU C 1 145 ? 3.307   108.504 234.916 1.00 200.75 ?  143  GLU C C     1 
ATOM   3458 O  O     . GLU C 1 145 ? 3.410   109.196 233.895 1.00 202.30 ?  143  GLU C O     1 
ATOM   3459 C  CB    . GLU C 1 145 ? 4.677   109.254 236.865 1.00 202.32 ?  143  GLU C CB    1 
ATOM   3460 C  CG    . GLU C 1 145 ? 4.830   110.133 238.097 1.00 204.24 ?  143  GLU C CG    1 
ATOM   3461 C  CD    . GLU C 1 145 ? 6.058   109.775 238.920 1.00 200.83 ?  143  GLU C CD    1 
ATOM   3462 O  OE1   . GLU C 1 145 ? 6.980   109.139 238.364 1.00 199.85 ?  143  GLU C OE1   1 
ATOM   3463 O  OE2   . GLU C 1 145 ? 6.100   110.114 240.123 1.00 197.39 -1 143  GLU C OE2   1 
ATOM   3464 N  N     . HIS C 1 146 ? 3.245   107.172 234.861 1.00 193.44 ?  144  HIS C N     1 
ATOM   3465 C  CA    . HIS C 1 146 ? 3.292   106.499 233.566 1.00 176.67 ?  144  HIS C CA    1 
ATOM   3466 C  C     . HIS C 1 146 ? 1.967   105.885 233.117 1.00 159.86 ?  144  HIS C C     1 
ATOM   3467 O  O     . HIS C 1 146 ? 1.928   105.255 232.054 1.00 147.09 ?  144  HIS C O     1 
ATOM   3468 C  CB    . HIS C 1 146 ? 4.398   105.438 233.561 1.00 175.04 ?  144  HIS C CB    1 
ATOM   3469 C  CG    . HIS C 1 146 ? 5.744   105.988 233.202 1.00 178.81 ?  144  HIS C CG    1 
ATOM   3470 N  ND1   . HIS C 1 146 ? 6.685   106.336 234.147 1.00 185.47 ?  144  HIS C ND1   1 
ATOM   3471 C  CD2   . HIS C 1 146 ? 6.292   106.283 232.000 1.00 176.25 ?  144  HIS C CD2   1 
ATOM   3472 C  CE1   . HIS C 1 146 ? 7.762   106.803 233.541 1.00 183.81 ?  144  HIS C CE1   1 
ATOM   3473 N  NE2   . HIS C 1 146 ? 7.549   106.781 232.238 1.00 177.27 ?  144  HIS C NE2   1 
ATOM   3474 N  N     . GLY C 1 147 ? 0.883   106.063 233.876 1.00 158.55 ?  145  GLY C N     1 
ATOM   3475 C  CA    . GLY C 1 147 ? -0.455  105.742 233.412 1.00 144.49 ?  145  GLY C CA    1 
ATOM   3476 C  C     . GLY C 1 147 ? -0.889  104.297 233.547 1.00 133.35 ?  145  GLY C C     1 
ATOM   3477 O  O     . GLY C 1 147 ? -2.000  103.961 233.115 1.00 123.46 ?  145  GLY C O     1 
ATOM   3478 N  N     . ILE C 1 148 ? -0.066  103.439 234.141 1.00 132.31 ?  146  ILE C N     1 
ATOM   3479 C  CA    . ILE C 1 148 ? -0.351  102.009 234.228 1.00 120.30 ?  146  ILE C CA    1 
ATOM   3480 C  C     . ILE C 1 148 ? -1.540  101.719 235.143 1.00 124.04 ?  146  ILE C C     1 
ATOM   3481 O  O     . ILE C 1 148 ? -1.804  100.566 235.493 1.00 129.56 ?  146  ILE C O     1 
ATOM   3482 C  CB    . ILE C 1 148 ? 0.891   101.250 234.702 1.00 96.38  ?  146  ILE C CB    1 
ATOM   3483 C  CG1   . ILE C 1 148 ? 1.103   101.477 236.198 1.00 88.31  ?  146  ILE C CG1   1 
ATOM   3484 C  CG2   . ILE C 1 148 ? 2.112   101.728 233.934 1.00 88.94  ?  146  ILE C CG2   1 
ATOM   3485 C  CD1   . ILE C 1 148 ? 2.320   100.791 236.750 1.00 89.42  ?  146  ILE C CD1   1 
ATOM   3486 N  N     . GLU C 1 152 ? -0.809  95.957  244.932 1.00 134.82 ?  150  GLU C N     1 
ATOM   3487 C  CA    . GLU C 1 152 ? 0.026   95.240  245.884 1.00 132.20 ?  150  GLU C CA    1 
ATOM   3488 C  C     . GLU C 1 152 ? -0.409  93.788  246.005 1.00 124.38 ?  150  GLU C C     1 
ATOM   3489 O  O     . GLU C 1 152 ? -1.597  93.471  245.942 1.00 116.97 ?  150  GLU C O     1 
ATOM   3490 C  CB    . GLU C 1 152 ? -0.008  95.915  247.253 1.00 139.04 ?  150  GLU C CB    1 
ATOM   3491 C  CG    . GLU C 1 152 ? 0.283   97.406  247.202 1.00 130.93 ?  150  GLU C CG    1 
ATOM   3492 C  CD    . GLU C 1 152 ? 0.921   97.912  248.476 1.00 124.62 ?  150  GLU C CD    1 
ATOM   3493 O  OE1   . GLU C 1 152 ? 2.046   98.452  248.405 1.00 123.00 ?  150  GLU C OE1   1 
ATOM   3494 O  OE2   . GLU C 1 152 ? 0.299   97.760  249.548 1.00 133.49 -1 150  GLU C OE2   1 
ATOM   3495 N  N     . THR C 1 153 ? 0.570   92.903  246.168 1.00 123.57 ?  151  THR C N     1 
ATOM   3496 C  CA    . THR C 1 153 ? 0.331   91.469  246.115 1.00 115.71 ?  151  THR C CA    1 
ATOM   3497 C  C     . THR C 1 153 ? 1.279   90.762  247.072 1.00 108.51 ?  151  THR C C     1 
ATOM   3498 O  O     . THR C 1 153 ? 2.351   91.278  247.381 1.00 119.80 ?  151  THR C O     1 
ATOM   3499 C  CB    . THR C 1 153 ? 0.534   90.920  244.698 1.00 123.11 ?  151  THR C CB    1 
ATOM   3500 O  OG1   . THR C 1 153 ? 1.884   91.167  244.279 1.00 127.21 ?  151  THR C OG1   1 
ATOM   3501 C  CG2   . THR C 1 153 ? -0.434  91.546  243.701 1.00 111.68 ?  151  THR C CG2   1 
ATOM   3502 N  N     . SER C 1 154 ? 0.889   89.577  247.532 1.00 101.12 ?  152  SER C N     1 
ATOM   3503 C  CA    . SER C 1 154 ? 1.756   88.730  248.341 1.00 96.30  ?  152  SER C CA    1 
ATOM   3504 C  C     . SER C 1 154 ? 1.678   87.319  247.793 1.00 99.28  ?  152  SER C C     1 
ATOM   3505 O  O     . SER C 1 154 ? 0.591   86.746  247.731 1.00 108.04 ?  152  SER C O     1 
ATOM   3506 C  CB    . SER C 1 154 ? 1.358   88.758  249.821 1.00 84.32  ?  152  SER C CB    1 
ATOM   3507 O  OG    . SER C 1 154 ? 1.942   87.670  250.522 1.00 65.84  ?  152  SER C OG    1 
ATOM   3508 N  N     . ALA C 1 155 ? 2.822   86.773  247.376 1.00 93.91  ?  153  ALA C N     1 
ATOM   3509 C  CA    . ALA C 1 155 ? 2.848   85.359  247.022 1.00 97.14  ?  153  ALA C CA    1 
ATOM   3510 C  C     . ALA C 1 155 ? 2.735   84.483  248.260 1.00 95.64  ?  153  ALA C C     1 
ATOM   3511 O  O     . ALA C 1 155 ? 2.175   83.382  248.191 1.00 87.57  ?  153  ALA C O     1 
ATOM   3512 C  CB    . ALA C 1 155 ? 4.123   85.017  246.253 1.00 96.18  ?  153  ALA C CB    1 
ATOM   3513 N  N     . LYS C 1 156 ? 3.258   84.956  249.393 1.00 101.33 ?  154  LYS C N     1 
ATOM   3514 C  CA    . LYS C 1 156 ? 3.228   84.173  250.624 1.00 103.68 ?  154  LYS C CA    1 
ATOM   3515 C  C     . LYS C 1 156 ? 1.801   84.000  251.127 1.00 102.64 ?  154  LYS C C     1 
ATOM   3516 O  O     . LYS C 1 156 ? 1.374   82.887  251.458 1.00 100.67 ?  154  LYS C O     1 
ATOM   3517 C  CB    . LYS C 1 156 ? 4.101   84.851  251.682 1.00 112.64 ?  154  LYS C CB    1 
ATOM   3518 C  CG    . LYS C 1 156 ? 4.479   83.971  252.861 1.00 116.32 ?  154  LYS C CG    1 
ATOM   3519 C  CD    . LYS C 1 156 ? 5.422   84.710  253.802 1.00 121.47 ?  154  LYS C CD    1 
ATOM   3520 C  CE    . LYS C 1 156 ? 6.290   83.748  254.600 1.00 112.97 ?  154  LYS C CE    1 
ATOM   3521 N  NZ    . LYS C 1 156 ? 7.499   84.425  255.151 1.00 117.02 ?  154  LYS C NZ    1 
ATOM   3522 N  N     . ALA C 1 157 ? 1.049   85.096  251.192 1.00 103.80 ?  155  ALA C N     1 
ATOM   3523 C  CA    . ALA C 1 157 ? -0.352  85.076  251.583 1.00 114.66 ?  155  ALA C CA    1 
ATOM   3524 C  C     . ALA C 1 157 ? -1.296  84.994  250.392 1.00 136.85 ?  155  ALA C C     1 
ATOM   3525 O  O     . ALA C 1 157 ? -2.515  85.035  250.588 1.00 137.60 ?  155  ALA C O     1 
ATOM   3526 C  CB    . ALA C 1 157 ? -0.685  86.313  252.418 1.00 115.42 ?  155  ALA C CB    1 
ATOM   3527 N  N     . ASN C 1 158 ? -0.763  84.896  249.173 1.00 152.12 ?  156  ASN C N     1 
ATOM   3528 C  CA    . ASN C 1 158 ? -1.554  84.698  247.955 1.00 142.81 ?  156  ASN C CA    1 
ATOM   3529 C  C     . ASN C 1 158 ? -2.711  85.688  247.855 1.00 124.71 ?  156  ASN C C     1 
ATOM   3530 O  O     . ASN C 1 158 ? -3.876  85.298  247.781 1.00 124.73 ?  156  ASN C O     1 
ATOM   3531 C  CB    . ASN C 1 158 ? -2.091  83.266  247.873 1.00 143.29 ?  156  ASN C CB    1 
ATOM   3532 C  CG    . ASN C 1 158 ? -1.126  82.313  247.216 1.00 138.85 ?  156  ASN C CG    1 
ATOM   3533 O  OD1   . ASN C 1 158 ? -1.429  81.735  246.176 1.00 139.52 ?  156  ASN C OD1   1 
ATOM   3534 N  ND2   . ASN C 1 158 ? 0.031   82.118  247.833 1.00 125.66 ?  156  ASN C ND2   1 
ATOM   3535 N  N     . ILE C 1 159 ? -2.397  86.981  247.851 1.00 114.20 ?  157  ILE C N     1 
ATOM   3536 C  CA    . ILE C 1 159 ? -3.434  88.005  247.781 1.00 127.33 ?  157  ILE C CA    1 
ATOM   3537 C  C     . ILE C 1 159 ? -3.197  88.878  246.556 1.00 135.29 ?  157  ILE C C     1 
ATOM   3538 O  O     . ILE C 1 159 ? -2.046  89.146  246.180 1.00 145.18 ?  157  ILE C O     1 
ATOM   3539 C  CB    . ILE C 1 159 ? -3.529  88.814  249.092 1.00 148.87 ?  157  ILE C CB    1 
ATOM   3540 C  CG1   . ILE C 1 159 ? -2.183  89.373  249.562 1.00 154.40 ?  157  ILE C CG1   1 
ATOM   3541 C  CG2   . ILE C 1 159 ? -4.164  87.953  250.196 1.00 157.24 ?  157  ILE C CG2   1 
ATOM   3542 C  CD1   . ILE C 1 159 ? -1.764  90.583  248.838 1.00 155.45 ?  157  ILE C CD1   1 
ATOM   3543 N  N     . ASN C 1 160 ? -4.294  89.264  245.899 1.00 134.93 ?  158  ASN C N     1 
ATOM   3544 C  CA    . ASN C 1 160 ? -4.331  90.078  244.678 1.00 123.92 ?  158  ASN C CA    1 
ATOM   3545 C  C     . ASN C 1 160 ? -3.361  89.591  243.604 1.00 119.18 ?  158  ASN C C     1 
ATOM   3546 O  O     . ASN C 1 160 ? -3.079  90.316  242.645 1.00 117.50 ?  158  ASN C O     1 
ATOM   3547 C  CB    . ASN C 1 160 ? -4.082  91.556  244.986 1.00 116.19 ?  158  ASN C CB    1 
ATOM   3548 C  CG    . ASN C 1 160 ? -5.373  92.336  245.121 1.00 112.20 ?  158  ASN C CG    1 
ATOM   3549 O  OD1   . ASN C 1 160 ? -6.433  91.753  245.361 1.00 107.50 ?  158  ASN C OD1   1 
ATOM   3550 N  ND2   . ASN C 1 160 ? -5.295  93.653  244.990 1.00 117.81 ?  158  ASN C ND2   1 
ATOM   3551 N  N     . ILE C 1 161 ? -2.868  88.358  243.722 1.00 113.40 ?  159  ILE C N     1 
ATOM   3552 C  CA    . ILE C 1 161 ? -2.006  87.802  242.687 1.00 111.45 ?  159  ILE C CA    1 
ATOM   3553 C  C     . ILE C 1 161 ? -2.823  87.452  241.451 1.00 115.68 ?  159  ILE C C     1 
ATOM   3554 O  O     . ILE C 1 161 ? -2.530  87.919  240.346 1.00 104.73 ?  159  ILE C O     1 
ATOM   3555 C  CB    . ILE C 1 161 ? -1.238  86.581  243.216 1.00 109.57 ?  159  ILE C CB    1 
ATOM   3556 C  CG1   . ILE C 1 161 ? -0.001  87.043  243.975 1.00 107.72 ?  159  ILE C CG1   1 
ATOM   3557 C  CG2   . ILE C 1 161 ? -0.841  85.676  242.073 1.00 98.59  ?  159  ILE C CG2   1 
ATOM   3558 C  CD1   . ILE C 1 161 ? 0.921   87.837  243.115 1.00 96.48  ?  159  ILE C CD1   1 
ATOM   3559 N  N     . GLU C 1 162 ? -3.853  86.613  241.617 1.00 130.44 ?  160  GLU C N     1 
ATOM   3560 C  CA    . GLU C 1 162 ? -4.659  86.213  240.465 1.00 130.98 ?  160  GLU C CA    1 
ATOM   3561 C  C     . GLU C 1 162 ? -5.200  87.440  239.739 1.00 141.08 ?  160  GLU C C     1 
ATOM   3562 O  O     . GLU C 1 162 ? -4.954  87.621  238.534 1.00 153.05 ?  160  GLU C O     1 
ATOM   3563 C  CB    . GLU C 1 162 ? -5.788  85.262  240.904 1.00 126.57 ?  160  GLU C CB    1 
ATOM   3564 C  CG    . GLU C 1 162 ? -6.455  84.506  239.742 1.00 131.28 ?  160  GLU C CG    1 
ATOM   3565 C  CD    . GLU C 1 162 ? -7.085  83.158  240.118 1.00 137.33 ?  160  GLU C CD    1 
ATOM   3566 O  OE1   . GLU C 1 162 ? -6.995  82.722  241.287 1.00 143.43 ?  160  GLU C OE1   1 
ATOM   3567 O  OE2   . GLU C 1 162 ? -7.668  82.529  239.209 1.00 143.18 -1 160  GLU C OE2   1 
ATOM   3568 N  N     . LYS C 1 163 ? -5.862  88.340  240.476 1.00 130.25 ?  161  LYS C N     1 
ATOM   3569 C  CA    . LYS C 1 163 ? -6.423  89.536  239.853 1.00 132.84 ?  161  LYS C CA    1 
ATOM   3570 C  C     . LYS C 1 163 ? -5.349  90.389  239.188 1.00 134.88 ?  161  LYS C C     1 
ATOM   3571 O  O     . LYS C 1 163 ? -5.622  91.067  238.189 1.00 150.28 ?  161  LYS C O     1 
ATOM   3572 C  CB    . LYS C 1 163 ? -7.195  90.361  240.878 1.00 128.22 ?  161  LYS C CB    1 
ATOM   3573 C  CG    . LYS C 1 163 ? -8.063  91.435  240.227 1.00 136.51 ?  161  LYS C CG    1 
ATOM   3574 C  CD    . LYS C 1 163 ? -8.816  90.816  239.046 1.00 136.80 ?  161  LYS C CD    1 
ATOM   3575 C  CE    . LYS C 1 163 ? -9.172  91.819  237.945 1.00 129.55 ?  161  LYS C CE    1 
ATOM   3576 N  NZ    . LYS C 1 163 ? -7.975  92.518  237.393 1.00 126.69 ?  161  LYS C NZ    1 
ATOM   3577 N  N     . ALA C 1 164 ? -4.127  90.374  239.724 1.00 114.86 ?  162  ALA C N     1 
ATOM   3578 C  CA    . ALA C 1 164 ? -3.042  91.127  239.102 1.00 103.55 ?  162  ALA C CA    1 
ATOM   3579 C  C     . ALA C 1 164 ? -2.827  90.682  237.660 1.00 116.21 ?  162  ALA C C     1 
ATOM   3580 O  O     . ALA C 1 164 ? -2.844  91.499  236.734 1.00 106.36 ?  162  ALA C O     1 
ATOM   3581 C  CB    . ALA C 1 164 ? -1.752  90.971  239.911 1.00 92.25  ?  162  ALA C CB    1 
ATOM   3582 N  N     . PHE C 1 165 ? -2.645  89.379  237.450 1.00 115.58 ?  163  PHE C N     1 
ATOM   3583 C  CA    . PHE C 1 165 ? -2.428  88.855  236.103 1.00 106.29 ?  163  PHE C CA    1 
ATOM   3584 C  C     . PHE C 1 165 ? -3.641  89.077  235.203 1.00 102.58 ?  163  PHE C C     1 
ATOM   3585 O  O     . PHE C 1 165 ? -3.505  89.532  234.054 1.00 110.10 ?  163  PHE C O     1 
ATOM   3586 C  CB    . PHE C 1 165 ? -2.089  87.366  236.182 1.00 103.43 ?  163  PHE C CB    1 
ATOM   3587 C  CG    . PHE C 1 165 ? -0.674  87.079  236.595 1.00 111.96 ?  163  PHE C CG    1 
ATOM   3588 C  CD1   . PHE C 1 165 ? 0.360   87.409  235.768 1.00 106.95 ?  163  PHE C CD1   1 
ATOM   3589 C  CD2   . PHE C 1 165 ? -0.393  86.529  237.826 1.00 122.88 ?  163  PHE C CD2   1 
ATOM   3590 C  CE1   . PHE C 1 165 ? 1.643   87.141  236.145 1.00 114.96 ?  163  PHE C CE1   1 
ATOM   3591 C  CE2   . PHE C 1 165 ? 0.899   86.268  238.198 1.00 134.58 ?  163  PHE C CE2   1 
ATOM   3592 C  CZ    . PHE C 1 165 ? 1.912   86.581  237.355 1.00 124.11 ?  163  PHE C CZ    1 
ATOM   3593 N  N     . LEU C 1 166 ? -4.837  88.724  235.689 1.00 92.03  ?  164  LEU C N     1 
ATOM   3594 C  CA    . LEU C 1 166 ? -6.023  88.953  234.867 1.00 95.33  ?  164  LEU C CA    1 
ATOM   3595 C  C     . LEU C 1 166 ? -6.160  90.411  234.434 1.00 103.56 ?  164  LEU C C     1 
ATOM   3596 O  O     . LEU C 1 166 ? -6.693  90.695  233.354 1.00 112.57 ?  164  LEU C O     1 
ATOM   3597 C  CB    . LEU C 1 166 ? -7.297  88.470  235.571 1.00 95.41  ?  164  LEU C CB    1 
ATOM   3598 C  CG    . LEU C 1 166 ? -7.637  86.982  235.833 1.00 103.25 ?  164  LEU C CG    1 
ATOM   3599 C  CD1   . LEU C 1 166 ? -6.513  86.036  236.378 1.00 106.55 ?  164  LEU C CD1   1 
ATOM   3600 C  CD2   . LEU C 1 166 ? -8.972  86.855  236.630 1.00 119.22 ?  164  LEU C CD2   1 
ATOM   3601 N  N     . THR C 1 167 ? -5.673  91.344  235.253 1.00 102.16 ?  165  THR C N     1 
ATOM   3602 C  CA    . THR C 1 167 ? -5.636  92.747  234.841 1.00 103.75 ?  165  THR C CA    1 
ATOM   3603 C  C     . THR C 1 167 ? -4.812  92.937  233.568 1.00 100.04 ?  165  THR C C     1 
ATOM   3604 O  O     . THR C 1 167 ? -5.250  93.600  232.615 1.00 105.37 ?  165  THR C O     1 
ATOM   3605 C  CB    . THR C 1 167 ? -5.071  93.602  235.977 1.00 94.39  ?  165  THR C CB    1 
ATOM   3606 O  OG1   . THR C 1 167 ? -6.094  93.889  236.913 1.00 87.58  ?  165  THR C OG1   1 
ATOM   3607 C  CG2   . THR C 1 167 ? -4.487  94.889  235.460 1.00 83.57  ?  165  THR C CG2   1 
ATOM   3608 N  N     . LEU C 1 168 ? -3.604  92.371  233.537 1.00 102.03 ?  166  LEU C N     1 
ATOM   3609 C  CA    . LEU C 1 168 ? -2.771  92.513  232.348 1.00 96.35  ?  166  LEU C CA    1 
ATOM   3610 C  C     . LEU C 1 168 ? -3.457  91.905  231.134 1.00 86.59  ?  166  LEU C C     1 
ATOM   3611 O  O     . LEU C 1 168 ? -3.422  92.476  230.030 1.00 61.87  ?  166  LEU C O     1 
ATOM   3612 C  CB    . LEU C 1 168 ? -1.404  91.873  232.576 1.00 80.32  ?  166  LEU C CB    1 
ATOM   3613 C  CG    . LEU C 1 168 ? -0.310  92.516  231.728 1.00 74.90  ?  166  LEU C CG    1 
ATOM   3614 C  CD1   . LEU C 1 168 ? -0.326  94.029  231.890 1.00 89.73  ?  166  LEU C CD1   1 
ATOM   3615 C  CD2   . LEU C 1 168 ? 1.049   91.958  232.082 1.00 69.76  ?  166  LEU C CD2   1 
ATOM   3616 N  N     . ALA C 1 169 ? -4.120  90.762  231.330 1.00 102.40 ?  167  ALA C N     1 
ATOM   3617 C  CA    . ALA C 1 169 ? -4.977  90.231  230.276 1.00 110.59 ?  167  ALA C CA    1 
ATOM   3618 C  C     . ALA C 1 169 ? -5.979  91.282  229.799 1.00 115.68 ?  167  ALA C C     1 
ATOM   3619 O  O     . ALA C 1 169 ? -6.211  91.430  228.596 1.00 124.12 ?  167  ALA C O     1 
ATOM   3620 C  CB    . ALA C 1 169 ? -5.693  88.975  230.768 1.00 105.70 ?  167  ALA C CB    1 
ATOM   3621 N  N     . GLU C 1 170 ? -6.578  92.031  230.731 1.00 107.94 ?  168  GLU C N     1 
ATOM   3622 C  CA    . GLU C 1 170 ? -7.474  93.119  230.329 1.00 101.23 ?  168  GLU C CA    1 
ATOM   3623 C  C     . GLU C 1 170 ? -6.766  94.103  229.400 1.00 91.13  ?  168  GLU C C     1 
ATOM   3624 O  O     . GLU C 1 170 ? -7.232  94.357  228.279 1.00 98.45  ?  168  GLU C O     1 
ATOM   3625 C  CB    . GLU C 1 170 ? -8.039  93.839  231.564 1.00 124.13 ?  168  GLU C CB    1 
ATOM   3626 C  CG    . GLU C 1 170 ? -9.103  94.904  231.262 1.00 131.90 ?  168  GLU C CG    1 
ATOM   3627 C  CD    . GLU C 1 170 ? -8.550  96.322  231.306 1.00 130.53 ?  168  GLU C CD    1 
ATOM   3628 O  OE1   . GLU C 1 170 ? -7.652  96.582  232.132 1.00 126.98 ?  168  GLU C OE1   1 
ATOM   3629 O  OE2   . GLU C 1 170 ? -8.998  97.168  230.501 1.00 124.35 -1 168  GLU C OE2   1 
ATOM   3630 N  N     . ASP C 1 171 ? -5.605  94.629  229.818 1.00 94.20  ?  169  ASP C N     1 
ATOM   3631 C  CA    . ASP C 1 171 ? -4.973  95.683  229.021 1.00 104.36 ?  169  ASP C CA    1 
ATOM   3632 C  C     . ASP C 1 171 ? -4.499  95.184  227.661 1.00 115.68 ?  169  ASP C C     1 
ATOM   3633 O  O     . ASP C 1 171 ? -4.295  95.991  226.747 1.00 122.34 ?  169  ASP C O     1 
ATOM   3634 C  CB    . ASP C 1 171 ? -3.782  96.309  229.743 1.00 105.84 ?  169  ASP C CB    1 
ATOM   3635 C  CG    . ASP C 1 171 ? -4.145  96.881  231.090 1.00 112.77 ?  169  ASP C CG    1 
ATOM   3636 O  OD1   . ASP C 1 171 ? -4.926  96.238  231.815 1.00 120.92 ?  169  ASP C OD1   1 
ATOM   3637 O  OD2   . ASP C 1 171 ? -3.671  97.992  231.408 1.00 104.42 -1 169  ASP C OD2   1 
ATOM   3638 N  N     . ILE C 1 172 ? -4.275  93.882  227.511 1.00 113.49 ?  170  ILE C N     1 
ATOM   3639 C  CA    . ILE C 1 172 ? -3.847  93.354  226.213 1.00 107.39 ?  170  ILE C CA    1 
ATOM   3640 C  C     . ILE C 1 172 ? -5.045  93.041  225.316 1.00 105.15 ?  170  ILE C C     1 
ATOM   3641 O  O     . ILE C 1 172 ? -5.125  93.491  224.162 1.00 110.46 ?  170  ILE C O     1 
ATOM   3642 C  CB    . ILE C 1 172 ? -2.950  92.116  226.434 1.00 100.34 ?  170  ILE C CB    1 
ATOM   3643 C  CG1   . ILE C 1 172 ? -1.498  92.550  226.639 1.00 89.10  ?  170  ILE C CG1   1 
ATOM   3644 C  CG2   . ILE C 1 172 ? -3.074  91.120  225.286 1.00 96.08  ?  170  ILE C CG2   1 
ATOM   3645 C  CD1   . ILE C 1 172 ? -0.563  91.408  226.920 1.00 83.27  ?  170  ILE C CD1   1 
ATOM   3646 N  N     . LEU C 1 173 ? -6.010  92.284  225.850 1.00 100.61 ?  171  LEU C N     1 
ATOM   3647 C  CA    . LEU C 1 173 ? -7.175  91.906  225.061 1.00 103.56 ?  171  LEU C CA    1 
ATOM   3648 C  C     . LEU C 1 173 ? -7.981  93.125  224.653 1.00 117.99 ?  171  LEU C C     1 
ATOM   3649 O  O     . LEU C 1 173 ? -8.672  93.080  223.638 1.00 114.78 ?  171  LEU C O     1 
ATOM   3650 C  CB    . LEU C 1 173 ? -8.052  90.907  225.828 1.00 91.69  ?  171  LEU C CB    1 
ATOM   3651 C  CG    . LEU C 1 173 ? -9.369  90.412  225.190 1.00 102.50 ?  171  LEU C CG    1 
ATOM   3652 C  CD1   . LEU C 1 173 ? -9.702  89.012  225.677 1.00 109.96 ?  171  LEU C CD1   1 
ATOM   3653 C  CD2   . LEU C 1 173 ? -10.576 91.327  225.434 1.00 95.59  ?  171  LEU C CD2   1 
ATOM   3654 N  N     . ARG C 1 174 ? -7.917  94.215  225.421 1.00 131.60 ?  172  ARG C N     1 
ATOM   3655 C  CA    . ARG C 1 174 ? -8.563  95.440  224.962 1.00 142.93 ?  172  ARG C CA    1 
ATOM   3656 C  C     . ARG C 1 174 ? -7.798  96.079  223.812 1.00 126.59 ?  172  ARG C C     1 
ATOM   3657 O  O     . ARG C 1 174 ? -8.403  96.745  222.965 1.00 138.05 ?  172  ARG C O     1 
ATOM   3658 C  CB    . ARG C 1 174 ? -8.713  96.429  226.117 1.00 163.89 ?  172  ARG C CB    1 
ATOM   3659 N  N     . LYS C 1 175 ? -6.477  95.891  223.762 1.00 101.33 ?  173  LYS C N     1 
ATOM   3660 C  CA    . LYS C 1 175 ? -5.731  96.305  222.582 1.00 97.78  ?  173  LYS C CA    1 
ATOM   3661 C  C     . LYS C 1 175 ? -6.099  95.456  221.375 1.00 98.10  ?  173  LYS C C     1 
ATOM   3662 O  O     . LYS C 1 175 ? -5.878  95.877  220.233 1.00 78.72  ?  173  LYS C O     1 
ATOM   3663 C  CB    . LYS C 1 175 ? -4.227  96.232  222.848 1.00 88.44  ?  173  LYS C CB    1 
ATOM   3664 N  N     . THR C 1 176 ? -6.660  94.263  221.602 1.00 107.16 ?  174  THR C N     1 
ATOM   3665 C  CA    . THR C 1 176 ? -7.088  93.442  220.467 1.00 113.13 ?  174  THR C CA    1 
ATOM   3666 C  C     . THR C 1 176 ? -8.204  94.085  219.639 1.00 137.18 ?  174  THR C C     1 
ATOM   3667 O  O     . THR C 1 176 ? -8.053  94.158  218.407 1.00 130.66 ?  174  THR C O     1 
ATOM   3668 C  CB    . THR C 1 176 ? -7.462  92.037  220.958 1.00 98.68  ?  174  THR C CB    1 
ATOM   3669 O  OG1   . THR C 1 176 ? -6.277  91.234  221.050 1.00 89.79  ?  174  THR C OG1   1 
ATOM   3670 C  CG2   . THR C 1 176 ? -8.452  91.367  220.013 1.00 98.53  ?  174  THR C CG2   1 
ATOM   3671 N  N     . PRO C 1 177 ? -9.330  94.567  220.213 1.00 156.69 ?  175  PRO C N     1 
ATOM   3672 C  CA    . PRO C 1 177 ? -10.265 95.252  219.315 1.00 156.06 ?  175  PRO C CA    1 
ATOM   3673 C  C     . PRO C 1 177 ? -10.010 96.755  219.245 1.00 153.39 ?  175  PRO C C     1 
ATOM   3674 O  O     . PRO C 1 177 ? -8.849  97.165  219.217 1.00 147.40 ?  175  PRO C O     1 
ATOM   3675 C  CB    . PRO C 1 177 ? -11.640 94.964  219.948 1.00 155.00 ?  175  PRO C CB    1 
ATOM   3676 C  CG    . PRO C 1 177 ? -11.375 94.011  221.099 1.00 151.11 ?  175  PRO C CG    1 
ATOM   3677 C  CD    . PRO C 1 177 ? -9.978  94.316  221.504 1.00 152.36 ?  175  PRO C CD    1 
HETATM 3678 MG MG    . MG  D 3 .   ? -9.748  58.268  194.949 1.00 62.05  ?  201  MG  A MG    1 
HETATM 3679 P  PG    . GNP E 4 .   ? -10.959 59.340  192.163 1.00 59.34  ?  202  GNP A PG    1 
HETATM 3680 O  O1G   . GNP E 4 .   ? -12.216 59.150  191.346 1.00 53.78  ?  202  GNP A O1G   1 
HETATM 3681 O  O2G   . GNP E 4 .   ? -10.571 60.775  192.432 1.00 53.67  ?  202  GNP A O2G   1 
HETATM 3682 O  O3G   . GNP E 4 .   ? -10.972 58.674  193.514 1.00 64.39  ?  202  GNP A O3G   1 
HETATM 3683 N  N3B   . GNP E 4 .   ? -9.800  58.634  191.343 1.00 63.94  ?  202  GNP A N3B   1 
HETATM 3684 P  PB    . GNP E 4 .   ? -8.269  58.702  191.754 1.00 57.50  ?  202  GNP A PB    1 
HETATM 3685 O  O1B   . GNP E 4 .   ? -7.692  60.003  191.346 1.00 51.74  ?  202  GNP A O1B   1 
HETATM 3686 O  O2B   . GNP E 4 .   ? -8.151  58.350  193.188 1.00 54.16  ?  202  GNP A O2B   1 
HETATM 3687 O  O3A   . GNP E 4 .   ? -7.569  57.619  190.927 1.00 69.12  ?  202  GNP A O3A   1 
HETATM 3688 P  PA    . GNP E 4 .   ? -7.467  56.180  191.422 1.00 66.73  ?  202  GNP A PA    1 
HETATM 3689 O  O1A   . GNP E 4 .   ? -8.735  55.774  192.071 1.00 82.81  ?  202  GNP A O1A   1 
HETATM 3690 O  O2A   . GNP E 4 .   ? -6.229  56.078  192.227 1.00 62.75  ?  202  GNP A O2A   1 
HETATM 3691 O  "O5'" . GNP E 4 .   ? -7.274  55.183  190.215 1.00 59.07  ?  202  GNP A "O5'" 1 
HETATM 3692 C  "C5'" . GNP E 4 .   ? -6.794  55.585  188.939 1.00 80.72  ?  202  GNP A "C5'" 1 
HETATM 3693 C  "C4'" . GNP E 4 .   ? -6.798  54.367  188.029 1.00 74.21  ?  202  GNP A "C4'" 1 
HETATM 3694 O  "O4'" . GNP E 4 .   ? -5.580  54.304  187.243 1.00 69.39  ?  202  GNP A "O4'" 1 
HETATM 3695 C  "C3'" . GNP E 4 .   ? -6.880  53.050  188.788 1.00 76.63  ?  202  GNP A "C3'" 1 
HETATM 3696 O  "O3'" . GNP E 4 .   ? -7.704  52.134  188.083 1.00 87.77  ?  202  GNP A "O3'" 1 
HETATM 3697 C  "C2'" . GNP E 4 .   ? -5.433  52.568  188.864 1.00 88.46  ?  202  GNP A "C2'" 1 
HETATM 3698 O  "O2'" . GNP E 4 .   ? -5.344  51.160  188.761 1.00 107.85 ?  202  GNP A "O2'" 1 
HETATM 3699 C  "C1'" . GNP E 4 .   ? -4.748  53.240  187.674 1.00 77.44  ?  202  GNP A "C1'" 1 
HETATM 3700 N  N9    . GNP E 4 .   ? -3.443  53.799  188.026 1.00 80.22  ?  202  GNP A N9    1 
HETATM 3701 C  C8    . GNP E 4 .   ? -3.180  54.576  189.131 1.00 80.19  ?  202  GNP A C8    1 
HETATM 3702 N  N7    . GNP E 4 .   ? -1.936  54.954  189.224 1.00 78.66  ?  202  GNP A N7    1 
HETATM 3703 C  C5    . GNP E 4 .   ? -1.326  54.394  188.106 1.00 73.45  ?  202  GNP A C5    1 
HETATM 3704 C  C6    . GNP E 4 .   ? 0.024   54.464  187.681 1.00 76.60  ?  202  GNP A C6    1 
HETATM 3705 O  O6    . GNP E 4 .   ? 0.976   55.054  188.212 1.00 87.13  ?  202  GNP A O6    1 
HETATM 3706 N  N1    . GNP E 4 .   ? 0.229   53.764  186.497 1.00 87.32  ?  202  GNP A N1    1 
HETATM 3707 C  C2    . GNP E 4 .   ? -0.743  53.076  185.814 1.00 84.56  ?  202  GNP A C2    1 
HETATM 3708 N  N2    . GNP E 4 .   ? -0.335  52.463  184.692 1.00 80.83  ?  202  GNP A N2    1 
HETATM 3709 N  N3    . GNP E 4 .   ? -2.013  52.999  186.202 1.00 81.12  ?  202  GNP A N3    1 
HETATM 3710 C  C4    . GNP E 4 .   ? -2.237  53.679  187.356 1.00 76.44  ?  202  GNP A C4    1 
HETATM 3711 MG MG    . MG  F 3 .   ? 13.936  83.607  240.066 1.00 93.49  ?  201  MG  C MG    1 
HETATM 3712 P  PG    . GNP G 4 .   ? 16.136  86.005  240.390 1.00 93.84  ?  202  GNP C PG    1 
HETATM 3713 O  O1G   . GNP G 4 .   ? 16.158  87.210  239.484 1.00 85.29  ?  202  GNP C O1G   1 
HETATM 3714 O  O2G   . GNP G 4 .   ? 15.429  84.788  239.853 1.00 91.75  ?  202  GNP C O2G   1 
HETATM 3715 O  O3G   . GNP G 4 .   ? 17.499  85.489  240.790 1.00 104.84 ?  202  GNP C O3G   1 
HETATM 3716 N  N3B   . GNP G 4 .   ? 15.436  86.461  241.743 1.00 100.99 ?  202  GNP C N3B   1 
HETATM 3717 P  PB    . GNP G 4 .   ? 13.866  86.600  241.971 1.00 94.07  ?  202  GNP C PB    1 
HETATM 3718 O  O1B   . GNP G 4 .   ? 13.182  85.646  241.064 1.00 95.15  ?  202  GNP C O1B   1 
HETATM 3719 O  O2B   . GNP G 4 .   ? 13.474  88.018  241.829 1.00 74.83  ?  202  GNP C O2B   1 
HETATM 3720 O  O3A   . GNP G 4 .   ? 13.608  86.227  243.444 1.00 90.13  ?  202  GNP C O3A   1 
HETATM 3721 P  PA    . GNP G 4 .   ? 12.633  85.167  243.971 1.00 90.83  ?  202  GNP C PA    1 
HETATM 3722 O  O1A   . GNP G 4 .   ? 11.393  85.250  243.177 1.00 97.05  ?  202  GNP C O1A   1 
HETATM 3723 O  O2A   . GNP G 4 .   ? 13.280  83.837  244.034 1.00 89.98  ?  202  GNP C O2A   1 
HETATM 3724 O  "O5'" . GNP G 4 .   ? 12.228  85.536  245.465 1.00 100.34 ?  202  GNP C "O5'" 1 
HETATM 3725 C  "C5'" . GNP G 4 .   ? 13.069  86.338  246.318 1.00 102.45 ?  202  GNP C "C5'" 1 
HETATM 3726 C  "C4'" . GNP G 4 .   ? 12.957  85.990  247.803 1.00 90.85  ?  202  GNP C "C4'" 1 
HETATM 3727 O  "O4'" . GNP G 4 .   ? 11.820  86.639  248.434 1.00 91.92  ?  202  GNP C "O4'" 1 
HETATM 3728 C  "C3'" . GNP G 4 .   ? 12.831  84.510  248.140 1.00 84.64  ?  202  GNP C "C3'" 1 
HETATM 3729 O  "O3'" . GNP G 4 .   ? 13.699  84.206  249.213 1.00 96.79  ?  202  GNP C "O3'" 1 
HETATM 3730 C  "C2'" . GNP G 4 .   ? 11.372  84.338  248.559 1.00 83.46  ?  202  GNP C "C2'" 1 
HETATM 3731 O  "O2'" . GNP G 4 .   ? 11.212  83.330  249.537 1.00 78.45  ?  202  GNP C "O2'" 1 
HETATM 3732 C  "C1'" . GNP G 4 .   ? 11.003  85.707  249.119 1.00 87.49  ?  202  GNP C "C1'" 1 
HETATM 3733 N  N9    . GNP G 4 .   ? 9.619   86.060  248.819 1.00 98.61  ?  202  GNP C N9    1 
HETATM 3734 C  C8    . GNP G 4 .   ? 9.088   86.066  247.554 1.00 109.15 ?  202  GNP C C8    1 
HETATM 3735 N  N7    . GNP G 4 .   ? 7.836   86.416  247.509 1.00 115.41 ?  202  GNP C N7    1 
HETATM 3736 C  C5    . GNP G 4 .   ? 7.508   86.666  248.834 1.00 116.26 ?  202  GNP C C5    1 
HETATM 3737 C  C6    . GNP G 4 .   ? 6.269   87.077  249.385 1.00 113.48 ?  202  GNP C C6    1 
HETATM 3738 O  O6    . GNP G 4 .   ? 5.209   87.312  248.790 1.00 117.52 ?  202  GNP C O6    1 
HETATM 3739 N  N1    . GNP G 4 .   ? 6.339   87.226  250.767 1.00 116.26 ?  202  GNP C N1    1 
HETATM 3740 C  C2    . GNP G 4 .   ? 7.466   86.995  251.518 1.00 117.49 ?  202  GNP C C2    1 
HETATM 3741 N  N2    . GNP G 4 .   ? 7.333   87.189  252.840 1.00 111.80 ?  202  GNP C N2    1 
HETATM 3742 N  N3    . GNP G 4 .   ? 8.636   86.602  251.013 1.00 119.35 ?  202  GNP C N3    1 
HETATM 3743 C  C4    . GNP G 4 .   ? 8.590   86.450  249.663 1.00 109.14 ?  202  GNP C C4    1 
HETATM 3744 O  O     . HOH H 5 .   ? -10.008 56.423  193.941 1.00 43.34  ?  301  HOH A O     1 
HETATM 3745 O  O     . HOH H 5 .   ? -8.803  59.962  194.827 1.00 65.78  ?  302  HOH A O     1 
HETATM 3746 O  O     . HOH I 5 .   ? 14.714  82.816  242.177 1.00 86.54  ?  301  HOH C O     1 
HETATM 3747 O  O     . HOH I 5 .   ? 13.273  84.901  238.677 1.00 88.18  ?  302  HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . THR A 7   ? 0.5376 0.6080 0.6901 0.0273  -0.0717 0.0146  5    THR A N     
2    C  CA    . THR A 7   ? 0.6228 0.6960 0.7606 0.0301  -0.0673 0.0110  5    THR A CA    
3    C  C     . THR A 7   ? 0.7547 0.8216 0.8870 0.0285  -0.0672 -0.0014 5    THR A C     
4    O  O     . THR A 7   ? 0.8421 0.9040 0.9798 0.0267  -0.0704 -0.0073 5    THR A O     
5    C  CB    . THR A 7   ? 0.6671 0.7447 0.7939 0.0348  -0.0664 0.0133  5    THR A CB    
6    O  OG1   . THR A 7   ? 0.8490 0.9236 0.9764 0.0343  -0.0701 0.0074  5    THR A OG1   
7    C  CG2   . THR A 7   ? 0.5693 0.6544 0.7007 0.0374  -0.0655 0.0266  5    THR A CG2   
8    N  N     . TYR A 8   ? 0.7784 0.8458 0.8999 0.0298  -0.0632 -0.0044 6    TYR A N     
9    C  CA    . TYR A 8   ? 0.6810 0.7431 0.7970 0.0285  -0.0622 -0.0147 6    TYR A CA    
10   C  C     . TYR A 8   ? 0.6634 0.7255 0.7631 0.0315  -0.0587 -0.0172 6    TYR A C     
11   O  O     . TYR A 8   ? 0.6786 0.7447 0.7708 0.0352  -0.0561 -0.0109 6    TYR A O     
12   C  CB    . TYR A 8   ? 0.5498 0.6102 0.6718 0.0261  -0.0612 -0.0159 6    TYR A CB    
13   C  CG    . TYR A 8   ? 0.5903 0.6561 0.7101 0.0275  -0.0575 -0.0084 6    TYR A CG    
14   C  CD1   . TYR A 8   ? 0.6613 0.7323 0.7917 0.0265  -0.0586 0.0019  6    TYR A CD1   
15   C  CD2   . TYR A 8   ? 0.4304 0.4965 0.5381 0.0300  -0.0526 -0.0110 6    TYR A CD2   
16   C  CE1   . TYR A 8   ? 0.6720 0.7502 0.8019 0.0280  -0.0549 0.0101  6    TYR A CE1   
17   C  CE2   . TYR A 8   ? 0.5427 0.6149 0.6483 0.0323  -0.0487 -0.0035 6    TYR A CE2   
18   C  CZ    . TYR A 8   ? 0.5976 0.6767 0.7147 0.0313  -0.0497 0.0074  6    TYR A CZ    
19   O  OH    . TYR A 8   ? 0.5526 0.6400 0.6692 0.0337  -0.0456 0.0163  6    TYR A OH    
20   N  N     . ASP A 9   ? 0.7311 0.7882 0.8250 0.0303  -0.0587 -0.0263 7    ASP A N     
21   C  CA    . ASP A 9   ? 0.8135 0.8678 0.8914 0.0327  -0.0566 -0.0299 7    ASP A CA    
22   C  C     . ASP A 9   ? 0.8862 0.9389 0.9567 0.0343  -0.0515 -0.0302 7    ASP A C     
23   O  O     . ASP A 9   ? 1.0114 1.0639 1.0687 0.0386  -0.0486 -0.0277 7    ASP A O     
24   C  CB    . ASP A 9   ? 0.8688 0.9186 0.9448 0.0300  -0.0593 -0.0384 7    ASP A CB    
25   C  CG    . ASP A 9   ? 0.9338 0.9861 1.0135 0.0295  -0.0641 -0.0376 7    ASP A CG    
26   O  OD1   . ASP A 9   ? 0.9832 1.0364 1.0534 0.0321  -0.0654 -0.0352 7    ASP A OD1   
27   O  OD2   . ASP A 9   ? 1.0996 1.1530 1.1908 0.0271  -0.0667 -0.0394 7    ASP A OD2   
28   N  N     . LEU A 10  ? 0.8657 0.9172 0.9433 0.0319  -0.0503 -0.0332 8    LEU A N     
29   C  CA    . LEU A 10  ? 0.6498 0.6999 0.7201 0.0335  -0.0454 -0.0343 8    LEU A CA    
30   C  C     . LEU A 10  ? 0.5187 0.5727 0.6003 0.0320  -0.0447 -0.0310 8    LEU A C     
31   O  O     . LEU A 10  ? 0.6180 0.6729 0.7125 0.0290  -0.0485 -0.0304 8    LEU A O     
32   C  CB    . LEU A 10  ? 0.6591 0.7022 0.7231 0.0322  -0.0446 -0.0434 8    LEU A CB    
33   C  CG    . LEU A 10  ? 0.7013 0.7392 0.7540 0.0325  -0.0464 -0.0474 8    LEU A CG    
34   C  CD1   . LEU A 10  ? 0.4689 0.5012 0.5211 0.0295  -0.0465 -0.0552 8    LEU A CD1   
35   C  CD2   . LEU A 10  ? 0.4913 0.5267 0.5272 0.0377  -0.0434 -0.0447 8    LEU A CD2   
36   N  N     . LEU A 11  ? 0.4400 0.4957 0.5161 0.0343  -0.0401 -0.0289 9    LEU A N     
37   C  CA    . LEU A 11  ? 0.4132 0.4734 0.4991 0.0328  -0.0397 -0.0253 9    LEU A CA    
38   C  C     . LEU A 11  ? 0.5694 0.6261 0.6500 0.0332  -0.0364 -0.0317 9    LEU A C     
39   O  O     . LEU A 11  ? 0.6360 0.6909 0.7037 0.0369  -0.0317 -0.0325 9    LEU A O     
40   C  CB    . LEU A 11  ? 0.4405 0.5094 0.5268 0.0356  -0.0369 -0.0143 9    LEU A CB    
41   C  CG    . LEU A 11  ? 0.4407 0.5157 0.5382 0.0335  -0.0372 -0.0093 9    LEU A CG    
42   C  CD1   . LEU A 11  ? 0.5953 0.6711 0.7096 0.0282  -0.0437 -0.0066 9    LEU A CD1   
43   C  CD2   . LEU A 11  ? 0.3409 0.4255 0.4354 0.0377  -0.0323 0.0013  9    LEU A CD2   
44   N  N     . PHE A 12  ? 0.5873 0.6425 0.6770 0.0302  -0.0390 -0.0360 10   PHE A N     
45   C  CA    . PHE A 12  ? 0.3690 0.4221 0.4552 0.0309  -0.0360 -0.0413 10   PHE A CA    
46   C  C     . PHE A 12  ? 0.5124 0.5712 0.6062 0.0302  -0.0365 -0.0369 10   PHE A C     
47   O  O     . PHE A 12  ? 0.5878 0.6485 0.6934 0.0271  -0.0416 -0.0341 10   PHE A O     
48   C  CB    . PHE A 12  ? 0.4697 0.5172 0.5590 0.0292  -0.0382 -0.0499 10   PHE A CB    
49   C  CG    . PHE A 12  ? 0.5800 0.6229 0.6632 0.0291  -0.0380 -0.0542 10   PHE A CG    
50   C  CD1   . PHE A 12  ? 0.4371 0.4788 0.5099 0.0308  -0.0360 -0.0522 10   PHE A CD1   
51   C  CD2   . PHE A 12  ? 0.6059 0.6459 0.6935 0.0278  -0.0400 -0.0601 10   PHE A CD2   
52   C  CE1   . PHE A 12  ? 0.5332 0.5702 0.6008 0.0300  -0.0372 -0.0563 10   PHE A CE1   
53   C  CE2   . PHE A 12  ? 0.4752 0.5125 0.5592 0.0270  -0.0404 -0.0631 10   PHE A CE2   
54   C  CZ    . PHE A 12  ? 0.4330 0.4684 0.5072 0.0275  -0.0395 -0.0614 10   PHE A CZ    
55   N  N     . LYS A 13  ? 0.7706 0.8314 0.8574 0.0330  -0.0315 -0.0365 11   LYS A N     
56   C  CA    . LYS A 13  ? 0.7616 0.8286 0.8550 0.0324  -0.0319 -0.0329 11   LYS A CA    
57   C  C     . LYS A 13  ? 0.7074 0.7700 0.8012 0.0319  -0.0327 -0.0413 11   LYS A C     
58   O  O     . LYS A 13  ? 0.6935 0.7520 0.7779 0.0346  -0.0282 -0.0467 11   LYS A O     
59   C  CB    . LYS A 13  ? 0.7453 0.8191 0.8315 0.0366  -0.0258 -0.0260 11   LYS A CB    
60   C  CG    . LYS A 13  ? 1.0622 1.1400 1.1446 0.0391  -0.0238 -0.0179 11   LYS A CG    
61   C  CD    . LYS A 13  ? 1.1295 1.2198 1.2207 0.0393  -0.0237 -0.0056 11   LYS A CD    
62   C  CE    . LYS A 13  ? 1.0794 1.1742 1.1619 0.0449  -0.0189 0.0026  11   LYS A CE    
63   N  NZ    . LYS A 13  ? 1.0739 1.1810 1.1690 0.0438  -0.0205 0.0157  11   LYS A NZ    
64   N  N     . LEU A 14  ? 0.6752 0.7382 0.7798 0.0288  -0.0387 -0.0422 12   LEU A N     
65   C  CA    . LEU A 14  ? 0.5788 0.6379 0.6839 0.0292  -0.0404 -0.0496 12   LEU A CA    
66   C  C     . LEU A 14  ? 0.5981 0.6631 0.7091 0.0281  -0.0432 -0.0460 12   LEU A C     
67   O  O     . LEU A 14  ? 0.6087 0.6800 0.7274 0.0254  -0.0458 -0.0377 12   LEU A O     
68   C  CB    . LEU A 14  ? 0.5730 0.6251 0.6837 0.0275  -0.0463 -0.0553 12   LEU A CB    
69   C  CG    . LEU A 14  ? 0.5032 0.5508 0.6100 0.0282  -0.0446 -0.0586 12   LEU A CG    
70   C  CD1   . LEU A 14  ? 0.4254 0.4672 0.5383 0.0275  -0.0502 -0.0633 12   LEU A CD1   
71   C  CD2   . LEU A 14  ? 0.4814 0.5276 0.5784 0.0313  -0.0382 -0.0632 12   LEU A CD2   
72   N  N     . LEU A 15  ? 0.5498 0.6134 0.6576 0.0301  -0.0427 -0.0518 13   LEU A N     
73   C  CA    . LEU A 15  ? 0.6100 0.6800 0.7217 0.0296  -0.0448 -0.0488 13   LEU A CA    
74   C  C     . LEU A 15  ? 0.5837 0.6485 0.6941 0.0311  -0.0483 -0.0574 13   LEU A C     
75   O  O     . LEU A 15  ? 0.5709 0.6308 0.6734 0.0350  -0.0442 -0.0642 13   LEU A O     
76   C  CB    . LEU A 15  ? 0.4044 0.4822 0.5088 0.0332  -0.0368 -0.0439 13   LEU A CB    
77   C  CG    . LEU A 15  ? 0.5217 0.6087 0.6294 0.0335  -0.0376 -0.0394 13   LEU A CG    
78   C  CD1   . LEU A 15  ? 0.5262 0.6225 0.6448 0.0296  -0.0410 -0.0284 13   LEU A CD1   
79   C  CD2   . LEU A 15  ? 0.7111 0.8019 0.8077 0.0393  -0.0284 -0.0386 13   LEU A CD2   
80   N  N     . LEU A 16  ? 0.3861 0.4517 0.5038 0.0283  -0.0562 -0.0569 14   LEU A N     
81   C  CA    . LEU A 16  ? 0.4867 0.5469 0.6016 0.0307  -0.0604 -0.0653 14   LEU A CA    
82   C  C     . LEU A 16  ? 0.4730 0.5414 0.5875 0.0315  -0.0605 -0.0629 14   LEU A C     
83   O  O     . LEU A 16  ? 0.3419 0.4174 0.4652 0.0271  -0.0649 -0.0553 14   LEU A O     
84   C  CB    . LEU A 16  ? 0.3937 0.4449 0.5155 0.0274  -0.0711 -0.0687 14   LEU A CB    
85   C  CG    . LEU A 16  ? 0.5593 0.6047 0.6856 0.0250  -0.0728 -0.0677 14   LEU A CG    
86   C  CD1   . LEU A 16  ? 0.5923 0.6291 0.7265 0.0211  -0.0843 -0.0691 14   LEU A CD1   
87   C  CD2   . LEU A 16  ? 0.4551 0.4951 0.5733 0.0298  -0.0672 -0.0742 14   LEU A CD2   
88   N  N     . ILE A 17  ? 0.5573 0.6254 0.6623 0.0373  -0.0558 -0.0686 15   ILE A N     
89   C  CA    . ILE A 17  ? 0.6085 0.6845 0.7118 0.0392  -0.0556 -0.0671 15   ILE A CA    
90   C  C     . ILE A 17  ? 0.5802 0.6499 0.6776 0.0435  -0.0595 -0.0766 15   ILE A C     
91   O  O     . ILE A 17  ? 0.5916 0.6522 0.6843 0.0466  -0.0592 -0.0838 15   ILE A O     
92   C  CB    . ILE A 17  ? 0.5207 0.6044 0.6165 0.0435  -0.0441 -0.0630 15   ILE A CB    
93   C  CG1   . ILE A 17  ? 0.4735 0.5507 0.5584 0.0493  -0.0366 -0.0699 15   ILE A CG1   
94   C  CG2   . ILE A 17  ? 0.4383 0.5266 0.5371 0.0410  -0.0399 -0.0543 15   ILE A CG2   
95   C  CD1   . ILE A 17  ? 0.4832 0.5648 0.5601 0.0533  -0.0258 -0.0663 15   ILE A CD1   
96   N  N     . GLY A 18  ? 0.3611 0.4365 0.4586 0.0442  -0.0633 -0.0763 16   GLY A N     
97   C  CA    . GLY A 18  ? 0.4407 0.5103 0.5323 0.0484  -0.0688 -0.0850 16   GLY A CA    
98   C  C     . GLY A 18  ? 0.6255 0.6992 0.7232 0.0444  -0.0795 -0.0831 16   GLY A C     
99   O  O     . GLY A 18  ? 0.5803 0.6595 0.6896 0.0371  -0.0841 -0.0750 16   GLY A O     
100  N  N     . ASP A 19  ? 0.5560 0.6275 0.6465 0.0492  -0.0838 -0.0899 17   ASP A N     
101  C  CA    . ASP A 19  ? 0.5310 0.6079 0.6268 0.0455  -0.0940 -0.0879 17   ASP A CA    
102  C  C     . ASP A 19  ? 0.5902 0.6579 0.6957 0.0375  -0.1085 -0.0886 17   ASP A C     
103  O  O     . ASP A 19  ? 0.6188 0.6736 0.7237 0.0371  -0.1113 -0.0935 17   ASP A O     
104  C  CB    . ASP A 19  ? 0.7094 0.7852 0.7933 0.0534  -0.0955 -0.0959 17   ASP A CB    
105  C  CG    . ASP A 19  ? 0.9219 1.0050 0.9958 0.0618  -0.0811 -0.0954 17   ASP A CG    
106  O  OD1   . ASP A 19  ? 1.1208 1.2081 1.1964 0.0613  -0.0707 -0.0897 17   ASP A OD1   
107  O  OD2   . ASP A 19  ? 0.9304 1.0145 0.9944 0.0692  -0.0805 -0.1006 17   ASP A OD2   
108  N  N     . SER A 20  ? 0.6725 0.7475 0.7880 0.0309  -0.1178 -0.0830 18   SER A N     
109  C  CA    . SER A 20  ? 0.6233 0.6901 0.7498 0.0220  -0.1327 -0.0822 18   SER A CA    
110  C  C     . SER A 20  ? 0.8391 0.8869 0.9553 0.0258  -0.1428 -0.0957 18   SER A C     
111  O  O     . SER A 20  ? 1.0244 1.0708 1.1309 0.0311  -0.1468 -0.1026 18   SER A O     
112  C  CB    . SER A 20  ? 0.6749 0.7549 0.8142 0.0145  -0.1410 -0.0733 18   SER A CB    
113  O  OG    . SER A 20  ? 0.7119 0.7829 0.8624 0.0052  -0.1568 -0.0727 18   SER A OG    
114  N  N     . GLY A 21  ? 0.8970 0.9300 1.0143 0.0242  -0.1467 -0.0995 19   GLY A N     
115  C  CA    . GLY A 21  ? 0.8922 0.9054 0.9999 0.0279  -0.1572 -0.1116 19   GLY A CA    
116  C  C     . GLY A 21  ? 0.8788 0.8813 0.9737 0.0375  -0.1494 -0.1199 19   GLY A C     
117  O  O     . GLY A 21  ? 1.1094 1.0944 1.1963 0.0413  -0.1578 -0.1293 19   GLY A O     
118  N  N     . VAL A 22  ? 0.4825 0.4944 0.5751 0.0417  -0.1341 -0.1166 20   VAL A N     
119  C  CA    . VAL A 22  ? 0.4545 0.4583 0.5357 0.0510  -0.1267 -0.1238 20   VAL A CA    
120  C  C     . VAL A 22  ? 0.4463 0.4399 0.5331 0.0479  -0.1285 -0.1234 20   VAL A C     
121  O  O     . VAL A 22  ? 0.4794 0.4646 0.5577 0.0554  -0.1248 -0.1296 20   VAL A O     
122  C  CB    . VAL A 22  ? 0.4129 0.4295 0.4894 0.0566  -0.1106 -0.1208 20   VAL A CB    
123  C  CG1   . VAL A 22  ? 0.4067 0.4350 0.4796 0.0589  -0.1081 -0.1192 20   VAL A CG1   
124  C  CG2   . VAL A 22  ? 0.6297 0.6542 0.7164 0.0505  -0.1026 -0.1115 20   VAL A CG2   
125  N  N     . GLY A 23  ? 0.3815 0.3764 0.4825 0.0376  -0.1336 -0.1155 21   GLY A N     
126  C  CA    . GLY A 23  ? 0.6165 0.6002 0.7227 0.0346  -0.1373 -0.1153 21   GLY A CA    
127  C  C     . GLY A 23  ? 0.6155 0.6080 0.7315 0.0298  -0.1288 -0.1059 21   GLY A C     
128  O  O     . GLY A 23  ? 0.5871 0.5712 0.7055 0.0292  -0.1296 -0.1061 21   GLY A O     
129  N  N     . LYS A 24  ? 0.6670 0.6758 0.7880 0.0269  -0.1210 -0.0974 22   LYS A N     
130  C  CA    . LYS A 24  ? 0.7204 0.7374 0.8472 0.0242  -0.1119 -0.0893 22   LYS A CA    
131  C  C     . LYS A 24  ? 0.5395 0.5518 0.6787 0.0166  -0.1187 -0.0833 22   LYS A C     
132  O  O     . LYS A 24  ? 0.6211 0.6294 0.7608 0.0174  -0.1152 -0.0829 22   LYS A O     
133  C  CB    . LYS A 24  ? 0.6364 0.6703 0.7657 0.0227  -0.1040 -0.0810 22   LYS A CB    
134  C  CG    . LYS A 24  ? 0.5762 0.6151 0.6940 0.0301  -0.0969 -0.0858 22   LYS A CG    
135  C  CD    . LYS A 24  ? 0.5475 0.6019 0.6667 0.0295  -0.0879 -0.0772 22   LYS A CD    
136  C  CE    . LYS A 24  ? 0.5958 0.6593 0.7259 0.0230  -0.0946 -0.0689 22   LYS A CE    
137  N  NZ    . LYS A 24  ? 0.6324 0.6952 0.7597 0.0242  -0.1022 -0.0738 22   LYS A NZ    
138  N  N     . THR A 25  ? 0.4842 0.4976 0.6341 0.0091  -0.1286 -0.0778 23   THR A N     
139  C  CA    . THR A 25  ? 0.5348 0.5435 0.6978 0.0014  -0.1359 -0.0711 23   THR A CA    
140  C  C     . THR A 25  ? 0.6828 0.6730 0.8416 0.0040  -0.1412 -0.0791 23   THR A C     
141  O  O     . THR A 25  ? 0.6755 0.6627 0.8414 0.0009  -0.1414 -0.0742 23   THR A O     
142  C  CB    . THR A 25  ? 0.5122 0.5225 0.6870 -0.0071 -0.1479 -0.0657 23   THR A CB    
143  O  OG1   . THR A 25  ? 0.6328 0.6614 0.8106 -0.0081 -0.1426 -0.0585 23   THR A OG1   
144  C  CG2   . THR A 25  ? 0.5193 0.5279 0.7102 -0.0158 -0.1542 -0.0558 23   THR A CG2   
145  N  N     . CYS A 26  ? 0.7182 0.6961 0.8648 0.0106  -0.1451 -0.0910 24   CYS A N     
146  C  CA    . CYS A 26  ? 0.8030 0.7624 0.9439 0.0146  -0.1507 -0.0990 24   CYS A CA    
147  C  C     . CYS A 26  ? 0.7977 0.7577 0.9303 0.0227  -0.1395 -0.1025 24   CYS A C     
148  O  O     . CYS A 26  ? 0.9379 0.8873 1.0708 0.0242  -0.1416 -0.1043 24   CYS A O     
149  C  CB    . CYS A 26  ? 0.8873 0.8324 1.0177 0.0191  -0.1606 -0.1101 24   CYS A CB    
150  S  SG    . CYS A 26  ? 0.9454 0.8793 1.0864 0.0085  -0.1796 -0.1081 24   CYS A SG    
151  N  N     . VAL A 27  ? 0.6052 0.5771 0.7310 0.0278  -0.1282 -0.1033 25   VAL A N     
152  C  CA    . VAL A 27  ? 0.6599 0.6358 0.7818 0.0328  -0.1175 -0.1035 25   VAL A CA    
153  C  C     . VAL A 27  ? 0.6175 0.5987 0.7502 0.0264  -0.1151 -0.0941 25   VAL A C     
154  O  O     . VAL A 27  ? 0.6274 0.6033 0.7608 0.0280  -0.1142 -0.0945 25   VAL A O     
155  C  CB    . VAL A 27  ? 0.5663 0.5543 0.6808 0.0376  -0.1063 -0.1043 25   VAL A CB    
156  C  CG1   . VAL A 27  ? 0.4241 0.4181 0.5380 0.0397  -0.0959 -0.1018 25   VAL A CG1   
157  C  CG2   . VAL A 27  ? 0.5672 0.5496 0.6695 0.0462  -0.1070 -0.1139 25   VAL A CG2   
158  N  N     . LEU A 28  ? 0.4326 0.4248 0.5737 0.0196  -0.1142 -0.0851 26   LEU A N     
159  C  CA    . LEU A 28  ? 0.6128 0.6113 0.7633 0.0145  -0.1115 -0.0754 26   LEU A CA    
160  C  C     . LEU A 28  ? 0.7859 0.7732 0.9449 0.0102  -0.1210 -0.0734 26   LEU A C     
161  O  O     . LEU A 28  ? 0.9025 0.8899 1.0655 0.0094  -0.1187 -0.0692 26   LEU A O     
162  C  CB    . LEU A 28  ? 0.4448 0.4578 0.6021 0.0093  -0.1087 -0.0655 26   LEU A CB    
163  C  CG    . LEU A 28  ? 0.5997 0.6200 0.7655 0.0053  -0.1054 -0.0548 26   LEU A CG    
164  C  CD1   . LEU A 28  ? 0.6007 0.6223 0.7591 0.0101  -0.0964 -0.0569 26   LEU A CD1   
165  C  CD2   . LEU A 28  ? 0.6720 0.7073 0.8437 0.0017  -0.1022 -0.0442 26   LEU A CD2   
166  N  N     . PHE A 29  ? 0.7765 0.7535 0.9384 0.0074  -0.1323 -0.0762 27   PHE A N     
167  C  CA    . PHE A 29  ? 0.8349 0.7994 1.0052 0.0028  -0.1421 -0.0739 27   PHE A CA    
168  C  C     . PHE A 29  ? 0.9204 0.8710 1.0826 0.0098  -0.1423 -0.0820 27   PHE A C     
169  O  O     . PHE A 29  ? 0.6956 0.6411 0.8638 0.0080  -0.1440 -0.0780 27   PHE A O     
170  C  CB    . PHE A 29  ? 0.9648 0.9203 1.1399 -0.0026 -0.1553 -0.0751 27   PHE A CB    
171  C  CG    . PHE A 29  ? 0.9387 0.8881 1.1286 -0.0113 -0.1647 -0.0667 27   PHE A CG    
172  C  CD1   . PHE A 29  ? 1.0650 1.0294 1.2695 -0.0191 -0.1628 -0.0526 27   PHE A CD1   
173  C  CD2   . PHE A 29  ? 0.8912 0.8194 1.0802 -0.0113 -0.1754 -0.0722 27   PHE A CD2   
174  C  CE1   . PHE A 29  ? 1.0811 1.0411 1.3007 -0.0273 -0.1711 -0.0435 27   PHE A CE1   
175  C  CE2   . PHE A 29  ? 0.9488 0.8706 1.1522 -0.0198 -0.1843 -0.0638 27   PHE A CE2   
176  C  CZ    . PHE A 29  ? 1.0286 0.9669 1.2480 -0.0282 -0.1820 -0.0490 27   PHE A CZ    
177  N  N     . ARG A 30  ? 1.0782 1.0233 1.2269 0.0183  -0.1403 -0.0927 28   ARG A N     
178  C  CA    . ARG A 30  ? 1.0233 0.9592 1.1639 0.0265  -0.1379 -0.0992 28   ARG A CA    
179  C  C     . ARG A 30  ? 0.9610 0.9079 1.1050 0.0269  -0.1280 -0.0934 28   ARG A C     
180  O  O     . ARG A 30  ? 0.9414 0.8819 1.0874 0.0284  -0.1289 -0.0925 28   ARG A O     
181  C  CB    . ARG A 30  ? 0.9232 0.8567 1.0494 0.0364  -0.1346 -0.1096 28   ARG A CB    
182  C  CG    . ARG A 30  ? 0.8683 0.8018 0.9875 0.0452  -0.1269 -0.1132 28   ARG A CG    
183  C  CD    . ARG A 30  ? 0.9429 0.8594 1.0606 0.0488  -0.1339 -0.1166 28   ARG A CD    
184  N  NE    . ARG A 30  ? 1.0486 0.9497 1.1543 0.0564  -0.1409 -0.1267 28   ARG A NE    
185  C  CZ    . ARG A 30  ? 1.0086 0.8899 1.1120 0.0573  -0.1519 -0.1307 28   ARG A CZ    
186  N  NH1   . ARG A 30  ? 1.0501 0.9255 1.1642 0.0506  -0.1569 -0.1246 28   ARG A NH1   
187  N  NH2   . ARG A 30  ? 0.8526 0.7194 0.9426 0.0654  -0.1580 -0.1407 28   ARG A NH2   
188  N  N     . PHE A 31  ? 0.9316 0.8944 1.0755 0.0259  -0.1187 -0.0894 29   PHE A N     
189  C  CA    . PHE A 31  ? 0.7685 0.7408 0.9138 0.0265  -0.1100 -0.0849 29   PHE A CA    
190  C  C     . PHE A 31  ? 0.6382 0.6120 0.7946 0.0201  -0.1126 -0.0754 29   PHE A C     
191  O  O     . PHE A 31  ? 0.6727 0.6458 0.8304 0.0217  -0.1106 -0.0737 29   PHE A O     
192  C  CB    . PHE A 31  ? 0.8255 0.8120 0.9670 0.0269  -0.1006 -0.0831 29   PHE A CB    
193  C  CG    . PHE A 31  ? 0.7871 0.7821 0.9286 0.0273  -0.0926 -0.0792 29   PHE A CG    
194  C  CD1   . PHE A 31  ? 0.8017 0.7942 0.9398 0.0324  -0.0899 -0.0831 29   PHE A CD1   
195  C  CD2   . PHE A 31  ? 0.7167 0.7224 0.8613 0.0230  -0.0881 -0.0715 29   PHE A CD2   
196  C  CE1   . PHE A 31  ? 0.8492 0.8494 0.9877 0.0321  -0.0838 -0.0796 29   PHE A CE1   
197  C  CE2   . PHE A 31  ? 0.6400 0.6520 0.7831 0.0236  -0.0819 -0.0686 29   PHE A CE2   
198  C  CZ    . PHE A 31  ? 0.6434 0.6526 0.7838 0.0276  -0.0802 -0.0728 29   PHE A CZ    
199  N  N     . SER A 32  ? 0.7288 0.7058 0.8938 0.0130  -0.1170 -0.0685 30   SER A N     
200  C  CA    . SER A 32  ? 0.6508 0.6320 0.8270 0.0071  -0.1184 -0.0576 30   SER A CA    
201  C  C     . SER A 32  ? 0.7566 0.7235 0.9390 0.0055  -0.1272 -0.0571 30   SER A C     
202  O  O     . SER A 32  ? 0.9670 0.9352 1.1541 0.0050  -0.1256 -0.0514 30   SER A O     
203  C  CB    . SER A 32  ? 0.7495 0.7404 0.9340 0.0004  -0.1198 -0.0489 30   SER A CB    
204  O  OG    . SER A 32  ? 1.0902 1.0759 1.2737 -0.0008 -0.1263 -0.0538 30   SER A OG    
205  N  N     . ASP A 33  ? 0.8712 0.8239 1.0532 0.0048  -0.1369 -0.0627 31   ASP A N     
206  C  CA    . ASP A 33  ? 0.8831 0.8201 1.0712 0.0025  -0.1466 -0.0616 31   ASP A CA    
207  C  C     . ASP A 33  ? 0.9177 0.8359 1.0950 0.0098  -0.1518 -0.0737 31   ASP A C     
208  O  O     . ASP A 33  ? 0.7775 0.6789 0.9578 0.0083  -0.1616 -0.0745 31   ASP A O     
209  C  CB    . ASP A 33  ? 0.8414 0.7761 1.0419 -0.0071 -0.1564 -0.0546 31   ASP A CB    
210  C  CG    . ASP A 33  ? 1.0232 0.9774 1.2352 -0.0136 -0.1512 -0.0410 31   ASP A CG    
211  O  OD1   . ASP A 33  ? 1.2413 1.2095 1.4504 -0.0107 -0.1405 -0.0375 31   ASP A OD1   
212  O  OD2   . ASP A 33  ? 0.8363 0.7918 1.0605 -0.0217 -0.1585 -0.0332 31   ASP A OD2   
213  N  N     . ASP A 34  ? 1.1465 1.0665 1.3110 0.0182  -0.1456 -0.0827 32   ASP A N     
214  C  CA    . ASP A 34  ? 1.2529 1.1575 1.4055 0.0276  -0.1484 -0.0936 32   ASP A CA    
215  C  C     . ASP A 34  ? 1.3395 1.2241 1.4901 0.0263  -0.1618 -0.0990 32   ASP A C     
216  O  O     . ASP A 34  ? 1.3240 1.1905 1.4719 0.0295  -0.1687 -0.1025 32   ASP A O     
217  C  CB    . ASP A 34  ? 1.1856 1.0867 1.3380 0.0326  -0.1453 -0.0925 32   ASP A CB    
218  C  CG    . ASP A 34  ? 1.1366 1.0249 1.2759 0.0441  -0.1459 -0.1029 32   ASP A CG    
219  O  OD1   . ASP A 34  ? 1.0594 0.9516 1.1887 0.0503  -0.1416 -0.1096 32   ASP A OD1   
220  O  OD2   . ASP A 34  ? 1.2873 1.1620 1.4260 0.0477  -0.1504 -0.1038 32   ASP A OD2   
221  N  N     . ALA A 35  ? 1.3689 1.2565 1.5203 0.0216  -0.1658 -0.0998 33   ALA A N     
222  C  CA    . ALA A 35  ? 1.3904 1.2601 1.5403 0.0190  -0.1797 -0.1048 33   ALA A CA    
223  C  C     . ALA A 35  ? 1.4275 1.3032 1.5707 0.0198  -0.1801 -0.1100 33   ALA A C     
224  O  O     . ALA A 35  ? 1.4671 1.3599 1.6071 0.0226  -0.1692 -0.1093 33   ALA A O     
225  C  CB    . ALA A 35  ? 1.3465 1.2130 1.5134 0.0068  -0.1888 -0.0945 33   ALA A CB    
226  N  N     . PHE A 36  ? 1.3171 1.1777 1.4578 0.0174  -0.1932 -0.1152 34   PHE A N     
227  C  CA    . PHE A 36  ? 1.2581 1.1224 1.3916 0.0187  -0.1955 -0.1209 34   PHE A CA    
228  C  C     . PHE A 36  ? 1.2280 1.0776 1.3665 0.0106  -0.2125 -0.1218 34   PHE A C     
229  O  O     . PHE A 36  ? 1.2686 1.0965 1.4060 0.0102  -0.2232 -0.1252 34   PHE A O     
230  C  CB    . PHE A 36  ? 1.3032 1.1610 1.4164 0.0331  -0.1911 -0.1335 34   PHE A CB    
231  C  CG    . PHE A 36  ? 1.3496 1.2082 1.4531 0.0358  -0.1948 -0.1404 34   PHE A CG    
232  C  CD1   . PHE A 36  ? 1.3634 1.2028 1.4609 0.0351  -0.2102 -0.1479 34   PHE A CD1   
233  C  CD2   . PHE A 36  ? 1.3122 1.1903 1.4125 0.0392  -0.1833 -0.1394 34   PHE A CD2   
234  C  CE1   . PHE A 36  ? 1.3756 1.2164 1.4638 0.0380  -0.2140 -0.1542 34   PHE A CE1   
235  C  CE2   . PHE A 36  ? 1.2001 1.0798 1.2916 0.0422  -0.1863 -0.1453 34   PHE A CE2   
236  C  CZ    . PHE A 36  ? 1.2131 1.0748 1.2985 0.0417  -0.2016 -0.1526 34   PHE A CZ    
237  N  N     . ASN A 37  ? 1.2160 1.0776 1.3605 0.0039  -0.2152 -0.1182 35   ASN A N     
238  C  CA    . ASN A 37  ? 1.3221 1.1722 1.4715 -0.0042 -0.2319 -0.1192 35   ASN A CA    
239  C  C     . ASN A 37  ? 1.3564 1.2101 1.4939 0.0005  -0.2336 -0.1273 35   ASN A C     
240  O  O     . ASN A 37  ? 1.3722 1.2460 1.5074 0.0039  -0.2214 -0.1253 35   ASN A O     
241  C  CB    . ASN A 37  ? 1.3161 1.1796 1.4892 -0.0193 -0.2355 -0.1036 35   ASN A CB    
242  C  CG    . ASN A 37  ? 1.3787 1.2373 1.5647 -0.0246 -0.2358 -0.0946 35   ASN A CG    
243  O  OD1   . ASN A 37  ? 1.4861 1.3554 1.6915 -0.0358 -0.2380 -0.0810 35   ASN A OD1   
244  N  ND2   . ASN A 37  ? 1.2823 1.1259 1.4580 -0.0163 -0.2334 -0.1014 35   ASN A ND2   
245  N  N     . THR A 38  ? 1.3242 1.1572 1.4530 0.0011  -0.2491 -0.1369 36   THR A N     
246  C  CA    . THR A 38  ? 1.2575 1.0932 1.3762 0.0042  -0.2536 -0.1440 36   THR A CA    
247  C  C     . THR A 38  ? 1.2932 1.1418 1.4293 -0.0097 -0.2617 -0.1344 36   THR A C     
248  O  O     . THR A 38  ? 1.2627 1.1207 1.3938 -0.0082 -0.2628 -0.1371 36   THR A O     
249  C  CB    . THR A 38  ? 1.2566 1.0637 1.3558 0.0123  -0.2671 -0.1594 36   THR A CB    
250  O  OG1   . THR A 38  ? 1.3132 1.0988 1.4207 0.0029  -0.2840 -0.1585 36   THR A OG1   
251  C  CG2   . THR A 38  ? 1.1375 0.9352 1.2176 0.0284  -0.2574 -0.1688 36   THR A CG2   
252  N  N     . THR A 39  ? 1.5300 1.3800 1.6868 -0.0226 -0.2675 -0.1225 37   THR A N     
253  C  CA    . THR A 39  ? 1.6039 1.4723 1.7809 -0.0358 -0.2719 -0.1096 37   THR A CA    
254  C  C     . THR A 39  ? 1.5244 1.4223 1.7033 -0.0327 -0.2547 -0.1026 37   THR A C     
255  O  O     . THR A 39  ? 1.5105 1.4198 1.6907 -0.0290 -0.2396 -0.0974 37   THR A O     
256  C  CB    . THR A 39  ? 1.6846 1.5529 1.8842 -0.0484 -0.2767 -0.0958 37   THR A CB    
257  O  OG1   . THR A 39  ? 1.7520 1.6397 1.9591 -0.0471 -0.2594 -0.0854 37   THR A OG1   
258  C  CG2   . THR A 39  ? 1.6712 1.5085 1.8660 -0.0482 -0.2886 -0.1031 37   THR A CG2   
259  N  N     . PHE A 40  ? 1.4384 1.3481 1.6167 -0.0340 -0.2575 -0.1028 38   PHE A N     
260  C  CA    . PHE A 40  ? 1.2670 1.2028 1.4448 -0.0300 -0.2421 -0.0973 38   PHE A CA    
261  C  C     . PHE A 40  ? 1.1391 1.0968 1.3399 -0.0422 -0.2427 -0.0801 38   PHE A C     
262  O  O     . PHE A 40  ? 1.1717 1.1324 1.3812 -0.0500 -0.2553 -0.0770 38   PHE A O     
263  C  CB    . PHE A 40  ? 1.2354 1.1710 1.3957 -0.0213 -0.2431 -0.1085 38   PHE A CB    
264  C  CG    . PHE A 40  ? 1.2995 1.2607 1.4589 -0.0172 -0.2281 -0.1030 38   PHE A CG    
265  C  CD1   . PHE A 40  ? 1.3301 1.3082 1.4962 -0.0168 -0.2120 -0.0930 38   PHE A CD1   
266  C  CD2   . PHE A 40  ? 1.2536 1.2209 1.4043 -0.0133 -0.2307 -0.1079 38   PHE A CD2   
267  C  CE1   . PHE A 40  ? 1.2401 1.2393 1.4041 -0.0126 -0.1988 -0.0883 38   PHE A CE1   
268  C  CE2   . PHE A 40  ? 1.2668 1.2564 1.4162 -0.0091 -0.2171 -0.1026 38   PHE A CE2   
269  C  CZ    . PHE A 40  ? 1.2199 1.2249 1.3759 -0.0088 -0.2011 -0.0929 38   PHE A CZ    
270  N  N     . ILE A 41  ? 0.9607 0.9344 1.1710 -0.0432 -0.2292 -0.0685 39   ILE A N     
271  C  CA    . ILE A 41  ? 0.9301 0.9286 1.1593 -0.0513 -0.2253 -0.0515 39   ILE A CA    
272  C  C     . ILE A 41  ? 0.9319 0.9497 1.1523 -0.0424 -0.2069 -0.0498 39   ILE A C     
273  O  O     . ILE A 41  ? 1.0582 1.0774 1.2725 -0.0364 -0.1939 -0.0499 39   ILE A O     
274  C  CB    . ILE A 41  ? 0.9560 0.9572 1.2037 -0.0596 -0.2252 -0.0380 39   ILE A CB    
275  C  CG1   . ILE A 41  ? 1.0007 0.9769 1.2514 -0.0648 -0.2399 -0.0429 39   ILE A CG1   
276  C  CG2   . ILE A 41  ? 0.8375 0.8609 1.1065 -0.0693 -0.2269 -0.0205 39   ILE A CG2   
277  C  CD1   . ILE A 41  ? 0.8850 0.8597 1.1466 -0.0684 -0.2365 -0.0338 39   ILE A CD1   
278  N  N     . SER A 42  ? 0.8346 0.8668 1.0541 -0.0416 -0.2063 -0.0482 40   SER A N     
279  C  CA    . SER A 42  ? 0.8022 0.8526 1.0141 -0.0337 -0.1894 -0.0454 40   SER A CA    
280  C  C     . SER A 42  ? 0.8293 0.8976 1.0545 -0.0369 -0.1788 -0.0294 40   SER A C     
281  O  O     . SER A 42  ? 0.7862 0.8620 1.0305 -0.0466 -0.1852 -0.0167 40   SER A O     
282  C  CB    . SER A 42  ? 0.5688 0.6318 0.7790 -0.0327 -0.1918 -0.0452 40   SER A CB    
283  O  OG    . SER A 42  ? 0.6767 0.7589 0.8827 -0.0263 -0.1757 -0.0395 40   SER A OG    
284  N  N     . THR A 43  ? 0.7654 0.8401 0.9799 -0.0284 -0.1626 -0.0301 41   THR A N     
285  C  CA    . THR A 43  ? 0.7675 0.8574 0.9898 -0.0289 -0.1512 -0.0168 41   THR A CA    
286  C  C     . THR A 43  ? 0.8047 0.9181 1.0352 -0.0302 -0.1470 -0.0041 41   THR A C     
287  O  O     . THR A 43  ? 0.8709 0.9899 1.0947 -0.0266 -0.1466 -0.0081 41   THR A O     
288  C  CB    . THR A 43  ? 0.7249 0.8113 0.9313 -0.0193 -0.1367 -0.0232 41   THR A CB    
289  O  OG1   . THR A 43  ? 0.7316 0.7985 0.9327 -0.0184 -0.1406 -0.0327 41   THR A OG1   
290  C  CG2   . THR A 43  ? 0.7176 0.8188 0.9286 -0.0184 -0.1249 -0.0106 41   THR A CG2   
291  N  N     . ILE A 44  ? 0.8038 0.9317 1.0492 -0.0347 -0.1438 0.0118  42   ILE A N     
292  C  CA    . ILE A 44  ? 0.6841 0.8365 0.9381 -0.0347 -0.1377 0.0263  42   ILE A CA    
293  C  C     . ILE A 44  ? 0.6087 0.7703 0.8579 -0.0282 -0.1220 0.0339  42   ILE A C     
294  O  O     . ILE A 44  ? 0.7069 0.8676 0.9640 -0.0312 -0.1213 0.0410  42   ILE A O     
295  C  CB    . ILE A 44  ? 0.5747 0.7386 0.8529 -0.0461 -0.1493 0.0410  42   ILE A CB    
296  C  CG1   . ILE A 44  ? 0.7402 0.8903 1.0230 -0.0537 -0.1674 0.0325  42   ILE A CG1   
297  C  CG2   . ILE A 44  ? 0.6579 0.8490 0.9448 -0.0450 -0.1427 0.0565  42   ILE A CG2   
298  C  CD1   . ILE A 44  ? 0.7798 0.9132 1.0711 -0.0611 -0.1777 0.0313  42   ILE A CD1   
299  N  N     . GLY A 45  ? 0.5424 0.7123 0.7782 -0.0191 -0.1097 0.0326  43   GLY A N     
300  C  CA    . GLY A 45  ? 0.5226 0.6995 0.7513 -0.0122 -0.0953 0.0388  43   GLY A CA    
301  C  C     . GLY A 45  ? 0.6473 0.8061 0.8611 -0.0076 -0.0905 0.0264  43   GLY A C     
302  O  O     . GLY A 45  ? 0.7494 0.8958 0.9500 -0.0038 -0.0904 0.0123  43   GLY A O     
303  N  N     . ILE A 46  ? 0.6496 0.8075 0.8663 -0.0081 -0.0871 0.0320  44   ILE A N     
304  C  CA    . ILE A 46  ? 0.5685 0.7127 0.7710 -0.0030 -0.0808 0.0225  44   ILE A CA    
305  C  C     . ILE A 46  ? 0.6685 0.8102 0.8805 -0.0072 -0.0834 0.0291  44   ILE A C     
306  O  O     . ILE A 46  ? 0.8356 0.9905 1.0614 -0.0107 -0.0842 0.0438  44   ILE A O     
307  C  CB    . ILE A 46  ? 0.4806 0.6305 0.6673 0.0066  -0.0666 0.0227  44   ILE A CB    
308  C  CG1   . ILE A 46  ? 0.4871 0.6214 0.6580 0.0114  -0.0617 0.0098  44   ILE A CG1   
309  C  CG2   . ILE A 46  ? 0.4152 0.5800 0.6065 0.0087  -0.0596 0.0381  44   ILE A CG2   
310  C  CD1   . ILE A 46  ? 0.5718 0.7086 0.7267 0.0201  -0.0493 0.0086  44   ILE A CD1   
311  N  N     . ASP A 47  ? 0.5807 0.7063 0.7861 -0.0066 -0.0848 0.0190  45   ASP A N     
312  C  CA    . ASP A 47  ? 0.6564 0.7794 0.8685 -0.0091 -0.0857 0.0248  45   ASP A CA    
313  C  C     . ASP A 47  ? 0.6585 0.7661 0.8572 -0.0050 -0.0829 0.0121  45   ASP A C     
314  O  O     . ASP A 47  ? 0.7688 0.8697 0.9546 -0.0004 -0.0799 0.0007  45   ASP A O     
315  C  CB    . ASP A 47  ? 0.7987 0.9193 1.0296 -0.0187 -0.0984 0.0306  45   ASP A CB    
316  C  CG    . ASP A 47  ? 0.8993 1.0241 1.1406 -0.0212 -0.0979 0.0424  45   ASP A CG    
317  O  OD1   . ASP A 47  ? 0.9200 1.0588 1.1601 -0.0170 -0.0886 0.0530  45   ASP A OD1   
318  O  OD2   . ASP A 47  ? 1.0131 1.1267 1.2629 -0.0268 -0.1066 0.0413  45   ASP A OD2   
319  N  N     . PHE A 48  ? 0.5739 0.6770 0.7761 -0.0063 -0.0837 0.0149  46   PHE A N     
320  C  CA    . PHE A 48  ? 0.6305 0.7211 0.8212 -0.0024 -0.0810 0.0041  46   PHE A CA    
321  C  C     . PHE A 48  ? 0.6514 0.7328 0.8508 -0.0066 -0.0880 0.0049  46   PHE A C     
322  O  O     . PHE A 48  ? 0.6194 0.7061 0.8326 -0.0115 -0.0922 0.0162  46   PHE A O     
323  C  CB    . PHE A 48  ? 0.6610 0.7568 0.8392 0.0043  -0.0697 0.0056  46   PHE A CB    
324  C  CG    . PHE A 48  ? 0.6802 0.7875 0.8641 0.0045  -0.0661 0.0198  46   PHE A CG    
325  C  CD1   . PHE A 48  ? 0.6415 0.7455 0.8288 0.0036  -0.0674 0.0230  46   PHE A CD1   
326  C  CD2   . PHE A 48  ? 0.6617 0.7840 0.8473 0.0065  -0.0610 0.0304  46   PHE A CD2   
327  C  CE1   . PHE A 48  ? 0.6564 0.7717 0.8482 0.0049  -0.0636 0.0365  46   PHE A CE1   
328  C  CE2   . PHE A 48  ? 0.7232 0.8572 0.9133 0.0081  -0.0570 0.0442  46   PHE A CE2   
329  C  CZ    . PHE A 48  ? 0.7032 0.8336 0.8962 0.0073  -0.0583 0.0472  46   PHE A CZ    
330  N  N     . LYS A 49  ? 0.6164 0.6844 0.8077 -0.0042 -0.0890 -0.0066 47   LYS A N     
331  C  CA    . LYS A 49  ? 0.6172 0.6760 0.8135 -0.0061 -0.0937 -0.0069 47   LYS A CA    
332  C  C     . LYS A 49  ? 0.5902 0.6481 0.7758 -0.0007 -0.0861 -0.0102 47   LYS A C     
333  O  O     . LYS A 49  ? 0.6047 0.6652 0.7782 0.0041  -0.0787 -0.0152 47   LYS A O     
334  C  CB    . LYS A 49  ? 0.5790 0.6220 0.7761 -0.0076 -0.1029 -0.0173 47   LYS A CB    
335  C  CG    . LYS A 49  ? 0.5506 0.5922 0.7552 -0.0125 -0.1116 -0.0168 47   LYS A CG    
336  C  CD    . LYS A 49  ? 0.6027 0.6526 0.8243 -0.0199 -0.1165 -0.0025 47   LYS A CD    
337  C  CE    . LYS A 49  ? 0.7864 0.8361 1.0159 -0.0254 -0.1258 -0.0019 47   LYS A CE    
338  N  NZ    . LYS A 49  ? 0.7509 0.8148 0.9972 -0.0322 -0.1282 0.0142  47   LYS A NZ    
339  N  N     . ILE A 50  ? 0.5393 0.5933 0.7297 -0.0017 -0.0884 -0.0071 48   ILE A N     
340  C  CA    . ILE A 50  ? 0.5436 0.5979 0.7259 0.0026  -0.0825 -0.0084 48   ILE A CA    
341  C  C     . ILE A 50  ? 0.6479 0.6895 0.8287 0.0036  -0.0867 -0.0174 48   ILE A C     
342  O  O     . ILE A 50  ? 0.7290 0.7623 0.9185 0.0004  -0.0945 -0.0171 48   ILE A O     
343  C  CB    . ILE A 50  ? 0.5280 0.5910 0.7166 0.0018  -0.0808 0.0045  48   ILE A CB    
344  C  CG1   . ILE A 50  ? 0.5252 0.6022 0.7125 0.0031  -0.0747 0.0138  48   ILE A CG1   
345  C  CG2   . ILE A 50  ? 0.6168 0.6777 0.7979 0.0056  -0.0773 0.0023  48   ILE A CG2   
346  C  CD1   . ILE A 50  ? 0.4671 0.5462 0.6386 0.0086  -0.0669 0.0072  48   ILE A CD1   
347  N  N     . LYS A 51  ? 0.6611 0.7008 0.8311 0.0081  -0.0817 -0.0248 49   LYS A N     
348  C  CA    . LYS A 51  ? 0.6249 0.6556 0.7942 0.0099  -0.0845 -0.0309 49   LYS A CA    
349  C  C     . LYS A 51  ? 0.6652 0.6993 0.8253 0.0137  -0.0783 -0.0337 49   LYS A C     
350  O  O     . LYS A 51  ? 0.6331 0.6698 0.7843 0.0160  -0.0731 -0.0384 49   LYS A O     
351  C  CB    . LYS A 51  ? 0.5362 0.5566 0.7038 0.0112  -0.0887 -0.0409 49   LYS A CB    
352  C  CG    . LYS A 51  ? 0.6116 0.6241 0.7772 0.0146  -0.0902 -0.0467 49   LYS A CG    
353  C  CD    . LYS A 51  ? 0.6839 0.6835 0.8526 0.0150  -0.0980 -0.0518 49   LYS A CD    
354  C  CE    . LYS A 51  ? 0.8142 0.8080 0.9756 0.0213  -0.0966 -0.0612 49   LYS A CE    
355  N  NZ    . LYS A 51  ? 1.1065 1.0881 1.2659 0.0236  -0.1028 -0.0683 49   LYS A NZ    
356  N  N     . THR A 52  ? 0.7744 0.8081 0.9369 0.0142  -0.0793 -0.0307 50   THR A N     
357  C  CA    . THR A 52  ? 0.7481 0.7850 0.9031 0.0171  -0.0750 -0.0327 50   THR A CA    
358  C  C     . THR A 52  ? 0.7402 0.7709 0.8932 0.0196  -0.0762 -0.0415 50   THR A C     
359  O  O     . THR A 52  ? 0.9025 0.9256 1.0606 0.0200  -0.0809 -0.0443 50   THR A O     
360  C  CB    . THR A 52  ? 0.7248 0.7657 0.8832 0.0169  -0.0756 -0.0243 50   THR A CB    
361  O  OG1   . THR A 52  ? 0.7295 0.7770 0.8912 0.0152  -0.0746 -0.0147 50   THR A OG1   
362  C  CG2   . THR A 52  ? 0.7406 0.7855 0.8899 0.0196  -0.0719 -0.0260 50   THR A CG2   
363  N  N     . VAL A 53  ? 0.6027 0.6365 0.7483 0.0217  -0.0720 -0.0455 51   VAL A N     
364  C  CA    . VAL A 53  ? 0.5682 0.5990 0.7123 0.0243  -0.0719 -0.0527 51   VAL A CA    
365  C  C     . VAL A 53  ? 0.7131 0.7486 0.8541 0.0250  -0.0701 -0.0523 51   VAL A C     
366  O  O     . VAL A 53  ? 0.7787 0.8187 0.9158 0.0239  -0.0686 -0.0480 51   VAL A O     
367  C  CB    . VAL A 53  ? 0.5640 0.5938 0.7028 0.0256  -0.0687 -0.0592 51   VAL A CB    
368  C  CG1   . VAL A 53  ? 0.5433 0.5675 0.6851 0.0256  -0.0719 -0.0609 51   VAL A CG1   
369  C  CG2   . VAL A 53  ? 0.6329 0.6678 0.7640 0.0246  -0.0635 -0.0581 51   VAL A CG2   
370  N  N     . GLU A 54  ? 0.8049 0.8398 0.9474 0.0273  -0.0706 -0.0564 52   GLU A N     
371  C  CA    . GLU A 54  ? 0.8139 0.8542 0.9544 0.0274  -0.0696 -0.0565 52   GLU A CA    
372  C  C     . GLU A 54  ? 0.7829 0.8245 0.9213 0.0288  -0.0667 -0.0622 52   GLU A C     
373  O  O     . GLU A 54  ? 0.8290 0.8687 0.9709 0.0320  -0.0670 -0.0653 52   GLU A O     
374  C  CB    . GLU A 54  ? 1.1299 1.1711 1.2766 0.0290  -0.0731 -0.0536 52   GLU A CB    
375  C  CG    . GLU A 54  ? 1.2333 1.2730 1.3837 0.0280  -0.0761 -0.0471 52   GLU A CG    
376  C  CD    . GLU A 54  ? 1.2965 1.3383 1.4518 0.0298  -0.0789 -0.0438 52   GLU A CD    
377  O  OE1   . GLU A 54  ? 1.1833 1.2308 1.3370 0.0304  -0.0784 -0.0449 52   GLU A OE1   
378  O  OE2   . GLU A 54  ? 1.3703 1.4078 1.5314 0.0305  -0.0820 -0.0399 52   GLU A OE2   
379  N  N     . LEU A 55  ? 0.8039 0.8484 0.9361 0.0267  -0.0638 -0.0631 53   LEU A N     
380  C  CA    . LEU A 55  ? 0.9134 0.9599 1.0442 0.0271  -0.0609 -0.0671 53   LEU A CA    
381  C  C     . LEU A 55  ? 1.0745 1.1259 1.2054 0.0248  -0.0623 -0.0657 53   LEU A C     
382  O  O     . LEU A 55  ? 1.0323 1.0833 1.1563 0.0222  -0.0625 -0.0648 53   LEU A O     
383  C  CB    . LEU A 55  ? 0.9555 0.9997 1.0791 0.0261  -0.0569 -0.0693 53   LEU A CB    
384  C  CG    . LEU A 55  ? 1.0065 1.0468 1.1300 0.0276  -0.0565 -0.0697 53   LEU A CG    
385  C  CD1   . LEU A 55  ? 0.9912 1.0304 1.1071 0.0263  -0.0534 -0.0689 53   LEU A CD1   
386  C  CD2   . LEU A 55  ? 1.0385 1.0772 1.1649 0.0312  -0.0557 -0.0739 53   LEU A CD2   
387  N  N     . GLN A 56  ? 1.5038 1.5597 1.6420 0.0264  -0.0639 -0.0654 54   GLN A N     
388  C  CA    . GLN A 56  ? 1.7149 1.7771 1.8555 0.0241  -0.0659 -0.0640 54   GLN A CA    
389  C  C     . GLN A 56  ? 1.7150 1.7770 1.8499 0.0211  -0.0690 -0.0616 54   GLN A C     
390  O  O     . GLN A 56  ? 1.8455 1.9080 1.9753 0.0177  -0.0700 -0.0623 54   GLN A O     
391  C  CB    . GLN A 56  ? 1.7883 1.8529 1.9285 0.0221  -0.0632 -0.0663 54   GLN A CB    
392  N  N     . GLY A 57  ? 1.4896 1.5498 1.6246 0.0227  -0.0708 -0.0585 55   GLY A N     
393  C  CA    . GLY A 57  ? 1.3298 1.3912 1.4601 0.0215  -0.0736 -0.0551 55   GLY A CA    
394  C  C     . GLY A 57  ? 1.1436 1.2003 1.2639 0.0212  -0.0719 -0.0540 55   GLY A C     
395  O  O     . GLY A 57  ? 1.2340 1.2916 1.3506 0.0220  -0.0736 -0.0500 55   GLY A O     
396  N  N     . LYS A 58  ? 0.8633 0.9160 0.9790 0.0208  -0.0681 -0.0570 56   LYS A N     
397  C  CA    . LYS A 58  ? 0.7191 0.7685 0.8268 0.0216  -0.0657 -0.0550 56   LYS A CA    
398  C  C     . LYS A 58  ? 0.7868 0.8355 0.9018 0.0229  -0.0650 -0.0526 56   LYS A C     
399  O  O     . LYS A 58  ? 1.0380 1.0849 1.1581 0.0233  -0.0640 -0.0558 56   LYS A O     
400  C  CB    . LYS A 58  ? 0.6101 0.6555 0.7088 0.0208  -0.0620 -0.0588 56   LYS A CB    
401  C  CG    . LYS A 58  ? 0.6192 0.6619 0.7056 0.0200  -0.0629 -0.0598 56   LYS A CG    
402  C  CD    . LYS A 58  ? 0.6238 0.6653 0.7004 0.0229  -0.0615 -0.0557 56   LYS A CD    
403  C  CE    . LYS A 58  ? 0.5647 0.6011 0.6259 0.0234  -0.0625 -0.0576 56   LYS A CE    
404  N  NZ    . LYS A 58  ? 0.5911 0.6291 0.6526 0.0216  -0.0684 -0.0584 56   LYS A NZ    
405  N  N     . LYS A 59  ? 0.6223 0.6720 0.7378 0.0238  -0.0658 -0.0467 57   LYS A N     
406  C  CA    . LYS A 59  ? 0.6709 0.7192 0.7936 0.0239  -0.0661 -0.0437 57   LYS A CA    
407  C  C     . LYS A 59  ? 0.7559 0.8044 0.8728 0.0240  -0.0626 -0.0413 57   LYS A C     
408  O  O     . LYS A 59  ? 0.6526 0.7038 0.7626 0.0253  -0.0611 -0.0367 57   LYS A O     
409  C  CB    . LYS A 59  ? 0.7481 0.7979 0.8785 0.0244  -0.0696 -0.0374 57   LYS A CB    
410  C  CG    . LYS A 59  ? 0.9576 1.0118 1.0834 0.0255  -0.0703 -0.0323 57   LYS A CG    
411  C  CD    . LYS A 59  ? 0.9724 1.0277 1.1076 0.0262  -0.0739 -0.0267 57   LYS A CD    
412  C  CE    . LYS A 59  ? 0.9499 1.0012 1.0949 0.0251  -0.0752 -0.0240 57   LYS A CE    
413  N  NZ    . LYS A 59  ? 1.1510 1.2027 1.3045 0.0255  -0.0783 -0.0165 57   LYS A NZ    
414  N  N     . ILE A 60  ? 0.8267 0.8729 0.9458 0.0235  -0.0612 -0.0442 58   ILE A N     
415  C  CA    . ILE A 60  ? 0.7513 0.7981 0.8644 0.0239  -0.0573 -0.0433 58   ILE A CA    
416  C  C     . ILE A 60  ? 0.6858 0.7332 0.8076 0.0228  -0.0589 -0.0391 58   ILE A C     
417  O  O     . ILE A 60  ? 0.8064 0.8503 0.9363 0.0217  -0.0625 -0.0416 58   ILE A O     
418  C  CB    . ILE A 60  ? 0.6177 0.6616 0.7253 0.0242  -0.0542 -0.0507 58   ILE A CB    
419  C  CG1   . ILE A 60  ? 0.7230 0.7659 0.8229 0.0242  -0.0535 -0.0539 58   ILE A CG1   
420  C  CG2   . ILE A 60  ? 0.4896 0.5342 0.5919 0.0251  -0.0501 -0.0497 58   ILE A CG2   
421  C  CD1   . ILE A 60  ? 0.9544 0.9948 1.0524 0.0238  -0.0515 -0.0604 58   ILE A CD1   
422  N  N     . LYS A 61  ? 0.6286 0.6805 0.7487 0.0231  -0.0567 -0.0324 59   LYS A N     
423  C  CA    . LYS A 61  ? 0.6662 0.7200 0.7954 0.0212  -0.0586 -0.0277 59   LYS A CA    
424  C  C     . LYS A 61  ? 0.7848 0.8381 0.9105 0.0214  -0.0560 -0.0318 59   LYS A C     
425  O  O     . LYS A 61  ? 0.7036 0.7591 0.8193 0.0238  -0.0507 -0.0322 59   LYS A O     
426  C  CB    . LYS A 61  ? 0.4876 0.5488 0.6190 0.0216  -0.0575 -0.0164 59   LYS A CB    
427  C  CG    . LYS A 61  ? 0.4883 0.5528 0.6304 0.0186  -0.0597 -0.0104 59   LYS A CG    
428  C  CD    . LYS A 61  ? 0.4950 0.5683 0.6427 0.0187  -0.0590 0.0026  59   LYS A CD    
429  C  CE    . LYS A 61  ? 0.6310 0.7025 0.7893 0.0164  -0.0642 0.0073  59   LYS A CE    
430  N  NZ    . LYS A 61  ? 0.7580 0.8392 0.9213 0.0172  -0.0626 0.0211  59   LYS A NZ    
431  N  N     . LEU A 62  ? 0.7678 0.8175 0.9009 0.0195  -0.0599 -0.0349 60   LEU A N     
432  C  CA    . LEU A 62  ? 0.4804 0.5302 0.6114 0.0198  -0.0583 -0.0383 60   LEU A CA    
433  C  C     . LEU A 62  ? 0.5619 0.6174 0.7007 0.0173  -0.0603 -0.0301 60   LEU A C     
434  O  O     . LEU A 62  ? 0.7591 0.8123 0.9087 0.0139  -0.0667 -0.0272 60   LEU A O     
435  C  CB    . LEU A 62  ? 0.5345 0.5770 0.6672 0.0201  -0.0616 -0.0471 60   LEU A CB    
436  C  CG    . LEU A 62  ? 0.5657 0.6042 0.6945 0.0222  -0.0606 -0.0535 60   LEU A CG    
437  C  CD1   . LEU A 62  ? 0.4568 0.4893 0.5866 0.0241  -0.0630 -0.0612 60   LEU A CD1   
438  C  CD2   . LEU A 62  ? 0.5324 0.5735 0.6509 0.0240  -0.0542 -0.0551 60   LEU A CD2   
439  N  N     . GLN A 63  ? 0.4636 0.5262 0.5972 0.0190  -0.0551 -0.0259 61   GLN A N     
440  C  CA    . GLN A 63  ? 0.5103 0.5803 0.6515 0.0170  -0.0564 -0.0181 61   GLN A CA    
441  C  C     . GLN A 63  ? 0.6458 0.7143 0.7844 0.0175  -0.0562 -0.0244 61   GLN A C     
442  O  O     . GLN A 63  ? 0.6450 0.7151 0.7731 0.0212  -0.0499 -0.0272 61   GLN A O     
443  C  CB    . GLN A 63  ? 0.4873 0.5675 0.6243 0.0199  -0.0503 -0.0082 61   GLN A CB    
444  C  CG    . GLN A 63  ? 0.5573 0.6480 0.7029 0.0182  -0.0507 0.0013  61   GLN A CG    
445  C  CD    . GLN A 63  ? 0.5735 0.6751 0.7139 0.0228  -0.0437 0.0119  61   GLN A CD    
446  O  OE1   . GLN A 63  ? 0.8668 0.9666 0.9955 0.0274  -0.0388 0.0111  61   GLN A OE1   
447  N  NE2   . GLN A 63  ? 0.4538 0.5671 0.6027 0.0218  -0.0434 0.0220  61   GLN A NE2   
448  N  N     . ILE A 64  ? 0.7036 0.7681 0.8508 0.0140  -0.0635 -0.0269 62   ILE A N     
449  C  CA    . ILE A 64  ? 0.6309 0.6922 0.7747 0.0151  -0.0645 -0.0346 62   ILE A CA    
450  C  C     . ILE A 64  ? 0.5105 0.5792 0.6622 0.0121  -0.0679 -0.0283 62   ILE A C     
451  O  O     . ILE A 64  ? 0.5758 0.6441 0.7396 0.0070  -0.0756 -0.0234 62   ILE A O     
452  C  CB    . ILE A 64  ? 0.6849 0.7346 0.8296 0.0150  -0.0704 -0.0440 62   ILE A CB    
453  C  CG1   . ILE A 64  ? 0.6923 0.7371 0.8311 0.0177  -0.0671 -0.0486 62   ILE A CG1   
454  C  CG2   . ILE A 64  ? 0.6934 0.7404 0.8327 0.0176  -0.0707 -0.0519 62   ILE A CG2   
455  C  CD1   . ILE A 64  ? 0.6942 0.7288 0.8355 0.0182  -0.0728 -0.0553 62   ILE A CD1   
456  N  N     . TRP A 65  ? 0.4944 0.5696 0.6397 0.0151  -0.0625 -0.0281 63   TRP A N     
457  C  CA    . TRP A 65  ? 0.6290 0.7139 0.7814 0.0129  -0.0647 -0.0212 63   TRP A CA    
458  C  C     . TRP A 65  ? 0.5793 0.6589 0.7318 0.0122  -0.0706 -0.0293 63   TRP A C     
459  O  O     . TRP A 65  ? 0.7544 0.8308 0.8962 0.0169  -0.0664 -0.0376 63   TRP A O     
460  C  CB    . TRP A 65  ? 0.6373 0.7329 0.7821 0.0175  -0.0551 -0.0155 63   TRP A CB    
461  C  CG    . TRP A 65  ? 0.4702 0.5712 0.6131 0.0194  -0.0494 -0.0071 63   TRP A CG    
462  C  CD1   . TRP A 65  ? 0.6177 0.7123 0.7517 0.0222  -0.0453 -0.0107 63   TRP A CD1   
463  C  CD2   . TRP A 65  ? 0.4542 0.5689 0.6035 0.0194  -0.0471 0.0066  63   TRP A CD2   
464  N  NE1   . TRP A 65  ? 0.5101 0.6123 0.6431 0.0243  -0.0409 -0.0008 63   TRP A NE1   
465  C  CE2   . TRP A 65  ? 0.4742 0.5891 0.6165 0.0231  -0.0414 0.0103  63   TRP A CE2   
466  C  CE3   . TRP A 65  ? 0.5531 0.6806 0.7137 0.0168  -0.0494 0.0168  63   TRP A CE3   
467  C  CZ2   . TRP A 65  ? 0.5773 0.7046 0.7224 0.0254  -0.0373 0.0236  63   TRP A CZ2   
468  C  CZ3   . TRP A 65  ? 0.6160 0.7570 0.7812 0.0184  -0.0452 0.0309  63   TRP A CZ3   
469  C  CH2   . TRP A 65  ? 0.5977 0.7384 0.7545 0.0232  -0.0389 0.0342  63   TRP A CH2   
470  N  N     . ASP A 66  ? 0.5914 0.6698 0.7559 0.0064  -0.0808 -0.0268 64   ASP A N     
471  C  CA    . ASP A 66  ? 0.7203 0.7954 0.8858 0.0052  -0.0880 -0.0324 64   ASP A CA    
472  C  C     . ASP A 66  ? 0.6309 0.7208 0.7994 0.0049  -0.0858 -0.0248 64   ASP A C     
473  O  O     . ASP A 66  ? 0.7517 0.8528 0.9317 0.0006  -0.0870 -0.0124 64   ASP A O     
474  C  CB    . ASP A 66  ? 0.8067 0.8729 0.9836 -0.0014 -0.1010 -0.0326 64   ASP A CB    
475  C  CG    . ASP A 66  ? 0.7431 0.7983 0.9155 -0.0006 -0.1092 -0.0435 64   ASP A CG    
476  O  OD1   . ASP A 66  ? 0.9182 0.9728 1.0784 0.0058  -0.1040 -0.0514 64   ASP A OD1   
477  O  OD2   . ASP A 66  ? 0.6218 0.6684 0.8023 -0.0059 -0.1210 -0.0442 64   ASP A OD2   
478  N  N     . THR A 67  ? 0.5537 0.6444 0.7119 0.0100  -0.0820 -0.0313 65   THR A N     
479  C  CA    . THR A 67  ? 0.4713 0.5752 0.6304 0.0110  -0.0798 -0.0257 65   THR A CA    
480  C  C     . THR A 67  ? 0.6196 0.7217 0.7850 0.0070  -0.0915 -0.0288 65   THR A C     
481  O  O     . THR A 67  ? 0.8025 0.8908 0.9670 0.0055  -0.1001 -0.0379 65   THR A O     
482  C  CB    . THR A 67  ? 0.4996 0.6050 0.6434 0.0192  -0.0688 -0.0308 65   THR A CB    
483  O  OG1   . THR A 67  ? 0.5949 0.6881 0.7297 0.0226  -0.0706 -0.0437 65   THR A OG1   
484  C  CG2   . THR A 67  ? 0.4185 0.5247 0.5553 0.0229  -0.0582 -0.0278 65   THR A CG2   
485  N  N     . ALA A 68  ? 0.4821 0.5983 0.6530 0.0058  -0.0921 -0.0213 66   ALA A N     
486  C  CA    . ALA A 68  ? 0.5858 0.7020 0.7610 0.0026  -0.1030 -0.0242 66   ALA A CA    
487  C  C     . ALA A 68  ? 0.7015 0.8166 0.8617 0.0106  -0.0981 -0.0336 66   ALA A C     
488  O  O     . ALA A 68  ? 0.6727 0.7969 0.8254 0.0166  -0.0866 -0.0306 66   ALA A O     
489  C  CB    . ALA A 68  ? 0.5669 0.7009 0.7577 -0.0033 -0.1069 -0.0100 66   ALA A CB    
490  N  N     . GLY A 69  ? 0.6200 0.7233 0.7753 0.0111  -0.1071 -0.0446 67   GLY A N     
491  C  CA    . GLY A 69  ? 0.7084 0.8098 0.8491 0.0194  -0.1028 -0.0538 67   GLY A CA    
492  C  C     . GLY A 69  ? 0.7724 0.8879 0.9139 0.0206  -0.1033 -0.0495 67   GLY A C     
493  O  O     . GLY A 69  ? 0.6873 0.8072 0.8175 0.0284  -0.0941 -0.0522 67   GLY A O     
494  N  N     . GLN A 70  ? 0.8353 0.9583 0.9907 0.0128  -0.1143 -0.0425 68   GLN A N     
495  C  CA    . GLN A 70  ? 0.8846 1.0223 1.0419 0.0135  -0.1161 -0.0381 68   GLN A CA    
496  C  C     . GLN A 70  ? 0.8359 0.9911 0.9929 0.0178  -0.1018 -0.0272 68   GLN A C     
497  O  O     . GLN A 70  ? 0.7793 0.9403 0.9432 0.0156  -0.0960 -0.0177 68   GLN A O     
498  C  CB    . GLN A 70  ? 0.9958 1.1387 1.1703 0.0030  -0.1319 -0.0315 68   GLN A CB    
499  C  CG    . GLN A 70  ? 1.1044 1.2570 1.2790 0.0033  -0.1393 -0.0318 68   GLN A CG    
500  C  CD    . GLN A 70  ? 1.1671 1.3442 1.3471 0.0054  -0.1308 -0.0187 68   GLN A CD    
501  O  OE1   . GLN A 70  ? 1.2231 1.4087 1.4011 0.0098  -0.1166 -0.0116 68   GLN A OE1   
502  N  NE2   . GLN A 70  ? 1.2110 1.3987 1.3964 0.0030  -0.1398 -0.0162 68   GLN A NE2   
503  N  N     . GLU A 71  ? 0.7968 0.9604 0.9451 0.0246  -0.0965 -0.0283 69   GLU A N     
504  C  CA    . GLU A 71  ? 0.8734 1.0491 1.0154 0.0318  -0.0813 -0.0213 69   GLU A CA    
505  C  C     . GLU A 71  ? 0.7887 0.9840 0.9444 0.0283  -0.0794 -0.0049 69   GLU A C     
506  O  O     . GLU A 71  ? 0.8983 1.1015 1.0490 0.0341  -0.0663 0.0021  69   GLU A O     
507  C  CB    . GLU A 71  ? 1.0289 1.2075 1.1585 0.0400  -0.0776 -0.0271 69   GLU A CB    
508  C  CG    . GLU A 71  ? 1.2647 1.4468 1.3994 0.0365  -0.0916 -0.0297 69   GLU A CG    
509  C  CD    . GLU A 71  ? 1.5448 1.7299 1.6662 0.0455  -0.0878 -0.0355 69   GLU A CD    
510  O  OE1   . GLU A 71  ? 1.6205 1.8026 1.7289 0.0541  -0.0745 -0.0384 69   GLU A OE1   
511  O  OE2   . GLU A 71  ? 1.6164 1.8068 1.7404 0.0439  -0.0983 -0.0369 69   GLU A OE2   
512  N  N     . ARG A 72  ? 0.6957 0.8992 0.8683 0.0193  -0.0921 0.0020  70   ARG A N     
513  C  CA    . ARG A 72  ? 0.4979 0.7218 0.6856 0.0157  -0.0902 0.0194  70   ARG A CA    
514  C  C     . ARG A 72  ? 0.5921 0.8146 0.7830 0.0150  -0.0829 0.0262  70   ARG A C     
515  O  O     . ARG A 72  ? 0.6742 0.9137 0.8732 0.0155  -0.0769 0.0409  70   ARG A O     
516  C  CB    . ARG A 72  ? 0.4794 0.7115 0.6867 0.0047  -0.1068 0.0257  70   ARG A CB    
517  C  CG    . ARG A 72  ? 0.5338 0.7624 0.7576 -0.0055 -0.1149 0.0322  70   ARG A CG    
518  C  CD    . ARG A 72  ? 0.7480 0.9828 0.9914 -0.0172 -0.1328 0.0378  70   ARG A CD    
519  N  NE    . ARG A 72  ? 0.9838 1.1974 1.2218 -0.0209 -0.1468 0.0221  70   ARG A NE    
520  C  CZ    . ARG A 72  ? 0.9389 1.1522 1.1740 -0.0214 -0.1568 0.0155  70   ARG A CZ    
521  N  NH1   . ARG A 72  ? 0.8260 1.0602 1.0648 -0.0192 -0.1546 0.0238  70   ARG A NH1   
522  N  NH2   . ARG A 72  ? 0.9147 1.1067 1.1426 -0.0235 -0.1693 0.0008  70   ARG A NH2   
523  N  N     . PHE A 73  ? 0.5593 0.7626 0.7431 0.0146  -0.0828 0.0161  71   PHE A N     
524  C  CA    . PHE A 73  ? 0.5244 0.7243 0.7078 0.0152  -0.0753 0.0205  71   PHE A CA    
525  C  C     . PHE A 73  ? 0.6210 0.8139 0.7853 0.0252  -0.0609 0.0146  71   PHE A C     
526  O  O     . PHE A 73  ? 0.6923 0.8828 0.8540 0.0268  -0.0540 0.0181  71   PHE A O     
527  C  CB    . PHE A 73  ? 0.4933 0.6770 0.6825 0.0080  -0.0851 0.0143  71   PHE A CB    
528  C  CG    . PHE A 73  ? 0.5985 0.7888 0.8084 -0.0027 -0.0980 0.0234  71   PHE A CG    
529  C  CD1   . PHE A 73  ? 0.5988 0.8040 0.8226 -0.0059 -0.0954 0.0397  71   PHE A CD1   
530  C  CD2   . PHE A 73  ? 0.5714 0.7532 0.7868 -0.0091 -0.1130 0.0163  71   PHE A CD2   
531  C  CE1   . PHE A 73  ? 0.5087 0.7210 0.7534 -0.0163 -0.1073 0.0496  71   PHE A CE1   
532  C  CE2   . PHE A 73  ? 0.5834 0.7704 0.8187 -0.0199 -0.1258 0.0252  71   PHE A CE2   
533  C  CZ    . PHE A 73  ? 0.5519 0.7547 0.8028 -0.0239 -0.1229 0.0423  71   PHE A CZ    
534  N  N     . HIS A 74  ? 0.7234 0.9128 0.8744 0.0318  -0.0566 0.0060  72   HIS A N     
535  C  CA    . HIS A 74  ? 0.6818 0.8631 0.8149 0.0407  -0.0439 -0.0001 72   HIS A CA    
536  C  C     . HIS A 74  ? 0.5589 0.7475 0.6888 0.0451  -0.0327 0.0101  72   HIS A C     
537  O  O     . HIS A 74  ? 0.5441 0.7227 0.6681 0.0461  -0.0281 0.0076  72   HIS A O     
538  C  CB    . HIS A 74  ? 0.8750 1.0589 0.9982 0.0472  -0.0407 -0.0052 72   HIS A CB    
539  C  CG    . HIS A 74  ? 0.9253 1.1059 1.0322 0.0566  -0.0266 -0.0070 72   HIS A CG    
540  N  ND1   . HIS A 74  ? 1.1312 1.3239 1.2331 0.0633  -0.0183 0.0000  72   HIS A ND1   
541  C  CD2   . HIS A 74  ? 0.9560 1.1220 1.0508 0.0602  -0.0198 -0.0149 72   HIS A CD2   
542  C  CE1   . HIS A 74  ? 1.0618 1.2459 1.1484 0.0707  -0.0071 -0.0039 72   HIS A CE1   
543  N  NE2   . HIS A 74  ? 1.0038 1.1720 1.0864 0.0685  -0.0081 -0.0128 72   HIS A NE2   
544  N  N     . THR A 75  ? 0.4312 0.6377 0.5654 0.0478  -0.0288 0.0221  73   THR A N     
545  C  CA    . THR A 75  ? 0.3292 0.5431 0.4582 0.0540  -0.0175 0.0323  73   THR A CA    
546  C  C     . THR A 75  ? 0.4302 0.6406 0.5649 0.0501  -0.0186 0.0365  73   THR A C     
547  O  O     . THR A 75  ? 0.4109 0.6147 0.5339 0.0556  -0.0099 0.0363  73   THR A O     
548  C  CB    . THR A 75  ? 0.2489 0.4854 0.3863 0.0563  -0.0155 0.0469  73   THR A CB    
549  O  OG1   . THR A 75  ? 0.5399 0.7801 0.6706 0.0611  -0.0134 0.0433  73   THR A OG1   
550  C  CG2   . THR A 75  ? 0.2828 0.5267 0.4134 0.0643  -0.0034 0.0579  73   THR A CG2   
551  N  N     . ILE A 76  ? 0.4176 0.6313 0.5698 0.0405  -0.0298 0.0402  74   ILE A N     
552  C  CA    . ILE A 76  ? 0.4030 0.6147 0.5620 0.0368  -0.0311 0.0455  74   ILE A CA    
553  C  C     . ILE A 76  ? 0.4151 0.6057 0.5634 0.0366  -0.0310 0.0321  74   ILE A C     
554  O  O     . ILE A 76  ? 0.5557 0.7415 0.6966 0.0401  -0.0245 0.0333  74   ILE A O     
555  C  CB    . ILE A 76  ? 0.5225 0.7429 0.7041 0.0262  -0.0435 0.0537  74   ILE A CB    
556  C  CG1   . ILE A 76  ? 0.6677 0.9125 0.8616 0.0268  -0.0413 0.0719  74   ILE A CG1   
557  C  CG2   . ILE A 76  ? 0.5085 0.7199 0.6959 0.0210  -0.0473 0.0540  74   ILE A CG2   
558  C  CD1   . ILE A 76  ? 0.5923 0.8476 0.8100 0.0156  -0.0549 0.0802  74   ILE A CD1   
559  N  N     . THR A 77  ? 0.4188 0.5969 0.5657 0.0333  -0.0380 0.0193  75   THR A N     
560  C  CA    . THR A 77  ? 0.5619 0.7219 0.7017 0.0326  -0.0388 0.0080  75   THR A CA    
561  C  C     . THR A 77  ? 0.4865 0.6390 0.6079 0.0408  -0.0273 0.0026  75   THR A C     
562  O  O     . THR A 77  ? 0.3166 0.4603 0.4327 0.0414  -0.0244 0.0002  75   THR A O     
563  C  CB    . THR A 77  ? 0.5809 0.7300 0.7222 0.0288  -0.0483 -0.0039 75   THR A CB    
564  O  OG1   . THR A 77  ? 0.6052 0.7588 0.7416 0.0323  -0.0475 -0.0069 75   THR A OG1   
565  C  CG2   . THR A 77  ? 0.5421 0.6917 0.7005 0.0195  -0.0613 -0.0005 75   THR A CG2   
566  N  N     . THR A 78  ? 0.4146 0.5703 0.5265 0.0470  -0.0210 0.0010  76   THR A N     
567  C  CA    . THR A 78  ? 0.5447 0.6932 0.6394 0.0547  -0.0100 -0.0027 76   THR A CA    
568  C  C     . THR A 78  ? 0.6004 0.7518 0.6906 0.0581  -0.0033 0.0057  76   THR A C     
569  O  O     . THR A 78  ? 0.7942 0.9342 0.8716 0.0618  0.0023  0.0009  76   THR A O     
570  C  CB    . THR A 78  ? 0.6282 0.7824 0.7153 0.0610  -0.0043 -0.0026 76   THR A CB    
571  O  OG1   . THR A 78  ? 0.8013 0.9732 0.8988 0.0602  -0.0064 0.0084  76   THR A OG1   
572  C  CG2   . THR A 78  ? 0.4458 0.5921 0.5304 0.0603  -0.0081 -0.0140 76   THR A CG2   
573  N  N     . SER A 79  ? 0.4298 0.5962 0.5306 0.0569  -0.0044 0.0186  77   SER A N     
574  C  CA    . SER A 79  ? 0.4664 0.6372 0.5640 0.0608  0.0013  0.0280  77   SER A CA    
575  C  C     . SER A 79  ? 0.5535 0.7102 0.6459 0.0591  0.0005  0.0218  77   SER A C     
576  O  O     . SER A 79  ? 0.6147 0.7682 0.6954 0.0649  0.0072  0.0243  77   SER A O     
577  C  CB    . SER A 79  ? 0.4393 0.6283 0.5547 0.0569  -0.0029 0.0426  77   SER A CB    
578  O  OG    . SER A 79  ? 1.0100 1.2005 1.1262 0.0578  -0.0008 0.0497  77   SER A OG    
579  N  N     . TYR A 80  ? 0.4147 0.5624 0.5145 0.0518  -0.0079 0.0134  78   TYR A N     
580  C  CA    . TYR A 80  ? 0.3684 0.5055 0.4673 0.0490  -0.0104 0.0092  78   TYR A CA    
581  C  C     . TYR A 80  ? 0.6601 0.7809 0.7467 0.0504  -0.0086 -0.0040 78   TYR A C     
582  O  O     . TYR A 80  ? 0.7100 0.8220 0.7959 0.0480  -0.0110 -0.0081 78   TYR A O     
583  C  CB    . TYR A 80  ? 0.4310 0.5694 0.5476 0.0402  -0.0211 0.0105  78   TYR A CB    
584  C  CG    . TYR A 80  ? 0.4419 0.5962 0.5724 0.0378  -0.0231 0.0252  78   TYR A CG    
585  C  CD1   . TYR A 80  ? 0.3707 0.5382 0.5107 0.0364  -0.0253 0.0320  78   TYR A CD1   
586  C  CD2   . TYR A 80  ? 0.6490 0.8063 0.7835 0.0373  -0.0227 0.0333  78   TYR A CD2   
587  C  CE1   . TYR A 80  ? 0.5343 0.7179 0.6888 0.0338  -0.0272 0.0469  78   TYR A CE1   
588  C  CE2   . TYR A 80  ? 0.6100 0.7833 0.7585 0.0354  -0.0240 0.0483  78   TYR A CE2   
589  C  CZ    . TYR A 80  ? 0.5200 0.7067 0.6790 0.0334  -0.0263 0.0554  78   TYR A CZ    
590  O  OH    . TYR A 80  ? 0.6076 0.8118 0.7824 0.0310  -0.0277 0.0717  78   TYR A OH    
591  N  N     . TYR A 81  ? 0.5785 0.6955 0.6559 0.0542  -0.0044 -0.0101 79   TYR A N     
592  C  CA    . TYR A 81  ? 0.5057 0.6083 0.5730 0.0552  -0.0026 -0.0213 79   TYR A CA    
593  C  C     . TYR A 81  ? 0.4706 0.5655 0.5249 0.0590  0.0030  -0.0212 79   TYR A C     
594  O  O     . TYR A 81  ? 0.6193 0.7025 0.6680 0.0580  0.0028  -0.0293 79   TYR A O     
595  C  CB    . TYR A 81  ? 0.3883 0.4889 0.4485 0.0589  0.0013  -0.0267 79   TYR A CB    
596  C  CG    . TYR A 81  ? 0.4231 0.5275 0.4928 0.0558  -0.0049 -0.0300 79   TYR A CG    
597  C  CD1   . TYR A 81  ? 0.5708 0.6827 0.6548 0.0503  -0.0132 -0.0258 79   TYR A CD1   
598  C  CD2   . TYR A 81  ? 0.5944 0.6942 0.6582 0.0585  -0.0028 -0.0374 79   TYR A CD2   
599  C  CE1   . TYR A 81  ? 0.4546 0.5680 0.5454 0.0477  -0.0200 -0.0298 79   TYR A CE1   
600  C  CE2   . TYR A 81  ? 0.4893 0.5919 0.5596 0.0568  -0.0087 -0.0410 79   TYR A CE2   
601  C  CZ    . TYR A 81  ? 0.3471 0.4558 0.4302 0.0515  -0.0176 -0.0377 79   TYR A CZ    
602  O  OH    . TYR A 81  ? 0.4666 0.5763 0.5545 0.0501  -0.0246 -0.0421 79   TYR A OH    
603  N  N     . ARG A 82  ? 0.7039 0.8056 0.7539 0.0634  0.0075  -0.0120 80   ARG A N     
604  C  CA    . ARG A 82  ? 0.6527 0.7463 0.6860 0.0694  0.0137  -0.0122 80   ARG A CA    
605  C  C     . ARG A 82  ? 0.7109 0.7947 0.7427 0.0661  0.0100  -0.0170 80   ARG A C     
606  O  O     . ARG A 82  ? 0.9772 1.0487 0.9956 0.0684  0.0126  -0.0229 80   ARG A O     
607  C  CB    . ARG A 82  ? 0.5558 0.6602 0.5854 0.0758  0.0188  -0.0003 80   ARG A CB    
608  N  N     . GLY A 83  ? 0.5235 0.6123 0.5687 0.0606  0.0036  -0.0140 81   GLY A N     
609  C  CA    . GLY A 83  ? 0.6323 0.7135 0.6755 0.0585  0.0006  -0.0170 81   GLY A CA    
610  C  C     . GLY A 83  ? 0.5657 0.6385 0.6149 0.0525  -0.0050 -0.0266 81   GLY A C     
611  O  O     . GLY A 83  ? 0.6126 0.6782 0.6588 0.0510  -0.0072 -0.0303 81   GLY A O     
612  N  N     . ALA A 84  ? 0.6021 0.6762 0.6591 0.0497  -0.0074 -0.0305 82   ALA A N     
613  C  CA    . ALA A 84  ? 0.5271 0.5959 0.5922 0.0447  -0.0133 -0.0378 82   ALA A CA    
614  C  C     . ALA A 84  ? 0.5677 0.6256 0.6241 0.0451  -0.0117 -0.0459 82   ALA A C     
615  O  O     . ALA A 84  ? 0.4725 0.5258 0.5184 0.0484  -0.0064 -0.0487 82   ALA A O     
616  C  CB    . ALA A 84  ? 0.5696 0.6415 0.6418 0.0435  -0.0156 -0.0405 82   ALA A CB    
617  N  N     . MET A 85  ? 0.4892 0.5432 0.5510 0.0415  -0.0165 -0.0490 83   MET A N     
618  C  CA    . MET A 85  ? 0.4328 0.4784 0.4899 0.0408  -0.0161 -0.0560 83   MET A CA    
619  C  C     . MET A 85  ? 0.5859 0.6301 0.6489 0.0396  -0.0177 -0.0621 83   MET A C     
620  O  O     . MET A 85  ? 0.5582 0.5972 0.6167 0.0401  -0.0153 -0.0669 83   MET A O     
621  C  CB    . MET A 85  ? 0.4985 0.5417 0.5577 0.0383  -0.0202 -0.0557 83   MET A CB    
622  C  CG    . MET A 85  ? 0.5879 0.6326 0.6397 0.0406  -0.0187 -0.0494 83   MET A CG    
623  S  SD    . MET A 85  ? 0.7000 0.7422 0.7524 0.0385  -0.0233 -0.0491 83   MET A SD    
624  C  CE    . MET A 85  ? 0.6999 0.7314 0.7410 0.0383  -0.0222 -0.0568 83   MET A CE    
625  N  N     . GLY A 86  ? 0.4816 0.5300 0.5541 0.0384  -0.0216 -0.0618 84   GLY A N     
626  C  CA    . GLY A 86  ? 0.3973 0.4441 0.4731 0.0390  -0.0228 -0.0677 84   GLY A CA    
627  C  C     . GLY A 86  ? 0.5157 0.5671 0.5969 0.0393  -0.0257 -0.0666 84   GLY A C     
628  O  O     . GLY A 86  ? 0.4784 0.5335 0.5662 0.0368  -0.0300 -0.0618 84   GLY A O     
629  N  N     . ILE A 87  ? 0.4455 0.4968 0.5241 0.0423  -0.0237 -0.0708 85   ILE A N     
630  C  CA    . ILE A 87  ? 0.4415 0.4967 0.5237 0.0429  -0.0270 -0.0707 85   ILE A CA    
631  C  C     . ILE A 87  ? 0.5332 0.5845 0.6165 0.0451  -0.0299 -0.0779 85   ILE A C     
632  O  O     . ILE A 87  ? 0.5123 0.5613 0.5906 0.0484  -0.0253 -0.0818 85   ILE A O     
633  C  CB    . ILE A 87  ? 0.3548 0.4155 0.4308 0.0461  -0.0213 -0.0678 85   ILE A CB    
634  C  CG1   . ILE A 87  ? 0.5928 0.6569 0.6653 0.0459  -0.0172 -0.0607 85   ILE A CG1   
635  C  CG2   . ILE A 87  ? 0.4393 0.5055 0.5205 0.0458  -0.0262 -0.0665 85   ILE A CG2   
636  C  CD1   . ILE A 87  ? 0.3661 0.4351 0.4313 0.0502  -0.0108 -0.0574 85   ILE A CD1   
637  N  N     . MET A 88  ? 0.5208 0.5710 0.6103 0.0436  -0.0377 -0.0792 86   MET A N     
638  C  CA    . MET A 88  ? 0.4873 0.5333 0.5758 0.0472  -0.0412 -0.0861 86   MET A CA    
639  C  C     . MET A 88  ? 0.4953 0.5455 0.5814 0.0493  -0.0421 -0.0864 86   MET A C     
640  O  O     . MET A 88  ? 0.6461 0.6992 0.7376 0.0457  -0.0479 -0.0829 86   MET A O     
641  C  CB    . MET A 88  ? 0.6071 0.6468 0.7022 0.0449  -0.0501 -0.0882 86   MET A CB    
642  C  CG    . MET A 88  ? 0.6123 0.6495 0.7116 0.0419  -0.0504 -0.0861 86   MET A CG    
643  S  SD    . MET A 88  ? 0.7839 0.8168 0.8801 0.0464  -0.0471 -0.0917 86   MET A SD    
644  C  CE    . MET A 88  ? 0.6265 0.6543 0.7306 0.0427  -0.0538 -0.0902 86   MET A CE    
645  N  N     . LEU A 89  ? 0.5835 0.6349 0.6621 0.0550  -0.0366 -0.0898 87   LEU A N     
646  C  CA    . LEU A 89  ? 0.4639 0.5181 0.5395 0.0583  -0.0387 -0.0919 87   LEU A CA    
647  C  C     . LEU A 89  ? 0.5414 0.5886 0.6167 0.0609  -0.0464 -0.0989 87   LEU A C     
648  O  O     . LEU A 89  ? 0.5865 0.6286 0.6596 0.0643  -0.0450 -0.1031 87   LEU A O     
649  C  CB    . LEU A 89  ? 0.3633 0.4216 0.4306 0.0642  -0.0297 -0.0925 87   LEU A CB    
650  C  CG    . LEU A 89  ? 0.5196 0.5822 0.5841 0.0633  -0.0212 -0.0866 87   LEU A CG    
651  C  CD1   . LEU A 89  ? 0.4535 0.5115 0.5167 0.0625  -0.0159 -0.0867 87   LEU A CD1   
652  C  CD2   . LEU A 89  ? 0.6763 0.7439 0.7339 0.0688  -0.0154 -0.0864 87   LEU A CD2   
653  N  N     . VAL A 90  ? 0.5319 0.5786 0.6092 0.0595  -0.0550 -0.1000 88   VAL A N     
654  C  CA    . VAL A 90  ? 0.7507 0.7880 0.8266 0.0618  -0.0641 -0.1070 88   VAL A CA    
655  C  C     . VAL A 90  ? 0.8293 0.8680 0.8987 0.0665  -0.0675 -0.1111 88   VAL A C     
656  O  O     . VAL A 90  ? 0.9271 0.9734 0.9990 0.0636  -0.0688 -0.1069 88   VAL A O     
657  C  CB    . VAL A 90  ? 0.6397 0.6713 0.7251 0.0543  -0.0744 -0.1050 88   VAL A CB    
658  C  CG1   . VAL A 90  ? 0.6824 0.7011 0.7650 0.0576  -0.0820 -0.1127 88   VAL A CG1   
659  C  CG2   . VAL A 90  ? 0.4733 0.5080 0.5660 0.0487  -0.0703 -0.0981 88   VAL A CG2   
660  N  N     . TYR A 91  ? 0.8301 0.8623 0.8908 0.0745  -0.0686 -0.1188 89   TYR A N     
661  C  CA    . TYR A 91  ? 0.7102 0.7406 0.7632 0.0798  -0.0745 -0.1244 89   TYR A CA    
662  C  C     . TYR A 91  ? 0.6633 0.6795 0.7122 0.0830  -0.0848 -0.1324 89   TYR A C     
663  O  O     . TYR A 91  ? 0.6830 0.6917 0.7356 0.0813  -0.0865 -0.1331 89   TYR A O     
664  C  CB    . TYR A 91  ? 0.7582 0.7950 0.8011 0.0893  -0.0647 -0.1260 89   TYR A CB    
665  C  CG    . TYR A 91  ? 0.7898 0.8230 0.8267 0.0975  -0.0580 -0.1297 89   TYR A CG    
666  C  CD1   . TYR A 91  ? 0.9111 0.9473 0.9527 0.0955  -0.0490 -0.1253 89   TYR A CD1   
667  C  CD2   . TYR A 91  ? 0.6643 0.6917 0.6906 0.1076  -0.0608 -0.1371 89   TYR A CD2   
668  C  CE1   . TYR A 91  ? 0.8923 0.9272 0.9303 0.1025  -0.0430 -0.1273 89   TYR A CE1   
669  C  CE2   . TYR A 91  ? 0.5938 0.6198 0.6154 0.1158  -0.0540 -0.1390 89   TYR A CE2   
670  C  CZ    . TYR A 91  ? 0.7170 0.7476 0.7456 0.1128  -0.0451 -0.1337 89   TYR A CZ    
671  O  OH    . TYR A 91  ? 0.8989 0.9300 0.9248 0.1204  -0.0386 -0.1343 89   TYR A OH    
672  N  N     . ASP A 92  ? 0.8444 0.8565 0.8848 0.0881  -0.0920 -0.1386 90   ASP A N     
673  C  CA    . ASP A 92  ? 0.8735 0.8700 0.9071 0.0922  -0.1033 -0.1473 90   ASP A CA    
674  C  C     . ASP A 92  ? 0.8443 0.8390 0.8623 0.1063  -0.0987 -0.1543 90   ASP A C     
675  O  O     . ASP A 92  ? 0.8988 0.9016 0.9104 0.1112  -0.0952 -0.1546 90   ASP A O     
676  C  CB    . ASP A 92  ? 0.8786 0.8707 0.9150 0.0858  -0.1178 -0.1487 90   ASP A CB    
677  C  CG    . ASP A 92  ? 0.9718 0.9447 1.0013 0.0886  -0.1315 -0.1578 90   ASP A CG    
678  O  OD1   . ASP A 92  ? 1.0302 0.9942 1.0480 0.0993  -0.1292 -0.1647 90   ASP A OD1   
679  O  OD2   . ASP A 92  ? 0.9366 0.9031 0.9725 0.0801  -0.1448 -0.1577 90   ASP A OD2   
680  N  N     . ILE A 93  ? 0.8038 0.7887 0.8158 0.1136  -0.0983 -0.1593 91   ILE A N     
681  C  CA    . ILE A 93  ? 0.8770 0.8624 0.8748 0.1282  -0.0920 -0.1642 91   ILE A CA    
682  C  C     . ILE A 93  ? 0.8641 0.8421 0.8481 0.1354  -0.1017 -0.1725 91   ILE A C     
683  O  O     . ILE A 93  ? 0.6911 0.6748 0.6639 0.1461  -0.0959 -0.1746 91   ILE A O     
684  C  CB    . ILE A 93  ? 0.8557 0.8339 0.8504 0.1354  -0.0886 -0.1666 91   ILE A CB    
685  C  CG1   . ILE A 93  ? 0.7683 0.7273 0.7546 0.1394  -0.1019 -0.1753 91   ILE A CG1   
686  C  CG2   . ILE A 93  ? 0.7704 0.7539 0.7796 0.1264  -0.0824 -0.1590 91   ILE A CG2   
687  C  CD1   . ILE A 93  ? 0.8609 0.8137 0.8386 0.1519  -0.0977 -0.1788 91   ILE A CD1   
688  N  N     . THR A 94  ? 0.8668 0.8321 0.8514 0.1295  -0.1170 -0.1769 92   THR A N     
689  C  CA    . THR A 94  ? 0.7421 0.6992 0.7137 0.1350  -0.1284 -0.1850 92   THR A CA    
690  C  C     . THR A 94  ? 0.8412 0.8121 0.8159 0.1305  -0.1282 -0.1811 92   THR A C     
691  O  O     . THR A 94  ? 1.1122 1.0804 1.0749 0.1369  -0.1350 -0.1872 92   THR A O     
692  C  CB    . THR A 94  ? 0.8644 0.8024 0.8369 0.1287  -0.1459 -0.1906 92   THR A CB    
693  O  OG1   . THR A 94  ? 0.9361 0.8797 0.9256 0.1127  -0.1520 -0.1835 92   THR A OG1   
694  C  CG2   . THR A 94  ? 0.9829 0.9087 0.9562 0.1306  -0.1455 -0.1921 92   THR A CG2   
695  N  N     . ASN A 95  ? 0.8542 0.8396 0.8439 0.1204  -0.1206 -0.1710 93   ASN A N     
696  C  CA    . ASN A 95  ? 0.7745 0.7733 0.7693 0.1149  -0.1208 -0.1658 93   ASN A CA    
697  C  C     . ASN A 95  ? 0.8780 0.8928 0.8716 0.1202  -0.1038 -0.1599 93   ASN A C     
698  O  O     . ASN A 95  ? 1.0977 1.1190 1.1005 0.1158  -0.0935 -0.1530 93   ASN A O     
699  C  CB    . ASN A 95  ? 0.6538 0.6559 0.6665 0.0993  -0.1267 -0.1581 93   ASN A CB    
700  C  CG    . ASN A 95  ? 0.7138 0.7312 0.7330 0.0937  -0.1267 -0.1514 93   ASN A CG    
701  O  OD1   . ASN A 95  ? 0.8826 0.9103 0.8944 0.1009  -0.1191 -0.1508 93   ASN A OD1   
702  N  ND2   . ASN A 95  ? 0.8836 0.9032 0.9171 0.0812  -0.1353 -0.1454 93   ASN A ND2   
703  N  N     . GLY A 96  ? 0.7302 0.7509 0.7123 0.1296  -0.1014 -0.1626 94   GLY A N     
704  C  CA    . GLY A 96  ? 0.6677 0.7031 0.6488 0.1345  -0.0858 -0.1566 94   GLY A CA    
705  C  C     . GLY A 96  ? 0.8725 0.9211 0.8660 0.1245  -0.0813 -0.1468 94   GLY A C     
706  O  O     . GLY A 96  ? 0.8564 0.9138 0.8533 0.1248  -0.0679 -0.1404 94   GLY A O     
707  N  N     . LYS A 97  ? 0.9965 1.0465 0.9969 0.1159  -0.0925 -0.1453 95   LYS A N     
708  C  CA    . LYS A 97  ? 0.8395 0.9033 0.8512 0.1076  -0.0884 -0.1353 95   LYS A CA    
709  C  C     . LYS A 97  ? 0.8283 0.8935 0.8514 0.1001  -0.0806 -0.1282 95   LYS A C     
710  O  O     . LYS A 97  ? 0.6125 0.6879 0.6387 0.0995  -0.0690 -0.1209 95   LYS A O     
711  C  CB    . LYS A 97  ? 0.7370 0.8022 0.7558 0.0992  -0.1032 -0.1343 95   LYS A CB    
712  C  CG    . LYS A 97  ? 0.7724 0.8546 0.8004 0.0936  -0.0997 -0.1240 95   LYS A CG    
713  C  CD    . LYS A 97  ? 0.8904 0.9836 0.9086 0.1034  -0.0895 -0.1228 95   LYS A CD    
714  C  CE    . LYS A 97  ? 1.0970 1.2070 1.1242 0.0987  -0.0839 -0.1116 95   LYS A CE    
715  N  NZ    . LYS A 97  ? 1.2104 1.3304 1.2286 0.1083  -0.0707 -0.1090 95   LYS A NZ    
716  N  N     . SER A 98  ? 0.8779 0.9319 0.9064 0.0948  -0.0873 -0.1306 96   SER A N     
717  C  CA    . SER A 98  ? 0.7764 0.8310 0.8148 0.0880  -0.0809 -0.1245 96   SER A CA    
718  C  C     . SER A 98  ? 0.7919 0.8491 0.8252 0.0944  -0.0662 -0.1234 96   SER A C     
719  O  O     . SER A 98  ? 1.0596 1.1230 1.0987 0.0904  -0.0575 -0.1164 96   SER A O     
720  C  CB    . SER A 98  ? 0.7924 0.8337 0.8357 0.0831  -0.0906 -0.1280 96   SER A CB    
721  O  OG    . SER A 98  ? 0.7080 0.7376 0.7401 0.0919  -0.0935 -0.1376 96   SER A OG    
722  N  N     . PHE A 99  ? 0.5432 0.5957 0.5656 0.1046  -0.0634 -0.1300 97   PHE A N     
723  C  CA    . PHE A 99  ? 0.6797 0.7354 0.6992 0.1101  -0.0499 -0.1280 97   PHE A CA    
724  C  C     . PHE A 99  ? 0.7621 0.8291 0.7783 0.1136  -0.0397 -0.1230 97   PHE A C     
725  O  O     . PHE A 99  ? 0.9045 0.9752 0.9225 0.1135  -0.0287 -0.1182 97   PHE A O     
726  C  CB    . PHE A 99  ? 0.7005 0.7492 0.7105 0.1205  -0.0493 -0.1350 97   PHE A CB    
727  C  CG    . PHE A 99  ? 0.6845 0.7379 0.6932 0.1259  -0.0358 -0.1318 97   PHE A CG    
728  C  CD1   . PHE A 99  ? 0.6745 0.7256 0.6908 0.1213  -0.0319 -0.1290 97   PHE A CD1   
729  C  CD2   . PHE A 99  ? 0.5748 0.6352 0.5754 0.1351  -0.0274 -0.1311 97   PHE A CD2   
730  C  CE1   . PHE A 99  ? 0.6862 0.7418 0.7028 0.1250  -0.0206 -0.1256 97   PHE A CE1   
731  C  CE2   . PHE A 99  ? 0.5692 0.6340 0.5704 0.1391  -0.0154 -0.1271 97   PHE A CE2   
732  C  CZ    . PHE A 99  ? 0.6398 0.7020 0.6493 0.1337  -0.0124 -0.1244 97   PHE A CZ    
733  N  N     . GLU A 100 ? 0.7510 0.8234 0.7622 0.1167  -0.0432 -0.1238 98   GLU A N     
734  C  CA    . GLU A 100 ? 0.8872 0.9705 0.8957 0.1201  -0.0330 -0.1182 98   GLU A CA    
735  C  C     . GLU A 100 ? 0.7643 0.8540 0.7819 0.1113  -0.0300 -0.1098 98   GLU A C     
736  O  O     . GLU A 100 ? 0.6612 0.7571 0.6771 0.1134  -0.0191 -0.1044 98   GLU A O     
737  C  CB    . GLU A 100 ? 1.0783 1.1667 1.0779 0.1273  -0.0368 -0.1212 98   GLU A CB    
738  C  CG    . GLU A 100 ? 1.3168 1.4035 1.3187 0.1225  -0.0521 -0.1244 98   GLU A CG    
739  C  CD    . GLU A 100 ? 1.4171 1.5027 1.4068 0.1318  -0.0589 -0.1316 98   GLU A CD    
740  O  OE1   . GLU A 100 ? 1.3770 1.4728 1.3622 0.1362  -0.0560 -0.1291 98   GLU A OE1   
741  O  OE2   . GLU A 100 ? 1.5206 1.5946 1.5042 0.1352  -0.0672 -0.1399 98   GLU A OE2   
742  N  N     . ASN A 101 ? 0.6616 0.7494 0.6885 0.1020  -0.0389 -0.1082 99   ASN A N     
743  C  CA    . ASN A 101 ? 0.4761 0.5707 0.5114 0.0946  -0.0358 -0.0994 99   ASN A CA    
744  C  C     . ASN A 101 ? 0.5880 0.6782 0.6272 0.0908  -0.0288 -0.0964 99   ASN A C     
745  O  O     . ASN A 101 ? 0.6494 0.7441 0.6939 0.0856  -0.0258 -0.0893 99   ASN A O     
746  C  CB    . ASN A 101 ? 0.3756 0.4720 0.4203 0.0864  -0.0482 -0.0973 99   ASN A CB    
747  C  CG    . ASN A 101 ? 0.5751 0.6794 0.6180 0.0884  -0.0545 -0.0974 99   ASN A CG    
748  O  OD1   . ASN A 101 ? 0.8841 0.9977 0.9219 0.0938  -0.0471 -0.0941 99   ASN A OD1   
749  N  ND2   . ASN A 101 ? 0.6484 0.7485 0.6954 0.0841  -0.0687 -0.1011 99   ASN A ND2   
750  N  N     . ILE A 102 ? 0.5835 0.6657 0.6198 0.0936  -0.0262 -0.1012 100  ILE A N     
751  C  CA    . ILE A 102 ? 0.6058 0.6842 0.6454 0.0900  -0.0200 -0.0985 100  ILE A CA    
752  C  C     . ILE A 102 ? 0.5937 0.6772 0.6305 0.0911  -0.0089 -0.0924 100  ILE A C     
753  O  O     . ILE A 102 ? 0.6929 0.7753 0.7329 0.0862  -0.0059 -0.0880 100  ILE A O     
754  C  CB    . ILE A 102 ? 0.6847 0.7560 0.7216 0.0942  -0.0183 -0.1039 100  ILE A CB    
755  C  CG1   . ILE A 102 ? 0.8264 0.8902 0.8664 0.0923  -0.0293 -0.1094 100  ILE A CG1   
756  C  CG2   . ILE A 102 ? 0.4370 0.5061 0.4763 0.0915  -0.0105 -0.1007 100  ILE A CG2   
757  C  CD1   . ILE A 102 ? 0.8720 0.9330 0.9215 0.0830  -0.0348 -0.1063 100  ILE A CD1   
758  N  N     . SER A 103 ? 0.6007 0.6890 0.6303 0.0980  -0.0029 -0.0920 101  SER A N     
759  C  CA    . SER A 103 ? 0.6987 0.7902 0.7243 0.0999  0.0077  -0.0864 101  SER A CA    
760  C  C     . SER A 103 ? 0.6890 0.7856 0.7179 0.0953  0.0071  -0.0798 101  SER A C     
761  O  O     . SER A 103 ? 0.8803 0.9747 0.9083 0.0933  0.0132  -0.0755 101  SER A O     
762  C  CB    . SER A 103 ? 0.9035 1.0002 0.9213 0.1086  0.0131  -0.0867 101  SER A CB    
763  O  OG    . SER A 103 ? 1.1061 1.2092 1.1234 0.1104  0.0057  -0.0882 101  SER A OG    
764  N  N     . LYS A 104 ? 0.5339 0.6375 0.5666 0.0937  -0.0006 -0.0787 102  LYS A N     
765  C  CA    . LYS A 104 ? 0.7934 0.9046 0.8307 0.0899  -0.0012 -0.0710 102  LYS A CA    
766  C  C     . LYS A 104 ? 0.7374 0.8444 0.7820 0.0824  -0.0044 -0.0687 102  LYS A C     
767  O  O     . LYS A 104 ? 0.5808 0.6903 0.6254 0.0812  0.0006  -0.0622 102  LYS A O     
768  C  CB    . LYS A 104 ? 0.7728 0.8935 0.8141 0.0894  -0.0097 -0.0699 102  LYS A CB    
769  C  CG    . LYS A 104 ? 1.1446 1.2753 1.1938 0.0847  -0.0119 -0.0609 102  LYS A CG    
770  C  CD    . LYS A 104 ? 1.3464 1.4849 1.4027 0.0818  -0.0237 -0.0608 102  LYS A CD    
771  C  CE    . LYS A 104 ? 1.4210 1.5506 1.4842 0.0754  -0.0355 -0.0664 102  LYS A CE    
772  N  NZ    . LYS A 104 ? 1.4632 1.5985 1.5348 0.0705  -0.0481 -0.0652 102  LYS A NZ    
773  N  N     . TRP A 105 ? 0.6522 0.7524 0.7020 0.0784  -0.0124 -0.0739 103  TRP A N     
774  C  CA    . TRP A 105 ? 0.6132 0.7092 0.6695 0.0719  -0.0149 -0.0717 103  TRP A CA    
775  C  C     . TRP A 105 ? 0.6598 0.7504 0.7107 0.0730  -0.0056 -0.0704 103  TRP A C     
776  O  O     . TRP A 105 ? 0.8293 0.9210 0.8813 0.0703  -0.0031 -0.0647 103  TRP A O     
777  C  CB    . TRP A 105 ? 0.5425 0.6306 0.6037 0.0687  -0.0240 -0.0781 103  TRP A CB    
778  C  CG    . TRP A 105 ? 0.5896 0.6806 0.6579 0.0651  -0.0353 -0.0781 103  TRP A CG    
779  C  CD1   . TRP A 105 ? 0.5073 0.5946 0.5739 0.0672  -0.0431 -0.0850 103  TRP A CD1   
780  C  CD2   . TRP A 105 ? 0.4936 0.5916 0.5717 0.0587  -0.0406 -0.0705 103  TRP A CD2   
781  N  NE1   . TRP A 105 ? 0.5198 0.6100 0.5947 0.0616  -0.0539 -0.0828 103  TRP A NE1   
782  C  CE2   . TRP A 105 ? 0.5807 0.6785 0.6640 0.0560  -0.0524 -0.0733 103  TRP A CE2   
783  C  CE3   . TRP A 105 ? 0.5808 0.6853 0.6637 0.0555  -0.0367 -0.0613 103  TRP A CE3   
784  C  CZ2   . TRP A 105 ? 0.4952 0.5997 0.5902 0.0490  -0.0606 -0.0664 103  TRP A CZ2   
785  C  CZ3   . TRP A 105 ? 0.6859 0.7983 0.7800 0.0496  -0.0438 -0.0540 103  TRP A CZ3   
786  C  CH2   . TRP A 105 ? 0.6140 0.7267 0.7151 0.0458  -0.0557 -0.0562 103  TRP A CH2   
787  N  N     . LEU A 106 ? 0.5896 0.6742 0.6344 0.0770  -0.0006 -0.0754 104  LEU A N     
788  C  CA    . LEU A 106 ? 0.6648 0.7434 0.7047 0.0774  0.0073  -0.0744 104  LEU A CA    
789  C  C     . LEU A 106 ? 0.7215 0.8033 0.7552 0.0798  0.0147  -0.0682 104  LEU A C     
790  O  O     . LEU A 106 ? 0.7606 0.8374 0.7911 0.0782  0.0183  -0.0656 104  LEU A O     
791  C  CB    . LEU A 106 ? 0.4957 0.5696 0.5314 0.0815  0.0118  -0.0792 104  LEU A CB    
792  C  CG    . LEU A 106 ? 0.5125 0.5824 0.5523 0.0812  0.0070  -0.0850 104  LEU A CG    
793  C  CD1   . LEU A 106 ? 0.6203 0.6907 0.6553 0.0880  0.0119  -0.0879 104  LEU A CD1   
794  C  CD2   . LEU A 106 ? 0.4373 0.5007 0.4803 0.0763  0.0070  -0.0851 104  LEU A CD2   
795  N  N     . ARG A 107 ? 0.5603 0.6498 0.5911 0.0842  0.0168  -0.0658 105  ARG A N     
796  C  CA    . ARG A 107 ? 0.5786 0.6712 0.6026 0.0878  0.0244  -0.0595 105  ARG A CA    
797  C  C     . ARG A 107 ? 0.6613 0.7589 0.6893 0.0845  0.0221  -0.0529 105  ARG A C     
798  O  O     . ARG A 107 ? 0.6749 0.7703 0.6962 0.0866  0.0283  -0.0484 105  ARG A O     
799  C  CB    . ARG A 107 ? 0.5216 0.6226 0.5419 0.0939  0.0275  -0.0579 105  ARG A CB    
800  C  CG    . ARG A 107 ? 0.6837 0.7975 0.7091 0.0935  0.0235  -0.0520 105  ARG A CG    
801  C  CD    . ARG A 107 ? 1.0337 1.1552 1.0522 0.1008  0.0305  -0.0477 105  ARG A CD    
802  N  NE    . ARG A 107 ? 1.1848 1.3016 1.1943 0.1046  0.0401  -0.0434 105  ARG A NE    
803  C  CZ    . ARG A 107 ? 1.3852 1.5018 1.3859 0.1113  0.0482  -0.0414 105  ARG A CZ    
804  N  NH1   . ARG A 107 ? 1.4620 1.5841 1.4618 0.1152  0.0485  -0.0430 105  ARG A NH1   
805  N  NH2   . ARG A 107 ? 1.1553 1.2654 1.1470 0.1147  0.0561  -0.0379 105  ARG A NH2   
806  N  N     . ASN A 108 ? 0.4986 0.6026 0.5373 0.0796  0.0131  -0.0519 106  ASN A N     
807  C  CA    . ASN A 108 ? 0.5876 0.6965 0.6320 0.0758  0.0106  -0.0449 106  ASN A CA    
808  C  C     . ASN A 108 ? 0.5976 0.6967 0.6390 0.0737  0.0126  -0.0458 106  ASN A C     
809  O  O     . ASN A 108 ? 0.5213 0.6221 0.5602 0.0743  0.0157  -0.0395 106  ASN A O     
810  C  CB    . ASN A 108 ? 0.6761 0.7904 0.7337 0.0695  -0.0005 -0.0443 106  ASN A CB    
811  C  CG    . ASN A 108 ? 0.5998 0.7234 0.6616 0.0703  -0.0052 -0.0438 106  ASN A CG    
812  O  OD1   . ASN A 108 ? 0.7546 0.8870 0.8128 0.0749  -0.0003 -0.0389 106  ASN A OD1   
813  N  ND2   . ASN A 108 ? 0.6137 0.7351 0.6830 0.0659  -0.0153 -0.0487 106  ASN A ND2   
814  N  N     . ILE A 109 ? 0.5508 0.6403 0.5929 0.0712  0.0100  -0.0532 107  ILE A N     
815  C  CA    . ILE A 109 ? 0.4780 0.5582 0.5171 0.0690  0.0115  -0.0546 107  ILE A CA    
816  C  C     . ILE A 109 ? 0.5793 0.6539 0.6057 0.0737  0.0206  -0.0529 107  ILE A C     
817  O  O     . ILE A 109 ? 0.7262 0.7981 0.7477 0.0740  0.0228  -0.0492 107  ILE A O     
818  C  CB    . ILE A 109 ? 0.3199 0.3924 0.3623 0.0663  0.0078  -0.0623 107  ILE A CB    
819  C  CG1   . ILE A 109 ? 0.3219 0.3968 0.3756 0.0614  -0.0018 -0.0635 107  ILE A CG1   
820  C  CG2   . ILE A 109 ? 0.3250 0.3879 0.3626 0.0649  0.0106  -0.0640 107  ILE A CG2   
821  C  CD1   . ILE A 109 ? 0.3995 0.4678 0.4559 0.0604  -0.0054 -0.0708 107  ILE A CD1   
822  N  N     . ASP A 110 ? 0.5362 0.6086 0.5562 0.0781  0.0260  -0.0554 108  ASP A N     
823  C  CA    . ASP A 110 ? 0.5580 0.6231 0.5654 0.0827  0.0343  -0.0540 108  ASP A CA    
824  C  C     . ASP A 110 ? 0.5540 0.6244 0.5557 0.0868  0.0381  -0.0463 108  ASP A C     
825  O  O     . ASP A 110 ? 0.5060 0.5685 0.4976 0.0890  0.0422  -0.0446 108  ASP A O     
826  C  CB    . ASP A 110 ? 0.7397 0.8038 0.7428 0.0872  0.0395  -0.0563 108  ASP A CB    
827  C  CG    . ASP A 110 ? 1.0341 1.0907 1.0395 0.0848  0.0386  -0.0626 108  ASP A CG    
828  O  OD1   . ASP A 110 ? 1.0408 1.1016 1.0493 0.0869  0.0385  -0.0651 108  ASP A OD1   
829  O  OD2   . ASP A 110 ? 1.1863 1.2335 1.1905 0.0813  0.0380  -0.0646 108  ASP A OD2   
830  N  N     . GLU A 111 ? 0.5811 0.6651 0.5890 0.0879  0.0364  -0.0414 109  GLU A N     
831  C  CA    . GLU A 111 ? 0.4898 0.5824 0.4943 0.0924  0.0402  -0.0326 109  GLU A CA    
832  C  C     . GLU A 111 ? 0.4840 0.5770 0.4903 0.0899  0.0378  -0.0283 109  GLU A C     
833  O  O     . GLU A 111 ? 0.5875 0.6784 0.5835 0.0952  0.0435  -0.0233 109  GLU A O     
834  C  CB    . GLU A 111 ? 0.5259 0.6348 0.5399 0.0927  0.0372  -0.0280 109  GLU A CB    
835  C  CG    . GLU A 111 ? 0.8555 0.9680 0.8629 0.0993  0.0432  -0.0273 109  GLU A CG    
836  C  CD    . GLU A 111 ? 1.1442 1.2558 1.1388 0.1074  0.0527  -0.0210 109  GLU A CD    
837  O  OE1   . GLU A 111 ? 1.3443 1.4429 1.3265 0.1114  0.0592  -0.0246 109  GLU A OE1   
838  O  OE2   . GLU A 111 ? 1.1796 1.3033 1.1766 0.1098  0.0537  -0.0120 109  GLU A OE2   
839  N  N     . HIS A 112 ? 0.3808 0.4758 0.3992 0.0828  0.0296  -0.0299 110  HIS A N     
840  C  CA    . HIS A 112 ? 0.4539 0.5547 0.4779 0.0805  0.0266  -0.0233 110  HIS A CA    
841  C  C     . HIS A 112 ? 0.5365 0.6274 0.5615 0.0756  0.0225  -0.0277 110  HIS A C     
842  O  O     . HIS A 112 ? 0.7192 0.8134 0.7461 0.0750  0.0214  -0.0220 110  HIS A O     
843  C  CB    . HIS A 112 ? 0.5600 0.6757 0.6001 0.0762  0.0197  -0.0180 110  HIS A CB    
844  C  CG    . HIS A 112 ? 0.6152 0.7439 0.6556 0.0808  0.0232  -0.0113 110  HIS A CG    
845  N  ND1   . HIS A 112 ? 0.5677 0.7023 0.6145 0.0795  0.0194  -0.0138 110  HIS A ND1   
846  C  CD2   . HIS A 112 ? 0.4804 0.6175 0.5149 0.0875  0.0302  -0.0020 110  HIS A CD2   
847  C  CE1   . HIS A 112 ? 0.4277 0.5745 0.4733 0.0845  0.0235  -0.0062 110  HIS A CE1   
848  N  NE2   . HIS A 112 ? 0.5028 0.6517 0.5414 0.0896  0.0304  0.0013  110  HIS A NE2   
849  N  N     . ALA A 113 ? 0.5260 0.6062 0.5502 0.0727  0.0206  -0.0367 111  ALA A N     
850  C  CA    . ALA A 113 ? 0.4836 0.5549 0.5083 0.0685  0.0170  -0.0406 111  ALA A CA    
851  C  C     . ALA A 113 ? 0.6195 0.6792 0.6290 0.0722  0.0226  -0.0420 111  ALA A C     
852  O  O     . ALA A 113 ? 0.6279 0.6843 0.6260 0.0780  0.0292  -0.0412 111  ALA A O     
853  C  CB    . ALA A 113 ? 0.4819 0.5482 0.5136 0.0639  0.0121  -0.0487 111  ALA A CB    
854  N  N     . ASN A 114 ? 0.7047 0.7574 0.7134 0.0691  0.0193  -0.0443 112  ASN A N     
855  C  CA    . ASN A 114 ? 0.6900 0.7288 0.6852 0.0707  0.0221  -0.0484 112  ASN A CA    
856  C  C     . ASN A 114 ? 0.7173 0.7488 0.7124 0.0691  0.0232  -0.0552 112  ASN A C     
857  O  O     . ASN A 114 ? 0.8881 0.9239 0.8945 0.0655  0.0198  -0.0583 112  ASN A O     
858  C  CB    . ASN A 114 ? 0.7740 0.8077 0.7700 0.0669  0.0172  -0.0499 112  ASN A CB    
859  C  CG    . ASN A 114 ? 0.6562 0.6966 0.6510 0.0694  0.0169  -0.0424 112  ASN A CG    
860  O  OD1   . ASN A 114 ? 0.7259 0.7722 0.7314 0.0653  0.0116  -0.0403 112  ASN A OD1   
861  N  ND2   . ASN A 114 ? 0.6007 0.6404 0.5823 0.0767  0.0228  -0.0377 112  ASN A ND2   
862  N  N     . GLU A 115 ? 0.6936 0.7137 0.6755 0.0723  0.0279  -0.0573 113  GLU A N     
863  C  CA    . GLU A 115 ? 0.7182 0.7306 0.7005 0.0701  0.0288  -0.0628 113  GLU A CA    
864  C  C     . GLU A 115 ? 0.7402 0.7505 0.7319 0.0632  0.0225  -0.0672 113  GLU A C     
865  O  O     . GLU A 115 ? 0.9060 0.9176 0.9059 0.0606  0.0215  -0.0704 113  GLU A O     
866  C  CB    . GLU A 115 ? 0.7871 0.7852 0.7536 0.0736  0.0336  -0.0640 113  GLU A CB    
867  C  CG    . GLU A 115 ? 0.9309 0.9205 0.8855 0.0751  0.0323  -0.0631 113  GLU A CG    
868  C  CD    . GLU A 115 ? 1.0129 0.9841 0.9534 0.0756  0.0334  -0.0669 113  GLU A CD    
869  O  OE1   . GLU A 115 ? 1.0088 0.9710 0.9422 0.0741  0.0294  -0.0688 113  GLU A OE1   
870  O  OE2   . GLU A 115 ? 1.2053 1.1704 1.1416 0.0775  0.0379  -0.0679 113  GLU A OE2   
871  N  N     . ASP A 116 ? 0.7447 0.7529 0.7354 0.0610  0.0183  -0.0666 114  ASP A N     
872  C  CA    . ASP A 116 ? 0.7814 0.7862 0.7787 0.0550  0.0125  -0.0703 114  ASP A CA    
873  C  C     . ASP A 116 ? 0.6786 0.6931 0.6918 0.0515  0.0084  -0.0714 114  ASP A C     
874  O  O     . ASP A 116 ? 0.8234 0.8362 0.8434 0.0475  0.0051  -0.0746 114  ASP A O     
875  C  CB    . ASP A 116 ? 0.6806 0.6823 0.6722 0.0546  0.0092  -0.0687 114  ASP A CB    
876  C  CG    . ASP A 116 ? 1.0931 1.0851 1.0825 0.0502  0.0049  -0.0729 114  ASP A CG    
877  O  OD1   . ASP A 116 ? 1.3502 1.3347 1.3380 0.0483  0.0060  -0.0762 114  ASP A OD1   
878  O  OD2   . ASP A 116 ? 1.2220 1.2146 1.2121 0.0483  0.0003  -0.0723 114  ASP A OD2   
879  N  N     . VAL A 117 ? 0.3764 0.4007 0.3955 0.0533  0.0083  -0.0685 115  VAL A N     
880  C  CA    . VAL A 117 ? 0.4802 0.5117 0.5124 0.0501  0.0025  -0.0688 115  VAL A CA    
881  C  C     . VAL A 117 ? 0.6127 0.6441 0.6524 0.0486  0.0012  -0.0737 115  VAL A C     
882  O  O     . VAL A 117 ? 0.6153 0.6446 0.6519 0.0506  0.0054  -0.0757 115  VAL A O     
883  C  CB    . VAL A 117 ? 0.4821 0.5231 0.5188 0.0519  0.0020  -0.0645 115  VAL A CB    
884  C  CG1   . VAL A 117 ? 0.3750 0.4188 0.4102 0.0554  0.0060  -0.0656 115  VAL A CG1   
885  C  CG2   . VAL A 117 ? 0.3121 0.3581 0.3613 0.0481  -0.0051 -0.0643 115  VAL A CG2   
886  N  N     . GLU A 118 ? 0.4841 0.5180 0.5334 0.0456  -0.0045 -0.0750 116  GLU A N     
887  C  CA    . GLU A 118 ? 0.4998 0.5351 0.5565 0.0456  -0.0062 -0.0789 116  GLU A CA    
888  C  C     . GLU A 118 ? 0.8015 0.8422 0.8623 0.0479  -0.0080 -0.0793 116  GLU A C     
889  O  O     . GLU A 118 ? 0.9042 0.9483 0.9681 0.0468  -0.0115 -0.0765 116  GLU A O     
890  C  CB    . GLU A 118 ? 0.3354 0.3700 0.3994 0.0422  -0.0116 -0.0801 116  GLU A CB    
891  C  CG    . GLU A 118 ? 0.4697 0.4994 0.5310 0.0394  -0.0111 -0.0805 116  GLU A CG    
892  C  CD    . GLU A 118 ? 0.8253 0.8534 0.8864 0.0401  -0.0073 -0.0825 116  GLU A CD    
893  O  OE1   . GLU A 118 ? 0.7161 0.7479 0.7844 0.0413  -0.0079 -0.0842 116  GLU A OE1   
894  O  OE2   . GLU A 118 ? 0.7913 0.8141 0.8447 0.0398  -0.0037 -0.0820 116  GLU A OE2   
895  N  N     . ARG A 119 ? 0.7808 0.8226 0.8418 0.0512  -0.0058 -0.0824 117  ARG A N     
896  C  CA    . ARG A 119 ? 0.5591 0.6048 0.6227 0.0540  -0.0083 -0.0841 117  ARG A CA    
897  C  C     . ARG A 119 ? 0.4593 0.5042 0.5279 0.0556  -0.0112 -0.0884 117  ARG A C     
898  O  O     . ARG A 119 ? 0.5847 0.6287 0.6530 0.0571  -0.0076 -0.0897 117  ARG A O     
899  C  CB    . ARG A 119 ? 0.6540 0.7024 0.7113 0.0586  -0.0026 -0.0837 117  ARG A CB    
900  C  CG    . ARG A 119 ? 0.6522 0.7002 0.7024 0.0586  0.0025  -0.0795 117  ARG A CG    
901  C  CD    . ARG A 119 ? 0.7647 0.8119 0.8080 0.0630  0.0099  -0.0798 117  ARG A CD    
902  N  NE    . ARG A 119 ? 1.1703 1.2138 1.2051 0.0634  0.0151  -0.0763 117  ARG A NE    
903  C  CZ    . ARG A 119 ? 1.3396 1.3857 1.3680 0.0675  0.0199  -0.0736 117  ARG A CZ    
904  N  NH1   . ARG A 119 ? 1.3012 1.3544 1.3312 0.0710  0.0198  -0.0738 117  ARG A NH1   
905  N  NH2   . ARG A 119 ? 1.3604 1.4015 1.3797 0.0687  0.0246  -0.0706 117  ARG A NH2   
906  N  N     . MET A 120 ? 0.5192 0.5640 0.5924 0.0555  -0.0179 -0.0902 118  MET A N     
907  C  CA    . MET A 120 ? 0.4835 0.5265 0.5595 0.0587  -0.0211 -0.0946 118  MET A CA    
908  C  C     . MET A 120 ? 0.5063 0.5495 0.5804 0.0625  -0.0249 -0.0977 118  MET A C     
909  O  O     . MET A 120 ? 0.6936 0.7375 0.7693 0.0597  -0.0295 -0.0961 118  MET A O     
910  C  CB    . MET A 120 ? 0.6145 0.6542 0.6969 0.0553  -0.0269 -0.0946 118  MET A CB    
911  C  CG    . MET A 120 ? 0.6699 0.7070 0.7544 0.0596  -0.0302 -0.0989 118  MET A CG    
912  S  SD    . MET A 120 ? 0.6975 0.7311 0.7894 0.0558  -0.0358 -0.0979 118  MET A SD    
913  C  CE    . MET A 120 ? 0.5499 0.5873 0.6429 0.0542  -0.0295 -0.0953 118  MET A CE    
914  N  N     . LEU A 121 ? 0.5432 0.5864 0.6139 0.0691  -0.0232 -0.1017 119  LEU A N     
915  C  CA    . LEU A 121 ? 0.4916 0.5344 0.5582 0.0740  -0.0267 -0.1055 119  LEU A CA    
916  C  C     . LEU A 121 ? 0.3919 0.4282 0.4596 0.0765  -0.0345 -0.1104 119  LEU A C     
917  O  O     . LEU A 121 ? 0.4091 0.4437 0.4776 0.0797  -0.0331 -0.1120 119  LEU A O     
918  C  CB    . LEU A 121 ? 0.4721 0.5189 0.5321 0.0813  -0.0194 -0.1067 119  LEU A CB    
919  C  CG    . LEU A 121 ? 0.5909 0.6379 0.6445 0.0880  -0.0224 -0.1110 119  LEU A CG    
920  C  CD1   . LEU A 121 ? 0.5803 0.6307 0.6324 0.0854  -0.0243 -0.1090 119  LEU A CD1   
921  C  CD2   . LEU A 121 ? 0.5243 0.5749 0.5722 0.0965  -0.0147 -0.1119 119  LEU A CD2   
922  N  N     . LEU A 122 ? 0.3752 0.4079 0.4432 0.0751  -0.0429 -0.1125 120  LEU A N     
923  C  CA    . LEU A 122 ? 0.4343 0.4580 0.5024 0.0769  -0.0518 -0.1174 120  LEU A CA    
924  C  C     . LEU A 122 ? 0.6313 0.6518 0.6918 0.0827  -0.0569 -0.1230 120  LEU A C     
925  O  O     . LEU A 122 ? 0.7538 0.7771 0.8146 0.0795  -0.0602 -0.1217 120  LEU A O     
926  C  CB    . LEU A 122 ? 0.4563 0.4760 0.5329 0.0684  -0.0595 -0.1145 120  LEU A CB    
927  C  CG    . LEU A 122 ? 0.5365 0.5587 0.6200 0.0628  -0.0559 -0.1090 120  LEU A CG    
928  C  CD1   . LEU A 122 ? 0.4145 0.4313 0.5057 0.0564  -0.0644 -0.1068 120  LEU A CD1   
929  C  CD2   . LEU A 122 ? 0.4307 0.4527 0.5128 0.0673  -0.0505 -0.1106 120  LEU A CD2   
930  N  N     . GLY A 123 ? 0.7761 0.7913 0.8295 0.0917  -0.0576 -0.1289 121  GLY A N     
931  C  CA    . GLY A 123 ? 0.4925 0.5014 0.5369 0.0982  -0.0647 -0.1356 121  GLY A CA    
932  C  C     . GLY A 123 ? 0.6074 0.6027 0.6525 0.0969  -0.0763 -0.1401 121  GLY A C     
933  O  O     . GLY A 123 ? 0.6846 0.6733 0.7267 0.1028  -0.0765 -0.1433 121  GLY A O     
934  N  N     . ASN A 124 ? 0.6793 0.6706 0.7289 0.0892  -0.0860 -0.1396 122  ASN A N     
935  C  CA    . ASN A 124 ? 0.7773 0.7550 0.8298 0.0857  -0.0977 -0.1424 122  ASN A CA    
936  C  C     . ASN A 124 ? 0.8325 0.7970 0.8725 0.0942  -0.1068 -0.1521 122  ASN A C     
937  O  O     . ASN A 124 ? 0.8025 0.7698 0.8327 0.1011  -0.1056 -0.1559 122  ASN A O     
938  C  CB    . ASN A 124 ? 0.6567 0.6362 0.7208 0.0733  -0.1046 -0.1365 122  ASN A CB    
939  C  CG    . ASN A 124 ? 0.6927 0.6600 0.7638 0.0677  -0.1144 -0.1364 122  ASN A CG    
940  O  OD1   . ASN A 124 ? 0.7652 0.7258 0.8352 0.0712  -0.1130 -0.1382 122  ASN A OD1   
941  N  ND2   . ASN A 124 ? 0.7191 0.6838 0.7978 0.0590  -0.1246 -0.1336 122  ASN A ND2   
942  N  N     . LYS A 125 ? 0.8652 0.8143 0.9047 0.0942  -0.1162 -0.1560 123  LYS A N     
943  C  CA    . LYS A 125 ? 0.9154 0.8477 0.9419 0.1020  -0.1269 -0.1659 123  LYS A CA    
944  C  C     . LYS A 125 ? 0.9315 0.8625 0.9431 0.1178  -0.1198 -0.1717 123  LYS A C     
945  O  O     . LYS A 125 ? 0.8478 0.7736 0.8456 0.1269  -0.1234 -0.1788 123  LYS A O     
946  C  CB    . LYS A 125 ? 0.8363 0.7671 0.8600 0.0986  -0.1365 -0.1686 123  LYS A CB    
947  C  CG    . LYS A 125 ? 0.8329 0.7688 0.8727 0.0834  -0.1423 -0.1609 123  LYS A CG    
948  C  CD    . LYS A 125 ? 0.8163 0.7518 0.8541 0.0802  -0.1525 -0.1632 123  LYS A CD    
949  C  CE    . LYS A 125 ? 0.7477 0.6872 0.8029 0.0650  -0.1600 -0.1548 123  LYS A CE    
950  N  NZ    . LYS A 125 ? 0.7194 0.6669 0.7759 0.0611  -0.1658 -0.1535 123  LYS A NZ    
951  N  N     . CYS A 126 ? 1.0791 1.0155 1.0937 0.1215  -0.1098 -0.1683 124  CYS A N     
952  C  CA    . CYS A 126 ? 1.1544 1.0915 1.1569 0.1366  -0.1025 -0.1720 124  CYS A CA    
953  C  C     . CYS A 126 ? 1.1836 1.1013 1.1740 0.1465  -0.1110 -0.1803 124  CYS A C     
954  O  O     . CYS A 126 ? 1.2733 1.1903 1.2515 0.1611  -0.1059 -0.1838 124  CYS A O     
955  C  CB    . CYS A 126 ? 1.0217 0.9724 1.0330 0.1366  -0.0894 -0.1645 124  CYS A CB    
956  S  SG    . CYS A 126 ? 1.0071 0.9535 1.0322 0.1273  -0.0919 -0.1597 124  CYS A SG    
957  N  N     . ASP A 127 ? 1.1979 1.0999 1.1913 0.1393  -0.1238 -0.1828 125  ASP A N     
958  C  CA    . ASP A 127 ? 1.2876 1.1679 1.2682 0.1486  -0.1332 -0.1913 125  ASP A CA    
959  C  C     . ASP A 127 ? 1.4079 1.2783 1.3692 0.1596  -0.1397 -0.2011 125  ASP A C     
960  O  O     . ASP A 127 ? 1.6031 1.4613 1.5479 0.1746  -0.1411 -0.2083 125  ASP A O     
961  C  CB    . ASP A 127 ? 1.3338 1.1992 1.3234 0.1367  -0.1461 -0.1910 125  ASP A CB    
962  C  CG    . ASP A 127 ? 1.3249 1.1920 1.3228 0.1231  -0.1547 -0.1892 125  ASP A CG    
963  O  OD1   . ASP A 127 ? 1.3156 1.2013 1.3199 0.1184  -0.1470 -0.1837 125  ASP A OD1   
964  O  OD2   . ASP A 127 ? 1.3737 1.2236 1.3719 0.1174  -0.1692 -0.1927 125  ASP A OD2   
965  N  N     . MET A 128 ? 1.2997 1.1755 1.2620 0.1533  -0.1437 -0.2014 126  MET A N     
966  C  CA    . MET A 128 ? 1.3665 1.2323 1.3110 0.1620  -0.1522 -0.2109 126  MET A CA    
967  C  C     . MET A 128 ? 1.3085 1.1904 1.2437 0.1743  -0.1392 -0.2104 126  MET A C     
968  O  O     . MET A 128 ? 1.1844 1.0807 1.1232 0.1701  -0.1354 -0.2070 126  MET A O     
969  C  CB    . MET A 128 ? 1.2142 1.0783 1.1660 0.1483  -0.1643 -0.2108 126  MET A CB    
970  C  CG    . MET A 128 ? 1.1902 1.0518 1.1615 0.1312  -0.1706 -0.2043 126  MET A CG    
971  S  SD    . MET A 128 ? 1.2259 1.0747 1.2007 0.1188  -0.1909 -0.2074 126  MET A SD    
972  C  CE    . MET A 128 ? 1.2791 1.0946 1.2344 0.1292  -0.2060 -0.2207 126  MET A CE    
973  N  N     . ASP A 129 ? 1.3974 1.2785 1.3213 0.1890  -0.1316 -0.2114 127  ASP A N     
974  C  CA    . ASP A 129 ? 1.4487 1.3471 1.3651 0.1995  -0.1182 -0.2070 127  ASP A CA    
975  C  C     . ASP A 129 ? 1.4976 1.3925 1.3972 0.2064  -0.1243 -0.2119 127  ASP A C     
976  O  O     . ASP A 129 ? 1.4452 1.3554 1.3410 0.2119  -0.1150 -0.2084 127  ASP A O     
977  C  CB    . ASP A 129 ? 1.3774 1.2800 1.2891 0.2100  -0.1078 -0.2018 127  ASP A CB    
978  C  CG    . ASP A 129 ? 1.4932 1.3951 1.4194 0.2042  -0.1051 -0.1983 127  ASP A CG    
979  O  OD1   . ASP A 129 ? 1.4657 1.3499 1.3915 0.2013  -0.1156 -0.2024 127  ASP A OD1   
980  O  OD2   . ASP A 129 ? 1.6056 1.5246 1.5441 0.2024  -0.0927 -0.1911 127  ASP A OD2   
981  N  N     . ASP A 130 ? 1.6373 1.5121 1.5270 0.2062  -0.1399 -0.2194 128  ASP A N     
982  C  CA    . ASP A 130 ? 1.6073 1.4777 1.4803 0.2134  -0.1469 -0.2244 128  ASP A CA    
983  C  C     . ASP A 130 ? 1.5486 1.4293 1.4270 0.2066  -0.1487 -0.2254 128  ASP A C     
984  O  O     . ASP A 130 ? 1.6720 1.5602 1.5392 0.2148  -0.1463 -0.2260 128  ASP A O     
985  C  CB    . ASP A 130 ? 1.6267 1.4721 1.4891 0.2134  -0.1643 -0.2320 128  ASP A CB    
986  C  CG    . ASP A 130 ? 1.6559 1.4891 1.5331 0.1969  -0.1772 -0.2342 128  ASP A CG    
987  O  OD1   . ASP A 130 ? 1.6898 1.5338 1.5833 0.1855  -0.1750 -0.2314 128  ASP A OD1   
988  O  OD2   . ASP A 130 ? 1.6610 1.4734 1.5334 0.1953  -0.1897 -0.2380 128  ASP A OD2   
989  N  N     . LYS A 131 ? 1.3575 1.2395 1.2528 0.1921  -0.1529 -0.2253 129  LYS A N     
990  C  CA    . LYS A 131 ? 1.1892 1.0830 1.0912 0.1841  -0.1544 -0.2242 129  LYS A CA    
991  C  C     . LYS A 131 ? 0.9657 0.8846 0.8808 0.1809  -0.1364 -0.2130 129  LYS A C     
992  O  O     . LYS A 131 ? 0.6659 0.5978 0.5896 0.1723  -0.1353 -0.2079 129  LYS A O     
993  C  CB    . LYS A 131 ? 1.2782 1.1654 1.1954 0.1654  -0.1683 -0.2223 129  LYS A CB    
994  C  CG    . LYS A 131 ? 1.4848 1.3454 1.3924 0.1652  -0.1878 -0.2325 129  LYS A CG    
995  C  CD    . LYS A 131 ? 1.5685 1.4222 1.4560 0.1759  -0.1952 -0.2392 129  LYS A CD    
996  C  CE    . LYS A 131 ? 1.5986 1.4322 1.4854 0.1674  -0.2155 -0.2435 129  LYS A CE    
997  N  NZ    . LYS A 131 ? 1.6877 1.5027 1.5764 0.1654  -0.2204 -0.2436 129  LYS A NZ    
998  N  N     . ARG A 132 ? 1.1208 1.0464 1.0377 0.1876  -0.1228 -0.2087 130  ARG A N     
999  C  CA    . ARG A 132 ? 1.1181 1.0655 1.0467 0.1846  -0.1064 -0.1983 130  ARG A CA    
1000 C  C     . ARG A 132 ? 0.9489 0.9090 0.8707 0.1898  -0.1015 -0.1975 130  ARG A C     
1001 O  O     . ARG A 132 ? 1.2019 1.1599 1.1063 0.2050  -0.1007 -0.2030 130  ARG A O     
1002 C  CB    . ARG A 132 ? 1.2369 1.1889 1.1645 0.1946  -0.0938 -0.1952 130  ARG A CB    
1003 C  CG    . ARG A 132 ? 1.1955 1.1687 1.1288 0.1969  -0.0772 -0.1865 130  ARG A CG    
1004 C  CD    . ARG A 132 ? 1.1603 1.1404 1.0959 0.2026  -0.0651 -0.1793 130  ARG A CD    
1005 N  NE    . ARG A 132 ? 1.3057 1.2805 1.2533 0.1964  -0.0666 -0.1791 130  ARG A NE    
1006 C  CZ    . ARG A 132 ? 1.2214 1.2052 1.1863 0.1825  -0.0620 -0.1712 130  ARG A CZ    
1007 N  NH1   . ARG A 132 ? 1.2514 1.2479 1.2227 0.1761  -0.0557 -0.1657 130  ARG A NH1   
1008 N  NH2   . ARG A 132 ? 1.1580 1.1375 1.1330 0.1756  -0.0637 -0.1689 130  ARG A NH2   
1009 N  N     . VAL A 133 ? 0.7400 0.7131 0.6750 0.1779  -0.0982 -0.1902 131  VAL A N     
1010 C  CA    . VAL A 133 ? 0.7621 0.7497 0.6932 0.1820  -0.0911 -0.1873 131  VAL A CA    
1011 C  C     . VAL A 133 ? 0.8099 0.8140 0.7504 0.1815  -0.0737 -0.1775 131  VAL A C     
1012 O  O     . VAL A 133 ? 0.8195 0.8348 0.7539 0.1899  -0.0643 -0.1750 131  VAL A O     
1013 C  CB    . VAL A 133 ? 0.6674 0.6578 0.6050 0.1704  -0.1005 -0.1862 131  VAL A CB    
1014 C  CG1   . VAL A 133 ? 0.6578 0.6655 0.5947 0.1728  -0.0912 -0.1808 131  VAL A CG1   
1015 C  CG2   . VAL A 133 ? 0.7082 0.6826 0.6343 0.1725  -0.1182 -0.1964 131  VAL A CG2   
1016 N  N     . VAL A 134 ? 0.7803 0.7858 0.7347 0.1725  -0.0691 -0.1718 132  VAL A N     
1017 C  CA    . VAL A 134 ? 0.8164 0.8354 0.7807 0.1701  -0.0544 -0.1627 132  VAL A CA    
1018 C  C     . VAL A 134 ? 0.8917 0.9085 0.8560 0.1767  -0.0484 -0.1622 132  VAL A C     
1019 O  O     . VAL A 134 ? 1.1068 1.1138 1.0751 0.1727  -0.0548 -0.1644 132  VAL A O     
1020 C  CB    . VAL A 134 ? 0.8402 0.8634 0.8206 0.1538  -0.0544 -0.1560 132  VAL A CB    
1021 C  CG1   . VAL A 134 ? 0.6607 0.6971 0.6484 0.1518  -0.0400 -0.1473 132  VAL A CG1   
1022 C  CG2   . VAL A 134 ? 0.9413 0.9643 0.9225 0.1468  -0.0639 -0.1571 132  VAL A CG2   
1023 N  N     . PRO A 135 ? 0.7209 0.7472 0.6813 0.1873  -0.0366 -0.1587 133  PRO A N     
1024 C  CA    . PRO A 135 ? 0.9312 0.9591 0.8954 0.1913  -0.0297 -0.1551 133  PRO A CA    
1025 C  C     . PRO A 135 ? 1.0662 1.0978 1.0475 0.1783  -0.0262 -0.1488 133  PRO A C     
1026 O  O     . PRO A 135 ? 1.1791 1.2173 1.1689 0.1683  -0.0227 -0.1436 133  PRO A O     
1027 C  CB    . PRO A 135 ? 0.9753 1.0152 0.9351 0.1973  -0.0175 -0.1458 133  PRO A CB    
1028 C  CG    . PRO A 135 ? 1.0034 1.0437 0.9514 0.2016  -0.0206 -0.1484 133  PRO A CG    
1029 C  CD    . PRO A 135 ? 0.8685 0.9023 0.8181 0.1958  -0.0315 -0.1570 133  PRO A CD    
1030 N  N     . LYS A 136 ? 1.0017 1.0287 0.9871 0.1788  -0.0272 -0.1488 134  LYS A N     
1031 C  CA    . LYS A 136 ? 0.8952 0.9261 0.8959 0.1675  -0.0237 -0.1423 134  LYS A CA    
1032 C  C     . LYS A 136 ? 0.9566 1.0019 0.9649 0.1656  -0.0112 -0.1337 134  LYS A C     
1033 O  O     . LYS A 136 ? 1.0500 1.0986 1.0690 0.1537  -0.0090 -0.1287 134  LYS A O     
1034 C  CB    . LYS A 136 ? 0.7972 0.8233 0.7992 0.1722  -0.0251 -0.1433 134  LYS A CB    
1035 C  CG    . LYS A 136 ? 0.8907 0.9190 0.9074 0.1610  -0.0239 -0.1378 134  LYS A CG    
1036 C  CD    . LYS A 136 ? 1.0283 1.0514 1.0446 0.1673  -0.0260 -0.1392 134  LYS A CD    
1037 C  CE    . LYS A 136 ? 0.9396 0.9693 0.9706 0.1588  -0.0221 -0.1321 134  LYS A CE    
1038 N  NZ    . LYS A 136 ? 0.9411 0.9724 0.9723 0.1684  -0.0196 -0.1308 134  LYS A NZ    
1039 N  N     . GLY A 137 ? 0.8067 0.8599 0.8088 0.1775  -0.0030 -0.1317 135  GLY A N     
1040 C  CA    . GLY A 137 ? 0.7119 0.7779 0.7215 0.1762  0.0088  -0.1230 135  GLY A CA    
1041 C  C     . GLY A 137 ? 0.7808 0.8502 0.7912 0.1694  0.0114  -0.1206 135  GLY A C     
1042 O  O     . GLY A 137 ? 0.7764 0.8533 0.7947 0.1645  0.0196  -0.1134 135  GLY A O     
1043 N  N     . LYS A 138 ? 0.8718 0.9356 0.8740 0.1691  0.0043  -0.1264 136  LYS A N     
1044 C  CA    . LYS A 138 ? 1.0878 1.1554 1.0914 0.1625  0.0065  -0.1235 136  LYS A CA    
1045 C  C     . LYS A 138 ? 1.0962 1.1606 1.1102 0.1476  0.0031  -0.1212 136  LYS A C     
1046 O  O     . LYS A 138 ? 1.2534 1.3223 1.2723 0.1414  0.0092  -0.1156 136  LYS A O     
1047 C  CB    . LYS A 138 ? 1.1700 1.2352 1.1620 0.1677  0.0004  -0.1293 136  LYS A CB    
1048 C  CG    . LYS A 138 ? 1.2091 1.2785 1.1894 0.1800  0.0052  -0.1283 136  LYS A CG    
1049 C  CD    . LYS A 138 ? 1.3750 1.4457 1.3462 0.1824  0.0017  -0.1309 136  LYS A CD    
1050 C  CE    . LYS A 138 ? 1.4372 1.4998 1.3951 0.1901  -0.0092 -0.1395 136  LYS A CE    
1051 N  NZ    . LYS A 138 ? 1.4352 1.4981 1.3871 0.1909  -0.0163 -0.1451 136  LYS A NZ    
1052 N  N     . GLY A 139 ? 0.8503 0.9063 0.8669 0.1425  -0.0063 -0.1252 137  GLY A N     
1053 C  CA    . GLY A 139 ? 0.7186 0.7724 0.7454 0.1297  -0.0086 -0.1221 137  GLY A CA    
1054 C  C     . GLY A 139 ? 0.7579 0.8162 0.7932 0.1262  -0.0009 -0.1161 137  GLY A C     
1055 O  O     . GLY A 139 ? 0.6838 0.7442 0.7245 0.1180  0.0026  -0.1115 137  GLY A O     
1056 N  N     . GLU A 140 ? 0.6600 0.7197 0.6962 0.1327  0.0017  -0.1160 138  GLU A N     
1057 C  CA    . GLU A 140 ? 0.5968 0.6629 0.6417 0.1302  0.0094  -0.1095 138  GLU A CA    
1058 C  C     . GLU A 140 ? 0.6593 0.7318 0.7045 0.1292  0.0182  -0.1041 138  GLU A C     
1059 O  O     . GLU A 140 ? 0.7564 0.8300 0.8086 0.1209  0.0215  -0.0993 138  GLU A O     
1060 C  CB    . GLU A 140 ? 0.6249 0.6949 0.6698 0.1402  0.0124  -0.1088 138  GLU A CB    
1061 C  CG    . GLU A 140 ? 0.7779 0.8413 0.8235 0.1413  0.0050  -0.1129 138  GLU A CG    
1062 C  CD    . GLU A 140 ? 0.8860 0.9550 0.9321 0.1520  0.0094  -0.1109 138  GLU A CD    
1063 O  OE1   . GLU A 140 ? 0.9486 1.0282 0.9985 0.1555  0.0185  -0.1044 138  GLU A OE1   
1064 O  OE2   . GLU A 140 ? 0.8369 0.8997 0.8798 0.1569  0.0038  -0.1151 138  GLU A OE2   
1065 N  N     . GLN A 141 ? 0.7554 0.8315 0.7923 0.1382  0.0218  -0.1049 139  GLN A N     
1066 C  CA    . GLN A 141 ? 0.7273 0.8094 0.7642 0.1385  0.0308  -0.0993 139  GLN A CA    
1067 C  C     . GLN A 141 ? 0.5949 0.6733 0.6336 0.1280  0.0300  -0.0977 139  GLN A C     
1068 O  O     . GLN A 141 ? 0.5969 0.6760 0.6414 0.1218  0.0350  -0.0925 139  GLN A O     
1069 C  CB    . GLN A 141 ? 0.7563 0.8426 0.7827 0.1502  0.0339  -0.1009 139  GLN A CB    
1070 C  CG    . GLN A 141 ? 0.7533 0.8469 0.7804 0.1529  0.0447  -0.0938 139  GLN A CG    
1071 C  CD    . GLN A 141 ? 1.0326 1.1292 1.0486 0.1616  0.0472  -0.0940 139  GLN A CD    
1072 O  OE1   . GLN A 141 ? 1.1643 1.2572 1.1714 0.1651  0.0400  -0.0997 139  GLN A OE1   
1073 N  NE2   . GLN A 141 ? 1.1327 1.2338 1.1494 0.1619  0.0562  -0.0860 139  GLN A NE2   
1074 N  N     . ILE A 142 ? 0.6625 0.7369 0.6965 0.1257  0.0233  -0.1020 140  ILE A N     
1075 C  CA    . ILE A 142 ? 0.6884 0.7609 0.7231 0.1176  0.0234  -0.0997 140  ILE A CA    
1076 C  C     . ILE A 142 ? 0.6796 0.7480 0.7222 0.1076  0.0220  -0.0974 140  ILE A C     
1077 O  O     . ILE A 142 ? 0.8104 0.8775 0.8541 0.1023  0.0261  -0.0934 140  ILE A O     
1078 C  CB    . ILE A 142 ? 0.6970 0.7679 0.7269 0.1171  0.0160  -0.1036 140  ILE A CB    
1079 C  CG1   . ILE A 142 ? 1.0279 1.0992 1.0579 0.1108  0.0180  -0.0997 140  ILE A CG1   
1080 C  CG2   . ILE A 142 ? 0.7556 0.8208 0.7889 0.1134  0.0057  -0.1081 140  ILE A CG2   
1081 C  CD1   . ILE A 142 ? 1.0362 1.1126 1.0598 0.1166  0.0257  -0.0967 140  ILE A CD1   
1082 N  N     . ALA A 143 ? 0.7271 0.7926 0.7743 0.1057  0.0159  -0.1000 141  ALA A N     
1083 C  CA    . ALA A 143 ? 0.5374 0.5997 0.5919 0.0971  0.0142  -0.0980 141  ALA A CA    
1084 C  C     . ALA A 143 ? 0.5144 0.5791 0.5732 0.0952  0.0215  -0.0928 141  ALA A C     
1085 O  O     . ALA A 143 ? 0.5523 0.6138 0.6124 0.0882  0.0229  -0.0900 141  ALA A O     
1086 C  CB    . ALA A 143 ? 0.4081 0.4679 0.4667 0.0973  0.0075  -0.1012 141  ALA A CB    
1087 N  N     . ARG A 144 ? 0.5574 0.6274 0.6180 0.1018  0.0261  -0.0913 142  ARG A N     
1088 C  CA    . ARG A 144 ? 0.6701 0.7435 0.7362 0.1001  0.0330  -0.0853 142  ARG A CA    
1089 C  C     . ARG A 144 ? 0.6167 0.6878 0.6784 0.0977  0.0383  -0.0823 142  ARG A C     
1090 O  O     . ARG A 144 ? 0.7120 0.7794 0.7771 0.0907  0.0401  -0.0789 142  ARG A O     
1091 C  CB    . ARG A 144 ? 0.8182 0.8999 0.8860 0.1097  0.0381  -0.0830 142  ARG A CB    
1092 C  CG    . ARG A 144 ? 0.9490 1.0360 1.0273 0.1071  0.0429  -0.0761 142  ARG A CG    
1093 C  CD    . ARG A 144 ? 1.1313 1.2281 1.2104 0.1175  0.0505  -0.0716 142  ARG A CD    
1094 N  NE    . ARG A 144 ? 1.2840 1.3832 1.3556 0.1288  0.0487  -0.0765 142  ARG A NE    
1095 C  CZ    . ARG A 144 ? 1.2177 1.3197 1.2801 0.1386  0.0524  -0.0777 142  ARG A CZ    
1096 N  NH1   . ARG A 144 ? 1.2071 1.3109 1.2677 0.1387  0.0589  -0.0736 142  ARG A NH1   
1097 N  NH2   . ARG A 144 ? 1.1274 1.2297 1.1818 0.1488  0.0493  -0.0830 142  ARG A NH2   
1098 N  N     . GLU A 145 ? 0.5747 0.6471 0.6283 0.1037  0.0403  -0.0839 143  GLU A N     
1099 C  CA    . GLU A 145 ? 0.7371 0.8078 0.7858 0.1031  0.0462  -0.0806 143  GLU A CA    
1100 C  C     . GLU A 145 ? 0.6108 0.6739 0.6573 0.0949  0.0433  -0.0809 143  GLU A C     
1101 O  O     . GLU A 145 ? 0.6209 0.6799 0.6642 0.0928  0.0481  -0.0776 143  GLU A O     
1102 C  CB    . GLU A 145 ? 0.8186 0.8937 0.8590 0.1118  0.0485  -0.0821 143  GLU A CB    
1103 C  CG    . GLU A 145 ? 0.8507 0.9330 0.8904 0.1219  0.0506  -0.0828 143  GLU A CG    
1104 C  CD    . GLU A 145 ? 1.1021 1.1884 1.1322 0.1309  0.0523  -0.0845 143  GLU A CD    
1105 O  OE1   . GLU A 145 ? 1.2094 1.3015 1.2367 0.1407  0.0547  -0.0849 143  GLU A OE1   
1106 O  OE2   . GLU A 145 ? 1.2281 1.3124 1.2532 0.1288  0.0515  -0.0850 143  GLU A OE2   
1107 N  N     . HIS A 146 ? 0.6509 0.7116 0.6984 0.0909  0.0358  -0.0844 144  HIS A N     
1108 C  CA    . HIS A 146 ? 0.7088 0.7633 0.7544 0.0839  0.0331  -0.0840 144  HIS A CA    
1109 C  C     . HIS A 146 ? 0.6745 0.7248 0.7263 0.0767  0.0297  -0.0836 144  HIS A C     
1110 O  O     . HIS A 146 ? 0.5385 0.5834 0.5881 0.0713  0.0272  -0.0832 144  HIS A O     
1111 C  CB    . HIS A 146 ? 0.5851 0.6407 0.6281 0.0840  0.0272  -0.0867 144  HIS A CB    
1112 C  CG    . HIS A 146 ? 0.5958 0.6551 0.6321 0.0893  0.0301  -0.0861 144  HIS A CG    
1113 N  ND1   . HIS A 146 ? 0.8232 0.8880 0.8578 0.0961  0.0290  -0.0888 144  HIS A ND1   
1114 C  CD2   . HIS A 146 ? 0.5617 0.6204 0.5920 0.0896  0.0341  -0.0832 144  HIS A CD2   
1115 C  CE1   . HIS A 146 ? 0.9280 0.9960 0.9565 0.0996  0.0318  -0.0873 144  HIS A CE1   
1116 N  NE2   . HIS A 146 ? 0.7113 0.7760 0.7375 0.0959  0.0352  -0.0836 144  HIS A NE2   
1117 N  N     . GLY A 147 ? 0.6384 0.6917 0.6974 0.0770  0.0295  -0.0832 145  GLY A N     
1118 C  CA    . GLY A 147 ? 0.6522 0.7028 0.7179 0.0702  0.0261  -0.0823 145  GLY A CA    
1119 C  C     . GLY A 147 ? 0.6697 0.7180 0.7364 0.0664  0.0186  -0.0851 145  GLY A C     
1120 O  O     . GLY A 147 ? 0.6098 0.6530 0.6765 0.0601  0.0160  -0.0844 145  GLY A O     
1121 N  N     . ILE A 148 ? 0.5423 0.5935 0.6093 0.0703  0.0148  -0.0882 146  ILE A N     
1122 C  CA    . ILE A 148 ? 0.5115 0.5606 0.5806 0.0669  0.0075  -0.0903 146  ILE A CA    
1123 C  C     . ILE A 148 ? 0.5504 0.6020 0.6243 0.0708  0.0037  -0.0929 146  ILE A C     
1124 O  O     . ILE A 148 ? 0.6694 0.7250 0.7433 0.0772  0.0069  -0.0935 146  ILE A O     
1125 C  CB    . ILE A 148 ? 0.5924 0.6403 0.6563 0.0669  0.0051  -0.0911 146  ILE A CB    
1126 C  CG1   . ILE A 148 ? 0.5715 0.6228 0.6325 0.0737  0.0049  -0.0938 146  ILE A CG1   
1127 C  CG2   . ILE A 148 ? 0.4167 0.4621 0.4745 0.0647  0.0096  -0.0881 146  ILE A CG2   
1128 C  CD1   . ILE A 148 ? 0.5469 0.5985 0.6049 0.0731  0.0012  -0.0941 146  ILE A CD1   
1129 N  N     . ARG A 149 ? 0.6687 0.7178 0.7459 0.0675  -0.0029 -0.0943 147  ARG A N     
1130 C  CA    . ARG A 149 ? 0.5717 0.6212 0.6526 0.0713  -0.0071 -0.0970 147  ARG A CA    
1131 C  C     . ARG A 149 ? 0.5022 0.5500 0.5781 0.0768  -0.0105 -0.1011 147  ARG A C     
1132 O  O     . ARG A 149 ? 0.6451 0.6916 0.7175 0.0750  -0.0122 -0.1014 147  ARG A O     
1133 C  CB    . ARG A 149 ? 0.4689 0.5155 0.5551 0.0659  -0.0131 -0.0965 147  ARG A CB    
1134 C  CG    . ARG A 149 ? 0.5489 0.5964 0.6390 0.0598  -0.0114 -0.0929 147  ARG A CG    
1135 C  CD    . ARG A 149 ? 0.5553 0.6056 0.6528 0.0602  -0.0131 -0.0921 147  ARG A CD    
1136 N  NE    . ARG A 149 ? 0.6683 0.7187 0.7695 0.0533  -0.0137 -0.0890 147  ARG A NE    
1137 C  CZ    . ARG A 149 ? 0.6255 0.6796 0.7305 0.0514  -0.0104 -0.0861 147  ARG A CZ    
1138 N  NH1   . ARG A 149 ? 0.7362 0.7891 0.8436 0.0448  -0.0125 -0.0840 147  ARG A NH1   
1139 N  NH2   . ARG A 149 ? 0.6048 0.6639 0.7115 0.0563  -0.0052 -0.0849 147  ARG A NH2   
1140 N  N     . PHE A 150 ? 0.5588 0.6069 0.6342 0.0838  -0.0116 -0.1040 148  PHE A N     
1141 C  CA    . PHE A 150 ? 0.6673 0.7119 0.7368 0.0898  -0.0163 -0.1090 148  PHE A CA    
1142 C  C     . PHE A 150 ? 0.7037 0.7428 0.7751 0.0921  -0.0229 -0.1122 148  PHE A C     
1143 O  O     . PHE A 150 ? 0.8276 0.8688 0.9035 0.0936  -0.0211 -0.1106 148  PHE A O     
1144 C  CB    . PHE A 150 ? 0.6842 0.7331 0.7473 0.0992  -0.0107 -0.1102 148  PHE A CB    
1145 C  CG    . PHE A 150 ? 0.8334 0.8777 0.8888 0.1068  -0.0161 -0.1162 148  PHE A CG    
1146 C  CD1   . PHE A 150 ? 0.9544 0.9938 1.0071 0.1034  -0.0233 -0.1190 148  PHE A CD1   
1147 C  CD2   . PHE A 150 ? 0.8749 0.9199 0.9255 0.1176  -0.0144 -0.1187 148  PHE A CD2   
1148 C  CE1   . PHE A 150 ? 1.0415 1.0753 1.0867 0.1098  -0.0297 -0.1251 148  PHE A CE1   
1149 C  CE2   . PHE A 150 ? 0.9059 0.9450 0.9472 0.1254  -0.0201 -0.1251 148  PHE A CE2   
1150 C  CZ    . PHE A 150 ? 0.9760 1.0087 1.0145 0.1211  -0.0284 -0.1287 148  PHE A CZ    
1151 N  N     . PHE A 151 ? 0.6846 0.7167 0.7530 0.0922  -0.0309 -0.1163 149  PHE A N     
1152 C  CA    . PHE A 151 ? 0.5654 0.5896 0.6335 0.0956  -0.0378 -0.1201 149  PHE A CA    
1153 C  C     . PHE A 151 ? 0.6387 0.6555 0.6986 0.1005  -0.0447 -0.1262 149  PHE A C     
1154 O  O     . PHE A 151 ? 0.7740 0.7913 0.8324 0.0968  -0.0470 -0.1263 149  PHE A O     
1155 C  CB    . PHE A 151 ? 0.6187 0.6388 0.6947 0.0869  -0.0435 -0.1178 149  PHE A CB    
1156 C  CG    . PHE A 151 ? 0.7786 0.8034 0.8615 0.0844  -0.0394 -0.1136 149  PHE A CG    
1157 C  CD1   . PHE A 151 ? 0.8850 0.9113 0.9682 0.0914  -0.0371 -0.1141 149  PHE A CD1   
1158 C  CD2   . PHE A 151 ? 0.7945 0.8227 0.8832 0.0754  -0.0381 -0.1087 149  PHE A CD2   
1159 C  CE1   . PHE A 151 ? 0.8179 0.8498 0.9086 0.0886  -0.0340 -0.1096 149  PHE A CE1   
1160 C  CE2   . PHE A 151 ? 0.7618 0.7940 0.8563 0.0729  -0.0354 -0.1051 149  PHE A CE2   
1161 C  CZ    . PHE A 151 ? 0.6865 0.7210 0.7828 0.0789  -0.0336 -0.1055 149  PHE A CZ    
1162 N  N     . GLU A 152 ? 0.8334 0.8435 0.8877 0.1093  -0.0481 -0.1312 150  GLU A N     
1163 C  CA    . GLU A 152 ? 0.7557 0.7544 0.8020 0.1131  -0.0577 -0.1380 150  GLU A CA    
1164 C  C     . GLU A 152 ? 0.7700 0.7578 0.8211 0.1081  -0.0668 -0.1390 150  GLU A C     
1165 O  O     . GLU A 152 ? 0.8546 0.8408 0.9086 0.1105  -0.0655 -0.1380 150  GLU A O     
1166 C  CB    . GLU A 152 ? 0.8361 0.8321 0.8703 0.1274  -0.0562 -0.1435 150  GLU A CB    
1167 C  CG    . GLU A 152 ? 0.9072 0.9084 0.9330 0.1327  -0.0529 -0.1452 150  GLU A CG    
1168 C  CD    . GLU A 152 ? 1.0788 1.0753 1.0904 0.1479  -0.0534 -0.1515 150  GLU A CD    
1169 O  OE1   . GLU A 152 ? 0.9427 0.9424 0.9458 0.1534  -0.0518 -0.1536 150  GLU A OE1   
1170 O  OE2   . GLU A 152 ? 1.1421 1.1317 1.1503 0.1550  -0.0551 -0.1540 150  GLU A OE2   
1171 N  N     . THR A 153 ? 0.6733 0.6543 0.7263 0.1010  -0.0759 -0.1402 151  THR A N     
1172 C  CA    . THR A 153 ? 0.7143 0.6864 0.7745 0.0939  -0.0842 -0.1391 151  THR A CA    
1173 C  C     . THR A 153 ? 0.8043 0.7617 0.8592 0.0945  -0.0969 -0.1453 151  THR A C     
1174 O  O     . THR A 153 ? 0.8978 0.8542 0.9455 0.0971  -0.0999 -0.1492 151  THR A O     
1175 C  CB    . THR A 153 ? 0.7759 0.7557 0.8479 0.0815  -0.0831 -0.1313 151  THR A CB    
1176 O  OG1   . THR A 153 ? 0.7800 0.7624 0.8519 0.0770  -0.0863 -0.1307 151  THR A OG1   
1177 C  CG2   . THR A 153 ? 0.6746 0.6673 0.7502 0.0805  -0.0716 -0.1259 151  THR A CG2   
1178 N  N     . SER A 154 ? 0.8156 0.7611 0.8742 0.0917  -0.1048 -0.1459 152  SER A N     
1179 C  CA    . SER A 154 ? 0.8274 0.7566 0.8828 0.0902  -0.1184 -0.1511 152  SER A CA    
1180 C  C     . SER A 154 ? 0.6972 0.6221 0.7657 0.0790  -0.1247 -0.1453 152  SER A C     
1181 O  O     . SER A 154 ? 0.8008 0.7212 0.8724 0.0800  -0.1238 -0.1438 152  SER A O     
1182 C  CB    . SER A 154 ? 0.8547 0.7682 0.8961 0.1028  -0.1230 -0.1601 152  SER A CB    
1183 O  OG    . SER A 154 ? 0.8323 0.7272 0.8719 0.0997  -0.1374 -0.1647 152  SER A OG    
1184 N  N     . ALA A 155 ? 0.6286 0.5560 0.7053 0.0686  -0.1305 -0.1412 153  ALA A N     
1185 C  CA    . ALA A 155 ? 0.6954 0.6177 0.7848 0.0583  -0.1379 -0.1353 153  ALA A CA    
1186 C  C     . ALA A 155 ? 0.7655 0.6660 0.8504 0.0611  -0.1496 -0.1415 153  ALA A C     
1187 O  O     . ALA A 155 ? 0.8259 0.7200 0.9183 0.0573  -0.1525 -0.1378 153  ALA A O     
1188 C  CB    . ALA A 155 ? 0.6968 0.6263 0.7954 0.0478  -0.1427 -0.1296 153  ALA A CB    
1189 N  N     . LYS A 156 ? 1.0323 0.9204 1.1039 0.0685  -0.1564 -0.1512 154  LYS A N     
1190 C  CA    . LYS A 156 ? 1.1490 1.0134 1.2136 0.0722  -0.1686 -0.1583 154  LYS A CA    
1191 C  C     . LYS A 156 ? 0.9997 0.8577 1.0574 0.0828  -0.1630 -0.1611 154  LYS A C     
1192 O  O     . LYS A 156 ? 1.0085 0.8559 1.0714 0.0804  -0.1673 -0.1590 154  LYS A O     
1193 C  CB    . LYS A 156 ? 1.2250 1.0781 1.2750 0.0783  -0.1773 -0.1684 154  LYS A CB    
1194 C  CG    . LYS A 156 ? 1.2491 1.0749 1.2903 0.0812  -0.1925 -0.1767 154  LYS A CG    
1195 C  CD    . LYS A 156 ? 1.2416 1.0577 1.2661 0.0886  -0.2003 -0.1872 154  LYS A CD    
1196 C  CE    . LYS A 156 ? 1.1302 0.9167 1.1401 0.0959  -0.2140 -0.1978 154  LYS A CE    
1197 N  NZ    . LYS A 156 ? 1.1080 0.8877 1.0945 0.1127  -0.2129 -0.2091 154  LYS A NZ    
1198 N  N     . ALA A 157 ? 0.7985 0.6638 0.8451 0.0947  -0.1530 -0.1649 155  ALA A N     
1199 C  CA    . ALA A 157 ? 0.7716 0.6327 0.8111 0.1062  -0.1473 -0.1672 155  ALA A CA    
1200 C  C     . ALA A 157 ? 0.8724 0.7486 0.9247 0.1020  -0.1370 -0.1580 155  ALA A C     
1201 O  O     . ALA A 157 ? 0.7676 0.6432 0.8165 0.1107  -0.1318 -0.1583 155  ALA A O     
1202 C  CB    . ALA A 157 ? 0.8043 0.6693 0.8282 0.1209  -0.1404 -0.1735 155  ALA A CB    
1203 N  N     . ASN A 158 ? 0.9183 0.8080 0.9848 0.0894  -0.1344 -0.1497 156  ASN A N     
1204 C  CA    . ASN A 158 ? 0.9314 0.8357 1.0090 0.0850  -0.1252 -0.1412 156  ASN A CA    
1205 C  C     . ASN A 158 ? 0.8391 0.7570 0.9119 0.0935  -0.1127 -0.1412 156  ASN A C     
1206 O  O     . ASN A 158 ? 1.0012 0.9250 1.0779 0.0959  -0.1067 -0.1376 156  ASN A O     
1207 C  CB    . ASN A 158 ? 0.9948 0.8891 1.0778 0.0840  -0.1293 -0.1387 156  ASN A CB    
1208 C  CG    . ASN A 158 ? 1.0754 0.9832 1.1722 0.0751  -0.1237 -0.1288 156  ASN A CG    
1209 O  OD1   . ASN A 158 ? 1.2399 1.1647 1.3397 0.0736  -0.1142 -0.1249 156  ASN A OD1   
1210 N  ND2   . ASN A 158 ? 1.1841 1.0839 1.2890 0.0695  -0.1299 -0.1246 156  ASN A ND2   
1211 N  N     . ILE A 159 ? 0.7169 0.6406 0.7820 0.0981  -0.1091 -0.1448 157  ILE A N     
1212 C  CA    . ILE A 159 ? 0.7311 0.6683 0.7925 0.1057  -0.0973 -0.1439 157  ILE A CA    
1213 C  C     . ILE A 159 ? 0.9010 0.8553 0.9719 0.0965  -0.0896 -0.1367 157  ILE A C     
1214 O  O     . ILE A 159 ? 0.8981 0.8556 0.9702 0.0905  -0.0911 -0.1359 157  ILE A O     
1215 C  CB    . ILE A 159 ? 0.8442 0.7785 0.8914 0.1168  -0.0968 -0.1511 157  ILE A CB    
1216 C  CG1   . ILE A 159 ? 0.7518 0.6672 0.7868 0.1275  -0.1047 -0.1590 157  ILE A CG1   
1217 C  CG2   . ILE A 159 ? 0.7208 0.6710 0.7664 0.1238  -0.0840 -0.1484 157  ILE A CG2   
1218 C  CD1   . ILE A 159 ? 0.8585 0.7683 0.8774 0.1386  -0.1064 -0.1670 157  ILE A CD1   
1219 N  N     . ASN A 160 ? 1.0508 1.0155 1.1284 0.0955  -0.0820 -0.1313 158  ASN A N     
1220 C  CA    . ASN A 160 ? 0.8698 0.8499 0.9533 0.0898  -0.0734 -0.1254 158  ASN A CA    
1221 C  C     . ASN A 160 ? 0.7199 0.7031 0.8112 0.0779  -0.0756 -0.1204 158  ASN A C     
1222 O  O     . ASN A 160 ? 0.6312 0.6250 0.7249 0.0738  -0.0691 -0.1165 158  ASN A O     
1223 C  CB    . ASN A 160 ? 0.8167 0.8042 0.8934 0.0953  -0.0668 -0.1274 158  ASN A CB    
1224 C  CG    . ASN A 160 ? 0.8537 0.8482 0.9281 0.1044  -0.0589 -0.1269 158  ASN A CG    
1225 O  OD1   . ASN A 160 ? 0.7969 0.7930 0.8761 0.1057  -0.0577 -0.1243 158  ASN A OD1   
1226 N  ND2   . ASN A 160 ? 0.9932 0.9931 1.0609 0.1111  -0.0534 -0.1286 158  ASN A ND2   
1227 N  N     . ILE A 161 ? 0.7311 0.7051 0.8263 0.0726  -0.0843 -0.1200 159  ILE A N     
1228 C  CA    . ILE A 161 ? 0.6097 0.5881 0.7127 0.0621  -0.0859 -0.1139 159  ILE A CA    
1229 C  C     . ILE A 161 ? 0.7175 0.7046 0.8275 0.0576  -0.0805 -0.1073 159  ILE A C     
1230 O  O     . ILE A 161 ? 0.6966 0.6938 0.8078 0.0539  -0.0743 -0.1034 159  ILE A O     
1231 C  CB    . ILE A 161 ? 0.7250 0.6918 0.8320 0.0574  -0.0970 -0.1139 159  ILE A CB    
1232 C  CG1   . ILE A 161 ? 0.6879 0.6454 0.7872 0.0613  -0.1038 -0.1209 159  ILE A CG1   
1233 C  CG2   . ILE A 161 ? 0.6188 0.5923 0.7356 0.0471  -0.0980 -0.1057 159  ILE A CG2   
1234 C  CD1   . ILE A 161 ? 0.6982 0.6639 0.7968 0.0579  -0.1023 -0.1198 159  ILE A CD1   
1235 N  N     . GLU A 162 ? 0.7502 0.7326 0.8640 0.0584  -0.0831 -0.1063 160  GLU A N     
1236 C  CA    . GLU A 162 ? 0.6735 0.6634 0.7936 0.0544  -0.0793 -0.1003 160  GLU A CA    
1237 C  C     . GLU A 162 ? 0.7252 0.7262 0.8431 0.0562  -0.0704 -0.0996 160  GLU A C     
1238 O  O     . GLU A 162 ? 0.8631 0.8716 0.9836 0.0509  -0.0667 -0.0950 160  GLU A O     
1239 C  CB    . GLU A 162 ? 0.6618 0.6452 0.7850 0.0570  -0.0831 -0.1000 160  GLU A CB    
1240 C  CG    . GLU A 162 ? 0.9151 0.9068 1.0440 0.0543  -0.0793 -0.0944 160  GLU A CG    
1241 C  CD    . GLU A 162 ? 1.0926 1.0779 1.2272 0.0529  -0.0849 -0.0912 160  GLU A CD    
1242 O  OE1   . GLU A 162 ? 0.9890 0.9709 1.1282 0.0468  -0.0896 -0.0874 160  GLU A OE1   
1243 O  OE2   . GLU A 162 ? 1.1610 1.1454 1.2962 0.0580  -0.0844 -0.0917 160  GLU A OE2   
1244 N  N     . LYS A 163 ? 0.7756 0.7771 0.8883 0.0640  -0.0669 -0.1040 161  LYS A N     
1245 C  CA    . LYS A 163 ? 0.8744 0.8864 0.9870 0.0654  -0.0589 -0.1024 161  LYS A CA    
1246 C  C     . LYS A 163 ? 0.9108 0.9285 1.0208 0.0616  -0.0544 -0.1012 161  LYS A C     
1247 O  O     . LYS A 163 ? 0.8596 0.8844 0.9712 0.0582  -0.0494 -0.0979 161  LYS A O     
1248 C  CB    . LYS A 163 ? 0.8162 0.8290 0.9248 0.0753  -0.0558 -0.1059 161  LYS A CB    
1249 C  CG    . LYS A 163 ? 0.9908 1.0152 1.1011 0.0760  -0.0477 -0.1030 161  LYS A CG    
1250 C  CD    . LYS A 163 ? 1.1386 1.1658 1.2438 0.0856  -0.0430 -0.1057 161  LYS A CD    
1251 C  CE    . LYS A 163 ? 1.1014 1.1375 1.2120 0.0899  -0.0387 -0.1021 161  LYS A CE    
1252 N  NZ    . LYS A 163 ? 1.0617 1.1067 1.1709 0.0949  -0.0310 -0.1008 161  LYS A NZ    
1253 N  N     . ALA A 164 ? 0.7941 0.8080 0.8995 0.0624  -0.0564 -0.1041 162  ALA A N     
1254 C  CA    . ALA A 164 ? 0.7587 0.7777 0.8614 0.0592  -0.0523 -0.1025 162  ALA A CA    
1255 C  C     . ALA A 164 ? 0.7265 0.7484 0.8334 0.0512  -0.0525 -0.0969 162  ALA A C     
1256 O  O     . ALA A 164 ? 0.7264 0.7539 0.8318 0.0488  -0.0470 -0.0942 162  ALA A O     
1257 C  CB    . ALA A 164 ? 0.7855 0.8004 0.8836 0.0612  -0.0559 -0.1061 162  ALA A CB    
1258 N  N     . PHE A 165 ? 0.6897 0.7073 0.8014 0.0475  -0.0589 -0.0948 163  PHE A N     
1259 C  CA    . PHE A 165 ? 0.6168 0.6379 0.7318 0.0410  -0.0588 -0.0886 163  PHE A CA    
1260 C  C     . PHE A 165 ? 0.7456 0.7708 0.8617 0.0396  -0.0552 -0.0860 163  PHE A C     
1261 O  O     . PHE A 165 ? 0.8618 0.8914 0.9753 0.0368  -0.0512 -0.0829 163  PHE A O     
1262 C  CB    . PHE A 165 ? 0.5129 0.5292 0.6341 0.0375  -0.0664 -0.0859 163  PHE A CB    
1263 C  CG    . PHE A 165 ? 0.5819 0.5981 0.7036 0.0352  -0.0695 -0.0847 163  PHE A CG    
1264 C  CD1   . PHE A 165 ? 0.5536 0.5771 0.6754 0.0316  -0.0661 -0.0790 163  PHE A CD1   
1265 C  CD2   . PHE A 165 ? 0.5145 0.5234 0.6359 0.0370  -0.0758 -0.0892 163  PHE A CD2   
1266 C  CE1   . PHE A 165 ? 0.5416 0.5671 0.6650 0.0295  -0.0688 -0.0769 163  PHE A CE1   
1267 C  CE2   . PHE A 165 ? 0.3214 0.3311 0.4441 0.0342  -0.0795 -0.0877 163  PHE A CE2   
1268 C  CZ    . PHE A 165 ? 0.3515 0.3705 0.4760 0.0303  -0.0757 -0.0811 163  PHE A CZ    
1269 N  N     . LEU A 166 ? 0.7220 0.7454 0.8413 0.0417  -0.0569 -0.0872 164  LEU A N     
1270 C  CA    . LEU A 166 ? 0.6440 0.6721 0.7650 0.0401  -0.0545 -0.0846 164  LEU A CA    
1271 C  C     . LEU A 166 ? 0.6605 0.6934 0.7774 0.0410  -0.0481 -0.0858 164  LEU A C     
1272 O  O     . LEU A 166 ? 0.6042 0.6403 0.7205 0.0377  -0.0461 -0.0833 164  LEU A O     
1273 C  CB    . LEU A 166 ? 0.6297 0.6562 0.7554 0.0431  -0.0574 -0.0853 164  LEU A CB    
1274 C  CG    . LEU A 166 ? 0.6950 0.7150 0.8251 0.0426  -0.0639 -0.0840 164  LEU A CG    
1275 C  CD1   . LEU A 166 ? 0.7289 0.7489 0.8630 0.0458  -0.0655 -0.0837 164  LEU A CD1   
1276 C  CD2   . LEU A 166 ? 0.6628 0.6839 0.7950 0.0366  -0.0657 -0.0784 164  LEU A CD2   
1277 N  N     . THR A 167 ? 0.6763 0.7093 0.7904 0.0455  -0.0453 -0.0894 165  THR A N     
1278 C  CA    . THR A 167 ? 0.5893 0.6266 0.7002 0.0461  -0.0391 -0.0897 165  THR A CA    
1279 C  C     . THR A 167 ? 0.7016 0.7390 0.8073 0.0422  -0.0364 -0.0878 165  THR A C     
1280 O  O     . THR A 167 ? 0.6953 0.7344 0.7991 0.0395  -0.0334 -0.0861 165  THR A O     
1281 C  CB    . THR A 167 ? 0.4994 0.5373 0.6080 0.0527  -0.0363 -0.0932 165  THR A CB    
1282 O  OG1   . THR A 167 ? 0.6349 0.6732 0.7472 0.0576  -0.0379 -0.0945 165  THR A OG1   
1283 C  CG2   . THR A 167 ? 0.3836 0.4260 0.4896 0.0530  -0.0296 -0.0925 165  THR A CG2   
1284 N  N     . LEU A 168 ? 0.6665 0.7018 0.7698 0.0420  -0.0379 -0.0878 166  LEU A N     
1285 C  CA    . LEU A 168 ? 0.4554 0.4916 0.5536 0.0393  -0.0352 -0.0850 166  LEU A CA    
1286 C  C     . LEU A 168 ? 0.5966 0.6329 0.6947 0.0351  -0.0361 -0.0812 166  LEU A C     
1287 O  O     . LEU A 168 ? 0.5109 0.5471 0.6032 0.0338  -0.0325 -0.0800 166  LEU A O     
1288 C  CB    . LEU A 168 ? 0.2956 0.3314 0.3937 0.0395  -0.0377 -0.0843 166  LEU A CB    
1289 C  CG    . LEU A 168 ? 0.4451 0.4833 0.5377 0.0384  -0.0340 -0.0809 166  LEU A CG    
1290 C  CD1   . LEU A 168 ? 0.3876 0.4263 0.4733 0.0408  -0.0272 -0.0827 166  LEU A CD1   
1291 C  CD2   . LEU A 168 ? 0.3486 0.3883 0.4433 0.0383  -0.0372 -0.0795 166  LEU A CD2   
1292 N  N     . ALA A 169 ? 0.6284 0.6641 0.7321 0.0335  -0.0412 -0.0793 167  ALA A N     
1293 C  CA    . ALA A 169 ? 0.5646 0.6011 0.6677 0.0304  -0.0424 -0.0753 167  ALA A CA    
1294 C  C     . ALA A 169 ? 0.3615 0.3984 0.4628 0.0294  -0.0409 -0.0764 167  ALA A C     
1295 O  O     . ALA A 169 ? 0.5141 0.5502 0.6095 0.0276  -0.0398 -0.0747 167  ALA A O     
1296 C  CB    . ALA A 169 ? 0.5117 0.5477 0.6221 0.0293  -0.0480 -0.0727 167  ALA A CB    
1297 N  N     . GLU A 170 ? 0.4366 0.4746 0.5427 0.0308  -0.0412 -0.0791 168  GLU A N     
1298 C  CA    . GLU A 170 ? 0.7458 0.7856 0.8523 0.0292  -0.0401 -0.0794 168  GLU A CA    
1299 C  C     . GLU A 170 ? 0.7080 0.7461 0.8073 0.0284  -0.0354 -0.0803 168  GLU A C     
1300 O  O     . GLU A 170 ? 0.7301 0.7667 0.8259 0.0253  -0.0355 -0.0797 168  GLU A O     
1301 C  CB    . GLU A 170 ? 0.9131 0.9565 1.0271 0.0319  -0.0404 -0.0808 168  GLU A CB    
1302 C  CG    . GLU A 170 ? 1.1100 1.1554 1.2309 0.0320  -0.0450 -0.0793 168  GLU A CG    
1303 C  CD    . GLU A 170 ? 1.0712 1.1222 1.1988 0.0342  -0.0443 -0.0792 168  GLU A CD    
1304 O  OE1   . GLU A 170 ? 1.0342 1.0888 1.1628 0.0312  -0.0428 -0.0781 168  GLU A OE1   
1305 O  OE2   . GLU A 170 ? 0.9915 1.0432 1.1235 0.0389  -0.0453 -0.0800 168  GLU A OE2   
1306 N  N     . ASP A 171 ? 0.4835 0.5211 0.5802 0.0312  -0.0317 -0.0819 169  ASP A N     
1307 C  CA    . ASP A 171 ? 0.6065 0.6418 0.6963 0.0311  -0.0267 -0.0825 169  ASP A CA    
1308 C  C     . ASP A 171 ? 0.6394 0.6703 0.7200 0.0292  -0.0263 -0.0808 169  ASP A C     
1309 O  O     . ASP A 171 ? 0.6849 0.7118 0.7597 0.0271  -0.0252 -0.0809 169  ASP A O     
1310 C  CB    . ASP A 171 ? 0.6137 0.6500 0.7020 0.0353  -0.0229 -0.0841 169  ASP A CB    
1311 C  CG    . ASP A 171 ? 0.6222 0.6624 0.7170 0.0387  -0.0220 -0.0859 169  ASP A CG    
1312 O  OD1   . ASP A 171 ? 0.7107 0.7535 0.8116 0.0376  -0.0236 -0.0852 169  ASP A OD1   
1313 O  OD2   . ASP A 171 ? 0.7277 0.7688 0.8209 0.0431  -0.0197 -0.0876 169  ASP A OD2   
1314 N  N     . ILE A 172 ? 0.6181 0.6496 0.6971 0.0302  -0.0275 -0.0788 170  ILE A N     
1315 C  CA    . ILE A 172 ? 0.5852 0.6140 0.6553 0.0298  -0.0268 -0.0761 170  ILE A CA    
1316 C  C     . ILE A 172 ? 0.5600 0.5863 0.6279 0.0271  -0.0301 -0.0755 170  ILE A C     
1317 O  O     . ILE A 172 ? 0.5434 0.5643 0.6014 0.0267  -0.0290 -0.0758 170  ILE A O     
1318 C  CB    . ILE A 172 ? 0.5245 0.5568 0.5969 0.0310  -0.0282 -0.0724 170  ILE A CB    
1319 C  CG1   . ILE A 172 ? 0.6212 0.6559 0.6958 0.0333  -0.0261 -0.0734 170  ILE A CG1   
1320 C  CG2   . ILE A 172 ? 0.5420 0.5732 0.6052 0.0320  -0.0265 -0.0685 170  ILE A CG2   
1321 C  CD1   . ILE A 172 ? 0.7881 0.8268 0.8665 0.0334  -0.0283 -0.0692 170  ILE A CD1   
1322 N  N     . LEU A 173 ? 0.5140 0.5438 0.5904 0.0257  -0.0347 -0.0748 171  LEU A N     
1323 C  CA    . LEU A 173 ? 0.5052 0.5340 0.5802 0.0233  -0.0386 -0.0738 171  LEU A CA    
1324 C  C     . LEU A 173 ? 0.4334 0.4585 0.5050 0.0207  -0.0388 -0.0765 171  LEU A C     
1325 O  O     . LEU A 173 ? 0.4095 0.4303 0.4733 0.0192  -0.0411 -0.0765 171  LEU A O     
1326 C  CB    . LEU A 173 ? 0.4875 0.5212 0.5736 0.0226  -0.0431 -0.0727 171  LEU A CB    
1327 C  CG    . LEU A 173 ? 0.5310 0.5651 0.6167 0.0203  -0.0474 -0.0717 171  LEU A CG    
1328 C  CD1   . LEU A 173 ? 0.3668 0.3992 0.4439 0.0212  -0.0484 -0.0684 171  LEU A CD1   
1329 C  CD2   . LEU A 173 ? 0.5790 0.6182 0.6764 0.0199  -0.0512 -0.0709 171  LEU A CD2   
1330 N  N     . ARG A 174 ? 0.4466 0.4730 0.5237 0.0203  -0.0366 -0.0786 172  ARG A N     
1331 C  CA    . ARG A 174 ? 0.5659 0.5900 0.6430 0.0168  -0.0374 -0.0799 172  ARG A CA    
1332 C  C     . ARG A 174 ? 0.5146 0.5292 0.5782 0.0161  -0.0358 -0.0811 172  ARG A C     
1333 O  O     . ARG A 174 ? 0.6927 0.7024 0.7527 0.0124  -0.0393 -0.0820 172  ARG A O     
1334 C  CB    . ARG A 174 ? 0.4931 0.5219 0.5793 0.0174  -0.0344 -0.0805 172  ARG A CB    
1335 C  CG    . ARG A 174 ? 0.7554 0.7806 0.8402 0.0143  -0.0330 -0.0810 172  ARG A CG    
1336 C  CD    . ARG A 174 ? 0.9898 1.0235 1.0882 0.0128  -0.0340 -0.0794 172  ARG A CD    
1337 N  NE    . ARG A 174 ? 1.2687 1.3006 1.3693 0.0080  -0.0346 -0.0783 172  ARG A NE    
1338 C  CZ    . ARG A 174 ? 1.2679 1.3081 1.3810 0.0053  -0.0368 -0.0756 172  ARG A CZ    
1339 N  NH1   . ARG A 174 ? 1.1980 1.2473 1.3200 0.0078  -0.0383 -0.0742 172  ARG A NH1   
1340 N  NH2   . ARG A 174 ? 1.2572 1.2963 1.3740 0.0001  -0.0378 -0.0737 172  ARG A NH2   
1341 N  N     . LYS A 175 ? 0.3616 0.3729 0.4171 0.0197  -0.0310 -0.0811 173  LYS A N     
1342 C  CA    . LYS A 175 ? 0.7290 0.7304 0.7699 0.0206  -0.0288 -0.0820 173  LYS A CA    
1343 C  C     . LYS A 175 ? 0.7515 0.7500 0.7813 0.0236  -0.0298 -0.0803 173  LYS A C     
1344 O  O     . LYS A 175 ? 0.6089 0.6024 0.6270 0.0275  -0.0257 -0.0797 173  LYS A O     
1345 C  CB    . LYS A 175 ? 0.5915 0.5915 0.6294 0.0238  -0.0222 -0.0823 173  LYS A CB    
1346 C  CG    . LYS A 175 ? 0.6577 0.6663 0.7026 0.0273  -0.0194 -0.0808 173  LYS A CG    
1347 C  CD    . LYS A 175 ? 0.6608 0.6681 0.7016 0.0306  -0.0131 -0.0811 173  LYS A CD    
1348 C  CE    . LYS A 175 ? 0.5690 0.5824 0.6106 0.0345  -0.0110 -0.0792 173  LYS A CE    
1349 N  NZ    . LYS A 175 ? 0.6121 0.6241 0.6474 0.0383  -0.0049 -0.0789 173  LYS A NZ    
1350 N  N     . THR A 176 ? 0.8343 0.8365 0.8672 0.0225  -0.0347 -0.0789 174  THR A N     
1351 C  CA    . THR A 176 ? 0.8521 0.8539 0.8759 0.0263  -0.0348 -0.0758 174  THR A CA    
1352 C  C     . THR A 176 ? 1.0663 1.0588 1.0748 0.0270  -0.0379 -0.0771 174  THR A C     
1353 O  O     . THR A 176 ? 1.1782 1.1683 1.1745 0.0322  -0.0357 -0.0747 174  THR A O     
1354 C  CB    . THR A 176 ? 0.7581 0.7693 0.7928 0.0261  -0.0378 -0.0723 174  THR A CB    
1355 O  OG1   . THR A 176 ? 0.9141 0.9286 0.9597 0.0218  -0.0425 -0.0739 174  THR A OG1   
1356 C  CG2   . THR A 176 ? 0.8210 0.8391 0.8641 0.0280  -0.0345 -0.0696 174  THR A CG2   
1357 N  N     . PRO A 177 ? 1.2638 1.2513 1.2720 0.0224  -0.0433 -0.0804 175  PRO A N     
1358 C  CA    . PRO A 177 ? 1.3550 1.3322 1.3460 0.0239  -0.0469 -0.0821 175  PRO A CA    
1359 C  C     . PRO A 177 ? 1.4143 1.3791 1.3869 0.0286  -0.0427 -0.0838 175  PRO A C     
1360 O  O     . PRO A 177 ? 1.5013 1.4660 1.4630 0.0354  -0.0394 -0.0809 175  PRO A O     
1361 C  CB    . PRO A 177 ? 1.4052 1.3789 1.4007 0.0170  -0.0539 -0.0856 175  PRO A CB    
1362 C  CG    . PRO A 177 ? 1.4684 1.4549 1.4848 0.0131  -0.0543 -0.0838 175  PRO A CG    
1363 C  CD    . PRO A 177 ? 1.3621 1.3538 1.3845 0.0163  -0.0470 -0.0820 175  PRO A CD    
1364 N  N     . LYS B 4   ? 1.8158 1.9178 1.5822 0.1930  -0.1162 0.0260  918  LYS B N     
1365 C  CA    . LYS B 4   ? 1.7041 1.8127 1.5038 0.1812  -0.1090 0.0316  918  LYS B CA    
1366 C  C     . LYS B 4   ? 1.7126 1.8320 1.5191 0.1895  -0.0951 0.0474  918  LYS B C     
1367 O  O     . LYS B 4   ? 1.7429 1.8730 1.5783 0.1827  -0.0892 0.0569  918  LYS B O     
1368 C  CB    . LYS B 4   ? 1.6102 1.7298 1.4374 0.1711  -0.1131 0.0348  918  LYS B CB    
1369 N  N     . GLU B 5   ? 1.6846 1.8014 1.4645 0.2046  -0.0902 0.0504  919  GLU B N     
1370 C  CA    . GLU B 5   ? 1.5531 1.6801 1.3392 0.2121  -0.0768 0.0653  919  GLU B CA    
1371 C  C     . GLU B 5   ? 1.5569 1.6768 1.3558 0.2023  -0.0723 0.0611  919  GLU B C     
1372 O  O     . GLU B 5   ? 1.4342 1.5649 1.2569 0.1985  -0.0637 0.0726  919  GLU B O     
1373 C  CB    . GLU B 5   ? 1.4903 1.6165 1.2427 0.2322  -0.0726 0.0696  919  GLU B CB    
1374 N  N     . GLU B 6   ? 1.5844 1.6861 1.3681 0.1977  -0.0785 0.0447  920  GLU B N     
1375 C  CA    . GLU B 6   ? 1.5602 1.6542 1.3559 0.1875  -0.0754 0.0391  920  GLU B CA    
1376 C  C     . GLU B 6   ? 1.5299 1.6325 1.3627 0.1721  -0.0749 0.0425  920  GLU B C     
1377 O  O     . GLU B 6   ? 1.5822 1.6872 1.4320 0.1666  -0.0682 0.0464  920  GLU B O     
1378 C  CB    . GLU B 6   ? 1.5942 1.6671 1.3707 0.1828  -0.0845 0.0204  920  GLU B CB    
1379 N  N     . GLU B 7   ? 1.4225 1.5295 1.2675 0.1657  -0.0821 0.0411  921  GLU B N     
1380 C  CA    . GLU B 7   ? 1.2211 1.3354 1.0994 0.1528  -0.0818 0.0446  921  GLU B CA    
1381 C  C     . GLU B 7   ? 1.3787 1.5067 1.2761 0.1551  -0.0715 0.0613  921  GLU B C     
1382 O  O     . GLU B 7   ? 1.3913 1.5203 1.3111 0.1456  -0.0683 0.0629  921  GLU B O     
1383 C  CB    . GLU B 7   ? 1.1233 1.2424 1.0088 0.1493  -0.0902 0.0432  921  GLU B CB    
1384 N  N     . MET B 8   ? 1.4598 1.5986 1.3487 0.1679  -0.0666 0.0743  922  MET B N     
1385 C  CA    . MET B 8   ? 1.4376 1.5902 1.3446 0.1704  -0.0568 0.0918  922  MET B CA    
1386 C  C     . MET B 8   ? 1.5386 1.6886 1.4432 0.1714  -0.0495 0.0930  922  MET B C     
1387 O  O     . MET B 8   ? 1.4282 1.5849 1.3562 0.1651  -0.0441 0.1016  922  MET B O     
1388 C  CB    . MET B 8   ? 1.2558 1.4213 1.1526 0.1850  -0.0529 0.1061  922  MET B CB    
1389 N  N     . LYS B 9   ? 1.6261 1.7658 1.5024 0.1794  -0.0495 0.0844  923  LYS B N     
1390 C  CA    . LYS B 9   ? 1.5299 1.6663 1.4027 0.1807  -0.0426 0.0847  923  LYS B CA    
1391 C  C     . LYS B 9   ? 1.4861 1.6171 1.3821 0.1647  -0.0440 0.0778  923  LYS B C     
1392 O  O     . LYS B 9   ? 1.5577 1.6950 1.4688 0.1620  -0.0372 0.0857  923  LYS B O     
1393 C  CB    . LYS B 9   ? 1.4788 1.6008 1.3163 0.1906  -0.0442 0.0735  923  LYS B CB    
1394 N  N     . ARG B 10  ? 1.3329 1.4532 1.2322 0.1541  -0.0529 0.0636  924  ARG B N     
1395 C  CA    . ARG B 10  ? 1.0833 1.1989 1.0042 0.1396  -0.0544 0.0570  924  ARG B CA    
1396 C  C     . ARG B 10  ? 1.0694 1.1975 1.0207 0.1335  -0.0507 0.0696  924  ARG B C     
1397 O  O     . ARG B 10  ? 0.9772 1.1046 0.9447 0.1256  -0.0481 0.0696  924  ARG B O     
1398 C  CB    . ARG B 10  ? 0.9846 1.0902 0.9060 0.1305  -0.0645 0.0425  924  ARG B CB    
1399 N  N     . PHE B 11  ? 1.1302 1.2690 1.0890 0.1371  -0.0508 0.0804  925  PHE B N     
1400 C  CA    . PHE B 11  ? 0.9736 1.1233 0.9602 0.1321  -0.0474 0.0937  925  PHE B CA    
1401 C  C     . PHE B 11  ? 0.9869 1.1450 0.9781 0.1362  -0.0385 0.1062  925  PHE B C     
1402 O  O     . PHE B 11  ? 1.0878 1.2473 1.0997 0.1276  -0.0368 0.1092  925  PHE B O     
1403 C  CB    . PHE B 11  ? 0.9167 1.0761 0.9082 0.1367  -0.0487 0.1040  925  PHE B CB    
1404 N  N     . CYS B 12  ? 1.0581 1.2223 1.0298 0.1499  -0.0330 0.1139  926  CYS B N     
1405 C  CA    . CYS B 12  ? 1.1227 1.2977 1.1000 0.1547  -0.0240 0.1279  926  CYS B CA    
1406 C  C     . CYS B 12  ? 1.1112 1.2789 1.0918 0.1479  -0.0225 0.1201  926  CYS B C     
1407 O  O     . CYS B 12  ? 1.2215 1.3971 1.2224 0.1428  -0.0184 0.1297  926  CYS B O     
1408 C  CB    . CYS B 12  ? 1.1298 1.3114 1.0817 0.1723  -0.0180 0.1358  926  CYS B CB    
1409 S  SG    . CYS B 12  ? 1.1186 1.3145 1.0721 0.1815  -0.0172 0.1511  926  CYS B SG    
1410 N  N     . LYS B 13  ? 1.0919 1.2444 1.0536 0.1470  -0.0262 0.1030  927  LYS B N     
1411 C  CA    . LYS B 13  ? 1.1885 1.3332 1.1543 0.1396  -0.0254 0.0946  927  LYS B CA    
1412 C  C     . LYS B 13  ? 1.0377 1.1823 1.0329 0.1247  -0.0290 0.0933  927  LYS B C     
1413 O  O     . LYS B 13  ? 0.9696 1.1198 0.9814 0.1200  -0.0254 0.0998  927  LYS B O     
1414 C  CB    . LYS B 13  ? 1.2720 1.3992 1.2143 0.1401  -0.0300 0.0763  927  LYS B CB    
1415 N  N     . ALA B 14  ? 0.9846 1.1231 0.9861 0.1176  -0.0364 0.0850  928  ALA B N     
1416 C  CA    . ALA B 14  ? 0.9791 1.1149 1.0051 0.1046  -0.0404 0.0817  928  ALA B CA    
1417 C  C     . ALA B 14  ? 1.0424 1.1898 1.0925 0.1016  -0.0373 0.0973  928  ALA B C     
1418 O  O     . ALA B 14  ? 1.0704 1.2159 1.1383 0.0925  -0.0382 0.0964  928  ALA B O     
1419 C  CB    . ALA B 14  ? 0.8246 0.9551 0.8526 0.1003  -0.0479 0.0737  928  ALA B CB    
1420 N  N     . GLN B 15  ? 0.9437 1.1028 0.9945 0.1092  -0.0340 0.1121  929  GLN B N     
1421 C  CA    . GLN B 15  ? 0.9529 1.1232 1.0280 0.1059  -0.0319 0.1284  929  GLN B CA    
1422 C  C     . GLN B 15  ? 0.9132 1.0920 0.9943 0.1070  -0.0255 0.1384  929  GLN B C     
1423 O  O     . GLN B 15  ? 1.0324 1.2144 1.1366 0.0984  -0.0263 0.1449  929  GLN B O     
1424 C  CB    . GLN B 15  ? 1.0925 1.2732 1.1665 0.1141  -0.0303 0.1416  929  GLN B CB    
1425 C  CG    . GLN B 15  ? 1.2088 1.3856 1.2937 0.1088  -0.0367 0.1391  929  GLN B CG    
1426 C  CD    . GLN B 15  ? 1.3352 1.5237 1.4212 0.1169  -0.0345 0.1542  929  GLN B CD    
1427 O  OE1   . GLN B 15  ? 1.3415 1.5429 1.4343 0.1218  -0.0285 0.1712  929  GLN B OE1   
1428 N  NE2   . GLN B 15  ? 1.4188 1.6040 1.4987 0.1187  -0.0392 0.1490  929  GLN B NE2   
1429 N  N     . THR B 16  ? 0.7650 0.9477 0.8255 0.1179  -0.0194 0.1402  930  THR B N     
1430 C  CA    . THR B 16  ? 0.9588 1.1492 1.0243 0.1187  -0.0134 0.1480  930  THR B CA    
1431 C  C     . THR B 16  ? 0.9609 1.1411 1.0363 0.1069  -0.0171 0.1360  930  THR B C     
1432 O  O     . THR B 16  ? 1.0767 1.2633 1.1712 0.1007  -0.0160 0.1437  930  THR B O     
1433 C  CB    . THR B 16  ? 1.0398 1.2324 1.0778 0.1329  -0.0067 0.1484  930  THR B CB    
1434 O  OG1   . THR B 16  ? 1.1751 1.3514 1.1892 0.1351  -0.0107 0.1299  930  THR B OG1   
1435 C  CG2   . THR B 16  ? 0.8503 1.0576 0.8822 0.1458  -0.0010 0.1653  930  THR B CG2   
1436 N  N     . ILE B 17  ? 0.9066 1.0714 0.9700 0.1035  -0.0220 0.1175  931  ILE B N     
1437 C  CA    . ILE B 17  ? 0.9259 1.0809 0.9970 0.0933  -0.0252 0.1057  931  ILE B CA    
1438 C  C     . ILE B 17  ? 0.9095 1.0648 1.0080 0.0818  -0.0302 0.1088  931  ILE B C     
1439 O  O     . ILE B 17  ? 0.9520 1.1086 1.0647 0.0752  -0.0303 0.1106  931  ILE B O     
1440 C  CB    . ILE B 17  ? 0.9403 1.0798 0.9940 0.0923  -0.0294 0.0868  931  ILE B CB    
1441 C  CG1   . ILE B 17  ? 0.9082 1.0445 0.9349 0.1027  -0.0249 0.0827  931  ILE B CG1   
1442 C  CG2   . ILE B 17  ? 0.7577 0.8879 0.8226 0.0813  -0.0334 0.0755  931  ILE B CG2   
1443 C  CD1   . ILE B 17  ? 0.8644 0.9848 0.8742 0.1010  -0.0293 0.0647  931  ILE B CD1   
1444 N  N     . GLN B 18  ? 0.7334 0.8870 0.8390 0.0796  -0.0348 0.1095  932  GLN B N     
1445 C  CA    . GLN B 18  ? 0.8009 0.9523 0.9306 0.0695  -0.0401 0.1119  932  GLN B CA    
1446 C  C     . GLN B 18  ? 0.7115 0.8744 0.8605 0.0670  -0.0377 0.1288  932  GLN B C     
1447 O  O     . GLN B 18  ? 0.8792 1.0389 1.0447 0.0580  -0.0410 0.1281  932  GLN B O     
1448 C  CB    . GLN B 18  ? 0.8406 0.9899 0.9731 0.0699  -0.0442 0.1125  932  GLN B CB    
1449 C  CG    . GLN B 18  ? 1.0339 1.1702 1.1715 0.0623  -0.0510 0.0986  932  GLN B CG    
1450 C  CD    . GLN B 18  ? 1.0633 1.1942 1.2199 0.0526  -0.0544 0.0973  932  GLN B CD    
1451 O  OE1   . GLN B 18  ? 1.1552 1.2921 1.3278 0.0497  -0.0540 0.1098  932  GLN B OE1   
1452 N  NE2   . GLN B 18  ? 1.0759 1.1955 1.2308 0.0476  -0.0580 0.0825  932  GLN B NE2   
1453 N  N     . ARG B 19  ? 0.7762 0.9529 0.9236 0.0751  -0.0323 0.1446  933  ARG B N     
1454 C  CA    . ARG B 19  ? 0.9286 1.1191 1.0940 0.0737  -0.0290 0.1626  933  ARG B CA    
1455 C  C     . ARG B 19  ? 0.8643 1.0550 1.0329 0.0694  -0.0279 0.1594  933  ARG B C     
1456 O  O     . ARG B 19  ? 0.8032 0.9952 0.9931 0.0601  -0.0314 0.1646  933  ARG B O     
1457 C  CB    . ARG B 19  ? 0.9890 1.1954 1.1450 0.0863  -0.0212 0.1782  933  ARG B CB    
1458 C  CG    . ARG B 19  ? 1.1118 1.3357 1.2885 0.0857  -0.0175 0.2004  933  ARG B CG    
1459 C  CD    . ARG B 19  ? 1.3258 1.5653 1.4910 0.1000  -0.0093 0.2156  933  ARG B CD    
1460 N  NE    . ARG B 19  ? 1.4105 1.6422 1.5506 0.1089  -0.0093 0.2047  933  ARG B NE    
1461 C  CZ    . ARG B 19  ? 1.5060 1.7380 1.6467 0.1114  -0.0113 0.2084  933  ARG B CZ    
1462 N  NH1   . ARG B 19  ? 1.5535 1.7925 1.7186 0.1059  -0.0131 0.2230  933  ARG B NH1   
1463 N  NH2   . ARG B 19  ? 1.5335 1.7585 1.6505 0.1193  -0.0120 0.1978  933  ARG B NH2   
1464 N  N     . ARG B 20  ? 0.7965 0.9847 0.9435 0.0760  -0.0235 0.1503  934  ARG B N     
1465 C  CA    . ARG B 20  ? 0.7773 0.9671 0.9259 0.0736  -0.0214 0.1485  934  ARG B CA    
1466 C  C     . ARG B 20  ? 0.8637 1.0411 1.0244 0.0613  -0.0287 0.1361  934  ARG B C     
1467 O  O     . ARG B 20  ? 0.8356 1.0170 1.0101 0.0554  -0.0296 0.1400  934  ARG B O     
1468 C  CB    . ARG B 20  ? 0.6621 0.8489 0.7835 0.0835  -0.0156 0.1400  934  ARG B CB    
1469 C  CG    . ARG B 20  ? 0.6627 0.8521 0.7848 0.0822  -0.0125 0.1389  934  ARG B CG    
1470 C  CD    . ARG B 20  ? 0.7151 0.9241 0.8524 0.0841  -0.0076 0.1595  934  ARG B CD    
1471 N  NE    . ARG B 20  ? 0.7606 0.9724 0.9079 0.0782  -0.0077 0.1591  934  ARG B NE    
1472 C  CZ    . ARG B 20  ? 0.8308 1.0596 0.9857 0.0816  -0.0022 0.1743  934  ARG B CZ    
1473 N  NH1   . ARG B 20  ? 0.7372 0.9679 0.9011 0.0757  -0.0032 0.1727  934  ARG B NH1   
1474 N  NH2   . ARG B 20  ? 0.9817 1.2265 1.1349 0.0914  0.0046  0.1914  934  ARG B NH2   
1475 N  N     . LEU B 21  ? 0.7525 0.9153 0.9079 0.0579  -0.0340 0.1213  935  LEU B N     
1476 C  CA    . LEU B 21  ? 0.7167 0.8675 0.8823 0.0477  -0.0407 0.1096  935  LEU B CA    
1477 C  C     . LEU B 21  ? 0.9690 1.1216 1.1599 0.0389  -0.0462 0.1190  935  LEU B C     
1478 O  O     . LEU B 21  ? 1.0642 1.2116 1.2658 0.0312  -0.0505 0.1146  935  LEU B O     
1479 C  CB    . LEU B 21  ? 0.6225 0.7595 0.7782 0.0469  -0.0448 0.0940  935  LEU B CB    
1480 C  CG    . LEU B 21  ? 0.7145 0.8477 0.8456 0.0545  -0.0412 0.0845  935  LEU B CG    
1481 C  CD1   . LEU B 21  ? 0.8708 0.9939 0.9968 0.0532  -0.0461 0.0734  935  LEU B CD1   
1482 C  CD2   . LEU B 21  ? 0.7692 0.8983 0.8909 0.0544  -0.0386 0.0756  935  LEU B CD2   
1483 N  N     . ASN B 22  ? 0.8541 1.0130 1.0544 0.0401  -0.0466 0.1317  936  ASN B N     
1484 C  CA    . ASN B 22  ? 0.8333 0.9936 1.0584 0.0315  -0.0520 0.1424  936  ASN B CA    
1485 C  C     . ASN B 22  ? 0.8025 0.9765 1.0401 0.0294  -0.0496 0.1561  936  ASN B C     
1486 O  O     . ASN B 22  ? 0.8251 0.9963 1.0806 0.0199  -0.0557 0.1581  936  ASN B O     
1487 C  CB    . ASN B 22  ? 0.9187 1.0825 1.1510 0.0336  -0.0527 0.1535  936  ASN B CB    
1488 C  CG    . ASN B 22  ? 1.0450 1.1974 1.2649 0.0364  -0.0549 0.1410  936  ASN B CG    
1489 O  OD1   . ASN B 22  ? 1.0954 1.2344 1.3099 0.0329  -0.0589 0.1248  936  ASN B OD1   
1490 N  ND2   . ASN B 22  ? 1.0863 1.2450 1.3022 0.0429  -0.0523 0.1492  936  ASN B ND2   
1491 N  N     . GLU B 23  ? 0.7901 0.9790 1.0181 0.0385  -0.0409 0.1657  937  GLU B N     
1492 C  CA    . GLU B 23  ? 0.7517 0.9553 0.9899 0.0377  -0.0376 0.1783  937  GLU B CA    
1493 C  C     . GLU B 23  ? 0.8408 1.0369 1.0786 0.0317  -0.0407 0.1660  937  GLU B C     
1494 O  O     . GLU B 23  ? 0.9629 1.1645 1.2188 0.0241  -0.0443 0.1732  937  GLU B O     
1495 C  CB    . GLU B 23  ? 0.7708 0.9895 0.9931 0.0509  -0.0270 0.1877  937  GLU B CB    
1496 C  CG    . GLU B 23  ? 0.9341 1.1638 1.1571 0.0583  -0.0228 0.2029  937  GLU B CG    
1497 C  CD    . GLU B 23  ? 1.0232 1.2674 1.2286 0.0728  -0.0122 0.2119  937  GLU B CD    
1498 O  OE1   . GLU B 23  ? 0.9804 1.2259 1.1743 0.0765  -0.0081 0.2069  937  GLU B OE1   
1499 O  OE2   . GLU B 23  ? 1.0444 1.2984 1.2466 0.0812  -0.0077 0.2241  937  GLU B OE2   
1500 N  N     . ILE B 24  ? 0.7454 0.9291 0.9631 0.0348  -0.0399 0.1477  938  ILE B N     
1501 C  CA    . ILE B 24  ? 0.7733 0.9507 0.9878 0.0309  -0.0414 0.1360  938  ILE B CA    
1502 C  C     . ILE B 24  ? 0.6899 0.8549 0.9199 0.0194  -0.0515 0.1286  938  ILE B C     
1503 O  O     . ILE B 24  ? 0.5564 0.7228 0.7967 0.0133  -0.0549 0.1290  938  ILE B O     
1504 C  CB    . ILE B 24  ? 0.9189 1.0865 1.1078 0.0377  -0.0375 0.1195  938  ILE B CB    
1505 C  CG1   . ILE B 24  ? 0.7712 0.9498 0.9433 0.0492  -0.0278 0.1262  938  ILE B CG1   
1506 C  CG2   . ILE B 24  ? 0.8087 0.9659 0.9959 0.0323  -0.0409 0.1051  938  ILE B CG2   
1507 C  CD1   . ILE B 24  ? 0.6085 0.7761 0.7547 0.0562  -0.0247 0.1113  938  ILE B CD1   
1508 N  N     . GLU B 25  ? 0.6067 0.7590 0.8372 0.0169  -0.0567 0.1212  939  GLU B N     
1509 C  CA    . GLU B 25  ? 0.6533 0.7933 0.8985 0.0071  -0.0665 0.1159  939  GLU B CA    
1510 C  C     . GLU B 25  ? 0.8010 0.9497 1.0693 -0.0002 -0.0707 0.1315  939  GLU B C     
1511 O  O     . GLU B 25  ? 0.9059 1.0512 1.1830 -0.0071 -0.0763 0.1283  939  GLU B O     
1512 C  CB    . GLU B 25  ? 0.6846 0.8133 0.9294 0.0071  -0.0703 0.1113  939  GLU B CB    
1513 C  CG    . GLU B 25  ? 0.9258 1.0373 1.1786 -0.0004 -0.0797 0.1007  939  GLU B CG    
1514 C  CD    . GLU B 25  ? 1.2899 1.3897 1.5278 0.0010  -0.0800 0.0817  939  GLU B CD    
1515 O  OE1   . GLU B 25  ? 1.3776 1.4693 1.6200 -0.0042 -0.0854 0.0744  939  GLU B OE1   
1516 O  OE2   . GLU B 25  ? 1.3427 1.4419 1.5647 0.0073  -0.0752 0.0743  939  GLU B OE2   
1517 N  N     . ALA B 26  ? 0.7867 0.9485 1.0646 0.0018  -0.0678 0.1493  940  ALA B N     
1518 C  CA    . ALA B 26  ? 0.8060 0.9780 1.1081 -0.0056 -0.0718 0.1667  940  ALA B CA    
1519 C  C     . ALA B 26  ? 0.8139 0.9962 1.1207 -0.0080 -0.0709 0.1699  940  ALA B C     
1520 O  O     . ALA B 26  ? 0.9418 1.1193 1.2634 -0.0178 -0.0795 0.1692  940  ALA B O     
1521 C  CB    . ALA B 26  ? 0.8666 1.0550 1.1751 -0.0003 -0.0658 0.1864  940  ALA B CB    
1522 N  N     . ALA B 27  ? 0.6565 0.8528 0.9503 0.0012  -0.0608 0.1738  941  ALA B N     
1523 C  CA    . ALA B 27  ? 0.6826 0.8909 0.9802 0.0003  -0.0587 0.1784  941  ALA B CA    
1524 C  C     . ALA B 27  ? 0.8620 1.0558 1.1571 -0.0061 -0.0656 0.1612  941  ALA B C     
1525 O  O     . ALA B 27  ? 0.9201 1.1191 1.2294 -0.0132 -0.0706 0.1657  941  ALA B O     
1526 C  CB    . ALA B 27  ? 0.5756 0.7962 0.8536 0.0132  -0.0463 0.1808  941  ALA B CB    
1527 N  N     . LEU B 28  ? 0.7633 0.9396 1.0410 -0.0037 -0.0663 0.1420  942  LEU B N     
1528 C  CA    . LEU B 28  ? 0.7620 0.9244 1.0361 -0.0086 -0.0722 0.1256  942  LEU B CA    
1529 C  C     . LEU B 28  ? 0.8583 1.0115 1.1520 -0.0200 -0.0846 0.1261  942  LEU B C     
1530 O  O     . LEU B 28  ? 0.9142 1.0646 1.2127 -0.0254 -0.0902 0.1213  942  LEU B O     
1531 C  CB    . LEU B 28  ? 0.7451 0.8915 0.9990 -0.0038 -0.0706 0.1070  942  LEU B CB    
1532 C  CG    . LEU B 28  ? 0.7323 0.8819 0.9642 0.0057  -0.0609 0.1001  942  LEU B CG    
1533 C  CD1   . LEU B 28  ? 0.6713 0.8052 0.8868 0.0087  -0.0607 0.0831  942  LEU B CD1   
1534 C  CD2   . LEU B 28  ? 0.7775 0.9318 1.0081 0.0049  -0.0597 0.0976  942  LEU B CD2   
1535 N  N     . ARG B 29  ? 0.9361 1.0835 1.2405 -0.0237 -0.0895 0.1316  943  ARG B N     
1536 C  CA    . ARG B 29  ? 0.9149 1.0515 1.2376 -0.0346 -0.1021 0.1325  943  ARG B CA    
1537 C  C     . ARG B 29  ? 0.8811 1.0327 1.2246 -0.0418 -0.1058 0.1488  943  ARG B C     
1538 O  O     . ARG B 29  ? 0.8595 1.0043 1.2119 -0.0499 -0.1153 0.1448  943  ARG B O     
1539 C  CB    . ARG B 29  ? 0.9676 1.0951 1.2976 -0.0364 -0.1060 0.1367  943  ARG B CB    
1540 C  CG    . ARG B 29  ? 1.0834 1.2078 1.3958 -0.0272 -0.0985 0.1299  943  ARG B CG    
1541 C  CD    . ARG B 29  ? 1.2222 1.3341 1.5398 -0.0288 -0.1034 0.1301  943  ARG B CD    
1542 N  NE    . ARG B 29  ? 1.3290 1.4209 1.6349 -0.0283 -0.1078 0.1106  943  ARG B NE    
1543 C  CZ    . ARG B 29  ? 1.3938 1.4734 1.6966 -0.0265 -0.1099 0.1056  943  ARG B CZ    
1544 N  NH1   . ARG B 29  ? 1.4159 1.5009 1.7261 -0.0252 -0.1082 0.1182  943  ARG B NH1   
1545 N  NH2   . ARG B 29  ? 1.3703 1.4332 1.6626 -0.0252 -0.1134 0.0886  943  ARG B NH2   
1546 N  N     . GLU B 30  ? 0.9979 1.1703 1.3495 -0.0387 -0.0986 0.1679  944  GLU B N     
1547 C  CA    . GLU B 30  ? 1.0327 1.2226 1.4055 -0.0452 -0.1014 0.1854  944  GLU B CA    
1548 C  C     . GLU B 30  ? 0.9839 1.1779 1.3517 -0.0458 -0.1016 0.1782  944  GLU B C     
1549 O  O     . GLU B 30  ? 0.8338 1.0293 1.2181 -0.0554 -0.1110 0.1822  944  GLU B O     
1550 C  CB    . GLU B 30  ? 1.0673 1.2814 1.4455 -0.0386 -0.0909 0.2066  944  GLU B CB    
1551 C  CG    . GLU B 30  ? 1.0941 1.3060 1.4773 -0.0372 -0.0900 0.2151  944  GLU B CG    
1552 C  CD    . GLU B 30  ? 1.2174 1.4516 1.6233 -0.0393 -0.0879 0.2418  944  GLU B CD    
1553 O  OE1   . GLU B 30  ? 1.2425 1.4973 1.6552 -0.0381 -0.0834 0.2542  944  GLU B OE1   
1554 O  OE2   . GLU B 30  ? 1.2717 1.5033 1.6891 -0.0420 -0.0905 0.2512  944  GLU B OE2   
1555 N  N     . LEU B 31  ? 1.0468 1.2410 1.3913 -0.0358 -0.0922 0.1668  945  LEU B N     
1556 C  CA    . LEU B 31  ? 1.0398 1.2383 1.3778 -0.0349 -0.0910 0.1602  945  LEU B CA    
1557 C  C     . LEU B 31  ? 1.0022 1.1808 1.3394 -0.0422 -0.1024 0.1431  945  LEU B C     
1558 O  O     . LEU B 31  ? 1.2098 1.3926 1.5555 -0.0478 -0.1082 0.1438  945  LEU B O     
1559 C  CB    . LEU B 31  ? 0.9840 1.1856 1.2967 -0.0221 -0.0782 0.1523  945  LEU B CB    
1560 C  CG    . LEU B 31  ? 0.8999 1.1229 1.2103 -0.0130 -0.0663 0.1690  945  LEU B CG    
1561 C  CD1   . LEU B 31  ? 0.7923 1.0182 1.0792 -0.0020 -0.0558 0.1611  945  LEU B CD1   
1562 C  CD2   . LEU B 31  ? 1.0086 1.2531 1.3432 -0.0183 -0.0682 0.1908  945  LEU B CD2   
1563 N  N     . GLU B 32  ? 0.8534 1.0108 1.1798 -0.0415 -0.1056 0.1277  946  GLU B N     
1564 C  CA    . GLU B 32  ? 0.8165 0.9540 1.1416 -0.0473 -0.1165 0.1120  946  GLU B CA    
1565 C  C     . GLU B 32  ? 0.8978 1.0336 1.2461 -0.0594 -0.1300 0.1207  946  GLU B C     
1566 O  O     . GLU B 32  ? 0.9265 1.0590 1.2783 -0.0646 -0.1379 0.1154  946  GLU B O     
1567 C  CB    . GLU B 32  ? 0.8536 0.9706 1.1665 -0.0443 -0.1177 0.0980  946  GLU B CB    
1568 C  CG    . GLU B 32  ? 1.0021 1.1124 1.2913 -0.0354 -0.1102 0.0813  946  GLU B CG    
1569 C  CD    . GLU B 32  ? 1.2074 1.3027 1.4900 -0.0374 -0.1173 0.0649  946  GLU B CD    
1570 O  OE1   . GLU B 32  ? 1.2211 1.3091 1.4860 -0.0309 -0.1123 0.0511  946  GLU B OE1   
1571 O  OE2   . GLU B 32  ? 1.2684 1.3591 1.5635 -0.0453 -0.1281 0.0663  946  GLU B OE2   
1572 N  N     . ALA B 33  ? 1.0128 1.1512 1.3776 -0.0641 -0.1330 0.1347  947  ALA B N     
1573 C  CA    . ALA B 33  ? 1.0906 1.2267 1.4793 -0.0766 -0.1464 0.1448  947  ALA B CA    
1574 C  C     . ALA B 33  ? 1.0560 1.2112 1.4580 -0.0816 -0.1484 0.1557  947  ALA B C     
1575 O  O     . ALA B 33  ? 1.1741 1.3213 1.5822 -0.0893 -0.1601 0.1498  947  ALA B O     
1576 C  CB    . ALA B 33  ? 1.1221 1.2632 1.5266 -0.0792 -0.1461 0.1617  947  ALA B CB    
1577 N  N     . GLU B 34  ? 0.9628 1.1438 1.3691 -0.0766 -0.1372 0.1721  948  GLU B N     
1578 C  CA    . GLU B 34  ? 0.8438 1.0455 1.2622 -0.0799 -0.1377 0.1835  948  GLU B CA    
1579 C  C     . GLU B 34  ? 0.9007 1.0944 1.3052 -0.0789 -0.1407 0.1660  948  GLU B C     
1580 O  O     . GLU B 34  ? 0.9614 1.1561 1.3785 -0.0877 -0.1515 0.1673  948  GLU B O     
1581 C  CB    . GLU B 34  ? 0.7933 1.0224 1.2103 -0.0704 -0.1223 0.1997  948  GLU B CB    
1582 C  CG    . GLU B 34  ? 0.8605 1.1154 1.3035 -0.0769 -0.1245 0.2232  948  GLU B CG    
1583 C  CD    . GLU B 34  ? 0.9099 1.1905 1.3461 -0.0664 -0.1106 0.2330  948  GLU B CD    
1584 O  OE1   . GLU B 34  ? 0.8419 1.1410 1.2938 -0.0711 -0.1134 0.2450  948  GLU B OE1   
1585 O  OE2   . GLU B 34  ? 0.9848 1.2669 1.3997 -0.0534 -0.0972 0.2288  948  GLU B OE2   
1586 N  N     . GLY B 35  ? 0.9237 1.1080 1.3024 -0.0686 -0.1320 0.1493  949  GLY B N     
1587 C  CA    . GLY B 35  ? 0.8541 1.0325 1.2185 -0.0660 -0.1329 0.1336  949  GLY B CA    
1588 C  C     . GLY B 35  ? 0.8724 1.0318 1.2418 -0.0753 -0.1490 0.1222  949  GLY B C     
1589 O  O     . GLY B 35  ? 1.0617 1.2254 1.4337 -0.0786 -0.1545 0.1200  949  GLY B O     
1590 N  N     . VAL B 36  ? 0.6734 0.8111 1.0433 -0.0791 -0.1571 0.1147  950  VAL B N     
1591 C  CA    . VAL B 36  ? 0.7153 0.8327 1.0891 -0.0873 -0.1734 0.1040  950  VAL B CA    
1592 C  C     . VAL B 36  ? 0.7654 0.8934 1.1646 -0.0997 -0.1852 0.1189  950  VAL B C     
1593 O  O     . VAL B 36  ? 0.8178 0.9426 1.2188 -0.1046 -0.1951 0.1131  950  VAL B O     
1594 C  CB    . VAL B 36  ? 0.7301 0.8228 1.1005 -0.0883 -0.1792 0.0955  950  VAL B CB    
1595 C  CG1   . VAL B 36  ? 0.7499 0.8184 1.1175 -0.0937 -0.1948 0.0808  950  VAL B CG1   
1596 C  CG2   . VAL B 36  ? 0.7110 0.7982 1.0596 -0.0765 -0.1666 0.0846  950  VAL B CG2   
1597 N  N     . LYS B 37  ? 0.7368 0.8786 1.1565 -0.1048 -0.1844 0.1392  951  LYS B N     
1598 C  CA    . LYS B 37  ? 0.6573 0.8117 1.1041 -0.1172 -0.1953 0.1561  951  LYS B CA    
1599 C  C     . LYS B 37  ? 0.6777 0.8529 1.1262 -0.1165 -0.1930 0.1600  951  LYS B C     
1600 O  O     . LYS B 37  ? 0.8099 0.9832 1.2689 -0.1257 -0.2066 0.1591  951  LYS B O     
1601 C  CB    . LYS B 37  ? 0.6838 0.8555 1.1512 -0.1200 -0.1905 0.1796  951  LYS B CB    
1602 N  N     . LEU B 38  ? 0.7171 0.9113 1.1539 -0.1051 -0.1762 0.1635  952  LEU B N     
1603 C  CA    . LEU B 38  ? 0.7750 0.9905 1.2122 -0.1026 -0.1719 0.1685  952  LEU B CA    
1604 C  C     . LEU B 38  ? 0.7918 0.9928 1.2149 -0.1027 -0.1794 0.1489  952  LEU B C     
1605 O  O     . LEU B 38  ? 0.6917 0.9025 1.1258 -0.1090 -0.1876 0.1530  952  LEU B O     
1606 C  CB    . LEU B 38  ? 0.6208 0.8542 1.0432 -0.0886 -0.1520 0.1730  952  LEU B CB    
1607 C  CG    . LEU B 38  ? 0.5917 0.8465 1.0255 -0.0853 -0.1416 0.1948  952  LEU B CG    
1608 C  CD1   . LEU B 38  ? 0.6605 0.9082 1.0741 -0.0737 -0.1285 0.1888  952  LEU B CD1   
1609 C  CD2   . LEU B 38  ? 0.4418 0.7258 0.8820 -0.0815 -0.1340 0.2096  952  LEU B CD2   
1610 N  N     . GLU B 39  ? 0.9179 1.0967 1.3171 -0.0954 -0.1766 0.1279  953  GLU B N     
1611 C  CA    . GLU B 39  ? 0.9804 1.1471 1.3643 -0.0933 -0.1817 0.1097  953  GLU B CA    
1612 C  C     . GLU B 39  ? 0.9934 1.1468 1.3899 -0.1056 -0.2021 0.1062  953  GLU B C     
1613 O  O     . GLU B 39  ? 0.9789 1.1348 1.3734 -0.1072 -0.2084 0.1009  953  GLU B O     
1614 C  CB    . GLU B 39  ? 1.1721 1.3185 1.5291 -0.0830 -0.1746 0.0894  953  GLU B CB    
1615 C  CG    . GLU B 39  ? 1.4454 1.5647 1.7985 -0.0853 -0.1825 0.0785  953  GLU B CG    
1616 C  CD    . GLU B 39  ? 1.5991 1.6971 1.9545 -0.0930 -0.2008 0.0675  953  GLU B CD    
1617 O  OE1   . GLU B 39  ? 1.6330 1.7323 1.9851 -0.0940 -0.2067 0.0615  953  GLU B OE1   
1618 O  OE2   . GLU B 39  ? 1.6640 1.7430 2.0237 -0.0977 -0.2096 0.0648  953  GLU B OE2   
1619 N  N     . LEU B 40  ? 0.9437 1.0827 1.3534 -0.1145 -0.2131 0.1095  954  LEU B N     
1620 C  CA    . LEU B 40  ? 0.9335 1.0594 1.3549 -0.1265 -0.2335 0.1064  954  LEU B CA    
1621 C  C     . LEU B 40  ? 0.9897 1.1414 1.4364 -0.1362 -0.2391 0.1261  954  LEU B C     
1622 O  O     . LEU B 40  ? 1.0815 1.2322 1.5247 -0.1386 -0.2465 0.1210  954  LEU B O     
1623 C  CB    . LEU B 40  ? 0.9466 1.0471 1.3746 -0.1339 -0.2458 0.1036  954  LEU B CB    
1624 C  CG    . LEU B 40  ? 1.1451 1.2207 1.5735 -0.1427 -0.2655 0.0943  954  LEU B CG    
1625 C  CD1   . LEU B 40  ? 1.1727 1.2523 1.5950 -0.1436 -0.2716 0.0885  954  LEU B CD1   
1626 C  CD2   . LEU B 40  ? 1.1408 1.1829 1.5514 -0.1387 -0.2720 0.0737  954  LEU B CD2   
1627 N  N     . ALA B 41  ? 0.9181 1.0901 1.3823 -0.1384 -0.2315 0.1479  955  ALA B N     
1628 C  CA    . ALA B 41  ? 0.8622 1.0573 1.3409 -0.1430 -0.2303 0.1665  955  ALA B CA    
1629 C  C     . ALA B 41  ? 0.7892 0.9977 1.2588 -0.1382 -0.2280 0.1603  955  ALA B C     
1630 O  O     . ALA B 41  ? 0.7023 0.9140 1.1771 -0.1442 -0.2359 0.1636  955  ALA B O     
1631 C  CB    . ALA B 41  ? 0.9231 1.1450 1.4152 -0.1397 -0.2160 0.1891  955  ALA B CB    
1632 N  N     . LEU B 42  ? 0.8530 1.0650 1.3062 -0.1269 -0.2177 0.1490  956  LEU B N     
1633 C  CA    . LEU B 42  ? 0.8237 1.0455 1.2623 -0.1192 -0.2119 0.1415  956  LEU B CA    
1634 C  C     . LEU B 42  ? 0.9744 1.1773 1.4054 -0.1237 -0.2279 0.1241  956  LEU B C     
1635 O  O     . LEU B 42  ? 1.0515 1.2665 1.4872 -0.1265 -0.2329 0.1272  956  LEU B O     
1636 C  CB    . LEU B 42  ? 0.7719 0.9902 1.1835 -0.1035 -0.1932 0.1305  956  LEU B CB    
1637 C  CG    . LEU B 42  ? 0.8441 1.0788 1.2459 -0.0960 -0.1857 0.1290  956  LEU B CG    
1638 C  CD1   . LEU B 42  ? 0.8714 1.1373 1.2930 -0.0972 -0.1786 0.1539  956  LEU B CD1   
1639 C  CD2   . LEU B 42  ? 0.7758 1.0042 1.1488 -0.0810 -0.1696 0.1151  956  LEU B CD2   
1640 N  N     . ARG B 43  ? 1.0236 1.1956 1.4382 -0.1219 -0.2335 0.1047  957  ARG B N     
1641 C  CA    . ARG B 43  ? 1.1015 1.2523 1.5045 -0.1238 -0.2479 0.0862  957  ARG B CA    
1642 C  C     . ARG B 43  ? 1.2173 1.3695 1.6336 -0.1350 -0.2620 0.0935  957  ARG B C     
1643 O  O     . ARG B 43  ? 1.1195 1.2774 1.5305 -0.1342 -0.2660 0.0888  957  ARG B O     
1644 C  CB    . ARG B 43  ? 1.1380 1.2551 1.5284 -0.1232 -0.2547 0.0699  957  ARG B CB    
1645 C  CG    . ARG B 43  ? 1.1848 1.2958 1.5563 -0.1109 -0.2377 0.0624  957  ARG B CG    
1646 C  CD    . ARG B 43  ? 1.2484 1.3486 1.5923 -0.0993 -0.2325 0.0423  957  ARG B CD    
1647 N  NE    . ARG B 43  ? 1.2316 1.3230 1.5574 -0.0883 -0.2183 0.0336  957  ARG B NE    
1648 C  CZ    . ARG B 43  ? 1.2347 1.3194 1.5373 -0.0770 -0.2098 0.0186  957  ARG B CZ    
1649 N  NH1   . ARG B 43  ? 1.2733 1.3581 1.5661 -0.0740 -0.2136 0.0096  957  ARG B NH1   
1650 N  NH2   . ARG B 43  ? 1.2703 1.3485 1.5596 -0.0685 -0.1977 0.0128  957  ARG B NH2   
1651 N  N     . ARG B 44  ? 1.3777 1.5231 1.8087 -0.1444 -0.2679 0.1049  958  ARG B N     
1652 C  CA    . ARG B 44  ? 1.1337 1.2773 1.5758 -0.1548 -0.2803 0.1123  958  ARG B CA    
1653 C  C     . ARG B 44  ? 1.1150 1.2919 1.5696 -0.1556 -0.2738 0.1292  958  ARG B C     
1654 O  O     . ARG B 44  ? 1.1007 1.2794 1.5554 -0.1595 -0.2826 0.1275  958  ARG B O     
1655 C  CB    . ARG B 44  ? 1.0995 1.2306 1.5565 -0.1641 -0.2869 0.1234  958  ARG B CB    
1656 C  CG    . ARG B 44  ? 1.1277 1.2257 1.5735 -0.1631 -0.2931 0.1087  958  ARG B CG    
1657 C  CD    . ARG B 44  ? 1.2774 1.3691 1.7407 -0.1714 -0.2968 0.1236  958  ARG B CD    
1658 N  NE    . ARG B 44  ? 1.4129 1.4844 1.8686 -0.1676 -0.2951 0.1151  958  ARG B NE    
1659 C  CZ    . ARG B 44  ? 1.4539 1.5204 1.9227 -0.1721 -0.2955 0.1269  958  ARG B CZ    
1660 N  NH1   . ARG B 44  ? 1.5527 1.6331 2.0432 -0.1806 -0.2974 0.1482  958  ARG B NH1   
1661 N  NH2   . ARG B 44  ? 1.3767 1.4251 1.8370 -0.1677 -0.2937 0.1177  958  ARG B NH2   
1662 N  N     . GLN B 45  ? 1.1576 1.3612 1.6216 -0.1511 -0.2583 0.1456  959  GLN B N     
1663 C  CA    . GLN B 45  ? 1.2803 1.5145 1.7592 -0.1529 -0.2525 0.1658  959  GLN B CA    
1664 C  C     . GLN B 45  ? 1.2771 1.5225 1.7484 -0.1498 -0.2542 0.1595  959  GLN B C     
1665 O  O     . GLN B 45  ? 1.3532 1.6109 1.8360 -0.1561 -0.2595 0.1705  959  GLN B O     
1666 C  CB    . GLN B 45  ? 1.3328 1.5929 1.8180 -0.1453 -0.2339 0.1822  959  GLN B CB    
1667 C  CG    . GLN B 45  ? 1.4865 1.7491 1.9900 -0.1521 -0.2335 0.2011  959  GLN B CG    
1668 C  CD    . GLN B 45  ? 1.5592 1.8529 2.0716 -0.1454 -0.2162 0.2227  959  GLN B CD    
1669 O  OE1   . GLN B 45  ? 1.6389 1.9505 2.1418 -0.1344 -0.2031 0.2223  959  GLN B OE1   
1670 N  NE2   . GLN B 45  ? 1.4868 1.7865 2.0165 -0.1512 -0.2158 0.2422  959  GLN B NE2   
1671 N  N     . SER B 46  ? 1.2395 1.4811 1.6920 -0.1402 -0.2503 0.1424  960  SER B N     
1672 C  CA    . SER B 46  ? 1.2361 1.4896 1.6813 -0.1364 -0.2514 0.1372  960  SER B CA    
1673 C  C     . SER B 46  ? 1.3862 1.6177 1.8094 -0.1308 -0.2578 0.1122  960  SER B C     
1674 O  O     . SER B 46  ? 1.2136 1.4329 1.6251 -0.1241 -0.2529 0.1010  960  SER B O     
1675 C  CB    . SER B 46  ? 1.1036 1.3900 1.5504 -0.1265 -0.2337 0.1499  960  SER B CB    
1676 O  OG    . SER B 46  ? 1.0937 1.3795 1.5289 -0.1159 -0.2218 0.1431  960  SER B OG    
1677 N  N     . SER B 47  ? 1.5910 1.8185 2.0084 -0.1329 -0.2687 0.1039  961  SER B N     
1678 C  CA    . SER B 47  ? 1.6354 1.8431 2.0307 -0.1265 -0.2750 0.0807  961  SER B CA    
1679 C  C     . SER B 47  ? 1.5999 1.8257 1.9844 -0.1138 -0.2626 0.0770  961  SER B C     
1680 O  O     . SER B 47  ? 1.6328 1.8400 1.9935 -0.1039 -0.2583 0.0586  961  SER B O     
1681 C  CB    . SER B 47  ? 1.6912 1.8882 2.0830 -0.1326 -0.2912 0.0733  961  SER B CB    
1682 O  OG    . SER B 47  ? 1.6685 1.8923 2.0649 -0.1308 -0.2883 0.0814  961  SER B OG    
1683 N  N     . SER B 48  ? 1.2681 1.5256 1.6628 -0.1112 -0.2523 0.0935  962  SER B N     
1684 C  CA    . SER B 48  ? 0.9833 1.2534 1.3605 -0.0971 -0.2369 0.0893  962  SER B CA    
1685 C  C     . SER B 48  ? 0.7326 0.9909 1.0892 -0.0848 -0.2182 0.0811  962  SER B C     
1686 O  O     . SER B 48  ? 0.7516 1.0144 1.1166 -0.0856 -0.2098 0.0916  962  SER B O     
1687 C  CB    . SER B 48  ? 1.0124 1.3192 1.4058 -0.0964 -0.2288 0.1107  962  SER B CB    
1688 O  OG    . SER B 48  ? 1.0946 1.4107 1.4681 -0.0812 -0.2105 0.1071  962  SER B OG    
1689 N  N     . PRO B 49  ? 0.5894 0.8332 0.9195 -0.0735 -0.2115 0.0630  963  PRO B N     
1690 C  CA    . PRO B 49  ? 0.6873 0.9184 0.9987 -0.0630 -0.1953 0.0547  963  PRO B CA    
1691 C  C     . PRO B 49  ? 0.7527 1.0049 1.0642 -0.0550 -0.1754 0.0682  963  PRO B C     
1692 O  O     . PRO B 49  ? 0.7147 0.9631 1.0262 -0.0535 -0.1667 0.0719  963  PRO B O     
1693 C  CB    . PRO B 49  ? 0.6044 0.8193 0.8903 -0.0533 -0.1942 0.0343  963  PRO B CB    
1694 C  CG    . PRO B 49  ? 0.6302 0.8583 0.9201 -0.0553 -0.2034 0.0360  963  PRO B CG    
1695 C  CD    . PRO B 49  ? 0.5665 0.8028 0.8831 -0.0704 -0.2202 0.0488  963  PRO B CD    
1696 N  N     . GLU B 50  ? 0.8266 1.1004 1.1370 -0.0492 -0.1679 0.0755  964  GLU B N     
1697 C  CA    . GLU B 50  ? 0.9867 1.2795 1.2958 -0.0407 -0.1492 0.0885  964  GLU B CA    
1698 C  C     . GLU B 50  ? 0.9065 1.2175 1.2403 -0.0485 -0.1502 0.1097  964  GLU B C     
1699 O  O     . GLU B 50  ? 0.8099 1.1286 1.1421 -0.0425 -0.1362 0.1188  964  GLU B O     
1700 C  CB    . GLU B 50  ? 0.8750 1.1859 1.1762 -0.0318 -0.1407 0.0916  964  GLU B CB    
1701 C  CG    . GLU B 50  ? 0.8403 1.1711 1.1398 -0.0221 -0.1218 0.1061  964  GLU B CG    
1702 C  CD    . GLU B 50  ? 0.9218 1.2429 1.1941 -0.0077 -0.1055 0.0948  964  GLU B CD    
1703 O  OE1   . GLU B 50  ? 0.9505 1.2806 1.2169 0.0009  -0.0900 0.1033  964  GLU B OE1   
1704 O  OE2   . GLU B 50  ? 0.9396 1.2439 1.1965 -0.0049 -0.1084 0.0777  964  GLU B OE2   
1705 N  N     . GLN B 51  ? 0.8631 1.1812 1.2199 -0.0617 -0.1670 0.1182  965  GLN B N     
1706 C  CA    . GLN B 51  ? 0.8005 1.1332 1.1827 -0.0705 -0.1696 0.1381  965  GLN B CA    
1707 C  C     . GLN B 51  ? 0.6946 1.0078 1.0735 -0.0716 -0.1672 0.1338  965  GLN B C     
1708 O  O     . GLN B 51  ? 0.8266 1.1517 1.2134 -0.0697 -0.1574 0.1481  965  GLN B O     
1709 C  CB    . GLN B 51  ? 0.8502 1.1891 1.2575 -0.0861 -0.1906 0.1457  965  GLN B CB    
1710 C  CG    . GLN B 51  ? 1.0098 1.3610 1.4430 -0.0961 -0.1936 0.1663  965  GLN B CG    
1711 C  CD    . GLN B 51  ? 1.0575 1.4388 1.4972 -0.0889 -0.1768 0.1875  965  GLN B CD    
1712 O  OE1   . GLN B 51  ? 1.0464 1.4462 1.4818 -0.0818 -0.1700 0.1916  965  GLN B OE1   
1713 N  NE2   . GLN B 51  ? 0.9902 1.3761 1.4393 -0.0899 -0.1697 0.2013  965  GLN B NE2   
1714 N  N     . GLN B 52  ? 0.5937 0.8775 0.9607 -0.0739 -0.1761 0.1144  966  GLN B N     
1715 C  CA    . GLN B 52  ? 0.7327 0.9969 1.0922 -0.0725 -0.1719 0.1079  966  GLN B CA    
1716 C  C     . GLN B 52  ? 0.7612 1.0307 1.1041 -0.0590 -0.1509 0.1089  966  GLN B C     
1717 O  O     . GLN B 52  ? 0.6968 0.9688 1.0442 -0.0582 -0.1438 0.1177  966  GLN B O     
1718 C  CB    . GLN B 52  ? 0.9132 1.1459 1.2563 -0.0727 -0.1811 0.0850  966  GLN B CB    
1719 C  CG    . GLN B 52  ? 0.9760 1.1935 1.3326 -0.0860 -0.2024 0.0817  966  GLN B CG    
1720 C  CD    . GLN B 52  ? 1.1196 1.3063 1.4558 -0.0829 -0.2092 0.0584  966  GLN B CD    
1721 O  OE1   . GLN B 52  ? 1.1500 1.3310 1.4640 -0.0717 -0.2001 0.0453  966  GLN B OE1   
1722 N  NE2   . GLN B 52  ? 1.1576 1.3242 1.5010 -0.0921 -0.2250 0.0536  966  GLN B NE2   
1723 N  N     . LYS B 53  ? 0.6912 0.9620 1.0145 -0.0483 -0.1412 0.1000  967  LYS B N     
1724 C  CA    . LYS B 53  ? 0.5674 0.8408 0.8731 -0.0354 -0.1221 0.0996  967  LYS B CA    
1725 C  C     . LYS B 53  ? 0.6302 0.9284 0.9480 -0.0330 -0.1121 0.1212  967  LYS B C     
1726 O  O     . LYS B 53  ? 0.6989 0.9949 1.0115 -0.0282 -0.1022 0.1247  967  LYS B O     
1727 C  CB    . LYS B 53  ? 0.5541 0.8274 0.8403 -0.0254 -0.1148 0.0892  967  LYS B CB    
1728 C  CG    . LYS B 53  ? 0.4165 0.6977 0.6867 -0.0122 -0.0956 0.0922  967  LYS B CG    
1729 C  CD    . LYS B 53  ? 0.3692 0.6490 0.6224 -0.0041 -0.0911 0.0819  967  LYS B CD    
1730 C  CE    . LYS B 53  ? 0.4571 0.7470 0.6962 0.0088  -0.0733 0.0869  967  LYS B CE    
1731 N  NZ    . LYS B 53  ? 0.4506 0.7443 0.6784 0.0153  -0.0703 0.0811  967  LYS B NZ    
1732 N  N     . LYS B 54  ? 0.6580 0.9805 0.9919 -0.0360 -0.1148 0.1363  968  LYS B N     
1733 C  CA    . LYS B 54  ? 0.5813 0.9300 0.9283 -0.0332 -0.1056 0.1587  968  LYS B CA    
1734 C  C     . LYS B 54  ? 0.5236 0.8710 0.8865 -0.0405 -0.1092 0.1688  968  LYS B C     
1735 O  O     . LYS B 54  ? 0.6683 1.0237 1.0286 -0.0335 -0.0969 0.1788  968  LYS B O     
1736 C  CB    . LYS B 54  ? 0.5104 0.8857 0.8767 -0.0377 -0.1112 0.1741  968  LYS B CB    
1737 C  CG    . LYS B 54  ? 0.5942 0.9703 0.9479 -0.0328 -0.1113 0.1639  968  LYS B CG    
1738 C  CD    . LYS B 54  ? 0.6179 1.0240 0.9758 -0.0250 -0.1012 0.1806  968  LYS B CD    
1739 C  CE    . LYS B 54  ? 0.7324 1.1399 1.0798 -0.0211 -0.1030 0.1712  968  LYS B CE    
1740 N  NZ    . LYS B 54  ? 0.8532 1.2805 1.1907 -0.0072 -0.0865 0.1806  968  LYS B NZ    
1741 N  N     . LEU B 55  ? 0.5673 0.9040 0.9462 -0.0542 -0.1263 0.1664  969  LEU B N     
1742 C  CA    . LEU B 55  ? 0.5745 0.9092 0.9698 -0.0619 -0.1306 0.1764  969  LEU B CA    
1743 C  C     . LEU B 55  ? 0.5879 0.9024 0.9643 -0.0548 -0.1217 0.1653  969  LEU B C     
1744 O  O     . LEU B 55  ? 0.6097 0.9303 0.9923 -0.0535 -0.1155 0.1770  969  LEU B O     
1745 C  CB    . LEU B 55  ? 0.5848 0.9081 0.9985 -0.0778 -0.1517 0.1737  969  LEU B CB    
1746 C  CG    . LEU B 55  ? 0.7282 1.0742 1.1690 -0.0885 -0.1631 0.1904  969  LEU B CG    
1747 C  CD1   . LEU B 55  ? 0.6938 1.0207 1.1469 -0.1038 -0.1846 0.1837  969  LEU B CD1   
1748 C  CD2   . LEU B 55  ? 0.7038 1.0754 1.1628 -0.0886 -0.1547 0.2163  969  LEU B CD2   
1749 N  N     . TRP B 56  ? 0.5464 0.8378 0.9001 -0.0500 -0.1210 0.1433  970  TRP B N     
1750 C  CA    . TRP B 56  ? 0.5962 0.8687 0.9319 -0.0435 -0.1131 0.1322  970  TRP B CA    
1751 C  C     . TRP B 56  ? 0.6775 0.9627 1.0011 -0.0309 -0.0949 0.1400  970  TRP B C     
1752 O  O     . TRP B 56  ? 0.5412 0.8241 0.8631 -0.0281 -0.0890 0.1445  970  TRP B O     
1753 C  CB    . TRP B 56  ? 0.4472 0.6957 0.7620 -0.0403 -0.1155 0.1085  970  TRP B CB    
1754 C  CG    . TRP B 56  ? 0.4967 0.7257 0.7943 -0.0345 -0.1088 0.0965  970  TRP B CG    
1755 C  CD1   . TRP B 56  ? 0.6243 0.8332 0.9229 -0.0398 -0.1168 0.0881  970  TRP B CD1   
1756 C  CD2   . TRP B 56  ? 0.5689 0.7965 0.8456 -0.0224 -0.0934 0.0916  970  TRP B CD2   
1757 N  NE1   . TRP B 56  ? 0.6934 0.8905 0.9743 -0.0319 -0.1071 0.0789  970  TRP B NE1   
1758 C  CE2   . TRP B 56  ? 0.7865 0.9942 1.0538 -0.0216 -0.0932 0.0807  970  TRP B CE2   
1759 C  CE3   . TRP B 56  ? 0.5081 0.7486 0.7730 -0.0122 -0.0801 0.0955  970  TRP B CE3   
1760 C  CZ2   . TRP B 56  ? 0.8740 1.0750 1.1216 -0.0119 -0.0810 0.0738  970  TRP B CZ2   
1761 C  CZ3   . TRP B 56  ? 0.6272 0.8590 0.8713 -0.0023 -0.0681 0.0881  970  TRP B CZ3   
1762 C  CH2   . TRP B 56  ? 0.7245 0.9371 0.9607 -0.0027 -0.0690 0.0774  970  TRP B CH2   
1763 N  N     . VAL B 57  ? 0.7020 0.9999 1.0159 -0.0224 -0.0861 0.1414  971  VAL B N     
1764 C  CA    . VAL B 57  ? 0.4958 0.8070 0.7989 -0.0101 -0.0694 0.1509  971  VAL B CA    
1765 C  C     . VAL B 57  ? 0.4732 0.8049 0.7962 -0.0123 -0.0678 0.1735  971  VAL B C     
1766 O  O     . VAL B 57  ? 0.6793 1.0139 0.9944 -0.0043 -0.0570 0.1797  971  VAL B O     
1767 C  CB    . VAL B 57  ? 0.3572 0.6809 0.6504 -0.0015 -0.0617 0.1517  971  VAL B CB    
1768 C  CG1   . VAL B 57  ? 0.3213 0.6586 0.6032 0.0120  -0.0449 0.1627  971  VAL B CG1   
1769 C  CG2   . VAL B 57  ? 0.5030 0.8061 0.7757 0.0017  -0.0620 0.1299  971  VAL B CG2   
1770 N  N     . GLY B 58  ? 0.5436 0.8895 0.8928 -0.0236 -0.0791 0.1863  972  GLY B N     
1771 C  CA    . GLY B 58  ? 0.6979 1.0659 1.0692 -0.0265 -0.0780 0.2099  972  GLY B CA    
1772 C  C     . GLY B 58  ? 0.8381 1.1961 1.2090 -0.0265 -0.0758 0.2117  972  GLY B C     
1773 O  O     . GLY B 58  ? 0.8869 1.2571 1.2536 -0.0171 -0.0635 0.2237  972  GLY B O     
1774 N  N     . GLN B 59  ? 0.8326 1.1682 1.2068 -0.0361 -0.0874 0.1998  973  GLN B N     
1775 C  CA    . GLN B 59  ? 0.7947 1.1231 1.1728 -0.0375 -0.0869 0.2040  973  GLN B CA    
1776 C  C     . GLN B 59  ? 0.7434 1.0425 1.1006 -0.0349 -0.0869 0.1823  973  GLN B C     
1777 O  O     . GLN B 59  ? 0.9767 1.2724 1.3225 -0.0273 -0.0776 0.1827  973  GLN B O     
1778 C  CB    . GLN B 59  ? 0.9722 1.3056 1.3809 -0.0526 -0.1011 0.2172  973  GLN B CB    
1779 C  CG    . GLN B 59  ? 1.1226 1.4557 1.5390 -0.0530 -0.0985 0.2276  973  GLN B CG    
1780 C  CD    . GLN B 59  ? 1.1995 1.5553 1.6482 -0.0621 -0.1039 0.2533  973  GLN B CD    
1781 O  OE1   . GLN B 59  ? 1.1858 1.5439 1.6553 -0.0751 -0.1180 0.2573  973  GLN B OE1   
1782 N  NE2   . GLN B 59  ? 1.1547 1.5269 1.6078 -0.0554 -0.0933 0.2708  973  GLN B NE2   
1783 N  N     . LEU B 60  ? 0.5643 0.8429 0.9161 -0.0406 -0.0971 0.1639  974  LEU B N     
1784 C  CA    . LEU B 60  ? 0.6945 0.9467 1.0294 -0.0388 -0.0978 0.1452  974  LEU B CA    
1785 C  C     . LEU B 60  ? 0.7898 1.0380 1.0984 -0.0251 -0.0828 0.1366  974  LEU B C     
1786 O  O     . LEU B 60  ? 0.8242 1.0585 1.1220 -0.0218 -0.0797 0.1291  974  LEU B O     
1787 C  CB    . LEU B 60  ? 0.5178 0.7503 0.8495 -0.0452 -0.1102 0.1274  974  LEU B CB    
1788 N  N     . LEU B 61  ? 0.6637 0.9241 0.9622 -0.0169 -0.0737 0.1382  975  LEU B N     
1789 C  CA    . LEU B 61  ? 0.6214 0.8751 0.8939 -0.0045 -0.0609 0.1284  975  LEU B CA    
1790 C  C     . LEU B 61  ? 0.6324 0.8914 0.8989 0.0031  -0.0508 0.1377  975  LEU B C     
1791 O  O     . LEU B 61  ? 0.6876 0.9312 0.9381 0.0076  -0.0469 0.1268  975  LEU B O     
1792 C  CB    . LEU B 61  ? 0.5944 0.8601 0.8587 0.0023  -0.0541 0.1295  975  LEU B CB    
1793 C  CG    . LEU B 61  ? 0.7080 0.9747 0.9491 0.0164  -0.0389 0.1276  975  LEU B CG    
1794 C  CD1   . LEU B 61  ? 0.8650 1.1075 1.0855 0.0194  -0.0373 0.1076  975  LEU B CD1   
1795 C  CD2   . LEU B 61  ? 0.7199 0.9998 0.9564 0.0222  -0.0334 0.1310  975  LEU B CD2   
1796 N  N     . GLN B 62  ? 0.7629 1.0448 1.0420 0.0051  -0.0463 0.1581  976  GLN B N     
1797 C  CA    . GLN B 62  ? 0.6506 0.9391 0.9238 0.0134  -0.0367 0.1684  976  GLN B CA    
1798 C  C     . GLN B 62  ? 0.4789 0.7522 0.7543 0.0086  -0.0419 0.1635  976  GLN B C     
1799 O  O     . GLN B 62  ? 0.5420 0.8073 0.8007 0.0164  -0.0348 0.1588  976  GLN B O     
1800 C  CB    . GLN B 62  ? 0.6879 1.0046 0.9797 0.0143  -0.0333 0.1933  976  GLN B CB    
1801 C  CG    . GLN B 62  ? 0.7990 1.1341 1.0916 0.0190  -0.0284 0.2009  976  GLN B CG    
1802 C  CD    . GLN B 62  ? 0.8808 1.2414 1.1763 0.0291  -0.0170 0.2228  976  GLN B CD    
1803 O  OE1   . GLN B 62  ? 0.9807 1.3569 1.2968 0.0251  -0.0189 0.2410  976  GLN B OE1   
1804 N  NE2   . GLN B 62  ? 0.8131 1.1779 1.0876 0.0430  -0.0048 0.2216  976  GLN B NE2   
1805 N  N     . LEU B 63  ? 0.5264 0.7947 0.8218 -0.0042 -0.0548 0.1640  977  LEU B N     
1806 C  CA    . LEU B 63  ? 0.5874 0.8389 0.8849 -0.0091 -0.0608 0.1577  977  LEU B CA    
1807 C  C     . LEU B 63  ? 0.6067 0.8356 0.8806 -0.0045 -0.0588 0.1359  977  LEU B C     
1808 O  O     . LEU B 63  ? 0.7058 0.9262 0.9698 -0.0003 -0.0551 0.1324  977  LEU B O     
1809 C  CB    . LEU B 63  ? 0.6276 0.8739 0.9479 -0.0235 -0.0760 0.1590  977  LEU B CB    
1810 C  CG    . LEU B 63  ? 0.5510 0.7799 0.8773 -0.0301 -0.0843 0.1542  977  LEU B CG    
1811 C  CD1   . LEU B 63  ? 0.6116 0.8462 0.9662 -0.0426 -0.0961 0.1679  977  LEU B CD1   
1812 C  CD2   . LEU B 63  ? 0.4900 0.6935 0.8020 -0.0313 -0.0899 0.1312  977  LEU B CD2   
1813 N  N     . VAL B 64  ? 0.6662 0.8860 0.9315 -0.0052 -0.0613 0.1217  978  VAL B N     
1814 C  CA    . VAL B 64  ? 0.5629 0.7625 0.8077 -0.0012 -0.0595 0.1019  978  VAL B CA    
1815 C  C     . VAL B 64  ? 0.4055 0.6056 0.6300 0.0103  -0.0470 0.1008  978  VAL B C     
1816 O  O     . VAL B 64  ? 0.5198 0.7056 0.7322 0.0127  -0.0459 0.0905  978  VAL B O     
1817 C  CB    . VAL B 64  ? 0.5132 0.7067 0.7520 -0.0022 -0.0625 0.0895  978  VAL B CB    
1818 C  CG1   . VAL B 64  ? 0.4145 0.5916 0.6308 0.0041  -0.0575 0.0719  978  VAL B CG1   
1819 C  CG2   . VAL B 64  ? 0.5678 0.7534 0.8220 -0.0132 -0.0767 0.0856  978  VAL B CG2   
1820 N  N     . ASP B 65  ? 0.3912 0.6075 0.6113 0.0178  -0.0379 0.1116  979  ASP B N     
1821 C  CA    . ASP B 65  ? 0.6128 0.8274 0.8112 0.0296  -0.0266 0.1098  979  ASP B CA    
1822 C  C     . ASP B 65  ? 0.6836 0.9009 0.8831 0.0322  -0.0244 0.1187  979  ASP B C     
1823 O  O     . ASP B 65  ? 0.5290 0.7357 0.7110 0.0383  -0.0200 0.1110  979  ASP B O     
1824 C  CB    . ASP B 65  ? 0.8488 1.0783 1.0398 0.0383  -0.0173 0.1181  979  ASP B CB    
1825 C  CG    . ASP B 65  ? 1.2885 1.5162 1.4780 0.0364  -0.0192 0.1098  979  ASP B CG    
1826 O  OD1   . ASP B 65  ? 1.4636 1.6898 1.6351 0.0452  -0.0108 0.1052  979  ASP B OD1   
1827 O  OD2   . ASP B 65  ? 1.3734 1.6006 1.5790 0.0264  -0.0291 0.1081  979  ASP B OD2   
1828 N  N     . LYS B 66  ? 0.5718 0.8038 0.7920 0.0277  -0.0274 0.1355  980  LYS B N     
1829 C  CA    . LYS B 66  ? 0.4978 0.7314 0.7211 0.0291  -0.0265 0.1437  980  LYS B CA    
1830 C  C     . LYS B 66  ? 0.5337 0.7462 0.7520 0.0247  -0.0326 0.1286  980  LYS B C     
1831 O  O     . LYS B 66  ? 0.6297 0.8358 0.8342 0.0309  -0.0284 0.1251  980  LYS B O     
1832 C  CB    . LYS B 66  ? 0.4398 0.6905 0.6903 0.0221  -0.0311 0.1634  980  LYS B CB    
1833 N  N     . LYS B 67  ? 0.4202 0.6216 0.6486 0.0147  -0.0427 0.1192  981  LYS B N     
1834 C  CA    . LYS B 67  ? 0.6588 0.8399 0.8811 0.0116  -0.0480 0.1036  981  LYS B CA    
1835 C  C     . LYS B 67  ? 0.6212 0.7920 0.8186 0.0201  -0.0410 0.0901  981  LYS B C     
1836 O  O     . LYS B 67  ? 0.6095 0.7718 0.7981 0.0228  -0.0400 0.0851  981  LYS B O     
1837 C  CB    . LYS B 67  ? 0.5876 0.7581 0.8192 0.0025  -0.0583 0.0936  981  LYS B CB    
1838 C  CG    . LYS B 67  ? 0.5516 0.7259 0.8075 -0.0078 -0.0684 0.1036  981  LYS B CG    
1839 C  CD    . LYS B 67  ? 0.6594 0.8236 0.9196 -0.0147 -0.0777 0.0927  981  LYS B CD    
1840 C  CE    . LYS B 67  ? 0.8129 0.9629 1.0857 -0.0236 -0.0898 0.0892  981  LYS B CE    
1841 N  NZ    . LYS B 67  ? 0.8351 0.9737 1.1089 -0.0288 -0.0990 0.0773  981  LYS B NZ    
1842 N  N     . ASN B 68  ? 0.4760 0.6477 0.6623 0.0241  -0.0363 0.0844  982  ASN B N     
1843 C  CA    . ASN B 68  ? 0.5599 0.7194 0.7241 0.0304  -0.0312 0.0704  982  ASN B CA    
1844 C  C     . ASN B 68  ? 0.5757 0.7369 0.7250 0.0394  -0.0236 0.0743  982  ASN B C     
1845 O  O     . ASN B 68  ? 0.4581 0.6071 0.5956 0.0413  -0.0237 0.0646  982  ASN B O     
1846 C  CB    . ASN B 68  ? 0.5691 0.7300 0.7249 0.0334  -0.0273 0.0655  982  ASN B CB    
1847 C  CG    . ASN B 68  ? 0.6750 0.8229 0.8090 0.0394  -0.0221 0.0519  982  ASN B CG    
1848 O  OD1   . ASN B 68  ? 0.8299 0.9644 0.9594 0.0372  -0.0254 0.0409  982  ASN B OD1   
1849 N  ND2   . ASN B 68  ? 0.8025 0.9545 0.9230 0.0471  -0.0141 0.0533  982  ASN B ND2   
1850 N  N     . SER B 69  ? 0.6500 0.8267 0.7992 0.0457  -0.0172 0.0889  983  SER B N     
1851 C  CA    . SER B 69  ? 0.5260 0.7043 0.6590 0.0558  -0.0100 0.0931  983  SER B CA    
1852 C  C     . SER B 69  ? 0.4856 0.6612 0.6239 0.0536  -0.0138 0.0956  983  SER B C     
1853 O  O     . SER B 69  ? 0.6079 0.7769 0.7297 0.0601  -0.0107 0.0916  983  SER B O     
1854 C  CB    . SER B 69  ? 0.6225 0.8196 0.7556 0.0637  -0.0022 0.1097  983  SER B CB    
1855 O  OG    . SER B 69  ? 0.8222 1.0350 0.9802 0.0570  -0.0060 0.1242  983  SER B OG    
1856 N  N     . LEU B 70  ? 0.5555 0.7351 0.7161 0.0446  -0.0210 0.1021  984  LEU B N     
1857 C  CA    . LEU B 70  ? 0.5678 0.7424 0.7338 0.0418  -0.0253 0.1029  984  LEU B CA    
1858 C  C     . LEU B 70  ? 0.5467 0.7025 0.7007 0.0405  -0.0287 0.0848  984  LEU B C     
1859 O  O     . LEU B 70  ? 0.5768 0.7278 0.7200 0.0449  -0.0273 0.0822  984  LEU B O     
1860 C  CB    . LEU B 70  ? 0.6397 0.8189 0.8318 0.0315  -0.0334 0.1116  984  LEU B CB    
1861 C  CG    . LEU B 70  ? 0.6060 0.8042 0.8125 0.0329  -0.0308 0.1331  984  LEU B CG    
1862 C  CD1   . LEU B 70  ? 0.7388 0.9401 0.9722 0.0212  -0.0400 0.1412  984  LEU B CD1   
1863 C  CD2   . LEU B 70  ? 0.7127 0.9123 0.9110 0.0398  -0.0270 0.1383  984  LEU B CD2   
1864 N  N     . VAL B 71  ? 0.6542 0.8000 0.8099 0.0348  -0.0330 0.0725  985  VAL B N     
1865 C  CA    . VAL B 71  ? 0.5838 0.7135 0.7298 0.0335  -0.0359 0.0564  985  VAL B CA    
1866 C  C     . VAL B 71  ? 0.5870 0.7120 0.7101 0.0418  -0.0294 0.0498  985  VAL B C     
1867 O  O     . VAL B 71  ? 0.6008 0.7172 0.7153 0.0430  -0.0306 0.0428  985  VAL B O     
1868 C  CB    . VAL B 71  ? 0.4386 0.5604 0.5897 0.0275  -0.0407 0.0458  985  VAL B CB    
1869 C  CG1   . VAL B 71  ? 0.3837 0.4909 0.5253 0.0270  -0.0427 0.0305  985  VAL B CG1   
1870 C  CG2   . VAL B 71  ? 0.3777 0.5015 0.5500 0.0192  -0.0486 0.0513  985  VAL B CG2   
1871 N  N     . ALA B 72  ? 0.5494 0.6795 0.6623 0.0476  -0.0229 0.0520  986  ALA B N     
1872 C  CA    . ALA B 72  ? 0.3338 0.4577 0.4236 0.0559  -0.0170 0.0461  986  ALA B CA    
1873 C  C     . ALA B 72  ? 0.4914 0.6167 0.5727 0.0617  -0.0155 0.0513  986  ALA B C     
1874 O  O     . ALA B 72  ? 0.6093 0.7238 0.6768 0.0638  -0.0164 0.0420  986  ALA B O     
1875 C  CB    . ALA B 72  ? 0.3402 0.4710 0.4215 0.0623  -0.0098 0.0508  986  ALA B CB    
1876 N  N     . GLU B 73  ? 0.6270 0.7663 0.7168 0.0644  -0.0134 0.0666  987  GLU B N     
1877 C  CA    . GLU B 73  ? 0.7335 0.8754 0.8162 0.0704  -0.0120 0.0728  987  GLU B CA    
1878 C  C     . GLU B 73  ? 0.7271 0.8597 0.8144 0.0647  -0.0189 0.0654  987  GLU B C     
1879 O  O     . GLU B 73  ? 0.6057 0.7320 0.6783 0.0693  -0.0189 0.0606  987  GLU B O     
1880 C  CB    . GLU B 73  ? 0.7142 0.8742 0.8099 0.0729  -0.0091 0.0920  987  GLU B CB    
1881 C  CG    . GLU B 73  ? 0.9282 1.0927 1.0183 0.0794  -0.0075 0.1000  987  GLU B CG    
1882 C  CD    . GLU B 73  ? 1.1234 1.3077 1.2236 0.0844  -0.0025 0.1206  987  GLU B CD    
1883 O  OE1   . GLU B 73  ? 1.1663 1.3562 1.2553 0.0942  0.0019  0.1283  987  GLU B OE1   
1884 O  OE2   . GLU B 73  ? 1.2196 1.4144 1.3390 0.0787  -0.0031 0.1295  987  GLU B OE2   
1885 N  N     . GLU B 74  ? 0.7312 0.8625 0.8382 0.0549  -0.0252 0.0642  988  GLU B N     
1886 C  CA    . GLU B 74  ? 0.6732 0.7958 0.7850 0.0500  -0.0316 0.0574  988  GLU B CA    
1887 C  C     . GLU B 74  ? 0.6551 0.7646 0.7502 0.0514  -0.0323 0.0422  988  GLU B C     
1888 O  O     . GLU B 74  ? 0.6705 0.7760 0.7583 0.0535  -0.0340 0.0393  988  GLU B O     
1889 C  CB    . GLU B 74  ? 0.7057 0.8258 0.8381 0.0403  -0.0382 0.0562  988  GLU B CB    
1890 C  CG    . GLU B 74  ? 0.8163 0.9326 0.9593 0.0362  -0.0442 0.0569  988  GLU B CG    
1891 C  CD    . GLU B 74  ? 0.9194 1.0272 1.0761 0.0279  -0.0512 0.0501  988  GLU B CD    
1892 O  OE1   . GLU B 74  ? 0.9863 1.0970 1.1604 0.0228  -0.0555 0.0584  988  GLU B OE1   
1893 O  OE2   . GLU B 74  ? 0.7988 0.8967 0.9488 0.0267  -0.0527 0.0367  988  GLU B OE2   
1894 N  N     . ALA B 75  ? 0.6630 0.7664 0.7517 0.0505  -0.0309 0.0330  989  ALA B N     
1895 C  CA    . ALA B 75  ? 0.6668 0.7581 0.7420 0.0506  -0.0319 0.0193  989  ALA B CA    
1896 C  C     . ALA B 75  ? 0.7229 0.8114 0.7769 0.0587  -0.0284 0.0185  989  ALA B C     
1897 O  O     . ALA B 75  ? 0.6339 0.7143 0.6795 0.0586  -0.0315 0.0107  989  ALA B O     
1898 C  CB    . ALA B 75  ? 0.7331 0.8194 0.8069 0.0483  -0.0305 0.0113  989  ALA B CB    
1899 N  N     . GLU B 76  ? 0.6533 0.7483 0.6981 0.0662  -0.0223 0.0265  990  GLU B N     
1900 C  CA    . GLU B 76  ? 0.7487 0.8401 0.7712 0.0754  -0.0192 0.0261  990  GLU B CA    
1901 C  C     . GLU B 76  ? 0.7221 0.8149 0.7440 0.0769  -0.0227 0.0291  990  GLU B C     
1902 O  O     . GLU B 76  ? 0.7020 0.7860 0.7082 0.0798  -0.0250 0.0218  990  GLU B O     
1903 C  CB    . GLU B 76  ? 0.9168 1.0172 0.9312 0.0845  -0.0116 0.0368  990  GLU B CB    
1904 C  CG    . GLU B 76  ? 1.2102 1.3064 1.2161 0.0865  -0.0072 0.0322  990  GLU B CG    
1905 C  CD    . GLU B 76  ? 1.3955 1.4744 1.3866 0.0850  -0.0094 0.0168  990  GLU B CD    
1906 O  OE1   . GLU B 76  ? 1.5545 1.6289 1.5489 0.0808  -0.0090 0.0105  990  GLU B OE1   
1907 O  OE2   . GLU B 76  ? 1.4619 1.5321 1.4387 0.0880  -0.0119 0.0115  990  GLU B OE2   
1908 N  N     . LEU B 77  ? 0.7799 0.8837 0.8192 0.0746  -0.0238 0.0401  991  LEU B N     
1909 C  CA    . LEU B 77  ? 0.8352 0.9414 0.8756 0.0760  -0.0269 0.0440  991  LEU B CA    
1910 C  C     . LEU B 77  ? 0.7740 0.8701 0.8167 0.0696  -0.0338 0.0322  991  LEU B C     
1911 O  O     . LEU B 77  ? 0.8258 0.9175 0.8563 0.0728  -0.0362 0.0283  991  LEU B O     
1912 C  CB    . LEU B 77  ? 0.7344 0.8538 0.7956 0.0738  -0.0268 0.0586  991  LEU B CB    
1913 C  CG    . LEU B 77  ? 0.7810 0.9134 0.8428 0.0800  -0.0199 0.0726  991  LEU B CG    
1914 C  CD1   . LEU B 77  ? 0.7287 0.8735 0.8159 0.0745  -0.0208 0.0865  991  LEU B CD1   
1915 C  CD2   . LEU B 77  ? 0.8542 0.9905 0.8962 0.0924  -0.0151 0.0786  991  LEU B CD2   
1916 N  N     . MET B 78  ? 0.7256 0.8180 0.7829 0.0609  -0.0371 0.0264  992  MET B N     
1917 C  CA    . MET B 78  ? 0.7272 0.8116 0.7877 0.0554  -0.0430 0.0162  992  MET B CA    
1918 C  C     . MET B 78  ? 0.7813 0.8556 0.8239 0.0570  -0.0438 0.0047  992  MET B C     
1919 O  O     . MET B 78  ? 0.7088 0.7784 0.7516 0.0540  -0.0487 -0.0020 992  MET B O     
1920 C  CB    . MET B 78  ? 0.7314 0.8136 0.8089 0.0476  -0.0455 0.0124  992  MET B CB    
1921 C  CG    . MET B 78  ? 0.9410 1.0313 1.0352 0.0454  -0.0452 0.0232  992  MET B CG    
1922 S  SD    . MET B 78  ? 1.0508 1.1432 1.1597 0.0426  -0.0506 0.0289  992  MET B SD    
1923 C  CE    . MET B 78  ? 0.9468 1.0284 1.0542 0.0386  -0.0552 0.0142  992  MET B CE    
1924 N  N     . ILE B 79  ? 0.8056 0.8764 0.8331 0.0615  -0.0393 0.0026  993  ILE B N     
1925 C  CA    . ILE B 79  ? 0.7730 0.8330 0.7816 0.0637  -0.0407 -0.0071 993  ILE B CA    
1926 C  C     . ILE B 79  ? 0.7824 0.8424 0.7752 0.0710  -0.0417 -0.0042 993  ILE B C     
1927 O  O     . ILE B 79  ? 0.8594 0.9124 0.8439 0.0700  -0.0469 -0.0114 993  ILE B O     
1928 C  CB    . ILE B 79  ? 0.7537 0.8076 0.7506 0.0662  -0.0359 -0.0111 993  ILE B CB    
1929 C  CG1   . ILE B 79  ? 0.6654 0.7186 0.6765 0.0591  -0.0356 -0.0154 993  ILE B CG1   
1930 C  CG2   . ILE B 79  ? 0.7840 0.8249 0.7599 0.0688  -0.0379 -0.0204 993  ILE B CG2   
1931 C  CD1   . ILE B 79  ? 0.7698 0.8177 0.7703 0.0618  -0.0305 -0.0186 993  ILE B CD1   
1932 N  N     . THR B 80  ? 0.9056 0.9738 0.8937 0.0788  -0.0369 0.0067  994  THR B N     
1933 C  CA    . THR B 80  ? 1.0001 1.0690 0.9723 0.0871  -0.0376 0.0100  994  THR B CA    
1934 C  C     . THR B 80  ? 0.9936 1.0647 0.9748 0.0831  -0.0441 0.0095  994  THR B C     
1935 O  O     . THR B 80  ? 0.9720 1.0380 0.9388 0.0863  -0.0483 0.0051  994  THR B O     
1936 C  CB    . THR B 80  ? 0.8775 0.9582 0.8472 0.0963  -0.0310 0.0242  994  THR B CB    
1937 O  OG1   . THR B 80  ? 0.9687 1.0619 0.9606 0.0925  -0.0314 0.0348  994  THR B OG1   
1938 C  CG2   . THR B 80  ? 0.8602 0.9423 0.8267 0.0994  -0.0241 0.0270  994  THR B CG2   
1939 N  N     . VAL B 81  ? 0.8809 0.9592 0.8853 0.0763  -0.0455 0.0140  995  VAL B N     
1940 C  CA    . VAL B 81  ? 0.6391 0.7190 0.6537 0.0722  -0.0514 0.0132  995  VAL B CA    
1941 C  C     . VAL B 81  ? 0.6536 0.7233 0.6611 0.0679  -0.0573 0.0001  995  VAL B C     
1942 O  O     . VAL B 81  ? 0.7810 0.8497 0.7812 0.0695  -0.0621 -0.0021 995  VAL B O     
1943 C  CB    . VAL B 81  ? 0.4949 0.5803 0.5345 0.0651  -0.0521 0.0178  995  VAL B CB    
1944 C  CG1   . VAL B 81  ? 0.3894 0.4742 0.4391 0.0605  -0.0582 0.0148  995  VAL B CG1   
1945 C  CG2   . VAL B 81  ? 0.3883 0.4847 0.4369 0.0685  -0.0478 0.0324  995  VAL B CG2   
1946 N  N     . GLN B 82  ? 0.8076 0.8705 0.8180 0.0623  -0.0572 -0.0081 996  GLN B N     
1947 C  CA    . GLN B 82  ? 0.7860 0.8402 0.7920 0.0575  -0.0624 -0.0194 996  GLN B CA    
1948 C  C     . GLN B 82  ? 0.8082 0.8551 0.7912 0.0627  -0.0651 -0.0238 996  GLN B C     
1949 O  O     . GLN B 82  ? 0.7119 0.7562 0.6922 0.0603  -0.0717 -0.0287 996  GLN B O     
1950 C  CB    . GLN B 82  ? 0.7166 0.7649 0.7265 0.0527  -0.0602 -0.0260 996  GLN B CB    
1951 C  CG    . GLN B 82  ? 0.7632 0.8146 0.7941 0.0455  -0.0615 -0.0274 996  GLN B CG    
1952 C  CD    . GLN B 82  ? 0.8158 0.8634 0.8503 0.0425  -0.0580 -0.0316 996  GLN B CD    
1953 O  OE1   . GLN B 82  ? 1.1167 1.1589 1.1517 0.0384  -0.0597 -0.0394 996  GLN B OE1   
1954 N  NE2   . GLN B 82  ? 0.5504 0.6018 0.5882 0.0446  -0.0531 -0.0258 996  GLN B NE2   
1955 N  N     . GLU B 83  ? 0.7507 0.7941 0.7164 0.0702  -0.0605 -0.0219 997  GLU B N     
1956 C  CA    . GLU B 83  ? 0.8720 0.9064 0.8131 0.0764  -0.0635 -0.0264 997  GLU B CA    
1957 C  C     . GLU B 83  ? 0.9232 0.9639 0.8602 0.0812  -0.0671 -0.0212 997  GLU B C     
1958 O  O     . GLU B 83  ? 0.8334 0.8676 0.7576 0.0818  -0.0740 -0.0273 997  GLU B O     
1959 C  CB    . GLU B 83  ? 0.9232 0.9529 0.8461 0.0852  -0.0569 -0.0243 997  GLU B CB    
1960 C  CG    . GLU B 83  ? 0.9981 1.0216 0.9239 0.0811  -0.0531 -0.0292 997  GLU B CG    
1961 C  CD    . GLU B 83  ? 1.1234 1.1431 1.0317 0.0906  -0.0460 -0.0264 997  GLU B CD    
1962 O  OE1   . GLU B 83  ? 1.1675 1.1964 1.0721 0.0991  -0.0410 -0.0162 997  GLU B OE1   
1963 O  OE2   . GLU B 83  ? 1.1830 1.1907 1.0812 0.0898  -0.0452 -0.0338 997  GLU B OE2   
1964 N  N     . LEU B 84  ? 1.0353 1.0889 0.9843 0.0841  -0.0631 -0.0098 998  LEU B N     
1965 C  CA    . LEU B 84  ? 0.9224 0.9838 0.8693 0.0893  -0.0654 -0.0030 998  LEU B CA    
1966 C  C     . LEU B 84  ? 1.0655 1.1269 1.0206 0.0828  -0.0737 -0.0083 998  LEU B C     
1967 O  O     . LEU B 84  ? 1.4189 1.4816 1.3638 0.0873  -0.0781 -0.0076 998  LEU B O     
1968 C  CB    . LEU B 84  ? 0.8826 0.9579 0.8464 0.0913  -0.0596 0.0109  998  LEU B CB    
1969 C  CG    . LEU B 84  ? 0.8372 0.9216 0.7921 0.1022  -0.0562 0.0227  998  LEU B CG    
1970 C  CD1   . LEU B 84  ? 0.7679 0.8491 0.7011 0.1123  -0.0504 0.0243  998  LEU B CD1   
1971 C  CD2   . LEU B 84  ? 0.8880 0.9859 0.8662 0.1003  -0.0524 0.0361  998  LEU B CD2   
1972 N  N     . ASN B 85  ? 0.8903 0.9510 0.8636 0.0729  -0.0758 -0.0130 999  ASN B N     
1973 C  CA    . ASN B 85  ? 0.9146 0.9766 0.8961 0.0673  -0.0833 -0.0172 999  ASN B CA    
1974 C  C     . ASN B 85  ? 0.8489 0.9003 0.8202 0.0627  -0.0897 -0.0289 999  ASN B C     
1975 O  O     . ASN B 85  ? 1.0489 1.1007 1.0173 0.0612  -0.0971 -0.0320 999  ASN B O     
1976 C  CB    . ASN B 85  ? 1.1360 1.2044 1.1430 0.0603  -0.0825 -0.0146 999  ASN B CB    
1977 C  CG    . ASN B 85  ? 1.3528 1.4293 1.3709 0.0633  -0.0766 -0.0034 999  ASN B CG    
1978 O  OD1   . ASN B 85  ? 1.4440 1.5252 1.4536 0.0708  -0.0739 0.0046  999  ASN B OD1   
1979 N  ND2   . ASN B 85  ? 1.3691 1.4475 1.4065 0.0577  -0.0751 -0.0021 999  ASN B ND2   
1980 N  N     . LEU B 86  ? 0.7581 0.8005 0.7248 0.0602  -0.0872 -0.0349 1000 LEU B N     
1981 C  CA    . LEU B 86  ? 0.9387 0.9694 0.8938 0.0563  -0.0931 -0.0452 1000 LEU B CA    
1982 C  C     . LEU B 86  ? 1.1196 1.1437 1.0506 0.0628  -0.0985 -0.0477 1000 LEU B C     
1983 O  O     . LEU B 86  ? 1.2432 1.2609 1.1679 0.0587  -0.1071 -0.0548 1000 LEU B O     
1984 C  CB    . LEU B 86  ? 0.8753 0.8966 0.8258 0.0548  -0.0883 -0.0498 1000 LEU B CB    
1985 C  CG    . LEU B 86  ? 0.7678 0.7931 0.7399 0.0475  -0.0848 -0.0502 1000 LEU B CG    
1986 C  CD1   . LEU B 86  ? 0.7916 0.8074 0.7569 0.0469  -0.0802 -0.0547 1000 LEU B CD1   
1987 C  CD2   . LEU B 86  ? 0.6531 0.6811 0.6390 0.0393  -0.0913 -0.0542 1000 LEU B CD2   
1988 N  N     . GLU B 87  ? 1.1561 1.1821 1.0735 0.0732  -0.0938 -0.0413 1001 GLU B N     
1989 C  CA    . GLU B 87  ? 1.2016 1.2212 1.0937 0.0814  -0.0985 -0.0433 1001 GLU B CA    
1990 C  C     . GLU B 87  ? 1.1141 1.1417 1.0105 0.0806  -0.1061 -0.0417 1001 GLU B C     
1991 O  O     . GLU B 87  ? 1.1375 1.1574 1.0194 0.0804  -0.1151 -0.0485 1001 GLU B O     
1992 C  CB    . GLU B 87  ? 1.2779 1.2997 1.1552 0.0941  -0.0905 -0.0355 1001 GLU B CB    
1993 C  CG    . GLU B 87  ? 1.4059 1.4168 1.2700 0.0975  -0.0847 -0.0386 1001 GLU B CG    
1994 C  CD    . GLU B 87  ? 1.6263 1.6394 1.4724 0.1117  -0.0774 -0.0308 1001 GLU B CD    
1995 O  OE1   . GLU B 87  ? 1.6763 1.7044 1.5319 0.1163  -0.0728 -0.0193 1001 GLU B OE1   
1996 O  OE2   . GLU B 87  ? 1.6906 1.6904 1.5129 0.1186  -0.0761 -0.0356 1001 GLU B OE2   
1997 N  N     . GLU B 88  ? 1.1066 1.1490 1.0223 0.0804  -0.1029 -0.0324 1002 GLU B N     
1998 C  CA    . GLU B 88  ? 1.1498 1.2006 1.0709 0.0797  -0.1096 -0.0302 1002 GLU B CA    
1999 C  C     . GLU B 88  ? 1.1632 1.2104 1.0915 0.0694  -0.1188 -0.0391 1002 GLU B C     
2000 O  O     . GLU B 88  ? 1.2108 1.2572 1.1301 0.0696  -0.1278 -0.0425 1002 GLU B O     
2001 C  CB    . GLU B 88  ? 1.2652 1.3309 1.2086 0.0798  -0.1045 -0.0192 1002 GLU B CB    
2002 C  CG    . GLU B 88  ? 1.4988 1.5693 1.4682 0.0694  -0.1054 -0.0203 1002 GLU B CG    
2003 C  CD    . GLU B 88  ? 1.6346 1.7178 1.6224 0.0701  -0.1037 -0.0106 1002 GLU B CD    
2004 O  OE1   . GLU B 88  ? 1.6330 1.7220 1.6162 0.0778  -0.1007 -0.0020 1002 GLU B OE1   
2005 O  OE2   . GLU B 88  ? 1.6378 1.7247 1.6442 0.0635  -0.1052 -0.0113 1002 GLU B OE2   
2006 N  N     . LYS B 89  ? 1.0651 1.1105 1.0093 0.0606  -0.1170 -0.0427 1003 LYS B N     
2007 C  CA    . LYS B 89  ? 1.0516 1.0947 1.0038 0.0509  -0.1250 -0.0500 1003 LYS B CA    
2008 C  C     . LYS B 89  ? 1.1000 1.1287 1.0298 0.0505  -0.1330 -0.0590 1003 LYS B C     
2009 O  O     . LYS B 89  ? 1.2666 1.2955 1.1943 0.0469  -0.1430 -0.0626 1003 LYS B O     
2010 C  CB    . LYS B 89  ? 1.0738 1.1171 1.0448 0.0432  -0.1202 -0.0515 1003 LYS B CB    
2011 C  CG    . LYS B 89  ? 1.0835 1.1400 1.0799 0.0389  -0.1194 -0.0466 1003 LYS B CG    
2012 C  CD    . LYS B 89  ? 1.0375 1.0951 1.0492 0.0363  -0.1113 -0.0451 1003 LYS B CD    
2013 C  CE    . LYS B 89  ? 1.1345 1.1973 1.1498 0.0424  -0.1041 -0.0366 1003 LYS B CE    
2014 N  NZ    . LYS B 89  ? 1.1865 1.2505 1.2175 0.0394  -0.0978 -0.0353 1003 LYS B NZ    
2015 N  N     . GLN B 90  ? 1.1467 1.1624 1.0588 0.0547  -0.1291 -0.0626 1004 GLN B N     
2016 C  CA    . GLN B 90  ? 1.1731 1.1721 1.0606 0.0558  -0.1368 -0.0715 1004 GLN B CA    
2017 C  C     . GLN B 90  ? 1.2259 1.2253 1.0962 0.0623  -0.1447 -0.0715 1004 GLN B C     
2018 O  O     . GLN B 90  ? 1.1230 1.1121 0.9805 0.0591  -0.1558 -0.0792 1004 GLN B O     
2019 C  CB    . GLN B 90  ? 1.0550 1.0410 0.9239 0.0626  -0.1297 -0.0734 1004 GLN B CB    
2020 C  CG    . GLN B 90  ? 1.0710 1.0370 0.9233 0.0590  -0.1358 -0.0840 1004 GLN B CG    
2021 C  CD    . GLN B 90  ? 1.1383 1.0914 0.9702 0.0677  -0.1282 -0.0852 1004 GLN B CD    
2022 O  OE1   . GLN B 90  ? 1.1184 1.0556 0.9412 0.0645  -0.1299 -0.0925 1004 GLN B OE1   
2023 N  NE2   . GLN B 90  ? 1.2873 1.2477 1.1123 0.0790  -0.1197 -0.0774 1004 GLN B NE2   
2024 N  N     . TRP B 91  ? 1.2790 1.2900 1.1489 0.0712  -0.1397 -0.0626 1005 TRP B N     
2025 C  CA    . TRP B 91  ? 1.3084 1.3215 1.1622 0.0786  -0.1465 -0.0615 1005 TRP B CA    
2026 C  C     . TRP B 91  ? 1.3467 1.3684 1.2149 0.0703  -0.1567 -0.0628 1005 TRP B C     
2027 O  O     . TRP B 91  ? 1.4984 1.5130 1.3519 0.0694  -0.1683 -0.0693 1005 TRP B O     
2028 C  CB    . TRP B 91  ? 1.3762 1.4014 1.2292 0.0900  -0.1374 -0.0500 1005 TRP B CB    
2029 C  CG    . TRP B 91  ? 1.2525 1.2848 1.0948 0.0978  -0.1427 -0.0462 1005 TRP B CG    
2030 C  CD1   . TRP B 91  ? 1.2050 1.2540 1.0645 0.0977  -0.1425 -0.0377 1005 TRP B CD1   
2031 C  CD2   . TRP B 91  ? 1.3564 1.3788 1.1672 0.1077  -0.1490 -0.0505 1005 TRP B CD2   
2032 N  NE1   . TRP B 91  ? 1.3481 1.3996 1.1899 0.1066  -0.1480 -0.0361 1005 TRP B NE1   
2033 C  CE2   . TRP B 91  ? 1.4043 1.4396 1.2155 0.1131  -0.1523 -0.0441 1005 TRP B CE2   
2034 C  CE3   . TRP B 91  ? 1.3171 1.3200 1.0983 0.1131  -0.1524 -0.0594 1005 TRP B CE3   
2035 C  CZ2   . TRP B 91  ? 1.3798 1.4099 1.1627 0.1238  -0.1589 -0.0464 1005 TRP B CZ2   
2036 C  CZ3   . TRP B 91  ? 1.3799 1.3763 1.1322 0.1239  -0.1593 -0.0621 1005 TRP B CZ3   
2037 C  CH2   . TRP B 91  ? 1.3907 1.4011 1.1439 0.1292  -0.1625 -0.0557 1005 TRP B CH2   
2038 N  N     . GLN B 92  ? 1.1505 1.1872 1.0470 0.0643  -0.1531 -0.0566 1006 GLN B N     
2039 C  CA    . GLN B 92  ? 1.1677 1.2144 1.0793 0.0571  -0.1620 -0.0567 1006 GLN B CA    
2040 C  C     . GLN B 92  ? 1.1197 1.1566 1.0293 0.0469  -0.1726 -0.0665 1006 GLN B C     
2041 O  O     . GLN B 92  ? 1.2302 1.2673 1.1336 0.0447  -0.1842 -0.0698 1006 GLN B O     
2042 C  CB    . GLN B 92  ? 1.2535 1.3152 1.1954 0.0522  -0.1557 -0.0495 1006 GLN B CB    
2043 C  CG    . GLN B 92  ? 1.2556 1.3221 1.2043 0.0582  -0.1432 -0.0413 1006 GLN B CG    
2044 C  CD    . GLN B 92  ? 1.2865 1.3601 1.2258 0.0693  -0.1406 -0.0330 1006 GLN B CD    
2045 O  OE1   . GLN B 92  ? 1.2777 1.3504 1.1999 0.0745  -0.1474 -0.0342 1006 GLN B OE1   
2046 N  NE2   . GLN B 92  ? 1.3472 1.4277 1.2977 0.0731  -0.1309 -0.0240 1006 GLN B NE2   
2047 N  N     . LEU B 93  ? 1.0490 1.0772 0.9642 0.0405  -0.1691 -0.0709 1007 LEU B N     
2048 C  CA    . LEU B 93  ? 1.0521 1.0714 0.9684 0.0300  -0.1787 -0.0789 1007 LEU B CA    
2049 C  C     . LEU B 93  ? 1.0940 1.0952 0.9803 0.0330  -0.1885 -0.0873 1007 LEU B C     
2050 O  O     . LEU B 93  ? 1.1995 1.1957 1.0843 0.0251  -0.2010 -0.0930 1007 LEU B O     
2051 C  CB    . LEU B 93  ? 1.0870 1.1012 1.0155 0.0234  -0.1718 -0.0809 1007 LEU B CB    
2052 C  CG    . LEU B 93  ? 0.9893 1.0197 0.9487 0.0176  -0.1658 -0.0750 1007 LEU B CG    
2053 C  CD1   . LEU B 93  ? 1.0211 1.0649 0.9961 0.0115  -0.1749 -0.0728 1007 LEU B CD1   
2054 C  CD2   . LEU B 93  ? 1.0544 1.0944 1.0221 0.0248  -0.1542 -0.0671 1007 LEU B CD2   
2055 N  N     . ASP B 94  ? 1.1796 1.1708 1.0417 0.0446  -0.1833 -0.0878 1008 ASP B N     
2056 C  CA    . ASP B 94  ? 1.3608 1.3348 1.1909 0.0505  -0.1925 -0.0952 1008 ASP B CA    
2057 C  C     . ASP B 94  ? 1.4720 1.4536 1.2988 0.0507  -0.2045 -0.0952 1008 ASP B C     
2058 O  O     . ASP B 94  ? 1.5434 1.5152 1.3619 0.0443  -0.2183 -0.1028 1008 ASP B O     
2059 C  CB    . ASP B 94  ? 1.3751 1.3423 1.1816 0.0656  -0.1830 -0.0930 1008 ASP B CB    
2060 C  CG    . ASP B 94  ? 1.4660 1.4088 1.2382 0.0714  -0.1895 -0.1027 1008 ASP B CG    
2061 O  OD1   . ASP B 94  ? 1.4774 1.4099 1.2354 0.0789  -0.1807 -0.1032 1008 ASP B OD1   
2062 O  OD2   . ASP B 94  ? 1.5757 1.5095 1.3348 0.0686  -0.2037 -0.1098 1008 ASP B OD2   
2063 N  N     . GLN B 95  ? 1.4337 1.4331 1.2681 0.0576  -0.1996 -0.0861 1009 GLN B N     
2064 C  CA    . GLN B 95  ? 1.3779 1.3867 1.2100 0.0588  -0.2100 -0.0847 1009 GLN B CA    
2065 C  C     . GLN B 95  ? 1.4861 1.5002 1.3373 0.0444  -0.2217 -0.0878 1009 GLN B C     
2066 O  O     . GLN B 95  ? 1.5684 1.5759 1.4071 0.0414  -0.2361 -0.0941 1009 GLN B O     
2067 C  CB    . GLN B 95  ? 1.3146 1.3438 1.1596 0.0662  -0.2014 -0.0728 1009 GLN B CB    
2068 C  CG    . GLN B 95  ? 1.4327 1.4603 1.2523 0.0820  -0.1982 -0.0695 1009 GLN B CG    
2069 C  CD    . GLN B 95  ? 1.4302 1.4446 1.2329 0.0897  -0.1884 -0.0706 1009 GLN B CD    
2070 O  OE1   . GLN B 95  ? 1.3934 1.4136 1.2114 0.0896  -0.1762 -0.0644 1009 GLN B OE1   
2071 N  NE2   . GLN B 95  ? 1.3793 1.3752 1.1498 0.0966  -0.1942 -0.0786 1009 GLN B NE2   
2072 N  N     . GLU B 96  ? 1.4610 1.4878 1.3429 0.0357  -0.2158 -0.0830 1010 GLU B N     
2073 C  CA    . GLU B 96  ? 1.5265 1.5619 1.4296 0.0227  -0.2255 -0.0839 1010 GLU B CA    
2074 C  C     . GLU B 96  ? 1.5352 1.5525 1.4263 0.0140  -0.2379 -0.0941 1010 GLU B C     
2075 O  O     . GLU B 96  ? 1.6419 1.6616 1.5351 0.0070  -0.2519 -0.0967 1010 GLU B O     
2076 C  CB    . GLU B 96  ? 1.5409 1.5891 1.4752 0.0161  -0.2157 -0.0780 1010 GLU B CB    
2077 C  CG    . GLU B 96  ? 1.6099 1.6732 1.5563 0.0239  -0.2038 -0.0683 1010 GLU B CG    
2078 C  CD    . GLU B 96  ? 1.7161 1.7935 1.6936 0.0172  -0.1978 -0.0628 1010 GLU B CD    
2079 O  OE1   . GLU B 96  ? 1.6665 1.7415 1.6555 0.0074  -0.2003 -0.0662 1010 GLU B OE1   
2080 O  OE2   . GLU B 96  ? 1.8323 1.9228 1.8223 0.0222  -0.1905 -0.0548 1010 GLU B OE2   
2081 N  N     . LEU B 97  ? 1.3735 1.3720 1.2517 0.0145  -0.2333 -0.0998 1011 LEU B N     
2082 C  CA    . LEU B 97  ? 1.3066 1.2848 1.1714 0.0068  -0.2451 -0.1097 1011 LEU B CA    
2083 C  C     . LEU B 97  ? 1.3170 1.2830 1.1522 0.0122  -0.2589 -0.1163 1011 LEU B C     
2084 O  O     . LEU B 97  ? 1.1830 1.1409 1.0152 0.0030  -0.2744 -0.1225 1011 LEU B O     
2085 C  CB    . LEU B 97  ? 1.3579 1.3177 1.2120 0.0085  -0.2364 -0.1141 1011 LEU B CB    
2086 C  CG    . LEU B 97  ? 1.3929 1.3383 1.2516 -0.0042 -0.2435 -0.1206 1011 LEU B CG    
2087 C  CD1   . LEU B 97  ? 1.5620 1.4857 1.3946 -0.0061 -0.2602 -0.1306 1011 LEU B CD1   
2088 C  CD2   . LEU B 97  ? 1.3721 1.3364 1.2665 -0.0177 -0.2455 -0.1151 1011 LEU B CD2   
2089 N  N     . ARG B 98  ? 1.4513 1.4159 1.2645 0.0273  -0.2538 -0.1148 1012 ARG B N     
2090 C  CA    . ARG B 98  ? 1.4098 1.3637 1.1929 0.0347  -0.2662 -0.1206 1012 ARG B CA    
2091 C  C     . ARG B 98  ? 1.4512 1.4197 1.2468 0.0274  -0.2800 -0.1191 1012 ARG B C     
2092 O  O     . ARG B 98  ? 1.6360 1.5923 1.4175 0.0224  -0.2968 -0.1271 1012 ARG B O     
2093 C  CB    . ARG B 98  ? 1.3637 1.3202 1.1263 0.0529  -0.2563 -0.1160 1012 ARG B CB    
2094 C  CG    . ARG B 98  ? 1.3274 1.2754 1.0816 0.0612  -0.2409 -0.1146 1012 ARG B CG    
2095 C  CD    . ARG B 98  ? 1.3699 1.2883 1.0913 0.0652  -0.2461 -0.1257 1012 ARG B CD    
2096 N  NE    . ARG B 98  ? 1.3747 1.2871 1.0852 0.0761  -0.2307 -0.1230 1012 ARG B NE    
2097 C  CZ    . ARG B 98  ? 1.3955 1.2841 1.0826 0.0801  -0.2300 -0.1306 1012 ARG B CZ    
2098 N  NH1   . ARG B 98  ? 1.4959 1.3621 1.1667 0.0738  -0.2445 -0.1421 1012 ARG B NH1   
2099 N  NH2   . ARG B 98  ? 1.3431 1.2298 1.0229 0.0903  -0.2152 -0.1265 1012 ARG B NH2   
2100 N  N     . GLY B 99  ? 1.3330 1.3275 1.1548 0.0270  -0.2736 -0.1087 1013 GLY B N     
2101 C  CA    . GLY B 99  ? 1.4184 1.4292 1.2533 0.0210  -0.2857 -0.1059 1013 GLY B CA    
2102 C  C     . GLY B 99  ? 1.6130 1.6196 1.4607 0.0043  -0.2999 -0.1111 1013 GLY B C     
2103 O  O     . GLY B 99  ? 1.5990 1.6047 1.4398 -0.0001 -0.3166 -0.1150 1013 GLY B O     
2104 N  N     . TYR B 100 ? 1.7063 1.7105 1.5728 -0.0053 -0.2939 -0.1110 1014 TYR B N     
2105 C  CA    . TYR B 100 ? 1.6975 1.6971 1.5774 -0.0214 -0.3061 -0.1149 1014 TYR B CA    
2106 C  C     . TYR B 100 ? 1.6458 1.6170 1.4953 -0.0233 -0.3211 -0.1271 1014 TYR B C     
2107 O  O     . TYR B 100 ? 1.5763 1.5276 1.3949 -0.0121 -0.3178 -0.1333 1014 TYR B O     
2108 C  CB    . TYR B 100 ? 1.7121 1.7128 1.6145 -0.0289 -0.2947 -0.1121 1014 TYR B CB    
2109 C  CG    . TYR B 100 ? 1.6342 1.6622 1.5718 -0.0320 -0.2844 -0.1010 1014 TYR B CG    
2110 C  CD1   . TYR B 100 ? 1.6537 1.6984 1.5965 -0.0215 -0.2739 -0.0934 1014 TYR B CD1   
2111 C  CD2   . TYR B 100 ? 1.5199 1.5564 1.4852 -0.0449 -0.2853 -0.0978 1014 TYR B CD2   
2112 C  CE1   . TYR B 100 ? 1.6197 1.6868 1.5932 -0.0238 -0.2650 -0.0839 1014 TYR B CE1   
2113 C  CE2   . TYR B 100 ? 1.4686 1.5288 1.4642 -0.0465 -0.2759 -0.0880 1014 TYR B CE2   
2114 C  CZ    . TYR B 100 ? 1.5398 1.6144 1.5388 -0.0359 -0.2660 -0.0816 1014 TYR B CZ    
2115 O  OH    . TYR B 100 ? 1.4636 1.5597 1.4912 -0.0369 -0.2571 -0.0724 1014 TYR B OH    
2116 N  N     . ASP B 112 ? 1.4028 1.5605 1.5535 -0.1072 -0.3060 -0.0509 1026 ASP B N     
2117 C  CA    . ASP B 112 ? 1.5417 1.6801 1.6632 -0.1066 -0.3196 -0.0608 1026 ASP B CA    
2118 C  C     . ASP B 112 ? 1.7131 1.8193 1.8099 -0.1074 -0.3193 -0.0719 1026 ASP B C     
2119 O  O     . ASP B 112 ? 1.5276 1.6189 1.6013 -0.0960 -0.3101 -0.0777 1026 ASP B O     
2120 C  CB    . ASP B 112 ? 1.5102 1.6570 1.6399 -0.1180 -0.3376 -0.0589 1026 ASP B CB    
2121 N  N     . ARG B 113 ? 1.9100 2.0062 2.0126 -0.1209 -0.3295 -0.0742 1027 ARG B N     
2122 C  CA    . ARG B 113 ? 1.9297 1.9940 2.0088 -0.1222 -0.3304 -0.0846 1027 ARG B CA    
2123 C  C     . ARG B 113 ? 1.9163 1.9764 1.9982 -0.1161 -0.3108 -0.0836 1027 ARG B C     
2124 O  O     . ARG B 113 ? 1.9150 1.9518 1.9714 -0.1089 -0.3052 -0.0919 1027 ARG B O     
2125 C  CB    . ARG B 113 ? 1.9208 1.9764 2.0059 -0.1362 -0.3381 -0.0849 1027 ARG B CB    
2126 N  N     . GLN B 114 ? 1.9086 1.9913 2.0206 -0.1180 -0.3003 -0.0734 1028 GLN B N     
2127 C  CA    . GLN B 114 ? 1.8070 1.8861 1.9236 -0.1136 -0.2831 -0.0723 1028 GLN B CA    
2128 C  C     . GLN B 114 ? 1.7889 1.8677 1.8922 -0.0981 -0.2683 -0.0735 1028 GLN B C     
2129 O  O     . GLN B 114 ? 1.8457 1.9130 1.9415 -0.0930 -0.2561 -0.0762 1028 GLN B O     
2130 C  CB    . GLN B 114 ? 1.7385 1.8419 1.8905 -0.1199 -0.2772 -0.0608 1028 GLN B CB    
2131 N  N     . ALA B 115 ? 1.5741 1.6658 1.6751 -0.0907 -0.2691 -0.0709 1029 ALA B N     
2132 C  CA    . ALA B 115 ? 1.3802 1.4743 1.4732 -0.0768 -0.2549 -0.0700 1029 ALA B CA    
2133 C  C     . ALA B 115 ? 1.5398 1.6086 1.6004 -0.0690 -0.2524 -0.0794 1029 ALA B C     
2134 O  O     . ALA B 115 ? 1.5581 1.6222 1.6130 -0.0605 -0.2385 -0.0796 1029 ALA B O     
2135 C  CB    . ALA B 115 ? 1.2199 1.3336 1.3188 -0.0712 -0.2573 -0.0643 1029 ALA B CB    
2136 N  N     . GLU B 116 ? 1.6920 1.7440 1.7308 -0.0714 -0.2659 -0.0870 1030 GLU B N     
2137 C  CA    . GLU B 116 ? 1.6287 1.6572 1.6347 -0.0623 -0.2638 -0.0954 1030 GLU B CA    
2138 C  C     . GLU B 116 ? 1.5779 1.5896 1.5787 -0.0626 -0.2544 -0.0992 1030 GLU B C     
2139 O  O     . GLU B 116 ? 1.6309 1.6335 1.6158 -0.0522 -0.2435 -0.1013 1030 GLU B O     
2140 C  CB    . GLU B 116 ? 1.6634 1.6751 1.6455 -0.0647 -0.2810 -0.1036 1030 GLU B CB    
2141 C  CG    . GLU B 116 ? 1.6453 1.6271 1.5945 -0.0584 -0.2798 -0.1134 1030 GLU B CG    
2142 C  CD    . GLU B 116 ? 1.6693 1.6317 1.5902 -0.0584 -0.2967 -0.1225 1030 GLU B CD    
2143 O  OE1   . GLU B 116 ? 1.6700 1.6428 1.5885 -0.0568 -0.3060 -0.1213 1030 GLU B OE1   
2144 O  OE2   . GLU B 116 ? 1.7385 1.6746 1.6385 -0.0594 -0.3007 -0.1311 1030 GLU B OE2   
2145 N  N     . ASP B 117 ? 1.4338 1.4415 1.4476 -0.0744 -0.2587 -0.0995 1031 ASP B N     
2146 C  CA    . ASP B 117 ? 1.3763 1.3688 1.3859 -0.0745 -0.2494 -0.1024 1031 ASP B CA    
2147 C  C     . ASP B 117 ? 1.2006 1.2055 1.2216 -0.0664 -0.2312 -0.0968 1031 ASP B C     
2148 O  O     . ASP B 117 ? 1.1361 1.1279 1.1433 -0.0597 -0.2213 -0.1002 1031 ASP B O     
2149 C  CB    . ASP B 117 ? 1.4596 1.4503 1.4869 -0.0888 -0.2559 -0.1012 1031 ASP B CB    
2150 C  CG    . ASP B 117 ? 1.5868 1.5570 1.6045 -0.0893 -0.2494 -0.1058 1031 ASP B CG    
2151 O  OD1   . ASP B 117 ? 1.5924 1.5369 1.5816 -0.0864 -0.2545 -0.1147 1031 ASP B OD1   
2152 O  OD2   . ASP B 117 ? 1.7169 1.6961 1.7544 -0.0919 -0.2392 -0.1004 1031 ASP B OD2   
2153 N  N     . GLN B 118 ? 1.1236 1.1534 1.1687 -0.0663 -0.2270 -0.0884 1032 GLN B N     
2154 C  CA    . GLN B 118 ? 1.1741 1.2148 1.2288 -0.0582 -0.2112 -0.0835 1032 GLN B CA    
2155 C  C     . GLN B 118 ? 1.2035 1.2367 1.2362 -0.0457 -0.2050 -0.0860 1032 GLN B C     
2156 O  O     . GLN B 118 ? 1.1419 1.1684 1.1687 -0.0396 -0.1935 -0.0869 1032 GLN B O     
2157 C  CB    . GLN B 118 ? 1.2251 1.2923 1.3069 -0.0594 -0.2096 -0.0743 1032 GLN B CB    
2158 N  N     . VAL B 119 ? 1.2806 1.3155 1.3013 -0.0415 -0.2125 -0.0867 1033 VAL B N     
2159 C  CA    . VAL B 119 ? 1.2693 1.2993 1.2708 -0.0289 -0.2057 -0.0874 1033 VAL B CA    
2160 C  C     . VAL B 119 ? 1.1607 1.1668 1.1358 -0.0248 -0.2037 -0.0949 1033 VAL B C     
2161 O  O     . VAL B 119 ? 1.0909 1.0933 1.0574 -0.0159 -0.1925 -0.0940 1033 VAL B O     
2162 C  CB    . VAL B 119 ? 1.2812 1.3186 1.2745 -0.0243 -0.2139 -0.0859 1033 VAL B CB    
2163 C  CG1   . VAL B 119 ? 1.3311 1.3589 1.3120 -0.0305 -0.2303 -0.0918 1033 VAL B CG1   
2164 C  CG2   . VAL B 119 ? 1.2586 1.2903 1.2311 -0.0112 -0.2069 -0.0859 1033 VAL B CG2   
2165 N  N     . LEU B 120 ? 1.1902 1.1796 1.1527 -0.0311 -0.2145 -0.1019 1034 LEU B N     
2166 C  CA    . LEU B 120 ? 1.1587 1.1237 1.0952 -0.0269 -0.2130 -0.1093 1034 LEU B CA    
2167 C  C     . LEU B 120 ? 1.1338 1.0966 1.0785 -0.0264 -0.1994 -0.1078 1034 LEU B C     
2168 O  O     . LEU B 120 ? 1.1447 1.0974 1.0726 -0.0172 -0.1907 -0.1095 1034 LEU B O     
2169 C  CB    . LEU B 120 ? 1.1710 1.1178 1.0958 -0.0356 -0.2282 -0.1169 1034 LEU B CB    
2170 C  CG    . LEU B 120 ? 1.1528 1.0705 1.0514 -0.0343 -0.2304 -0.1258 1034 LEU B CG    
2171 C  CD1   . LEU B 120 ? 1.3311 1.2429 1.2437 -0.0431 -0.2262 -0.1259 1034 LEU B CD1   
2172 C  CD2   . LEU B 120 ? 1.1905 1.0974 1.0620 -0.0189 -0.2213 -0.1281 1034 LEU B CD2   
2173 N  N     . ARG B 121 ? 1.1507 1.1242 1.1215 -0.0355 -0.1973 -0.1040 1035 ARG B N     
2174 C  CA    . ARG B 121 ? 0.9733 0.9456 0.9525 -0.0351 -0.1849 -0.1026 1035 ARG B CA    
2175 C  C     . ARG B 121 ? 0.7482 0.7335 0.7340 -0.0260 -0.1718 -0.0970 1035 ARG B C     
2176 O  O     . ARG B 121 ? 0.7995 0.7800 0.7826 -0.0218 -0.1613 -0.0971 1035 ARG B O     
2177 C  CB    . ARG B 121 ? 0.9989 0.9798 1.0037 -0.0465 -0.1863 -0.0994 1035 ARG B CB    
2178 C  CG    . ARG B 121 ? 1.2396 1.2062 1.2397 -0.0567 -0.1989 -0.1042 1035 ARG B CG    
2179 C  CD    . ARG B 121 ? 1.4917 1.4442 1.4908 -0.0600 -0.1934 -0.1065 1035 ARG B CD    
2180 N  NE    . ARG B 121 ? 1.6971 1.6323 1.6892 -0.0696 -0.2061 -0.1115 1035 ARG B NE    
2181 C  CZ    . ARG B 121 ? 1.7296 1.6533 1.7250 -0.0759 -0.2049 -0.1125 1035 ARG B CZ    
2182 N  NH1   . ARG B 121 ? 1.6709 1.5776 1.6597 -0.0851 -0.2179 -0.1169 1035 ARG B NH1   
2183 N  NH2   . ARG B 121 ? 1.7508 1.6796 1.7562 -0.0731 -0.1913 -0.1091 1035 ARG B NH2   
2184 N  N     . LYS B 122 ? 0.6592 0.6607 0.6537 -0.0230 -0.1726 -0.0920 1036 LYS B N     
2185 C  CA    . LYS B 122 ? 0.8035 0.8142 0.8011 -0.0140 -0.1614 -0.0870 1036 LYS B CA    
2186 C  C     . LYS B 122 ? 1.0763 1.0742 1.0483 -0.0040 -0.1575 -0.0896 1036 LYS B C     
2187 O  O     . LYS B 122 ? 1.2944 1.2912 1.2651 0.0014  -0.1468 -0.0877 1036 LYS B O     
2188 C  CB    . LYS B 122 ? 0.7219 0.7512 0.7332 -0.0126 -0.1637 -0.0809 1036 LYS B CB    
2189 N  N     . LEU B 123 ? 0.9192 0.9071 0.8699 -0.0013 -0.1664 -0.0936 1037 LEU B N     
2190 C  CA    . LEU B 123 ? 0.9923 0.9669 0.9160 0.0092  -0.1629 -0.0962 1037 LEU B CA    
2191 C  C     . LEU B 123 ? 0.8394 0.7992 0.7546 0.0098  -0.1562 -0.0999 1037 LEU B C     
2192 O  O     . LEU B 123 ? 0.8630 0.8221 0.7718 0.0180  -0.1457 -0.0973 1037 LEU B O     
2193 C  CB    . LEU B 123 ? 1.1945 1.1578 1.0952 0.0112  -0.1753 -0.1016 1037 LEU B CB    
2194 C  CG    . LEU B 123 ? 1.1607 1.1071 1.0281 0.0227  -0.1750 -0.1057 1037 LEU B CG    
2195 C  CD1   . LEU B 123 ? 1.1664 1.1108 1.0175 0.0261  -0.1867 -0.1082 1037 LEU B CD1   
2196 C  CD2   . LEU B 123 ? 1.2615 1.1850 1.1122 0.0212  -0.1761 -0.1136 1037 LEU B CD2   
2197 N  N     . VAL B 124 ? 0.8312 0.7796 0.7469 0.0010  -0.1622 -0.1054 1038 VAL B N     
2198 C  CA    . VAL B 124 ? 0.9746 0.9077 0.8817 0.0014  -0.1564 -0.1091 1038 VAL B CA    
2199 C  C     . VAL B 124 ? 0.8828 0.8275 0.8076 0.0027  -0.1430 -0.1036 1038 VAL B C     
2200 O  O     . VAL B 124 ? 0.8998 0.8381 0.8139 0.0098  -0.1340 -0.1035 1038 VAL B O     
2201 C  CB    . VAL B 124 ? 0.9841 0.9055 0.8942 -0.0099 -0.1655 -0.1145 1038 VAL B CB    
2202 C  CG1   . VAL B 124 ? 0.9603 0.8707 0.8695 -0.0109 -0.1576 -0.1163 1038 VAL B CG1   
2203 C  CG2   . VAL B 124 ? 0.9413 0.8447 0.8272 -0.0099 -0.1788 -0.1217 1038 VAL B CG2   
2204 N  N     . ASP B 125 ? 0.6494 0.6112 0.6009 -0.0037 -0.1418 -0.0990 1039 ASP B N     
2205 C  CA    . ASP B 125 ? 0.6634 0.6357 0.6313 -0.0023 -0.1303 -0.0943 1039 ASP B CA    
2206 C  C     . ASP B 125 ? 0.6853 0.6616 0.6455 0.0081  -0.1221 -0.0904 1039 ASP B C     
2207 O  O     . ASP B 125 ? 0.6727 0.6481 0.6333 0.0117  -0.1128 -0.0889 1039 ASP B O     
2208 C  CB    . ASP B 125 ? 0.8259 0.8165 0.8210 -0.0084 -0.1309 -0.0896 1039 ASP B CB    
2209 C  CG    . ASP B 125 ? 0.7723 0.7718 0.7831 -0.0070 -0.1201 -0.0858 1039 ASP B CG    
2210 O  OD1   . ASP B 125 ? 0.7984 0.7942 0.8152 -0.0110 -0.1170 -0.0873 1039 ASP B OD1   
2211 O  OD2   . ASP B 125 ? 0.6676 0.6772 0.6845 -0.0018 -0.1152 -0.0812 1039 ASP B OD2   
2212 N  N     . LEU B 126 ? 0.7367 0.7180 0.6901 0.0131  -0.1257 -0.0880 1040 LEU B N     
2213 C  CA    . LEU B 126 ? 0.8572 0.8434 0.8046 0.0228  -0.1180 -0.0827 1040 LEU B CA    
2214 C  C     . LEU B 126 ? 0.8369 0.8089 0.7608 0.0304  -0.1135 -0.0852 1040 LEU B C     
2215 O  O     . LEU B 126 ? 0.8602 0.8354 0.7848 0.0359  -0.1040 -0.0809 1040 LEU B O     
2216 C  CB    . LEU B 126 ? 0.7036 0.6980 0.6482 0.0268  -0.1229 -0.0791 1040 LEU B CB    
2217 C  CG    . LEU B 126 ? 0.7540 0.7655 0.7246 0.0221  -0.1228 -0.0740 1040 LEU B CG    
2218 C  CD1   . LEU B 126 ? 0.7401 0.7605 0.7087 0.0269  -0.1262 -0.0693 1040 LEU B CD1   
2219 C  CD2   . LEU B 126 ? 0.8522 0.8703 0.8375 0.0231  -0.1125 -0.0696 1040 LEU B CD2   
2220 N  N     . VAL B 127 ? 0.7635 0.7192 0.6661 0.0310  -0.1206 -0.0918 1041 VAL B N     
2221 C  CA    . VAL B 127 ? 0.6683 0.6082 0.5479 0.0383  -0.1162 -0.0950 1041 VAL B CA    
2222 C  C     . VAL B 127 ? 0.7859 0.7257 0.6758 0.0362  -0.1071 -0.0941 1041 VAL B C     
2223 O  O     . VAL B 127 ? 0.8373 0.7760 0.7189 0.0441  -0.0982 -0.0912 1041 VAL B O     
2224 C  CB    . VAL B 127 ? 0.8178 0.7372 0.6757 0.0368  -0.1264 -0.1039 1041 VAL B CB    
2225 C  CG1   . VAL B 127 ? 0.8348 0.7363 0.6682 0.0450  -0.1214 -0.1073 1041 VAL B CG1   
2226 C  CG2   . VAL B 127 ? 0.7842 0.7035 0.6293 0.0402  -0.1358 -0.1050 1041 VAL B CG2   
2227 N  N     . ASN B 128 ? 0.9841 0.9268 0.8931 0.0258  -0.1089 -0.0958 1042 ASN B N     
2228 C  CA    . ASN B 128 ? 0.8679 0.8095 0.7855 0.0238  -0.1008 -0.0956 1042 ASN B CA    
2229 C  C     . ASN B 128 ? 0.6024 0.5605 0.5375 0.0260  -0.0917 -0.0887 1042 ASN B C     
2230 O  O     . ASN B 128 ? 0.5302 0.4876 0.4676 0.0277  -0.0840 -0.0877 1042 ASN B O     
2231 C  CB    . ASN B 128 ? 0.8137 0.7528 0.7450 0.0128  -0.1056 -0.0991 1042 ASN B CB    
2232 C  CG    . ASN B 128 ? 0.9996 0.9198 0.9138 0.0095  -0.1147 -0.1061 1042 ASN B CG    
2233 O  OD1   . ASN B 128 ? 0.9667 0.8706 0.8577 0.0158  -0.1138 -0.1097 1042 ASN B OD1   
2234 N  ND2   . ASN B 128 ? 1.1005 1.0224 1.0262 -0.0003 -0.1239 -0.1078 1042 ASN B ND2   
2235 N  N     . GLN B 129 ? 0.6391 0.6116 0.5870 0.0260  -0.0930 -0.0838 1043 GLN B N     
2236 C  CA    . GLN B 129 ? 0.6564 0.6418 0.6181 0.0289  -0.0851 -0.0772 1043 GLN B CA    
2237 C  C     . GLN B 129 ? 0.7651 0.7493 0.7122 0.0387  -0.0790 -0.0731 1043 GLN B C     
2238 O  O     . GLN B 129 ? 0.6520 0.6400 0.6040 0.0411  -0.0713 -0.0696 1043 GLN B O     
2239 C  CB    . GLN B 129 ? 0.7783 0.7779 0.7574 0.0264  -0.0882 -0.0730 1043 GLN B CB    
2240 C  CG    . GLN B 129 ? 0.7274 0.7307 0.7225 0.0177  -0.0933 -0.0756 1043 GLN B CG    
2241 C  CD    . GLN B 129 ? 0.9395 0.9568 0.9515 0.0164  -0.0955 -0.0710 1043 GLN B CD    
2242 O  OE1   . GLN B 129 ? 0.9223 0.9472 0.9408 0.0203  -0.0911 -0.0657 1043 GLN B OE1   
2243 N  NE2   . GLN B 129 ? 1.0101 1.0309 1.0297 0.0107  -0.1027 -0.0726 1043 GLN B NE2   
2244 N  N     . ARG B 130 ? 0.6200 0.5999 0.5491 0.0448  -0.0825 -0.0729 1044 ARG B N     
2245 C  CA    . ARG B 130 ? 0.5514 0.5288 0.4632 0.0554  -0.0764 -0.0689 1044 ARG B CA    
2246 C  C     . ARG B 130 ? 0.5807 0.5472 0.4823 0.0575  -0.0709 -0.0721 1044 ARG B C     
2247 O  O     . ARG B 130 ? 0.5923 0.5639 0.4955 0.0623  -0.0625 -0.0668 1044 ARG B O     
2248 C  CB    . ARG B 130 ? 0.7481 0.7182 0.6372 0.0623  -0.0819 -0.0704 1044 ARG B CB    
2249 C  CG    . ARG B 130 ? 0.6510 0.6317 0.5464 0.0623  -0.0872 -0.0667 1044 ARG B CG    
2250 C  CD    . ARG B 130 ? 0.7223 0.7062 0.6015 0.0744  -0.0840 -0.0602 1044 ARG B CD    
2251 N  NE    . ARG B 130 ? 0.8867 0.8552 0.7369 0.0831  -0.0833 -0.0643 1044 ARG B NE    
2252 C  CZ    . ARG B 130 ? 0.9497 0.9033 0.7790 0.0845  -0.0918 -0.0724 1044 ARG B CZ    
2253 N  NH1   . ARG B 130 ? 1.0103 0.9640 0.8457 0.0769  -0.1019 -0.0767 1044 ARG B NH1   
2254 N  NH2   . ARG B 130 ? 0.8193 0.7576 0.6212 0.0937  -0.0906 -0.0760 1044 ARG B NH2   
2255 N  N     . ASP B 131 ? 0.6223 0.5736 0.5137 0.0536  -0.0759 -0.0804 1045 ASP B N     
2256 C  CA    . ASP B 131 ? 0.8271 0.7660 0.7076 0.0555  -0.0712 -0.0838 1045 ASP B CA    
2257 C  C     . ASP B 131 ? 0.8470 0.7953 0.7471 0.0518  -0.0637 -0.0807 1045 ASP B C     
2258 O  O     . ASP B 131 ? 0.9516 0.8992 0.8461 0.0576  -0.0559 -0.0780 1045 ASP B O     
2259 C  CB    . ASP B 131 ? 0.8351 0.7566 0.7064 0.0495  -0.0790 -0.0929 1045 ASP B CB    
2260 C  CG    . ASP B 131 ? 0.9203 0.8271 0.7795 0.0516  -0.0744 -0.0964 1045 ASP B CG    
2261 O  OD1   . ASP B 131 ? 0.9899 0.8944 0.8349 0.0617  -0.0671 -0.0935 1045 ASP B OD1   
2262 O  OD2   . ASP B 131 ? 1.0656 0.9639 0.9299 0.0435  -0.0778 -0.1015 1045 ASP B OD2   
2263 N  N     . ALA B 132 ? 0.6195 0.5769 0.5421 0.0428  -0.0662 -0.0808 1046 ALA B N     
2264 C  CA    . ALA B 132 ? 0.5676 0.5332 0.5080 0.0396  -0.0601 -0.0787 1046 ALA B CA    
2265 C  C     . ALA B 132 ? 0.6727 0.6498 0.6179 0.0455  -0.0531 -0.0711 1046 ALA B C     
2266 O  O     . ALA B 132 ? 0.6635 0.6429 0.6128 0.0467  -0.0467 -0.0693 1046 ALA B O     
2267 C  CB    . ALA B 132 ? 0.6988 0.6730 0.6611 0.0307  -0.0642 -0.0795 1046 ALA B CB    
2268 N  N     . LEU B 133 ? 0.5326 0.5178 0.4783 0.0489  -0.0546 -0.0658 1047 LEU B N     
2269 C  CA    . LEU B 133 ? 0.6036 0.5994 0.5532 0.0546  -0.0483 -0.0573 1047 LEU B CA    
2270 C  C     . LEU B 133 ? 0.5848 0.5746 0.5162 0.0631  -0.0420 -0.0557 1047 LEU B C     
2271 O  O     . LEU B 133 ? 0.4945 0.4902 0.4318 0.0649  -0.0355 -0.0514 1047 LEU B O     
2272 C  CB    . LEU B 133 ? 0.6450 0.6493 0.5964 0.0575  -0.0510 -0.0515 1047 LEU B CB    
2273 C  CG    . LEU B 133 ? 0.6718 0.6844 0.6437 0.0502  -0.0558 -0.0512 1047 LEU B CG    
2274 C  CD1   . LEU B 133 ? 0.5143 0.5362 0.4892 0.0536  -0.0573 -0.0438 1047 LEU B CD1   
2275 C  CD2   . LEU B 133 ? 0.7149 0.7337 0.7060 0.0453  -0.0526 -0.0502 1047 LEU B CD2   
2276 N  N     . ILE B 134 ? 0.5093 0.4869 0.4178 0.0687  -0.0440 -0.0592 1048 ILE B N     
2277 C  CA    . ILE B 134 ? 0.6689 0.6396 0.5574 0.0784  -0.0378 -0.0576 1048 ILE B CA    
2278 C  C     . ILE B 134 ? 0.6991 0.6646 0.5902 0.0760  -0.0332 -0.0608 1048 ILE B C     
2279 O  O     . ILE B 134 ? 0.7230 0.6944 0.6144 0.0811  -0.0256 -0.0552 1048 ILE B O     
2280 C  CB    . ILE B 134 ? 0.7054 0.6602 0.5668 0.0847  -0.0422 -0.0629 1048 ILE B CB    
2281 C  CG1   . ILE B 134 ? 0.6450 0.6070 0.4976 0.0933  -0.0423 -0.0563 1048 ILE B CG1   
2282 C  CG2   . ILE B 134 ? 0.7648 0.7053 0.6048 0.0922  -0.0373 -0.0658 1048 ILE B CG2   
2283 C  CD1   . ILE B 134 ? 0.7734 0.7462 0.6420 0.0874  -0.0483 -0.0542 1048 ILE B CD1   
2284 N  N     . ARG B 135 ? 0.7935 0.7492 0.6876 0.0681  -0.0377 -0.0689 1049 ARG B N     
2285 C  CA    . ARG B 135 ? 0.7721 0.7224 0.6687 0.0657  -0.0335 -0.0719 1049 ARG B CA    
2286 C  C     . ARG B 135 ? 0.8593 0.8254 0.7771 0.0631  -0.0283 -0.0666 1049 ARG B C     
2287 O  O     . ARG B 135 ? 0.8578 0.8241 0.7744 0.0659  -0.0219 -0.0651 1049 ARG B O     
2288 C  CB    . ARG B 135 ? 0.5688 0.5085 0.4688 0.0566  -0.0399 -0.0801 1049 ARG B CB    
2289 C  CG    . ARG B 135 ? 0.7470 0.6657 0.6248 0.0589  -0.0418 -0.0866 1049 ARG B CG    
2290 C  CD    . ARG B 135 ? 0.8054 0.7163 0.6920 0.0485  -0.0473 -0.0927 1049 ARG B CD    
2291 N  NE    . ARG B 135 ? 0.9633 0.8828 0.8655 0.0407  -0.0547 -0.0931 1049 ARG B NE    
2292 C  CZ    . ARG B 135 ? 1.2965 1.2222 1.2187 0.0316  -0.0568 -0.0941 1049 ARG B CZ    
2293 N  NH1   . ARG B 135 ? 1.1526 1.0772 1.0818 0.0292  -0.0520 -0.0946 1049 ARG B NH1   
2294 N  NH2   . ARG B 135 ? 1.4911 1.4251 1.4262 0.0257  -0.0633 -0.0938 1049 ARG B NH2   
2295 N  N     . PHE B 136 ? 0.8176 0.7961 0.7542 0.0579  -0.0313 -0.0638 1050 PHE B N     
2296 C  CA    . PHE B 136 ? 0.5752 0.5669 0.5312 0.0553  -0.0279 -0.0594 1050 PHE B CA    
2297 C  C     . PHE B 136 ? 0.5612 0.5610 0.5142 0.0626  -0.0214 -0.0511 1050 PHE B C     
2298 O  O     . PHE B 136 ? 0.5319 0.5353 0.4895 0.0633  -0.0164 -0.0494 1050 PHE B O     
2299 C  CB    . PHE B 136 ? 0.4833 0.4846 0.4574 0.0495  -0.0330 -0.0578 1050 PHE B CB    
2300 C  CG    . PHE B 136 ? 0.5070 0.5204 0.4993 0.0475  -0.0307 -0.0530 1050 PHE B CG    
2301 C  CD1   . PHE B 136 ? 0.6243 0.6478 0.6219 0.0505  -0.0295 -0.0447 1050 PHE B CD1   
2302 C  CD2   . PHE B 136 ? 0.6619 0.6761 0.6659 0.0428  -0.0301 -0.0566 1050 PHE B CD2   
2303 C  CE1   . PHE B 136 ? 0.7419 0.7749 0.7563 0.0479  -0.0287 -0.0405 1050 PHE B CE1   
2304 C  CE2   . PHE B 136 ? 0.4769 0.5005 0.4961 0.0412  -0.0291 -0.0530 1050 PHE B CE2   
2305 C  CZ    . PHE B 136 ? 0.6233 0.6557 0.6478 0.0433  -0.0289 -0.0452 1050 PHE B CZ    
2306 N  N     . GLN B 137 ? 0.5802 0.5839 0.5256 0.0685  -0.0213 -0.0453 1051 GLN B N     
2307 C  CA    . GLN B 137 ? 0.6859 0.6992 0.6298 0.0757  -0.0147 -0.0360 1051 GLN B CA    
2308 C  C     . GLN B 137 ? 0.6604 0.6654 0.5862 0.0829  -0.0086 -0.0371 1051 GLN B C     
2309 O  O     . GLN B 137 ? 0.7289 0.7427 0.6581 0.0867  -0.0025 -0.0305 1051 GLN B O     
2310 C  CB    . GLN B 137 ? 0.5091 0.5298 0.4491 0.0813  -0.0150 -0.0280 1051 GLN B CB    
2311 C  CG    . GLN B 137 ? 0.7144 0.7245 0.6355 0.0854  -0.0189 -0.0322 1051 GLN B CG    
2312 C  CD    . GLN B 137 ? 0.8044 0.8246 0.7291 0.0882  -0.0208 -0.0244 1051 GLN B CD    
2313 O  OE1   . GLN B 137 ? 0.7776 0.8107 0.7227 0.0837  -0.0213 -0.0181 1051 GLN B OE1   
2314 N  NE2   . GLN B 137 ? 0.7397 0.7535 0.6440 0.0960  -0.0220 -0.0248 1051 GLN B NE2   
2315 N  N     . GLU B 138 ? 0.4542 0.4422 0.3616 0.0846  -0.0104 -0.0452 1052 GLU B N     
2316 C  CA    . GLU B 138 ? 0.6905 0.6683 0.5813 0.0909  -0.0049 -0.0472 1052 GLU B CA    
2317 C  C     . GLU B 138 ? 0.6922 0.6741 0.5966 0.0861  -0.0014 -0.0480 1052 GLU B C     
2318 O  O     . GLU B 138 ? 0.6009 0.5876 0.5024 0.0920  0.0055  -0.0430 1052 GLU B O     
2319 C  CB    . GLU B 138 ? 0.6254 0.5820 0.4960 0.0915  -0.0092 -0.0567 1052 GLU B CB    
2320 C  CG    . GLU B 138 ? 0.8382 0.7809 0.6942 0.0954  -0.0047 -0.0607 1052 GLU B CG    
2321 C  CD    . GLU B 138 ? 0.9657 0.9089 0.8041 0.1088  0.0032  -0.0544 1052 GLU B CD    
2322 O  OE1   . GLU B 138 ? 0.9743 0.9277 0.8098 0.1155  0.0050  -0.0469 1052 GLU B OE1   
2323 O  OE2   . GLU B 138 ? 1.2135 1.1477 1.0414 0.1130  0.0082  -0.0561 1052 GLU B OE2   
2324 N  N     . GLU B 139 ? 0.7062 0.6873 0.6255 0.0762  -0.0059 -0.0537 1053 GLU B N     
2325 C  CA    . GLU B 139 ? 0.8289 0.8135 0.7597 0.0725  -0.0027 -0.0548 1053 GLU B CA    
2326 C  C     . GLU B 139 ? 0.6343 0.6367 0.5816 0.0725  0.0001  -0.0470 1053 GLU B C     
2327 O  O     . GLU B 139 ? 0.6232 0.6297 0.5745 0.0734  0.0045  -0.0456 1053 GLU B O     
2328 C  CB    . GLU B 139 ? 0.8097 0.7901 0.7520 0.0631  -0.0078 -0.0621 1053 GLU B CB    
2329 C  CG    . GLU B 139 ? 1.3066 1.2721 1.2378 0.0606  -0.0132 -0.0688 1053 GLU B CG    
2330 C  CD    . GLU B 139 ? 1.4186 1.3824 1.3632 0.0514  -0.0176 -0.0743 1053 GLU B CD    
2331 O  OE1   . GLU B 139 ? 1.5512 1.5017 1.4874 0.0488  -0.0208 -0.0797 1053 GLU B OE1   
2332 O  OE2   . GLU B 139 ? 1.4730 1.4486 1.4361 0.0472  -0.0179 -0.0727 1053 GLU B OE2   
2333 N  N     . ARG B 140 ? 0.6623 0.6751 0.6196 0.0711  -0.0029 -0.0417 1054 ARG B N     
2334 C  CA    . ARG B 140 ? 0.7175 0.7462 0.6896 0.0711  -0.0008 -0.0331 1054 ARG B CA    
2335 C  C     . ARG B 140 ? 0.7885 0.8221 0.7502 0.0802  0.0064  -0.0255 1054 ARG B C     
2336 O  O     . ARG B 140 ? 0.7503 0.7918 0.7189 0.0807  0.0101  -0.0220 1054 ARG B O     
2337 C  CB    . ARG B 140 ? 0.6798 0.7175 0.6637 0.0684  -0.0053 -0.0279 1054 ARG B CB    
2338 C  CG    . ARG B 140 ? 0.7700 0.8032 0.7620 0.0611  -0.0122 -0.0344 1054 ARG B CG    
2339 C  CD    . ARG B 140 ? 0.9731 1.0057 0.9782 0.0543  -0.0142 -0.0403 1054 ARG B CD    
2340 N  NE    . ARG B 140 ? 1.0932 1.1355 1.1103 0.0535  -0.0123 -0.0357 1054 ARG B NE    
2341 C  CZ    . ARG B 140 ? 1.1542 1.1956 1.1707 0.0540  -0.0089 -0.0383 1054 ARG B CZ    
2342 N  NH1   . ARG B 140 ? 1.0978 1.1287 1.1028 0.0552  -0.0066 -0.0449 1054 ARG B NH1   
2343 N  NH2   . ARG B 140 ? 1.0045 1.0552 1.0319 0.0531  -0.0082 -0.0341 1054 ARG B NH2   
2344 N  N     . ARG B 141 ? 0.8232 0.8529 0.7679 0.0881  0.0085  -0.0225 1055 ARG B N     
2345 C  CA    . ARG B 141 ? 0.8707 0.9037 0.8019 0.0988  0.0161  -0.0154 1055 ARG B CA    
2346 C  C     . ARG B 141 ? 0.9132 0.9406 0.8386 0.1007  0.0209  -0.0189 1055 ARG B C     
2347 O  O     . ARG B 141 ? 1.0810 1.1200 1.0119 0.1039  0.0260  -0.0117 1055 ARG B O     
2348 C  CB    . ARG B 141 ? 0.8995 0.9217 0.8071 0.1076  0.0168  -0.0163 1055 ARG B CB    
2349 C  CG    . ARG B 141 ? 0.7603 0.7921 0.6580 0.1196  0.0234  -0.0048 1055 ARG B CG    
2350 C  CD    . ARG B 141 ? 0.7124 0.7276 0.5798 0.1309  0.0265  -0.0086 1055 ARG B CD    
2351 N  NE    . ARG B 141 ? 0.8364 0.8414 0.6926 0.1345  0.0312  -0.0129 1055 ARG B NE    
2352 C  CZ    . ARG B 141 ? 0.8950 0.8784 0.7351 0.1339  0.0289  -0.0242 1055 ARG B CZ    
2353 N  NH1   . ARG B 141 ? 0.8309 0.8011 0.6644 0.1297  0.0214  -0.0324 1055 ARG B NH1   
2354 N  NH2   . ARG B 141 ? 0.9187 0.8938 0.7498 0.1375  0.0339  -0.0267 1055 ARG B NH2   
2355 N  N     . LEU B 142 ? 0.8649 0.8750 0.7802 0.0984  0.0189  -0.0295 1056 LEU B N     
2356 C  CA    . LEU B 142 ? 0.7364 0.7395 0.6465 0.0994  0.0231  -0.0335 1056 LEU B CA    
2357 C  C     . LEU B 142 ? 0.8338 0.8508 0.7641 0.0943  0.0240  -0.0307 1056 LEU B C     
2358 O  O     . LEU B 142 ? 0.9269 0.9490 0.8554 0.0991  0.0299  -0.0267 1056 LEU B O     
2359 C  CB    . LEU B 142 ? 0.7842 0.7688 0.6874 0.0943  0.0189  -0.0448 1056 LEU B CB    
2360 C  CG    . LEU B 142 ? 0.8719 0.8364 0.7493 0.1008  0.0196  -0.0497 1056 LEU B CG    
2361 C  CD1   . LEU B 142 ? 0.8485 0.7973 0.7252 0.0927  0.0137  -0.0598 1056 LEU B CD1   
2362 C  CD2   . LEU B 142 ? 0.8203 0.7812 0.6838 0.1103  0.0279  -0.0468 1056 LEU B CD2   
2363 N  N     . SER B 143 ? 0.8391 0.8619 0.7881 0.0850  0.0180  -0.0329 1057 SER B N     
2364 C  CA    . SER B 143 ? 0.7961 0.8297 0.7629 0.0800  0.0176  -0.0318 1057 SER B CA    
2365 C  C     . SER B 143 ? 0.8140 0.8639 0.7872 0.0842  0.0212  -0.0210 1057 SER B C     
2366 O  O     . SER B 143 ? 0.8800 0.9355 0.8561 0.0857  0.0248  -0.0191 1057 SER B O     
2367 C  CB    . SER B 143 ? 0.8311 0.8677 0.8151 0.0709  0.0102  -0.0351 1057 SER B CB    
2368 O  OG    . SER B 143 ? 1.0723 1.1161 1.0619 0.0704  0.0071  -0.0292 1057 SER B OG    
2369 N  N     . GLU B 144 ? 0.8245 0.8831 0.8005 0.0861  0.0204  -0.0129 1058 GLU B N     
2370 C  CA    . GLU B 144 ? 0.6936 0.7698 0.6791 0.0889  0.0232  -0.0011 1058 GLU B CA    
2371 C  C     . GLU B 144 ? 0.7615 0.8399 0.7320 0.0997  0.0318  0.0047  1058 GLU B C     
2372 O  O     . GLU B 144 ? 0.7662 0.8596 0.7454 0.1016  0.0347  0.0137  1058 GLU B O     
2373 C  CB    . GLU B 144 ? 0.5866 0.6726 0.5807 0.0880  0.0203  0.0074  1058 GLU B CB    
2374 N  N     . LEU B 145 ? 0.9438 1.0073 0.8918 0.1069  0.0356  0.0001  1059 LEU B N     
2375 C  CA    . LEU B 145 ? 1.0679 1.1315 0.9998 0.1184  0.0441  0.0051  1059 LEU B CA    
2376 C  C     . LEU B 145 ? 1.2666 1.3332 1.2031 0.1176  0.0472  0.0039  1059 LEU B C     
2377 O  O     . LEU B 145 ? 1.1461 1.2284 1.0888 0.1216  0.0515  0.0135  1059 LEU B O     
2378 C  CB    . LEU B 145 ? 1.0727 1.1155 0.9781 0.1257  0.0464  -0.0018 1059 LEU B CB    
2379 C  CG    . LEU B 145 ? 1.0374 1.0757 0.9264 0.1339  0.0472  0.0013  1059 LEU B CG    
2380 C  CD1   . LEU B 145 ? 0.8664 0.8847 0.7268 0.1441  0.0517  -0.0041 1059 LEU B CD1   
2381 C  CD2   . LEU B 145 ? 0.9884 1.0476 0.8838 0.1404  0.0513  0.0163  1059 LEU B CD2   
2382 N  N     . ALA B 146 ? 1.4650 1.5175 1.3988 0.1128  0.0452  -0.0073 1060 ALA B N     
2383 C  CA    . ALA B 146 ? 1.5065 1.5571 1.4400 0.1133  0.0487  -0.0104 1060 ALA B CA    
2384 C  C     . ALA B 146 ? 1.4437 1.5109 1.3809 0.1194  0.0546  -0.0003 1060 ALA B C     
2385 O  O     . ALA B 146 ? 1.2899 1.3564 1.2117 0.1302  0.0618  0.0051  1060 ALA B O     
2386 C  CB    . ALA B 146 ? 1.4557 1.5063 1.4058 0.1023  0.0425  -0.0177 1060 ALA B CB    
2387 N  N     . TYR C 8   ? 0.9146 0.9840 0.7877 0.1559  0.0359  0.0363  6    TYR C N     
2388 C  CA    . TYR C 8   ? 0.9150 0.9673 0.7552 0.1690  0.0391  0.0309  6    TYR C CA    
2389 C  C     . TYR C 8   ? 0.8467 0.8865 0.6780 0.1693  0.0420  0.0231  6    TYR C C     
2390 O  O     . TYR C 8   ? 0.7919 0.8335 0.6415 0.1580  0.0397  0.0190  6    TYR C O     
2391 C  CB    . TYR C 8   ? 0.8475 0.8818 0.6728 0.1674  0.0313  0.0195  6    TYR C CB    
2392 C  CG    . TYR C 8   ? 0.9306 0.9494 0.7620 0.1539  0.0235  0.0046  6    TYR C CG    
2393 C  CD1   . TYR C 8   ? 0.9882 1.0145 0.8457 0.1398  0.0174  0.0030  6    TYR C CD1   
2394 C  CD2   . TYR C 8   ? 0.9721 0.9688 0.7833 0.1557  0.0226  -0.0072 6    TYR C CD2   
2395 C  CE1   . TYR C 8   ? 1.0066 1.0207 0.8701 0.1285  0.0110  -0.0094 6    TYR C CE1   
2396 C  CE2   . TYR C 8   ? 1.0423 1.0267 0.8608 0.1434  0.0159  -0.0192 6    TYR C CE2   
2397 C  CZ    . TYR C 8   ? 1.0092 1.0032 0.8539 0.1301  0.0104  -0.0200 6    TYR C CZ    
2398 O  OH    . TYR C 8   ? 0.7067 0.6900 0.5589 0.1188  0.0044  -0.0309 6    TYR C OH    
2399 N  N     . ASP C 9   ? 1.0468 1.0729 0.8490 0.1827  0.0468  0.0207  7    ASP C N     
2400 C  CA    . ASP C 9   ? 1.0641 1.0802 0.8569 0.1855  0.0513  0.0161  7    ASP C CA    
2401 C  C     . ASP C 9   ? 1.1084 1.0983 0.8904 0.1784  0.0448  -0.0009 7    ASP C C     
2402 O  O     . ASP C 9   ? 1.3736 1.3605 1.1654 0.1709  0.0449  -0.0057 7    ASP C O     
2403 C  CB    . ASP C 9   ? 1.1071 1.1218 0.8740 0.2048  0.0607  0.0233  7    ASP C CB    
2404 C  CG    . ASP C 9   ? 1.3045 1.3481 1.0856 0.2114  0.0686  0.0420  7    ASP C CG    
2405 O  OD1   . ASP C 9   ? 1.2659 1.3284 1.0773 0.2001  0.0672  0.0482  7    ASP C OD1   
2406 O  OD2   . ASP C 9   ? 1.4983 1.5457 1.2603 0.2281  0.0759  0.0508  7    ASP C OD2   
2407 N  N     . LEU C 10  ? 1.0016 0.9730 0.7641 0.1805  0.0389  -0.0096 8    LEU C N     
2408 C  CA    . LEU C 10  ? 0.9864 0.9324 0.7376 0.1742  0.0325  -0.0247 8    LEU C CA    
2409 C  C     . LEU C 10  ? 1.0617 0.9969 0.8078 0.1690  0.0224  -0.0327 8    LEU C C     
2410 O  O     . LEU C 10  ? 1.2061 1.1523 0.9544 0.1718  0.0211  -0.0267 8    LEU C O     
2411 C  CB    . LEU C 10  ? 1.0916 1.0173 0.8124 0.1870  0.0374  -0.0287 8    LEU C CB    
2412 C  CG    . LEU C 10  ? 1.2969 1.2144 1.0225 0.1815  0.0396  -0.0339 8    LEU C CG    
2413 C  CD1   . LEU C 10  ? 1.4667 1.3594 1.1599 0.1936  0.0429  -0.0394 8    LEU C CD1   
2414 C  CD2   . LEU C 10  ? 1.2177 1.1289 0.9614 0.1639  0.0308  -0.0438 8    LEU C CD2   
2415 N  N     . LEU C 11  ? 0.9970 0.9109 0.7365 0.1613  0.0153  -0.0456 9    LEU C N     
2416 C  CA    . LEU C 11  ? 0.8200 0.7246 0.5591 0.1534  0.0044  -0.0537 9    LEU C CA    
2417 C  C     . LEU C 11  ? 0.8623 0.7370 0.5753 0.1550  -0.0013 -0.0660 9    LEU C C     
2418 O  O     . LEU C 11  ? 0.9481 0.8108 0.6630 0.1489  -0.0019 -0.0723 9    LEU C O     
2419 C  CB    . LEU C 11  ? 0.6528 0.5684 0.4236 0.1364  -0.0006 -0.0557 9    LEU C CB    
2420 C  CG    . LEU C 11  ? 0.7291 0.6421 0.5090 0.1256  -0.0114 -0.0620 9    LEU C CG    
2421 C  CD1   . LEU C 11  ? 0.6523 0.5417 0.4211 0.1192  -0.0193 -0.0744 9    LEU C CD1   
2422 C  CD2   . LEU C 11  ? 0.8038 0.7227 0.5754 0.1322  -0.0140 -0.0576 9    LEU C CD2   
2423 N  N     . PHE C 12  ? 1.1239 0.9859 0.8123 0.1634  -0.0060 -0.0693 10   PHE C N     
2424 C  CA    . PHE C 12  ? 1.1520 0.9836 0.8140 0.1648  -0.0134 -0.0815 10   PHE C CA    
2425 C  C     . PHE C 12  ? 1.0598 0.8860 0.7246 0.1554  -0.0261 -0.0885 10   PHE C C     
2426 O  O     . PHE C 12  ? 1.0612 0.9015 0.7303 0.1576  -0.0276 -0.0835 10   PHE C O     
2427 C  CB    . PHE C 12  ? 1.2248 1.0414 0.8498 0.1844  -0.0092 -0.0811 10   PHE C CB    
2428 C  CG    . PHE C 12  ? 1.2863 1.1090 0.9059 0.1960  0.0038  -0.0730 10   PHE C CG    
2429 C  CD1   . PHE C 12  ? 1.3350 1.1690 0.9778 0.1882  0.0097  -0.0695 10   PHE C CD1   
2430 C  CD2   . PHE C 12  ? 1.3088 1.1261 0.8991 0.2158  0.0103  -0.0687 10   PHE C CD2   
2431 C  CE1   . PHE C 12  ? 1.4052 1.2459 1.0430 0.1992  0.0213  -0.0616 10   PHE C CE1   
2432 C  CE2   . PHE C 12  ? 1.3137 1.1377 0.8989 0.2273  0.0224  -0.0604 10   PHE C CE2   
2433 C  CZ    . PHE C 12  ? 1.3822 1.2183 0.9918 0.2186  0.0278  -0.0568 10   PHE C CZ    
2434 N  N     . LYS C 13  ? 0.8608 0.6672 0.5237 0.1450  -0.0352 -0.0994 11   LYS C N     
2435 C  CA    . LYS C 13  ? 0.9594 0.7610 0.6274 0.1343  -0.0482 -0.1062 11   LYS C CA    
2436 C  C     . LYS C 13  ? 1.0603 0.8308 0.6956 0.1389  -0.0575 -0.1170 11   LYS C C     
2437 O  O     . LYS C 13  ? 1.0639 0.8133 0.6916 0.1345  -0.0608 -0.1244 11   LYS C O     
2438 C  CB    . LYS C 13  ? 0.9304 0.7382 0.6288 0.1162  -0.0524 -0.1087 11   LYS C CB    
2439 C  CG    . LYS C 13  ? 1.0927 0.9212 0.8175 0.1122  -0.0425 -0.1011 11   LYS C CG    
2440 C  CD    . LYS C 13  ? 1.1201 0.9507 0.8699 0.0959  -0.0471 -0.1048 11   LYS C CD    
2441 C  CE    . LYS C 13  ? 1.0789 0.9225 0.8478 0.0935  -0.0375 -0.0996 11   LYS C CE    
2442 N  NZ    . LYS C 13  ? 1.1667 1.0366 0.9639 0.0879  -0.0353 -0.0927 11   LYS C NZ    
2443 N  N     . LEU C 14  ? 1.1303 0.8974 0.7464 0.1473  -0.0627 -0.1180 12   LEU C N     
2444 C  CA    . LEU C 14  ? 1.2460 0.9828 0.8277 0.1534  -0.0724 -0.1285 12   LEU C CA    
2445 C  C     . LEU C 14  ? 1.1164 0.8480 0.7049 0.1402  -0.0878 -0.1360 12   LEU C C     
2446 O  O     . LEU C 14  ? 0.9817 0.7357 0.5977 0.1305  -0.0896 -0.1315 12   LEU C O     
2447 C  CB    . LEU C 14  ? 1.1118 0.8467 0.6633 0.1736  -0.0684 -0.1251 12   LEU C CB    
2448 C  CG    . LEU C 14  ? 1.1581 0.9082 0.7084 0.1874  -0.0522 -0.1138 12   LEU C CG    
2449 C  CD1   . LEU C 14  ? 1.0705 0.8269 0.5992 0.2049  -0.0492 -0.1081 12   LEU C CD1   
2450 C  CD2   . LEU C 14  ? 1.1963 0.9248 0.7279 0.1939  -0.0471 -0.1178 12   LEU C CD2   
2451 N  N     . LEU C 15  ? 1.0044 0.7061 0.5672 0.1404  -0.0993 -0.1472 13   LEU C N     
2452 C  CA    . LEU C 15  ? 1.1432 0.8397 0.7098 0.1291  -0.1150 -0.1540 13   LEU C CA    
2453 C  C     . LEU C 15  ? 1.4112 1.0792 0.9375 0.1394  -0.1257 -0.1636 13   LEU C C     
2454 O  O     . LEU C 15  ? 1.5666 1.2077 1.0638 0.1487  -0.1254 -0.1695 13   LEU C O     
2455 C  CB    . LEU C 15  ? 0.9520 0.6433 0.5424 0.1092  -0.1224 -0.1586 13   LEU C CB    
2456 C  CG    . LEU C 15  ? 1.2026 0.8817 0.7932 0.0968  -0.1404 -0.1670 13   LEU C CG    
2457 C  CD1   . LEU C 15  ? 1.3262 1.0301 0.9337 0.0932  -0.1443 -0.1624 13   LEU C CD1   
2458 C  CD2   . LEU C 15  ? 1.1411 0.8156 0.7554 0.0787  -0.1452 -0.1696 13   LEU C CD2   
2459 N  N     . LEU C 16  ? 1.3222 0.9965 0.8461 0.1387  -0.1351 -0.1648 14   LEU C N     
2460 C  CA    . LEU C 16  ? 1.3974 1.0472 0.8868 0.1460  -0.1480 -0.1742 14   LEU C CA    
2461 C  C     . LEU C 16  ? 1.4585 1.0979 0.9610 0.1269  -0.1649 -0.1820 14   LEU C C     
2462 O  O     . LEU C 16  ? 1.5703 1.2295 1.1011 0.1136  -0.1695 -0.1797 14   LEU C O     
2463 C  CB    . LEU C 16  ? 1.2285 0.8949 0.7087 0.1577  -0.1476 -0.1693 14   LEU C CB    
2464 C  CG    . LEU C 16  ? 1.2615 0.9531 0.7470 0.1714  -0.1298 -0.1560 14   LEU C CG    
2465 C  CD1   . LEU C 16  ? 1.2114 0.9288 0.7095 0.1725  -0.1305 -0.1487 14   LEU C CD1   
2466 C  CD2   . LEU C 16  ? 1.2072 0.8826 0.6566 0.1921  -0.1237 -0.1561 14   LEU C CD2   
2467 N  N     . ILE C 17  ? 1.4219 1.0354 0.9096 0.1251  -0.1724 -0.1879 15   ILE C N     
2468 C  CA    . ILE C 17  ? 1.5976 1.1995 1.0945 0.1082  -0.1890 -0.1946 15   ILE C CA    
2469 C  C     . ILE C 17  ? 2.0289 1.6147 1.4997 0.1158  -0.1989 -0.1992 15   ILE C C     
2470 O  O     . ILE C 17  ? 1.8983 1.4688 1.3415 0.1318  -0.1939 -0.1994 15   ILE C O     
2471 C  CB    . ILE C 17  ? 1.5947 1.1797 1.1022 0.0955  -0.1907 -0.1977 15   ILE C CB    
2472 C  CG1   . ILE C 17  ? 1.5998 1.2027 1.1416 0.0799  -0.1893 -0.1951 15   ILE C CG1   
2473 C  CG2   . ILE C 17  ? 1.6979 1.2607 1.1989 0.0860  -0.2062 -0.2045 15   ILE C CG2   
2474 C  CD1   . ILE C 17  ? 1.5690 1.1588 1.1232 0.0679  -0.1901 -0.1968 15   ILE C CD1   
2475 N  N     . GLY C 18  ? 2.4357 2.0261 1.9159 0.1049  -0.2130 -0.2022 16   GLY C N     
2476 C  CA    . GLY C 18  ? 2.5748 2.1483 2.0321 0.1097  -0.2244 -0.2075 16   GLY C CA    
2477 C  C     . GLY C 18  ? 2.6156 2.1970 2.0868 0.0961  -0.2400 -0.2103 16   GLY C C     
2478 O  O     . GLY C 18  ? 2.6644 2.2662 2.1643 0.0827  -0.2425 -0.2075 16   GLY C O     
2479 N  N     . ASP C 19  ? 2.5393 2.1035 1.9890 0.1001  -0.2511 -0.2157 17   ASP C N     
2480 C  CA    . ASP C 19  ? 2.3783 1.9460 1.8355 0.0891  -0.2673 -0.2190 17   ASP C CA    
2481 C  C     . ASP C 19  ? 2.2108 1.8004 1.6640 0.0993  -0.2657 -0.2151 17   ASP C C     
2482 O  O     . ASP C 19  ? 2.2241 1.8182 1.6591 0.1179  -0.2542 -0.2114 17   ASP C O     
2483 C  CB    . ASP C 19  ? 2.3824 1.9209 1.8161 0.0900  -0.2803 -0.2269 17   ASP C CB    
2484 C  CG    . ASP C 19  ? 2.2710 1.7890 1.7138 0.0751  -0.2866 -0.2309 17   ASP C CG    
2485 O  OD1   . ASP C 19  ? 2.1001 1.6256 1.5698 0.0554  -0.2964 -0.2309 17   ASP C OD1   
2486 O  OD2   . ASP C 19  ? 2.3080 1.8017 1.7300 0.0834  -0.2828 -0.2338 17   ASP C OD2   
2487 N  N     . SER C 20  ? 1.9249 1.5295 1.3962 0.0872  -0.2768 -0.2150 18   SER C N     
2488 C  CA    . SER C 20  ? 1.7933 1.4214 1.2643 0.0960  -0.2748 -0.2102 18   SER C CA    
2489 C  C     . SER C 20  ? 1.9279 1.5438 1.3652 0.1127  -0.2783 -0.2133 18   SER C C     
2490 O  O     . SER C 20  ? 1.9138 1.5182 1.3441 0.1074  -0.2926 -0.2190 18   SER C O     
2491 C  CB    . SER C 20  ? 1.7634 1.4128 1.2648 0.0786  -0.2853 -0.2083 18   SER C CB    
2492 O  OG    . SER C 20  ? 1.7574 1.4302 1.2593 0.0873  -0.2829 -0.2029 18   SER C OG    
2493 N  N     . GLY C 21  ? 2.1362 1.7550 1.5528 0.1335  -0.2652 -0.2090 19   GLY C N     
2494 C  CA    . GLY C 21  ? 2.1874 1.7993 1.5738 0.1513  -0.2668 -0.2101 19   GLY C CA    
2495 C  C     . GLY C 21  ? 2.1564 1.7503 1.5130 0.1713  -0.2559 -0.2099 19   GLY C C     
2496 O  O     . GLY C 21  ? 2.2070 1.7856 1.5355 0.1848  -0.2597 -0.2133 19   GLY C O     
2497 N  N     . VAL C 22  ? 1.7558 1.3525 1.1189 0.1740  -0.2421 -0.2054 20   VAL C N     
2498 C  CA    . VAL C 22  ? 1.5810 1.1592 0.9200 0.1900  -0.2319 -0.2050 20   VAL C CA    
2499 C  C     . VAL C 22  ? 1.6696 1.2670 1.0057 0.2072  -0.2130 -0.1944 20   VAL C C     
2500 O  O     . VAL C 22  ? 1.6330 1.2193 0.9456 0.2253  -0.2042 -0.1922 20   VAL C O     
2501 C  CB    . VAL C 22  ? 1.4153 0.9740 0.7619 0.1777  -0.2331 -0.2097 20   VAL C CB    
2502 C  CG1   . VAL C 22  ? 1.5320 1.0662 0.8733 0.1656  -0.2510 -0.2196 20   VAL C CG1   
2503 C  CG2   . VAL C 22  ? 1.4956 1.0742 0.8764 0.1611  -0.2299 -0.2062 20   VAL C CG2   
2504 N  N     . GLY C 23  ? 1.6526 1.2783 1.0125 0.2021  -0.2064 -0.1873 21   GLY C N     
2505 C  CA    . GLY C 23  ? 1.5691 1.2156 0.9265 0.2187  -0.1896 -0.1760 21   GLY C CA    
2506 C  C     . GLY C 23  ? 1.5427 1.2083 0.9242 0.2127  -0.1780 -0.1693 21   GLY C C     
2507 O  O     . GLY C 23  ? 1.5266 1.2127 0.9088 0.2254  -0.1644 -0.1588 21   GLY C O     
2508 N  N     . LYS C 24  ? 1.6627 1.3231 1.0648 0.1937  -0.1832 -0.1745 22   LYS C N     
2509 C  CA    . LYS C 24  ? 1.4660 1.1410 0.8901 0.1876  -0.1728 -0.1695 22   LYS C CA    
2510 C  C     . LYS C 24  ? 1.2120 0.9185 0.6486 0.1931  -0.1638 -0.1591 22   LYS C C     
2511 O  O     . LYS C 24  ? 1.1485 0.8668 0.5840 0.2046  -0.1486 -0.1503 22   LYS C O     
2512 C  CB    . LYS C 24  ? 1.5133 1.1850 0.9632 0.1643  -0.1827 -0.1759 22   LYS C CB    
2513 C  CG    . LYS C 24  ? 1.5436 1.1876 0.9882 0.1538  -0.1944 -0.1854 22   LYS C CG    
2514 C  CD    . LYS C 24  ? 1.3644 1.0104 0.8383 0.1332  -0.1979 -0.1878 22   LYS C CD    
2515 C  CE    . LYS C 24  ? 1.4529 1.0875 0.9356 0.1162  -0.2155 -0.1950 22   LYS C CE    
2516 N  NZ    . LYS C 24  ? 1.8011 1.4188 1.2577 0.1239  -0.2249 -0.1998 22   LYS C NZ    
2517 N  N     . THR C 25  ? 1.0443 0.7670 0.4980 0.1836  -0.1726 -0.1584 23   THR C N     
2518 C  CA    . THR C 25  ? 1.0642 0.8223 0.5463 0.1844  -0.1612 -0.1437 23   THR C CA    
2519 C  C     . THR C 25  ? 1.1795 0.9456 0.6375 0.2074  -0.1513 -0.1353 23   THR C C     
2520 O  O     . THR C 25  ? 1.3113 1.1035 0.7886 0.2118  -0.1372 -0.1213 23   THR C O     
2521 C  CB    . THR C 25  ? 1.2157 0.9894 0.7224 0.1700  -0.1720 -0.1435 23   THR C CB    
2522 O  OG1   . THR C 25  ? 1.2344 0.9991 0.7604 0.1498  -0.1819 -0.1514 23   THR C OG1   
2523 C  CG2   . THR C 25  ? 1.1602 0.9690 0.7012 0.1677  -0.1603 -0.1286 23   THR C CG2   
2524 N  N     . CYS C 26  ? 1.3354 1.0802 0.7545 0.2217  -0.1576 -0.1422 24   CYS C N     
2525 C  CA    . CYS C 26  ? 1.4207 1.1740 0.8212 0.2436  -0.1463 -0.1323 24   CYS C CA    
2526 C  C     . CYS C 26  ? 1.3620 1.1092 0.7521 0.2562  -0.1313 -0.1273 24   CYS C C     
2527 O  O     . CYS C 26  ? 1.3306 1.0961 0.7183 0.2715  -0.1175 -0.1145 24   CYS C O     
2528 C  CB    . CYS C 26  ? 1.3884 1.1274 0.7658 0.2517  -0.1559 -0.1378 24   CYS C CB    
2529 S  SG    . CYS C 26  ? 1.3064 1.0501 0.6949 0.2364  -0.1750 -0.1446 24   CYS C SG    
2530 N  N     . VAL C 27  ? 1.4842 1.2074 0.8693 0.2506  -0.1332 -0.1357 25   VAL C N     
2531 C  CA    . VAL C 27  ? 1.5365 1.2575 0.9153 0.2621  -0.1182 -0.1295 25   VAL C CA    
2532 C  C     . VAL C 27  ? 1.4788 1.2255 0.8812 0.2585  -0.1063 -0.1196 25   VAL C C     
2533 O  O     . VAL C 27  ? 1.5094 1.2743 0.9118 0.2724  -0.0915 -0.1065 25   VAL C O     
2534 C  CB    . VAL C 27  ? 1.6230 1.3131 0.9922 0.2566  -0.1229 -0.1398 25   VAL C CB    
2535 C  CG1   . VAL C 27  ? 1.6212 1.3036 1.0104 0.2336  -0.1332 -0.1492 25   VAL C CG1   
2536 C  CG2   . VAL C 27  ? 1.6158 1.3065 0.9814 0.2679  -0.1071 -0.1324 25   VAL C CG2   
2537 N  N     . LEU C 28  ? 1.3637 1.1152 0.7923 0.2384  -0.1124 -0.1240 26   LEU C N     
2538 C  CA    . LEU C 28  ? 1.1581 0.9392 0.6276 0.2290  -0.1004 -0.1113 26   LEU C CA    
2539 C  C     . LEU C 28  ? 1.0522 0.8636 0.5345 0.2363  -0.0931 -0.0967 26   LEU C C     
2540 O  O     . LEU C 28  ? 1.0577 0.8907 0.5569 0.2406  -0.0790 -0.0833 26   LEU C O     
2541 C  CB    . LEU C 28  ? 1.1921 0.9761 0.6958 0.2046  -0.1085 -0.1165 26   LEU C CB    
2542 C  CG    . LEU C 28  ? 1.0057 0.8178 0.5527 0.1925  -0.0987 -0.1057 26   LEU C CG    
2543 C  CD1   . LEU C 28  ? 0.9492 0.7717 0.4985 0.2027  -0.0821 -0.0952 26   LEU C CD1   
2544 C  CD2   . LEU C 28  ? 1.0361 0.8415 0.6063 0.1719  -0.1059 -0.1135 26   LEU C CD2   
2545 N  N     . PHE C 29  ? 1.1981 1.0120 0.6732 0.2377  -0.1025 -0.0986 27   PHE C N     
2546 C  CA    . PHE C 29  ? 1.2096 1.0529 0.6997 0.2435  -0.0956 -0.0840 27   PHE C CA    
2547 C  C     . PHE C 29  ? 1.3283 1.1775 0.7940 0.2674  -0.0831 -0.0733 27   PHE C C     
2548 O  O     . PHE C 29  ? 1.2987 1.1750 0.7842 0.2716  -0.0709 -0.0572 27   PHE C O     
2549 C  CB    . PHE C 29  ? 1.1779 1.0232 0.6661 0.2398  -0.1086 -0.0880 27   PHE C CB    
2550 C  CG    . PHE C 29  ? 1.0855 0.9624 0.5996 0.2394  -0.1026 -0.0733 27   PHE C CG    
2551 C  CD1   . PHE C 29  ? 1.0057 0.9016 0.5620 0.2219  -0.1003 -0.0677 27   PHE C CD1   
2552 C  CD2   . PHE C 29  ? 1.3152 1.2020 0.8110 0.2571  -0.0992 -0.0648 27   PHE C CD2   
2553 C  CE1   . PHE C 29  ? 1.0206 0.9436 0.6006 0.2214  -0.0952 -0.0543 27   PHE C CE1   
2554 C  CE2   . PHE C 29  ? 1.3070 1.2224 0.8277 0.2564  -0.0937 -0.0505 27   PHE C CE2   
2555 C  CZ    . PHE C 29  ? 1.2218 1.1545 0.7847 0.2382  -0.0919 -0.0455 27   PHE C CZ    
2556 N  N     . ARG C 30  ? 1.3926 1.2167 0.8156 0.2833  -0.0859 -0.0816 28   ARG C N     
2557 C  CA    . ARG C 30  ? 1.4749 1.3053 0.8800 0.3056  -0.0726 -0.0705 28   ARG C CA    
2558 C  C     . ARG C 30  ? 1.4999 1.3416 0.9170 0.3082  -0.0575 -0.0606 28   ARG C C     
2559 O  O     . ARG C 30  ? 1.3936 1.2570 0.8159 0.3211  -0.0438 -0.0444 28   ARG C O     
2560 C  CB    . ARG C 30  ? 1.5365 1.3385 0.9131 0.3160  -0.0774 -0.0799 28   ARG C CB    
2561 N  N     . PHE C 31  ? 1.6420 1.4709 1.0690 0.2949  -0.0594 -0.0689 29   PHE C N     
2562 C  CA    . PHE C 31  ? 1.6344 1.4759 1.0778 0.2959  -0.0449 -0.0588 29   PHE C CA    
2563 C  C     . PHE C 31  ? 1.5750 1.4493 1.0651 0.2821  -0.0385 -0.0456 29   PHE C C     
2564 O  O     . PHE C 31  ? 1.5697 1.4661 1.0725 0.2893  -0.0251 -0.0301 29   PHE C O     
2565 C  CB    . PHE C 31  ? 1.4923 1.3098 0.9325 0.2867  -0.0482 -0.0713 29   PHE C CB    
2566 C  CG    . PHE C 31  ? 1.4538 1.2844 0.9136 0.2854  -0.0347 -0.0620 29   PHE C CG    
2567 C  CD1   . PHE C 31  ? 1.5600 1.3987 1.0560 0.2647  -0.0353 -0.0628 29   PHE C CD1   
2568 C  CD2   . PHE C 31  ? 1.4972 1.3324 0.9396 0.3051  -0.0215 -0.0520 29   PHE C CD2   
2569 C  CE1   . PHE C 31  ? 1.4534 1.3039 0.9666 0.2637  -0.0236 -0.0547 29   PHE C CE1   
2570 C  CE2   . PHE C 31  ? 1.5523 1.4003 1.0122 0.3040  -0.0096 -0.0433 29   PHE C CE2   
2571 C  CZ    . PHE C 31  ? 1.4303 1.2857 0.9259 0.2829  -0.0110 -0.0449 29   PHE C CZ    
2572 N  N     . SER C 32  ? 1.4516 1.3284 0.9676 0.2619  -0.0483 -0.0516 30   SER C N     
2573 C  CA    . SER C 32  ? 1.4154 1.3193 0.9750 0.2476  -0.0439 -0.0412 30   SER C CA    
2574 C  C     . SER C 32  ? 1.4726 1.4030 1.0409 0.2568  -0.0371 -0.0249 30   SER C C     
2575 O  O     . SER C 32  ? 1.4181 1.3721 1.0140 0.2539  -0.0274 -0.0110 30   SER C O     
2576 C  CB    . SER C 32  ? 1.4811 1.3804 1.0615 0.2267  -0.0567 -0.0516 30   SER C CB    
2577 O  OG    . SER C 32  ? 1.6349 1.5276 1.1994 0.2293  -0.0676 -0.0573 30   SER C OG    
2578 N  N     . ASP C 33  ? 1.5575 1.4841 1.1024 0.2680  -0.0423 -0.0260 31   ASP C N     
2579 C  CA    . ASP C 33  ? 1.5136 1.4658 1.0684 0.2757  -0.0366 -0.0102 31   ASP C CA    
2580 C  C     . ASP C 33  ? 1.4832 1.4332 1.0011 0.3003  -0.0326 -0.0051 31   ASP C C     
2581 O  O     . ASP C 33  ? 1.3833 1.3534 0.9066 0.3077  -0.0290 0.0077  31   ASP C O     
2582 C  CB    . ASP C 33  ? 1.5590 1.5185 1.1339 0.2619  -0.0470 -0.0128 31   ASP C CB    
2583 C  CG    . ASP C 33  ? 1.6858 1.6460 1.2946 0.2387  -0.0519 -0.0189 31   ASP C CG    
2584 O  OD1   . ASP C 33  ? 1.6370 1.6171 1.2780 0.2284  -0.0509 -0.0107 31   ASP C OD1   
2585 O  OD2   . ASP C 33  ? 1.8270 1.7671 1.4295 0.2312  -0.0568 -0.0319 31   ASP C OD2   
2586 N  N     . ASP C 34  ? 1.5241 1.4500 1.0042 0.3136  -0.0333 -0.0143 32   ASP C N     
2587 C  CA    . ASP C 34  ? 1.6455 1.5695 1.0917 0.3384  -0.0275 -0.0087 32   ASP C CA    
2588 C  C     . ASP C 34  ? 1.5846 1.5088 1.0211 0.3424  -0.0363 -0.0110 32   ASP C C     
2589 O  O     . ASP C 34  ? 1.6861 1.6293 1.1254 0.3546  -0.0287 0.0026  32   ASP C O     
2590 C  CB    . ASP C 34  ? 1.6551 1.6077 1.1184 0.3490  -0.0099 0.0130  32   ASP C CB    
2591 C  CG    . ASP C 34  ? 1.6671 1.6155 1.1133 0.3693  -0.0008 0.0172  32   ASP C CG    
2592 O  OD1   . ASP C 34  ? 1.6917 1.6117 1.1118 0.3750  -0.0073 0.0030  32   ASP C OD1   
2593 O  OD2   . ASP C 34  ? 1.7049 1.6787 1.1652 0.3794  0.0127  0.0354  32   ASP C OD2   
2594 N  N     . ALA C 35  ? 1.4725 1.3763 0.8993 0.3313  -0.0526 -0.0280 33   ALA C N     
2595 C  CA    . ALA C 35  ? 1.5105 1.4157 0.9310 0.3323  -0.0625 -0.0308 33   ALA C CA    
2596 C  C     . ALA C 35  ? 1.5765 1.4499 0.9774 0.3250  -0.0794 -0.0518 33   ALA C C     
2597 O  O     . ALA C 35  ? 1.6231 1.4749 1.0196 0.3164  -0.0840 -0.0638 33   ALA C O     
2598 C  CB    . ALA C 35  ? 1.5318 1.4623 0.9885 0.3173  -0.0643 -0.0223 33   ALA C CB    
2599 N  N     . PHE C 36  ? 1.6088 1.4801 0.9994 0.3281  -0.0886 -0.0555 34   PHE C N     
2600 C  CA    . PHE C 36  ? 1.5816 1.4256 0.9562 0.3203  -0.1060 -0.0739 34   PHE C CA    
2601 C  C     . PHE C 36  ? 1.5255 1.3802 0.9036 0.3171  -0.1162 -0.0739 34   PHE C C     
2602 O  O     . PHE C 36  ? 1.5509 1.4255 0.9294 0.3296  -0.1088 -0.0613 34   PHE C O     
2603 C  CB    . PHE C 36  ? 1.5384 1.3568 0.8831 0.3346  -0.1062 -0.0810 34   PHE C CB    
2604 C  CG    . PHE C 36  ? 1.5556 1.3468 0.8844 0.3268  -0.1245 -0.0983 34   PHE C CG    
2605 C  CD1   . PHE C 36  ? 1.5989 1.3661 0.9279 0.3118  -0.1342 -0.1119 34   PHE C CD1   
2606 C  CD2   . PHE C 36  ? 1.5351 1.3258 0.8507 0.3336  -0.1324 -0.1003 34   PHE C CD2   
2607 C  CE1   . PHE C 36  ? 1.5512 1.2948 0.8686 0.3033  -0.1514 -0.1264 34   PHE C CE1   
2608 C  CE2   . PHE C 36  ? 1.4951 1.2620 0.7977 0.3255  -0.1498 -0.1155 34   PHE C CE2   
2609 C  CZ    . PHE C 36  ? 1.5553 1.2987 0.8593 0.3100  -0.1595 -0.1283 34   PHE C CZ    
2610 N  N     . ASN C 37  ? 1.5703 1.4126 0.9523 0.3002  -0.1330 -0.0873 35   ASN C N     
2611 C  CA    . ASN C 37  ? 1.6681 1.5189 1.0534 0.2961  -0.1443 -0.0886 35   ASN C CA    
2612 C  C     . ASN C 37  ? 1.6156 1.4393 0.9871 0.2868  -0.1624 -0.1063 35   ASN C C     
2613 O  O     . ASN C 37  ? 1.5109 1.3155 0.8853 0.2733  -0.1697 -0.1175 35   ASN C O     
2614 C  CB    . ASN C 37  ? 1.6299 1.5055 1.0461 0.2824  -0.1463 -0.0816 35   ASN C CB    
2615 C  CG    . ASN C 37  ? 1.6623 1.5660 1.1043 0.2870  -0.1270 -0.0622 35   ASN C CG    
2616 O  OD1   . ASN C 37  ? 1.7750 1.6771 1.2199 0.2893  -0.1159 -0.0585 35   ASN C OD1   
2617 N  ND2   . ASN C 37  ? 1.6874 1.6166 1.1467 0.2891  -0.1233 -0.0492 35   ASN C ND2   
2618 N  N     . THR C 38  ? 1.7065 1.5298 1.0645 0.2939  -0.1695 -0.1078 36   THR C N     
2619 C  CA    . THR C 38  ? 1.8271 1.6243 1.1676 0.2891  -0.1858 -0.1230 36   THR C CA    
2620 C  C     . THR C 38  ? 1.8073 1.6015 1.1670 0.2655  -0.2022 -0.1325 36   THR C C     
2621 O  O     . THR C 38  ? 1.9136 1.6828 1.2656 0.2557  -0.2144 -0.1456 36   THR C O     
2622 C  CB    . THR C 38  ? 1.7722 1.5734 1.0947 0.3035  -0.1882 -0.1206 36   THR C CB    
2623 O  OG1   . THR C 38  ? 1.7556 1.5882 1.0968 0.3040  -0.1842 -0.1082 36   THR C OG1   
2624 C  CG2   . THR C 38  ? 1.7406 1.5352 1.0384 0.3270  -0.1756 -0.1156 36   THR C CG2   
2625 N  N     . THR C 39  ? 1.6459 1.4655 1.0311 0.2565  -0.2030 -0.1253 37   THR C N     
2626 C  CA    . THR C 39  ? 1.6010 1.4209 1.0068 0.2349  -0.2185 -0.1330 37   THR C CA    
2627 C  C     . THR C 39  ? 1.5837 1.3861 0.9989 0.2198  -0.2215 -0.1418 37   THR C C     
2628 O  O     . THR C 39  ? 1.6434 1.4449 1.0602 0.2234  -0.2095 -0.1383 37   THR C O     
2629 C  CB    . THR C 39  ? 1.5818 1.4334 1.0153 0.2295  -0.2169 -0.1222 37   THR C CB    
2630 O  OG1   . THR C 39  ? 1.5508 1.4120 1.0121 0.2197  -0.2069 -0.1168 37   THR C OG1   
2631 C  CG2   . THR C 39  ? 1.5401 1.4124 0.9665 0.2482  -0.2057 -0.1082 37   THR C CG2   
2632 N  N     . PHE C 40  ? 1.5328 1.3216 0.9547 0.2029  -0.2374 -0.1528 38   PHE C N     
2633 C  CA    . PHE C 40  ? 1.6077 1.3801 1.0411 0.1867  -0.2415 -0.1610 38   PHE C CA    
2634 C  C     . PHE C 40  ? 1.6966 1.4885 1.1653 0.1682  -0.2473 -0.1589 38   PHE C C     
2635 O  O     . PHE C 40  ? 1.6936 1.4915 1.1744 0.1571  -0.2603 -0.1614 38   PHE C O     
2636 C  CB    . PHE C 40  ? 1.7530 1.4963 1.1709 0.1806  -0.2547 -0.1734 38   PHE C CB    
2637 C  CG    . PHE C 40  ? 1.9119 1.6446 1.3505 0.1587  -0.2637 -0.1806 38   PHE C CG    
2638 C  CD1   . PHE C 40  ? 1.9331 1.6699 1.3901 0.1411  -0.2791 -0.1845 38   PHE C CD1   
2639 C  CD2   . PHE C 40  ? 2.0201 1.7409 1.4616 0.1558  -0.2558 -0.1821 38   PHE C CD2   
2640 C  CE1   . PHE C 40  ? 2.0188 1.7477 1.4969 0.1211  -0.2863 -0.1894 38   PHE C CE1   
2641 C  CE2   . PHE C 40  ? 2.0480 1.7601 1.5095 0.1361  -0.2630 -0.1875 38   PHE C CE2   
2642 C  CZ    . PHE C 40  ? 2.0950 1.8113 1.5753 0.1186  -0.2781 -0.1909 38   PHE C CZ    
2643 N  N     . ILE C 41  ? 1.6464 1.4504 1.1368 0.1643  -0.2352 -0.1523 39   ILE C N     
2644 C  CA    . ILE C 41  ? 1.3622 1.1879 0.8984 0.1453  -0.2334 -0.1463 39   ILE C CA    
2645 C  C     . ILE C 41  ? 1.3246 1.1337 0.8712 0.1309  -0.2354 -0.1537 39   ILE C C     
2646 O  O     . ILE C 41  ? 1.5275 1.3328 1.0753 0.1344  -0.2225 -0.1511 39   ILE C O     
2647 C  CB    . ILE C 41  ? 1.3235 1.1782 0.8852 0.1498  -0.2150 -0.1306 39   ILE C CB    
2648 C  CG1   . ILE C 41  ? 1.3177 1.1883 0.8685 0.1643  -0.2132 -0.1225 39   ILE C CG1   
2649 C  CG2   . ILE C 41  ? 1.3825 1.2568 0.9891 0.1311  -0.2131 -0.1253 39   ILE C CG2   
2650 C  CD1   . ILE C 41  ? 1.2117 1.1058 0.7779 0.1735  -0.1944 -0.1067 39   ILE C CD1   
2651 N  N     . SER C 42  ? 1.1927 0.9924 0.7469 0.1151  -0.2517 -0.1623 40   SER C N     
2652 C  CA    . SER C 42  ? 1.3120 1.0954 0.8762 0.1010  -0.2549 -0.1690 40   SER C CA    
2653 C  C     . SER C 42  ? 1.2329 1.0360 0.8336 0.0931  -0.2391 -0.1594 40   SER C C     
2654 O  O     . SER C 42  ? 1.1275 0.9573 0.7593 0.0867  -0.2349 -0.1505 40   SER C O     
2655 C  CB    . SER C 42  ? 1.3764 1.1536 0.9507 0.0834  -0.2746 -0.1766 40   SER C CB    
2656 O  OG    . SER C 42  ? 1.4281 1.2032 1.0288 0.0665  -0.2744 -0.1775 40   SER C OG    
2657 N  N     . THR C 43  ? 1.3287 1.1179 0.9243 0.0946  -0.2304 -0.1614 41   THR C N     
2658 C  CA    . THR C 43  ? 1.3880 1.1928 1.0169 0.0860  -0.2173 -0.1539 41   THR C CA    
2659 C  C     . THR C 43  ? 1.3781 1.1862 1.0363 0.0653  -0.2266 -0.1564 41   THR C C     
2660 O  O     . THR C 43  ? 1.3534 1.1422 1.0018 0.0571  -0.2416 -0.1658 41   THR C O     
2661 C  CB    . THR C 43  ? 1.2752 1.0640 0.8897 0.0934  -0.2063 -0.1554 41   THR C CB    
2662 O  OG1   . THR C 43  ? 1.2959 1.0831 0.8830 0.1135  -0.1975 -0.1521 41   THR C OG1   
2663 C  CG2   . THR C 43  ? 1.2318 1.0379 0.8798 0.0857  -0.1926 -0.1474 41   THR C CG2   
2664 N  N     . ILE C 44  ? 1.3608 1.1936 1.0553 0.0570  -0.2179 -0.1474 42   ILE C N     
2665 C  CA    . ILE C 44  ? 1.3537 1.1946 1.0793 0.0386  -0.2244 -0.1473 42   ILE C CA    
2666 C  C     . ILE C 44  ? 1.3352 1.1773 1.0795 0.0330  -0.2126 -0.1446 42   ILE C C     
2667 O  O     . ILE C 44  ? 1.3986 1.2573 1.1572 0.0377  -0.1982 -0.1365 42   ILE C O     
2668 C  CB    . ILE C 44  ? 1.2565 1.1259 1.0095 0.0337  -0.2254 -0.1392 42   ILE C CB    
2669 C  CG1   . ILE C 44  ? 1.1932 1.0634 0.9284 0.0396  -0.2369 -0.1412 42   ILE C CG1   
2670 C  CG2   . ILE C 44  ? 1.3502 1.2285 1.1347 0.0158  -0.2314 -0.1384 42   ILE C CG2   
2671 C  CD1   . ILE C 44  ? 1.1918 1.0909 0.9489 0.0406  -0.2333 -0.1313 42   ILE C CD1   
2672 N  N     . GLY C 45  ? 1.1817 1.0068 0.9270 0.0226  -0.2193 -0.1510 43   GLY C N     
2673 C  CA    . GLY C 45  ? 1.0249 0.8514 0.7890 0.0161  -0.2095 -0.1486 43   GLY C CA    
2674 C  C     . GLY C 45  ? 1.0756 0.8895 0.8209 0.0279  -0.1970 -0.1492 43   GLY C C     
2675 O  O     . GLY C 45  ? 1.0970 0.8853 0.8200 0.0296  -0.2006 -0.1567 43   GLY C O     
2676 N  N     . ILE C 46  ? 1.1523 0.9842 0.9065 0.0361  -0.1824 -0.1409 44   ILE C N     
2677 C  CA    . ILE C 46  ? 1.1382 0.9632 0.8798 0.0466  -0.1692 -0.1394 44   ILE C CA    
2678 C  C     . ILE C 46  ? 1.1166 0.9613 0.8604 0.0581  -0.1581 -0.1304 44   ILE C C     
2679 O  O     . ILE C 46  ? 1.1281 0.9940 0.8923 0.0548  -0.1580 -0.1243 44   ILE C O     
2680 C  CB    . ILE C 46  ? 1.1345 0.9617 0.8979 0.0376  -0.1616 -0.1377 44   ILE C CB    
2681 C  CG1   . ILE C 46  ? 1.1552 0.9710 0.9022 0.0479  -0.1500 -0.1377 44   ILE C CG1   
2682 C  CG2   . ILE C 46  ? 1.0416 0.8970 0.8401 0.0313  -0.1548 -0.1290 44   ILE C CG2   
2683 C  CD1   . ILE C 46  ? 1.2355 1.0218 0.9459 0.0559  -0.1558 -0.1463 44   ILE C CD1   
2684 N  N     . ASP C 47  ? 1.0564 0.8942 0.7795 0.0719  -0.1486 -0.1288 45   ASP C N     
2685 C  CA    . ASP C 47  ? 1.0876 0.9459 0.8180 0.0813  -0.1362 -0.1183 45   ASP C CA    
2686 C  C     . ASP C 47  ? 1.0023 0.8538 0.7198 0.0915  -0.1240 -0.1161 45   ASP C C     
2687 O  O     . ASP C 47  ? 0.8892 0.7204 0.5925 0.0913  -0.1250 -0.1228 45   ASP C O     
2688 C  CB    . ASP C 47  ? 1.1735 1.0375 0.8887 0.0914  -0.1399 -0.1156 45   ASP C CB    
2689 C  CG    . ASP C 47  ? 1.2298 1.1199 0.9634 0.0961  -0.1298 -0.1033 45   ASP C CG    
2690 O  OD1   . ASP C 47  ? 1.1338 1.0346 0.8860 0.0942  -0.1191 -0.0972 45   ASP C OD1   
2691 O  OD2   . ASP C 47  ? 1.1133 1.0125 0.8426 0.1015  -0.1331 -0.0997 45   ASP C OD2   
2692 N  N     . PHE C 48  ? 1.1045 0.9738 0.8283 0.1001  -0.1125 -0.1058 46   PHE C N     
2693 C  CA    . PHE C 48  ? 1.0703 0.9358 0.7805 0.1117  -0.1009 -0.1021 46   PHE C CA    
2694 C  C     . PHE C 48  ? 1.0385 0.9249 0.7531 0.1222  -0.0913 -0.0899 46   PHE C C     
2695 O  O     . PHE C 48  ? 0.9966 0.9020 0.7326 0.1174  -0.0918 -0.0837 46   PHE C O     
2696 C  CB    . PHE C 48  ? 1.0206 0.8861 0.7482 0.1038  -0.0942 -0.1022 46   PHE C CB    
2697 C  CG    . PHE C 48  ? 0.9019 0.7918 0.6634 0.0969  -0.0870 -0.0934 46   PHE C CG    
2698 C  CD1   . PHE C 48  ? 0.7969 0.7020 0.5638 0.1051  -0.0754 -0.0831 46   PHE C CD1   
2699 C  CD2   . PHE C 48  ? 0.8415 0.7386 0.6291 0.0823  -0.0920 -0.0953 46   PHE C CD2   
2700 C  CE1   . PHE C 48  ? 0.6733 0.5985 0.4702 0.0984  -0.0701 -0.0758 46   PHE C CE1   
2701 C  CE2   . PHE C 48  ? 0.7762 0.6935 0.5926 0.0769  -0.0858 -0.0880 46   PHE C CE2   
2702 C  CZ    . PHE C 48  ? 0.6750 0.6053 0.4956 0.0847  -0.0753 -0.0787 46   PHE C CZ    
2703 N  N     . LYS C 49  ? 1.0253 0.9080 0.7196 0.1367  -0.0825 -0.0858 47   LYS C N     
2704 C  CA    . LYS C 49  ? 0.8996 0.8027 0.5993 0.1468  -0.0718 -0.0724 47   LYS C CA    
2705 C  C     . LYS C 49  ? 0.9525 0.8579 0.6537 0.1518  -0.0598 -0.0673 47   LYS C C     
2706 O  O     . LYS C 49  ? 0.8271 0.7148 0.5163 0.1515  -0.0596 -0.0746 47   LYS C O     
2707 C  CB    . LYS C 49  ? 0.9582 0.8591 0.6298 0.1630  -0.0726 -0.0698 47   LYS C CB    
2708 C  CG    . LYS C 49  ? 1.1215 1.0195 0.7882 0.1596  -0.0852 -0.0752 47   LYS C CG    
2709 C  CD    . LYS C 49  ? 1.2305 1.1512 0.9309 0.1486  -0.0864 -0.0684 47   LYS C CD    
2710 C  CE    . LYS C 49  ? 1.1693 1.0873 0.8664 0.1441  -0.0994 -0.0742 47   LYS C CE    
2711 N  NZ    . LYS C 49  ? 1.0954 1.0272 0.8266 0.1280  -0.1033 -0.0731 47   LYS C NZ    
2712 N  N     . ILE C 50  ? 1.0359 0.9633 0.7527 0.1560  -0.0501 -0.0541 48   ILE C N     
2713 C  CA    . ILE C 50  ? 0.8125 0.7473 0.5364 0.1594  -0.0387 -0.0470 48   ILE C CA    
2714 C  C     . ILE C 50  ? 0.8663 0.8091 0.5728 0.1774  -0.0297 -0.0360 48   ILE C C     
2715 O  O     . ILE C 50  ? 0.9569 0.9156 0.6689 0.1820  -0.0285 -0.0266 48   ILE C O     
2716 C  CB    . ILE C 50  ? 0.7236 0.6789 0.4849 0.1473  -0.0354 -0.0400 48   ILE C CB    
2717 C  CG1   . ILE C 50  ? 0.7589 0.7080 0.5375 0.1307  -0.0436 -0.0499 48   ILE C CG1   
2718 C  CG2   . ILE C 50  ? 0.6913 0.6551 0.4596 0.1509  -0.0244 -0.0323 48   ILE C CG2   
2719 C  CD1   . ILE C 50  ? 0.7957 0.7266 0.5660 0.1269  -0.0444 -0.0596 48   ILE C CD1   
2720 N  N     . LYS C 51  ? 0.9864 0.9195 0.6730 0.1881  -0.0229 -0.0361 49   LYS C N     
2721 C  CA    . LYS C 51  ? 1.2034 1.1460 0.8742 0.2064  -0.0130 -0.0243 49   LYS C CA    
2722 C  C     . LYS C 51  ? 1.2544 1.2038 0.9314 0.2098  -0.0020 -0.0174 49   LYS C C     
2723 O  O     . LYS C 51  ? 1.1583 1.0896 0.8212 0.2108  -0.0015 -0.0257 49   LYS C O     
2724 C  CB    . LYS C 51  ? 1.3350 1.2570 0.9647 0.2222  -0.0160 -0.0308 49   LYS C CB    
2725 C  CG    . LYS C 51  ? 1.3773 1.3135 0.9953 0.2380  -0.0114 -0.0189 49   LYS C CG    
2726 C  CD    . LYS C 51  ? 1.3778 1.3148 0.9720 0.2585  0.0002  -0.0104 49   LYS C CD    
2727 C  CE    . LYS C 51  ? 1.2729 1.2234 0.8532 0.2754  0.0045  0.0013  49   LYS C CE    
2728 N  NZ    . LYS C 51  ? 1.3873 1.3349 0.9381 0.2977  0.0149  0.0080  49   LYS C NZ    
2729 N  N     . THR C 52  ? 1.3202 1.2954 1.0180 0.2116  0.0064  -0.0019 50   THR C N     
2730 C  CA    . THR C 52  ? 1.2544 1.2405 0.9601 0.2156  0.0170  0.0072  50   THR C CA    
2731 C  C     . THR C 52  ? 1.3436 1.3314 1.0221 0.2374  0.0261  0.0162  50   THR C C     
2732 O  O     . THR C 52  ? 1.3716 1.3717 1.0450 0.2473  0.0285  0.0261  50   THR C O     
2733 C  CB    . THR C 52  ? 1.2235 1.2368 0.9669 0.2057  0.0203  0.0199  50   THR C CB    
2734 O  OG1   . THR C 52  ? 1.2889 1.3011 1.0539 0.1885  0.0109  0.0125  50   THR C OG1   
2735 C  CG2   . THR C 52  ? 1.1583 1.1797 0.9152 0.2034  0.0277  0.0249  50   THR C CG2   
2736 N  N     . VAL C 53  ? 1.4067 1.3824 1.0672 0.2455  0.0316  0.0131  51   VAL C N     
2737 C  CA    . VAL C 53  ? 1.3802 1.3537 1.0108 0.2675  0.0405  0.0199  51   VAL C CA    
2738 C  C     . VAL C 53  ? 1.5708 1.5574 1.2115 0.2712  0.0516  0.0299  51   VAL C C     
2739 O  O     . VAL C 53  ? 1.6470 1.6370 1.3111 0.2571  0.0508  0.0274  51   VAL C O     
2740 C  CB    . VAL C 53  ? 1.3101 1.2497 0.9001 0.2769  0.0351  0.0043  51   VAL C CB    
2741 C  CG1   . VAL C 53  ? 1.3116 1.2376 0.8958 0.2692  0.0219  -0.0074 51   VAL C CG1   
2742 C  CG2   . VAL C 53  ? 1.3757 1.2965 0.9629 0.2703  0.0343  -0.0066 51   VAL C CG2   
2743 N  N     . GLU C 54  ? 1.6290 1.6234 1.2509 0.2913  0.0620  0.0415  52   GLU C N     
2744 C  CA    . GLU C 54  ? 1.6019 1.6164 1.2368 0.2964  0.0735  0.0557  52   GLU C CA    
2745 C  C     . GLU C 54  ? 1.5317 1.5289 1.1358 0.3120  0.0803  0.0521  52   GLU C C     
2746 O  O     . GLU C 54  ? 1.4661 1.4792 1.0752 0.3231  0.0899  0.0660  52   GLU C O     
2747 C  CB    . GLU C 54  ? 1.7249 1.7705 1.3712 0.3064  0.0818  0.0771  52   GLU C CB    
2748 C  CG    . GLU C 54  ? 1.8680 1.9367 1.5538 0.2896  0.0777  0.0853  52   GLU C CG    
2749 C  CD    . GLU C 54  ? 1.9699 2.0324 1.6521 0.2859  0.0688  0.0795  52   GLU C CD    
2750 O  OE1   . GLU C 54  ? 1.8621 1.9446 1.5520 0.2917  0.0719  0.0938  52   GLU C OE1   
2751 O  OE2   . GLU C 54  ? 2.0599 2.0987 1.7328 0.2770  0.0587  0.0616  52   GLU C OE2   
2752 N  N     . LEU C 55  ? 1.5939 1.5590 1.1766 0.3093  0.0734  0.0336  53   LEU C N     
2753 C  CA    . LEU C 55  ? 1.6665 1.6112 1.2313 0.3191  0.0754  0.0294  53   LEU C CA    
2754 C  C     . LEU C 55  ? 1.7435 1.6998 1.3258 0.3165  0.0833  0.0364  53   LEU C C     
2755 O  O     . LEU C 55  ? 1.8171 1.7799 1.4163 0.3030  0.0833  0.0333  53   LEU C O     
2756 C  CB    . LEU C 55  ? 1.5979 1.5054 1.1405 0.3132  0.0644  0.0087  53   LEU C CB    
2757 C  CG    . LEU C 55  ? 1.6322 1.5133 1.1597 0.3164  0.0635  0.0009  53   LEU C CG    
2758 C  CD1   . LEU C 55  ? 1.6622 1.5409 1.1746 0.3356  0.0690  0.0100  53   LEU C CD1   
2759 C  CD2   . LEU C 55  ? 1.5977 1.4454 1.1069 0.3080  0.0508  -0.0184 53   LEU C CD2   
2760 N  N     . GLN C 56  ? 1.6695 1.6284 1.2475 0.3303  0.0899  0.0458  54   GLN C N     
2761 C  CA    . GLN C 56  ? 1.4717 1.4380 1.0621 0.3300  0.0964  0.0519  54   GLN C CA    
2762 C  C     . GLN C 56  ? 1.4426 1.4416 1.0656 0.3198  0.1019  0.0633  54   GLN C C     
2763 O  O     . GLN C 56  ? 1.2653 1.2677 0.9010 0.3125  0.1042  0.0629  54   GLN C O     
2764 C  CB    . GLN C 56  ? 1.2961 1.2321 0.8738 0.3228  0.0913  0.0360  54   GLN C CB    
2765 C  CG    . GLN C 56  ? 1.4124 1.3249 0.9662 0.3360  0.0913  0.0335  54   GLN C CG    
2766 C  CD    . GLN C 56  ? 1.5469 1.4282 1.0881 0.3274  0.0851  0.0177  54   GLN C CD    
2767 O  OE1   . GLN C 56  ? 1.4132 1.2983 0.9699 0.3159  0.0865  0.0153  54   GLN C OE1   
2768 N  NE2   . GLN C 56  ? 1.6414 1.4920 1.1550 0.3327  0.0781  0.0071  54   GLN C NE2   
2769 N  N     . GLY C 57  ? 1.5266 1.5498 1.1635 0.3190  0.1035  0.0739  55   GLY C N     
2770 C  CA    . GLY C 57  ? 1.6105 1.6647 1.2785 0.3087  0.1077  0.0858  55   GLY C CA    
2771 C  C     . GLY C 57  ? 1.7666 1.8137 1.4520 0.2875  0.0994  0.0732  55   GLY C C     
2772 O  O     . GLY C 57  ? 1.8293 1.8974 1.5491 0.2730  0.0967  0.0799  55   GLY C O     
2773 N  N     . LYS C 58  ? 1.7873 1.8038 1.4546 0.2836  0.0934  0.0549  56   LYS C N     
2774 C  CA    . LYS C 58  ? 1.7282 1.7345 1.4141 0.2624  0.0828  0.0414  56   LYS C CA    
2775 C  C     . LYS C 58  ? 1.6927 1.6958 1.3803 0.2564  0.0739  0.0370  56   LYS C C     
2776 O  O     . LYS C 58  ? 1.7761 1.7605 1.4353 0.2658  0.0710  0.0301  56   LYS C O     
2777 C  CB    . LYS C 58  ? 1.6706 1.6463 1.3370 0.2609  0.0798  0.0251  56   LYS C CB    
2778 N  N     . LYS C 59  ? 1.4100 1.4314 1.1303 0.2414  0.0695  0.0413  57   LYS C N     
2779 C  CA    . LYS C 59  ? 1.2296 1.2496 0.9544 0.2348  0.0610  0.0377  57   LYS C CA    
2780 C  C     . LYS C 59  ? 1.1720 1.1661 0.8909 0.2229  0.0505  0.0186  57   LYS C C     
2781 O  O     . LYS C 59  ? 1.1044 1.0993 0.8457 0.2072  0.0462  0.0130  57   LYS C O     
2782 C  CB    . LYS C 59  ? 1.1746 1.2219 0.9367 0.2229  0.0601  0.0491  57   LYS C CB    
2783 C  CG    . LYS C 59  ? 1.3021 1.3551 1.0709 0.2194  0.0541  0.0511  57   LYS C CG    
2784 C  CD    . LYS C 59  ? 1.3817 1.4637 1.1844 0.2123  0.0558  0.0668  57   LYS C CD    
2785 C  CE    . LYS C 59  ? 1.5136 1.6164 1.3126 0.2279  0.0655  0.0859  57   LYS C CE    
2786 N  NZ    . LYS C 59  ? 1.5271 1.6343 1.3196 0.2340  0.0638  0.0913  57   LYS C NZ    
2787 N  N     . ILE C 60  ? 1.0835 1.0544 0.7722 0.2305  0.0460  0.0086  58   ILE C N     
2788 C  CA    . ILE C 60  ? 1.0239 0.9702 0.7068 0.2192  0.0353  -0.0088 58   ILE C CA    
2789 C  C     . ILE C 60  ? 1.2896 1.2402 0.9853 0.2092  0.0260  -0.0115 58   ILE C C     
2790 O  O     . ILE C 60  ? 1.4325 1.3899 1.1195 0.2178  0.0261  -0.0054 58   ILE C O     
2791 C  CB    . ILE C 60  ? 0.9054 0.8210 0.5490 0.2307  0.0332  -0.0200 58   ILE C CB    
2792 C  CG1   . ILE C 60  ? 0.9910 0.8948 0.6205 0.2380  0.0403  -0.0217 58   ILE C CG1   
2793 C  CG2   . ILE C 60  ? 1.0182 0.9120 0.6607 0.2170  0.0207  -0.0361 58   ILE C CG2   
2794 C  CD1   . ILE C 60  ? 1.1044 1.0218 0.7246 0.2554  0.0532  -0.0081 58   ILE C CD1   
2795 N  N     . LYS C 61  ? 1.1943 1.1408 0.9097 0.1917  0.0182  -0.0203 59   LYS C N     
2796 C  CA    . LYS C 61  ? 1.0504 0.9958 0.7747 0.1817  0.0081  -0.0257 59   LYS C CA    
2797 C  C     . LYS C 61  ? 0.9852 0.9022 0.6877 0.1794  -0.0012 -0.0413 59   LYS C C     
2798 O  O     . LYS C 61  ? 0.8138 0.7168 0.5175 0.1717  -0.0035 -0.0501 59   LYS C O     
2799 C  CB    . LYS C 61  ? 1.1014 1.0615 0.8618 0.1646  0.0052  -0.0246 59   LYS C CB    
2800 C  CG    . LYS C 61  ? 0.8029 0.7681 0.5762 0.1559  -0.0034 -0.0263 59   LYS C CG    
2801 C  CD    . LYS C 61  ? 0.9001 0.8747 0.7053 0.1396  -0.0066 -0.0277 59   LYS C CD    
2802 C  CE    . LYS C 61  ? 0.9942 0.9851 0.8193 0.1343  -0.0101 -0.0213 59   LYS C CE    
2803 N  NZ    . LYS C 61  ? 1.1132 1.1175 0.9693 0.1224  -0.0096 -0.0183 59   LYS C NZ    
2804 N  N     . LEU C 62  ? 0.9919 0.9007 0.6749 0.1859  -0.0069 -0.0442 60   LEU C N     
2805 C  CA    . LEU C 62  ? 0.9544 0.8365 0.6162 0.1836  -0.0175 -0.0586 60   LEU C CA    
2806 C  C     . LEU C 62  ? 0.9125 0.7981 0.5949 0.1677  -0.0280 -0.0638 60   LEU C C     
2807 O  O     . LEU C 62  ? 1.0378 0.9419 0.7354 0.1659  -0.0287 -0.0566 60   LEU C O     
2808 C  CB    . LEU C 62  ? 1.2568 1.1265 0.8830 0.2006  -0.0187 -0.0597 60   LEU C CB    
2809 C  CG    . LEU C 62  ? 1.4691 1.3238 1.0623 0.2188  -0.0115 -0.0595 60   LEU C CG    
2810 C  CD1   . LEU C 62  ? 1.4287 1.2523 1.0040 0.2152  -0.0174 -0.0738 60   LEU C CD1   
2811 C  CD2   . LEU C 62  ? 1.4927 1.3680 1.0965 0.2266  0.0028  -0.0455 60   LEU C CD2   
2812 N  N     . GLN C 63  ? 0.8401 0.7083 0.5234 0.1564  -0.0362 -0.0755 61   GLN C N     
2813 C  CA    . GLN C 63  ? 0.8842 0.7523 0.5823 0.1425  -0.0474 -0.0816 61   GLN C CA    
2814 C  C     . GLN C 63  ? 0.9011 0.7418 0.5713 0.1440  -0.0580 -0.0938 61   GLN C C     
2815 O  O     . GLN C 63  ? 0.9552 0.7767 0.6195 0.1385  -0.0616 -0.1024 61   GLN C O     
2816 C  CB    . GLN C 63  ? 0.9133 0.7881 0.6416 0.1264  -0.0480 -0.0833 61   GLN C CB    
2817 C  CG    . GLN C 63  ? 0.9498 0.8254 0.6937 0.1126  -0.0591 -0.0889 61   GLN C CG    
2818 C  CD    . GLN C 63  ? 1.0324 0.9132 0.8033 0.0984  -0.0592 -0.0906 61   GLN C CD    
2819 O  OE1   . GLN C 63  ? 1.0572 0.9286 0.8263 0.0970  -0.0556 -0.0936 61   GLN C OE1   
2820 N  NE2   . GLN C 63  ? 1.1602 1.0562 0.9560 0.0886  -0.0630 -0.0885 61   GLN C NE2   
2821 N  N     . ILE C 64  ? 0.9998 0.8380 0.6523 0.1519  -0.0633 -0.0943 62   ILE C N     
2822 C  CA    . ILE C 64  ? 1.1331 0.9444 0.7557 0.1550  -0.0743 -0.1058 62   ILE C CA    
2823 C  C     . ILE C 64  ? 1.0730 0.8840 0.7107 0.1396  -0.0877 -0.1122 62   ILE C C     
2824 O  O     . ILE C 64  ? 1.0105 0.8392 0.6614 0.1375  -0.0901 -0.1073 62   ILE C O     
2825 C  CB    . ILE C 64  ? 1.1015 0.9086 0.6922 0.1740  -0.0730 -0.1034 62   ILE C CB    
2826 C  CG1   . ILE C 64  ? 0.9122 0.7261 0.4929 0.1897  -0.0581 -0.0939 62   ILE C CG1   
2827 C  CG2   . ILE C 64  ? 1.0884 0.8635 0.6445 0.1783  -0.0846 -0.1167 62   ILE C CG2   
2828 C  CD1   . ILE C 64  ? 0.8775 0.7187 0.4669 0.1990  -0.0496 -0.0795 62   ILE C CD1   
2829 N  N     . TRP C 65  ? 1.0299 0.8215 0.6665 0.1289  -0.0962 -0.1224 63   TRP C N     
2830 C  CA    . TRP C 65  ? 0.9196 0.7092 0.5699 0.1138  -0.1096 -0.1286 63   TRP C CA    
2831 C  C     . TRP C 65  ? 1.1393 0.9078 0.7593 0.1187  -0.1226 -0.1375 63   TRP C C     
2832 O  O     . TRP C 65  ? 1.1075 0.8503 0.6962 0.1275  -0.1248 -0.1445 63   TRP C O     
2833 C  CB    . TRP C 65  ? 0.9417 0.7223 0.6081 0.0993  -0.1122 -0.1337 63   TRP C CB    
2834 C  CG    . TRP C 65  ? 0.9429 0.7457 0.6428 0.0917  -0.1022 -0.1259 63   TRP C CG    
2835 C  CD1   . TRP C 65  ? 0.7512 0.5574 0.4545 0.0963  -0.0899 -0.1214 63   TRP C CD1   
2836 C  CD2   . TRP C 65  ? 0.7327 0.5564 0.4661 0.0789  -0.1041 -0.1221 63   TRP C CD2   
2837 N  NE1   . TRP C 65  ? 0.7822 0.6096 0.5183 0.0869  -0.0847 -0.1155 63   TRP C NE1   
2838 C  CE2   . TRP C 65  ? 0.7100 0.5478 0.4645 0.0765  -0.0930 -0.1159 63   TRP C CE2   
2839 C  CE3   . TRP C 65  ? 0.7647 0.5965 0.5115 0.0697  -0.1142 -0.1232 63   TRP C CE3   
2840 C  CZ2   . TRP C 65  ? 0.6239 0.4821 0.4109 0.0659  -0.0918 -0.1114 63   TRP C CZ2   
2841 C  CZ3   . TRP C 65  ? 0.7735 0.6265 0.5534 0.0594  -0.1123 -0.1181 63   TRP C CZ3   
2842 C  CH2   . TRP C 65  ? 0.7917 0.6568 0.5906 0.0579  -0.1012 -0.1126 63   TRP C CH2   
2843 N  N     . ASP C 66  ? 1.2417 1.0206 0.8706 0.1133  -0.1315 -0.1375 64   ASP C N     
2844 C  CA    . ASP C 66  ? 1.4113 1.1744 1.0148 0.1170  -0.1451 -0.1452 64   ASP C CA    
2845 C  C     . ASP C 66  ? 1.5363 1.2913 1.1536 0.0988  -0.1600 -0.1530 64   ASP C C     
2846 O  O     . ASP C 66  ? 1.4658 1.2418 1.1152 0.0865  -0.1613 -0.1484 64   ASP C O     
2847 C  CB    . ASP C 66  ? 1.4140 1.1979 1.0188 0.1249  -0.1438 -0.1377 64   ASP C CB    
2848 C  CG    . ASP C 66  ? 1.3372 1.1050 0.9075 0.1355  -0.1544 -0.1443 64   ASP C CG    
2849 O  OD1   . ASP C 66  ? 1.4004 1.1393 0.9454 0.1358  -0.1642 -0.1556 64   ASP C OD1   
2850 O  OD2   . ASP C 66  ? 1.2616 1.0451 0.8295 0.1437  -0.1531 -0.1381 64   ASP C OD2   
2851 N  N     . THR C 67  ? 1.7686 1.4933 1.3625 0.0970  -0.1712 -0.1642 65   THR C N     
2852 C  CA    . THR C 67  ? 1.7385 1.4566 1.3464 0.0793  -0.1865 -0.1706 65   THR C CA    
2853 C  C     . THR C 67  ? 1.6599 1.3763 1.2556 0.0797  -0.2012 -0.1748 65   THR C C     
2854 O  O     . THR C 67  ? 1.6931 1.4021 1.2588 0.0950  -0.2021 -0.1766 65   THR C O     
2855 C  CB    . THR C 67  ? 1.8695 1.5561 1.4631 0.0735  -0.1941 -0.1804 65   THR C CB    
2856 O  OG1   . THR C 67  ? 1.9434 1.6315 1.5611 0.0539  -0.2064 -0.1829 65   THR C OG1   
2857 C  CG2   . THR C 67  ? 2.0147 1.6707 1.5655 0.0843  -0.2050 -0.1905 65   THR C CG2   
2858 N  N     . ALA C 68  ? 1.5508 1.2743 1.1698 0.0629  -0.2128 -0.1762 66   ALA C N     
2859 C  CA    . ALA C 68  ? 1.5440 1.2645 1.1541 0.0599  -0.2294 -0.1811 66   ALA C CA    
2860 C  C     . ALA C 68  ? 1.7040 1.3952 1.3022 0.0496  -0.2455 -0.1920 66   ALA C C     
2861 O  O     . ALA C 68  ? 1.4651 1.1578 1.0887 0.0327  -0.2503 -0.1920 66   ALA C O     
2862 C  CB    . ALA C 68  ? 1.4398 1.1915 1.0860 0.0489  -0.2308 -0.1733 66   ALA C CB    
2863 N  N     . GLY C 69  ? 1.9042 1.5751 1.4726 0.0593  -0.2490 -0.1966 67   GLY C N     
2864 C  CA    . GLY C 69  ? 2.0168 1.6626 1.5775 0.0515  -0.2585 -0.2027 67   GLY C CA    
2865 C  C     . GLY C 69  ? 2.1072 1.7538 1.6730 0.0414  -0.2750 -0.2054 67   GLY C C     
2866 O  O     . GLY C 69  ? 2.2972 1.9291 1.8383 0.0490  -0.2820 -0.2099 67   GLY C O     
2867 N  N     . GLN C 70  ? 1.8985 1.5631 1.4977 0.0241  -0.2811 -0.2022 68   GLN C N     
2868 C  CA    . GLN C 70  ? 1.9008 1.5754 1.5140 0.0124  -0.2957 -0.2022 68   GLN C CA    
2869 C  C     . GLN C 70  ? 2.2252 1.9026 1.8700 -0.0084 -0.3013 -0.2005 68   GLN C C     
2870 O  O     . GLN C 70  ? 2.0351 1.7281 1.7047 -0.0146 -0.2939 -0.1953 68   GLN C O     
2871 C  CB    . GLN C 70  ? 1.7744 1.4785 1.4004 0.0154  -0.2944 -0.1965 68   GLN C CB    
2872 C  CG    . GLN C 70  ? 1.7607 1.4667 1.3593 0.0337  -0.2924 -0.1969 68   GLN C CG    
2873 C  CD    . GLN C 70  ? 1.7057 1.4255 1.3110 0.0289  -0.3049 -0.1960 68   GLN C CD    
2874 O  OE1   . GLN C 70  ? 1.7017 1.4166 1.3173 0.0151  -0.3174 -0.1985 68   GLN C OE1   
2875 N  NE2   . GLN C 70  ? 1.7153 1.4546 1.3178 0.0394  -0.3015 -0.1914 68   GLN C NE2   
2876 N  N     . GLU C 71  ? 2.7198 2.3833 2.3645 -0.0189 -0.3143 -0.2041 69   GLU C N     
2877 C  CA    . GLU C 71  ? 2.8091 2.4673 2.4767 -0.0359 -0.3176 -0.2028 69   GLU C CA    
2878 C  C     . GLU C 71  ? 2.8148 2.5018 2.5222 -0.0485 -0.3141 -0.1945 69   GLU C C     
2879 O  O     . GLU C 71  ? 2.9169 2.6029 2.6403 -0.0552 -0.3076 -0.1919 69   GLU C O     
2880 C  CB    . GLU C 71  ? 2.8130 2.4569 2.4785 -0.0465 -0.3338 -0.2067 69   GLU C CB    
2881 C  CG    . GLU C 71  ? 2.8324 2.4644 2.5151 -0.0618 -0.3369 -0.2058 69   GLU C CG    
2882 C  CD    . GLU C 71  ? 2.8319 2.4552 2.5138 -0.0577 -0.3228 -0.2049 69   GLU C CD    
2883 O  OE1   . GLU C 71  ? 2.7813 2.4220 2.4931 -0.0672 -0.3169 -0.1984 69   GLU C OE1   
2884 O  OE2   . GLU C 71  ? 2.8759 2.4759 2.5274 -0.0443 -0.3174 -0.2103 69   GLU C OE2   
2885 N  N     . ARG C 72  ? 2.6101 2.3232 2.3325 -0.0498 -0.3172 -0.1901 70   ARG C N     
2886 C  CA    . ARG C 72  ? 2.3440 2.0857 2.1044 -0.0606 -0.3140 -0.1817 70   ARG C CA    
2887 C  C     . ARG C 72  ? 2.3889 2.1324 2.1574 -0.0578 -0.2998 -0.1793 70   ARG C C     
2888 O  O     . ARG C 72  ? 2.4500 2.2032 2.2472 -0.0700 -0.2979 -0.1742 70   ARG C O     
2889 C  CB    . ARG C 72  ? 2.1300 1.8979 1.8980 -0.0560 -0.3152 -0.1775 70   ARG C CB    
2890 C  CG    . ARG C 72  ? 2.1135 1.8754 1.8561 -0.0473 -0.3235 -0.1819 70   ARG C CG    
2891 C  CD    . ARG C 72  ? 2.0743 1.8645 1.8285 -0.0437 -0.3241 -0.1763 70   ARG C CD    
2892 N  NE    . ARG C 72  ? 2.0914 1.9050 1.8825 -0.0598 -0.3305 -0.1693 70   ARG C NE    
2893 C  CZ    . ARG C 72  ? 2.1130 1.9507 1.9174 -0.0606 -0.3353 -0.1642 70   ARG C CZ    
2894 N  NH1   . ARG C 72  ? 2.1355 1.9760 1.9187 -0.0465 -0.3351 -0.1657 70   ARG C NH1   
2895 N  NH2   . ARG C 72  ? 2.1024 1.9618 1.9409 -0.0747 -0.3402 -0.1570 70   ARG C NH2   
2896 N  N     . PHE C 73  ? 2.2110 1.9452 1.9543 -0.0415 -0.2897 -0.1826 71   PHE C N     
2897 C  CA    . PHE C 73  ? 2.0189 1.7608 1.7712 -0.0368 -0.2747 -0.1790 71   PHE C CA    
2898 C  C     . PHE C 73  ? 2.2412 1.9607 1.9874 -0.0390 -0.2699 -0.1823 71   PHE C C     
2899 O  O     . PHE C 73  ? 2.0671 1.7968 1.8259 -0.0357 -0.2536 -0.1766 71   PHE C O     
2900 C  CB    . PHE C 73  ? 1.8477 1.5959 1.5806 -0.0178 -0.2620 -0.1774 71   PHE C CB    
2901 C  CG    . PHE C 73  ? 1.8081 1.5798 1.5480 -0.0143 -0.2642 -0.1727 71   PHE C CG    
2902 C  CD1   . PHE C 73  ? 1.8450 1.6112 1.5553 0.0009  -0.2650 -0.1757 71   PHE C CD1   
2903 C  CD2   . PHE C 73  ? 1.7716 1.5711 1.5474 -0.0254 -0.2651 -0.1649 71   PHE C CD2   
2904 C  CE1   . PHE C 73  ? 1.8361 1.6239 1.5529 0.0043  -0.2668 -0.1709 71   PHE C CE1   
2905 C  CE2   . PHE C 73  ? 1.7596 1.5802 1.5416 -0.0219 -0.2670 -0.1604 71   PHE C CE2   
2906 C  CZ    . PHE C 73  ? 1.8017 1.6165 1.5546 -0.0073 -0.2679 -0.1633 71   PHE C CZ    
2907 N  N     . HIS C 74  ? 2.6812 2.3777 2.4154 -0.0436 -0.2771 -0.1866 72   HIS C N     
2908 C  CA    . HIS C 74  ? 2.7954 2.4681 2.5163 -0.0409 -0.2705 -0.1896 72   HIS C CA    
2909 C  C     . HIS C 74  ? 2.5841 2.2643 2.3337 -0.0522 -0.2646 -0.1847 72   HIS C C     
2910 O  O     . HIS C 74  ? 2.5113 2.1759 2.2516 -0.0480 -0.2560 -0.1862 72   HIS C O     
2911 C  CB    . HIS C 74  ? 3.1083 2.7548 2.8107 -0.0436 -0.2812 -0.1953 72   HIS C CB    
2912 C  CG    . HIS C 74  ? 3.2892 2.9243 2.9581 -0.0293 -0.2848 -0.2008 72   HIS C CG    
2913 N  ND1   . HIS C 74  ? 3.3578 2.9636 2.9962 -0.0216 -0.2878 -0.2073 72   HIS C ND1   
2914 C  CD2   . HIS C 74  ? 3.3220 2.9715 2.9824 -0.0195 -0.2847 -0.2003 72   HIS C CD2   
2915 C  CE1   . HIS C 74  ? 3.3705 2.9735 2.9836 -0.0082 -0.2899 -0.2105 72   HIS C CE1   
2916 N  NE2   . HIS C 74  ? 3.3498 2.9793 2.9757 -0.0067 -0.2878 -0.2062 72   HIS C NE2   
2917 N  N     . THR C 75  ? 2.3983 2.1023 2.1823 -0.0657 -0.2687 -0.1783 73   THR C N     
2918 C  CA    . THR C 75  ? 2.1099 1.8290 1.9234 -0.0727 -0.2588 -0.1712 73   THR C CA    
2919 C  C     . THR C 75  ? 1.9664 1.7007 1.7797 -0.0586 -0.2385 -0.1666 73   THR C C     
2920 O  O     . THR C 75  ? 2.1439 1.8658 1.9464 -0.0520 -0.2277 -0.1676 73   THR C O     
2921 C  CB    . THR C 75  ? 2.0464 1.7941 1.8976 -0.0867 -0.2642 -0.1629 73   THR C CB    
2922 O  OG1   . THR C 75  ? 2.0152 1.7890 1.8734 -0.0794 -0.2587 -0.1585 73   THR C OG1   
2923 C  CG2   . THR C 75  ? 2.0401 1.7791 1.8926 -0.0986 -0.2816 -0.1649 73   THR C CG2   
2924 N  N     . ILE C 76  ? 1.7094 1.4696 1.5327 -0.0534 -0.2335 -0.1615 74   ILE C N     
2925 C  CA    . ILE C 76  ? 1.5600 1.3411 1.3960 -0.0452 -0.2149 -0.1543 74   ILE C CA    
2926 C  C     . ILE C 76  ? 1.5735 1.3409 1.3804 -0.0289 -0.2044 -0.1576 74   ILE C C     
2927 O  O     . ILE C 76  ? 1.5879 1.3626 1.4017 -0.0238 -0.1897 -0.1533 74   ILE C O     
2928 C  CB    . ILE C 76  ? 1.4866 1.2983 1.3428 -0.0448 -0.2130 -0.1475 74   ILE C CB    
2929 C  CG1   . ILE C 76  ? 1.4216 1.2307 1.2538 -0.0339 -0.2175 -0.1509 74   ILE C CG1   
2930 C  CG2   . ILE C 76  ? 1.4788 1.3056 1.3642 -0.0602 -0.2231 -0.1433 74   ILE C CG2   
2931 C  CD1   . ILE C 76  ? 1.4149 1.2531 1.2642 -0.0300 -0.2114 -0.1433 74   ILE C CD1   
2932 N  N     . THR C 77  ? 1.6223 1.3699 1.3962 -0.0199 -0.2116 -0.1649 75   THR C N     
2933 C  CA    . THR C 77  ? 1.6338 1.3696 1.3800 -0.0034 -0.2010 -0.1669 75   THR C CA    
2934 C  C     . THR C 77  ? 1.7064 1.4224 1.4449 -0.0030 -0.1949 -0.1694 75   THR C C     
2935 O  O     . THR C 77  ? 1.5756 1.2912 1.3037 0.0089  -0.1812 -0.1673 75   THR C O     
2936 C  CB    . THR C 77  ? 1.6380 1.3551 1.3481 0.0072  -0.2102 -0.1744 75   THR C CB    
2937 O  OG1   . THR C 77  ? 1.6745 1.3576 1.3611 0.0046  -0.2214 -0.1840 75   THR C OG1   
2938 C  CG2   . THR C 77  ? 1.5468 1.2784 1.2640 0.0033  -0.2212 -0.1736 75   THR C CG2   
2939 N  N     . THR C 78  ? 1.9210 1.6215 1.6659 -0.0161 -0.2046 -0.1729 76   THR C N     
2940 C  CA    . THR C 78  ? 1.8871 1.5708 1.6282 -0.0164 -0.1979 -0.1739 76   THR C CA    
2941 C  C     . THR C 78  ? 1.8357 1.5424 1.5975 -0.0127 -0.1796 -0.1653 76   THR C C     
2942 O  O     . THR C 78  ? 1.9055 1.6025 1.6545 -0.0038 -0.1689 -0.1654 76   THR C O     
2943 C  CB    . THR C 78  ? 1.9049 1.5767 1.6608 -0.0334 -0.2089 -0.1754 76   THR C CB    
2944 O  OG1   . THR C 78  ? 1.9177 1.6185 1.7133 -0.0449 -0.2050 -0.1664 76   THR C OG1   
2945 C  CG2   . THR C 78  ? 1.9097 1.5603 1.6499 -0.0401 -0.2293 -0.1835 76   THR C CG2   
2946 N  N     . SER C 79  ? 1.7089 1.4459 1.5016 -0.0189 -0.1763 -0.1578 77   SER C N     
2947 C  CA    . SER C 79  ? 1.4460 1.2057 1.2601 -0.0164 -0.1606 -0.1499 77   SER C CA    
2948 C  C     . SER C 79  ? 1.4245 1.1806 1.2186 -0.0006 -0.1476 -0.1495 77   SER C C     
2949 O  O     . SER C 79  ? 1.6562 1.4130 1.4550 0.0018  -0.1366 -0.1467 77   SER C O     
2950 C  CB    . SER C 79  ? 1.4318 1.2221 1.2716 -0.0200 -0.1597 -0.1434 77   SER C CB    
2951 O  OG    . SER C 79  ? 1.5565 1.3675 1.4188 -0.0194 -0.1465 -0.1362 77   SER C OG    
2952 N  N     . TYR C 80  ? 1.2710 1.0232 1.0421 0.0107  -0.1489 -0.1518 78   TYR C N     
2953 C  CA    . TYR C 80  ? 1.1940 0.9506 0.9518 0.0257  -0.1355 -0.1485 78   TYR C CA    
2954 C  C     . TYR C 80  ? 1.2029 0.9321 0.9296 0.0357  -0.1328 -0.1538 78   TYR C C     
2955 O  O     . TYR C 80  ? 1.2569 0.9871 0.9671 0.0499  -0.1232 -0.1515 78   TYR C O     
2956 C  CB    . TYR C 80  ? 1.1333 0.9025 0.8836 0.0343  -0.1362 -0.1463 78   TYR C CB    
2957 C  CG    . TYR C 80  ? 1.0879 0.8853 0.8688 0.0264  -0.1368 -0.1401 78   TYR C CG    
2958 C  CD1   . TYR C 80  ? 1.1785 0.9786 0.9732 0.0140  -0.1492 -0.1421 78   TYR C CD1   
2959 C  CD2   . TYR C 80  ? 0.9193 0.7401 0.7154 0.0314  -0.1253 -0.1320 78   TYR C CD2   
2960 C  CE1   . TYR C 80  ? 1.1827 1.0082 1.0046 0.0079  -0.1493 -0.1361 78   TYR C CE1   
2961 C  CE2   . TYR C 80  ? 0.8912 0.7355 0.7138 0.0249  -0.1260 -0.1267 78   TYR C CE2   
2962 C  CZ    . TYR C 80  ? 1.0824 0.9290 0.9174 0.0137  -0.1376 -0.1288 78   TYR C CZ    
2963 O  OH    . TYR C 80  ? 1.0779 0.9476 0.9383 0.0083  -0.1379 -0.1232 78   TYR C OH    
2964 N  N     . TYR C 81  ? 1.2467 0.9518 0.9660 0.0285  -0.1406 -0.1600 79   TYR C N     
2965 C  CA    . TYR C 81  ? 1.4587 1.1342 1.1461 0.0382  -0.1394 -0.1658 79   TYR C CA    
2966 C  C     . TYR C 81  ? 1.4061 1.0843 1.0988 0.0426  -0.1247 -0.1613 79   TYR C C     
2967 O  O     . TYR C 81  ? 1.3263 0.9925 0.9944 0.0567  -0.1171 -0.1620 79   TYR C O     
2968 C  CB    . TYR C 81  ? 1.7408 1.3874 1.4181 0.0282  -0.1546 -0.1743 79   TYR C CB    
2969 C  CG    . TYR C 81  ? 1.9408 1.5759 1.6017 0.0269  -0.1706 -0.1811 79   TYR C CG    
2970 C  CD1   . TYR C 81  ? 2.0331 1.6394 1.6814 0.0185  -0.1863 -0.1896 79   TYR C CD1   
2971 C  CD2   . TYR C 81  ? 1.9311 1.5836 1.5894 0.0339  -0.1707 -0.1789 79   TYR C CD2   
2972 C  CE1   . TYR C 81  ? 1.9976 1.5973 1.6343 0.0169  -0.2001 -0.1941 79   TYR C CE1   
2973 C  CE2   . TYR C 81  ? 1.9507 1.5933 1.5936 0.0331  -0.1856 -0.1851 79   TYR C CE2   
2974 C  CZ    . TYR C 81  ? 1.9557 1.5708 1.5866 0.0247  -0.2010 -0.1935 79   TYR C CZ    
2975 O  OH    . TYR C 81  ? 1.9290 1.5402 1.5499 0.0237  -0.2133 -0.1966 79   TYR C OH    
2976 N  N     . ARG C 82  ? 1.4665 1.1604 1.1903 0.0314  -0.1206 -0.1562 80   ARG C N     
2977 C  CA    . ARG C 82  ? 1.4204 1.1157 1.1495 0.0346  -0.1078 -0.1523 80   ARG C CA    
2978 C  C     . ARG C 82  ? 1.2282 0.9392 0.9520 0.0489  -0.0939 -0.1466 80   ARG C C     
2979 O  O     . ARG C 82  ? 1.2730 0.9741 0.9809 0.0591  -0.0851 -0.1461 80   ARG C O     
2980 C  CB    . ARG C 82  ? 1.3698 1.0829 1.1343 0.0209  -0.1058 -0.1472 80   ARG C CB    
2981 N  N     . GLY C 83  ? 0.9224 0.6580 0.6593 0.0500  -0.0922 -0.1418 81   GLY C N     
2982 C  CA    . GLY C 83  ? 1.0587 0.8113 0.7941 0.0620  -0.0799 -0.1352 81   GLY C CA    
2983 C  C     . GLY C 83  ? 1.1585 0.8972 0.8603 0.0782  -0.0777 -0.1369 81   GLY C C     
2984 O  O     . GLY C 83  ? 1.0169 0.7667 0.7149 0.0893  -0.0663 -0.1307 81   GLY C O     
2985 N  N     . ALA C 84  ? 1.3975 1.1125 1.0746 0.0801  -0.0885 -0.1448 82   ALA C N     
2986 C  CA    . ALA C 84  ? 1.3692 1.0704 1.0118 0.0969  -0.0871 -0.1467 82   ALA C CA    
2987 C  C     . ALA C 84  ? 1.3912 1.0814 1.0168 0.1088  -0.0758 -0.1451 82   ALA C C     
2988 O  O     . ALA C 84  ? 1.4654 1.1359 1.0859 0.1051  -0.0769 -0.1496 82   ALA C O     
2989 C  CB    . ALA C 84  ? 1.3928 1.0663 1.0106 0.0958  -0.1022 -0.1571 82   ALA C CB    
2990 N  N     . MET C 85  ? 1.3160 1.0203 0.9341 0.1232  -0.0648 -0.1379 83   MET C N     
2991 C  CA    . MET C 85  ? 1.2845 0.9794 0.8825 0.1375  -0.0539 -0.1355 83   MET C CA    
2992 C  C     . MET C 85  ? 1.6288 1.2968 1.1852 0.1528  -0.0576 -0.1416 83   MET C C     
2993 O  O     . MET C 85  ? 1.6110 1.2518 1.1447 0.1580  -0.0580 -0.1474 83   MET C O     
2994 C  CB    . MET C 85  ? 1.0666 0.7914 0.6782 0.1456  -0.0401 -0.1234 83   MET C CB    
2995 C  CG    . MET C 85  ? 1.0223 0.7726 0.6720 0.1330  -0.0354 -0.1173 83   MET C CG    
2996 S  SD    . MET C 85  ? 1.0479 0.8325 0.7124 0.1417  -0.0226 -0.1034 83   MET C SD    
2997 C  CE    . MET C 85  ? 1.0567 0.8308 0.6945 0.1601  -0.0107 -0.0998 83   MET C CE    
2998 N  N     . GLY C 86  ? 1.8008 1.4758 1.3461 0.1607  -0.0602 -0.1401 84   GLY C N     
2999 C  CA    . GLY C 86  ? 1.7982 1.4488 1.3030 0.1758  -0.0649 -0.1462 84   GLY C CA    
3000 C  C     . GLY C 86  ? 1.7274 1.3708 1.2278 0.1688  -0.0803 -0.1534 84   GLY C C     
3001 O  O     . GLY C 86  ? 1.5890 1.2545 1.1169 0.1571  -0.0839 -0.1502 84   GLY C O     
3002 N  N     . ILE C 87  ? 1.7309 1.3516 1.2093 0.1729  -0.0880 -0.1580 85   ILE C N     
3003 C  CA    . ILE C 87  ? 1.6197 1.2307 1.0935 0.1653  -0.1039 -0.1654 85   ILE C CA    
3004 C  C     . ILE C 87  ? 1.8181 1.4198 1.2629 0.1818  -0.1049 -0.1645 85   ILE C C     
3005 O  O     . ILE C 87  ? 1.8842 1.4752 1.3107 0.1952  -0.0976 -0.1614 85   ILE C O     
3006 C  CB    . ILE C 87  ? 1.3750 0.9633 0.8547 0.1486  -0.1163 -0.1740 85   ILE C CB    
3007 C  CG1   . ILE C 87  ? 1.2673 0.8671 0.7782 0.1314  -0.1170 -0.1747 85   ILE C CG1   
3008 C  CG2   . ILE C 87  ? 1.3018 0.8774 0.7721 0.1434  -0.1327 -0.1810 85   ILE C CG2   
3009 C  CD1   . ILE C 87  ? 1.3631 0.9466 0.8850 0.1131  -0.1310 -0.1818 85   ILE C CD1   
3010 N  N     . MET C 88  ? 1.8240 1.4302 1.2648 0.1814  -0.1142 -0.1668 86   MET C N     
3011 C  CA    . MET C 88  ? 1.5577 1.1487 0.9706 0.1938  -0.1196 -0.1688 86   MET C CA    
3012 C  C     . MET C 88  ? 1.6519 1.2325 1.0660 0.1810  -0.1377 -0.1777 86   MET C C     
3013 O  O     . MET C 88  ? 1.3938 0.9901 0.8279 0.1690  -0.1435 -0.1786 86   MET C O     
3014 C  CB    . MET C 88  ? 1.3303 0.9405 0.7326 0.2123  -0.1098 -0.1598 86   MET C CB    
3015 C  CG    . MET C 88  ? 1.4174 1.0418 0.8218 0.2245  -0.0918 -0.1492 86   MET C CG    
3016 S  SD    . MET C 88  ? 1.3889 1.0411 0.7890 0.2409  -0.0837 -0.1383 86   MET C SD    
3017 C  CE    . MET C 88  ? 1.3616 1.0328 0.7899 0.2219  -0.0908 -0.1412 86   MET C CE    
3018 N  N     . LEU C 89  ? 2.0875 1.6413 1.4802 0.1836  -0.1467 -0.1840 87   LEU C N     
3019 C  CA    . LEU C 89  ? 2.2693 1.8089 1.6607 0.1716  -0.1647 -0.1928 87   LEU C CA    
3020 C  C     . LEU C 89  ? 2.4257 1.9626 1.7929 0.1860  -0.1692 -0.1933 87   LEU C C     
3021 O  O     . LEU C 89  ? 2.4450 1.9756 1.7882 0.2054  -0.1612 -0.1898 87   LEU C O     
3022 C  CB    . LEU C 89  ? 2.2978 1.8079 1.6835 0.1628  -0.1729 -0.1998 87   LEU C CB    
3023 C  CG    . LEU C 89  ? 2.2384 1.7509 1.6500 0.1470  -0.1698 -0.1994 87   LEU C CG    
3024 C  CD1   . LEU C 89  ? 2.1449 1.6849 1.5868 0.1343  -0.1703 -0.1969 87   LEU C CD1   
3025 C  CD2   . LEU C 89  ? 2.2304 1.7422 1.6363 0.1583  -0.1537 -0.1938 87   LEU C CD2   
3026 N  N     . VAL C 90  ? 2.4552 1.9981 1.8296 0.1767  -0.1817 -0.1971 88   VAL C N     
3027 C  CA    . VAL C 90  ? 2.5464 2.0949 1.9031 0.1899  -0.1844 -0.1960 88   VAL C CA    
3028 C  C     . VAL C 90  ? 2.6795 2.1983 2.0095 0.1944  -0.1966 -0.2040 88   VAL C C     
3029 O  O     . VAL C 90  ? 2.5392 2.0425 1.8743 0.1789  -0.2112 -0.2118 88   VAL C O     
3030 C  CB    . VAL C 90  ? 2.5636 2.1358 1.9413 0.1792  -0.1908 -0.1950 88   VAL C CB    
3031 C  CG1   . VAL C 90  ? 2.6078 2.1704 1.9994 0.1586  -0.2077 -0.2029 88   VAL C CG1   
3032 C  CG2   . VAL C 90  ? 2.5594 2.1461 1.9234 0.1948  -0.1885 -0.1904 88   VAL C CG2   
3033 N  N     . TYR C 91  ? 2.9009 2.4115 2.2024 0.2161  -0.1904 -0.2015 89   TYR C N     
3034 C  CA    . TYR C 91  ? 2.8366 2.3217 2.1105 0.2230  -0.2023 -0.2088 89   TYR C CA    
3035 C  C     . TYR C 91  ? 2.6223 2.1171 1.8769 0.2424  -0.1995 -0.2049 89   TYR C C     
3036 O  O     . TYR C 91  ? 2.4924 1.9996 1.7391 0.2602  -0.1846 -0.1960 89   TYR C O     
3037 C  CB    . TYR C 91  ? 2.9700 2.4251 2.2226 0.2303  -0.2013 -0.2121 89   TYR C CB    
3038 C  CG    . TYR C 91  ? 3.1934 2.6248 2.4190 0.2370  -0.2143 -0.2195 89   TYR C CG    
3039 C  CD1   . TYR C 91  ? 3.2923 2.7199 2.5264 0.2211  -0.2308 -0.2268 89   TYR C CD1   
3040 C  CD2   . TYR C 91  ? 3.3314 2.7426 2.5244 0.2574  -0.2116 -0.2198 89   TYR C CD2   
3041 C  CE1   . TYR C 91  ? 3.4604 2.8652 2.6709 0.2248  -0.2454 -0.2348 89   TYR C CE1   
3042 C  CE2   . TYR C 91  ? 3.4909 2.8793 2.6599 0.2622  -0.2249 -0.2275 89   TYR C CE2   
3043 C  CZ    . TYR C 91  ? 3.5762 2.9607 2.7537 0.2457  -0.2419 -0.2353 89   TYR C CZ    
3044 O  OH    . TYR C 91  ? 3.6529 3.0150 2.8071 0.2491  -0.2571 -0.2437 89   TYR C OH    
3045 N  N     . ASP C 92  ? 2.4546 1.9461 1.7040 0.2382  -0.2136 -0.2107 90   ASP C N     
3046 C  CA    . ASP C 92  ? 2.3337 1.8290 1.5607 0.2573  -0.2130 -0.2084 90   ASP C CA    
3047 C  C     . ASP C 92  ? 2.2058 1.6676 1.3993 0.2681  -0.2221 -0.2161 90   ASP C C     
3048 O  O     . ASP C 92  ? 2.2515 1.6911 1.4426 0.2548  -0.2376 -0.2259 90   ASP C O     
3049 C  CB    . ASP C 92  ? 2.2196 1.7338 1.4589 0.2493  -0.2219 -0.2091 90   ASP C CB    
3050 C  CG    . ASP C 92  ? 2.1395 1.6596 1.3565 0.2699  -0.2195 -0.2056 90   ASP C CG    
3051 O  OD1   . ASP C 92  ? 2.1477 1.6634 1.3446 0.2908  -0.2078 -0.2003 90   ASP C OD1   
3052 O  OD2   . ASP C 92  ? 2.0856 1.6165 1.3068 0.2655  -0.2285 -0.2072 90   ASP C OD2   
3053 N  N     . ILE C 93  ? 2.0249 1.4840 1.1931 0.2928  -0.2125 -0.2111 91   ILE C N     
3054 C  CA    . ILE C 93  ? 1.9439 1.3715 1.0769 0.3072  -0.2196 -0.2174 91   ILE C CA    
3055 C  C     . ILE C 93  ? 1.9500 1.3644 1.0731 0.3004  -0.2391 -0.2275 91   ILE C C     
3056 O  O     . ILE C 93  ? 1.8574 1.2405 0.9627 0.2975  -0.2523 -0.2372 91   ILE C O     
3057 C  CB    . ILE C 93  ? 1.7593 1.1942 0.8708 0.3357  -0.2051 -0.2082 91   ILE C CB    
3058 C  CG1   . ILE C 93  ? 1.7423 1.2086 0.8626 0.3421  -0.2000 -0.2008 91   ILE C CG1   
3059 C  CG2   . ILE C 93  ? 1.6096 1.0547 0.7300 0.3419  -0.1870 -0.1984 91   ILE C CG2   
3060 C  CD1   . ILE C 93  ? 1.8257 1.2922 0.9189 0.3695  -0.1932 -0.1955 91   ILE C CD1   
3061 N  N     . THR C 94  ? 1.9568 1.3948 1.0915 0.2974  -0.2415 -0.2252 92   THR C N     
3062 C  CA    . THR C 94  ? 1.9079 1.3367 1.0336 0.2921  -0.2593 -0.2338 92   THR C CA    
3063 C  C     . THR C 94  ? 2.0036 1.4319 1.1549 0.2638  -0.2741 -0.2406 92   THR C C     
3064 O  O     . THR C 94  ? 1.6082 1.0291 0.7548 0.2570  -0.2900 -0.2477 92   THR C O     
3065 C  CB    . THR C 94  ? 1.8766 1.3315 1.0018 0.3031  -0.2555 -0.2277 92   THR C CB    
3066 O  OG1   . THR C 94  ? 1.9312 1.4148 1.0903 0.2852  -0.2555 -0.2239 92   THR C OG1   
3067 C  CG2   . THR C 94  ? 1.8523 1.3201 0.9658 0.3276  -0.2364 -0.2166 92   THR C CG2   
3068 N  N     . ASN C 95  ? 2.5060 1.9434 1.6851 0.2475  -0.2692 -0.2380 93   ASN C N     
3069 C  CA    . ASN C 95  ? 2.4834 1.9256 1.6904 0.2211  -0.2820 -0.2425 93   ASN C CA    
3070 C  C     . ASN C 95  ? 2.4824 1.8921 1.6830 0.2090  -0.2961 -0.2522 93   ASN C C     
3071 O  O     . ASN C 95  ? 2.4302 1.8170 1.6141 0.2166  -0.2922 -0.2539 93   ASN C O     
3072 C  CB    . ASN C 95  ? 2.4012 1.8694 1.6426 0.2085  -0.2714 -0.2353 93   ASN C CB    
3073 C  CG    . ASN C 95  ? 2.3112 1.8135 1.5679 0.2104  -0.2658 -0.2279 93   ASN C CG    
3074 O  OD1   . ASN C 95  ? 2.4374 1.9486 1.6770 0.2296  -0.2587 -0.2232 93   ASN C OD1   
3075 N  ND2   . ASN C 95  ? 2.1230 1.6443 1.4119 0.1906  -0.2698 -0.2266 93   ASN C ND2   
3076 N  N     . GLY C 96  ? 2.3531 1.7618 1.5677 0.1902  -0.3128 -0.2579 94   GLY C N     
3077 C  CA    . GLY C 96  ? 2.3163 1.6939 1.5219 0.1799  -0.3288 -0.2673 94   GLY C CA    
3078 C  C     . GLY C 96  ? 2.3682 1.7468 1.6057 0.1545  -0.3341 -0.2680 94   GLY C C     
3079 O  O     . GLY C 96  ? 2.2147 1.6177 1.4830 0.1382  -0.3370 -0.2650 94   GLY C O     
3080 N  N     . LYS C 97  ? 2.5094 1.8625 1.7407 0.1510  -0.3352 -0.2714 95   LYS C N     
3081 C  CA    . LYS C 97  ? 2.5033 1.8552 1.7641 0.1269  -0.3414 -0.2721 95   LYS C CA    
3082 C  C     . LYS C 97  ? 2.6949 2.0799 1.9910 0.1171  -0.3293 -0.2636 95   LYS C C     
3083 O  O     . LYS C 97  ? 3.2447 2.6414 2.5716 0.0961  -0.3359 -0.2626 95   LYS C O     
3084 C  CB    . LYS C 97  ? 2.5148 1.8584 1.7819 0.1102  -0.3631 -0.2787 95   LYS C CB    
3085 C  CG    . LYS C 97  ? 2.5189 1.8652 1.8206 0.0821  -0.3743 -0.2790 95   LYS C CG    
3086 C  CD    . LYS C 97  ? 2.4250 1.8083 1.7650 0.0667  -0.3734 -0.2725 95   LYS C CD    
3087 C  CE    . LYS C 97  ? 2.3293 1.7175 1.7049 0.0411  -0.3810 -0.2707 95   LYS C CE    
3088 N  NZ    . LYS C 97  ? 2.2893 1.7139 1.7013 0.0274  -0.3804 -0.2640 95   LYS C NZ    
3089 N  N     . SER C 98  ? 2.5621 1.9639 1.8541 0.1326  -0.3120 -0.2570 96   SER C N     
3090 C  CA    . SER C 98  ? 2.4652 1.8906 1.7861 0.1253  -0.2987 -0.2496 96   SER C CA    
3091 C  C     . SER C 98  ? 2.4050 1.8125 1.7230 0.1257  -0.2910 -0.2495 96   SER C C     
3092 O  O     . SER C 98  ? 2.2849 1.7057 1.6268 0.1171  -0.2816 -0.2446 96   SER C O     
3093 C  CB    . SER C 98  ? 2.4080 1.8587 1.7263 0.1414  -0.2838 -0.2422 96   SER C CB    
3094 O  OG    . SER C 98  ? 2.4050 1.8467 1.7012 0.1610  -0.2695 -0.2392 96   SER C OG    
3095 N  N     . PHE C 99  ? 2.5449 1.9210 1.8333 0.1353  -0.2957 -0.2550 97   PHE C N     
3096 C  CA    . PHE C 99  ? 2.5445 1.9009 1.8284 0.1354  -0.2900 -0.2554 97   PHE C CA    
3097 C  C     . PHE C 99  ? 2.8188 2.1614 2.1214 0.1126  -0.3027 -0.2596 97   PHE C C     
3098 O  O     . PHE C 99  ? 2.4534 1.7906 1.7676 0.1059  -0.2966 -0.2576 97   PHE C O     
3099 C  CB    . PHE C 99  ? 2.4418 1.7724 1.6851 0.1580  -0.2875 -0.2582 97   PHE C CB    
3100 C  CG    . PHE C 99  ? 2.4329 1.7790 1.6652 0.1790  -0.2694 -0.2507 97   PHE C CG    
3101 C  CD1   . PHE C 99  ? 2.4366 1.7656 1.6426 0.1980  -0.2597 -0.2491 97   PHE C CD1   
3102 C  CD2   . PHE C 99  ? 2.4621 1.8411 1.7131 0.1787  -0.2617 -0.2444 97   PHE C CD2   
3103 C  CE1   . PHE C 99  ? 2.4486 1.7942 1.6470 0.2172  -0.2421 -0.2407 97   PHE C CE1   
3104 C  CE2   . PHE C 99  ? 2.4979 1.8936 1.7435 0.1958  -0.2447 -0.2364 97   PHE C CE2   
3105 C  CZ    . PHE C 99  ? 2.4712 1.8505 1.6899 0.2159  -0.2346 -0.2342 97   PHE C CZ    
3106 N  N     . GLU C 100 ? 3.3743 2.7113 2.6802 0.1009  -0.3203 -0.2649 98   GLU C N     
3107 C  CA    . GLU C 100 ? 3.4044 2.7342 2.7336 0.0775  -0.3329 -0.2672 98   GLU C CA    
3108 C  C     . GLU C 100 ? 3.3519 2.7039 2.7190 0.0620  -0.3240 -0.2603 98   GLU C C     
3109 O  O     . GLU C 100 ? 3.3628 2.7036 2.7447 0.0474  -0.3285 -0.2608 98   GLU C O     
3110 C  CB    . GLU C 100 ? 3.4236 2.7591 2.7596 0.0668  -0.3501 -0.2707 98   GLU C CB    
3111 C  CG    . GLU C 100 ? 3.3508 2.7236 2.7169 0.0582  -0.3470 -0.2647 98   GLU C CG    
3112 C  CD    . GLU C 100 ? 3.2729 2.6672 2.6305 0.0764  -0.3321 -0.2599 98   GLU C CD    
3113 O  OE1   . GLU C 100 ? 3.3076 2.6988 2.6508 0.0919  -0.3170 -0.2572 98   GLU C OE1   
3114 O  OE2   . GLU C 100 ? 3.2742 2.6899 2.6401 0.0752  -0.3355 -0.2583 98   GLU C OE2   
3115 N  N     . ASN C 101 ? 2.9493 2.3318 2.3322 0.0652  -0.3118 -0.2539 99   ASN C N     
3116 C  CA    . ASN C 101 ? 2.6150 2.0210 2.0343 0.0510  -0.3042 -0.2474 99   ASN C CA    
3117 C  C     . ASN C 101 ? 2.4509 1.8596 1.8683 0.0611  -0.2857 -0.2428 99   ASN C C     
3118 O  O     . ASN C 101 ? 2.4710 1.8983 1.9167 0.0512  -0.2781 -0.2375 99   ASN C O     
3119 C  CB    . ASN C 101 ? 2.5585 1.9983 2.0000 0.0461  -0.3037 -0.2430 99   ASN C CB    
3120 C  CG    . ASN C 101 ? 2.5017 1.9461 1.9566 0.0309  -0.3214 -0.2454 99   ASN C CG    
3121 O  OD1   . ASN C 101 ? 2.4616 1.8907 1.9236 0.0170  -0.3335 -0.2484 99   ASN C OD1   
3122 N  ND2   . ASN C 101 ? 2.4819 1.9485 1.9409 0.0338  -0.3229 -0.2436 99   ASN C ND2   
3123 N  N     . ILE C 102 ? 2.2837 1.6752 1.6691 0.0810  -0.2780 -0.2442 100  ILE C N     
3124 C  CA    . ILE C 102 ? 1.8925 1.2896 1.2761 0.0919  -0.2596 -0.2389 100  ILE C CA    
3125 C  C     . ILE C 102 ? 1.9556 1.3470 1.3597 0.0779  -0.2571 -0.2375 100  ILE C C     
3126 O  O     . ILE C 102 ? 1.7954 1.2064 1.2212 0.0741  -0.2455 -0.2317 100  ILE C O     
3127 C  CB    . ILE C 102 ? 1.5279 0.9054 0.8734 0.1152  -0.2531 -0.2402 100  ILE C CB    
3128 C  CG1   . ILE C 102 ? 1.4773 0.8659 0.8062 0.1299  -0.2529 -0.2396 100  ILE C CG1   
3129 C  CG2   . ILE C 102 ? 1.5373 0.9195 0.8817 0.1256  -0.2347 -0.2341 100  ILE C CG2   
3130 C  CD1   . ILE C 102 ? 1.4774 0.8993 0.8213 0.1352  -0.2395 -0.2319 100  ILE C CD1   
3131 N  N     . SER C 103 ? 2.2113 1.5755 1.6088 0.0699  -0.2682 -0.2426 101  SER C N     
3132 C  CA    . SER C 103 ? 2.2516 1.6098 1.6691 0.0560  -0.2667 -0.2409 101  SER C CA    
3133 C  C     . SER C 103 ? 2.2505 1.6366 1.7080 0.0376  -0.2669 -0.2361 101  SER C C     
3134 O  O     . SER C 103 ? 2.3038 1.7009 1.7806 0.0331  -0.2561 -0.2311 101  SER C O     
3135 C  CB    . SER C 103 ? 2.3237 1.6507 1.7320 0.0472  -0.2818 -0.2469 101  SER C CB    
3136 O  OG    . SER C 103 ? 2.3347 1.6595 1.7674 0.0313  -0.2812 -0.2443 101  SER C OG    
3137 N  N     . LYS C 104 ? 2.2080 1.6070 1.6778 0.0280  -0.2786 -0.2371 102  LYS C N     
3138 C  CA    . LYS C 104 ? 2.1680 1.5951 1.6758 0.0113  -0.2793 -0.2319 102  LYS C CA    
3139 C  C     . LYS C 104 ? 2.2132 1.6650 1.7319 0.0186  -0.2622 -0.2259 102  LYS C C     
3140 O  O     . LYS C 104 ? 2.1212 1.5829 1.6640 0.0094  -0.2555 -0.2214 102  LYS C O     
3141 C  CB    . LYS C 104 ? 2.1479 1.5868 1.6646 0.0027  -0.2935 -0.2334 102  LYS C CB    
3142 C  CG    . LYS C 104 ? 2.2078 1.6270 1.7256 -0.0110 -0.3114 -0.2377 102  LYS C CG    
3143 C  CD    . LYS C 104 ? 2.2103 1.6516 1.7599 -0.0294 -0.3225 -0.2345 102  LYS C CD    
3144 C  CE    . LYS C 104 ? 2.2598 1.6923 1.7960 -0.0307 -0.3391 -0.2399 102  LYS C CE    
3145 N  NZ    . LYS C 104 ? 2.2104 1.6725 1.7622 -0.0337 -0.3419 -0.2369 102  LYS C NZ    
3146 N  N     . TRP C 105 ? 2.3810 1.8414 1.8810 0.0360  -0.2545 -0.2254 103  TRP C N     
3147 C  CA    . TRP C 105 ? 2.3130 1.7961 1.8232 0.0428  -0.2385 -0.2195 103  TRP C CA    
3148 C  C     . TRP C 105 ? 2.2925 1.7663 1.8003 0.0475  -0.2258 -0.2173 103  TRP C C     
3149 O  O     . TRP C 105 ? 2.3313 1.8221 1.8600 0.0437  -0.2157 -0.2124 103  TRP C O     
3150 C  CB    . TRP C 105 ? 2.3287 1.8204 1.8172 0.0621  -0.2316 -0.2186 103  TRP C CB    
3151 C  CG    . TRP C 105 ? 2.3536 1.8626 1.8506 0.0582  -0.2393 -0.2184 103  TRP C CG    
3152 C  CD1   . TRP C 105 ? 2.3607 1.8914 1.8893 0.0422  -0.2445 -0.2158 103  TRP C CD1   
3153 C  CD2   . TRP C 105 ? 2.3489 1.8561 1.8227 0.0706  -0.2436 -0.2207 103  TRP C CD2   
3154 N  NE1   . TRP C 105 ? 2.3309 1.8741 1.8574 0.0439  -0.2518 -0.2162 103  TRP C NE1   
3155 C  CE2   . TRP C 105 ? 2.3610 1.8899 1.8537 0.0614  -0.2514 -0.2194 103  TRP C CE2   
3156 C  CE3   . TRP C 105 ? 2.3804 1.8704 1.8193 0.0894  -0.2415 -0.2232 103  TRP C CE3   
3157 C  CZ2   . TRP C 105 ? 2.3844 1.9180 1.8619 0.0701  -0.2568 -0.2207 103  TRP C CZ2   
3158 C  CZ3   . TRP C 105 ? 2.3996 1.8942 1.8235 0.0984  -0.2467 -0.2245 103  TRP C CZ3   
3159 C  CH2   . TRP C 105 ? 2.3667 1.8829 1.8095 0.0889  -0.2540 -0.2233 103  TRP C CH2   
3160 N  N     . LEU C 106 ? 2.2067 1.6535 1.6874 0.0573  -0.2258 -0.2208 104  LEU C N     
3161 C  CA    . LEU C 106 ? 1.9841 1.4225 1.4605 0.0636  -0.2130 -0.2182 104  LEU C CA    
3162 C  C     . LEU C 106 ? 2.0364 1.4707 1.5382 0.0451  -0.2162 -0.2174 104  LEU C C     
3163 O  O     . LEU C 106 ? 1.8761 1.3173 1.3900 0.0447  -0.2044 -0.2132 104  LEU C O     
3164 C  CB    . LEU C 106 ? 1.8304 1.2424 1.2703 0.0808  -0.2110 -0.2213 104  LEU C CB    
3165 C  CG    . LEU C 106 ? 1.8025 1.2213 1.2183 0.1019  -0.2034 -0.2196 104  LEU C CG    
3166 C  CD1   . LEU C 106 ? 1.8955 1.2971 1.2849 0.1193  -0.1936 -0.2184 104  LEU C CD1   
3167 C  CD2   . LEU C 106 ? 1.7169 1.1680 1.1492 0.1049  -0.1925 -0.2134 104  LEU C CD2   
3168 N  N     . ARG C 107 ? 2.2162 1.6433 1.7297 0.0288  -0.2320 -0.2205 105  ARG C N     
3169 C  CA    . ARG C 107 ? 2.2040 1.6353 1.7487 0.0096  -0.2349 -0.2176 105  ARG C CA    
3170 C  C     . ARG C 107 ? 2.1351 1.5974 1.7074 0.0054  -0.2251 -0.2115 105  ARG C C     
3171 O  O     . ARG C 107 ? 2.1793 1.6457 1.7633 0.0045  -0.2142 -0.2076 105  ARG C O     
3172 C  CB    . ARG C 107 ? 2.2850 1.7111 1.8425 -0.0077 -0.2535 -0.2201 105  ARG C CB    
3173 C  CG    . ARG C 107 ? 2.3689 1.7614 1.9027 -0.0067 -0.2643 -0.2263 105  ARG C CG    
3174 C  CD    . ARG C 107 ? 2.3850 1.7740 1.9354 -0.0256 -0.2826 -0.2277 105  ARG C CD    
3175 N  NE    . ARG C 107 ? 2.3222 1.7030 1.8936 -0.0412 -0.2852 -0.2247 105  ARG C NE    
3176 C  CZ    . ARG C 107 ? 2.2738 1.6662 1.8766 -0.0611 -0.2951 -0.2209 105  ARG C CZ    
3177 N  NH1   . ARG C 107 ? 2.2776 1.6621 1.8985 -0.0739 -0.2964 -0.2172 105  ARG C NH1   
3178 N  NH2   . ARG C 107 ? 2.2249 1.6378 1.8416 -0.0679 -0.3032 -0.2198 105  ARG C NH2   
3179 N  N     . ASN C 108 ? 2.1127 1.5966 1.6927 0.0051  -0.2282 -0.2107 106  ASN C N     
3180 C  CA    . ASN C 108 ? 2.0490 1.5622 1.6551 0.0009  -0.2205 -0.2051 106  ASN C CA    
3181 C  C     . ASN C 108 ? 2.0473 1.5655 1.6470 0.0142  -0.2026 -0.2020 106  ASN C C     
3182 O  O     . ASN C 108 ? 2.0267 1.5596 1.6498 0.0078  -0.1955 -0.1976 106  ASN C O     
3183 C  CB    . ASN C 108 ? 1.9608 1.4942 1.5702 0.0020  -0.2259 -0.2050 106  ASN C CB    
3184 C  CG    . ASN C 108 ? 1.8387 1.3788 1.4696 -0.0160 -0.2418 -0.2051 106  ASN C CG    
3185 O  OD1   . ASN C 108 ? 1.7766 1.3169 1.4312 -0.0317 -0.2463 -0.2025 106  ASN C OD1   
3186 N  ND2   . ASN C 108 ? 1.8322 1.3793 1.4558 -0.0134 -0.2500 -0.2071 106  ASN C ND2   
3187 N  N     . ILE C 109 ? 2.0772 1.5835 1.6460 0.0329  -0.1949 -0.2037 107  ILE C N     
3188 C  CA    . ILE C 109 ? 2.0689 1.5840 1.6346 0.0451  -0.1775 -0.1993 107  ILE C CA    
3189 C  C     . ILE C 109 ? 2.0369 1.5404 1.6111 0.0395  -0.1721 -0.1979 107  ILE C C     
3190 O  O     . ILE C 109 ? 2.0200 1.5381 1.6149 0.0352  -0.1635 -0.1936 107  ILE C O     
3191 C  CB    . ILE C 109 ? 2.0906 1.6003 1.6239 0.0672  -0.1694 -0.1994 107  ILE C CB    
3192 C  CG1   . ILE C 109 ? 2.1547 1.6740 1.6862 0.0795  -0.1512 -0.1938 107  ILE C CG1   
3193 C  CG2   . ILE C 109 ? 2.1819 1.6621 1.6878 0.0737  -0.1746 -0.2038 107  ILE C CG2   
3194 C  CD1   . ILE C 109 ? 2.1960 1.7149 1.6989 0.1014  -0.1421 -0.1915 107  ILE C CD1   
3195 N  N     . ASP C 110 ? 1.9711 1.4479 1.5315 0.0376  -0.1788 -0.2015 108  ASP C N     
3196 C  CA    . ASP C 110 ? 1.7422 1.2063 1.3126 0.0296  -0.1764 -0.2002 108  ASP C CA    
3197 C  C     . ASP C 110 ? 1.8261 1.3055 1.4330 0.0101  -0.1807 -0.1970 108  ASP C C     
3198 O  O     . ASP C 110 ? 1.8094 1.2920 1.4316 0.0060  -0.1727 -0.1931 108  ASP C O     
3199 C  CB    . ASP C 110 ? 1.5828 1.0156 1.1345 0.0282  -0.1865 -0.2051 108  ASP C CB    
3200 N  N     . GLU C 111 ? 1.9152 1.4061 1.5370 -0.0014 -0.1930 -0.1978 109  GLU C N     
3201 C  CA    . GLU C 111 ? 1.9259 1.4319 1.5835 -0.0200 -0.1976 -0.1936 109  GLU C CA    
3202 C  C     . GLU C 111 ? 2.1258 1.6590 1.8026 -0.0186 -0.1870 -0.1888 109  GLU C C     
3203 O  O     . GLU C 111 ? 2.0395 1.5826 1.7432 -0.0299 -0.1851 -0.1842 109  GLU C O     
3204 C  CB    . GLU C 111 ? 1.8989 1.4103 1.5692 -0.0336 -0.2143 -0.1948 109  GLU C CB    
3205 C  CG    . GLU C 111 ? 2.0646 1.5500 1.7210 -0.0385 -0.2274 -0.1993 109  GLU C CG    
3206 C  CD    . GLU C 111 ? 2.1989 1.6880 1.8504 -0.0411 -0.2410 -0.2027 109  GLU C CD    
3207 O  OE1   . GLU C 111 ? 2.2750 1.7437 1.9145 -0.0449 -0.2531 -0.2069 109  GLU C OE1   
3208 O  OE2   . GLU C 111 ? 2.2179 1.7305 1.8783 -0.0397 -0.2400 -0.2010 109  GLU C OE2   
3209 N  N     . HIS C 112 ? 2.3359 1.8814 1.9998 -0.0048 -0.1801 -0.1894 110  HIS C N     
3210 C  CA    . HIS C 112 ? 2.2630 1.8419 1.9523 -0.0056 -0.1709 -0.1827 110  HIS C CA    
3211 C  C     . HIS C 112 ? 2.0921 1.6841 1.7728 0.0112  -0.1529 -0.1785 110  HIS C C     
3212 O  O     . HIS C 112 ? 1.9797 1.6001 1.6870 0.0095  -0.1413 -0.1701 110  HIS C O     
3213 C  CB    . HIS C 112 ? 2.2943 1.8930 1.9941 -0.0102 -0.1796 -0.1822 110  HIS C CB    
3214 C  CG    . HIS C 112 ? 2.3334 1.9241 2.0439 -0.0269 -0.1982 -0.1854 110  HIS C CG    
3215 N  ND1   . HIS C 112 ? 2.3033 1.9021 2.0134 -0.0296 -0.2094 -0.1874 110  HIS C ND1   
3216 C  CD2   . HIS C 112 ? 2.3817 1.9625 2.1079 -0.0418 -0.2057 -0.1844 110  HIS C CD2   
3217 C  CE1   . HIS C 112 ? 2.3373 1.9335 2.0632 -0.0451 -0.2221 -0.1867 110  HIS C CE1   
3218 N  NE2   . HIS C 112 ? 2.3743 1.9599 2.1106 -0.0529 -0.2201 -0.1847 110  HIS C NE2   
3219 N  N     . ALA C 113 ? 1.9402 1.5137 1.5855 0.0274  -0.1502 -0.1834 111  ALA C N     
3220 C  CA    . ALA C 113 ? 1.6834 1.2722 1.3219 0.0434  -0.1337 -0.1781 111  ALA C CA    
3221 C  C     . ALA C 113 ? 1.8450 1.4305 1.4867 0.0468  -0.1208 -0.1743 111  ALA C C     
3222 O  O     . ALA C 113 ? 1.7402 1.3069 1.3840 0.0387  -0.1246 -0.1765 111  ALA C O     
3223 C  CB    . ALA C 113 ? 1.5258 1.0974 1.1251 0.0607  -0.1351 -0.1836 111  ALA C CB    
3224 N  N     . ASN C 114 ? 2.0945 1.6995 1.7379 0.0585  -0.1056 -0.1677 112  ASN C N     
3225 C  CA    . ASN C 114 ? 2.1140 1.7168 1.7566 0.0647  -0.0925 -0.1638 112  ASN C CA    
3226 C  C     . ASN C 114 ? 2.1950 1.7616 1.7990 0.0767  -0.0936 -0.1705 112  ASN C C     
3227 O  O     . ASN C 114 ? 2.3332 1.8870 1.9107 0.0863  -0.0986 -0.1749 112  ASN C O     
3228 C  CB    . ASN C 114 ? 2.0352 1.6685 1.6883 0.0744  -0.0774 -0.1550 112  ASN C CB    
3229 C  CG    . ASN C 114 ? 2.0096 1.6406 1.6565 0.0842  -0.0635 -0.1509 112  ASN C CG    
3230 O  OD1   . ASN C 114 ? 2.0363 1.6452 1.6750 0.0827  -0.0639 -0.1539 112  ASN C OD1   
3231 N  ND2   . ASN C 114 ? 1.9613 1.6161 1.6134 0.0939  -0.0514 -0.1435 112  ASN C ND2   
3232 N  N     . GLU C 115 ? 1.9638 1.5165 1.5667 0.0763  -0.0883 -0.1699 113  GLU C N     
3233 C  CA    . GLU C 115 ? 1.7697 1.2935 1.3452 0.0843  -0.0892 -0.1731 113  GLU C CA    
3234 C  C     . GLU C 115 ? 1.6508 1.1781 1.2019 0.1046  -0.0796 -0.1698 113  GLU C C     
3235 O  O     . GLU C 115 ? 1.8180 1.3274 1.3452 0.1120  -0.0844 -0.1725 113  GLU C O     
3236 C  CB    . GLU C 115 ? 1.7639 1.2765 1.3461 0.0806  -0.0834 -0.1711 113  GLU C CB    
3237 N  N     . ASP C 116 ? 1.5434 1.0939 1.1005 0.1138  -0.0662 -0.1635 114  ASP C N     
3238 C  CA    . ASP C 116 ? 1.4911 1.0480 1.0285 0.1329  -0.0559 -0.1581 114  ASP C CA    
3239 C  C     . ASP C 116 ? 1.5230 1.0921 1.0523 0.1396  -0.0589 -0.1578 114  ASP C C     
3240 O  O     . ASP C 116 ? 1.5589 1.1399 1.0770 0.1551  -0.0491 -0.1514 114  ASP C O     
3241 C  CB    . ASP C 116 ? 1.4784 1.0558 1.0270 0.1398  -0.0397 -0.1499 114  ASP C CB    
3242 N  N     . VAL C 117 ? 1.5208 1.0883 1.0561 0.1287  -0.0721 -0.1637 115  VAL C N     
3243 C  CA    . VAL C 117 ? 1.5427 1.1227 1.0710 0.1351  -0.0750 -0.1631 115  VAL C CA    
3244 C  C     . VAL C 117 ? 1.6179 1.1827 1.1157 0.1499  -0.0759 -0.1632 115  VAL C C     
3245 O  O     . VAL C 117 ? 1.6114 1.1505 1.0946 0.1486  -0.0831 -0.1680 115  VAL C O     
3246 C  CB    . VAL C 117 ? 1.5022 1.0832 1.0440 0.1196  -0.0899 -0.1693 115  VAL C CB    
3247 C  CG1   . VAL C 117 ? 1.5267 1.0808 1.0602 0.1103  -0.1041 -0.1765 115  VAL C CG1   
3248 C  CG2   . VAL C 117 ? 1.5208 1.1173 1.0567 0.1267  -0.0919 -0.1680 115  VAL C CG2   
3249 N  N     . GLU C 118 ? 1.6994 1.2800 1.1875 0.1644  -0.0689 -0.1573 116  GLU C N     
3250 C  CA    . GLU C 118 ? 1.8021 1.3697 1.2613 0.1796  -0.0698 -0.1567 116  GLU C CA    
3251 C  C     . GLU C 118 ? 1.8043 1.3623 1.2543 0.1754  -0.0848 -0.1638 116  GLU C C     
3252 O  O     . GLU C 118 ? 1.6652 1.2326 1.1319 0.1627  -0.0928 -0.1672 116  GLU C O     
3253 C  CB    . GLU C 118 ? 1.7608 1.3496 1.2137 0.1977  -0.0558 -0.1461 116  GLU C CB    
3254 C  CG    . GLU C 118 ? 1.6805 1.2799 1.1416 0.2031  -0.0410 -0.1380 116  GLU C CG    
3255 C  CD    . GLU C 118 ? 1.8175 1.3941 1.2759 0.1973  -0.0423 -0.1421 116  GLU C CD    
3256 O  OE1   . GLU C 118 ? 1.8911 1.4421 1.3273 0.2021  -0.0482 -0.1462 116  GLU C OE1   
3257 O  OE2   . GLU C 118 ? 1.8727 1.4568 1.3513 0.1883  -0.0374 -0.1411 116  GLU C OE2   
3258 N  N     . ARG C 119 ? 1.9120 1.4506 1.3346 0.1866  -0.0888 -0.1658 117  ARG C N     
3259 C  CA    . ARG C 119 ? 1.9357 1.4608 1.3457 0.1838  -0.1038 -0.1730 117  ARG C CA    
3260 C  C     . ARG C 119 ? 2.0218 1.5424 1.4029 0.2048  -0.1006 -0.1697 117  ARG C C     
3261 O  O     . ARG C 119 ? 2.1213 1.6256 1.4829 0.2164  -0.0961 -0.1682 117  ARG C O     
3262 C  CB    . ARG C 119 ? 1.7991 1.2952 1.2058 0.1709  -0.1170 -0.1820 117  ARG C CB    
3263 C  CG    . ARG C 119 ? 1.7559 1.2535 1.1896 0.1525  -0.1176 -0.1835 117  ARG C CG    
3264 C  CD    . ARG C 119 ? 1.7798 1.2504 1.2126 0.1388  -0.1315 -0.1914 117  ARG C CD    
3265 N  NE    . ARG C 119 ? 1.8221 1.2944 1.2796 0.1239  -0.1296 -0.1910 117  ARG C NE    
3266 C  CZ    . ARG C 119 ? 1.8941 1.3503 1.3615 0.1077  -0.1410 -0.1961 117  ARG C CZ    
3267 N  NH1   . ARG C 119 ? 1.9428 1.3796 1.3976 0.1035  -0.1557 -0.2024 117  ARG C NH1   
3268 N  NH2   . ARG C 119 ? 1.9129 1.3727 1.4033 0.0955  -0.1378 -0.1943 117  ARG C NH2   
3269 N  N     . MET C 120 ? 1.8993 1.4346 1.2778 0.2102  -0.1025 -0.1679 118  MET C N     
3270 C  CA    . MET C 120 ? 1.6160 1.1480 0.9681 0.2299  -0.1007 -0.1648 118  MET C CA    
3271 C  C     . MET C 120 ? 1.5313 1.0542 0.8745 0.2256  -0.1163 -0.1725 118  MET C C     
3272 O  O     . MET C 120 ? 1.3340 0.8659 0.6962 0.2100  -0.1247 -0.1765 118  MET C O     
3273 C  CB    . MET C 120 ? 1.4468 1.0091 0.8040 0.2436  -0.0859 -0.1528 118  MET C CB    
3274 C  CG    . MET C 120 ? 1.4239 0.9856 0.7558 0.2653  -0.0824 -0.1476 118  MET C CG    
3275 S  SD    . MET C 120 ? 1.6123 1.2083 0.9519 0.2822  -0.0624 -0.1307 118  MET C SD    
3276 C  CE    . MET C 120 ? 1.5456 1.1655 0.8939 0.2812  -0.0661 -0.1286 118  MET C CE    
3277 N  N     . LEU C 121 ? 1.9171 1.4220 1.2314 0.2397  -0.1205 -0.1745 119  LEU C N     
3278 C  CA    . LEU C 121 ? 1.9470 1.4396 1.2496 0.2367  -0.1361 -0.1824 119  LEU C CA    
3279 C  C     . LEU C 121 ? 2.2116 1.7142 1.4956 0.2567  -0.1319 -0.1770 119  LEU C C     
3280 O  O     . LEU C 121 ? 2.0637 1.5627 1.3287 0.2759  -0.1222 -0.1710 119  LEU C O     
3281 C  CB    . LEU C 121 ? 1.7005 1.1572 0.9841 0.2335  -0.1482 -0.1918 119  LEU C CB    
3282 C  CG    . LEU C 121 ? 1.6438 1.0831 0.9179 0.2257  -0.1672 -0.2018 119  LEU C CG    
3283 C  CD1   . LEU C 121 ? 1.7633 1.2251 1.0540 0.2174  -0.1729 -0.2019 119  LEU C CD1   
3284 C  CD2   . LEU C 121 ? 1.6678 1.0836 0.9486 0.2074  -0.1791 -0.2101 119  LEU C CD2   
3285 N  N     . LEU C 122 ? 2.6385 2.1539 1.9280 0.2528  -0.1391 -0.1786 120  LEU C N     
3286 C  CA    . LEU C 122 ? 2.7826 2.3119 2.0581 0.2714  -0.1337 -0.1720 120  LEU C CA    
3287 C  C     . LEU C 122 ? 2.7434 2.2541 1.9966 0.2753  -0.1483 -0.1800 120  LEU C C     
3288 O  O     . LEU C 122 ? 2.8801 2.3790 2.1389 0.2588  -0.1636 -0.1895 120  LEU C O     
3289 C  CB    . LEU C 122 ? 2.9496 2.5138 2.2492 0.2674  -0.1270 -0.1645 120  LEU C CB    
3290 C  CG    . LEU C 122 ? 3.0848 2.6586 2.4093 0.2453  -0.1376 -0.1700 120  LEU C CG    
3291 C  CD1   . LEU C 122 ? 3.1953 2.7613 2.5094 0.2431  -0.1528 -0.1770 120  LEU C CD1   
3292 C  CD2   . LEU C 122 ? 3.0869 2.6940 2.4372 0.2412  -0.1279 -0.1616 120  LEU C CD2   
3293 N  N     . GLY C 123 ? 2.3725 1.8802 1.6006 0.2975  -0.1435 -0.1757 121  GLY C N     
3294 C  CA    . GLY C 123 ? 1.9838 1.4829 1.1918 0.3054  -0.1540 -0.1803 121  GLY C CA    
3295 C  C     . GLY C 123 ? 1.7986 1.3291 1.0143 0.3142  -0.1465 -0.1713 121  GLY C C     
3296 O  O     . GLY C 123 ? 1.7400 1.2876 0.9536 0.3309  -0.1312 -0.1598 121  GLY C O     
3297 N  N     . ASN C 124 ? 1.7758 1.3154 1.0022 0.3025  -0.1570 -0.1755 122  ASN C N     
3298 C  CA    . ASN C 124 ? 1.7948 1.3644 1.0308 0.3078  -0.1517 -0.1674 122  ASN C CA    
3299 C  C     . ASN C 124 ? 1.8705 1.4324 1.0835 0.3194  -0.1606 -0.1709 122  ASN C C     
3300 O  O     . ASN C 124 ? 1.9114 1.4445 1.1027 0.3210  -0.1723 -0.1805 122  ASN C O     
3301 C  CB    . ASN C 124 ? 1.6131 1.2022 0.8805 0.2861  -0.1562 -0.1683 122  ASN C CB    
3302 C  CG    . ASN C 124 ? 1.5853 1.2065 0.8634 0.2917  -0.1501 -0.1588 122  ASN C CG    
3303 O  OD1   . ASN C 124 ? 1.5680 1.2023 0.8366 0.3111  -0.1377 -0.1485 122  ASN C OD1   
3304 N  ND2   . ASN C 124 ? 1.5433 1.1776 0.8417 0.2753  -0.1588 -0.1614 122  ASN C ND2   
3305 N  N     . LYS C 125 ? 1.9547 1.5429 1.1724 0.3282  -0.1546 -0.1623 123  LYS C N     
3306 C  CA    . LYS C 125 ? 2.1045 1.6919 1.3038 0.3397  -0.1613 -0.1637 123  LYS C CA    
3307 C  C     . LYS C 125 ? 2.2587 1.8251 1.4247 0.3623  -0.1591 -0.1643 123  LYS C C     
3308 O  O     . LYS C 125 ? 2.2941 1.8484 1.4393 0.3703  -0.1688 -0.1698 123  LYS C O     
3309 C  CB    . LYS C 125 ? 2.1211 1.6961 1.3220 0.3224  -0.1814 -0.1761 123  LYS C CB    
3310 C  CG    . LYS C 125 ? 2.0229 1.6141 1.2562 0.2984  -0.1864 -0.1774 123  LYS C CG    
3311 C  CD    . LYS C 125 ? 2.0012 1.5919 1.2368 0.2873  -0.2034 -0.1848 123  LYS C CD    
3312 C  CE    . LYS C 125 ? 1.9651 1.5643 1.2316 0.2614  -0.2117 -0.1884 123  LYS C CE    
3313 N  NZ    . LYS C 125 ? 2.0127 1.6068 1.2811 0.2488  -0.2302 -0.1967 123  LYS C NZ    
3314 N  N     . CYS C 126 ? 2.3297 1.8917 1.4898 0.3737  -0.1466 -0.1584 124  CYS C N     
3315 C  CA    . CYS C 126 ? 2.3162 1.8535 1.4437 0.3939  -0.1465 -0.1603 124  CYS C CA    
3316 C  C     . CYS C 126 ? 2.4083 1.9567 1.5187 0.4167  -0.1417 -0.1536 124  CYS C C     
3317 O  O     . CYS C 126 ? 2.5004 2.0293 1.5817 0.4358  -0.1422 -0.1550 124  CYS C O     
3318 C  CB    . CYS C 126 ? 2.1117 1.6456 1.2384 0.4019  -0.1331 -0.1536 124  CYS C CB    
3319 S  SG    . CYS C 126 ? 1.9342 1.5094 1.0813 0.4139  -0.1110 -0.1343 124  CYS C SG    
3320 N  N     . ASP C 127 ? 2.3372 1.9166 1.4651 0.4154  -0.1371 -0.1459 125  ASP C N     
3321 C  CA    . ASP C 127 ? 2.2443 1.8326 1.3568 0.4335  -0.1364 -0.1418 125  ASP C CA    
3322 C  C     . ASP C 127 ? 2.1957 1.7604 1.2890 0.4288  -0.1560 -0.1561 125  ASP C C     
3323 O  O     . ASP C 127 ? 2.2553 1.8176 1.3274 0.4463  -0.1577 -0.1556 125  ASP C O     
3324 C  CB    . ASP C 127 ? 2.1958 1.8236 1.3334 0.4318  -0.1270 -0.1295 125  ASP C CB    
3325 C  CG    . ASP C 127 ? 2.1110 1.7468 1.2696 0.4074  -0.1389 -0.1360 125  ASP C CG    
3326 O  OD1   . ASP C 127 ? 2.1301 1.7650 1.3084 0.3880  -0.1409 -0.1393 125  ASP C OD1   
3327 O  OD2   . ASP C 127 ? 2.0379 1.6817 1.1939 0.4081  -0.1460 -0.1373 125  ASP C OD2   
3328 N  N     . MET C 128 ? 2.1365 1.6845 1.2375 0.4058  -0.1709 -0.1683 126  MET C N     
3329 C  CA    . MET C 128 ? 2.0450 1.5714 1.1310 0.3987  -0.1907 -0.1817 126  MET C CA    
3330 C  C     . MET C 128 ? 2.0877 1.5747 1.1431 0.4065  -0.1990 -0.1916 126  MET C C     
3331 O  O     . MET C 128 ? 1.9593 1.4217 1.0129 0.3903  -0.2135 -0.2034 126  MET C O     
3332 C  CB    . MET C 128 ? 2.0316 1.5626 1.1439 0.3699  -0.2027 -0.1886 126  MET C CB    
3333 C  CG    . MET C 128 ? 2.0907 1.6589 1.2307 0.3631  -0.1962 -0.1793 126  MET C CG    
3334 S  SD    . MET C 128 ? 2.0976 1.6793 1.2265 0.3737  -0.2022 -0.1780 126  MET C SD    
3335 C  CE    . MET C 128 ? 2.0569 1.6097 1.1773 0.3555  -0.2280 -0.1957 126  MET C CE    
3336 N  N     . ASP C 129 ? 2.3436 1.8261 1.3752 0.4327  -0.1889 -0.1855 127  ASP C N     
3337 C  CA    . ASP C 129 ? 2.5174 1.9641 1.5156 0.4464  -0.1944 -0.1925 127  ASP C CA    
3338 C  C     . ASP C 129 ? 2.6246 2.0450 1.5998 0.4444  -0.2147 -0.2063 127  ASP C C     
3339 O  O     . ASP C 129 ? 2.6393 2.0252 1.5950 0.4423  -0.2260 -0.2167 127  ASP C O     
3340 C  CB    . ASP C 129 ? 2.6424 2.0967 1.6224 0.4768  -0.1786 -0.1810 127  ASP C CB    
3341 C  CG    . ASP C 129 ? 2.7645 2.2334 1.7336 0.4927  -0.1783 -0.1775 127  ASP C CG    
3342 O  OD1   . ASP C 129 ? 2.7298 2.2304 1.7109 0.5049  -0.1625 -0.1634 127  ASP C OD1   
3343 O  OD2   . ASP C 129 ? 2.8585 2.3080 1.8078 0.4927  -0.1943 -0.1885 127  ASP C OD2   
3344 N  N     . ASP C 130 ? 2.6726 2.1086 1.6485 0.4463  -0.2194 -0.2061 128  ASP C N     
3345 C  CA    . ASP C 130 ? 2.7184 2.1314 1.6700 0.4481  -0.2377 -0.2181 128  ASP C CA    
3346 C  C     . ASP C 130 ? 2.7316 2.1248 1.6926 0.4207  -0.2568 -0.2313 128  ASP C C     
3347 O  O     . ASP C 130 ? 2.7822 2.1417 1.7195 0.4206  -0.2717 -0.2428 128  ASP C O     
3348 C  CB    . ASP C 130 ? 2.7177 2.1567 1.6728 0.4545  -0.2370 -0.2134 128  ASP C CB    
3349 C  CG    . ASP C 130 ? 2.6650 2.1387 1.6587 0.4353  -0.2322 -0.2067 128  ASP C CG    
3350 O  OD1   . ASP C 130 ? 2.6046 2.1090 1.6113 0.4454  -0.2155 -0.1931 128  ASP C OD1   
3351 O  OD2   . ASP C 130 ? 2.6313 2.1016 1.6430 0.4101  -0.2450 -0.2145 128  ASP C OD2   
3352 N  N     . LYS C 131 ? 2.4023 1.8167 1.3984 0.3973  -0.2568 -0.2294 129  LYS C N     
3353 C  CA    . LYS C 131 ? 2.1333 1.5337 1.1451 0.3700  -0.2722 -0.2395 129  LYS C CA    
3354 C  C     . LYS C 131 ? 1.9810 1.3702 1.0029 0.3611  -0.2662 -0.2390 129  LYS C C     
3355 O  O     . LYS C 131 ? 1.8121 1.1979 0.8558 0.3369  -0.2746 -0.2441 129  LYS C O     
3356 C  CB    . LYS C 131 ? 2.0677 1.4973 1.1124 0.3497  -0.2759 -0.2375 129  LYS C CB    
3357 C  CG    . LYS C 131 ? 2.0905 1.5334 1.1274 0.3572  -0.2819 -0.2374 129  LYS C CG    
3358 C  CD    . LYS C 131 ? 2.2459 1.6608 1.2626 0.3523  -0.3035 -0.2508 129  LYS C CD    
3359 C  CE    . LYS C 131 ? 2.2341 1.6634 1.2429 0.3602  -0.3091 -0.2504 129  LYS C CE    
3360 N  NZ    . LYS C 131 ? 2.2199 1.6299 1.2210 0.3471  -0.3320 -0.2630 129  LYS C NZ    
3361 N  N     . ARG C 132 ? 1.9986 1.3835 1.0062 0.3805  -0.2515 -0.2323 130  ARG C N     
3362 C  CA    . ARG C 132 ? 2.0308 1.3996 1.0415 0.3747  -0.2472 -0.2329 130  ARG C CA    
3363 C  C     . ARG C 132 ? 2.1431 1.4747 1.1401 0.3628  -0.2663 -0.2467 130  ARG C C     
3364 O  O     . ARG C 132 ? 2.2882 1.5937 1.2531 0.3758  -0.2758 -0.2535 130  ARG C O     
3365 C  CB    . ARG C 132 ? 2.0299 1.3956 1.0204 0.4010  -0.2309 -0.2243 130  ARG C CB    
3366 C  CG    . ARG C 132 ? 2.0546 1.4022 1.0429 0.3997  -0.2253 -0.2240 130  ARG C CG    
3367 C  CD    . ARG C 132 ? 2.2253 1.5784 1.1969 0.4275  -0.2075 -0.2128 130  ARG C CD    
3368 N  NE    . ARG C 132 ? 2.4250 1.7578 1.3865 0.4323  -0.2021 -0.2121 130  ARG C NE    
3369 C  CZ    . ARG C 132 ? 2.5739 1.9070 1.5187 0.4564  -0.1882 -0.2029 130  ARG C CZ    
3370 N  NH1   . ARG C 132 ? 2.5919 1.9063 1.5280 0.4597  -0.1840 -0.2023 130  ARG C NH1   
3371 N  NH2   . ARG C 132 ? 2.6451 1.9979 1.5824 0.4776  -0.1784 -0.1937 130  ARG C NH2   
3372 N  N     . VAL C 133 ? 2.0373 1.3674 1.0597 0.3374  -0.2723 -0.2505 131  VAL C N     
3373 C  CA    . VAL C 133 ? 1.8889 1.1857 0.9038 0.3233  -0.2895 -0.2622 131  VAL C CA    
3374 C  C     . VAL C 133 ? 1.9160 1.1939 0.9274 0.3233  -0.2831 -0.2617 131  VAL C C     
3375 O  O     . VAL C 133 ? 1.9496 1.1938 0.9440 0.3197  -0.2954 -0.2705 131  VAL C O     
3376 C  CB    . VAL C 133 ? 1.7345 1.0414 0.7807 0.2940  -0.3027 -0.2671 131  VAL C CB    
3377 C  CG1   . VAL C 133 ? 1.7843 1.0591 0.8273 0.2773  -0.3202 -0.2779 131  VAL C CG1   
3378 C  CG2   . VAL C 133 ? 1.7010 1.0252 0.7489 0.2941  -0.3104 -0.2680 131  VAL C CG2   
3379 N  N     . VAL C 134 ? 2.0133 1.3106 1.0381 0.3287  -0.2644 -0.2513 132  VAL C N     
3380 C  CA    . VAL C 134 ? 2.1718 1.4579 1.2037 0.3223  -0.2582 -0.2501 132  VAL C CA    
3381 C  C     . VAL C 134 ? 2.2889 1.5793 1.3055 0.3468  -0.2394 -0.2402 132  VAL C C     
3382 O  O     . VAL C 134 ? 2.0181 1.3400 1.0489 0.3541  -0.2242 -0.2295 132  VAL C O     
3383 C  CB    . VAL C 134 ? 2.2855 1.5949 1.3587 0.2976  -0.2554 -0.2474 132  VAL C CB    
3384 C  CG1   . VAL C 134 ? 2.2258 1.5360 1.3096 0.2962  -0.2419 -0.2417 132  VAL C CG1   
3385 C  CG2   . VAL C 134 ? 2.3664 1.6631 1.4526 0.2727  -0.2754 -0.2577 132  VAL C CG2   
3386 N  N     . PRO C 135 ? 2.6026 1.8626 1.5900 0.3604  -0.2403 -0.2430 133  PRO C N     
3387 C  CA    . PRO C 135 ? 2.6731 1.9374 1.6464 0.3840  -0.2225 -0.2327 133  PRO C CA    
3388 C  C     . PRO C 135 ? 2.6209 1.9099 1.6234 0.3767  -0.2060 -0.2228 133  PRO C C     
3389 O  O     . PRO C 135 ? 2.6181 1.9162 1.6498 0.3534  -0.2085 -0.2248 133  PRO C O     
3390 C  CB    . PRO C 135 ? 2.7185 1.9415 1.6594 0.3929  -0.2300 -0.2396 133  PRO C CB    
3391 C  CG    . PRO C 135 ? 2.7251 1.9235 1.6528 0.3834  -0.2518 -0.2529 133  PRO C CG    
3392 C  CD    . PRO C 135 ? 2.6457 1.8663 1.6070 0.3587  -0.2589 -0.2554 133  PRO C CD    
3393 N  N     . LYS C 136 ? 2.4509 1.7514 1.4454 0.3979  -0.1889 -0.2116 134  LYS C N     
3394 C  CA    . LYS C 136 ? 2.3839 1.7071 1.4030 0.3941  -0.1724 -0.2013 134  LYS C CA    
3395 C  C     . LYS C 136 ? 2.5191 1.8209 1.5429 0.3797  -0.1757 -0.2064 134  LYS C C     
3396 O  O     . LYS C 136 ? 2.6628 1.9800 1.7166 0.3617  -0.1713 -0.2044 134  LYS C O     
3397 C  CB    . LYS C 136 ? 2.2389 1.5746 1.2449 0.4212  -0.1550 -0.1883 134  LYS C CB    
3398 C  CG    . LYS C 136 ? 2.0884 1.4644 1.1243 0.4208  -0.1372 -0.1746 134  LYS C CG    
3399 C  CD    . LYS C 136 ? 2.0388 1.4270 1.0621 0.4482  -0.1207 -0.1610 134  LYS C CD    
3400 C  CE    . LYS C 136 ? 1.9438 1.3743 0.9978 0.4479  -0.1041 -0.1469 134  LYS C CE    
3401 N  NZ    . LYS C 136 ? 1.9171 1.3610 0.9631 0.4729  -0.0876 -0.1324 134  LYS C NZ    
3402 N  N     . GLY C 137 ? 2.4634 1.7293 1.4574 0.3878  -0.1836 -0.2130 135  GLY C N     
3403 C  CA    . GLY C 137 ? 2.3476 1.5912 1.3435 0.3756  -0.1870 -0.2177 135  GLY C CA    
3404 C  C     . GLY C 137 ? 2.3500 1.5748 1.3547 0.3510  -0.2056 -0.2303 135  GLY C C     
3405 O  O     . GLY C 137 ? 2.4394 1.6498 1.4522 0.3376  -0.2080 -0.2335 135  GLY C O     
3406 N  N     . LYS C 138 ? 2.3682 1.5934 1.3720 0.3451  -0.2189 -0.2369 136  LYS C N     
3407 C  CA    . LYS C 138 ? 2.4373 1.6526 1.4571 0.3193  -0.2361 -0.2471 136  LYS C CA    
3408 C  C     . LYS C 138 ? 2.6882 1.9227 1.7463 0.2975  -0.2303 -0.2439 136  LYS C C     
3409 O  O     . LYS C 138 ? 2.6217 1.8388 1.6885 0.2805  -0.2383 -0.2495 136  LYS C O     
3410 C  CB    . LYS C 138 ? 2.3176 1.5447 1.3407 0.3154  -0.2466 -0.2510 136  LYS C CB    
3411 C  CG    . LYS C 138 ? 2.2043 1.4227 1.2443 0.2891  -0.2656 -0.2609 136  LYS C CG    
3412 C  CD    . LYS C 138 ? 2.1190 1.3230 1.1379 0.2931  -0.2822 -0.2692 136  LYS C CD    
3413 C  CE    . LYS C 138 ? 2.0580 1.2479 1.0897 0.2682  -0.3025 -0.2791 136  LYS C CE    
3414 N  NZ    . LYS C 138 ? 1.9547 1.1716 1.0125 0.2532  -0.3086 -0.2791 136  LYS C NZ    
3415 N  N     . GLY C 139 ? 2.9432 2.2133 2.0240 0.2982  -0.2161 -0.2344 137  GLY C N     
3416 C  CA    . GLY C 139 ? 2.9260 2.2156 2.0415 0.2804  -0.2087 -0.2304 137  GLY C CA    
3417 C  C     . GLY C 139 ? 2.9310 2.2278 2.0467 0.2920  -0.1904 -0.2210 137  GLY C C     
3418 O  O     . GLY C 139 ? 2.9573 2.2590 2.0945 0.2786  -0.1854 -0.2193 137  GLY C O     
3419 N  N     . GLU C 140 ? 2.8263 2.1248 1.9188 0.3170  -0.1800 -0.2143 138  GLU C N     
3420 C  CA    . GLU C 140 ? 2.6560 1.9643 1.7503 0.3283  -0.1622 -0.2040 138  GLU C CA    
3421 C  C     . GLU C 140 ? 2.6046 1.8845 1.6896 0.3247  -0.1641 -0.2078 138  GLU C C     
3422 O  O     . GLU C 140 ? 2.5998 1.8895 1.6978 0.3238  -0.1516 -0.2011 138  GLU C O     
3423 C  CB    . GLU C 140 ? 2.6062 1.9214 1.6776 0.3564  -0.1514 -0.1953 138  GLU C CB    
3424 C  CG    . GLU C 140 ? 2.5475 1.8803 1.6261 0.3675  -0.1321 -0.1826 138  GLU C CG    
3425 C  CD    . GLU C 140 ? 2.5846 1.9288 1.6451 0.3948  -0.1207 -0.1721 138  GLU C CD    
3426 O  OE1   . GLU C 140 ? 2.5821 1.9576 1.6607 0.4004  -0.1052 -0.1599 138  GLU C OE1   
3427 O  OE2   . GLU C 140 ? 2.5881 1.9103 1.6169 0.4108  -0.1273 -0.1758 138  GLU C OE2   
3428 N  N     . GLN C 141 ? 2.5761 1.8211 1.6391 0.3223  -0.1798 -0.2184 139  GLN C N     
3429 C  CA    . GLN C 141 ? 2.6268 1.8448 1.6842 0.3155  -0.1831 -0.2226 139  GLN C CA    
3430 C  C     . GLN C 141 ? 2.8156 2.0421 1.9081 0.2885  -0.1861 -0.2252 139  GLN C C     
3431 O  O     . GLN C 141 ? 2.7881 2.0073 1.8874 0.2830  -0.1809 -0.2237 139  GLN C O     
3432 C  CB    . GLN C 141 ? 2.5701 1.7479 1.5950 0.3197  -0.1998 -0.2332 139  GLN C CB    
3433 C  CG    . GLN C 141 ? 2.6000 1.7565 1.5880 0.3454  -0.1941 -0.2303 139  GLN C CG    
3434 C  CD    . GLN C 141 ? 2.6524 1.8320 1.6317 0.3688  -0.1796 -0.2196 139  GLN C CD    
3435 O  OE1   . GLN C 141 ? 2.7754 1.9521 1.7358 0.3818  -0.1844 -0.2211 139  GLN C OE1   
3436 N  NE2   . GLN C 141 ? 2.5337 1.7367 1.5276 0.3744  -0.1619 -0.2082 139  GLN C NE2   
3437 N  N     . ILE C 142 ? 2.9498 2.1922 2.0648 0.2719  -0.1944 -0.2286 140  ILE C N     
3438 C  CA    . ILE C 142 ? 2.9431 2.1997 2.0946 0.2476  -0.1951 -0.2290 140  ILE C CA    
3439 C  C     . ILE C 142 ? 2.9446 2.2308 2.1169 0.2505  -0.1758 -0.2183 140  ILE C C     
3440 O  O     . ILE C 142 ? 2.9296 2.2191 2.1227 0.2378  -0.1712 -0.2168 140  ILE C O     
3441 C  CB    . ILE C 142 ? 2.8742 2.1443 2.0448 0.2314  -0.2073 -0.2337 140  ILE C CB    
3442 C  CG1   . ILE C 142 ? 2.8568 2.1048 2.0013 0.2366  -0.2236 -0.2420 140  ILE C CG1   
3443 C  CG2   . ILE C 142 ? 2.8373 2.1089 2.0390 0.2051  -0.2144 -0.2370 140  ILE C CG2   
3444 C  CD1   . ILE C 142 ? 2.8549 2.0638 1.9810 0.2318  -0.2376 -0.2509 140  ILE C CD1   
3445 N  N     . ALA C 143 ? 2.9211 2.2292 2.0882 0.2676  -0.1641 -0.2102 141  ALA C N     
3446 C  CA    . ALA C 143 ? 2.7986 2.1355 1.9840 0.2720  -0.1458 -0.1992 141  ALA C CA    
3447 C  C     . ALA C 143 ? 2.7884 2.1125 1.9638 0.2806  -0.1359 -0.1951 141  ALA C C     
3448 O  O     . ALA C 143 ? 2.7389 2.0764 1.9360 0.2728  -0.1264 -0.1903 141  ALA C O     
3449 C  CB    . ALA C 143 ? 2.7508 2.1120 1.9307 0.2898  -0.1362 -0.1909 141  ALA C CB    
3450 N  N     . ARG C 144 ? 2.8419 2.1395 1.9837 0.2972  -0.1383 -0.1967 142  ARG C N     
3451 C  CA    . ARG C 144 ? 2.8405 2.1219 1.9709 0.3044  -0.1310 -0.1938 142  ARG C CA    
3452 C  C     . ARG C 144 ? 2.9650 2.2284 2.1084 0.2835  -0.1391 -0.2011 142  ARG C C     
3453 O  O     . ARG C 144 ? 2.8734 2.1353 2.0227 0.2826  -0.1302 -0.1971 142  ARG C O     
3454 C  CB    . ARG C 144 ? 2.7780 2.0317 1.8680 0.3260  -0.1339 -0.1951 142  ARG C CB    
3455 N  N     . GLU C 145 ? 3.1344 2.3852 2.2835 0.2665  -0.1559 -0.2111 143  GLU C N     
3456 C  CA    . GLU C 145 ? 3.0983 2.3337 2.2628 0.2456  -0.1643 -0.2173 143  GLU C CA    
3457 C  C     . GLU C 145 ? 3.0546 2.3172 2.2557 0.2313  -0.1543 -0.2118 143  GLU C C     
3458 O  O     . GLU C 145 ? 3.0737 2.3273 2.2854 0.2216  -0.1527 -0.2122 143  GLU C O     
3459 C  CB    . GLU C 145 ? 3.0998 2.3208 2.2665 0.2298  -0.1844 -0.2277 143  GLU C CB    
3460 C  CG    . GLU C 145 ? 3.1474 2.3349 2.2780 0.2403  -0.1976 -0.2353 143  GLU C CG    
3461 C  CD    . GLU C 145 ? 3.1043 2.2885 2.2377 0.2290  -0.2152 -0.2433 143  GLU C CD    
3462 O  OE1   . GLU C 145 ? 3.0757 2.2773 2.2405 0.2088  -0.2196 -0.2441 143  GLU C OE1   
3463 O  OE2   . GLU C 145 ? 3.0770 2.2417 2.1811 0.2407  -0.2245 -0.2484 143  GLU C OE2   
3464 N  N     . HIS C 146 ? 2.9444 2.2400 2.1653 0.2301  -0.1476 -0.2067 144  HIS C N     
3465 C  CA    . HIS C 146 ? 2.7121 2.0335 1.9672 0.2171  -0.1385 -0.2017 144  HIS C CA    
3466 C  C     . HIS C 146 ? 2.4891 1.8361 1.7487 0.2313  -0.1190 -0.1904 144  HIS C C     
3467 O  O     . HIS C 146 ? 2.3106 1.6803 1.5979 0.2220  -0.1108 -0.1859 144  HIS C O     
3468 C  CB    . HIS C 146 ? 2.6767 2.0168 1.9572 0.2002  -0.1466 -0.2047 144  HIS C CB    
3469 C  CG    . HIS C 146 ? 2.7254 2.0493 2.0193 0.1784  -0.1619 -0.2128 144  HIS C CG    
3470 N  ND1   . HIS C 146 ? 2.8199 2.1248 2.1022 0.1730  -0.1792 -0.2210 144  HIS C ND1   
3471 C  CD2   . HIS C 146 ? 2.6848 2.0087 2.0032 0.1611  -0.1625 -0.2133 144  HIS C CD2   
3472 C  CE1   . HIS C 146 ? 2.7961 2.0913 2.0965 0.1525  -0.1899 -0.2257 144  HIS C CE1   
3473 N  NE2   . HIS C 146 ? 2.7022 2.0085 2.0247 0.1451  -0.1799 -0.2210 144  HIS C NE2   
3474 N  N     . GLY C 147 ? 2.4818 1.8263 1.7160 0.2535  -0.1117 -0.1851 145  GLY C N     
3475 C  CA    . GLY C 147 ? 2.2959 1.6612 1.5330 0.2675  -0.0935 -0.1734 145  GLY C CA    
3476 C  C     . GLY C 147 ? 2.1375 1.5389 1.3905 0.2722  -0.0842 -0.1653 145  GLY C C     
3477 O  O     . GLY C 147 ? 2.0035 1.4250 1.2622 0.2827  -0.0692 -0.1547 145  GLY C O     
3478 N  N     . ILE C 148 ? 2.1188 1.5292 1.3791 0.2650  -0.0928 -0.1695 146  ILE C N     
3479 C  CA    . ILE C 148 ? 1.9497 1.3943 1.2270 0.2674  -0.0850 -0.1623 146  ILE C CA    
3480 C  C     . ILE C 148 ? 1.9997 1.4547 1.2586 0.2913  -0.0752 -0.1528 146  ILE C C     
3481 O  O     . ILE C 148 ? 2.0577 1.5389 1.3260 0.2961  -0.0697 -0.1465 146  ILE C O     
3482 C  CB    . ILE C 148 ? 1.6417 1.0907 0.9293 0.2539  -0.0979 -0.1695 146  ILE C CB    
3483 C  CG1   . ILE C 148 ? 1.5544 0.9870 0.8140 0.2652  -0.1078 -0.1740 146  ILE C CG1   
3484 C  CG2   . ILE C 148 ? 1.5470 0.9818 0.8503 0.2312  -0.1095 -0.1788 146  ILE C CG2   
3485 C  CD1   . ILE C 148 ? 1.5646 1.0008 0.8324 0.2529  -0.1212 -0.1810 146  ILE C CD1   
3486 N  N     . GLU C 152 ? 2.1395 1.6652 1.3178 0.3752  -0.0971 -0.1410 150  GLU C N     
3487 C  CA    . GLU C 152 ? 2.1055 1.6365 1.2810 0.3736  -0.1066 -0.1451 150  GLU C CA    
3488 C  C     . GLU C 152 ? 1.9873 1.5566 1.1819 0.3784  -0.0953 -0.1327 150  GLU C C     
3489 O  O     . GLU C 152 ? 1.8859 1.4741 1.0843 0.3929  -0.0798 -0.1196 150  GLU C O     
3490 C  CB    . GLU C 152 ? 2.2114 1.7193 1.3522 0.3917  -0.1138 -0.1496 150  GLU C CB    
3491 C  CG    . GLU C 152 ? 2.1290 1.5977 1.2479 0.3896  -0.1243 -0.1606 150  GLU C CG    
3492 C  CD    . GLU C 152 ? 2.0671 1.5108 1.1571 0.3970  -0.1390 -0.1704 150  GLU C CD    
3493 O  OE1   . GLU C 152 ? 2.0544 1.4764 1.1424 0.3805  -0.1553 -0.1830 150  GLU C OE1   
3494 O  OE2   . GLU C 152 ? 2.1852 1.6316 1.2553 0.4193  -0.1344 -0.1650 150  GLU C OE2   
3495 N  N     . THR C 153 ? 1.9687 1.5499 1.1764 0.3657  -0.1034 -0.1364 151  THR C N     
3496 C  CA    . THR C 153 ? 1.8499 1.4673 1.0792 0.3660  -0.0941 -0.1254 151  THR C CA    
3497 C  C     . THR C 153 ? 1.7581 1.3805 0.9844 0.3636  -0.1048 -0.1296 151  THR C C     
3498 O  O     . THR C 153 ? 1.9116 1.5120 1.1283 0.3537  -0.1208 -0.1424 151  THR C O     
3499 C  CB    . THR C 153 ? 1.9277 1.5616 1.1883 0.3464  -0.0904 -0.1237 151  THR C CB    
3500 O  OG1   . THR C 153 ? 1.9824 1.6010 1.2500 0.3249  -0.1062 -0.1372 151  THR C OG1   
3501 C  CG2   . THR C 153 ? 1.7820 1.4139 1.0475 0.3486  -0.0790 -0.1187 151  THR C CG2   
3502 N  N     . SER C 154 ? 1.6514 1.3036 0.8870 0.3722  -0.0960 -0.1181 152  SER C N     
3503 C  CA    . SER C 154 ? 1.5867 1.2489 0.8235 0.3692  -0.1046 -0.1201 152  SER C CA    
3504 C  C     . SER C 154 ? 1.6028 1.3005 0.8688 0.3618  -0.0963 -0.1092 152  SER C C     
3505 O  O     . SER C 154 ? 1.7032 1.4241 0.9776 0.3735  -0.0806 -0.0947 152  SER C O     
3506 C  CB    . SER C 154 ? 1.4438 1.1041 0.6560 0.3919  -0.1031 -0.1165 152  SER C CB    
3507 O  OG    . SER C 154 ? 1.2013 0.8807 0.4198 0.3911  -0.1066 -0.1137 152  SER C OG    
3508 N  N     . ALA C 155 ? 1.5279 1.2300 0.8101 0.3422  -0.1071 -0.1157 153  ALA C N     
3509 C  CA    . ALA C 155 ? 1.5494 1.2847 0.8568 0.3364  -0.1011 -0.1054 153  ALA C CA    
3510 C  C     . ALA C 155 ? 1.5263 1.2798 0.8278 0.3504  -0.0984 -0.0967 153  ALA C C     
3511 O  O     . ALA C 155 ? 1.4085 1.1921 0.7266 0.3547  -0.0870 -0.0823 153  ALA C O     
3512 C  CB    . ALA C 155 ? 1.5310 1.2660 0.8573 0.3125  -0.1140 -0.1144 153  ALA C CB    
3513 N  N     . LYS C 156 ? 1.6119 1.3478 0.8905 0.3575  -0.1087 -0.1047 154  LYS C N     
3514 C  CA    . LYS C 156 ? 1.6385 1.3904 0.9103 0.3711  -0.1069 -0.0974 154  LYS C CA    
3515 C  C     . LYS C 156 ? 1.6222 1.3892 0.8884 0.3939  -0.0890 -0.0823 154  LYS C C     
3516 O  O     . LYS C 156 ? 1.5831 1.3796 0.8624 0.4008  -0.0791 -0.0681 154  LYS C O     
3517 C  CB    . LYS C 156 ? 1.7687 1.4955 1.0154 0.3736  -0.1226 -0.1105 154  LYS C CB    
3518 C  CG    . LYS C 156 ? 1.8115 1.5540 1.0541 0.3819  -0.1251 -0.1061 154  LYS C CG    
3519 C  CD    . LYS C 156 ? 1.8936 1.6096 1.1121 0.3822  -0.1423 -0.1205 154  LYS C CD    
3520 C  CE    . LYS C 156 ? 1.7793 1.5110 1.0020 0.3798  -0.1499 -0.1194 154  LYS C CE    
3521 N  NZ    . LYS C 156 ? 1.8440 1.5509 1.0514 0.3714  -0.1700 -0.1352 154  LYS C NZ    
3522 N  N     . ALA C 157 ? 1.6495 1.3969 0.8975 0.4058  -0.0847 -0.0845 155  ALA C N     
3523 C  CA    . ALA C 157 ? 1.7841 1.5446 1.0278 0.4276  -0.0679 -0.0704 155  ALA C CA    
3524 C  C     . ALA C 157 ? 2.0536 1.8282 1.3179 0.4240  -0.0544 -0.0606 155  ALA C C     
3525 O  O     . ALA C 157 ? 2.0593 1.8457 1.3231 0.4408  -0.0401 -0.0482 155  ALA C O     
3526 C  CB    . ALA C 157 ? 1.8143 1.5460 1.0250 0.4451  -0.0709 -0.0772 155  ALA C CB    
3527 N  N     . ASN C 158 ? 2.2410 2.0151 1.5237 0.4028  -0.0588 -0.0658 156  ASN C N     
3528 C  CA    . ASN C 158 ? 2.1106 1.9001 1.4153 0.3972  -0.0468 -0.0569 156  ASN C CA    
3529 C  C     . ASN C 158 ? 1.8889 1.6679 1.1818 0.4117  -0.0371 -0.0531 156  ASN C C     
3530 O  O     . ASN C 158 ? 1.8778 1.6795 1.1819 0.4230  -0.0218 -0.0376 156  ASN C O     
3531 C  CB    . ASN C 158 ? 2.0952 1.9239 1.4254 0.3986  -0.0347 -0.0389 156  ASN C CB    
3532 C  CG    . ASN C 158 ? 2.0276 1.8688 1.3792 0.3784  -0.0419 -0.0409 156  ASN C CG    
3533 O  OD1   . ASN C 158 ? 2.0223 1.8813 1.3974 0.3687  -0.0353 -0.0334 156  ASN C OD1   
3534 N  ND2   . ASN C 158 ? 1.8659 1.6988 1.2097 0.3725  -0.0556 -0.0504 156  ASN C ND2   
3535 N  N     . ILE C 159 ? 1.7743 1.5193 1.0456 0.4113  -0.0462 -0.0667 157  ILE C N     
3536 C  CA    . ILE C 159 ? 1.9494 1.6815 1.2072 0.4255  -0.0384 -0.0638 157  ILE C CA    
3537 C  C     . ILE C 159 ? 2.0556 1.7679 1.3171 0.4102  -0.0427 -0.0732 157  ILE C C     
3538 O  O     . ILE C 159 ? 2.1866 1.8815 1.4483 0.3924  -0.0564 -0.0869 157  ILE C O     
3539 C  CB    . ILE C 159 ? 2.2407 1.9504 1.4652 0.4450  -0.0431 -0.0684 157  ILE C CB    
3540 C  CG1   . ILE C 159 ? 2.3270 2.0069 1.5327 0.4355  -0.0625 -0.0865 157  ILE C CG1   
3541 C  CG2   . ILE C 159 ? 2.3385 2.0734 1.5626 0.4643  -0.0334 -0.0548 157  ILE C CG2   
3542 C  CD1   . ILE C 159 ? 2.3537 2.0021 1.5508 0.4240  -0.0717 -0.0994 157  ILE C CD1   
3543 N  N     . ASN C 160 ? 2.0473 1.7648 1.3145 0.4166  -0.0305 -0.0646 158  ASN C N     
3544 C  CA    . ASN C 160 ? 1.9110 1.6138 1.1836 0.4047  -0.0310 -0.0703 158  ASN C CA    
3545 C  C     . ASN C 160 ? 1.8422 1.5491 1.1371 0.3797  -0.0377 -0.0776 158  ASN C C     
3546 O  O     . ASN C 160 ? 1.8252 1.5157 1.1234 0.3672  -0.0415 -0.0855 158  ASN C O     
3547 C  CB    . ASN C 160 ? 1.8358 1.4995 1.0795 0.4091  -0.0406 -0.0826 158  ASN C CB    
3548 C  CG    . ASN C 160 ? 1.7912 1.4503 1.0217 0.4289  -0.0297 -0.0741 158  ASN C CG    
3549 O  OD1   . ASN C 160 ? 1.7202 1.4051 0.9591 0.4432  -0.0160 -0.0588 158  ASN C OD1   
3550 N  ND2   . ASN C 160 ? 1.8797 1.5066 1.0900 0.4299  -0.0359 -0.0831 158  ASN C ND2   
3551 N  N     . ILE C 161 ? 1.7560 1.4856 1.0672 0.3725  -0.0388 -0.0741 159  ILE C N     
3552 C  CA    . ILE C 161 ? 1.7217 1.4578 1.0552 0.3501  -0.0445 -0.0797 159  ILE C CA    
3553 C  C     . ILE C 161 ? 1.7608 1.5170 1.1177 0.3455  -0.0316 -0.0698 159  ILE C C     
3554 O  O     . ILE C 161 ? 1.6226 1.3684 0.9883 0.3318  -0.0341 -0.0769 159  ILE C O     
3555 C  CB    . ILE C 161 ? 1.6888 1.4429 1.0315 0.3448  -0.0500 -0.0783 159  ILE C CB    
3556 C  CG1   . ILE C 161 ? 1.6793 1.4089 1.0046 0.3394  -0.0675 -0.0932 159  ILE C CG1   
3557 C  CG2   . ILE C 161 ? 1.5341 1.3070 0.9049 0.3269  -0.0494 -0.0766 159  ILE C CG2   
3558 C  CD1   . ILE C 161 ? 1.5440 1.2496 0.8720 0.3205  -0.0793 -0.1079 159  ILE C CD1   
3559 N  N     . GLU C 162 ? 1.9339 1.7199 1.3025 0.3567  -0.0177 -0.0529 160  GLU C N     
3560 C  CA    . GLU C 162 ? 1.9256 1.7330 1.3180 0.3522  -0.0057 -0.0424 160  GLU C CA    
3561 C  C     . GLU C 162 ? 2.0618 1.8506 1.4479 0.3534  -0.0025 -0.0461 160  GLU C C     
3562 O  O     . GLU C 162 ? 2.2102 1.9955 1.6094 0.3389  -0.0033 -0.0511 160  GLU C O     
3563 C  CB    . GLU C 162 ? 1.8542 1.6954 1.2595 0.3658  0.0085  -0.0223 160  GLU C CB    
3564 C  CG    . GLU C 162 ? 1.8947 1.7637 1.3296 0.3579  0.0192  -0.0101 160  GLU C CG    
3565 C  CD    . GLU C 162 ? 1.9524 1.8582 1.4074 0.3632  0.0288  0.0088  160  GLU C CD    
3566 O  OE1   . GLU C 162 ? 2.0301 1.9421 1.4774 0.3731  0.0279  0.0131  160  GLU C OE1   
3567 O  OE2   . GLU C 162 ? 2.0105 1.9395 1.4903 0.3568  0.0370  0.0199  160  GLU C OE2   
3568 N  N     . LYS C 163 ? 1.9366 1.7112 1.3012 0.3706  0.0002  -0.0445 161  LYS C N     
3569 C  CA    . LYS C 163 ? 1.9779 1.7346 1.3349 0.3732  0.0033  -0.0468 161  LYS C CA    
3570 C  C     . LYS C 163 ? 2.0156 1.7425 1.3667 0.3564  -0.0093 -0.0641 161  LYS C C     
3571 O  O     . LYS C 163 ? 2.2115 1.9304 1.5678 0.3507  -0.0064 -0.0658 161  LYS C O     
3572 C  CB    . LYS C 163 ? 1.9320 1.6761 1.2638 0.3954  0.0064  -0.0431 161  LYS C CB    
3573 C  CG    . LYS C 163 ? 2.0423 1.7752 1.3693 0.4011  0.0128  -0.0406 161  LYS C CG    
3574 C  CD    . LYS C 163 ? 2.0263 1.7879 1.3834 0.3944  0.0247  -0.0290 161  LYS C CD    
3575 C  CE    . LYS C 163 ? 1.9388 1.6867 1.2970 0.3895  0.0271  -0.0317 161  LYS C CE    
3576 N  NZ    . LYS C 163 ? 1.9146 1.6334 1.2659 0.3724  0.0145  -0.0492 161  LYS C NZ    
3577 N  N     . ALA C 164 ? 1.7704 1.4815 1.1121 0.3482  -0.0234 -0.0765 162  ALA C N     
3578 C  CA    . ALA C 164 ? 1.6366 1.3215 0.9765 0.3307  -0.0361 -0.0922 162  ALA C CA    
3579 C  C     . ALA C 164 ? 1.7835 1.4812 1.1510 0.3130  -0.0332 -0.0924 162  ALA C C     
3580 O  O     . ALA C 164 ? 1.6623 1.3462 1.0328 0.3056  -0.0330 -0.0970 162  ALA C O     
3581 C  CB    . ALA C 164 ? 1.5009 1.1728 0.8314 0.3236  -0.0519 -0.1035 162  ALA C CB    
3582 N  N     . PHE C 165 ? 1.7599 1.4843 1.1475 0.3068  -0.0306 -0.0870 163  PHE C N     
3583 C  CA    . PHE C 165 ? 1.6291 1.3667 1.0427 0.2909  -0.0281 -0.0872 163  PHE C CA    
3584 C  C     . PHE C 165 ? 1.5748 1.3242 0.9988 0.2960  -0.0136 -0.0770 163  PHE C C     
3585 O  O     . PHE C 165 ? 1.6688 1.4112 1.1034 0.2850  -0.0133 -0.0818 163  PHE C O     
3586 C  CB    . PHE C 165 ? 1.5782 1.3429 1.0088 0.2860  -0.0279 -0.0818 163  PHE C CB    
3587 C  CG    . PHE C 165 ? 1.6901 1.4450 1.1189 0.2742  -0.0436 -0.0934 163  PHE C CG    
3588 C  CD1   . PHE C 165 ? 1.6283 1.3686 1.0665 0.2559  -0.0539 -0.1059 163  PHE C CD1   
3589 C  CD2   . PHE C 165 ? 1.8300 1.5903 1.2484 0.2818  -0.0482 -0.0914 163  PHE C CD2   
3590 C  CE1   . PHE C 165 ? 1.7315 1.4650 1.1715 0.2445  -0.0686 -0.1152 163  PHE C CE1   
3591 C  CE2   . PHE C 165 ? 1.9810 1.7336 1.3990 0.2708  -0.0630 -0.1015 163  PHE C CE2   
3592 C  CZ    . PHE C 165 ? 1.8492 1.5885 1.2780 0.2521  -0.0734 -0.1134 163  PHE C CZ    
3593 N  N     . LEU C 166 ? 1.4347 1.2039 0.8580 0.3124  -0.0016 -0.0622 164  LEU C N     
3594 C  CA    . LEU C 166 ? 1.4687 1.2503 0.9029 0.3173  0.0116  -0.0516 164  LEU C CA    
3595 C  C     . LEU C 166 ? 1.5866 1.3407 1.0075 0.3179  0.0100  -0.0588 164  LEU C C     
3596 O  O     . LEU C 166 ? 1.6948 1.4538 1.1284 0.3139  0.0170  -0.0555 164  LEU C O     
3597 C  CB    . LEU C 166 ? 1.4614 1.2671 0.8967 0.3356  0.0237  -0.0340 164  LEU C CB    
3598 C  CG    . LEU C 166 ? 1.5424 1.3836 0.9969 0.3373  0.0304  -0.0201 164  LEU C CG    
3599 C  CD1   . LEU C 166 ? 1.5826 1.4277 1.0382 0.3293  0.0210  -0.0255 164  LEU C CD1   
3600 C  CD2   . LEU C 166 ? 1.7389 1.5987 1.1921 0.3574  0.0420  -0.0030 164  LEU C CD2   
3601 N  N     . THR C 167 ? 1.5871 1.3121 0.9825 0.3226  0.0005  -0.0684 165  THR C N     
3602 C  CA    . THR C 167 ? 1.6213 1.3176 1.0033 0.3213  -0.0028 -0.0763 165  THR C CA    
3603 C  C     . THR C 167 ? 1.5715 1.2598 0.9697 0.3006  -0.0080 -0.0859 165  THR C C     
3604 O  O     . THR C 167 ? 1.6387 1.3226 1.0424 0.2980  -0.0027 -0.0848 165  THR C O     
3605 C  CB    . THR C 167 ? 1.5226 1.1887 0.8752 0.3278  -0.0143 -0.0859 165  THR C CB    
3606 O  OG1   . THR C 167 ? 1.4420 1.1093 0.7765 0.3497  -0.0074 -0.0768 165  THR C OG1   
3607 C  CG2   . THR C 167 ? 1.3996 1.0336 0.7422 0.3186  -0.0227 -0.0980 165  THR C CG2   
3608 N  N     . LEU C 168 ? 1.5944 1.2812 1.0010 0.2859  -0.0184 -0.0951 166  LEU C N     
3609 C  CA    . LEU C 168 ? 1.5191 1.1992 0.9427 0.2665  -0.0237 -0.1040 166  LEU C CA    
3610 C  C     . LEU C 168 ? 1.3790 1.0839 0.8272 0.2629  -0.0115 -0.0953 166  LEU C C     
3611 O  O     . LEU C 168 ? 1.0650 0.7630 0.5228 0.2543  -0.0098 -0.0983 166  LEU C O     
3612 C  CB    . LEU C 168 ? 1.3144 0.9925 0.7449 0.2523  -0.0369 -0.1136 166  LEU C CB    
3613 C  CG    . LEU C 168 ? 1.2495 0.9078 0.6886 0.2336  -0.0472 -0.1257 166  LEU C CG    
3614 C  CD1   . LEU C 168 ? 1.4543 1.0818 0.8734 0.2365  -0.0514 -0.1314 166  LEU C CD1   
3615 C  CD2   . LEU C 168 ? 1.1831 0.8389 0.6284 0.2203  -0.0615 -0.1346 166  LEU C CD2   
3616 N  N     . ALA C 169 ? 1.5657 1.3002 1.0246 0.2698  -0.0027 -0.0837 167  ALA C N     
3617 C  CA    . ALA C 169 ? 1.6539 1.4133 1.1347 0.2690  0.0097  -0.0735 167  ALA C CA    
3618 C  C     . ALA C 169 ? 1.7223 1.4750 1.1979 0.2769  0.0180  -0.0683 167  ALA C C     
3619 O  O     . ALA C 169 ? 1.8223 1.5801 1.3136 0.2697  0.0231  -0.0673 167  ALA C O     
3620 C  CB    . ALA C 169 ? 1.5782 1.3697 1.0683 0.2778  0.0181  -0.0595 167  ALA C CB    
3621 N  N     . GLU C 170 ? 1.6356 1.3765 1.0889 0.2923  0.0193  -0.0650 168  GLU C N     
3622 C  CA    . GLU C 170 ? 1.5563 1.2880 1.0021 0.3003  0.0259  -0.0607 168  GLU C CA    
3623 C  C     . GLU C 170 ? 1.4367 1.1439 0.8821 0.2872  0.0199  -0.0725 168  GLU C C     
3624 O  O     . GLU C 170 ? 1.5227 1.2363 0.9817 0.2832  0.0268  -0.0690 168  GLU C O     
3625 C  CB    . GLU C 170 ? 1.8601 1.5779 1.2785 0.3190  0.0259  -0.0576 168  GLU C CB    
3626 C  CG    . GLU C 170 ? 1.9640 1.6743 1.3732 0.3303  0.0335  -0.0512 168  GLU C CG    
3627 C  CD    . GLU C 170 ? 1.9668 1.6393 1.3533 0.3287  0.0249  -0.0632 168  GLU C CD    
3628 O  OE1   . GLU C 170 ? 1.9347 1.5859 1.3039 0.3271  0.0136  -0.0736 168  GLU C OE1   
3629 O  OE2   . GLU C 170 ? 1.8912 1.5557 1.2778 0.3285  0.0292  -0.0620 168  GLU C OE2   
3630 N  N     . ASP C 171 ? 1.4888 1.1693 0.9209 0.2796  0.0067  -0.0860 169  ASP C N     
3631 C  CA    . ASP C 171 ? 1.6261 1.2820 1.0570 0.2681  0.0008  -0.0960 169  ASP C CA    
3632 C  C     . ASP C 171 ? 1.7563 1.4241 1.2149 0.2514  0.0022  -0.0984 169  ASP C C     
3633 O  O     . ASP C 171 ? 1.8438 1.4983 1.3064 0.2437  0.0017  -0.1027 169  ASP C O     
3634 C  CB    . ASP C 171 ? 1.6606 1.2867 1.0743 0.2619  -0.0146 -0.1094 169  ASP C CB    
3635 C  CG    . ASP C 171 ? 1.7632 1.3739 1.1476 0.2783  -0.0173 -0.1087 169  ASP C CG    
3636 O  OD1   . ASP C 171 ? 1.8618 1.4905 1.2422 0.2924  -0.0104 -0.0991 169  ASP C OD1   
3637 O  OD2   . ASP C 171 ? 1.6738 1.2543 1.0392 0.2775  -0.0263 -0.1173 169  ASP C OD2   
3638 N  N     . ILE C 172 ? 1.7144 1.4060 1.1916 0.2458  0.0034  -0.0960 170  ILE C N     
3639 C  CA    . ILE C 172 ? 1.6246 1.3280 1.1279 0.2312  0.0048  -0.0981 170  ILE C CA    
3640 C  C     . ILE C 172 ? 1.5828 1.3105 1.1018 0.2364  0.0192  -0.0860 170  ILE C C     
3641 O  O     . ILE C 172 ? 1.6468 1.3728 1.1772 0.2299  0.0227  -0.0868 170  ILE C O     
3642 C  CB    . ILE C 172 ? 1.5271 1.2427 1.0426 0.2221  -0.0020 -0.1021 170  ILE C CB    
3643 C  CG1   . ILE C 172 ? 1.3944 1.0856 0.9055 0.2088  -0.0177 -0.1160 170  ILE C CG1   
3644 C  CG2   . ILE C 172 ? 1.4507 1.1962 1.0037 0.2107  0.0038  -0.0947 170  ILE C CG2   
3645 C  CD1   . ILE C 172 ? 1.3088 1.0155 0.8398 0.1969  -0.0259 -0.1170 170  ILE C CD1   
3646 N  N     . LEU C 173 ? 1.5171 1.2684 1.0374 0.2483  0.0274  -0.0740 171  LEU C N     
3647 C  CA    . LEU C 173 ? 1.5401 1.3173 1.0774 0.2527  0.0403  -0.0612 171  LEU C CA    
3648 C  C     . LEU C 173 ? 1.7293 1.4956 1.2581 0.2596  0.0458  -0.0576 171  LEU C C     
3649 O  O     . LEU C 173 ? 1.6782 1.4599 1.2232 0.2583  0.0540  -0.0507 171  LEU C O     
3650 C  CB    . LEU C 173 ? 1.3797 1.1841 0.9202 0.2642  0.0472  -0.0478 171  LEU C CB    
3651 C  CG    . LEU C 173 ? 1.5002 1.3350 1.0595 0.2696  0.0600  -0.0320 171  LEU C CG    
3652 C  CD1   . LEU C 173 ? 1.5805 1.4450 1.1525 0.2726  0.0639  -0.0215 171  LEU C CD1   
3653 C  CD2   . LEU C 173 ? 1.4171 1.2497 0.9651 0.2840  0.0670  -0.0225 171  LEU C CD2   
3654 N  N     . ARG C 174 ? 1.9189 1.6591 1.4223 0.2671  0.0412  -0.0620 172  ARG C N     
3655 C  CA    . ARG C 174 ? 2.0697 1.7966 1.5642 0.2727  0.0455  -0.0598 172  ARG C CA    
3656 C  C     . ARG C 174 ? 1.8654 1.5767 1.3678 0.2583  0.0418  -0.0693 172  ARG C C     
3657 O  O     . ARG C 174 ? 2.0094 1.7204 1.5155 0.2596  0.0481  -0.0653 172  ARG C O     
3658 C  CB    . ARG C 174 ? 2.3537 2.0559 1.8175 0.2857  0.0415  -0.0618 172  ARG C CB    
3659 N  N     . LYS C 175 ? 1.5484 1.2473 1.0542 0.2446  0.0314  -0.0814 173  LYS C N     
3660 C  CA    . LYS C 175 ? 1.5026 1.1915 1.0212 0.2301  0.0285  -0.0890 173  LYS C CA    
3661 C  C     . LYS C 175 ? 1.4881 1.2047 1.0345 0.2244  0.0370  -0.0828 173  LYS C C     
3662 O  O     . LYS C 175 ? 1.2401 0.9530 0.7979 0.2162  0.0385  -0.0853 173  LYS C O     
3663 C  CB    . LYS C 175 ? 1.3904 1.0615 0.9085 0.2166  0.0148  -0.1021 173  LYS C CB    
3664 N  N     . THR C 176 ? 1.5899 1.3343 1.1474 0.2289  0.0424  -0.0744 174  THR C N     
3665 C  CA    . THR C 176 ? 1.6478 1.4192 1.2315 0.2241  0.0503  -0.0679 174  THR C CA    
3666 C  C     . THR C 176 ? 1.9483 1.7274 1.5365 0.2298  0.0601  -0.0589 174  THR C C     
3667 O  O     . THR C 176 ? 1.8589 1.6421 1.4634 0.2213  0.0625  -0.0603 174  THR C O     
3668 C  CB    . THR C 176 ? 1.4520 1.2513 1.0461 0.2278  0.0535  -0.0602 174  THR C CB    
3669 O  OG1   . THR C 176 ? 1.3324 1.1349 0.9444 0.2121  0.0430  -0.0661 174  THR C OG1   
3670 C  CG2   . THR C 176 ? 1.4315 1.2620 1.0504 0.2276  0.0634  -0.0480 174  THR C CG2   
3671 N  N     . PRO C 177 ? 2.1989 1.9805 1.7742 0.2440  0.0659  -0.0493 175  PRO C N     
3672 C  CA    . PRO C 177 ? 2.1875 1.9743 1.7678 0.2477  0.0739  -0.0419 175  PRO C CA    
3673 C  C     . PRO C 177 ? 2.1706 1.9261 1.7315 0.2491  0.0709  -0.0485 175  PRO C C     
3674 O  O     . PRO C 177 ? 2.1042 1.8369 1.6593 0.2398  0.0626  -0.0607 175  PRO C O     
3675 C  CB    . PRO C 177 ? 2.1680 1.9750 1.7461 0.2626  0.0815  -0.0271 175  PRO C CB    
3676 C  CG    . PRO C 177 ? 2.1174 1.9321 1.6918 0.2657  0.0782  -0.0266 175  PRO C CG    
3677 C  CD    . PRO C 177 ? 2.1468 1.9342 1.7082 0.2576  0.0674  -0.0419 175  PRO C CD    
3678 MG MG    . MG  D .   ? 0.7106 0.7588 0.8884 -0.0076 -0.1392 -0.0536 201  MG  A MG    
3679 P  PG    . GNP E .   ? 0.6792 0.7345 0.8410 -0.0002 -0.1450 -0.0654 202  GNP A PG    
3680 O  O1G   . GNP E .   ? 0.6046 0.6666 0.7724 -0.0046 -0.1555 -0.0630 202  GNP A O1G   
3681 O  O2G   . GNP E .   ? 0.6070 0.6729 0.7593 0.0077  -0.1282 -0.0642 202  GNP A O2G   
3682 O  O3G   . GNP E .   ? 0.7382 0.7943 0.9141 -0.0075 -0.1458 -0.0556 202  GNP A O3G   
3683 N  N3B   . GNP E .   ? 0.7489 0.7823 0.8982 0.0051  -0.1510 -0.0803 202  GNP A N3B   
3684 P  PB    . GNP E .   ? 0.6739 0.6970 0.8138 0.0117  -0.1425 -0.0865 202  GNP A PB    
3685 O  O1B   . GNP E .   ? 0.6033 0.6327 0.7300 0.0212  -0.1292 -0.0905 202  GNP A O1B   
3686 O  O2B   . GNP E .   ? 0.6268 0.6526 0.7786 0.0056  -0.1399 -0.0771 202  GNP A O2B   
3687 O  O3A   . GNP E .   ? 0.8308 0.8327 0.9628 0.0146  -0.1534 -0.0983 202  GNP A O3A   
3688 P  PA    . GNP E .   ? 0.8023 0.7897 0.9434 0.0076  -0.1652 -0.0976 202  GNP A PA    
3689 O  O1A   . GNP E .   ? 0.9969 0.9934 1.1563 -0.0041 -0.1722 -0.0856 202  GNP A O1A   
3690 O  O2A   . GNP E .   ? 0.7545 0.7364 0.8933 0.0111  -0.1575 -0.0984 202  GNP A O2A   
3691 O  "O5'" . GNP E .   ? 0.7155 0.6821 0.8468 0.0106  -0.1794 -0.1100 202  GNP A "O5'" 
3692 C  "C5'" . GNP E .   ? 0.9976 0.9585 1.1108 0.0216  -0.1780 -0.1217 202  GNP A "C5'" 
3693 C  "C4'" . GNP E .   ? 0.9249 0.8637 1.0310 0.0225  -0.1946 -0.1319 202  GNP A "C4'" 
3694 O  "O4'" . GNP E .   ? 0.8747 0.8001 0.9618 0.0357  -0.1915 -0.1440 202  GNP A "O4'" 
3695 C  "C3'" . GNP E .   ? 0.9561 0.8813 1.0742 0.0132  -0.2058 -0.1284 202  GNP A "C3'" 
3696 O  "O3'" . GNP E .   ? 1.1011 1.0133 1.2204 0.0076  -0.2238 -0.1323 202  GNP A "O3'" 
3697 C  "C2'" . GNP E .   ? 1.1149 1.0242 1.2221 0.0220  -0.2022 -0.1361 202  GNP A "C2'" 
3698 O  "O2'" . GNP E .   ? 1.3681 1.2544 1.4753 0.0191  -0.2169 -0.1408 202  GNP A "O2'" 
3699 C  "C1'" . GNP E .   ? 0.9827 0.8904 1.0694 0.0362  -0.1960 -0.1471 202  GNP A "C1'" 
3700 N  N9    . GNP E .   ? 1.0186 0.9303 1.0991 0.0450  -0.1814 -0.1479 202  GNP A N9    
3701 C  C8    . GNP E .   ? 1.0096 0.9375 1.0997 0.0418  -0.1683 -0.1386 202  GNP A C8    
3702 N  N7    . GNP E .   ? 0.9925 0.9209 1.0752 0.0505  -0.1578 -0.1413 202  GNP A N7    
3703 C  C5    . GNP E .   ? 0.9371 0.8494 1.0041 0.0609  -0.1632 -0.1527 202  GNP A C5    
3704 C  C6    . GNP E .   ? 0.9829 0.8901 1.0373 0.0735  -0.1561 -0.1590 202  GNP A C6    
3705 O  O6    . GNP E .   ? 1.1129 1.0290 1.1686 0.0770  -0.1440 -0.1557 202  GNP A O6    
3706 N  N1    . GNP E .   ? 1.1296 1.0196 1.1685 0.0828  -0.1649 -0.1699 202  GNP A N1    
3707 C  C2    . GNP E .   ? 1.0999 0.9777 1.1353 0.0797  -0.1797 -0.1750 202  GNP A C2    
3708 N  N2    . GNP E .   ? 1.0646 0.9247 1.0818 0.0911  -0.1867 -0.1864 202  GNP A N2    
3709 N  N3    . GNP E .   ? 1.0503 0.9330 1.0988 0.0666  -0.1873 -0.1690 202  GNP A N3    
3710 C  C4    . GNP E .   ? 0.9797 0.8806 1.0440 0.0580  -0.1779 -0.1575 202  GNP A C4    
3711 MG MG    . MG  F .   ? 1.4257 1.1742 0.9523 0.1317  -0.2077 -0.1651 201  MG  C MG    
3712 P  PG    . GNP G .   ? 1.4526 1.1484 0.9646 0.1057  -0.2437 -0.1893 202  GNP C PG    
3713 O  O1G   . GNP G .   ? 1.3498 1.0248 0.8659 0.0957  -0.2439 -0.1942 202  GNP C O1G   
3714 O  O2G   . GNP G .   ? 1.4127 1.1347 0.9388 0.1117  -0.2305 -0.1801 202  GNP C O2G   
3715 O  O3G   . GNP G .   ? 1.5822 1.2903 1.1112 0.0929  -0.2583 -0.1901 202  GNP C O3G   
3716 N  N3B   . GNP G .   ? 1.5608 1.2414 1.0352 0.1257  -0.2418 -0.1910 202  GNP C N3B   
3717 P  PB    . GNP G .   ? 1.4829 1.1589 0.9326 0.1476  -0.2253 -0.1866 202  GNP C PB    
3718 O  O1B   . GNP G .   ? 1.4832 1.1818 0.9500 0.1494  -0.2122 -0.1784 202  GNP C O1B   
3719 O  O2B   . GNP G .   ? 1.2545 0.9016 0.6873 0.1497  -0.2246 -0.1925 202  GNP C O2B   
3720 O  O3A   . GNP G .   ? 1.4400 1.1190 0.8654 0.1650  -0.2257 -0.1843 202  GNP C O3A   
3721 P  PA    . GNP G .   ? 1.4443 1.1449 0.8617 0.1837  -0.2125 -0.1739 202  GNP C PA    
3722 O  O1A   . GNP G .   ? 1.5224 1.2254 0.9395 0.1918  -0.1961 -0.1681 202  GNP C O1A   
3723 O  O2A   . GNP G .   ? 1.4178 1.1456 0.8554 0.1779  -0.2163 -0.1685 202  GNP C O2A   
3724 O  "O5'" . GNP G .   ? 1.5797 1.2687 0.9640 0.2030  -0.2128 -0.1744 202  GNP C "O5'" 
3725 C  "C5'" . GNP G .   ? 1.6186 1.2864 0.9878 0.1997  -0.2280 -0.1840 202  GNP C "C5'" 
3726 C  "C4'" . GNP G .   ? 1.4782 1.1491 0.8248 0.2166  -0.2294 -0.1819 202  GNP C "C4'" 
3727 O  "O4'" . GNP G .   ? 1.5062 1.1626 0.8236 0.2377  -0.2199 -0.1805 202  GNP C "O4'" 
3728 C  "C3'" . GNP G .   ? 1.3852 1.0883 0.7424 0.2231  -0.2230 -0.1712 202  GNP C "C3'" 
3729 O  "O3'" . GNP G .   ? 1.5403 1.2461 0.8912 0.2233  -0.2349 -0.1739 202  GNP C "O3'" 
3730 C  "C2'" . GNP G .   ? 1.3742 1.0831 0.7138 0.2464  -0.2055 -0.1617 202  GNP C "C2'" 
3731 O  "O2'" . GNP G .   ? 1.3054 1.0350 0.6404 0.2594  -0.2016 -0.1531 202  GNP C "O2'" 
3732 C  "C1'" . GNP G .   ? 1.4455 1.1230 0.7559 0.2563  -0.2078 -0.1695 202  GNP C "C1'" 
3733 N  N9    . GNP G .   ? 1.5905 1.2654 0.8911 0.2711  -0.1914 -0.1632 202  GNP C N9    
3734 C  C8    . GNP G .   ? 1.7165 1.3968 1.0340 0.2645  -0.1818 -0.1596 202  GNP C C8    
3735 N  N7    . GNP G .   ? 1.8005 1.4785 1.1062 0.2801  -0.1677 -0.1534 202  GNP C N7    
3736 C  C5    . GNP G .   ? 1.8226 1.4928 1.1017 0.2988  -0.1677 -0.1528 202  GNP C C5    
3737 C  C6    . GNP G .   ? 1.7958 1.4617 1.0541 0.3212  -0.1553 -0.1464 202  GNP C C6    
3738 O  O6    . GNP G .   ? 1.8455 1.5141 1.1056 0.3284  -0.1418 -0.1396 202  GNP C O6    
3739 N  N1    . GNP G .   ? 1.8418 1.4998 1.0758 0.3362  -0.1600 -0.1481 202  GNP C N1    
3740 C  C2    . GNP G .   ? 1.8596 1.5146 1.0898 0.3299  -0.1749 -0.1552 202  GNP C C2    
3741 N  N2    . GNP G .   ? 1.7988 1.4458 1.0033 0.3473  -0.1772 -0.1560 202  GNP C N2    
3742 N  N3    . GNP G .   ? 1.8747 1.5347 1.1252 0.3083  -0.1866 -0.1607 202  GNP C N3    
3743 C  C4    . GNP G .   ? 1.7348 1.4026 1.0096 0.2938  -0.1822 -0.1591 202  GNP C C4    
3744 O  O     . HOH H .   ? 0.4789 0.5054 0.6623 -0.0148 -0.1626 -0.0612 301  HOH A O     
3745 O  O     . HOH H .   ? 0.7621 0.8159 0.9213 0.0045  -0.1208 -0.0596 302  HOH A O     
3746 O  O     . HOH I .   ? 1.3437 1.0994 0.8450 0.1435  -0.2231 -0.1662 301  HOH C O     
3747 O  O     . HOH I .   ? 1.3657 1.0920 0.8926 0.1264  -0.2001 -0.1699 302  HOH C O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1   ?    ?   ?   A . n 
A 1 2   HIS 2   0    ?    ?   ?   A . n 
A 1 3   MET 3   1    ?    ?   ?   A . n 
A 1 4   ALA 4   2    ?    ?   ?   A . n 
A 1 5   LYS 5   3    ?    ?   ?   A . n 
A 1 6   LYS 6   4    ?    ?   ?   A . n 
A 1 7   THR 7   5    5    THR THR A . n 
A 1 8   TYR 8   6    6    TYR TYR A . n 
A 1 9   ASP 9   7    7    ASP ASP A . n 
A 1 10  LEU 10  8    8    LEU LEU A . n 
A 1 11  LEU 11  9    9    LEU LEU A . n 
A 1 12  PHE 12  10   10   PHE PHE A . n 
A 1 13  LYS 13  11   11   LYS LYS A . n 
A 1 14  LEU 14  12   12   LEU LEU A . n 
A 1 15  LEU 15  13   13   LEU LEU A . n 
A 1 16  LEU 16  14   14   LEU LEU A . n 
A 1 17  ILE 17  15   15   ILE ILE A . n 
A 1 18  GLY 18  16   16   GLY GLY A . n 
A 1 19  ASP 19  17   17   ASP ASP A . n 
A 1 20  SER 20  18   18   SER SER A . n 
A 1 21  GLY 21  19   19   GLY GLY A . n 
A 1 22  VAL 22  20   20   VAL VAL A . n 
A 1 23  GLY 23  21   21   GLY GLY A . n 
A 1 24  LYS 24  22   22   LYS LYS A . n 
A 1 25  THR 25  23   23   THR THR A . n 
A 1 26  CYS 26  24   24   CYS CYS A . n 
A 1 27  VAL 27  25   25   VAL VAL A . n 
A 1 28  LEU 28  26   26   LEU LEU A . n 
A 1 29  PHE 29  27   27   PHE PHE A . n 
A 1 30  ARG 30  28   28   ARG ARG A . n 
A 1 31  PHE 31  29   29   PHE PHE A . n 
A 1 32  SER 32  30   30   SER SER A . n 
A 1 33  ASP 33  31   31   ASP ASP A . n 
A 1 34  ASP 34  32   32   ASP ASP A . n 
A 1 35  ALA 35  33   33   ALA ALA A . n 
A 1 36  PHE 36  34   34   PHE PHE A . n 
A 1 37  ASN 37  35   35   ASN ASN A . n 
A 1 38  THR 38  36   36   THR THR A . n 
A 1 39  THR 39  37   37   THR THR A . n 
A 1 40  PHE 40  38   38   PHE PHE A . n 
A 1 41  ILE 41  39   39   ILE ILE A . n 
A 1 42  SER 42  40   40   SER SER A . n 
A 1 43  THR 43  41   41   THR THR A . n 
A 1 44  ILE 44  42   42   ILE ILE A . n 
A 1 45  GLY 45  43   43   GLY GLY A . n 
A 1 46  ILE 46  44   44   ILE ILE A . n 
A 1 47  ASP 47  45   45   ASP ASP A . n 
A 1 48  PHE 48  46   46   PHE PHE A . n 
A 1 49  LYS 49  47   47   LYS LYS A . n 
A 1 50  ILE 50  48   48   ILE ILE A . n 
A 1 51  LYS 51  49   49   LYS LYS A . n 
A 1 52  THR 52  50   50   THR THR A . n 
A 1 53  VAL 53  51   51   VAL VAL A . n 
A 1 54  GLU 54  52   52   GLU GLU A . n 
A 1 55  LEU 55  53   53   LEU LEU A . n 
A 1 56  GLN 56  54   54   GLN GLN A . n 
A 1 57  GLY 57  55   55   GLY GLY A . n 
A 1 58  LYS 58  56   56   LYS LYS A . n 
A 1 59  LYS 59  57   57   LYS LYS A . n 
A 1 60  ILE 60  58   58   ILE ILE A . n 
A 1 61  LYS 61  59   59   LYS LYS A . n 
A 1 62  LEU 62  60   60   LEU LEU A . n 
A 1 63  GLN 63  61   61   GLN GLN A . n 
A 1 64  ILE 64  62   62   ILE ILE A . n 
A 1 65  TRP 65  63   63   TRP TRP A . n 
A 1 66  ASP 66  64   64   ASP ASP A . n 
A 1 67  THR 67  65   65   THR THR A . n 
A 1 68  ALA 68  66   66   ALA ALA A . n 
A 1 69  GLY 69  67   67   GLY GLY A . n 
A 1 70  GLN 70  68   68   GLN GLN A . n 
A 1 71  GLU 71  69   69   GLU GLU A . n 
A 1 72  ARG 72  70   70   ARG ARG A . n 
A 1 73  PHE 73  71   71   PHE PHE A . n 
A 1 74  HIS 74  72   72   HIS HIS A . n 
A 1 75  THR 75  73   73   THR THR A . n 
A 1 76  ILE 76  74   74   ILE ILE A . n 
A 1 77  THR 77  75   75   THR THR A . n 
A 1 78  THR 78  76   76   THR THR A . n 
A 1 79  SER 79  77   77   SER SER A . n 
A 1 80  TYR 80  78   78   TYR TYR A . n 
A 1 81  TYR 81  79   79   TYR TYR A . n 
A 1 82  ARG 82  80   80   ARG ARG A . n 
A 1 83  GLY 83  81   81   GLY GLY A . n 
A 1 84  ALA 84  82   82   ALA ALA A . n 
A 1 85  MET 85  83   83   MET MET A . n 
A 1 86  GLY 86  84   84   GLY GLY A . n 
A 1 87  ILE 87  85   85   ILE ILE A . n 
A 1 88  MET 88  86   86   MET MET A . n 
A 1 89  LEU 89  87   87   LEU LEU A . n 
A 1 90  VAL 90  88   88   VAL VAL A . n 
A 1 91  TYR 91  89   89   TYR TYR A . n 
A 1 92  ASP 92  90   90   ASP ASP A . n 
A 1 93  ILE 93  91   91   ILE ILE A . n 
A 1 94  THR 94  92   92   THR THR A . n 
A 1 95  ASN 95  93   93   ASN ASN A . n 
A 1 96  GLY 96  94   94   GLY GLY A . n 
A 1 97  LYS 97  95   95   LYS LYS A . n 
A 1 98  SER 98  96   96   SER SER A . n 
A 1 99  PHE 99  97   97   PHE PHE A . n 
A 1 100 GLU 100 98   98   GLU GLU A . n 
A 1 101 ASN 101 99   99   ASN ASN A . n 
A 1 102 ILE 102 100  100  ILE ILE A . n 
A 1 103 SER 103 101  101  SER SER A . n 
A 1 104 LYS 104 102  102  LYS LYS A . n 
A 1 105 TRP 105 103  103  TRP TRP A . n 
A 1 106 LEU 106 104  104  LEU LEU A . n 
A 1 107 ARG 107 105  105  ARG ARG A . n 
A 1 108 ASN 108 106  106  ASN ASN A . n 
A 1 109 ILE 109 107  107  ILE ILE A . n 
A 1 110 ASP 110 108  108  ASP ASP A . n 
A 1 111 GLU 111 109  109  GLU GLU A . n 
A 1 112 HIS 112 110  110  HIS HIS A . n 
A 1 113 ALA 113 111  111  ALA ALA A . n 
A 1 114 ASN 114 112  112  ASN ASN A . n 
A 1 115 GLU 115 113  113  GLU GLU A . n 
A 1 116 ASP 116 114  114  ASP ASP A . n 
A 1 117 VAL 117 115  115  VAL VAL A . n 
A 1 118 GLU 118 116  116  GLU GLU A . n 
A 1 119 ARG 119 117  117  ARG ARG A . n 
A 1 120 MET 120 118  118  MET MET A . n 
A 1 121 LEU 121 119  119  LEU LEU A . n 
A 1 122 LEU 122 120  120  LEU LEU A . n 
A 1 123 GLY 123 121  121  GLY GLY A . n 
A 1 124 ASN 124 122  122  ASN ASN A . n 
A 1 125 LYS 125 123  123  LYS LYS A . n 
A 1 126 CYS 126 124  124  CYS CYS A . n 
A 1 127 ASP 127 125  125  ASP ASP A . n 
A 1 128 MET 128 126  126  MET MET A . n 
A 1 129 ASP 129 127  127  ASP ASP A . n 
A 1 130 ASP 130 128  128  ASP ASP A . n 
A 1 131 LYS 131 129  129  LYS LYS A . n 
A 1 132 ARG 132 130  130  ARG ARG A . n 
A 1 133 VAL 133 131  131  VAL VAL A . n 
A 1 134 VAL 134 132  132  VAL VAL A . n 
A 1 135 PRO 135 133  133  PRO PRO A . n 
A 1 136 LYS 136 134  134  LYS LYS A . n 
A 1 137 GLY 137 135  135  GLY GLY A . n 
A 1 138 LYS 138 136  136  LYS LYS A . n 
A 1 139 GLY 139 137  137  GLY GLY A . n 
A 1 140 GLU 140 138  138  GLU GLU A . n 
A 1 141 GLN 141 139  139  GLN GLN A . n 
A 1 142 ILE 142 140  140  ILE ILE A . n 
A 1 143 ALA 143 141  141  ALA ALA A . n 
A 1 144 ARG 144 142  142  ARG ARG A . n 
A 1 145 GLU 145 143  143  GLU GLU A . n 
A 1 146 HIS 146 144  144  HIS HIS A . n 
A 1 147 GLY 147 145  145  GLY GLY A . n 
A 1 148 ILE 148 146  146  ILE ILE A . n 
A 1 149 ARG 149 147  147  ARG ARG A . n 
A 1 150 PHE 150 148  148  PHE PHE A . n 
A 1 151 PHE 151 149  149  PHE PHE A . n 
A 1 152 GLU 152 150  150  GLU GLU A . n 
A 1 153 THR 153 151  151  THR THR A . n 
A 1 154 SER 154 152  152  SER SER A . n 
A 1 155 ALA 155 153  153  ALA ALA A . n 
A 1 156 LYS 156 154  154  LYS LYS A . n 
A 1 157 ALA 157 155  155  ALA ALA A . n 
A 1 158 ASN 158 156  156  ASN ASN A . n 
A 1 159 ILE 159 157  157  ILE ILE A . n 
A 1 160 ASN 160 158  158  ASN ASN A . n 
A 1 161 ILE 161 159  159  ILE ILE A . n 
A 1 162 GLU 162 160  160  GLU GLU A . n 
A 1 163 LYS 163 161  161  LYS LYS A . n 
A 1 164 ALA 164 162  162  ALA ALA A . n 
A 1 165 PHE 165 163  163  PHE PHE A . n 
A 1 166 LEU 166 164  164  LEU LEU A . n 
A 1 167 THR 167 165  165  THR THR A . n 
A 1 168 LEU 168 166  166  LEU LEU A . n 
A 1 169 ALA 169 167  167  ALA ALA A . n 
A 1 170 GLU 170 168  168  GLU GLU A . n 
A 1 171 ASP 171 169  169  ASP ASP A . n 
A 1 172 ILE 172 170  170  ILE ILE A . n 
A 1 173 LEU 173 171  171  LEU LEU A . n 
A 1 174 ARG 174 172  172  ARG ARG A . n 
A 1 175 LYS 175 173  173  LYS LYS A . n 
A 1 176 THR 176 174  174  THR THR A . n 
A 1 177 PRO 177 175  175  PRO PRO A . n 
B 2 1   GLY 1   915  ?    ?   ?   B . n 
B 2 2   HIS 2   916  ?    ?   ?   B . n 
B 2 3   MET 3   917  ?    ?   ?   B . n 
B 2 4   LYS 4   918  918  LYS LYS B . n 
B 2 5   GLU 5   919  919  GLU GLU B . n 
B 2 6   GLU 6   920  920  GLU GLU B . n 
B 2 7   GLU 7   921  921  GLU GLU B . n 
B 2 8   MET 8   922  922  MET MET B . n 
B 2 9   LYS 9   923  923  LYS LYS B . n 
B 2 10  ARG 10  924  924  ARG ARG B . n 
B 2 11  PHE 11  925  925  PHE PHE B . n 
B 2 12  CYS 12  926  926  CYS CYS B . n 
B 2 13  LYS 13  927  927  LYS LYS B . n 
B 2 14  ALA 14  928  928  ALA ALA B . n 
B 2 15  GLN 15  929  929  GLN GLN B . n 
B 2 16  THR 16  930  930  THR THR B . n 
B 2 17  ILE 17  931  931  ILE ILE B . n 
B 2 18  GLN 18  932  932  GLN GLN B . n 
B 2 19  ARG 19  933  933  ARG ARG B . n 
B 2 20  ARG 20  934  934  ARG ARG B . n 
B 2 21  LEU 21  935  935  LEU LEU B . n 
B 2 22  ASN 22  936  936  ASN ASN B . n 
B 2 23  GLU 23  937  937  GLU GLU B . n 
B 2 24  ILE 24  938  938  ILE ILE B . n 
B 2 25  GLU 25  939  939  GLU GLU B . n 
B 2 26  ALA 26  940  940  ALA ALA B . n 
B 2 27  ALA 27  941  941  ALA ALA B . n 
B 2 28  LEU 28  942  942  LEU LEU B . n 
B 2 29  ARG 29  943  943  ARG ARG B . n 
B 2 30  GLU 30  944  944  GLU GLU B . n 
B 2 31  LEU 31  945  945  LEU LEU B . n 
B 2 32  GLU 32  946  946  GLU GLU B . n 
B 2 33  ALA 33  947  947  ALA ALA B . n 
B 2 34  GLU 34  948  948  GLU GLU B . n 
B 2 35  GLY 35  949  949  GLY GLY B . n 
B 2 36  VAL 36  950  950  VAL VAL B . n 
B 2 37  LYS 37  951  951  LYS LYS B . n 
B 2 38  LEU 38  952  952  LEU LEU B . n 
B 2 39  GLU 39  953  953  GLU GLU B . n 
B 2 40  LEU 40  954  954  LEU LEU B . n 
B 2 41  ALA 41  955  955  ALA ALA B . n 
B 2 42  LEU 42  956  956  LEU LEU B . n 
B 2 43  ARG 43  957  957  ARG ARG B . n 
B 2 44  ARG 44  958  958  ARG ARG B . n 
B 2 45  GLN 45  959  959  GLN GLN B . n 
B 2 46  SER 46  960  960  SER SER B . n 
B 2 47  SER 47  961  961  SER SER B . n 
B 2 48  SER 48  962  962  SER SER B . n 
B 2 49  PRO 49  963  963  PRO PRO B . n 
B 2 50  GLU 50  964  964  GLU GLU B . n 
B 2 51  GLN 51  965  965  GLN GLN B . n 
B 2 52  GLN 52  966  966  GLN GLN B . n 
B 2 53  LYS 53  967  967  LYS LYS B . n 
B 2 54  LYS 54  968  968  LYS LYS B . n 
B 2 55  LEU 55  969  969  LEU LEU B . n 
B 2 56  TRP 56  970  970  TRP TRP B . n 
B 2 57  VAL 57  971  971  VAL VAL B . n 
B 2 58  GLY 58  972  972  GLY GLY B . n 
B 2 59  GLN 59  973  973  GLN GLN B . n 
B 2 60  LEU 60  974  974  LEU LEU B . n 
B 2 61  LEU 61  975  975  LEU LEU B . n 
B 2 62  GLN 62  976  976  GLN GLN B . n 
B 2 63  LEU 63  977  977  LEU LEU B . n 
B 2 64  VAL 64  978  978  VAL VAL B . n 
B 2 65  ASP 65  979  979  ASP ASP B . n 
B 2 66  LYS 66  980  980  LYS LYS B . n 
B 2 67  LYS 67  981  981  LYS LYS B . n 
B 2 68  ASN 68  982  982  ASN ASN B . n 
B 2 69  SER 69  983  983  SER SER B . n 
B 2 70  LEU 70  984  984  LEU LEU B . n 
B 2 71  VAL 71  985  985  VAL VAL B . n 
B 2 72  ALA 72  986  986  ALA ALA B . n 
B 2 73  GLU 73  987  987  GLU GLU B . n 
B 2 74  GLU 74  988  988  GLU GLU B . n 
B 2 75  ALA 75  989  989  ALA ALA B . n 
B 2 76  GLU 76  990  990  GLU GLU B . n 
B 2 77  LEU 77  991  991  LEU LEU B . n 
B 2 78  MET 78  992  992  MET MET B . n 
B 2 79  ILE 79  993  993  ILE ILE B . n 
B 2 80  THR 80  994  994  THR THR B . n 
B 2 81  VAL 81  995  995  VAL VAL B . n 
B 2 82  GLN 82  996  996  GLN GLN B . n 
B 2 83  GLU 83  997  997  GLU GLU B . n 
B 2 84  LEU 84  998  998  LEU LEU B . n 
B 2 85  ASN 85  999  999  ASN ASN B . n 
B 2 86  LEU 86  1000 1000 LEU LEU B . n 
B 2 87  GLU 87  1001 1001 GLU GLU B . n 
B 2 88  GLU 88  1002 1002 GLU GLU B . n 
B 2 89  LYS 89  1003 1003 LYS LYS B . n 
B 2 90  GLN 90  1004 1004 GLN GLN B . n 
B 2 91  TRP 91  1005 1005 TRP TRP B . n 
B 2 92  GLN 92  1006 1006 GLN GLN B . n 
B 2 93  LEU 93  1007 1007 LEU LEU B . n 
B 2 94  ASP 94  1008 1008 ASP ASP B . n 
B 2 95  GLN 95  1009 1009 GLN GLN B . n 
B 2 96  GLU 96  1010 1010 GLU GLU B . n 
B 2 97  LEU 97  1011 1011 LEU LEU B . n 
B 2 98  ARG 98  1012 1012 ARG ARG B . n 
B 2 99  GLY 99  1013 1013 GLY GLY B . n 
B 2 100 TYR 100 1014 1014 TYR TYR B . n 
B 2 101 MET 101 1015 ?    ?   ?   B . n 
B 2 102 ASN 102 1016 ?    ?   ?   B . n 
B 2 103 ARG 103 1017 ?    ?   ?   B . n 
B 2 104 GLU 104 1018 ?    ?   ?   B . n 
B 2 105 GLU 105 1019 ?    ?   ?   B . n 
B 2 106 ASN 106 1020 ?    ?   ?   B . n 
B 2 107 LEU 107 1021 ?    ?   ?   B . n 
B 2 108 LYS 108 1022 ?    ?   ?   B . n 
B 2 109 THR 109 1023 ?    ?   ?   B . n 
B 2 110 ALA 110 1024 ?    ?   ?   B . n 
B 2 111 ALA 111 1025 ?    ?   ?   B . n 
B 2 112 ASP 112 1026 1026 ASP ASP B . n 
B 2 113 ARG 113 1027 1027 ARG ARG B . n 
B 2 114 GLN 114 1028 1028 GLN GLN B . n 
B 2 115 ALA 115 1029 1029 ALA ALA B . n 
B 2 116 GLU 116 1030 1030 GLU GLU B . n 
B 2 117 ASP 117 1031 1031 ASP ASP B . n 
B 2 118 GLN 118 1032 1032 GLN GLN B . n 
B 2 119 VAL 119 1033 1033 VAL VAL B . n 
B 2 120 LEU 120 1034 1034 LEU LEU B . n 
B 2 121 ARG 121 1035 1035 ARG ARG B . n 
B 2 122 LYS 122 1036 1036 LYS LYS B . n 
B 2 123 LEU 123 1037 1037 LEU LEU B . n 
B 2 124 VAL 124 1038 1038 VAL VAL B . n 
B 2 125 ASP 125 1039 1039 ASP ASP B . n 
B 2 126 LEU 126 1040 1040 LEU LEU B . n 
B 2 127 VAL 127 1041 1041 VAL VAL B . n 
B 2 128 ASN 128 1042 1042 ASN ASN B . n 
B 2 129 GLN 129 1043 1043 GLN GLN B . n 
B 2 130 ARG 130 1044 1044 ARG ARG B . n 
B 2 131 ASP 131 1045 1045 ASP ASP B . n 
B 2 132 ALA 132 1046 1046 ALA ALA B . n 
B 2 133 LEU 133 1047 1047 LEU LEU B . n 
B 2 134 ILE 134 1048 1048 ILE ILE B . n 
B 2 135 ARG 135 1049 1049 ARG ARG B . n 
B 2 136 PHE 136 1050 1050 PHE PHE B . n 
B 2 137 GLN 137 1051 1051 GLN GLN B . n 
B 2 138 GLU 138 1052 1052 GLU GLU B . n 
B 2 139 GLU 139 1053 1053 GLU GLU B . n 
B 2 140 ARG 140 1054 1054 ARG ARG B . n 
B 2 141 ARG 141 1055 1055 ARG ARG B . n 
B 2 142 LEU 142 1056 1056 LEU LEU B . n 
B 2 143 SER 143 1057 1057 SER SER B . n 
B 2 144 GLU 144 1058 1058 GLU GLU B . n 
B 2 145 LEU 145 1059 1059 LEU LEU B . n 
B 2 146 ALA 146 1060 1060 ALA ALA B . n 
B 2 147 LEU 147 1061 ?    ?   ?   B . n 
B 2 148 GLY 148 1062 ?    ?   ?   B . n 
B 2 149 THR 149 1063 ?    ?   ?   B . n 
B 2 150 GLY 150 1064 ?    ?   ?   B . n 
B 2 151 ALA 151 1065 ?    ?   ?   B . n 
B 2 152 GLN 152 1066 ?    ?   ?   B . n 
B 2 153 GLY 153 1067 ?    ?   ?   B . n 
C 1 1   GLY 1   -1   ?    ?   ?   C . n 
C 1 2   HIS 2   0    ?    ?   ?   C . n 
C 1 3   MET 3   1    ?    ?   ?   C . n 
C 1 4   ALA 4   2    ?    ?   ?   C . n 
C 1 5   LYS 5   3    ?    ?   ?   C . n 
C 1 6   LYS 6   4    ?    ?   ?   C . n 
C 1 7   THR 7   5    ?    ?   ?   C . n 
C 1 8   TYR 8   6    6    TYR TYR C . n 
C 1 9   ASP 9   7    7    ASP ASP C . n 
C 1 10  LEU 10  8    8    LEU LEU C . n 
C 1 11  LEU 11  9    9    LEU LEU C . n 
C 1 12  PHE 12  10   10   PHE PHE C . n 
C 1 13  LYS 13  11   11   LYS LYS C . n 
C 1 14  LEU 14  12   12   LEU LEU C . n 
C 1 15  LEU 15  13   13   LEU LEU C . n 
C 1 16  LEU 16  14   14   LEU LEU C . n 
C 1 17  ILE 17  15   15   ILE ILE C . n 
C 1 18  GLY 18  16   16   GLY GLY C . n 
C 1 19  ASP 19  17   17   ASP ASP C . n 
C 1 20  SER 20  18   18   SER SER C . n 
C 1 21  GLY 21  19   19   GLY GLY C . n 
C 1 22  VAL 22  20   20   VAL VAL C . n 
C 1 23  GLY 23  21   21   GLY GLY C . n 
C 1 24  LYS 24  22   22   LYS LYS C . n 
C 1 25  THR 25  23   23   THR THR C . n 
C 1 26  CYS 26  24   24   CYS CYS C . n 
C 1 27  VAL 27  25   25   VAL VAL C . n 
C 1 28  LEU 28  26   26   LEU LEU C . n 
C 1 29  PHE 29  27   27   PHE PHE C . n 
C 1 30  ARG 30  28   28   ARG ARG C . n 
C 1 31  PHE 31  29   29   PHE PHE C . n 
C 1 32  SER 32  30   30   SER SER C . n 
C 1 33  ASP 33  31   31   ASP ASP C . n 
C 1 34  ASP 34  32   32   ASP ASP C . n 
C 1 35  ALA 35  33   33   ALA ALA C . n 
C 1 36  PHE 36  34   34   PHE PHE C . n 
C 1 37  ASN 37  35   35   ASN ASN C . n 
C 1 38  THR 38  36   36   THR THR C . n 
C 1 39  THR 39  37   37   THR THR C . n 
C 1 40  PHE 40  38   38   PHE PHE C . n 
C 1 41  ILE 41  39   39   ILE ILE C . n 
C 1 42  SER 42  40   40   SER SER C . n 
C 1 43  THR 43  41   41   THR THR C . n 
C 1 44  ILE 44  42   42   ILE ILE C . n 
C 1 45  GLY 45  43   43   GLY GLY C . n 
C 1 46  ILE 46  44   44   ILE ILE C . n 
C 1 47  ASP 47  45   45   ASP ASP C . n 
C 1 48  PHE 48  46   46   PHE PHE C . n 
C 1 49  LYS 49  47   47   LYS LYS C . n 
C 1 50  ILE 50  48   48   ILE ILE C . n 
C 1 51  LYS 51  49   49   LYS LYS C . n 
C 1 52  THR 52  50   50   THR THR C . n 
C 1 53  VAL 53  51   51   VAL VAL C . n 
C 1 54  GLU 54  52   52   GLU GLU C . n 
C 1 55  LEU 55  53   53   LEU LEU C . n 
C 1 56  GLN 56  54   54   GLN GLN C . n 
C 1 57  GLY 57  55   55   GLY GLY C . n 
C 1 58  LYS 58  56   56   LYS LYS C . n 
C 1 59  LYS 59  57   57   LYS LYS C . n 
C 1 60  ILE 60  58   58   ILE ILE C . n 
C 1 61  LYS 61  59   59   LYS LYS C . n 
C 1 62  LEU 62  60   60   LEU LEU C . n 
C 1 63  GLN 63  61   61   GLN GLN C . n 
C 1 64  ILE 64  62   62   ILE ILE C . n 
C 1 65  TRP 65  63   63   TRP TRP C . n 
C 1 66  ASP 66  64   64   ASP ASP C . n 
C 1 67  THR 67  65   65   THR THR C . n 
C 1 68  ALA 68  66   66   ALA ALA C . n 
C 1 69  GLY 69  67   67   GLY GLY C . n 
C 1 70  GLN 70  68   68   GLN GLN C . n 
C 1 71  GLU 71  69   69   GLU GLU C . n 
C 1 72  ARG 72  70   70   ARG ARG C . n 
C 1 73  PHE 73  71   71   PHE PHE C . n 
C 1 74  HIS 74  72   72   HIS HIS C . n 
C 1 75  THR 75  73   73   THR THR C . n 
C 1 76  ILE 76  74   74   ILE ILE C . n 
C 1 77  THR 77  75   75   THR THR C . n 
C 1 78  THR 78  76   76   THR THR C . n 
C 1 79  SER 79  77   77   SER SER C . n 
C 1 80  TYR 80  78   78   TYR TYR C . n 
C 1 81  TYR 81  79   79   TYR TYR C . n 
C 1 82  ARG 82  80   80   ARG ARG C . n 
C 1 83  GLY 83  81   81   GLY GLY C . n 
C 1 84  ALA 84  82   82   ALA ALA C . n 
C 1 85  MET 85  83   83   MET MET C . n 
C 1 86  GLY 86  84   84   GLY GLY C . n 
C 1 87  ILE 87  85   85   ILE ILE C . n 
C 1 88  MET 88  86   86   MET MET C . n 
C 1 89  LEU 89  87   87   LEU LEU C . n 
C 1 90  VAL 90  88   88   VAL VAL C . n 
C 1 91  TYR 91  89   89   TYR TYR C . n 
C 1 92  ASP 92  90   90   ASP ASP C . n 
C 1 93  ILE 93  91   91   ILE ILE C . n 
C 1 94  THR 94  92   92   THR THR C . n 
C 1 95  ASN 95  93   93   ASN ASN C . n 
C 1 96  GLY 96  94   94   GLY GLY C . n 
C 1 97  LYS 97  95   95   LYS LYS C . n 
C 1 98  SER 98  96   96   SER SER C . n 
C 1 99  PHE 99  97   97   PHE PHE C . n 
C 1 100 GLU 100 98   98   GLU GLU C . n 
C 1 101 ASN 101 99   99   ASN ASN C . n 
C 1 102 ILE 102 100  100  ILE ILE C . n 
C 1 103 SER 103 101  101  SER SER C . n 
C 1 104 LYS 104 102  102  LYS LYS C . n 
C 1 105 TRP 105 103  103  TRP TRP C . n 
C 1 106 LEU 106 104  104  LEU LEU C . n 
C 1 107 ARG 107 105  105  ARG ARG C . n 
C 1 108 ASN 108 106  106  ASN ASN C . n 
C 1 109 ILE 109 107  107  ILE ILE C . n 
C 1 110 ASP 110 108  108  ASP ASP C . n 
C 1 111 GLU 111 109  109  GLU GLU C . n 
C 1 112 HIS 112 110  110  HIS HIS C . n 
C 1 113 ALA 113 111  111  ALA ALA C . n 
C 1 114 ASN 114 112  112  ASN ASN C . n 
C 1 115 GLU 115 113  113  GLU GLU C . n 
C 1 116 ASP 116 114  114  ASP ASP C . n 
C 1 117 VAL 117 115  115  VAL VAL C . n 
C 1 118 GLU 118 116  116  GLU GLU C . n 
C 1 119 ARG 119 117  117  ARG ARG C . n 
C 1 120 MET 120 118  118  MET MET C . n 
C 1 121 LEU 121 119  119  LEU LEU C . n 
C 1 122 LEU 122 120  120  LEU LEU C . n 
C 1 123 GLY 123 121  121  GLY GLY C . n 
C 1 124 ASN 124 122  122  ASN ASN C . n 
C 1 125 LYS 125 123  123  LYS LYS C . n 
C 1 126 CYS 126 124  124  CYS CYS C . n 
C 1 127 ASP 127 125  125  ASP ASP C . n 
C 1 128 MET 128 126  126  MET MET C . n 
C 1 129 ASP 129 127  127  ASP ASP C . n 
C 1 130 ASP 130 128  128  ASP ASP C . n 
C 1 131 LYS 131 129  129  LYS LYS C . n 
C 1 132 ARG 132 130  130  ARG ARG C . n 
C 1 133 VAL 133 131  131  VAL VAL C . n 
C 1 134 VAL 134 132  132  VAL VAL C . n 
C 1 135 PRO 135 133  133  PRO PRO C . n 
C 1 136 LYS 136 134  134  LYS LYS C . n 
C 1 137 GLY 137 135  135  GLY GLY C . n 
C 1 138 LYS 138 136  136  LYS LYS C . n 
C 1 139 GLY 139 137  137  GLY GLY C . n 
C 1 140 GLU 140 138  138  GLU GLU C . n 
C 1 141 GLN 141 139  139  GLN GLN C . n 
C 1 142 ILE 142 140  140  ILE ILE C . n 
C 1 143 ALA 143 141  141  ALA ALA C . n 
C 1 144 ARG 144 142  142  ARG ARG C . n 
C 1 145 GLU 145 143  143  GLU GLU C . n 
C 1 146 HIS 146 144  144  HIS HIS C . n 
C 1 147 GLY 147 145  145  GLY GLY C . n 
C 1 148 ILE 148 146  146  ILE ILE C . n 
C 1 149 ARG 149 147  ?    ?   ?   C . n 
C 1 150 PHE 150 148  ?    ?   ?   C . n 
C 1 151 PHE 151 149  ?    ?   ?   C . n 
C 1 152 GLU 152 150  150  GLU GLU C . n 
C 1 153 THR 153 151  151  THR THR C . n 
C 1 154 SER 154 152  152  SER SER C . n 
C 1 155 ALA 155 153  153  ALA ALA C . n 
C 1 156 LYS 156 154  154  LYS LYS C . n 
C 1 157 ALA 157 155  155  ALA ALA C . n 
C 1 158 ASN 158 156  156  ASN ASN C . n 
C 1 159 ILE 159 157  157  ILE ILE C . n 
C 1 160 ASN 160 158  158  ASN ASN C . n 
C 1 161 ILE 161 159  159  ILE ILE C . n 
C 1 162 GLU 162 160  160  GLU GLU C . n 
C 1 163 LYS 163 161  161  LYS LYS C . n 
C 1 164 ALA 164 162  162  ALA ALA C . n 
C 1 165 PHE 165 163  163  PHE PHE C . n 
C 1 166 LEU 166 164  164  LEU LEU C . n 
C 1 167 THR 167 165  165  THR THR C . n 
C 1 168 LEU 168 166  166  LEU LEU C . n 
C 1 169 ALA 169 167  167  ALA ALA C . n 
C 1 170 GLU 170 168  168  GLU GLU C . n 
C 1 171 ASP 171 169  169  ASP ASP C . n 
C 1 172 ILE 172 170  170  ILE ILE C . n 
C 1 173 LEU 173 171  171  LEU LEU C . n 
C 1 174 ARG 174 172  172  ARG ARG C . n 
C 1 175 LYS 175 173  173  LYS LYS C . n 
C 1 176 THR 176 174  174  THR THR C . n 
C 1 177 PRO 177 175  175  PRO PRO C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 MG  1 201 400 MG  MG  A . 
E 4 GNP 1 202 500 GNP GNP A . 
F 3 MG  1 201 400 MG  MG  C . 
G 4 GNP 1 202 500 GNP GNP C . 
H 5 HOH 1 301 1   HOH HOH A . 
H 5 HOH 2 302 2   HOH HOH A . 
I 5 HOH 1 301 4   HOH HOH C . 
I 5 HOH 2 302 3   HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5980  ? 
1 MORE         -43   ? 
1 'SSA (A^2)'  23450 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 25 ? A THR 23  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 OG1 ? A THR 43 ? A THR 41  ? 1_555 99.3  ? 
2  OG1 ? A THR 25 ? A THR 23  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O3G ? E GNP .  ? A GNP 202 ? 1_555 147.5 ? 
3  OG1 ? A THR 43 ? A THR 41  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O3G ? E GNP .  ? A GNP 202 ? 1_555 95.9  ? 
4  OG1 ? A THR 25 ? A THR 23  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O2B ? E GNP .  ? A GNP 202 ? 1_555 78.7  ? 
5  OG1 ? A THR 43 ? A THR 41  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O2B ? E GNP .  ? A GNP 202 ? 1_555 172.5 ? 
6  O3G ? E GNP .  ? A GNP 202 ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O2B ? E GNP .  ? A GNP 202 ? 1_555 82.4  ? 
7  OG1 ? A THR 25 ? A THR 23  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 301 ? 1_555 74.3  ? 
8  OG1 ? A THR 43 ? A THR 41  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 301 ? 1_555 96.4  ? 
9  O3G ? E GNP .  ? A GNP 202 ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 301 ? 1_555 75.6  ? 
10 O2B ? E GNP .  ? A GNP 202 ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 301 ? 1_555 76.1  ? 
11 OG1 ? A THR 25 ? A THR 23  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 302 ? 1_555 101.7 ? 
12 OG1 ? A THR 43 ? A THR 41  ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 302 ? 1_555 121.2 ? 
13 O3G ? E GNP .  ? A GNP 202 ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 302 ? 1_555 94.5  ? 
14 O2B ? E GNP .  ? A GNP 202 ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 302 ? 1_555 66.2  ? 
15 O   ? H HOH .  ? A HOH 301 ? 1_555 MG ? D MG . ? A MG 201 ? 1_555 O   ? H HOH .  ? A HOH 302 ? 1_555 142.1 ? 
16 OG1 ? C THR 25 ? C THR 23  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 OG1 ? C THR 43 ? C THR 41  ? 1_555 83.7  ? 
17 OG1 ? C THR 25 ? C THR 23  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O   ? I HOH .  ? C HOH 302 ? 1_555 75.1  ? 
18 OG1 ? C THR 43 ? C THR 41  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O   ? I HOH .  ? C HOH 302 ? 1_555 91.4  ? 
19 OG1 ? C THR 25 ? C THR 23  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O2G ? G GNP .  ? C GNP 202 ? 1_555 152.4 ? 
20 OG1 ? C THR 43 ? C THR 41  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O2G ? G GNP .  ? C GNP 202 ? 1_555 100.3 ? 
21 O   ? I HOH .  ? C HOH 302 ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O2G ? G GNP .  ? C GNP 202 ? 1_555 77.5  ? 
22 OG1 ? C THR 25 ? C THR 23  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O1B ? G GNP .  ? C GNP 202 ? 1_555 90.4  ? 
23 OG1 ? C THR 43 ? C THR 41  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O1B ? G GNP .  ? C GNP 202 ? 1_555 160.0 ? 
24 O   ? I HOH .  ? C HOH 302 ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O1B ? G GNP .  ? C GNP 202 ? 1_555 68.6  ? 
25 O2G ? G GNP .  ? C GNP 202 ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O1B ? G GNP .  ? C GNP 202 ? 1_555 76.5  ? 
26 OG1 ? C THR 25 ? C THR 23  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O   ? I HOH .  ? C HOH 301 ? 1_555 111.9 ? 
27 OG1 ? C THR 43 ? C THR 41  ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O   ? I HOH .  ? C HOH 301 ? 1_555 109.0 ? 
28 O   ? I HOH .  ? C HOH 302 ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O   ? I HOH .  ? C HOH 301 ? 1_555 158.8 ? 
29 O2G ? G GNP .  ? C GNP 202 ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O   ? I HOH .  ? C HOH 301 ? 1_555 92.8  ? 
30 O1B ? G GNP .  ? C GNP 202 ? 1_555 MG ? F MG . ? C MG 201 ? 1_555 O   ? I HOH .  ? C HOH 301 ? 1_555 90.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-24 
2 'Structure model' 1 1 2016-09-07 
3 'Structure model' 1 2 2016-09-14 
4 'Structure model' 1 3 2017-09-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         1.7086 
_pdbx_refine_tls.origin_y         73.9068 
_pdbx_refine_tls.origin_z         216.9504 
_pdbx_refine_tls.T[1][1]          0.3390 
_pdbx_refine_tls.T[2][2]          0.3542 
_pdbx_refine_tls.T[3][3]          0.3078 
_pdbx_refine_tls.T[1][2]          0.0622 
_pdbx_refine_tls.T[1][3]          -0.0207 
_pdbx_refine_tls.T[2][3]          -0.0427 
_pdbx_refine_tls.L[1][1]          0.7826 
_pdbx_refine_tls.L[2][2]          0.7247 
_pdbx_refine_tls.L[3][3]          1.0177 
_pdbx_refine_tls.L[1][2]          -0.5522 
_pdbx_refine_tls.L[1][3]          0.2051 
_pdbx_refine_tls.L[2][3]          -0.6177 
_pdbx_refine_tls.S[1][1]          -0.0376 
_pdbx_refine_tls.S[1][2]          -0.2198 
_pdbx_refine_tls.S[1][3]          -0.1146 
_pdbx_refine_tls.S[2][1]          0.2532 
_pdbx_refine_tls.S[2][2]          0.1731 
_pdbx_refine_tls.S[2][3]          -0.0524 
_pdbx_refine_tls.S[3][1]          -0.2518 
_pdbx_refine_tls.S[3][2]          -0.1436 
_pdbx_refine_tls.S[3][3]          0.0247 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                  4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   C LYS 95  ? ? OE2 C GLU 98  ? ? 1.43 
2 1 O   C LYS 95  ? ? CD  C GLU 98  ? ? 1.86 
3 1 OD1 A ASP 17  ? ? NE1 A TRP 103 ? ? 2.08 
4 1 NH1 A ARG 130 ? ? O   A VAL 132 ? ? 2.12 
5 1 CD1 C TYR 89  ? ? CE2 C PHE 97  ? ? 2.14 
6 1 O   A PHE 29  ? ? NZ  A LYS 49  ? ? 2.15 
7 1 O   A LEU 171 ? ? OG1 A THR 174 ? ? 2.16 
8 1 OE1 A GLN 68  ? ? N   A ARG 70  ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE A ARG 105 ? ? CZ  A ARG 105 ? ? 1.237 1.326 -0.089 0.013 N 
2 1 CZ A ARG 105 ? ? NH1 A ARG 105 ? ? 1.234 1.326 -0.092 0.013 N 
3 1 CB C TRP 103 ? ? CG  C TRP 103 ? ? 1.363 1.498 -0.135 0.018 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB B LEU 956 ? ? CG B LEU 956 ? ? CD1 B LEU 956 ? ? 98.43  111.00 -12.57 1.70 N 
2 1 CB C TYR 89  ? ? CG C TYR 89  ? ? CD1 C TYR 89  ? ? 115.86 121.00 -5.14  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 123 ? ? 70.23  44.93  
2 1 LYS A 173 ? ? -97.01 37.70  
3 1 ALA B 955 ? ? -38.49 -38.42 
4 1 THR C 73  ? ? -60.21 -71.76 
5 1 ASN C 158 ? ? 47.75  16.60  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 54   ? CG  ? A GLN 56  CG  
2   1 Y 1 A GLN 54   ? CD  ? A GLN 56  CD  
3   1 Y 1 A GLN 54   ? OE1 ? A GLN 56  OE1 
4   1 Y 1 A GLN 54   ? NE2 ? A GLN 56  NE2 
5   1 Y 1 A ARG 80   ? CG  ? A ARG 82  CG  
6   1 Y 1 A ARG 80   ? CD  ? A ARG 82  CD  
7   1 Y 1 A ARG 80   ? NE  ? A ARG 82  NE  
8   1 Y 1 A ARG 80   ? CZ  ? A ARG 82  CZ  
9   1 Y 1 A ARG 80   ? NH1 ? A ARG 82  NH1 
10  1 Y 1 A ARG 80   ? NH2 ? A ARG 82  NH2 
11  1 Y 1 B LYS 918  ? CG  ? B LYS 4   CG  
12  1 Y 1 B LYS 918  ? CD  ? B LYS 4   CD  
13  1 Y 1 B LYS 918  ? CE  ? B LYS 4   CE  
14  1 Y 1 B LYS 918  ? NZ  ? B LYS 4   NZ  
15  1 Y 1 B GLU 919  ? CG  ? B GLU 5   CG  
16  1 Y 1 B GLU 919  ? CD  ? B GLU 5   CD  
17  1 Y 1 B GLU 919  ? OE1 ? B GLU 5   OE1 
18  1 Y 1 B GLU 919  ? OE2 ? B GLU 5   OE2 
19  1 Y 1 B GLU 920  ? CG  ? B GLU 6   CG  
20  1 Y 1 B GLU 920  ? CD  ? B GLU 6   CD  
21  1 Y 1 B GLU 920  ? OE1 ? B GLU 6   OE1 
22  1 Y 1 B GLU 920  ? OE2 ? B GLU 6   OE2 
23  1 Y 1 B GLU 921  ? CG  ? B GLU 7   CG  
24  1 Y 1 B GLU 921  ? CD  ? B GLU 7   CD  
25  1 Y 1 B GLU 921  ? OE1 ? B GLU 7   OE1 
26  1 Y 1 B GLU 921  ? OE2 ? B GLU 7   OE2 
27  1 Y 1 B MET 922  ? CG  ? B MET 8   CG  
28  1 Y 1 B MET 922  ? SD  ? B MET 8   SD  
29  1 Y 1 B MET 922  ? CE  ? B MET 8   CE  
30  1 Y 1 B LYS 923  ? CG  ? B LYS 9   CG  
31  1 Y 1 B LYS 923  ? CD  ? B LYS 9   CD  
32  1 Y 1 B LYS 923  ? CE  ? B LYS 9   CE  
33  1 Y 1 B LYS 923  ? NZ  ? B LYS 9   NZ  
34  1 Y 1 B ARG 924  ? CG  ? B ARG 10  CG  
35  1 Y 1 B ARG 924  ? CD  ? B ARG 10  CD  
36  1 Y 1 B ARG 924  ? NE  ? B ARG 10  NE  
37  1 Y 1 B ARG 924  ? CZ  ? B ARG 10  CZ  
38  1 Y 1 B ARG 924  ? NH1 ? B ARG 10  NH1 
39  1 Y 1 B ARG 924  ? NH2 ? B ARG 10  NH2 
40  1 Y 1 B PHE 925  ? CG  ? B PHE 11  CG  
41  1 Y 1 B PHE 925  ? CD1 ? B PHE 11  CD1 
42  1 Y 1 B PHE 925  ? CD2 ? B PHE 11  CD2 
43  1 Y 1 B PHE 925  ? CE1 ? B PHE 11  CE1 
44  1 Y 1 B PHE 925  ? CE2 ? B PHE 11  CE2 
45  1 Y 1 B PHE 925  ? CZ  ? B PHE 11  CZ  
46  1 Y 1 B LYS 927  ? CG  ? B LYS 13  CG  
47  1 Y 1 B LYS 927  ? CD  ? B LYS 13  CD  
48  1 Y 1 B LYS 927  ? CE  ? B LYS 13  CE  
49  1 Y 1 B LYS 927  ? NZ  ? B LYS 13  NZ  
50  1 Y 1 B LYS 951  ? CG  ? B LYS 37  CG  
51  1 Y 1 B LYS 951  ? CD  ? B LYS 37  CD  
52  1 Y 1 B LYS 951  ? CE  ? B LYS 37  CE  
53  1 Y 1 B LYS 951  ? NZ  ? B LYS 37  NZ  
54  1 Y 1 B LEU 974  ? CG  ? B LEU 60  CG  
55  1 Y 1 B LEU 974  ? CD1 ? B LEU 60  CD1 
56  1 Y 1 B LEU 974  ? CD2 ? B LEU 60  CD2 
57  1 Y 1 B LYS 980  ? CG  ? B LYS 66  CG  
58  1 Y 1 B LYS 980  ? CD  ? B LYS 66  CD  
59  1 Y 1 B LYS 980  ? CE  ? B LYS 66  CE  
60  1 Y 1 B LYS 980  ? NZ  ? B LYS 66  NZ  
61  1 Y 1 B ASP 1026 ? CG  ? B ASP 112 CG  
62  1 Y 1 B ASP 1026 ? OD1 ? B ASP 112 OD1 
63  1 Y 1 B ASP 1026 ? OD2 ? B ASP 112 OD2 
64  1 Y 1 B ARG 1027 ? CG  ? B ARG 113 CG  
65  1 Y 1 B ARG 1027 ? CD  ? B ARG 113 CD  
66  1 Y 1 B ARG 1027 ? NE  ? B ARG 113 NE  
67  1 Y 1 B ARG 1027 ? CZ  ? B ARG 113 CZ  
68  1 Y 1 B ARG 1027 ? NH1 ? B ARG 113 NH1 
69  1 Y 1 B ARG 1027 ? NH2 ? B ARG 113 NH2 
70  1 Y 1 B GLN 1028 ? CG  ? B GLN 114 CG  
71  1 Y 1 B GLN 1028 ? CD  ? B GLN 114 CD  
72  1 Y 1 B GLN 1028 ? OE1 ? B GLN 114 OE1 
73  1 Y 1 B GLN 1028 ? NE2 ? B GLN 114 NE2 
74  1 Y 1 B GLN 1032 ? CG  ? B GLN 118 CG  
75  1 Y 1 B GLN 1032 ? CD  ? B GLN 118 CD  
76  1 Y 1 B GLN 1032 ? OE1 ? B GLN 118 OE1 
77  1 Y 1 B GLN 1032 ? NE2 ? B GLN 118 NE2 
78  1 Y 1 B LYS 1036 ? CG  ? B LYS 122 CG  
79  1 Y 1 B LYS 1036 ? CD  ? B LYS 122 CD  
80  1 Y 1 B LYS 1036 ? CE  ? B LYS 122 CE  
81  1 Y 1 B LYS 1036 ? NZ  ? B LYS 122 NZ  
82  1 Y 1 B GLU 1058 ? CG  ? B GLU 144 CG  
83  1 Y 1 B GLU 1058 ? CD  ? B GLU 144 CD  
84  1 Y 1 B GLU 1058 ? OE1 ? B GLU 144 OE1 
85  1 Y 1 B GLU 1058 ? OE2 ? B GLU 144 OE2 
86  1 Y 1 C ARG 28   ? CG  ? C ARG 30  CG  
87  1 Y 1 C ARG 28   ? CD  ? C ARG 30  CD  
88  1 Y 1 C ARG 28   ? NE  ? C ARG 30  NE  
89  1 Y 1 C ARG 28   ? CZ  ? C ARG 30  CZ  
90  1 Y 1 C ARG 28   ? NH1 ? C ARG 30  NH1 
91  1 Y 1 C ARG 28   ? NH2 ? C ARG 30  NH2 
92  1 Y 1 C LYS 56   ? CG  ? C LYS 58  CG  
93  1 Y 1 C LYS 56   ? CD  ? C LYS 58  CD  
94  1 Y 1 C LYS 56   ? CE  ? C LYS 58  CE  
95  1 Y 1 C LYS 56   ? NZ  ? C LYS 58  NZ  
96  1 Y 1 C ARG 80   ? CG  ? C ARG 82  CG  
97  1 Y 1 C ARG 80   ? CD  ? C ARG 82  CD  
98  1 Y 1 C ARG 80   ? NE  ? C ARG 82  NE  
99  1 Y 1 C ARG 80   ? CZ  ? C ARG 82  CZ  
100 1 Y 1 C ARG 80   ? NH1 ? C ARG 82  NH1 
101 1 Y 1 C ARG 80   ? NH2 ? C ARG 82  NH2 
102 1 Y 1 C ASP 108  ? CG  ? C ASP 110 CG  
103 1 Y 1 C ASP 108  ? OD1 ? C ASP 110 OD1 
104 1 Y 1 C ASP 108  ? OD2 ? C ASP 110 OD2 
105 1 Y 1 C GLU 113  ? CG  ? C GLU 115 CG  
106 1 Y 1 C GLU 113  ? CD  ? C GLU 115 CD  
107 1 Y 1 C GLU 113  ? OE1 ? C GLU 115 OE1 
108 1 Y 1 C GLU 113  ? OE2 ? C GLU 115 OE2 
109 1 Y 1 C ASP 114  ? CG  ? C ASP 116 CG  
110 1 Y 1 C ASP 114  ? OD1 ? C ASP 116 OD1 
111 1 Y 1 C ASP 114  ? OD2 ? C ASP 116 OD2 
112 1 Y 1 C ARG 142  ? CG  ? C ARG 144 CG  
113 1 Y 1 C ARG 142  ? CD  ? C ARG 144 CD  
114 1 Y 1 C ARG 142  ? NE  ? C ARG 144 NE  
115 1 Y 1 C ARG 142  ? CZ  ? C ARG 144 CZ  
116 1 Y 1 C ARG 142  ? NH1 ? C ARG 144 NH1 
117 1 Y 1 C ARG 142  ? NH2 ? C ARG 144 NH2 
118 1 Y 1 C ARG 172  ? CG  ? C ARG 174 CG  
119 1 Y 1 C ARG 172  ? CD  ? C ARG 174 CD  
120 1 Y 1 C ARG 172  ? NE  ? C ARG 174 NE  
121 1 Y 1 C ARG 172  ? CZ  ? C ARG 174 CZ  
122 1 Y 1 C ARG 172  ? NH1 ? C ARG 174 NH1 
123 1 Y 1 C ARG 172  ? NH2 ? C ARG 174 NH2 
124 1 Y 1 C LYS 173  ? CG  ? C LYS 175 CG  
125 1 Y 1 C LYS 173  ? CD  ? C LYS 175 CD  
126 1 Y 1 C LYS 173  ? CE  ? C LYS 175 CE  
127 1 Y 1 C LYS 173  ? NZ  ? C LYS 175 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1   ? A GLY 1   
2  1 Y 1 A HIS 0    ? A HIS 2   
3  1 Y 1 A MET 1    ? A MET 3   
4  1 Y 1 A ALA 2    ? A ALA 4   
5  1 Y 1 A LYS 3    ? A LYS 5   
6  1 Y 1 A LYS 4    ? A LYS 6   
7  1 Y 1 B GLY 915  ? B GLY 1   
8  1 Y 1 B HIS 916  ? B HIS 2   
9  1 Y 1 B MET 917  ? B MET 3   
10 1 Y 1 B MET 1015 ? B MET 101 
11 1 Y 1 B ASN 1016 ? B ASN 102 
12 1 Y 1 B ARG 1017 ? B ARG 103 
13 1 Y 1 B GLU 1018 ? B GLU 104 
14 1 Y 1 B GLU 1019 ? B GLU 105 
15 1 Y 1 B ASN 1020 ? B ASN 106 
16 1 Y 1 B LEU 1021 ? B LEU 107 
17 1 Y 1 B LYS 1022 ? B LYS 108 
18 1 Y 1 B THR 1023 ? B THR 109 
19 1 Y 1 B ALA 1024 ? B ALA 110 
20 1 Y 1 B ALA 1025 ? B ALA 111 
21 1 Y 1 B LEU 1061 ? B LEU 147 
22 1 Y 1 B GLY 1062 ? B GLY 148 
23 1 Y 1 B THR 1063 ? B THR 149 
24 1 Y 1 B GLY 1064 ? B GLY 150 
25 1 Y 1 B ALA 1065 ? B ALA 151 
26 1 Y 1 B GLN 1066 ? B GLN 152 
27 1 Y 1 B GLY 1067 ? B GLY 153 
28 1 Y 1 C GLY -1   ? C GLY 1   
29 1 Y 1 C HIS 0    ? C HIS 2   
30 1 Y 1 C MET 1    ? C MET 3   
31 1 Y 1 C ALA 2    ? C ALA 4   
32 1 Y 1 C LYS 3    ? C LYS 5   
33 1 Y 1 C LYS 4    ? C LYS 6   
34 1 Y 1 C THR 5    ? C THR 7   
35 1 Y 1 C ARG 147  ? C ARG 149 
36 1 Y 1 C PHE 148  ? C PHE 150 
37 1 Y 1 C PHE 149  ? C PHE 151 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'German Research Foundation' Germany 'SFB642, grant A4' 1 
'Max Planck Society'         Germany ?                  2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION'                               MG  
4 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' GNP 
5 water                                         HOH 
#