data_5LSJ
# 
_entry.id   5LSJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LSJ         
WWPDB D_1200001287 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LSJ 
_pdbx_database_status.recvd_initial_deposition_date   2016-09-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vetter, I.R.' 1 
'Petrovic, A.' 2 
'Keller, J.'   3 
'Liu, Y.'      4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            167 
_citation.language                  ? 
_citation.page_first                1028 
_citation.page_last                 1040.e15 
_citation.title                     
'Structure of the MIS12 Complex and Molecular Basis of Its Interaction with CENP-C at Human Kinetochores.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2016.10.005 
_citation.pdbx_database_id_PubMed   27881301 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Petrovic, A.'    1  
primary 'Keller, J.'      2  
primary 'Liu, Y.'         3  
primary 'Overlack, K.'    4  
primary 'John, J.'        5  
primary 'Dimitrova, Y.N.' 6  
primary 'Jenni, S.'       7  
primary 'van Gerwen, S.'  8  
primary 'Stege, P.'       9  
primary 'Wohlgemuth, S.'  10 
primary 'Rombaut, P.'     11 
primary 'Herzog, F.'      12 
primary 'Harrison, S.C.'  13 
primary 'Vetter, I.R.'    14 
primary 'Musacchio, A.'   15 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   102.820 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LSJ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     68.160 
_cell.length_a_esd                 ? 
_cell.length_b                     156.400 
_cell.length_b_esd                 ? 
_cell.length_c                     76.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LSJ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protein MIS12 homolog'                       24170.922 2 ? ? ?                      ? 
2 polymer man 'Polyamine-modulated factor 1'                20522.359 2 ? ? 'UNP residues 31-205'  ? 
3 polymer man 'Kinetochore-associated protein DSN1 homolog' 20252.930 2 ? ? 'UNP residues 186-356' ? 
4 polymer man 'Kinetochore-associated protein NSL1 homolog' 13331.376 2 ? ? 'UNP residues 92-206'  ? 
5 polymer man 'Centromere protein C'                        8501.529  2 ? ? 'UNP residues 1-71'    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 PMF-1                                                                                                     
5 'CENP-C,Centromere autoantigen C,Centromere protein C 1,CENP-C 1,Interphase centromere complex protein 7' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCFMKGHFDNLFS
KMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFD
ELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS
;
;MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCFMKGHFDNLFS
KMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFD
ELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS
;
A,C ? 
2 'polypeptide(L)' no no 
;MTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALD
KIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQA
LHREQRELVAVLREPE
;
;MTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALD
KIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQA
LHREQRELVAVLREPE
;
B,E ? 
3 'polypeptide(L)' no no 
;MGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQ
NEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNP
PAIHGSGSGSCQHHHHHH
;
;MGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQ
NEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNP
PAIHGSGSGSCQHHHHHH
;
D,F ? 
4 'polypeptide(L)' no no 
;MGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHM
ENLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLR
;
;MGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHM
ENLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLR
;
N,G ? 
5 'polypeptide(L)' no no GPLGSMAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTCI 
GPLGSMAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTCI P,Q ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   VAL n 
1 4   ASP n 
1 5   PRO n 
1 6   MET n 
1 7   THR n 
1 8   TYR n 
1 9   GLU n 
1 10  ALA n 
1 11  GLN n 
1 12  PHE n 
1 13  PHE n 
1 14  GLY n 
1 15  PHE n 
1 16  THR n 
1 17  PRO n 
1 18  GLN n 
1 19  THR n 
1 20  CYS n 
1 21  MET n 
1 22  LEU n 
1 23  ARG n 
1 24  ILE n 
1 25  TYR n 
1 26  ILE n 
1 27  ALA n 
1 28  PHE n 
1 29  GLN n 
1 30  ASP n 
1 31  TYR n 
1 32  LEU n 
1 33  PHE n 
1 34  GLU n 
1 35  VAL n 
1 36  MET n 
1 37  GLN n 
1 38  ALA n 
1 39  VAL n 
1 40  GLU n 
1 41  GLN n 
1 42  VAL n 
1 43  ILE n 
1 44  LEU n 
1 45  LYS n 
1 46  LYS n 
1 47  LEU n 
1 48  ASP n 
1 49  GLY n 
1 50  ILE n 
1 51  PRO n 
1 52  ASP n 
1 53  CYS n 
1 54  ASP n 
1 55  ILE n 
1 56  SER n 
1 57  PRO n 
1 58  VAL n 
1 59  GLN n 
1 60  ILE n 
1 61  ARG n 
1 62  LYS n 
1 63  CYS n 
1 64  THR n 
1 65  GLU n 
1 66  LYS n 
1 67  PHE n 
1 68  LEU n 
1 69  CYS n 
1 70  PHE n 
1 71  MET n 
1 72  LYS n 
1 73  GLY n 
1 74  HIS n 
1 75  PHE n 
1 76  ASP n 
1 77  ASN n 
1 78  LEU n 
1 79  PHE n 
1 80  SER n 
1 81  LYS n 
1 82  MET n 
1 83  GLU n 
1 84  GLN n 
1 85  LEU n 
1 86  PHE n 
1 87  LEU n 
1 88  GLN n 
1 89  LEU n 
1 90  ILE n 
1 91  LEU n 
1 92  ARG n 
1 93  ILE n 
1 94  PRO n 
1 95  SER n 
1 96  ASN n 
1 97  ILE n 
1 98  LEU n 
1 99  LEU n 
1 100 PRO n 
1 101 GLU n 
1 102 ASP n 
1 103 LYS n 
1 104 CYS n 
1 105 LYS n 
1 106 GLU n 
1 107 THR n 
1 108 PRO n 
1 109 TYR n 
1 110 SER n 
1 111 GLU n 
1 112 GLU n 
1 113 ASP n 
1 114 PHE n 
1 115 GLN n 
1 116 HIS n 
1 117 LEU n 
1 118 GLN n 
1 119 LYS n 
1 120 GLU n 
1 121 ILE n 
1 122 GLU n 
1 123 GLN n 
1 124 LEU n 
1 125 GLN n 
1 126 GLU n 
1 127 LYS n 
1 128 TYR n 
1 129 LYS n 
1 130 THR n 
1 131 GLU n 
1 132 LEU n 
1 133 CYS n 
1 134 THR n 
1 135 LYS n 
1 136 GLN n 
1 137 ALA n 
1 138 LEU n 
1 139 LEU n 
1 140 ALA n 
1 141 GLU n 
1 142 LEU n 
1 143 GLU n 
1 144 GLU n 
1 145 GLN n 
1 146 LYS n 
1 147 ILE n 
1 148 VAL n 
1 149 GLN n 
1 150 ALA n 
1 151 LYS n 
1 152 LEU n 
1 153 LYS n 
1 154 GLN n 
1 155 THR n 
1 156 LEU n 
1 157 THR n 
1 158 PHE n 
1 159 PHE n 
1 160 ASP n 
1 161 GLU n 
1 162 LEU n 
1 163 HIS n 
1 164 ASN n 
1 165 VAL n 
1 166 GLY n 
1 167 ARG n 
1 168 ASP n 
1 169 HIS n 
1 170 GLY n 
1 171 THR n 
1 172 SER n 
1 173 ASP n 
1 174 PHE n 
1 175 ARG n 
1 176 GLU n 
1 177 SER n 
1 178 LEU n 
1 179 VAL n 
1 180 SER n 
1 181 LEU n 
1 182 VAL n 
1 183 GLN n 
1 184 ASN n 
1 185 SER n 
1 186 ARG n 
1 187 LYS n 
1 188 LEU n 
1 189 GLN n 
1 190 ASN n 
1 191 ILE n 
1 192 ARG n 
1 193 ASP n 
1 194 ASN n 
1 195 VAL n 
1 196 GLU n 
1 197 LYS n 
1 198 GLU n 
1 199 SER n 
1 200 LYS n 
1 201 ARG n 
1 202 LEU n 
1 203 LYS n 
1 204 ILE n 
1 205 SER n 
2 1   MET n 
2 2   THR n 
2 3   ILE n 
2 4   SER n 
2 5   ARG n 
2 6   VAL n 
2 7   LYS n 
2 8   LEU n 
2 9   LEU n 
2 10  ASP n 
2 11  THR n 
2 12  MET n 
2 13  VAL n 
2 14  ASP n 
2 15  THR n 
2 16  PHE n 
2 17  LEU n 
2 18  GLN n 
2 19  LYS n 
2 20  LEU n 
2 21  VAL n 
2 22  ALA n 
2 23  ALA n 
2 24  GLY n 
2 25  SER n 
2 26  TYR n 
2 27  GLN n 
2 28  ARG n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  CYS n 
2 33  TYR n 
2 34  LYS n 
2 35  CYS n 
2 36  PHE n 
2 37  TYR n 
2 38  GLN n 
2 39  LEU n 
2 40  GLN n 
2 41  PRO n 
2 42  ALA n 
2 43  MET n 
2 44  THR n 
2 45  GLN n 
2 46  GLN n 
2 47  ILE n 
2 48  TYR n 
2 49  ASP n 
2 50  LYS n 
2 51  PHE n 
2 52  ILE n 
2 53  ALA n 
2 54  GLN n 
2 55  LEU n 
2 56  GLN n 
2 57  THR n 
2 58  SER n 
2 59  ILE n 
2 60  ARG n 
2 61  GLU n 
2 62  GLU n 
2 63  ILE n 
2 64  SER n 
2 65  ASP n 
2 66  ILE n 
2 67  LYS n 
2 68  GLU n 
2 69  GLU n 
2 70  GLY n 
2 71  ASN n 
2 72  LEU n 
2 73  GLU n 
2 74  ALA n 
2 75  VAL n 
2 76  LEU n 
2 77  ASN n 
2 78  ALA n 
2 79  LEU n 
2 80  ASP n 
2 81  LYS n 
2 82  ILE n 
2 83  VAL n 
2 84  GLU n 
2 85  GLU n 
2 86  GLY n 
2 87  LYS n 
2 88  VAL n 
2 89  ARG n 
2 90  LYS n 
2 91  GLU n 
2 92  PRO n 
2 93  ALA n 
2 94  TRP n 
2 95  ARG n 
2 96  PRO n 
2 97  SER n 
2 98  GLY n 
2 99  ILE n 
2 100 PRO n 
2 101 GLU n 
2 102 LYS n 
2 103 ASP n 
2 104 LEU n 
2 105 HIS n 
2 106 SER n 
2 107 VAL n 
2 108 MET n 
2 109 ALA n 
2 110 PRO n 
2 111 TYR n 
2 112 PHE n 
2 113 LEU n 
2 114 GLN n 
2 115 GLN n 
2 116 ARG n 
2 117 ASP n 
2 118 THR n 
2 119 LEU n 
2 120 ARG n 
2 121 ARG n 
2 122 HIS n 
2 123 VAL n 
2 124 GLN n 
2 125 LYS n 
2 126 GLN n 
2 127 GLU n 
2 128 ALA n 
2 129 GLU n 
2 130 ASN n 
2 131 GLN n 
2 132 GLN n 
2 133 LEU n 
2 134 ALA n 
2 135 ASP n 
2 136 ALA n 
2 137 VAL n 
2 138 LEU n 
2 139 ALA n 
2 140 GLY n 
2 141 ARG n 
2 142 ARG n 
2 143 GLN n 
2 144 VAL n 
2 145 GLU n 
2 146 GLU n 
2 147 LEU n 
2 148 GLN n 
2 149 LEU n 
2 150 GLN n 
2 151 VAL n 
2 152 GLN n 
2 153 ALA n 
2 154 GLN n 
2 155 GLN n 
2 156 GLN n 
2 157 ALA n 
2 158 TRP n 
2 159 GLN n 
2 160 ALA n 
2 161 LEU n 
2 162 HIS n 
2 163 ARG n 
2 164 GLU n 
2 165 GLN n 
2 166 ARG n 
2 167 GLU n 
2 168 LEU n 
2 169 VAL n 
2 170 ALA n 
2 171 VAL n 
2 172 LEU n 
2 173 ARG n 
2 174 GLU n 
2 175 PRO n 
2 176 GLU n 
3 1   MET n 
3 2   GLY n 
3 3   THR n 
3 4   LEU n 
3 5   GLN n 
3 6   LYS n 
3 7   CYS n 
3 8   PHE n 
3 9   GLU n 
3 10  ASP n 
3 11  SER n 
3 12  ASN n 
3 13  GLY n 
3 14  LYS n 
3 15  ALA n 
3 16  SER n 
3 17  ASP n 
3 18  PHE n 
3 19  SER n 
3 20  LEU n 
3 21  GLU n 
3 22  ALA n 
3 23  SER n 
3 24  VAL n 
3 25  ALA n 
3 26  GLU n 
3 27  MET n 
3 28  LYS n 
3 29  GLU n 
3 30  TYR n 
3 31  ILE n 
3 32  THR n 
3 33  LYS n 
3 34  PHE n 
3 35  SER n 
3 36  LEU n 
3 37  GLU n 
3 38  ARG n 
3 39  GLN n 
3 40  THR n 
3 41  TRP n 
3 42  ASP n 
3 43  GLN n 
3 44  LEU n 
3 45  LEU n 
3 46  LEU n 
3 47  HIS n 
3 48  TYR n 
3 49  GLN n 
3 50  GLN n 
3 51  GLU n 
3 52  ALA n 
3 53  LYS n 
3 54  GLU n 
3 55  ILE n 
3 56  LEU n 
3 57  SER n 
3 58  ARG n 
3 59  GLY n 
3 60  SER n 
3 61  THR n 
3 62  GLU n 
3 63  ALA n 
3 64  LYS n 
3 65  ILE n 
3 66  THR n 
3 67  GLU n 
3 68  VAL n 
3 69  LYS n 
3 70  VAL n 
3 71  GLU n 
3 72  PRO n 
3 73  MET n 
3 74  THR n 
3 75  TYR n 
3 76  LEU n 
3 77  GLY n 
3 78  SER n 
3 79  SER n 
3 80  GLN n 
3 81  ASN n 
3 82  GLU n 
3 83  VAL n 
3 84  LEU n 
3 85  ASN n 
3 86  THR n 
3 87  LYS n 
3 88  PRO n 
3 89  ASP n 
3 90  TYR n 
3 91  GLN n 
3 92  LYS n 
3 93  ILE n 
3 94  LEU n 
3 95  GLN n 
3 96  ASN n 
3 97  GLN n 
3 98  SER n 
3 99  LYS n 
3 100 VAL n 
3 101 PHE n 
3 102 ASP n 
3 103 CYS n 
3 104 MET n 
3 105 GLU n 
3 106 LEU n 
3 107 VAL n 
3 108 MET n 
3 109 ASP n 
3 110 GLU n 
3 111 LEU n 
3 112 GLN n 
3 113 GLY n 
3 114 SER n 
3 115 VAL n 
3 116 LYS n 
3 117 GLN n 
3 118 LEU n 
3 119 GLN n 
3 120 ALA n 
3 121 PHE n 
3 122 MET n 
3 123 ASP n 
3 124 GLU n 
3 125 SER n 
3 126 THR n 
3 127 GLN n 
3 128 CYS n 
3 129 PHE n 
3 130 GLN n 
3 131 LYS n 
3 132 VAL n 
3 133 SER n 
3 134 VAL n 
3 135 GLN n 
3 136 LEU n 
3 137 GLY n 
3 138 LYS n 
3 139 ARG n 
3 140 SER n 
3 141 MET n 
3 142 GLN n 
3 143 GLN n 
3 144 LEU n 
3 145 ASP n 
3 146 PRO n 
3 147 SER n 
3 148 PRO n 
3 149 ALA n 
3 150 ARG n 
3 151 LYS n 
3 152 LEU n 
3 153 LEU n 
3 154 LYS n 
3 155 LEU n 
3 156 GLN n 
3 157 LEU n 
3 158 GLN n 
3 159 ASN n 
3 160 PRO n 
3 161 PRO n 
3 162 ALA n 
3 163 ILE n 
3 164 HIS n 
3 165 GLY n 
3 166 SER n 
3 167 GLY n 
3 168 SER n 
3 169 GLY n 
3 170 SER n 
3 171 CYS n 
3 172 GLN n 
3 173 HIS n 
3 174 HIS n 
3 175 HIS n 
3 176 HIS n 
3 177 HIS n 
3 178 HIS n 
4 1   MET n 
4 2   GLY n 
4 3   GLN n 
4 4   ALA n 
4 5   TRP n 
4 6   GLN n 
4 7   GLU n 
4 8   ALA n 
4 9   SER n 
4 10  ASP n 
4 11  ASN n 
4 12  CYS n 
4 13  PHE n 
4 14  MET n 
4 15  ASP n 
4 16  SER n 
4 17  ASP n 
4 18  ILE n 
4 19  LYS n 
4 20  VAL n 
4 21  LEU n 
4 22  GLU n 
4 23  ASP n 
4 24  GLN n 
4 25  PHE n 
4 26  ASP n 
4 27  GLU n 
4 28  ILE n 
4 29  ILE n 
4 30  VAL n 
4 31  ASP n 
4 32  ILE n 
4 33  ALA n 
4 34  THR n 
4 35  LYS n 
4 36  ARG n 
4 37  LYS n 
4 38  GLN n 
4 39  TYR n 
4 40  PRO n 
4 41  ARG n 
4 42  LYS n 
4 43  ILE n 
4 44  LEU n 
4 45  GLU n 
4 46  CYS n 
4 47  VAL n 
4 48  ILE n 
4 49  LYS n 
4 50  THR n 
4 51  ILE n 
4 52  LYS n 
4 53  ALA n 
4 54  LYS n 
4 55  GLN n 
4 56  GLU n 
4 57  ILE n 
4 58  LEU n 
4 59  LYS n 
4 60  GLN n 
4 61  TYR n 
4 62  HIS n 
4 63  PRO n 
4 64  VAL n 
4 65  VAL n 
4 66  HIS n 
4 67  PRO n 
4 68  LEU n 
4 69  ASP n 
4 70  LEU n 
4 71  LYS n 
4 72  TYR n 
4 73  ASP n 
4 74  PRO n 
4 75  ASP n 
4 76  PRO n 
4 77  ALA n 
4 78  PRO n 
4 79  HIS n 
4 80  MET n 
4 81  GLU n 
4 82  ASN n 
4 83  LEU n 
4 84  LYS n 
4 85  CYS n 
4 86  ARG n 
4 87  GLY n 
4 88  GLU n 
4 89  THR n 
4 90  VAL n 
4 91  ALA n 
4 92  LYS n 
4 93  GLU n 
4 94  ILE n 
4 95  SER n 
4 96  GLU n 
4 97  ALA n 
4 98  MET n 
4 99  LYS n 
4 100 SER n 
4 101 LEU n 
4 102 PRO n 
4 103 ALA n 
4 104 LEU n 
4 105 ILE n 
4 106 GLU n 
4 107 GLN n 
4 108 GLY n 
4 109 GLU n 
4 110 GLY n 
4 111 PHE n 
4 112 SER n 
4 113 GLN n 
4 114 VAL n 
4 115 LEU n 
4 116 ARG n 
5 1   GLY n 
5 2   PRO n 
5 3   LEU n 
5 4   GLY n 
5 5   SER n 
5 6   MET n 
5 7   ALA n 
5 8   ALA n 
5 9   SER n 
5 10  GLY n 
5 11  LEU n 
5 12  ASP n 
5 13  HIS n 
5 14  LEU n 
5 15  LYS n 
5 16  ASN n 
5 17  GLY n 
5 18  TYR n 
5 19  ARG n 
5 20  ARG n 
5 21  ARG n 
5 22  PHE n 
5 23  CYS n 
5 24  ARG n 
5 25  PRO n 
5 26  SER n 
5 27  ARG n 
5 28  ALA n 
5 29  ARG n 
5 30  ASP n 
5 31  ILE n 
5 32  ASN n 
5 33  THR n 
5 34  GLU n 
5 35  GLN n 
5 36  GLY n 
5 37  GLN n 
5 38  ASN n 
5 39  VAL n 
5 40  LEU n 
5 41  GLU n 
5 42  ILE n 
5 43  LEU n 
5 44  GLN n 
5 45  ASP n 
5 46  CYS n 
5 47  PHE n 
5 48  GLU n 
5 49  GLU n 
5 50  LYS n 
5 51  SER n 
5 52  LEU n 
5 53  ALA n 
5 54  ASN n 
5 55  ASP n 
5 56  PHE n 
5 57  SER n 
5 58  THR n 
5 59  ASN n 
5 60  SER n 
5 61  THR n 
5 62  LYS n 
5 63  SER n 
5 64  VAL n 
5 65  PRO n 
5 66  ASN n 
5 67  SER n 
5 68  THR n 
5 69  ARG n 
5 70  LYS n 
5 71  ILE n 
5 72  LYS n 
5 73  ASP n 
5 74  THR n 
5 75  CYS n 
5 76  ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 205 Human ? MIS12                             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? codon-plus-RIL ? ? ? ? ? ? plasmid ? ? ? pST39 ? ? 
2 1 sample 'Biological sequence' 1 176 Human ? PMF1                              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? codon-plus-RIL ? ? ? ? ? ? plasmid ? ? ? pST39 ? ? 
3 1 sample 'Biological sequence' 1 178 Human ? 'DSN1, C20orf172, MIS13'          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? codon-plus-RIL ? ? ? ? ? ? plasmid ? ? ? pST39 ? ? 
4 1 sample 'Biological sequence' 1 116 Human ? 'NSL1, C1orf48, DC31, DC8, MIS14' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? codon-plus-RIL ? ? ? ? ? ? plasmid ? ? ? pST39 ? ? 
5 1 sample 'Biological sequence' 1 76  Human ? 'CENPC, CENPC1, ICEN7'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? codon-plus-RIL ? ? ? ? ? ? plasmid ? ? ? pST39 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MIS12_HUMAN Q9H081 ? 1 
;MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCFMKGHFDNLFS
KMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFD
ELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS
;
1   
2 UNP PMF1_HUMAN  Q6P1K2 ? 2 
;TISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDK
IVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQAL
HREQRELVAVLREPE
;
31  
3 UNP DSN1_HUMAN  Q9H410 ? 3 
;GTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQN
EVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPP
AIHGSGSGSCQ
;
186 
4 UNP NSL1_HUMAN  Q96IY1 ? 4 
;GQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYPRKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHME
NLKCRGETVAKEISEAMKSLPALIEQGEGFSQVLR
;
92  
5 UNP CENPC_HUMAN Q03188 ? 5 MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTCI 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5LSJ A 1 ? 205 ? Q9H081 1   ? 205 ? 1   205 
2  2 5LSJ B 2 ? 176 ? Q6P1K2 31  ? 205 ? 31  205 
3  3 5LSJ D 2 ? 172 ? Q9H410 186 ? 356 ? 186 356 
4  4 5LSJ N 2 ? 116 ? Q96IY1 92  ? 206 ? 92  206 
5  5 5LSJ P 6 ? 76  ? Q03188 1   ? 71  ? 1   71  
6  1 5LSJ C 1 ? 205 ? Q9H081 1   ? 205 ? 1   205 
7  2 5LSJ E 2 ? 176 ? Q6P1K2 31  ? 205 ? 31  205 
8  3 5LSJ F 2 ? 172 ? Q9H410 186 ? 356 ? 186 356 
9  4 5LSJ G 2 ? 116 ? Q96IY1 92  ? 206 ? 92  206 
10 5 5LSJ Q 6 ? 76  ? Q03188 1   ? 71  ? 1   71  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2  5LSJ MET B 1   ? UNP Q6P1K2 ? ? 'initiating methionine' 30  1  
3  5LSJ MET D 1   ? UNP Q9H410 ? ? 'initiating methionine' 185 2  
3  5LSJ HIS D 173 ? UNP Q9H410 ? ? 'expression tag'        357 3  
3  5LSJ HIS D 174 ? UNP Q9H410 ? ? 'expression tag'        358 4  
3  5LSJ HIS D 175 ? UNP Q9H410 ? ? 'expression tag'        359 5  
3  5LSJ HIS D 176 ? UNP Q9H410 ? ? 'expression tag'        360 6  
3  5LSJ HIS D 177 ? UNP Q9H410 ? ? 'expression tag'        361 7  
3  5LSJ HIS D 178 ? UNP Q9H410 ? ? 'expression tag'        362 8  
4  5LSJ MET N 1   ? UNP Q96IY1 ? ? 'initiating methionine' 91  9  
5  5LSJ GLY P 1   ? UNP Q03188 ? ? 'expression tag'        -4  10 
5  5LSJ PRO P 2   ? UNP Q03188 ? ? 'expression tag'        -3  11 
5  5LSJ LEU P 3   ? UNP Q03188 ? ? 'expression tag'        -2  12 
5  5LSJ GLY P 4   ? UNP Q03188 ? ? 'expression tag'        -1  13 
5  5LSJ SER P 5   ? UNP Q03188 ? ? 'expression tag'        0   14 
7  5LSJ MET E 1   ? UNP Q6P1K2 ? ? 'initiating methionine' 30  15 
8  5LSJ MET F 1   ? UNP Q9H410 ? ? 'initiating methionine' 185 16 
8  5LSJ HIS F 173 ? UNP Q9H410 ? ? 'expression tag'        357 17 
8  5LSJ HIS F 174 ? UNP Q9H410 ? ? 'expression tag'        358 18 
8  5LSJ HIS F 175 ? UNP Q9H410 ? ? 'expression tag'        359 19 
8  5LSJ HIS F 176 ? UNP Q9H410 ? ? 'expression tag'        360 20 
8  5LSJ HIS F 177 ? UNP Q9H410 ? ? 'expression tag'        361 21 
8  5LSJ HIS F 178 ? UNP Q9H410 ? ? 'expression tag'        362 22 
9  5LSJ MET G 1   ? UNP Q96IY1 ? ? 'initiating methionine' 91  23 
10 5LSJ GLY Q 1   ? UNP Q03188 ? ? 'expression tag'        -4  24 
10 5LSJ PRO Q 2   ? UNP Q03188 ? ? 'expression tag'        -3  25 
10 5LSJ LEU Q 3   ? UNP Q03188 ? ? 'expression tag'        -2  26 
10 5LSJ GLY Q 4   ? UNP Q03188 ? ? 'expression tag'        -1  27 
10 5LSJ SER Q 5   ? UNP Q03188 ? ? 'expression tag'        0   28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LSJ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.9 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.1 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% PEG3350, 0.2M potassium sodium tartrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-03-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97857 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97857 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            48.372 
_reflns.entry_id                         5LSJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.000 
_reflns.d_resolution_low                 45.5 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       31073 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  23.7 
_reflns.pdbx_Rmerge_I_obs                0.351 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.470 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.000  3.080  ? 3.890  ? ? ? ? ? 100.000 ? ? ? ? 1.026 ? ? ? ? ? ? ? ? 24.82 ? ? ? ? ? ? ? 1  1 ? ? 
3.080  3.160  ? 4.100  ? ? ? ? ? 100.000 ? ? ? ? 0.978 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 2  1 ? ? 
3.160  3.250  ? 4.210  ? ? ? ? ? 99.800  ? ? ? ? 0.949 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 3  1 ? ? 
3.250  3.350  ? 4.730  ? ? ? ? ? 100.000 ? ? ? ? 0.868 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 4  1 ? ? 
3.350  3.460  ? 5.110  ? ? ? ? ? 99.800  ? ? ? ? 0.814 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 5  1 ? ? 
3.460  3.590  ? 5.630  ? ? ? ? ? 99.800  ? ? ? ? 0.730 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 6  1 ? ? 
3.590  3.720  ? 6.850  ? ? ? ? ? 100.000 ? ? ? ? 0.609 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 7  1 ? ? 
3.720  3.870  ? 7.470  ? ? ? ? ? 99.800  ? ? ? ? 0.535 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 8  1 ? ? 
3.870  4.050  ? 8.370  ? ? ? ? ? 99.900  ? ? ? ? 0.443 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 9  1 ? ? 
4.050  4.240  ? 9.690  ? ? ? ? ? 99.900  ? ? ? ? 0.363 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 10 1 ? ? 
4.240  4.470  ? 11.300 ? ? ? ? ? 100.000 ? ? ? ? 0.323 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 11 1 ? ? 
4.470  4.740  ? 13.030 ? ? ? ? ? 99.400  ? ? ? ? 0.276 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 12 1 ? ? 
4.740  5.070  ? 13.950 ? ? ? ? ? 99.700  ? ? ? ? 0.244 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 13 1 ? ? 
5.070  5.480  ? 13.320 ? ? ? ? ? 99.900  ? ? ? ? 0.271 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 14 1 ? ? 
5.480  6.000  ? 12.090 ? ? ? ? ? 99.900  ? ? ? ? 0.308 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 15 1 ? ? 
6.000  6.710  ? 12.860 ? ? ? ? ? 100.000 ? ? ? ? 0.294 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 16 1 ? ? 
6.710  7.750  ? 17.490 ? ? ? ? ? 99.500  ? ? ? ? 0.182 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 17 1 ? ? 
7.750  9.490  ? 26.740 ? ? ? ? ? 100.000 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 18 1 ? ? 
9.490  13.420 ? 33.560 ? ? ? ? ? 100.000 ? ? ? ? 0.091 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 19 1 ? ? 
13.420 ?      ? 32.600 ? ? ? ? ? 96.000  ? ? ? ? 0.085 ? ? ? ? ? ? ? ? ?     ? ? ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                150.630 
_refine.B_iso_mean                               54.8084 
_refine.B_iso_min                                10.910 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5LSJ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.2500 
_refine.ls_d_res_low                             19.9930 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24286 
_refine.ls_number_reflns_R_free                  1214 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.6900 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2488 
_refine.ls_R_factor_R_free                       0.2971 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2463 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.390 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5LSK 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 34.3400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.6300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9621 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               9621 
_refine_hist.d_res_high                       3.2500 
_refine_hist.d_res_low                        19.9930 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 9773  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.815  ? 13140 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.044  ? 1461  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 1708  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 19.846 ? 6097  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2500 3.3795  2682 . 134 2548 100.0000 . . . 0.4255 . 0.3544 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.3795 3.5326  2701 . 136 2565 100.0000 . . . 0.3770 . 0.3170 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.5326 3.7177  2683 . 133 2550 100.0000 . . . 0.3131 . 0.2695 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.7177 3.9489  2705 . 135 2570 100.0000 . . . 0.2985 . 0.2512 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.9489 4.2511  2694 . 135 2559 99.0000  . . . 0.3466 . 0.2419 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 4.2511 4.6740  2687 . 134 2553 99.0000  . . . 0.2758 . 0.2240 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 4.6740 5.3390  2689 . 135 2554 99.0000  . . . 0.2817 . 0.2264 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 5.3390 6.6846  2708 . 135 2573 100.0000 . . . 0.3014 . 0.2611 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 6.6846 19.9933 2737 . 137 2600 100.0000 . . . 0.2119 . 0.1872 . . . . . . 9 . . . 
# 
_struct.entry_id                     5LSJ 
_struct.title                        'CRYSTAL STRUCTURE OF THE HUMAN KINETOCHORE MIS12-CENP-C delta-HEAD2 COMPLEX' 
_struct.pdbx_descriptor              
;Protein MIS12 homolog, Polyamine-modulated factor 1, Kinetochore-associated protein DSN1 homolog, Kinetochore-associated protein NSL1 homolog, Centromere protein C
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LSJ 
_struct_keywords.text            'ALPHA-HELICAL, cell cycle' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 16  ? ASP A 48  ? THR A 16  ASP A 48  1 ? 33 
HELX_P HELX_P2  AA2 SER A 56  ? ILE A 90  ? SER A 56  ILE A 90  1 ? 35 
HELX_P HELX_P3  AA3 LEU A 99  ? THR A 107 ? LEU A 99  THR A 107 5 ? 9  
HELX_P HELX_P4  AA4 SER A 110 ? ASP A 168 ? SER A 110 ASP A 168 1 ? 59 
HELX_P HELX_P5  AA5 ASP A 173 ? GLU A 198 ? ASP A 173 GLU A 198 1 ? 26 
HELX_P HELX_P6  AA6 ARG B 5   ? ALA B 23  ? ARG B 34  ALA B 52  1 ? 19 
HELX_P HELX_P7  AA7 TYR B 26  ? TYR B 33  ? TYR B 55  TYR B 62  1 ? 8  
HELX_P HELX_P8  AA8 TYR B 33  ? GLN B 38  ? TYR B 62  GLN B 67  1 ? 6  
HELX_P HELX_P9  AA9 GLN B 40  ? GLU B 68  ? GLN B 69  GLU B 97  1 ? 29 
HELX_P HELX_P10 AB1 ASN B 71  ? LYS B 87  ? ASN B 100 LYS B 116 1 ? 17 
HELX_P HELX_P11 AB2 ILE B 99  ? ALA B 160 ? ILE B 128 ALA B 189 1 ? 62 
HELX_P HELX_P12 AB3 ALA B 160 ? LEU B 172 ? ALA B 189 LEU B 201 1 ? 13 
HELX_P HELX_P13 AB4 LEU C 20  ? GLY C 59  ? LEU D 204 GLY D 243 1 ? 40 
HELX_P HELX_P14 AB5 GLN C 80  ? THR C 86  ? GLN D 264 THR D 270 1 ? 7  
HELX_P HELX_P15 AB6 ASP C 89  ? LYS C 131 ? ASP D 273 LYS D 315 1 ? 43 
HELX_P HELX_P16 AB7 ASP D 15  ? GLN D 60  ? ASP N 105 GLN N 150 1 ? 46 
HELX_P HELX_P17 AB8 HIS D 79  ? PHE D 111 ? HIS N 169 PHE N 201 1 ? 33 
HELX_P HELX_P18 AB9 THR F 16  ? GLY F 49  ? THR C 16  GLY C 49  1 ? 34 
HELX_P HELX_P19 AC1 PRO F 57  ? ILE F 90  ? PRO C 57  ILE C 90  1 ? 34 
HELX_P HELX_P20 AC2 LEU F 99  ? LYS F 103 ? LEU C 99  LYS C 103 5 ? 5  
HELX_P HELX_P21 AC3 SER F 110 ? ASP F 168 ? SER C 110 ASP C 168 1 ? 59 
HELX_P HELX_P22 AC4 ASP F 173 ? SER F 199 ? ASP C 173 SER C 199 1 ? 27 
HELX_P HELX_P23 AC5 ARG G 5   ? ALA G 23  ? ARG E 34  ALA E 52  1 ? 19 
HELX_P HELX_P24 AC6 SER G 25  ? ASP G 31  ? SER E 54  ASP E 60  1 ? 7  
HELX_P HELX_P25 AC7 TYR G 33  ? GLN G 38  ? TYR E 62  GLN E 67  1 ? 6  
HELX_P HELX_P26 AC8 GLN G 40  ? GLU G 68  ? GLN E 69  GLU E 97  1 ? 29 
HELX_P HELX_P27 AC9 ASN G 71  ? LYS G 87  ? ASN E 100 LYS E 116 1 ? 17 
HELX_P HELX_P28 AD1 ILE G 99  ? ALA G 160 ? ILE E 128 ALA E 189 1 ? 62 
HELX_P HELX_P29 AD2 ALA G 160 ? LEU G 172 ? ALA E 189 LEU E 201 1 ? 13 
HELX_P HELX_P30 AD3 LEU H 20  ? GLY H 59  ? LEU F 204 GLY F 243 1 ? 40 
HELX_P HELX_P31 AD4 GLN H 80  ? THR H 86  ? GLN F 264 THR F 270 1 ? 7  
HELX_P HELX_P32 AD5 ASP H 89  ? LYS H 131 ? ASP F 273 LYS F 315 1 ? 43 
HELX_P HELX_P33 AD6 MET I 14  ? GLN I 60  ? MET G 104 GLN G 150 1 ? 47 
HELX_P HELX_P34 AD7 HIS I 79  ? PHE I 111 ? HIS G 169 PHE G 201 1 ? 33 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           56 
_struct_mon_prot_cis.label_asym_id          F 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            56 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    57 
_struct_mon_prot_cis.pdbx_label_asym_id_2   F 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     57 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -14.62 
# 
_atom_sites.entry_id                    5LSJ 
_atom_sites.fract_transf_matrix[1][1]   0.014671 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003338 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006394 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013494 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . SER A 1 2   ? 76.444 -4.345   26.282 1.00 63.56  ? 2   SER A N   1 
ATOM 2    C CA  . SER A 1 2   ? 75.680 -3.180   25.847 1.00 73.75  ? 2   SER A CA  1 
ATOM 3    C C   . SER A 1 2   ? 74.555 -3.574   24.892 1.00 65.11  ? 2   SER A C   1 
ATOM 4    O O   . SER A 1 2   ? 74.302 -4.758   24.674 1.00 58.84  ? 2   SER A O   1 
ATOM 5    C CB  . SER A 1 2   ? 76.598 -2.154   25.177 1.00 79.26  ? 2   SER A CB  1 
ATOM 6    O OG  . SER A 1 2   ? 77.186 -2.684   24.001 1.00 76.16  ? 2   SER A OG  1 
ATOM 7    N N   . VAL A 1 3   ? 73.910 -2.560   24.310 1.00 69.01  ? 3   VAL A N   1 
ATOM 8    C CA  . VAL A 1 3   ? 72.834 -2.720   23.332 1.00 63.59  ? 3   VAL A CA  1 
ATOM 9    C C   . VAL A 1 3   ? 71.769 -3.671   23.858 1.00 55.94  ? 3   VAL A C   1 
ATOM 10   O O   . VAL A 1 3   ? 71.592 -4.775   23.334 1.00 63.48  ? 3   VAL A O   1 
ATOM 11   C CB  . VAL A 1 3   ? 73.375 -3.214   21.978 1.00 61.89  ? 3   VAL A CB  1 
ATOM 12   C CG1 . VAL A 1 3   ? 72.344 -2.991   20.874 1.00 48.29  ? 3   VAL A CG1 1 
ATOM 13   C CG2 . VAL A 1 3   ? 74.668 -2.514   21.649 1.00 65.54  ? 3   VAL A CG2 1 
ATOM 14   N N   . ASP A 1 4   ? 71.057 -3.251   24.900 1.00 52.72  ? 4   ASP A N   1 
ATOM 15   C CA  . ASP A 1 4   ? 69.979 -4.053   25.460 1.00 48.58  ? 4   ASP A CA  1 
ATOM 16   C C   . ASP A 1 4   ? 68.692 -3.747   24.706 1.00 45.03  ? 4   ASP A C   1 
ATOM 17   O O   . ASP A 1 4   ? 68.140 -2.648   24.871 1.00 54.94  ? 4   ASP A O   1 
ATOM 18   C CB  . ASP A 1 4   ? 69.815 -3.758   26.941 1.00 45.71  ? 4   ASP A CB  1 
ATOM 19   C CG  . ASP A 1 4   ? 68.749 -4.608   27.589 1.00 49.57  ? 4   ASP A CG  1 
ATOM 20   O OD1 . ASP A 1 4   ? 68.295 -4.238   28.691 1.00 51.61  ? 4   ASP A OD1 1 
ATOM 21   O OD2 . ASP A 1 4   ? 68.369 -5.646   27.006 1.00 60.95  ? 4   ASP A OD2 1 
ATOM 22   N N   . PRO A 1 5   ? 68.173 -4.665   23.886 1.00 39.01  ? 5   PRO A N   1 
ATOM 23   C CA  . PRO A 1 5   ? 66.916 -4.386   23.177 1.00 43.21  ? 5   PRO A CA  1 
ATOM 24   C C   . PRO A 1 5   ? 65.694 -4.420   24.075 1.00 40.37  ? 5   PRO A C   1 
ATOM 25   O O   . PRO A 1 5   ? 64.628 -3.957   23.648 1.00 37.91  ? 5   PRO A O   1 
ATOM 26   C CB  . PRO A 1 5   ? 66.861 -5.495   22.123 1.00 44.50  ? 5   PRO A CB  1 
ATOM 27   C CG  . PRO A 1 5   ? 67.561 -6.633   22.777 1.00 46.86  ? 5   PRO A CG  1 
ATOM 28   C CD  . PRO A 1 5   ? 68.671 -6.021   23.602 1.00 47.07  ? 5   PRO A CD  1 
ATOM 29   N N   . MET A 1 6   ? 65.819 -4.951   25.292 1.00 40.57  ? 6   MET A N   1 
ATOM 30   C CA  . MET A 1 6   ? 64.702 -5.119   26.223 1.00 44.84  ? 6   MET A CA  1 
ATOM 31   C C   . MET A 1 6   ? 63.501 -5.754   25.529 1.00 44.68  ? 6   MET A C   1 
ATOM 32   O O   . MET A 1 6   ? 62.385 -5.228   25.536 1.00 42.12  ? 6   MET A O   1 
ATOM 33   C CB  . MET A 1 6   ? 64.327 -3.797   26.885 1.00 40.99  ? 6   MET A CB  1 
ATOM 34   C CG  . MET A 1 6   ? 65.497 -3.136   27.584 1.00 43.42  ? 6   MET A CG  1 
ATOM 35   S SD  . MET A 1 6   ? 65.032 -2.204   29.051 1.00 42.61  ? 6   MET A SD  1 
ATOM 36   C CE  . MET A 1 6   ? 66.611 -1.503   29.524 1.00 46.58  ? 6   MET A CE  1 
ATOM 37   N N   . THR A 1 7   ? 63.756 -6.905   24.905 1.00 43.21  ? 7   THR A N   1 
ATOM 38   C CA  . THR A 1 7   ? 62.699 -7.616   24.197 1.00 39.92  ? 7   THR A CA  1 
ATOM 39   C C   . THR A 1 7   ? 61.585 -8.044   25.144 1.00 36.84  ? 7   THR A C   1 
ATOM 40   O O   . THR A 1 7   ? 60.401 -7.956   24.799 1.00 31.32  ? 7   THR A O   1 
ATOM 41   C CB  . THR A 1 7   ? 63.289 -8.824   23.467 1.00 46.72  ? 7   THR A CB  1 
ATOM 42   O OG1 . THR A 1 7   ? 62.233 -9.656   22.989 1.00 57.83  ? 7   THR A OG1 1 
ATOM 43   C CG2 . THR A 1 7   ? 64.211 -9.623   24.383 1.00 47.16  ? 7   THR A CG2 1 
ATOM 44   N N   . TYR A 1 8   ? 61.939 -8.498   26.345 1.00 36.58  ? 8   TYR A N   1 
ATOM 45   C CA  . TYR A 1 8   ? 60.921 -8.936   27.286 1.00 36.76  ? 8   TYR A CA  1 
ATOM 46   C C   . TYR A 1 8   ? 60.274 -7.773   28.019 1.00 31.79  ? 8   TYR A C   1 
ATOM 47   O O   . TYR A 1 8   ? 59.199 -7.949   28.601 1.00 29.92  ? 8   TYR A O   1 
ATOM 48   C CB  . TYR A 1 8   ? 61.515 -9.926   28.289 1.00 44.33  ? 8   TYR A CB  1 
ATOM 49   C CG  . TYR A 1 8   ? 60.487 -10.853  28.900 1.00 41.96  ? 8   TYR A CG  1 
ATOM 50   C CD1 . TYR A 1 8   ? 59.856 -11.815  28.122 1.00 41.23  ? 8   TYR A CD1 1 
ATOM 51   C CD2 . TYR A 1 8   ? 60.161 -10.785  30.248 1.00 41.09  ? 8   TYR A CD2 1 
ATOM 52   C CE1 . TYR A 1 8   ? 58.918 -12.676  28.658 1.00 42.48  ? 8   TYR A CE1 1 
ATOM 53   C CE2 . TYR A 1 8   ? 59.221 -11.646  30.798 1.00 47.36  ? 8   TYR A CE2 1 
ATOM 54   C CZ  . TYR A 1 8   ? 58.604 -12.591  29.997 1.00 51.50  ? 8   TYR A CZ  1 
ATOM 55   O OH  . TYR A 1 8   ? 57.669 -13.455  30.530 1.00 46.41  ? 8   TYR A OH  1 
ATOM 56   N N   . GLU A 1 9   ? 60.905 -6.595   28.006 1.00 39.50  ? 9   GLU A N   1 
ATOM 57   C CA  . GLU A 1 9   ? 60.266 -5.406   28.564 1.00 35.45  ? 9   GLU A CA  1 
ATOM 58   C C   . GLU A 1 9   ? 59.179 -4.885   27.635 1.00 32.38  ? 9   GLU A C   1 
ATOM 59   O O   . GLU A 1 9   ? 58.135 -4.409   28.095 1.00 29.57  ? 9   GLU A O   1 
ATOM 60   C CB  . GLU A 1 9   ? 61.314 -4.333   28.849 1.00 28.62  ? 9   GLU A CB  1 
ATOM 61   C CG  . GLU A 1 9   ? 61.981 -4.496   30.204 1.00 36.46  ? 9   GLU A CG  1 
ATOM 62   C CD  . GLU A 1 9   ? 63.005 -5.626   30.256 1.00 43.06  ? 9   GLU A CD  1 
ATOM 63   O OE1 . GLU A 1 9   ? 63.037 -6.478   29.339 1.00 43.01  ? 9   GLU A OE1 1 
ATOM 64   O OE2 . GLU A 1 9   ? 63.778 -5.668   31.237 1.00 39.74  ? 9   GLU A OE2 1 
ATOM 65   N N   . ALA A 1 10  ? 59.393 -4.985   26.329 1.00 29.62  ? 10  ALA A N   1 
ATOM 66   C CA  . ALA A 1 10  ? 58.290 -4.922   25.383 1.00 26.33  ? 10  ALA A CA  1 
ATOM 67   C C   . ALA A 1 10  ? 57.467 -6.201   25.543 1.00 41.37  ? 10  ALA A C   1 
ATOM 68   O O   . ALA A 1 10  ? 57.692 -7.005   26.453 1.00 41.78  ? 10  ALA A O   1 
ATOM 69   C CB  . ALA A 1 10  ? 58.810 -4.727   23.965 1.00 29.76  ? 10  ALA A CB  1 
ATOM 70   N N   . GLN A 1 11  ? 56.474 -6.386   24.668 1.00 44.65  ? 11  GLN A N   1 
ATOM 71   C CA  . GLN A 1 11  ? 55.542 -7.516   24.719 1.00 44.76  ? 11  GLN A CA  1 
ATOM 72   C C   . GLN A 1 11  ? 54.610 -7.366   25.919 1.00 39.93  ? 11  GLN A C   1 
ATOM 73   O O   . GLN A 1 11  ? 53.463 -7.824   25.888 1.00 34.02  ? 11  GLN A O   1 
ATOM 74   C CB  . GLN A 1 11  ? 56.290 -8.861   24.758 1.00 36.29  ? 11  GLN A CB  1 
ATOM 75   C CG  . GLN A 1 11  ? 55.436 -10.077  25.108 1.00 36.18  ? 11  GLN A CG  1 
ATOM 76   C CD  . GLN A 1 11  ? 56.256 -11.260  25.600 1.00 29.80  ? 11  GLN A CD  1 
ATOM 77   O OE1 . GLN A 1 11  ? 57.413 -11.432  25.219 1.00 29.44  ? 11  GLN A OE1 1 
ATOM 78   N NE2 . GLN A 1 11  ? 55.655 -12.084  26.445 1.00 31.62  ? 11  GLN A NE2 1 
ATOM 79   N N   . PHE A 1 12  ? 55.079 -6.680   26.962 1.00 40.81  ? 12  PHE A N   1 
ATOM 80   C CA  . PHE A 1 12  ? 54.242 -6.287   28.087 1.00 37.68  ? 12  PHE A CA  1 
ATOM 81   C C   . PHE A 1 12  ? 53.753 -4.854   27.937 1.00 32.07  ? 12  PHE A C   1 
ATOM 82   O O   . PHE A 1 12  ? 52.544 -4.611   27.899 1.00 35.53  ? 12  PHE A O   1 
ATOM 83   C CB  . PHE A 1 12  ? 55.003 -6.457   29.406 1.00 33.35  ? 12  PHE A CB  1 
ATOM 84   C CG  . PHE A 1 12  ? 54.236 -5.989   30.608 1.00 28.32  ? 12  PHE A CG  1 
ATOM 85   C CD1 . PHE A 1 12  ? 52.944 -6.432   30.842 1.00 37.29  ? 12  PHE A CD1 1 
ATOM 86   C CD2 . PHE A 1 12  ? 54.820 -5.133   31.520 1.00 25.55  ? 12  PHE A CD2 1 
ATOM 87   C CE1 . PHE A 1 12  ? 52.239 -6.006   31.953 1.00 33.53  ? 12  PHE A CE1 1 
ATOM 88   C CE2 . PHE A 1 12  ? 54.124 -4.709   32.634 1.00 27.43  ? 12  PHE A CE2 1 
ATOM 89   C CZ  . PHE A 1 12  ? 52.831 -5.146   32.852 1.00 28.57  ? 12  PHE A CZ  1 
ATOM 90   N N   . PHE A 1 13  ? 54.678 -3.895   27.859 1.00 31.78  ? 13  PHE A N   1 
ATOM 91   C CA  . PHE A 1 13  ? 54.281 -2.515   27.611 1.00 32.87  ? 13  PHE A CA  1 
ATOM 92   C C   . PHE A 1 13  ? 53.816 -2.333   26.173 1.00 36.06  ? 13  PHE A C   1 
ATOM 93   O O   . PHE A 1 13  ? 52.738 -1.784   25.920 1.00 33.57  ? 13  PHE A O   1 
ATOM 94   C CB  . PHE A 1 13  ? 55.432 -1.567   27.939 1.00 24.84  ? 13  PHE A CB  1 
ATOM 95   C CG  . PHE A 1 13  ? 55.789 -1.541   29.393 1.00 25.98  ? 13  PHE A CG  1 
ATOM 96   C CD1 . PHE A 1 13  ? 54.997 -0.860   30.305 1.00 27.85  ? 13  PHE A CD1 1 
ATOM 97   C CD2 . PHE A 1 13  ? 56.920 -2.190   29.851 1.00 26.27  ? 13  PHE A CD2 1 
ATOM 98   C CE1 . PHE A 1 13  ? 55.324 -0.841   31.648 1.00 28.02  ? 13  PHE A CE1 1 
ATOM 99   C CE2 . PHE A 1 13  ? 57.252 -2.173   31.190 1.00 25.55  ? 13  PHE A CE2 1 
ATOM 100  C CZ  . PHE A 1 13  ? 56.455 -1.497   32.091 1.00 24.66  ? 13  PHE A CZ  1 
ATOM 101  N N   . GLY A 1 14  ? 54.612 -2.798   25.217 1.00 36.14  ? 14  GLY A N   1 
ATOM 102  C CA  . GLY A 1 14  ? 54.271 -2.637   23.825 1.00 34.14  ? 14  GLY A CA  1 
ATOM 103  C C   . GLY A 1 14  ? 54.882 -1.438   23.145 1.00 31.91  ? 14  GLY A C   1 
ATOM 104  O O   . GLY A 1 14  ? 54.458 -1.098   22.035 1.00 39.48  ? 14  GLY A O   1 
ATOM 105  N N   . PHE A 1 15  ? 55.841 -0.763   23.775 1.00 24.88  ? 15  PHE A N   1 
ATOM 106  C CA  . PHE A 1 15  ? 56.517 0.347    23.120 1.00 37.34  ? 15  PHE A CA  1 
ATOM 107  C C   . PHE A 1 15  ? 58.026 0.332    23.252 1.00 38.10  ? 15  PHE A C   1 
ATOM 108  O O   . PHE A 1 15  ? 58.683 1.015    22.461 1.00 45.66  ? 15  PHE A O   1 
ATOM 109  C CB  . PHE A 1 15  ? 55.993 1.700    23.631 1.00 46.55  ? 15  PHE A CB  1 
ATOM 110  C CG  . PHE A 1 15  ? 55.643 1.720    25.086 1.00 35.14  ? 15  PHE A CG  1 
ATOM 111  C CD1 . PHE A 1 15  ? 54.329 1.561    25.492 1.00 31.73  ? 15  PHE A CD1 1 
ATOM 112  C CD2 . PHE A 1 15  ? 56.615 1.941    26.046 1.00 27.01  ? 15  PHE A CD2 1 
ATOM 113  C CE1 . PHE A 1 15  ? 53.993 1.590    26.828 1.00 30.58  ? 15  PHE A CE1 1 
ATOM 114  C CE2 . PHE A 1 15  ? 56.287 1.980    27.385 1.00 25.81  ? 15  PHE A CE2 1 
ATOM 115  C CZ  . PHE A 1 15  ? 54.973 1.806    27.777 1.00 30.41  ? 15  PHE A CZ  1 
ATOM 116  N N   . THR A 1 16  ? 58.584 -0.391   24.231 1.00 28.90  ? 16  THR A N   1 
ATOM 117  C CA  . THR A 1 16  ? 59.979 -0.480   24.661 1.00 32.24  ? 16  THR A CA  1 
ATOM 118  C C   . THR A 1 16  ? 60.259 0.765    25.495 1.00 39.01  ? 16  THR A C   1 
ATOM 119  O O   . THR A 1 16  ? 59.702 1.843    25.232 1.00 44.93  ? 16  THR A O   1 
ATOM 120  C CB  . THR A 1 16  ? 60.986 -0.596   23.506 1.00 32.95  ? 16  THR A CB  1 
ATOM 121  O OG1 . THR A 1 16  ? 62.189 -1.177   23.988 1.00 39.19  ? 16  THR A OG1 1 
ATOM 122  C CG2 . THR A 1 16  ? 61.418 0.761    23.026 1.00 37.18  ? 16  THR A CG2 1 
ATOM 123  N N   . PRO A 1 17  ? 61.061 0.646    26.544 1.00 36.89  ? 17  PRO A N   1 
ATOM 124  C CA  . PRO A 1 17  ? 61.265 1.780    27.454 1.00 46.49  ? 17  PRO A CA  1 
ATOM 125  C C   . PRO A 1 17  ? 62.155 2.878    26.883 1.00 46.80  ? 17  PRO A C   1 
ATOM 126  O O   . PRO A 1 17  ? 61.930 4.060    27.166 1.00 38.24  ? 17  PRO A O   1 
ATOM 127  C CB  . PRO A 1 17  ? 61.904 1.117    28.676 1.00 39.64  ? 17  PRO A CB  1 
ATOM 128  C CG  . PRO A 1 17  ? 62.609 -0.061   28.110 1.00 40.87  ? 17  PRO A CG  1 
ATOM 129  C CD  . PRO A 1 17  ? 61.733 -0.573   27.016 1.00 35.28  ? 17  PRO A CD  1 
ATOM 130  N N   . GLN A 1 18  ? 63.164 2.507    26.085 1.00 45.84  ? 18  GLN A N   1 
ATOM 131  C CA  . GLN A 1 18  ? 64.095 3.505    25.559 1.00 47.53  ? 18  GLN A CA  1 
ATOM 132  C C   . GLN A 1 18  ? 63.387 4.522    24.679 1.00 44.40  ? 18  GLN A C   1 
ATOM 133  O O   . GLN A 1 18  ? 63.601 5.732    24.818 1.00 42.84  ? 18  GLN A O   1 
ATOM 134  C CB  . GLN A 1 18  ? 65.231 2.839    24.783 1.00 52.07  ? 18  GLN A CB  1 
ATOM 135  C CG  . GLN A 1 18  ? 66.065 1.847    25.561 1.00 53.60  ? 18  GLN A CG  1 
ATOM 136  C CD  . GLN A 1 18  ? 65.513 0.448    25.533 1.00 47.38  ? 18  GLN A CD  1 
ATOM 137  O OE1 . GLN A 1 18  ? 64.483 0.179    24.916 1.00 46.53  ? 18  GLN A OE1 1 
ATOM 138  N NE2 . GLN A 1 18  ? 66.214 -0.464   26.187 1.00 47.06  ? 18  GLN A NE2 1 
ATOM 139  N N   . THR A 1 19  ? 62.542 4.053    23.761 1.00 43.44  ? 19  THR A N   1 
ATOM 140  C CA  . THR A 1 19  ? 61.797 4.982    22.919 1.00 44.11  ? 19  THR A CA  1 
ATOM 141  C C   . THR A 1 19  ? 60.947 5.916    23.769 1.00 43.30  ? 19  THR A C   1 
ATOM 142  O O   . THR A 1 19  ? 60.916 7.132    23.536 1.00 49.29  ? 19  THR A O   1 
ATOM 143  C CB  . THR A 1 19  ? 60.936 4.204    21.927 1.00 43.39  ? 19  THR A CB  1 
ATOM 144  O OG1 . THR A 1 19  ? 61.774 3.323    21.171 1.00 41.67  ? 19  THR A OG1 1 
ATOM 145  C CG2 . THR A 1 19  ? 60.219 5.149    20.980 1.00 49.42  ? 19  THR A CG2 1 
ATOM 146  N N   . CYS A 1 20  ? 60.302 5.371    24.801 1.00 40.29  ? 20  CYS A N   1 
ATOM 147  C CA  . CYS A 1 20  ? 59.499 6.194    25.696 1.00 43.84  ? 20  CYS A CA  1 
ATOM 148  C C   . CYS A 1 20  ? 60.353 7.264    26.366 1.00 44.62  ? 20  CYS A C   1 
ATOM 149  O O   . CYS A 1 20  ? 59.942 8.427    26.472 1.00 41.56  ? 20  CYS A O   1 
ATOM 150  C CB  . CYS A 1 20  ? 58.827 5.306    26.739 1.00 41.13  ? 20  CYS A CB  1 
ATOM 151  S SG  . CYS A 1 20  ? 57.731 6.176    27.856 1.00 30.38  ? 20  CYS A SG  1 
ATOM 152  N N   . MET A 1 21  ? 61.555 6.891    26.806 1.00 43.42  ? 21  MET A N   1 
ATOM 153  C CA  . MET A 1 21  ? 62.458 7.867    27.403 1.00 39.62  ? 21  MET A CA  1 
ATOM 154  C C   . MET A 1 21  ? 62.886 8.919    26.393 1.00 41.50  ? 21  MET A C   1 
ATOM 155  O O   . MET A 1 21  ? 63.136 10.066   26.770 1.00 49.87  ? 21  MET A O   1 
ATOM 156  C CB  . MET A 1 21  ? 63.683 7.166    27.990 1.00 44.51  ? 21  MET A CB  1 
ATOM 157  C CG  . MET A 1 21  ? 63.362 6.260    29.158 1.00 47.46  ? 21  MET A CG  1 
ATOM 158  S SD  . MET A 1 21  ? 62.814 7.207    30.585 1.00 41.89  ? 21  MET A SD  1 
ATOM 159  C CE  . MET A 1 21  ? 61.155 6.572    30.789 1.00 37.42  ? 21  MET A CE  1 
ATOM 160  N N   . LEU A 1 22  ? 63.001 8.552    25.114 1.00 38.79  ? 22  LEU A N   1 
ATOM 161  C CA  . LEU A 1 22  ? 63.280 9.558    24.093 1.00 36.17  ? 22  LEU A CA  1 
ATOM 162  C C   . LEU A 1 22  ? 62.134 10.558   23.984 1.00 35.28  ? 22  LEU A C   1 
ATOM 163  O O   . LEU A 1 22  ? 62.359 11.775   23.969 1.00 42.24  ? 22  LEU A O   1 
ATOM 164  C CB  . LEU A 1 22  ? 63.567 8.890    22.748 1.00 35.08  ? 22  LEU A CB  1 
ATOM 165  C CG  . LEU A 1 22  ? 63.867 9.823    21.571 1.00 30.23  ? 22  LEU A CG  1 
ATOM 166  C CD1 . LEU A 1 22  ? 65.003 9.285    20.714 1.00 37.32  ? 22  LEU A CD1 1 
ATOM 167  C CD2 . LEU A 1 22  ? 62.619 10.015   20.717 1.00 29.58  ? 22  LEU A CD2 1 
ATOM 168  N N   . ARG A 1 23  ? 60.893 10.065   23.912 1.00 34.07  ? 23  ARG A N   1 
ATOM 169  C CA  . ARG A 1 23  ? 59.748 10.975   23.878 1.00 40.78  ? 23  ARG A CA  1 
ATOM 170  C C   . ARG A 1 23  ? 59.757 11.911   25.085 1.00 39.45  ? 23  ARG A C   1 
ATOM 171  O O   . ARG A 1 23  ? 59.618 13.134   24.945 1.00 41.02  ? 23  ARG A O   1 
ATOM 172  C CB  . ARG A 1 23  ? 58.440 10.178   23.805 1.00 52.11  ? 23  ARG A CB  1 
ATOM 173  C CG  . ARG A 1 23  ? 58.505 8.960    22.878 1.00 52.92  ? 23  ARG A CG  1 
ATOM 174  C CD  . ARG A 1 23  ? 57.142 8.575    22.289 1.00 56.83  ? 23  ARG A CD  1 
ATOM 175  N NE  . ARG A 1 23  ? 56.194 8.093    23.295 1.00 74.10  ? 23  ARG A NE  1 
ATOM 176  C CZ  . ARG A 1 23  ? 55.971 6.807    23.570 1.00 77.99  ? 23  ARG A CZ  1 
ATOM 177  N NH1 . ARG A 1 23  ? 56.621 5.857    22.909 1.00 77.77  ? 23  ARG A NH1 1 
ATOM 178  N NH2 . ARG A 1 23  ? 55.088 6.466    24.505 1.00 58.32  ? 23  ARG A NH2 1 
ATOM 179  N N   . ILE A 1 24  ? 59.964 11.353   26.280 1.00 41.03  ? 24  ILE A N   1 
ATOM 180  C CA  . ILE A 1 24  ? 60.006 12.173   27.489 1.00 38.31  ? 24  ILE A CA  1 
ATOM 181  C C   . ILE A 1 24  ? 61.129 13.199   27.403 1.00 36.35  ? 24  ILE A C   1 
ATOM 182  O O   . ILE A 1 24  ? 60.973 14.352   27.827 1.00 35.93  ? 24  ILE A O   1 
ATOM 183  C CB  . ILE A 1 24  ? 60.155 11.275   28.731 1.00 39.24  ? 24  ILE A CB  1 
ATOM 184  C CG1 . ILE A 1 24  ? 58.951 10.341   28.860 1.00 34.92  ? 24  ILE A CG1 1 
ATOM 185  C CG2 . ILE A 1 24  ? 60.318 12.121   29.981 1.00 31.28  ? 24  ILE A CG2 1 
ATOM 186  C CD1 . ILE A 1 24  ? 59.021 9.419    30.052 1.00 28.42  ? 24  ILE A CD1 1 
ATOM 187  N N   . TYR A 1 25  ? 62.274 12.803   26.841 1.00 35.54  ? 25  TYR A N   1 
ATOM 188  C CA  . TYR A 1 25  ? 63.398 13.724   26.718 1.00 39.73  ? 25  TYR A CA  1 
ATOM 189  C C   . TYR A 1 25  ? 63.043 14.908   25.834 1.00 37.89  ? 25  TYR A C   1 
ATOM 190  O O   . TYR A 1 25  ? 63.194 16.067   26.240 1.00 40.06  ? 25  TYR A O   1 
ATOM 191  C CB  . TYR A 1 25  ? 64.625 13.007   26.158 1.00 39.09  ? 25  TYR A CB  1 
ATOM 192  C CG  . TYR A 1 25  ? 65.811 13.930   25.958 1.00 42.80  ? 25  TYR A CG  1 
ATOM 193  C CD1 . TYR A 1 25  ? 66.674 14.216   27.008 1.00 46.81  ? 25  TYR A CD1 1 
ATOM 194  C CD2 . TYR A 1 25  ? 66.059 14.526   24.728 1.00 34.58  ? 25  TYR A CD2 1 
ATOM 195  C CE1 . TYR A 1 25  ? 67.756 15.057   26.840 1.00 45.60  ? 25  TYR A CE1 1 
ATOM 196  C CE2 . TYR A 1 25  ? 67.141 15.370   24.551 1.00 38.64  ? 25  TYR A CE2 1 
ATOM 197  C CZ  . TYR A 1 25  ? 67.985 15.631   25.612 1.00 42.71  ? 25  TYR A CZ  1 
ATOM 198  O OH  . TYR A 1 25  ? 69.065 16.469   25.450 1.00 47.66  ? 25  TYR A OH  1 
ATOM 199  N N   . ILE A 1 26  ? 62.578 14.636   24.612 1.00 31.36  ? 26  ILE A N   1 
ATOM 200  C CA  . ILE A 1 26  ? 62.303 15.737   23.697 1.00 40.17  ? 26  ILE A CA  1 
ATOM 201  C C   . ILE A 1 26  ? 61.211 16.639   24.262 1.00 42.63  ? 26  ILE A C   1 
ATOM 202  O O   . ILE A 1 26  ? 61.267 17.868   24.102 1.00 45.39  ? 26  ILE A O   1 
ATOM 203  C CB  . ILE A 1 26  ? 61.961 15.203   22.289 1.00 32.09  ? 26  ILE A CB  1 
ATOM 204  C CG1 . ILE A 1 26  ? 60.720 14.314   22.313 1.00 35.97  ? 26  ILE A CG1 1 
ATOM 205  C CG2 . ILE A 1 26  ? 63.135 14.421   21.721 1.00 23.20  ? 26  ILE A CG2 1 
ATOM 206  C CD1 . ILE A 1 26  ? 60.227 13.921   20.934 1.00 35.80  ? 26  ILE A CD1 1 
ATOM 207  N N   . ALA A 1 27  ? 60.244 16.065   24.987 1.00 35.13  ? 27  ALA A N   1 
ATOM 208  C CA  . ALA A 1 27  ? 59.214 16.890   25.615 1.00 38.34  ? 27  ALA A CA  1 
ATOM 209  C C   . ALA A 1 27  ? 59.809 17.812   26.680 1.00 43.51  ? 27  ALA A C   1 
ATOM 210  O O   . ALA A 1 27  ? 59.572 19.028   26.670 1.00 45.16  ? 27  ALA A O   1 
ATOM 211  C CB  . ALA A 1 27  ? 58.124 16.003   26.216 1.00 39.58  ? 27  ALA A CB  1 
ATOM 212  N N   . PHE A 1 28  ? 60.585 17.246   27.612 1.00 45.10  ? 28  PHE A N   1 
ATOM 213  C CA  . PHE A 1 28  ? 61.181 18.050   28.679 1.00 40.43  ? 28  PHE A CA  1 
ATOM 214  C C   . PHE A 1 28  ? 62.051 19.168   28.114 1.00 34.90  ? 28  PHE A C   1 
ATOM 215  O O   . PHE A 1 28  ? 61.935 20.331   28.522 1.00 33.84  ? 28  PHE A O   1 
ATOM 216  C CB  . PHE A 1 28  ? 62.009 17.164   29.616 1.00 41.81  ? 28  PHE A CB  1 
ATOM 217  C CG  . PHE A 1 28  ? 61.190 16.298   30.535 1.00 32.75  ? 28  PHE A CG  1 
ATOM 218  C CD1 . PHE A 1 28  ? 59.824 16.160   30.361 1.00 32.36  ? 28  PHE A CD1 1 
ATOM 219  C CD2 . PHE A 1 28  ? 61.795 15.644   31.598 1.00 27.43  ? 28  PHE A CD2 1 
ATOM 220  C CE1 . PHE A 1 28  ? 59.080 15.370   31.217 1.00 32.54  ? 28  PHE A CE1 1 
ATOM 221  C CE2 . PHE A 1 28  ? 61.056 14.859   32.458 1.00 26.66  ? 28  PHE A CE2 1 
ATOM 222  C CZ  . PHE A 1 28  ? 59.697 14.722   32.269 1.00 28.49  ? 28  PHE A CZ  1 
ATOM 223  N N   . GLN A 1 29  ? 62.944 18.823   27.184 1.00 35.83  ? 29  GLN A N   1 
ATOM 224  C CA  . GLN A 1 29  ? 63.802 19.817   26.547 1.00 42.35  ? 29  GLN A CA  1 
ATOM 225  C C   . GLN A 1 29  ? 62.972 20.931   25.918 1.00 44.96  ? 29  GLN A C   1 
ATOM 226  O O   . GLN A 1 29  ? 63.246 22.125   26.118 1.00 40.19  ? 29  GLN A O   1 
ATOM 227  C CB  . GLN A 1 29  ? 64.684 19.127   25.503 1.00 40.02  ? 29  GLN A CB  1 
ATOM 228  C CG  . GLN A 1 29  ? 65.943 19.879   25.114 1.00 37.68  ? 29  GLN A CG  1 
ATOM 229  C CD  . GLN A 1 29  ? 66.614 19.283   23.889 1.00 39.86  ? 29  GLN A CD  1 
ATOM 230  O OE1 . GLN A 1 29  ? 67.835 19.353   23.738 1.00 37.27  ? 29  GLN A OE1 1 
ATOM 231  N NE2 . GLN A 1 29  ? 65.815 18.693   23.006 1.00 37.18  ? 29  GLN A NE2 1 
ATOM 232  N N   . ASP A 1 30  ? 61.934 20.554   25.165 1.00 44.16  ? 30  ASP A N   1 
ATOM 233  C CA  . ASP A 1 30  ? 61.069 21.561   24.561 1.00 39.65  ? 30  ASP A CA  1 
ATOM 234  C C   . ASP A 1 30  ? 60.470 22.484   25.614 1.00 42.03  ? 30  ASP A C   1 
ATOM 235  O O   . ASP A 1 30  ? 60.368 23.695   25.393 1.00 49.82  ? 30  ASP A O   1 
ATOM 236  C CB  . ASP A 1 30  ? 59.966 20.897   23.738 1.00 43.55  ? 30  ASP A CB  1 
ATOM 237  C CG  . ASP A 1 30  ? 60.463 20.392   22.398 1.00 56.27  ? 30  ASP A CG  1 
ATOM 238  O OD1 . ASP A 1 30  ? 61.697 20.344   22.199 1.00 65.69  ? 30  ASP A OD1 1 
ATOM 239  O OD2 . ASP A 1 30  ? 59.620 20.059   21.536 1.00 53.92  ? 30  ASP A OD2 1 
ATOM 240  N N   . TYR A 1 31  ? 60.068 21.940   26.767 1.00 39.03  ? 31  TYR A N   1 
ATOM 241  C CA  . TYR A 1 31  ? 59.458 22.792   27.788 1.00 37.58  ? 31  TYR A CA  1 
ATOM 242  C C   . TYR A 1 31  ? 60.477 23.748   28.401 1.00 39.10  ? 31  TYR A C   1 
ATOM 243  O O   . TYR A 1 31  ? 60.167 24.923   28.643 1.00 46.11  ? 31  TYR A O   1 
ATOM 244  C CB  . TYR A 1 31  ? 58.791 21.933   28.858 1.00 40.01  ? 31  TYR A CB  1 
ATOM 245  C CG  . TYR A 1 31  ? 57.496 21.325   28.372 1.00 45.50  ? 31  TYR A CG  1 
ATOM 246  C CD1 . TYR A 1 31  ? 56.603 22.068   27.611 1.00 45.70  ? 31  TYR A CD1 1 
ATOM 247  C CD2 . TYR A 1 31  ? 57.179 20.002   28.647 1.00 46.84  ? 31  TYR A CD2 1 
ATOM 248  C CE1 . TYR A 1 31  ? 55.424 21.515   27.148 1.00 50.70  ? 31  TYR A CE1 1 
ATOM 249  C CE2 . TYR A 1 31  ? 56.001 19.441   28.189 1.00 47.20  ? 31  TYR A CE2 1 
ATOM 250  C CZ  . TYR A 1 31  ? 55.128 20.201   27.439 1.00 49.61  ? 31  TYR A CZ  1 
ATOM 251  O OH  . TYR A 1 31  ? 53.954 19.644   26.980 1.00 50.09  ? 31  TYR A OH  1 
ATOM 252  N N   . LEU A 1 32  ? 61.697 23.268   28.658 1.00 36.81  ? 32  LEU A N   1 
ATOM 253  C CA  . LEU A 1 32  ? 62.751 24.155   29.143 1.00 33.34  ? 32  LEU A CA  1 
ATOM 254  C C   . LEU A 1 32  ? 62.965 25.320   28.182 1.00 37.88  ? 32  LEU A C   1 
ATOM 255  O O   . LEU A 1 32  ? 62.982 26.492   28.588 1.00 40.77  ? 32  LEU A O   1 
ATOM 256  C CB  . LEU A 1 32  ? 64.048 23.367   29.330 1.00 34.73  ? 32  LEU A CB  1 
ATOM 257  C CG  . LEU A 1 32  ? 65.234 24.100   29.958 1.00 30.55  ? 32  LEU A CG  1 
ATOM 258  C CD1 . LEU A 1 32  ? 64.923 24.475   31.396 1.00 32.26  ? 32  LEU A CD1 1 
ATOM 259  C CD2 . LEU A 1 32  ? 66.504 23.261   29.873 1.00 25.00  ? 32  LEU A CD2 1 
ATOM 260  N N   . PHE A 1 33  ? 63.116 25.015   26.891 1.00 40.97  ? 33  PHE A N   1 
ATOM 261  C CA  . PHE A 1 33  ? 63.274 26.084   25.912 1.00 39.02  ? 33  PHE A CA  1 
ATOM 262  C C   . PHE A 1 33  ? 62.037 26.972   25.843 1.00 43.61  ? 33  PHE A C   1 
ATOM 263  O O   . PHE A 1 33  ? 62.146 28.161   25.518 1.00 49.84  ? 33  PHE A O   1 
ATOM 264  C CB  . PHE A 1 33  ? 63.594 25.489   24.544 1.00 41.18  ? 33  PHE A CB  1 
ATOM 265  C CG  . PHE A 1 33  ? 65.016 25.036   24.411 1.00 48.88  ? 33  PHE A CG  1 
ATOM 266  C CD1 . PHE A 1 33  ? 65.442 23.862   25.011 1.00 56.35  ? 33  PHE A CD1 1 
ATOM 267  C CD2 . PHE A 1 33  ? 65.932 25.785   23.699 1.00 50.30  ? 33  PHE A CD2 1 
ATOM 268  C CE1 . PHE A 1 33  ? 66.754 23.442   24.899 1.00 57.76  ? 33  PHE A CE1 1 
ATOM 269  C CE2 . PHE A 1 33  ? 67.246 25.372   23.580 1.00 58.34  ? 33  PHE A CE2 1 
ATOM 270  C CZ  . PHE A 1 33  ? 67.658 24.200   24.184 1.00 58.32  ? 33  PHE A CZ  1 
ATOM 271  N N   . GLU A 1 34  ? 60.859 26.422   26.147 1.00 39.63  ? 34  GLU A N   1 
ATOM 272  C CA  . GLU A 1 34  ? 59.648 27.235   26.194 1.00 43.43  ? 34  GLU A CA  1 
ATOM 273  C C   . GLU A 1 34  ? 59.737 28.293   27.286 1.00 46.71  ? 34  GLU A C   1 
ATOM 274  O O   . GLU A 1 34  ? 59.518 29.484   27.030 1.00 52.81  ? 34  GLU A O   1 
ATOM 275  C CB  . GLU A 1 34  ? 58.413 26.353   26.401 1.00 48.74  ? 34  GLU A CB  1 
ATOM 276  C CG  . GLU A 1 34  ? 57.896 25.664   25.140 1.00 54.88  ? 34  GLU A CG  1 
ATOM 277  C CD  . GLU A 1 34  ? 56.534 25.012   25.341 1.00 52.05  ? 34  GLU A CD  1 
ATOM 278  O OE1 . GLU A 1 34  ? 55.898 25.264   26.388 1.00 48.59  ? 34  GLU A OE1 1 
ATOM 279  O OE2 . GLU A 1 34  ? 56.098 24.250   24.450 1.00 48.61  ? 34  GLU A OE2 1 
ATOM 280  N N   . VAL A 1 35  ? 60.058 27.881   28.517 1.00 42.79  ? 35  VAL A N   1 
ATOM 281  C CA  . VAL A 1 35  ? 60.086 28.866   29.595 1.00 44.46  ? 35  VAL A CA  1 
ATOM 282  C C   . VAL A 1 35  ? 61.230 29.853   29.399 1.00 47.04  ? 35  VAL A C   1 
ATOM 283  O O   . VAL A 1 35  ? 61.112 31.029   29.774 1.00 48.47  ? 35  VAL A O   1 
ATOM 284  C CB  . VAL A 1 35  ? 60.161 28.186   30.977 1.00 42.30  ? 35  VAL A CB  1 
ATOM 285  C CG1 . VAL A 1 35  ? 58.840 27.508   31.312 1.00 46.97  ? 35  VAL A CG1 1 
ATOM 286  C CG2 . VAL A 1 35  ? 61.303 27.197   31.035 1.00 41.17  ? 35  VAL A CG2 1 
ATOM 287  N N   . MET A 1 36  ? 62.338 29.422   28.787 1.00 45.67  ? 36  MET A N   1 
ATOM 288  C CA  . MET A 1 36  ? 63.414 30.375   28.522 1.00 44.47  ? 36  MET A CA  1 
ATOM 289  C C   . MET A 1 36  ? 63.015 31.390   27.456 1.00 49.08  ? 36  MET A C   1 
ATOM 290  O O   . MET A 1 36  ? 63.310 32.588   27.586 1.00 56.03  ? 36  MET A O   1 
ATOM 291  C CB  . MET A 1 36  ? 64.688 29.640   28.125 1.00 43.86  ? 36  MET A CB  1 
ATOM 292  C CG  . MET A 1 36  ? 65.395 28.995   29.300 1.00 47.64  ? 36  MET A CG  1 
ATOM 293  S SD  . MET A 1 36  ? 66.422 30.171   30.210 1.00 59.75  ? 36  MET A SD  1 
ATOM 294  C CE  . MET A 1 36  ? 65.317 30.670   31.526 1.00 35.25  ? 36  MET A CE  1 
ATOM 295  N N   . GLN A 1 37  ? 62.341 30.937   26.397 1.00 49.31  ? 37  GLN A N   1 
ATOM 296  C CA  . GLN A 1 37  ? 61.779 31.880   25.436 1.00 57.31  ? 37  GLN A CA  1 
ATOM 297  C C   . GLN A 1 37  ? 60.839 32.859   26.130 1.00 56.80  ? 37  GLN A C   1 
ATOM 298  O O   . GLN A 1 37  ? 60.842 34.064   25.831 1.00 53.70  ? 37  GLN A O   1 
ATOM 299  C CB  . GLN A 1 37  ? 61.041 31.120   24.334 1.00 59.03  ? 37  GLN A CB  1 
ATOM 300  C CG  . GLN A 1 37  ? 61.909 30.688   23.164 1.00 61.70  ? 37  GLN A CG  1 
ATOM 301  C CD  . GLN A 1 37  ? 61.974 31.738   22.076 1.00 70.80  ? 37  GLN A CD  1 
ATOM 302  O OE1 . GLN A 1 37  ? 61.004 32.456   21.832 1.00 73.30  ? 37  GLN A OE1 1 
ATOM 303  N NE2 . GLN A 1 37  ? 63.113 31.819   21.398 1.00 76.46  ? 37  GLN A NE2 1 
ATOM 304  N N   . ALA A 1 38  ? 60.053 32.359   27.088 1.00 52.62  ? 38  ALA A N   1 
ATOM 305  C CA  . ALA A 1 38  ? 59.128 33.213   27.825 1.00 54.52  ? 38  ALA A CA  1 
ATOM 306  C C   . ALA A 1 38  ? 59.870 34.303   28.588 1.00 58.03  ? 38  ALA A C   1 
ATOM 307  O O   . ALA A 1 38  ? 59.507 35.482   28.510 1.00 59.20  ? 38  ALA A O   1 
ATOM 308  C CB  . ALA A 1 38  ? 58.280 32.370   28.776 1.00 56.53  ? 38  ALA A CB  1 
ATOM 309  N N   . VAL A 1 39  ? 60.919 33.933   29.329 1.00 57.85  ? 39  VAL A N   1 
ATOM 310  C CA  . VAL A 1 39  ? 61.608 34.940   30.132 1.00 52.11  ? 39  VAL A CA  1 
ATOM 311  C C   . VAL A 1 39  ? 62.323 35.948   29.240 1.00 56.25  ? 39  VAL A C   1 
ATOM 312  O O   . VAL A 1 39  ? 62.359 37.145   29.551 1.00 57.80  ? 39  VAL A O   1 
ATOM 313  C CB  . VAL A 1 39  ? 62.570 34.296   31.150 1.00 45.38  ? 39  VAL A CB  1 
ATOM 314  C CG1 . VAL A 1 39  ? 61.831 33.296   32.010 1.00 52.46  ? 39  VAL A CG1 1 
ATOM 315  C CG2 . VAL A 1 39  ? 63.770 33.668   30.470 1.00 50.65  ? 39  VAL A CG2 1 
ATOM 316  N N   . GLU A 1 40  ? 62.891 35.497   28.115 1.00 54.63  ? 40  GLU A N   1 
ATOM 317  C CA  . GLU A 1 40  ? 63.558 36.446   27.227 1.00 56.99  ? 40  GLU A CA  1 
ATOM 318  C C   . GLU A 1 40  ? 62.566 37.447   26.648 1.00 57.24  ? 40  GLU A C   1 
ATOM 319  O O   . GLU A 1 40  ? 62.795 38.664   26.683 1.00 51.25  ? 40  GLU A O   1 
ATOM 320  C CB  . GLU A 1 40  ? 64.293 35.714   26.106 1.00 58.94  ? 40  GLU A CB  1 
ATOM 321  C CG  . GLU A 1 40  ? 65.002 36.666   25.149 1.00 57.64  ? 40  GLU A CG  1 
ATOM 322  C CD  . GLU A 1 40  ? 65.736 35.950   24.032 1.00 67.70  ? 40  GLU A CD  1 
ATOM 323  O OE1 . GLU A 1 40  ? 65.142 35.776   22.946 1.00 77.47  ? 40  GLU A OE1 1 
ATOM 324  O OE2 . GLU A 1 40  ? 66.905 35.561   24.241 1.00 63.36  ? 40  GLU A OE2 1 
ATOM 325  N N   . GLN A 1 41  ? 61.446 36.960   26.115 1.00 58.87  ? 41  GLN A N   1 
ATOM 326  C CA  . GLN A 1 41  ? 60.498 37.914   25.558 1.00 57.12  ? 41  GLN A CA  1 
ATOM 327  C C   . GLN A 1 41  ? 59.751 38.702   26.625 1.00 55.50  ? 41  GLN A C   1 
ATOM 328  O O   . GLN A 1 41  ? 59.097 39.691   26.284 1.00 56.37  ? 41  GLN A O   1 
ATOM 329  C CB  . GLN A 1 41  ? 59.505 37.212   24.633 1.00 58.14  ? 41  GLN A CB  1 
ATOM 330  C CG  . GLN A 1 41  ? 60.118 36.773   23.315 1.00 59.86  ? 41  GLN A CG  1 
ATOM 331  C CD  . GLN A 1 41  ? 59.293 37.209   22.121 1.00 64.32  ? 41  GLN A CD  1 
ATOM 332  O OE1 . GLN A 1 41  ? 58.138 37.615   22.262 1.00 52.94  ? 41  GLN A OE1 1 
ATOM 333  N NE2 . GLN A 1 41  ? 59.886 37.135   20.934 1.00 77.70  ? 41  GLN A NE2 1 
ATOM 334  N N   . VAL A 1 42  ? 59.826 38.305   27.896 1.00 56.81  ? 42  VAL A N   1 
ATOM 335  C CA  . VAL A 1 42  ? 59.231 39.134   28.941 1.00 60.47  ? 42  VAL A CA  1 
ATOM 336  C C   . VAL A 1 42  ? 60.197 40.229   29.380 1.00 58.25  ? 42  VAL A C   1 
ATOM 337  O O   . VAL A 1 42  ? 59.784 41.363   29.644 1.00 57.42  ? 42  VAL A O   1 
ATOM 338  C CB  . VAL A 1 42  ? 58.768 38.265   30.126 1.00 58.59  ? 42  VAL A CB  1 
ATOM 339  C CG1 . VAL A 1 42  ? 58.526 39.125   31.360 1.00 50.09  ? 42  VAL A CG1 1 
ATOM 340  C CG2 . VAL A 1 42  ? 57.497 37.511   29.760 1.00 58.83  ? 42  VAL A CG2 1 
ATOM 341  N N   . ILE A 1 43  ? 61.498 39.928   29.439 1.00 59.06  ? 43  ILE A N   1 
ATOM 342  C CA  . ILE A 1 43  ? 62.451 40.973   29.805 1.00 56.42  ? 43  ILE A CA  1 
ATOM 343  C C   . ILE A 1 43  ? 62.635 41.958   28.661 1.00 56.82  ? 43  ILE A C   1 
ATOM 344  O O   . ILE A 1 43  ? 62.919 43.137   28.897 1.00 60.56  ? 43  ILE A O   1 
ATOM 345  C CB  . ILE A 1 43  ? 63.804 40.380   30.240 1.00 49.61  ? 43  ILE A CB  1 
ATOM 346  C CG1 . ILE A 1 43  ? 64.416 39.566   29.104 1.00 55.65  ? 43  ILE A CG1 1 
ATOM 347  C CG2 . ILE A 1 43  ? 63.659 39.564   31.507 1.00 48.50  ? 43  ILE A CG2 1 
ATOM 348  C CD1 . ILE A 1 43  ? 65.532 38.680   29.532 1.00 60.77  ? 43  ILE A CD1 1 
ATOM 349  N N   . LEU A 1 44  ? 62.476 41.509   27.411 1.00 60.40  ? 44  LEU A N   1 
ATOM 350  C CA  . LEU A 1 44  ? 62.651 42.424   26.286 1.00 56.89  ? 44  LEU A CA  1 
ATOM 351  C C   . LEU A 1 44  ? 61.563 43.492   26.255 1.00 60.62  ? 44  LEU A C   1 
ATOM 352  O O   . LEU A 1 44  ? 61.836 44.648   25.916 1.00 61.82  ? 44  LEU A O   1 
ATOM 353  C CB  . LEU A 1 44  ? 62.676 41.656   24.965 1.00 57.63  ? 44  LEU A CB  1 
ATOM 354  C CG  . LEU A 1 44  ? 64.046 41.181   24.482 1.00 55.28  ? 44  LEU A CG  1 
ATOM 355  C CD1 . LEU A 1 44  ? 63.981 40.813   23.012 1.00 53.50  ? 44  LEU A CD1 1 
ATOM 356  C CD2 . LEU A 1 44  ? 65.093 42.253   24.717 1.00 50.89  ? 44  LEU A CD2 1 
ATOM 357  N N   . LYS A 1 45  ? 60.321 43.124   26.577 1.00 63.49  ? 45  LYS A N   1 
ATOM 358  C CA  . LYS A 1 45  ? 59.245 44.111   26.543 1.00 59.55  ? 45  LYS A CA  1 
ATOM 359  C C   . LYS A 1 45  ? 59.335 45.061   27.730 1.00 63.98  ? 45  LYS A C   1 
ATOM 360  O O   . LYS A 1 45  ? 59.074 46.261   27.592 1.00 80.40  ? 45  LYS A O   1 
ATOM 361  C CB  . LYS A 1 45  ? 57.883 43.420   26.501 1.00 58.82  ? 45  LYS A CB  1 
ATOM 362  C CG  . LYS A 1 45  ? 57.778 42.334   25.438 1.00 71.21  ? 45  LYS A CG  1 
ATOM 363  C CD  . LYS A 1 45  ? 58.381 42.754   24.100 1.00 65.71  ? 45  LYS A CD  1 
ATOM 364  C CE  . LYS A 1 45  ? 58.276 41.629   23.079 1.00 56.78  ? 45  LYS A CE  1 
ATOM 365  N NZ  . LYS A 1 45  ? 59.497 41.524   22.228 1.00 49.13  ? 45  LYS A NZ  1 
ATOM 366  N N   . LYS A 1 46  ? 59.699 44.544   28.906 1.00 60.28  ? 46  LYS A N   1 
ATOM 367  C CA  . LYS A 1 46  ? 60.042 45.433   30.008 1.00 60.33  ? 46  LYS A CA  1 
ATOM 368  C C   . LYS A 1 46  ? 61.297 46.243   29.704 1.00 62.32  ? 46  LYS A C   1 
ATOM 369  O O   . LYS A 1 46  ? 61.472 47.333   30.261 1.00 60.88  ? 46  LYS A O   1 
ATOM 370  C CB  . LYS A 1 46  ? 60.228 44.637   31.304 1.00 59.03  ? 46  LYS A CB  1 
ATOM 371  C CG  . LYS A 1 46  ? 59.028 44.663   32.235 1.00 57.58  ? 46  LYS A CG  1 
ATOM 372  C CD  . LYS A 1 46  ? 58.513 46.087   32.421 1.00 81.42  ? 46  LYS A CD  1 
ATOM 373  C CE  . LYS A 1 46  ? 59.529 46.981   33.128 1.00 69.12  ? 46  LYS A CE  1 
ATOM 374  N NZ  . LYS A 1 46  ? 59.091 48.407   33.154 1.00 33.33  ? 46  LYS A NZ  1 
ATOM 375  N N   . LEU A 1 47  ? 62.177 45.729   28.833 1.00 67.53  ? 47  LEU A N   1 
ATOM 376  C CA  . LEU A 1 47  ? 63.376 46.469   28.452 1.00 66.62  ? 47  LEU A CA  1 
ATOM 377  C C   . LEU A 1 47  ? 63.051 47.674   27.582 1.00 73.74  ? 47  LEU A C   1 
ATOM 378  O O   . LEU A 1 47  ? 63.850 48.608   27.528 1.00 78.40  ? 47  LEU A O   1 
ATOM 379  C CB  . LEU A 1 47  ? 64.371 45.548   27.724 1.00 70.89  ? 47  LEU A CB  1 
ATOM 380  C CG  . LEU A 1 47  ? 65.815 45.959   27.467 1.00 76.36  ? 47  LEU A CG  1 
ATOM 381  C CD1 . LEU A 1 47  ? 66.769 44.809   27.578 1.00 69.32  ? 47  LEU A CD1 1 
ATOM 382  C CD2 . LEU A 1 47  ? 65.997 46.659   26.154 1.00 82.63  ? 47  LEU A CD2 1 
ATOM 383  N N   . ASP A 1 48  ? 61.905 47.677   26.897 1.00 76.02  ? 48  ASP A N   1 
ATOM 384  C CA  . ASP A 1 48  ? 61.494 48.859   26.145 1.00 73.08  ? 48  ASP A CA  1 
ATOM 385  C C   . ASP A 1 48  ? 61.129 50.020   27.050 1.00 75.02  ? 48  ASP A C   1 
ATOM 386  O O   . ASP A 1 48  ? 61.095 51.163   26.586 1.00 81.32  ? 48  ASP A O   1 
ATOM 387  C CB  . ASP A 1 48  ? 60.329 48.556   25.207 1.00 71.49  ? 48  ASP A CB  1 
ATOM 388  C CG  . ASP A 1 48  ? 60.740 48.607   23.746 1.00 73.07  ? 48  ASP A CG  1 
ATOM 389  O OD1 . ASP A 1 48  ? 61.941 48.828   23.477 1.00 68.80  ? 48  ASP A OD1 1 
ATOM 390  O OD2 . ASP A 1 48  ? 59.869 48.445   22.867 1.00 83.27  ? 48  ASP A OD2 1 
ATOM 391  N N   . GLY A 1 49  ? 60.857 49.754   28.320 1.00 73.51  ? 49  GLY A N   1 
ATOM 392  C CA  . GLY A 1 49  ? 60.476 50.797   29.245 1.00 74.74  ? 49  GLY A CA  1 
ATOM 393  C C   . GLY A 1 49  ? 61.677 51.525   29.813 1.00 78.18  ? 49  GLY A C   1 
ATOM 394  O O   . GLY A 1 49  ? 61.690 51.869   30.999 1.00 76.13  ? 49  GLY A O   1 
ATOM 395  N N   . ILE A 1 50  ? 62.691 51.756   28.991 1.00 83.01  ? 50  ILE A N   1 
ATOM 396  C CA  . ILE A 1 50  ? 63.884 52.480   29.411 1.00 88.90  ? 50  ILE A CA  1 
ATOM 397  C C   . ILE A 1 50  ? 63.839 53.861   28.771 1.00 96.54  ? 50  ILE A C   1 
ATOM 398  O O   . ILE A 1 50  ? 63.658 53.977   27.551 1.00 97.01  ? 50  ILE A O   1 
ATOM 399  C CB  . ILE A 1 50  ? 65.187 51.742   29.036 1.00 89.46  ? 50  ILE A CB  1 
ATOM 400  C CG1 . ILE A 1 50  ? 65.172 51.174   27.604 1.00 86.11  ? 50  ILE A CG1 1 
ATOM 401  C CG2 . ILE A 1 50  ? 65.506 50.656   30.057 1.00 73.65  ? 50  ILE A CG2 1 
ATOM 402  C CD1 . ILE A 1 50  ? 65.531 52.118   26.464 1.00 88.40  ? 50  ILE A CD1 1 
ATOM 403  N N   . PRO A 1 51  ? 63.889 54.907   29.537 1.00 98.75  ? 51  PRO A N   1 
ATOM 404  C CA  . PRO A 1 51  ? 64.247 56.204   28.969 1.00 107.60 ? 51  PRO A CA  1 
ATOM 405  C C   . PRO A 1 51  ? 65.727 56.444   29.200 1.00 119.41 ? 51  PRO A C   1 
ATOM 406  O O   . PRO A 1 51  ? 66.449 55.516   29.583 1.00 108.79 ? 51  PRO A O   1 
ATOM 407  C CB  . PRO A 1 51  ? 63.364 57.183   29.751 1.00 108.45 ? 51  PRO A CB  1 
ATOM 408  C CG  . PRO A 1 51  ? 62.293 56.322   30.380 1.00 95.36  ? 51  PRO A CG  1 
ATOM 409  C CD  . PRO A 1 51  ? 63.021 55.061   30.708 1.00 99.09  ? 51  PRO A CD  1 
ATOM 410  N N   . ASP A 1 52  ? 66.194 57.663   28.938 1.00 134.68 ? 52  ASP A N   1 
ATOM 411  C CA  . ASP A 1 52  ? 67.567 58.070   29.223 1.00 143.08 ? 52  ASP A CA  1 
ATOM 412  C C   . ASP A 1 52  ? 68.591 57.214   28.477 1.00 143.02 ? 52  ASP A C   1 
ATOM 413  O O   . ASP A 1 52  ? 69.317 57.731   27.622 1.00 143.99 ? 52  ASP A O   1 
ATOM 414  C CB  . ASP A 1 52  ? 67.834 58.045   30.735 1.00 144.27 ? 52  ASP A CB  1 
ATOM 415  C CG  . ASP A 1 52  ? 69.179 58.655   31.105 1.00 145.11 ? 52  ASP A CG  1 
ATOM 416  O OD1 . ASP A 1 52  ? 69.699 58.347   32.199 1.00 136.14 ? 52  ASP A OD1 1 
ATOM 417  O OD2 . ASP A 1 52  ? 69.711 59.453   30.303 1.00 150.63 ? 52  ASP A OD2 1 
ATOM 418  N N   . CYS A 1 53  ? 68.669 55.913   28.776 1.00 134.78 ? 53  CYS A N   1 
ATOM 419  C CA  . CYS A 1 53  ? 69.620 55.037   28.102 1.00 126.27 ? 53  CYS A CA  1 
ATOM 420  C C   . CYS A 1 53  ? 68.936 53.780   27.581 1.00 117.79 ? 53  CYS A C   1 
ATOM 421  O O   . CYS A 1 53  ? 67.820 53.441   27.979 1.00 111.44 ? 53  CYS A O   1 
ATOM 422  C CB  . CYS A 1 53  ? 70.765 54.631   29.033 1.00 128.05 ? 53  CYS A CB  1 
ATOM 423  S SG  . CYS A 1 53  ? 71.427 55.982   30.035 1.00 136.53 ? 53  CYS A SG  1 
ATOM 424  N N   . ASP A 1 54  ? 69.637 53.091   26.678 1.00 113.32 ? 54  ASP A N   1 
ATOM 425  C CA  . ASP A 1 54  ? 69.175 51.872   26.025 1.00 101.74 ? 54  ASP A CA  1 
ATOM 426  C C   . ASP A 1 54  ? 70.248 50.795   26.127 1.00 93.49  ? 54  ASP A C   1 
ATOM 427  O O   . ASP A 1 54  ? 71.445 51.099   26.103 1.00 91.99  ? 54  ASP A O   1 
ATOM 428  C CB  . ASP A 1 54  ? 68.821 52.126   24.550 1.00 105.96 ? 54  ASP A CB  1 
ATOM 429  C CG  . ASP A 1 54  ? 68.005 50.998   23.943 1.00 92.54  ? 54  ASP A CG  1 
ATOM 430  O OD1 . ASP A 1 54  ? 68.015 50.847   22.705 1.00 75.35  ? 54  ASP A OD1 1 
ATOM 431  O OD2 . ASP A 1 54  ? 67.505 50.151   24.715 1.00 91.33  ? 54  ASP A OD2 1 
ATOM 432  N N   . ILE A 1 55  ? 69.824 49.541   26.267 1.00 93.76  ? 55  ILE A N   1 
ATOM 433  C CA  . ILE A 1 55  ? 70.735 48.402   26.363 1.00 91.91  ? 55  ILE A CA  1 
ATOM 434  C C   . ILE A 1 55  ? 70.372 47.399   25.272 1.00 91.73  ? 55  ILE A C   1 
ATOM 435  O O   . ILE A 1 55  ? 69.205 47.010   25.142 1.00 88.76  ? 55  ILE A O   1 
ATOM 436  C CB  . ILE A 1 55  ? 70.681 47.751   27.757 1.00 84.64  ? 55  ILE A CB  1 
ATOM 437  C CG1 . ILE A 1 55  ? 71.278 48.704   28.796 1.00 87.34  ? 55  ILE A CG1 1 
ATOM 438  C CG2 . ILE A 1 55  ? 71.404 46.407   27.752 1.00 72.86  ? 55  ILE A CG2 1 
ATOM 439  C CD1 . ILE A 1 55  ? 72.630 49.270   28.409 1.00 70.06  ? 55  ILE A CD1 1 
ATOM 440  N N   . SER A 1 56  ? 71.378 46.968   24.504 1.00 93.69  ? 56  SER A N   1 
ATOM 441  C CA  . SER A 1 56  ? 71.128 46.254   23.254 1.00 80.16  ? 56  SER A CA  1 
ATOM 442  C C   . SER A 1 56  ? 70.487 44.892   23.514 1.00 66.33  ? 56  SER A C   1 
ATOM 443  O O   . SER A 1 56  ? 70.784 44.247   24.523 1.00 72.49  ? 56  SER A O   1 
ATOM 444  C CB  . SER A 1 56  ? 72.427 46.066   22.470 1.00 71.01  ? 56  SER A CB  1 
ATOM 445  O OG  . SER A 1 56  ? 73.204 45.010   23.007 1.00 56.89  ? 56  SER A OG  1 
ATOM 446  N N   . PRO A 1 57  ? 69.598 44.432   22.618 1.00 71.00  ? 57  PRO A N   1 
ATOM 447  C CA  . PRO A 1 57  ? 68.981 43.107   22.782 1.00 72.42  ? 57  PRO A CA  1 
ATOM 448  C C   . PRO A 1 57  ? 69.880 41.947   22.374 1.00 60.40  ? 57  PRO A C   1 
ATOM 449  O O   . PRO A 1 57  ? 69.708 40.832   22.874 1.00 54.52  ? 57  PRO A O   1 
ATOM 450  C CB  . PRO A 1 57  ? 67.745 43.183   21.872 1.00 65.56  ? 57  PRO A CB  1 
ATOM 451  C CG  . PRO A 1 57  ? 67.495 44.647   21.678 1.00 72.65  ? 57  PRO A CG  1 
ATOM 452  C CD  . PRO A 1 57  ? 68.864 45.255   21.644 1.00 74.03  ? 57  PRO A CD  1 
ATOM 453  N N   . VAL A 1 58  ? 70.820 42.174   21.453 1.00 58.97  ? 58  VAL A N   1 
ATOM 454  C CA  . VAL A 1 58  ? 71.706 41.090   21.030 1.00 62.68  ? 58  VAL A CA  1 
ATOM 455  C C   . VAL A 1 58  ? 72.549 40.596   22.200 1.00 62.91  ? 58  VAL A C   1 
ATOM 456  O O   . VAL A 1 58  ? 72.927 39.418   22.256 1.00 68.60  ? 58  VAL A O   1 
ATOM 457  C CB  . VAL A 1 58  ? 72.582 41.545   19.845 1.00 67.31  ? 58  VAL A CB  1 
ATOM 458  C CG1 . VAL A 1 58  ? 73.526 40.428   19.408 1.00 66.15  ? 58  VAL A CG1 1 
ATOM 459  C CG2 . VAL A 1 58  ? 71.708 42.001   18.684 1.00 66.55  ? 58  VAL A CG2 1 
ATOM 460  N N   . GLN A 1 59  ? 72.846 41.478   23.155 1.00 63.51  ? 59  GLN A N   1 
ATOM 461  C CA  . GLN A 1 59  ? 73.555 41.071   24.365 1.00 63.16  ? 59  GLN A CA  1 
ATOM 462  C C   . GLN A 1 59  ? 72.669 40.215   25.263 1.00 61.99  ? 59  GLN A C   1 
ATOM 463  O O   . GLN A 1 59  ? 73.134 39.232   25.854 1.00 65.95  ? 59  GLN A O   1 
ATOM 464  C CB  . GLN A 1 59  ? 74.045 42.315   25.108 1.00 76.03  ? 59  GLN A CB  1 
ATOM 465  C CG  . GLN A 1 59  ? 74.307 42.134   26.595 1.00 82.32  ? 59  GLN A CG  1 
ATOM 466  C CD  . GLN A 1 59  ? 74.565 43.459   27.299 1.00 79.96  ? 59  GLN A CD  1 
ATOM 467  O OE1 . GLN A 1 59  ? 73.881 44.454   27.047 1.00 63.11  ? 59  GLN A OE1 1 
ATOM 468  N NE2 . GLN A 1 59  ? 75.555 43.476   28.186 1.00 76.53  ? 59  GLN A NE2 1 
ATOM 469  N N   . ILE A 1 60  ? 71.387 40.570   25.371 1.00 59.04  ? 60  ILE A N   1 
ATOM 470  C CA  . ILE A 1 60  ? 70.480 39.812   26.223 1.00 61.08  ? 60  ILE A CA  1 
ATOM 471  C C   . ILE A 1 60  ? 70.172 38.456   25.598 1.00 61.70  ? 60  ILE A C   1 
ATOM 472  O O   . ILE A 1 60  ? 69.913 37.478   26.313 1.00 60.89  ? 60  ILE A O   1 
ATOM 473  C CB  . ILE A 1 60  ? 69.206 40.638   26.501 1.00 55.84  ? 60  ILE A CB  1 
ATOM 474  C CG1 . ILE A 1 60  ? 68.627 40.297   27.869 1.00 64.27  ? 60  ILE A CG1 1 
ATOM 475  C CG2 . ILE A 1 60  ? 68.135 40.387   25.454 1.00 54.02  ? 60  ILE A CG2 1 
ATOM 476  C CD1 . ILE A 1 60  ? 67.563 41.273   28.313 1.00 64.08  ? 60  ILE A CD1 1 
ATOM 477  N N   . ARG A 1 61  ? 70.216 38.367   24.264 1.00 61.04  ? 61  ARG A N   1 
ATOM 478  C CA  . ARG A 1 61  ? 70.009 37.089   23.587 1.00 60.50  ? 61  ARG A CA  1 
ATOM 479  C C   . ARG A 1 61  ? 71.092 36.089   23.973 1.00 56.45  ? 61  ARG A C   1 
ATOM 480  O O   . ARG A 1 61  ? 70.793 34.964   24.389 1.00 64.37  ? 61  ARG A O   1 
ATOM 481  C CB  . ARG A 1 61  ? 69.989 37.310   22.072 1.00 61.65  ? 61  ARG A CB  1 
ATOM 482  C CG  . ARG A 1 61  ? 69.991 36.053   21.202 1.00 59.89  ? 61  ARG A CG  1 
ATOM 483  C CD  . ARG A 1 61  ? 68.716 35.226   21.356 1.00 57.39  ? 61  ARG A CD  1 
ATOM 484  N NE  . ARG A 1 61  ? 68.489 34.384   20.182 1.00 65.41  ? 61  ARG A NE  1 
ATOM 485  C CZ  . ARG A 1 61  ? 67.293 33.978   19.763 1.00 68.91  ? 61  ARG A CZ  1 
ATOM 486  N NH1 . ARG A 1 61  ? 67.192 33.220   18.678 1.00 71.93  ? 61  ARG A NH1 1 
ATOM 487  N NH2 . ARG A 1 61  ? 66.197 34.328   20.425 1.00 56.70  ? 61  ARG A NH2 1 
ATOM 488  N N   . LYS A 1 62  ? 72.361 36.489   23.858 1.00 50.01  ? 62  LYS A N   1 
ATOM 489  C CA  . LYS A 1 62  ? 73.449 35.608   24.267 1.00 55.58  ? 62  LYS A CA  1 
ATOM 490  C C   . LYS A 1 62  ? 73.518 35.450   25.780 1.00 54.17  ? 62  LYS A C   1 
ATOM 491  O O   . LYS A 1 62  ? 74.099 34.474   26.266 1.00 60.89  ? 62  LYS A O   1 
ATOM 492  C CB  . LYS A 1 62  ? 74.782 36.102   23.703 1.00 58.74  ? 62  LYS A CB  1 
ATOM 493  C CG  . LYS A 1 62  ? 75.790 34.977   23.486 1.00 56.47  ? 62  LYS A CG  1 
ATOM 494  C CD  . LYS A 1 62  ? 76.851 35.345   22.464 1.00 65.75  ? 62  LYS A CD  1 
ATOM 495  C CE  . LYS A 1 62  ? 76.229 35.523   21.085 1.00 69.85  ? 62  LYS A CE  1 
ATOM 496  N NZ  . LYS A 1 62  ? 75.486 34.304   20.647 1.00 52.69  ? 62  LYS A NZ  1 
ATOM 497  N N   . CYS A 1 63  ? 72.951 36.392   26.534 1.00 49.71  ? 63  CYS A N   1 
ATOM 498  C CA  . CYS A 1 63  ? 72.792 36.194   27.971 1.00 57.94  ? 63  CYS A CA  1 
ATOM 499  C C   . CYS A 1 63  ? 71.892 34.988   28.247 1.00 52.57  ? 63  CYS A C   1 
ATOM 500  O O   . CYS A 1 63  ? 72.275 34.044   28.964 1.00 48.24  ? 63  CYS A O   1 
ATOM 501  C CB  . CYS A 1 63  ? 72.221 37.479   28.580 1.00 54.91  ? 63  CYS A CB  1 
ATOM 502  S SG  . CYS A 1 63  ? 72.115 37.566   30.367 1.00 44.97  ? 63  CYS A SG  1 
ATOM 503  N N   . THR A 1 64  ? 70.698 34.990   27.643 1.00 49.09  ? 64  THR A N   1 
ATOM 504  C CA  . THR A 1 64  ? 69.814 33.830   27.706 1.00 48.25  ? 64  THR A CA  1 
ATOM 505  C C   . THR A 1 64  ? 70.504 32.577   27.182 1.00 45.59  ? 64  THR A C   1 
ATOM 506  O O   . THR A 1 64  ? 70.285 31.478   27.701 1.00 41.05  ? 64  THR A O   1 
ATOM 507  C CB  . THR A 1 64  ? 68.535 34.105   26.914 1.00 49.83  ? 64  THR A CB  1 
ATOM 508  O OG1 . THR A 1 64  ? 67.890 35.273   27.435 1.00 54.78  ? 64  THR A OG1 1 
ATOM 509  C CG2 . THR A 1 64  ? 67.580 32.921   26.999 1.00 49.81  ? 64  THR A CG2 1 
ATOM 510  N N   . GLU A 1 65  ? 71.347 32.722   26.156 1.00 46.96  ? 65  GLU A N   1 
ATOM 511  C CA  . GLU A 1 65  ? 72.063 31.567   25.624 1.00 40.95  ? 65  GLU A CA  1 
ATOM 512  C C   . GLU A 1 65  ? 73.033 30.999   26.652 1.00 43.29  ? 65  GLU A C   1 
ATOM 513  O O   . GLU A 1 65  ? 73.223 29.779   26.727 1.00 50.29  ? 65  GLU A O   1 
ATOM 514  C CB  . GLU A 1 65  ? 72.803 31.949   24.340 1.00 37.36  ? 65  GLU A CB  1 
ATOM 515  C CG  . GLU A 1 65  ? 71.894 32.210   23.147 1.00 39.34  ? 65  GLU A CG  1 
ATOM 516  C CD  . GLU A 1 65  ? 72.666 32.551   21.883 1.00 51.19  ? 65  GLU A CD  1 
ATOM 517  O OE1 . GLU A 1 65  ? 72.271 33.504   21.178 1.00 54.47  ? 65  GLU A OE1 1 
ATOM 518  O OE2 . GLU A 1 65  ? 73.670 31.868   21.594 1.00 58.86  ? 65  GLU A OE2 1 
ATOM 519  N N   . LYS A 1 66  ? 73.650 31.866   27.454 1.00 43.02  ? 66  LYS A N   1 
ATOM 520  C CA  . LYS A 1 66  ? 74.533 31.404   28.519 1.00 50.91  ? 66  LYS A CA  1 
ATOM 521  C C   . LYS A 1 66  ? 73.753 30.615   29.566 1.00 51.13  ? 66  LYS A C   1 
ATOM 522  O O   . LYS A 1 66  ? 74.064 29.445   29.856 1.00 48.99  ? 66  LYS A O   1 
ATOM 523  C CB  . LYS A 1 66  ? 75.241 32.605   29.148 1.00 54.39  ? 66  LYS A CB  1 
ATOM 524  C CG  . LYS A 1 66  ? 76.247 32.270   30.233 1.00 60.56  ? 66  LYS A CG  1 
ATOM 525  C CD  . LYS A 1 66  ? 77.553 33.014   29.981 1.00 68.01  ? 66  LYS A CD  1 
ATOM 526  C CE  . LYS A 1 66  ? 78.398 33.117   31.238 1.00 71.12  ? 66  LYS A CE  1 
ATOM 527  N NZ  . LYS A 1 66  ? 77.841 34.109   32.201 1.00 66.05  ? 66  LYS A NZ  1 
ATOM 528  N N   . PHE A 1 67  ? 72.717 31.241   30.138 1.00 48.27  ? 67  PHE A N   1 
ATOM 529  C CA  . PHE A 1 67  ? 71.925 30.539   31.145 1.00 41.35  ? 67  PHE A CA  1 
ATOM 530  C C   . PHE A 1 67  ? 71.329 29.249   30.590 1.00 40.08  ? 67  PHE A C   1 
ATOM 531  O O   . PHE A 1 67  ? 71.181 28.263   31.324 1.00 42.65  ? 67  PHE A O   1 
ATOM 532  C CB  . PHE A 1 67  ? 70.821 31.450   31.676 1.00 42.37  ? 67  PHE A CB  1 
ATOM 533  C CG  . PHE A 1 67  ? 70.105 30.897   32.872 1.00 38.91  ? 67  PHE A CG  1 
ATOM 534  C CD1 . PHE A 1 67  ? 70.785 30.668   34.057 1.00 39.60  ? 67  PHE A CD1 1 
ATOM 535  C CD2 . PHE A 1 67  ? 68.755 30.597   32.809 1.00 38.62  ? 67  PHE A CD2 1 
ATOM 536  C CE1 . PHE A 1 67  ? 70.128 30.157   35.161 1.00 38.86  ? 67  PHE A CE1 1 
ATOM 537  C CE2 . PHE A 1 67  ? 68.092 30.084   33.908 1.00 36.35  ? 67  PHE A CE2 1 
ATOM 538  C CZ  . PHE A 1 67  ? 68.779 29.865   35.086 1.00 40.05  ? 67  PHE A CZ  1 
ATOM 539  N N   . LEU A 1 68  ? 71.018 29.226   29.294 1.00 41.49  ? 68  LEU A N   1 
ATOM 540  C CA  . LEU A 1 68  ? 70.427 28.045   28.677 1.00 40.22  ? 68  LEU A CA  1 
ATOM 541  C C   . LEU A 1 68  ? 71.451 26.944   28.463 1.00 40.66  ? 68  LEU A C   1 
ATOM 542  O O   . LEU A 1 68  ? 71.115 25.763   28.564 1.00 40.81  ? 68  LEU A O   1 
ATOM 543  C CB  . LEU A 1 68  ? 69.776 28.403   27.343 1.00 43.96  ? 68  LEU A CB  1 
ATOM 544  C CG  . LEU A 1 68  ? 68.265 28.206   27.288 1.00 41.56  ? 68  LEU A CG  1 
ATOM 545  C CD1 . LEU A 1 68  ? 67.764 28.317   25.860 1.00 46.96  ? 68  LEU A CD1 1 
ATOM 546  C CD2 . LEU A 1 68  ? 67.895 26.863   27.884 1.00 39.70  ? 68  LEU A CD2 1 
ATOM 547  N N   . CYS A 1 69  ? 72.693 27.300   28.137 1.00 41.35  ? 69  CYS A N   1 
ATOM 548  C CA  . CYS A 1 69  ? 73.728 26.280   28.017 1.00 43.98  ? 69  CYS A CA  1 
ATOM 549  C C   . CYS A 1 69  ? 74.010 25.638   29.368 1.00 47.46  ? 69  CYS A C   1 
ATOM 550  O O   . CYS A 1 69  ? 74.164 24.411   29.465 1.00 54.12  ? 69  CYS A O   1 
ATOM 551  C CB  . CYS A 1 69  ? 74.996 26.889   27.429 1.00 43.61  ? 69  CYS A CB  1 
ATOM 552  S SG  . CYS A 1 69  ? 74.897 27.128   25.647 1.00 67.04  ? 69  CYS A SG  1 
ATOM 553  N N   . PHE A 1 70  ? 74.067 26.454   30.423 1.00 43.43  ? 70  PHE A N   1 
ATOM 554  C CA  . PHE A 1 70  ? 74.149 25.905   31.774 1.00 46.75  ? 70  PHE A CA  1 
ATOM 555  C C   . PHE A 1 70  ? 72.988 24.947   32.037 1.00 45.79  ? 70  PHE A C   1 
ATOM 556  O O   . PHE A 1 70  ? 73.183 23.793   32.463 1.00 47.86  ? 70  PHE A O   1 
ATOM 557  C CB  . PHE A 1 70  ? 74.154 27.064   32.772 1.00 43.05  ? 70  PHE A CB  1 
ATOM 558  C CG  . PHE A 1 70  ? 74.255 26.648   34.205 1.00 37.53  ? 70  PHE A CG  1 
ATOM 559  C CD1 . PHE A 1 70  ? 73.132 26.619   35.007 1.00 39.14  ? 70  PHE A CD1 1 
ATOM 560  C CD2 . PHE A 1 70  ? 75.478 26.320   34.758 1.00 38.63  ? 70  PHE A CD2 1 
ATOM 561  C CE1 . PHE A 1 70  ? 73.220 26.248   36.331 1.00 46.12  ? 70  PHE A CE1 1 
ATOM 562  C CE2 . PHE A 1 70  ? 75.574 25.950   36.084 1.00 46.27  ? 70  PHE A CE2 1 
ATOM 563  C CZ  . PHE A 1 70  ? 74.442 25.914   36.872 1.00 47.34  ? 70  PHE A CZ  1 
ATOM 564  N N   . MET A 1 71  ? 71.768 25.408   31.739 1.00 40.38  ? 71  MET A N   1 
ATOM 565  C CA  . MET A 1 71  ? 70.570 24.601   31.941 1.00 39.39  ? 71  MET A CA  1 
ATOM 566  C C   . MET A 1 71  ? 70.603 23.301   31.146 1.00 44.02  ? 71  MET A C   1 
ATOM 567  O O   . MET A 1 71  ? 70.033 22.298   31.585 1.00 47.21  ? 71  MET A O   1 
ATOM 568  C CB  . MET A 1 71  ? 69.335 25.424   31.578 1.00 41.12  ? 71  MET A CB  1 
ATOM 569  C CG  . MET A 1 71  ? 68.832 26.333   32.696 1.00 38.07  ? 71  MET A CG  1 
ATOM 570  S SD  . MET A 1 71  ? 68.409 25.455   34.217 1.00 45.93  ? 71  MET A SD  1 
ATOM 571  C CE  . MET A 1 71  ? 69.906 25.581   35.184 1.00 35.57  ? 71  MET A CE  1 
ATOM 572  N N   . LYS A 1 72  ? 71.234 23.295   29.971 1.00 47.49  ? 72  LYS A N   1 
ATOM 573  C CA  . LYS A 1 72  ? 71.315 22.060   29.198 1.00 48.11  ? 72  LYS A CA  1 
ATOM 574  C C   . LYS A 1 72  ? 72.368 21.116   29.748 1.00 48.02  ? 72  LYS A C   1 
ATOM 575  O O   . LYS A 1 72  ? 72.193 19.895   29.669 1.00 51.13  ? 72  LYS A O   1 
ATOM 576  C CB  . LYS A 1 72  ? 71.608 22.349   27.725 1.00 51.87  ? 72  LYS A CB  1 
ATOM 577  C CG  . LYS A 1 72  ? 70.395 22.761   26.913 1.00 55.85  ? 72  LYS A CG  1 
ATOM 578  C CD  . LYS A 1 72  ? 70.545 22.329   25.459 1.00 62.68  ? 72  LYS A CD  1 
ATOM 579  C CE  . LYS A 1 72  ? 70.978 20.870   25.347 1.00 60.63  ? 72  LYS A CE  1 
ATOM 580  N NZ  . LYS A 1 72  ? 69.996 19.929   25.958 1.00 54.79  ? 72  LYS A NZ  1 
ATOM 581  N N   . GLY A 1 73  ? 73.458 21.648   30.294 1.00 45.74  ? 73  GLY A N   1 
ATOM 582  C CA  . GLY A 1 73  ? 74.404 20.782   30.965 1.00 53.43  ? 73  GLY A CA  1 
ATOM 583  C C   . GLY A 1 73  ? 73.740 20.032   32.102 1.00 46.00  ? 73  GLY A C   1 
ATOM 584  O O   . GLY A 1 73  ? 73.641 18.792   32.085 1.00 38.30  ? 73  GLY A O   1 
ATOM 585  N N   . HIS A 1 74  ? 73.231 20.789   33.081 1.00 43.42  ? 74  HIS A N   1 
ATOM 586  C CA  . HIS A 1 74  ? 72.678 20.143   34.268 1.00 39.91  ? 74  HIS A CA  1 
ATOM 587  C C   . HIS A 1 74  ? 71.413 19.359   33.941 1.00 38.86  ? 74  HIS A C   1 
ATOM 588  O O   . HIS A 1 74  ? 71.211 18.252   34.456 1.00 37.70  ? 74  HIS A O   1 
ATOM 589  C CB  . HIS A 1 74  ? 72.411 21.187   35.349 1.00 42.78  ? 74  HIS A CB  1 
ATOM 590  C CG  . HIS A 1 74  ? 73.654 21.675   36.025 1.00 48.07  ? 74  HIS A CG  1 
ATOM 591  N ND1 . HIS A 1 74  ? 73.832 21.612   37.390 1.00 56.22  ? 74  HIS A ND1 1 
ATOM 592  C CD2 . HIS A 1 74  ? 74.791 22.210   35.521 1.00 49.64  ? 74  HIS A CD2 1 
ATOM 593  C CE1 . HIS A 1 74  ? 75.020 22.102   37.699 1.00 60.05  ? 74  HIS A CE1 1 
ATOM 594  N NE2 . HIS A 1 74  ? 75.622 22.470   36.583 1.00 54.57  ? 74  HIS A NE2 1 
ATOM 595  N N   . PHE A 1 75  ? 70.566 19.904   33.065 1.00 41.02  ? 75  PHE A N   1 
ATOM 596  C CA  . PHE A 1 75  ? 69.358 19.201   32.644 1.00 39.94  ? 75  PHE A CA  1 
ATOM 597  C C   . PHE A 1 75  ? 69.695 17.870   31.991 1.00 36.00  ? 75  PHE A C   1 
ATOM 598  O O   . PHE A 1 75  ? 69.071 16.845   32.284 1.00 37.54  ? 75  PHE A O   1 
ATOM 599  C CB  . PHE A 1 75  ? 68.556 20.074   31.678 1.00 44.36  ? 75  PHE A CB  1 
ATOM 600  C CG  . PHE A 1 75  ? 67.505 19.323   30.894 1.00 41.40  ? 75  PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 75  ? 67.812 18.740   29.669 1.00 38.89  ? 75  PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 75  ? 66.206 19.228   31.363 1.00 40.24  ? 75  PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 75  ? 66.852 18.059   28.945 1.00 36.85  ? 75  PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 75  ? 65.238 18.552   30.639 1.00 40.51  ? 75  PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 75  ? 65.563 17.967   29.428 1.00 38.65  ? 75  PHE A CZ  1 
ATOM 606  N N   . ASP A 1 76  ? 70.675 17.873   31.085 1.00 36.78  ? 76  ASP A N   1 
ATOM 607  C CA  . ASP A 1 76  ? 71.004 16.660   30.345 1.00 40.55  ? 76  ASP A CA  1 
ATOM 608  C C   . ASP A 1 76  ? 71.577 15.591   31.271 1.00 36.34  ? 76  ASP A C   1 
ATOM 609  O O   . ASP A 1 76  ? 71.141 14.432   31.243 1.00 31.64  ? 76  ASP A O   1 
ATOM 610  C CB  . ASP A 1 76  ? 71.983 16.989   29.218 1.00 42.38  ? 76  ASP A CB  1 
ATOM 611  C CG  . ASP A 1 76  ? 71.553 16.408   27.884 1.00 44.77  ? 76  ASP A CG  1 
ATOM 612  O OD1 . ASP A 1 76  ? 71.063 15.260   27.865 1.00 46.79  ? 76  ASP A OD1 1 
ATOM 613  O OD2 . ASP A 1 76  ? 71.709 17.096   26.852 1.00 46.42  ? 76  ASP A OD2 1 
ATOM 614  N N   . ASN A 1 77  ? 72.544 15.967   32.112 1.00 35.72  ? 77  ASN A N   1 
ATOM 615  C CA  . ASN A 1 77  ? 73.111 15.002   33.052 1.00 31.09  ? 77  ASN A CA  1 
ATOM 616  C C   . ASN A 1 77  ? 72.036 14.430   33.973 1.00 31.48  ? 77  ASN A C   1 
ATOM 617  O O   . ASN A 1 77  ? 71.882 13.203   34.100 1.00 38.60  ? 77  ASN A O   1 
ATOM 618  C CB  . ASN A 1 77  ? 74.226 15.669   33.859 1.00 36.34  ? 77  ASN A CB  1 
ATOM 619  C CG  . ASN A 1 77  ? 74.617 14.878   35.088 1.00 43.45  ? 77  ASN A CG  1 
ATOM 620  O OD1 . ASN A 1 77  ? 74.243 15.227   36.208 1.00 40.73  ? 77  ASN A OD1 1 
ATOM 621  N ND2 . ASN A 1 77  ? 75.371 13.804   34.886 1.00 60.05  ? 77  ASN A ND2 1 
ATOM 622  N N   . LEU A 1 78  ? 71.262 15.313   34.606 1.00 34.90  ? 78  LEU A N   1 
ATOM 623  C CA  . LEU A 1 78  ? 70.253 14.866   35.557 1.00 34.76  ? 78  LEU A CA  1 
ATOM 624  C C   . LEU A 1 78  ? 69.196 14.002   34.885 1.00 32.01  ? 78  LEU A C   1 
ATOM 625  O O   . LEU A 1 78  ? 68.667 13.071   35.505 1.00 32.59  ? 78  LEU A O   1 
ATOM 626  C CB  . LEU A 1 78  ? 69.617 16.079   36.229 1.00 32.25  ? 78  LEU A CB  1 
ATOM 627  C CG  . LEU A 1 78  ? 70.593 16.722   37.212 1.00 32.16  ? 78  LEU A CG  1 
ATOM 628  C CD1 . LEU A 1 78  ? 70.166 18.136   37.569 1.00 41.50  ? 78  LEU A CD1 1 
ATOM 629  C CD2 . LEU A 1 78  ? 70.774 15.854   38.444 1.00 35.03  ? 78  LEU A CD2 1 
ATOM 630  N N   . PHE A 1 79  ? 68.882 14.284   33.619 1.00 31.87  ? 79  PHE A N   1 
ATOM 631  C CA  . PHE A 1 79  ? 67.924 13.449   32.908 1.00 35.44  ? 79  PHE A CA  1 
ATOM 632  C C   . PHE A 1 79  ? 68.508 12.083   32.584 1.00 37.55  ? 79  PHE A C   1 
ATOM 633  O O   . PHE A 1 79  ? 67.773 11.091   32.566 1.00 33.22  ? 79  PHE A O   1 
ATOM 634  C CB  . PHE A 1 79  ? 67.452 14.134   31.628 1.00 36.73  ? 79  PHE A CB  1 
ATOM 635  C CG  . PHE A 1 79  ? 66.397 13.362   30.891 1.00 36.56  ? 79  PHE A CG  1 
ATOM 636  C CD1 . PHE A 1 79  ? 66.744 12.473   29.887 1.00 36.29  ? 79  PHE A CD1 1 
ATOM 637  C CD2 . PHE A 1 79  ? 65.058 13.517   31.207 1.00 39.50  ? 79  PHE A CD2 1 
ATOM 638  C CE1 . PHE A 1 79  ? 65.778 11.756   29.212 1.00 37.30  ? 79  PHE A CE1 1 
ATOM 639  C CE2 . PHE A 1 79  ? 64.085 12.801   30.531 1.00 39.18  ? 79  PHE A CE2 1 
ATOM 640  C CZ  . PHE A 1 79  ? 64.446 11.922   29.533 1.00 34.80  ? 79  PHE A CZ  1 
ATOM 641  N N   . SER A 1 80  ? 69.811 12.008   32.300 1.00 36.28  ? 80  SER A N   1 
ATOM 642  C CA  . SER A 1 80  ? 70.437 10.700   32.136 1.00 27.04  ? 80  SER A CA  1 
ATOM 643  C C   . SER A 1 80  ? 70.299 9.869    33.404 1.00 26.36  ? 80  SER A C   1 
ATOM 644  O O   . SER A 1 80  ? 69.827 8.726    33.359 1.00 35.24  ? 80  SER A O   1 
ATOM 645  C CB  . SER A 1 80  ? 71.906 10.854   31.747 1.00 26.06  ? 80  SER A CB  1 
ATOM 646  O OG  . SER A 1 80  ? 72.029 11.437   30.462 1.00 29.88  ? 80  SER A OG  1 
ATOM 647  N N   . LYS A 1 81  ? 70.684 10.431   34.552 1.00 29.05  ? 81  LYS A N   1 
ATOM 648  C CA  . LYS A 1 81  ? 70.601 9.658    35.792 1.00 34.57  ? 81  LYS A CA  1 
ATOM 649  C C   . LYS A 1 81  ? 69.159 9.263    36.109 1.00 33.09  ? 81  LYS A C   1 
ATOM 650  O O   . LYS A 1 81  ? 68.872 8.101    36.432 1.00 35.60  ? 81  LYS A O   1 
ATOM 651  C CB  . LYS A 1 81  ? 71.212 10.448   36.949 1.00 37.86  ? 81  LYS A CB  1 
ATOM 652  C CG  . LYS A 1 81  ? 72.698 10.720   36.779 1.00 47.71  ? 81  LYS A CG  1 
ATOM 653  C CD  . LYS A 1 81  ? 73.302 11.370   38.016 1.00 51.71  ? 81  LYS A CD  1 
ATOM 654  C CE  . LYS A 1 81  ? 72.925 12.835   38.122 1.00 46.87  ? 81  LYS A CE  1 
ATOM 655  N NZ  . LYS A 1 81  ? 73.389 13.425   39.408 1.00 55.04  ? 81  LYS A NZ  1 
ATOM 656  N N   . MET A 1 82  ? 68.234 10.220   36.011 1.00 37.10  ? 82  MET A N   1 
ATOM 657  C CA  . MET A 1 82  ? 66.833 9.918    36.283 1.00 37.04  ? 82  MET A CA  1 
ATOM 658  C C   . MET A 1 82  ? 66.286 8.886    35.304 1.00 33.26  ? 82  MET A C   1 
ATOM 659  O O   . MET A 1 82  ? 65.414 8.086    35.663 1.00 32.86  ? 82  MET A O   1 
ATOM 660  C CB  . MET A 1 82  ? 66.009 11.207   36.238 1.00 32.91  ? 82  MET A CB  1 
ATOM 661  C CG  . MET A 1 82  ? 64.571 11.064   36.701 1.00 30.85  ? 82  MET A CG  1 
ATOM 662  S SD  . MET A 1 82  ? 63.410 10.985   35.331 1.00 33.77  ? 82  MET A SD  1 
ATOM 663  C CE  . MET A 1 82  ? 63.510 12.656   34.705 1.00 38.30  ? 82  MET A CE  1 
ATOM 664  N N   . GLU A 1 83  ? 66.798 8.874    34.075 1.00 34.75  ? 83  GLU A N   1 
ATOM 665  C CA  . GLU A 1 83  ? 66.317 7.928    33.076 1.00 39.68  ? 83  GLU A CA  1 
ATOM 666  C C   . GLU A 1 83  ? 66.846 6.523    33.333 1.00 38.83  ? 83  GLU A C   1 
ATOM 667  O O   . GLU A 1 83  ? 66.135 5.541    33.096 1.00 39.82  ? 83  GLU A O   1 
ATOM 668  C CB  . GLU A 1 83  ? 66.710 8.407    31.677 1.00 42.96  ? 83  GLU A CB  1 
ATOM 669  C CG  . GLU A 1 83  ? 66.493 7.382    30.580 1.00 34.22  ? 83  GLU A CG  1 
ATOM 670  C CD  . GLU A 1 83  ? 67.789 6.763    30.107 1.00 39.35  ? 83  GLU A CD  1 
ATOM 671  O OE1 . GLU A 1 83  ? 67.944 5.538    30.259 1.00 51.23  ? 83  GLU A OE1 1 
ATOM 672  O OE2 . GLU A 1 83  ? 68.663 7.501    29.607 1.00 39.80  ? 83  GLU A OE2 1 
ATOM 673  N N   . GLN A 1 84  ? 68.082 6.402    33.827 1.00 41.25  ? 84  GLN A N   1 
ATOM 674  C CA  . GLN A 1 84  ? 68.588 5.079    34.183 1.00 39.31  ? 84  GLN A CA  1 
ATOM 675  C C   . GLN A 1 84  ? 67.873 4.536    35.416 1.00 36.93  ? 84  GLN A C   1 
ATOM 676  O O   . GLN A 1 84  ? 67.611 3.330    35.506 1.00 38.76  ? 84  GLN A O   1 
ATOM 677  C CB  . GLN A 1 84  ? 70.107 5.120    34.375 1.00 41.11  ? 84  GLN A CB  1 
ATOM 678  C CG  . GLN A 1 84  ? 70.598 5.237    35.809 1.00 50.13  ? 84  GLN A CG  1 
ATOM 679  C CD  . GLN A 1 84  ? 72.113 5.239    35.898 1.00 62.32  ? 84  GLN A CD  1 
ATOM 680  O OE1 . GLN A 1 84  ? 72.782 4.395    35.300 1.00 72.26  ? 84  GLN A OE1 1 
ATOM 681  N NE2 . GLN A 1 84  ? 72.663 6.194    36.642 1.00 58.66  ? 84  GLN A NE2 1 
ATOM 682  N N   . LEU A 1 85  ? 67.536 5.407    36.375 1.00 40.02  ? 85  LEU A N   1 
ATOM 683  C CA  . LEU A 1 85  ? 66.670 4.967    37.466 1.00 37.10  ? 85  LEU A CA  1 
ATOM 684  C C   . LEU A 1 85  ? 65.311 4.527    36.934 1.00 30.93  ? 85  LEU A C   1 
ATOM 685  O O   . LEU A 1 85  ? 64.731 3.543    37.414 1.00 32.17  ? 85  LEU A O   1 
ATOM 686  C CB  . LEU A 1 85  ? 66.507 6.088    38.492 1.00 47.16  ? 85  LEU A CB  1 
ATOM 687  C CG  . LEU A 1 85  ? 67.505 6.104    39.651 1.00 53.29  ? 85  LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 85  ? 67.488 7.450    40.363 1.00 46.86  ? 85  LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 85  ? 67.195 4.976    40.620 1.00 64.66  ? 85  LEU A CD2 1 
ATOM 690  N N   . PHE A 1 86  ? 64.796 5.244    35.929 1.00 36.28  ? 86  PHE A N   1 
ATOM 691  C CA  . PHE A 1 86  ? 63.555 4.843    35.273 1.00 39.34  ? 86  PHE A CA  1 
ATOM 692  C C   . PHE A 1 86  ? 63.663 3.446    34.686 1.00 35.18  ? 86  PHE A C   1 
ATOM 693  O O   . PHE A 1 86  ? 62.748 2.633    34.837 1.00 33.24  ? 86  PHE A O   1 
ATOM 694  C CB  . PHE A 1 86  ? 63.174 5.841    34.178 1.00 42.28  ? 86  PHE A CB  1 
ATOM 695  C CG  . PHE A 1 86  ? 61.944 6.640    34.486 1.00 42.30  ? 86  PHE A CG  1 
ATOM 696  C CD1 . PHE A 1 86  ? 60.686 6.115    34.228 1.00 39.34  ? 86  PHE A CD1 1 
ATOM 697  C CD2 . PHE A 1 86  ? 62.035 7.896    35.049 1.00 43.17  ? 86  PHE A CD2 1 
ATOM 698  C CE1 . PHE A 1 86  ? 59.544 6.838    34.509 1.00 39.01  ? 86  PHE A CE1 1 
ATOM 699  C CE2 . PHE A 1 86  ? 60.897 8.625    35.338 1.00 47.43  ? 86  PHE A CE2 1 
ATOM 700  C CZ  . PHE A 1 86  ? 59.650 8.094    35.067 1.00 46.63  ? 86  PHE A CZ  1 
ATOM 701  N N   . LEU A 1 87  ? 64.769 3.153    34.000 1.00 35.22  ? 87  LEU A N   1 
ATOM 702  C CA  . LEU A 1 87  ? 64.924 1.847    33.374 1.00 34.04  ? 87  LEU A CA  1 
ATOM 703  C C   . LEU A 1 87  ? 65.222 0.753    34.387 1.00 32.67  ? 87  LEU A C   1 
ATOM 704  O O   . LEU A 1 87  ? 65.002 -0.426   34.092 1.00 34.52  ? 87  LEU A O   1 
ATOM 705  C CB  . LEU A 1 87  ? 66.041 1.904    32.333 1.00 31.18  ? 87  LEU A CB  1 
ATOM 706  C CG  . LEU A 1 87  ? 65.710 2.671    31.055 1.00 31.29  ? 87  LEU A CG  1 
ATOM 707  C CD1 . LEU A 1 87  ? 66.553 2.176    29.895 1.00 37.84  ? 87  LEU A CD1 1 
ATOM 708  C CD2 . LEU A 1 87  ? 64.234 2.572    30.738 1.00 30.54  ? 87  LEU A CD2 1 
ATOM 709  N N   . GLN A 1 88  ? 65.698 1.112    35.576 1.00 38.33  ? 88  GLN A N   1 
ATOM 710  C CA  . GLN A 1 88  ? 65.956 0.107    36.599 1.00 36.15  ? 88  GLN A CA  1 
ATOM 711  C C   . GLN A 1 88  ? 64.674 -0.279   37.325 1.00 32.13  ? 88  GLN A C   1 
ATOM 712  O O   . GLN A 1 88  ? 64.271 -1.446   37.315 1.00 36.75  ? 88  GLN A O   1 
ATOM 713  C CB  . GLN A 1 88  ? 66.999 0.620    37.592 1.00 43.11  ? 88  GLN A CB  1 
ATOM 714  C CG  . GLN A 1 88  ? 68.429 0.339    37.189 1.00 48.06  ? 88  GLN A CG  1 
ATOM 715  C CD  . GLN A 1 88  ? 69.423 1.028    38.098 1.00 72.65  ? 88  GLN A CD  1 
ATOM 716  O OE1 . GLN A 1 88  ? 69.052 1.584    39.134 1.00 74.34  ? 88  GLN A OE1 1 
ATOM 717  N NE2 . GLN A 1 88  ? 70.694 1.004    37.713 1.00 84.67  ? 88  GLN A NE2 1 
ATOM 718  N N   . LEU A 1 89  ? 64.015 0.690    37.960 1.00 37.11  ? 89  LEU A N   1 
ATOM 719  C CA  . LEU A 1 89  ? 62.908 0.368    38.851 1.00 38.04  ? 89  LEU A CA  1 
ATOM 720  C C   . LEU A 1 89  ? 61.535 0.484    38.200 1.00 36.34  ? 89  LEU A C   1 
ATOM 721  O O   . LEU A 1 89  ? 60.544 0.062    38.806 1.00 36.13  ? 89  LEU A O   1 
ATOM 722  C CB  . LEU A 1 89  ? 62.963 1.266    40.093 1.00 50.49  ? 89  LEU A CB  1 
ATOM 723  C CG  . LEU A 1 89  ? 64.341 1.391    40.747 1.00 51.44  ? 89  LEU A CG  1 
ATOM 724  C CD1 . LEU A 1 89  ? 64.325 2.436    41.856 1.00 48.17  ? 89  LEU A CD1 1 
ATOM 725  C CD2 . LEU A 1 89  ? 64.821 0.040    41.270 1.00 42.68  ? 89  LEU A CD2 1 
ATOM 726  N N   . ILE A 1 90  ? 61.451 1.019    36.985 1.00 38.02  ? 90  ILE A N   1 
ATOM 727  C CA  . ILE A 1 90  ? 60.216 1.056    36.215 1.00 41.00  ? 90  ILE A CA  1 
ATOM 728  C C   . ILE A 1 90  ? 60.552 0.500    34.836 1.00 43.72  ? 90  ILE A C   1 
ATOM 729  O O   . ILE A 1 90  ? 61.719 0.335    34.481 1.00 44.03  ? 90  ILE A O   1 
ATOM 730  C CB  . ILE A 1 90  ? 59.608 2.480    36.120 1.00 35.38  ? 90  ILE A CB  1 
ATOM 731  C CG1 . ILE A 1 90  ? 59.506 3.128    37.499 1.00 36.04  ? 90  ILE A CG1 1 
ATOM 732  C CG2 . ILE A 1 90  ? 58.199 2.454    35.549 1.00 32.53  ? 90  ILE A CG2 1 
ATOM 733  C CD1 . ILE A 1 90  ? 60.695 3.968    37.866 1.00 38.11  ? 90  ILE A CD1 1 
ATOM 734  N N   . LEU A 1 91  ? 59.513 0.162    34.072 1.00 41.04  ? 91  LEU A N   1 
ATOM 735  C CA  . LEU A 1 91  ? 59.678 -0.257   32.681 1.00 39.27  ? 91  LEU A CA  1 
ATOM 736  C C   . LEU A 1 91  ? 60.644 -1.431   32.561 1.00 36.94  ? 91  LEU A C   1 
ATOM 737  O O   . LEU A 1 91  ? 61.358 -1.566   31.564 1.00 36.37  ? 91  LEU A O   1 
ATOM 738  C CB  . LEU A 1 91  ? 60.140 0.904    31.796 1.00 33.64  ? 91  LEU A CB  1 
ATOM 739  C CG  . LEU A 1 91  ? 59.300 2.180    31.839 1.00 33.04  ? 91  LEU A CG  1 
ATOM 740  C CD1 . LEU A 1 91  ? 59.940 3.244    30.977 1.00 46.80  ? 91  LEU A CD1 1 
ATOM 741  C CD2 . LEU A 1 91  ? 57.877 1.912    31.388 1.00 29.41  ? 91  LEU A CD2 1 
ATOM 742  N N   . ARG A 1 92  ? 60.703 -2.267   33.593 1.00 35.56  ? 92  ARG A N   1 
ATOM 743  C CA  . ARG A 1 92  ? 61.599 -3.412   33.599 1.00 36.78  ? 92  ARG A CA  1 
ATOM 744  C C   . ARG A 1 92  ? 60.894 -4.608   34.213 1.00 40.07  ? 92  ARG A C   1 
ATOM 745  O O   . ARG A 1 92  ? 60.289 -4.492   35.284 1.00 33.92  ? 92  ARG A O   1 
ATOM 746  C CB  . ARG A 1 92  ? 62.881 -3.090   34.373 1.00 37.65  ? 92  ARG A CB  1 
ATOM 747  C CG  . ARG A 1 92  ? 63.525 -4.278   35.059 1.00 38.22  ? 92  ARG A CG  1 
ATOM 748  C CD  . ARG A 1 92  ? 65.026 -4.204   34.892 1.00 43.14  ? 92  ARG A CD  1 
ATOM 749  N NE  . ARG A 1 92  ? 65.383 -4.179   33.476 1.00 54.86  ? 92  ARG A NE  1 
ATOM 750  C CZ  . ARG A 1 92  ? 66.601 -3.920   33.011 1.00 61.79  ? 92  ARG A CZ  1 
ATOM 751  N NH1 . ARG A 1 92  ? 66.823 -3.926   31.703 1.00 52.67  ? 92  ARG A NH1 1 
ATOM 752  N NH2 . ARG A 1 92  ? 67.593 -3.644   33.849 1.00 61.15  ? 92  ARG A NH2 1 
ATOM 753  N N   . ILE A 1 93  ? 60.970 -5.748   33.531 1.00 39.75  ? 93  ILE A N   1 
ATOM 754  C CA  . ILE A 1 93  ? 60.526 -7.017   34.101 1.00 32.29  ? 93  ILE A CA  1 
ATOM 755  C C   . ILE A 1 93  ? 61.697 -7.531   34.925 1.00 34.28  ? 93  ILE A C   1 
ATOM 756  O O   . ILE A 1 93  ? 62.801 -7.692   34.386 1.00 42.99  ? 93  ILE A O   1 
ATOM 757  C CB  . ILE A 1 93  ? 60.110 -8.021   33.018 1.00 28.18  ? 93  ILE A CB  1 
ATOM 758  C CG1 . ILE A 1 93  ? 59.355 -7.313   31.898 1.00 32.31  ? 93  ILE A CG1 1 
ATOM 759  C CG2 . ILE A 1 93  ? 59.230 -9.098   33.618 1.00 31.28  ? 93  ILE A CG2 1 
ATOM 760  C CD1 . ILE A 1 93  ? 58.047 -6.711   32.340 1.00 32.88  ? 93  ILE A CD1 1 
ATOM 761  N N   . PRO A 1 94  ? 61.513 -7.805   36.214 1.00 28.48  ? 94  PRO A N   1 
ATOM 762  C CA  . PRO A 1 94  ? 62.665 -8.016   37.105 1.00 31.58  ? 94  PRO A CA  1 
ATOM 763  C C   . PRO A 1 94  ? 63.584 -9.177   36.736 1.00 46.90  ? 94  PRO A C   1 
ATOM 764  O O   . PRO A 1 94  ? 64.583 -9.396   37.430 1.00 53.68  ? 94  PRO A O   1 
ATOM 765  C CB  . PRO A 1 94  ? 62.003 -8.253   38.470 1.00 29.89  ? 94  PRO A CB  1 
ATOM 766  C CG  . PRO A 1 94  ? 60.680 -7.572   38.372 1.00 26.16  ? 94  PRO A CG  1 
ATOM 767  C CD  . PRO A 1 94  ? 60.239 -7.764   36.953 1.00 26.33  ? 94  PRO A CD  1 
ATOM 768  N N   . SER A 1 95  ? 63.249 -9.931   35.678 1.00 47.75  ? 95  SER A N   1 
ATOM 769  C CA  . SER A 1 95  ? 63.943 -11.150  35.246 1.00 49.49  ? 95  SER A CA  1 
ATOM 770  C C   . SER A 1 95  ? 63.678 -12.297  36.217 1.00 44.17  ? 95  SER A C   1 
ATOM 771  O O   . SER A 1 95  ? 63.862 -13.468  35.875 1.00 43.27  ? 95  SER A O   1 
ATOM 772  C CB  . SER A 1 95  ? 65.454 -10.931  35.086 1.00 53.16  ? 95  SER A CB  1 
ATOM 773  O OG  . SER A 1 95  ? 66.112 -10.885  36.344 1.00 53.21  ? 95  SER A OG  1 
ATOM 774  N N   . ASN A 1 96  ? 63.248 -11.959  37.431 1.00 44.63  ? 96  ASN A N   1 
ATOM 775  C CA  . ASN A 1 96  ? 62.722 -12.930  38.380 1.00 43.64  ? 96  ASN A CA  1 
ATOM 776  C C   . ASN A 1 96  ? 61.275 -13.289  38.060 1.00 43.69  ? 96  ASN A C   1 
ATOM 777  O O   . ASN A 1 96  ? 60.838 -14.416  38.322 1.00 45.54  ? 96  ASN A O   1 
ATOM 778  C CB  . ASN A 1 96  ? 62.848 -12.355  39.795 1.00 44.40  ? 96  ASN A CB  1 
ATOM 779  C CG  . ASN A 1 96  ? 62.119 -13.175  40.842 1.00 58.35  ? 96  ASN A CG  1 
ATOM 780  O OD1 . ASN A 1 96  ? 61.964 -14.389  40.712 1.00 71.48  ? 96  ASN A OD1 1 
ATOM 781  N ND2 . ASN A 1 96  ? 61.667 -12.507  41.896 1.00 53.60  ? 96  ASN A ND2 1 
ATOM 782  N N   . ILE A 1 97  ? 60.537 -12.360  37.481 1.00 40.90  ? 97  ILE A N   1 
ATOM 783  C CA  . ILE A 1 97  ? 59.109 -12.504  37.226 1.00 39.99  ? 97  ILE A CA  1 
ATOM 784  C C   . ILE A 1 97  ? 58.896 -13.108  35.844 1.00 34.57  ? 97  ILE A C   1 
ATOM 785  O O   . ILE A 1 97  ? 59.668 -12.850  34.911 1.00 36.64  ? 97  ILE A O   1 
ATOM 786  C CB  . ILE A 1 97  ? 58.407 -11.137  37.369 1.00 33.74  ? 97  ILE A CB  1 
ATOM 787  C CG1 . ILE A 1 97  ? 57.899 -10.936  38.801 1.00 31.27  ? 97  ILE A CG1 1 
ATOM 788  C CG2 . ILE A 1 97  ? 57.297 -10.948  36.337 1.00 29.52  ? 97  ILE A CG2 1 
ATOM 789  C CD1 . ILE A 1 97  ? 58.995 -10.724  39.831 1.00 35.22  ? 97  ILE A CD1 1 
ATOM 790  N N   . LEU A 1 98  ? 57.871 -13.948  35.721 1.00 29.41  ? 98  LEU A N   1 
ATOM 791  C CA  . LEU A 1 98  ? 57.445 -14.498  34.439 1.00 35.77  ? 98  LEU A CA  1 
ATOM 792  C C   . LEU A 1 98  ? 56.048 -13.982  34.115 1.00 35.80  ? 98  LEU A C   1 
ATOM 793  O O   . LEU A 1 98  ? 55.159 -14.008  34.974 1.00 35.74  ? 98  LEU A O   1 
ATOM 794  C CB  . LEU A 1 98  ? 57.476 -16.031  34.475 1.00 48.89  ? 98  LEU A CB  1 
ATOM 795  C CG  . LEU A 1 98  ? 56.804 -16.839  33.364 1.00 43.20  ? 98  LEU A CG  1 
ATOM 796  C CD1 . LEU A 1 98  ? 57.602 -18.102  33.064 1.00 40.90  ? 98  LEU A CD1 1 
ATOM 797  C CD2 . LEU A 1 98  ? 55.387 -17.210  33.778 1.00 41.76  ? 98  LEU A CD2 1 
ATOM 798  N N   . LEU A 1 99  ? 55.854 -13.534  32.875 1.00 32.52  ? 99  LEU A N   1 
ATOM 799  C CA  . LEU A 1 99  ? 54.605 -12.889  32.497 1.00 34.43  ? 99  LEU A CA  1 
ATOM 800  C C   . LEU A 1 99  ? 53.458 -13.896  32.460 1.00 40.07  ? 99  LEU A C   1 
ATOM 801  O O   . LEU A 1 99  ? 53.662 -15.073  32.154 1.00 49.29  ? 99  LEU A O   1 
ATOM 802  C CB  . LEU A 1 99  ? 54.737 -12.209  31.137 1.00 37.91  ? 99  LEU A CB  1 
ATOM 803  C CG  . LEU A 1 99  ? 55.591 -10.938  31.107 1.00 38.15  ? 99  LEU A CG  1 
ATOM 804  C CD1 . LEU A 1 99  ? 55.690 -10.392  29.693 1.00 35.15  ? 99  LEU A CD1 1 
ATOM 805  C CD2 . LEU A 1 99  ? 55.051 -9.884   32.065 1.00 31.16  ? 99  LEU A CD2 1 
ATOM 806  N N   . PRO A 1 100 ? 52.234 -13.457  32.769 1.00 45.54  ? 100 PRO A N   1 
ATOM 807  C CA  . PRO A 1 100 ? 51.084 -14.374  32.679 1.00 53.55  ? 100 PRO A CA  1 
ATOM 808  C C   . PRO A 1 100 ? 50.811 -14.846  31.266 1.00 47.51  ? 100 PRO A C   1 
ATOM 809  O O   . PRO A 1 100 ? 50.104 -15.844  31.083 1.00 47.36  ? 100 PRO A O   1 
ATOM 810  C CB  . PRO A 1 100 ? 49.913 -13.539  33.224 1.00 52.70  ? 100 PRO A CB  1 
ATOM 811  C CG  . PRO A 1 100 ? 50.529 -12.316  33.844 1.00 45.78  ? 100 PRO A CG  1 
ATOM 812  C CD  . PRO A 1 100 ? 51.833 -12.096  33.160 1.00 44.37  ? 100 PRO A CD  1 
ATOM 813  N N   . GLU A 1 101 ? 51.353 -14.154  30.264 1.00 47.84  ? 101 GLU A N   1 
ATOM 814  C CA  . GLU A 1 101 ? 51.144 -14.538  28.874 1.00 49.22  ? 101 GLU A CA  1 
ATOM 815  C C   . GLU A 1 101 ? 51.716 -15.920  28.592 1.00 45.91  ? 101 GLU A C   1 
ATOM 816  O O   . GLU A 1 101 ? 51.075 -16.745  27.931 1.00 49.89  ? 101 GLU A O   1 
ATOM 817  C CB  . GLU A 1 101 ? 51.790 -13.494  27.968 1.00 48.16  ? 101 GLU A CB  1 
ATOM 818  C CG  . GLU A 1 101 ? 51.594 -12.080  28.485 1.00 51.56  ? 101 GLU A CG  1 
ATOM 819  C CD  . GLU A 1 101 ? 52.533 -11.091  27.839 1.00 50.40  ? 101 GLU A CD  1 
ATOM 820  O OE1 . GLU A 1 101 ? 52.357 -9.874   28.059 1.00 48.51  ? 101 GLU A OE1 1 
ATOM 821  O OE2 . GLU A 1 101 ? 53.453 -11.536  27.119 1.00 48.78  ? 101 GLU A OE2 1 
ATOM 822  N N   . ASP A 1 102 ? 52.921 -16.189  29.085 1.00 42.91  ? 102 ASP A N   1 
ATOM 823  C CA  . ASP A 1 102 ? 53.605 -17.460  28.870 1.00 41.37  ? 102 ASP A CA  1 
ATOM 824  C C   . ASP A 1 102 ? 53.907 -18.085  30.228 1.00 40.20  ? 102 ASP A C   1 
ATOM 825  O O   . ASP A 1 102 ? 55.048 -18.086  30.692 1.00 32.66  ? 102 ASP A O   1 
ATOM 826  C CB  . ASP A 1 102 ? 54.878 -17.261  28.031 1.00 40.93  ? 102 ASP A CB  1 
ATOM 827  C CG  . ASP A 1 102 ? 55.585 -15.955  28.333 1.00 41.26  ? 102 ASP A CG  1 
ATOM 828  O OD1 . ASP A 1 102 ? 56.222 -15.400  27.414 1.00 41.42  ? 102 ASP A OD1 1 
ATOM 829  O OD2 . ASP A 1 102 ? 55.509 -15.481  29.484 1.00 46.29  ? 102 ASP A OD2 1 
ATOM 830  N N   . LYS A 1 103 ? 52.863 -18.616  30.864 1.00 47.73  ? 103 LYS A N   1 
ATOM 831  C CA  . LYS A 1 103 ? 53.016 -19.417  32.071 1.00 46.49  ? 103 LYS A CA  1 
ATOM 832  C C   . LYS A 1 103 ? 53.324 -20.873  31.756 1.00 41.70  ? 103 LYS A C   1 
ATOM 833  O O   . LYS A 1 103 ? 53.976 -21.548  32.559 1.00 42.09  ? 103 LYS A O   1 
ATOM 834  C CB  . LYS A 1 103 ? 51.748 -19.347  32.929 1.00 50.27  ? 103 LYS A CB  1 
ATOM 835  C CG  . LYS A 1 103 ? 50.506 -19.943  32.267 1.00 57.71  ? 103 LYS A CG  1 
ATOM 836  C CD  . LYS A 1 103 ? 49.771 -18.926  31.405 1.00 59.95  ? 103 LYS A CD  1 
ATOM 837  C CE  . LYS A 1 103 ? 48.638 -19.566  30.616 1.00 63.29  ? 103 LYS A CE  1 
ATOM 838  N NZ  . LYS A 1 103 ? 47.900 -18.559  29.801 1.00 52.13  ? 103 LYS A NZ  1 
ATOM 839  N N   . CYS A 1 104 ? 52.867 -21.366  30.600 1.00 38.80  ? 104 CYS A N   1 
ATOM 840  C CA  . CYS A 1 104 ? 53.144 -22.744  30.206 1.00 46.03  ? 104 CYS A CA  1 
ATOM 841  C C   . CYS A 1 104 ? 54.635 -22.988  30.028 1.00 43.42  ? 104 CYS A C   1 
ATOM 842  O O   . CYS A 1 104 ? 55.098 -24.127  30.161 1.00 49.88  ? 104 CYS A O   1 
ATOM 843  C CB  . CYS A 1 104 ? 52.397 -23.086  28.917 1.00 50.31  ? 104 CYS A CB  1 
ATOM 844  S SG  . CYS A 1 104 ? 52.372 -21.761  27.690 1.00 54.55  ? 104 CYS A SG  1 
ATOM 845  N N   . LYS A 1 105 ? 55.396 -21.941  29.723 1.00 38.24  ? 105 LYS A N   1 
ATOM 846  C CA  . LYS A 1 105 ? 56.843 -22.038  29.597 1.00 40.28  ? 105 LYS A CA  1 
ATOM 847  C C   . LYS A 1 105 ? 57.554 -22.089  30.942 1.00 39.17  ? 105 LYS A C   1 
ATOM 848  O O   . LYS A 1 105 ? 58.789 -22.122  30.968 1.00 40.82  ? 105 LYS A O   1 
ATOM 849  C CB  . LYS A 1 105 ? 57.381 -20.864  28.776 1.00 42.42  ? 105 LYS A CB  1 
ATOM 850  C CG  . LYS A 1 105 ? 57.179 -20.992  27.273 1.00 38.68  ? 105 LYS A CG  1 
ATOM 851  C CD  . LYS A 1 105 ? 55.835 -20.419  26.856 1.00 38.15  ? 105 LYS A CD  1 
ATOM 852  C CE  . LYS A 1 105 ? 55.929 -19.679  25.531 1.00 36.63  ? 105 LYS A CE  1 
ATOM 853  N NZ  . LYS A 1 105 ? 54.678 -18.929  25.226 1.00 33.24  ? 105 LYS A NZ  1 
ATOM 854  N N   . GLU A 1 106 ? 56.813 -22.067  32.055 1.00 40.84  ? 106 GLU A N   1 
ATOM 855  C CA  . GLU A 1 106 ? 57.448 -22.136  33.367 1.00 48.38  ? 106 GLU A CA  1 
ATOM 856  C C   . GLU A 1 106 ? 58.008 -23.529  33.629 1.00 50.38  ? 106 GLU A C   1 
ATOM 857  O O   . GLU A 1 106 ? 59.120 -23.672  34.153 1.00 42.97  ? 106 GLU A O   1 
ATOM 858  C CB  . GLU A 1 106 ? 56.439 -21.742  34.445 1.00 48.57  ? 106 GLU A CB  1 
ATOM 859  C CG  . GLU A 1 106 ? 56.711 -22.318  35.821 1.00 59.83  ? 106 GLU A CG  1 
ATOM 860  C CD  . GLU A 1 106 ? 55.437 -22.495  36.631 1.00 71.02  ? 106 GLU A CD  1 
ATOM 861  O OE1 . GLU A 1 106 ? 54.670 -21.515  36.761 1.00 56.07  ? 106 GLU A OE1 1 
ATOM 862  O OE2 . GLU A 1 106 ? 55.202 -23.616  37.136 1.00 83.60  ? 106 GLU A OE2 1 
ATOM 863  N N   . THR A 1 107 ? 57.246 -24.571  33.290 1.00 54.82  ? 107 THR A N   1 
ATOM 864  C CA  . THR A 1 107 ? 57.763 -25.935  33.219 1.00 54.18  ? 107 THR A CA  1 
ATOM 865  C C   . THR A 1 107 ? 57.868 -26.319  31.745 1.00 47.81  ? 107 THR A C   1 
ATOM 866  O O   . THR A 1 107 ? 56.947 -26.929  31.180 1.00 43.87  ? 107 THR A O   1 
ATOM 867  C CB  . THR A 1 107 ? 56.874 -26.912  33.995 1.00 52.15  ? 107 THR A CB  1 
ATOM 868  O OG1 . THR A 1 107 ? 57.254 -28.254  33.692 1.00 50.41  ? 107 THR A OG1 1 
ATOM 869  C CG2 . THR A 1 107 ? 55.390 -26.688  33.696 1.00 55.70  ? 107 THR A CG2 1 
ATOM 870  N N   . PRO A 1 108 ? 58.982 -26.012  31.086 1.00 45.85  ? 108 PRO A N   1 
ATOM 871  C CA  . PRO A 1 108 ? 59.053 -26.192  29.631 1.00 48.02  ? 108 PRO A CA  1 
ATOM 872  C C   . PRO A 1 108 ? 59.092 -27.660  29.245 1.00 52.14  ? 108 PRO A C   1 
ATOM 873  O O   . PRO A 1 108 ? 59.801 -28.462  29.857 1.00 52.21  ? 108 PRO A O   1 
ATOM 874  C CB  . PRO A 1 108 ? 60.359 -25.483  29.247 1.00 50.50  ? 108 PRO A CB  1 
ATOM 875  C CG  . PRO A 1 108 ? 60.724 -24.642  30.451 1.00 49.38  ? 108 PRO A CG  1 
ATOM 876  C CD  . PRO A 1 108 ? 60.205 -25.401  31.625 1.00 46.74  ? 108 PRO A CD  1 
ATOM 877  N N   . TYR A 1 109 ? 58.332 -28.007  28.208 1.00 52.72  ? 109 TYR A N   1 
ATOM 878  C CA  . TYR A 1 109 ? 58.379 -29.355  27.662 1.00 55.13  ? 109 TYR A CA  1 
ATOM 879  C C   . TYR A 1 109 ? 59.510 -29.408  26.647 1.00 53.01  ? 109 TYR A C   1 
ATOM 880  O O   . TYR A 1 109 ? 59.463 -28.725  25.617 1.00 48.91  ? 109 TYR A O   1 
ATOM 881  C CB  . TYR A 1 109 ? 57.052 -29.763  27.025 1.00 51.15  ? 109 TYR A CB  1 
ATOM 882  C CG  . TYR A 1 109 ? 56.708 -31.213  27.291 1.00 50.81  ? 109 TYR A CG  1 
ATOM 883  C CD1 . TYR A 1 109 ? 56.461 -31.658  28.584 1.00 56.33  ? 109 TYR A CD1 1 
ATOM 884  C CD2 . TYR A 1 109 ? 56.655 -32.141  26.258 1.00 49.10  ? 109 TYR A CD2 1 
ATOM 885  C CE1 . TYR A 1 109 ? 56.153 -32.981  28.843 1.00 58.69  ? 109 TYR A CE1 1 
ATOM 886  C CE2 . TYR A 1 109 ? 56.348 -33.470  26.507 1.00 53.08  ? 109 TYR A CE2 1 
ATOM 887  C CZ  . TYR A 1 109 ? 56.099 -33.883  27.802 1.00 58.66  ? 109 TYR A CZ  1 
ATOM 888  O OH  . TYR A 1 109 ? 55.794 -35.199  28.059 1.00 55.63  ? 109 TYR A OH  1 
ATOM 889  N N   . SER A 1 110 ? 60.519 -30.220  26.946 1.00 59.10  ? 110 SER A N   1 
ATOM 890  C CA  . SER A 1 110 ? 61.722 -30.291  26.135 1.00 57.73  ? 110 SER A CA  1 
ATOM 891  C C   . SER A 1 110 ? 61.400 -30.692  24.700 1.00 54.47  ? 110 SER A C   1 
ATOM 892  O O   . SER A 1 110 ? 60.338 -31.241  24.395 1.00 55.93  ? 110 SER A O   1 
ATOM 893  C CB  . SER A 1 110 ? 62.707 -31.284  26.747 1.00 67.95  ? 110 SER A CB  1 
ATOM 894  O OG  . SER A 1 110 ? 62.739 -31.152  28.158 1.00 78.67  ? 110 SER A OG  1 
ATOM 895  N N   . GLU A 1 111 ? 62.349 -30.396  23.811 1.00 57.00  ? 111 GLU A N   1 
ATOM 896  C CA  . GLU A 1 111 ? 62.227 -30.788  22.411 1.00 63.92  ? 111 GLU A CA  1 
ATOM 897  C C   . GLU A 1 111 ? 62.118 -32.302  22.271 1.00 59.18  ? 111 GLU A C   1 
ATOM 898  O O   . GLU A 1 111 ? 61.339 -32.806  21.451 1.00 52.30  ? 111 GLU A O   1 
ATOM 899  C CB  . GLU A 1 111 ? 63.430 -30.246  21.636 1.00 67.55  ? 111 GLU A CB  1 
ATOM 900  C CG  . GLU A 1 111 ? 63.396 -30.406  20.127 1.00 68.87  ? 111 GLU A CG  1 
ATOM 901  C CD  . GLU A 1 111 ? 64.535 -29.653  19.453 1.00 73.68  ? 111 GLU A CD  1 
ATOM 902  O OE1 . GLU A 1 111 ? 65.696 -30.104  19.563 1.00 74.32  ? 111 GLU A OE1 1 
ATOM 903  O OE2 . GLU A 1 111 ? 64.273 -28.603  18.827 1.00 63.65  ? 111 GLU A OE2 1 
ATOM 904  N N   . GLU A 1 112 ? 62.873 -33.044  23.085 1.00 62.42  ? 112 GLU A N   1 
ATOM 905  C CA  . GLU A 1 112 ? 62.919 -34.497  22.970 1.00 54.72  ? 112 GLU A CA  1 
ATOM 906  C C   . GLU A 1 112 ? 61.670 -35.152  23.544 1.00 48.43  ? 112 GLU A C   1 
ATOM 907  O O   . GLU A 1 112 ? 61.119 -36.072  22.933 1.00 54.43  ? 112 GLU A O   1 
ATOM 908  C CB  . GLU A 1 112 ? 64.169 -35.041  23.663 1.00 61.51  ? 112 GLU A CB  1 
ATOM 909  C CG  . GLU A 1 112 ? 65.467 -34.328  23.288 1.00 76.67  ? 112 GLU A CG  1 
ATOM 910  C CD  . GLU A 1 112 ? 65.666 -33.019  24.035 1.00 73.07  ? 112 GLU A CD  1 
ATOM 911  O OE1 . GLU A 1 112 ? 64.987 -32.810  25.063 1.00 69.42  ? 112 GLU A OE1 1 
ATOM 912  O OE2 . GLU A 1 112 ? 66.498 -32.200  23.589 1.00 69.40  ? 112 GLU A OE2 1 
ATOM 913  N N   . ASP A 1 113 ? 61.203 -34.689  24.705 1.00 43.55  ? 113 ASP A N   1 
ATOM 914  C CA  . ASP A 1 113 ? 59.939 -35.187  25.234 1.00 43.03  ? 113 ASP A CA  1 
ATOM 915  C C   . ASP A 1 113 ? 58.800 -34.876  24.276 1.00 46.07  ? 113 ASP A C   1 
ATOM 916  O O   . ASP A 1 113 ? 57.861 -35.670  24.125 1.00 41.98  ? 113 ASP A O   1 
ATOM 917  C CB  . ASP A 1 113 ? 59.668 -34.569  26.603 1.00 48.97  ? 113 ASP A CB  1 
ATOM 918  C CG  . ASP A 1 113 ? 60.547 -35.148  27.688 1.00 56.17  ? 113 ASP A CG  1 
ATOM 919  O OD1 . ASP A 1 113 ? 60.820 -36.365  27.650 1.00 57.61  ? 113 ASP A OD1 1 
ATOM 920  O OD2 . ASP A 1 113 ? 60.978 -34.381  28.575 1.00 60.65  ? 113 ASP A OD2 1 
ATOM 921  N N   . PHE A 1 114 ? 58.879 -33.724  23.609 1.00 50.42  ? 114 PHE A N   1 
ATOM 922  C CA  . PHE A 1 114 ? 57.821 -33.305  22.700 1.00 50.27  ? 114 PHE A CA  1 
ATOM 923  C C   . PHE A 1 114 ? 57.794 -34.180  21.450 1.00 51.47  ? 114 PHE A C   1 
ATOM 924  O O   . PHE A 1 114 ? 56.736 -34.689  21.062 1.00 50.77  ? 114 PHE A O   1 
ATOM 925  C CB  . PHE A 1 114 ? 58.004 -31.830  22.340 1.00 38.97  ? 114 PHE A CB  1 
ATOM 926  C CG  . PHE A 1 114 ? 56.872 -31.257  21.544 1.00 37.69  ? 114 PHE A CG  1 
ATOM 927  C CD1 . PHE A 1 114 ? 56.946 -31.178  20.164 1.00 39.94  ? 114 PHE A CD1 1 
ATOM 928  C CD2 . PHE A 1 114 ? 55.729 -30.804  22.177 1.00 35.02  ? 114 PHE A CD2 1 
ATOM 929  C CE1 . PHE A 1 114 ? 55.901 -30.653  19.430 1.00 38.78  ? 114 PHE A CE1 1 
ATOM 930  C CE2 . PHE A 1 114 ? 54.681 -30.279  21.450 1.00 39.76  ? 114 PHE A CE2 1 
ATOM 931  C CZ  . PHE A 1 114 ? 54.767 -30.204  20.074 1.00 41.08  ? 114 PHE A CZ  1 
ATOM 932  N N   . GLN A 1 115 ? 58.949 -34.370  20.803 1.00 51.56  ? 115 GLN A N   1 
ATOM 933  C CA  . GLN A 1 115 ? 58.984 -35.227  19.620 1.00 51.42  ? 115 GLN A CA  1 
ATOM 934  C C   . GLN A 1 115 ? 58.643 -36.669  19.971 1.00 53.58  ? 115 GLN A C   1 
ATOM 935  O O   . GLN A 1 115 ? 57.907 -37.342  19.233 1.00 54.57  ? 115 GLN A O   1 
ATOM 936  C CB  . GLN A 1 115 ? 60.360 -35.149  18.956 1.00 54.16  ? 115 GLN A CB  1 
ATOM 937  C CG  . GLN A 1 115 ? 60.517 -36.054  17.743 1.00 60.37  ? 115 GLN A CG  1 
ATOM 938  C CD  . GLN A 1 115 ? 59.675 -35.623  16.555 1.00 68.52  ? 115 GLN A CD  1 
ATOM 939  O OE1 . GLN A 1 115 ? 59.007 -34.588  16.589 1.00 69.25  ? 115 GLN A OE1 1 
ATOM 940  N NE2 . GLN A 1 115 ? 59.697 -36.426  15.497 1.00 66.59  ? 115 GLN A NE2 1 
ATOM 941  N N   . HIS A 1 116 ? 59.154 -37.149  21.108 1.00 57.80  ? 116 HIS A N   1 
ATOM 942  C CA  . HIS A 1 116 ? 58.763 -38.453  21.634 1.00 59.75  ? 116 HIS A CA  1 
ATOM 943  C C   . HIS A 1 116 ? 57.250 -38.570  21.735 1.00 52.63  ? 116 HIS A C   1 
ATOM 944  O O   . HIS A 1 116 ? 56.664 -39.589  21.344 1.00 52.11  ? 116 HIS A O   1 
ATOM 945  C CB  . HIS A 1 116 ? 59.419 -38.665  23.003 1.00 57.90  ? 116 HIS A CB  1 
ATOM 946  C CG  . HIS A 1 116 ? 59.131 -39.994  23.631 1.00 62.37  ? 116 HIS A CG  1 
ATOM 947  N ND1 . HIS A 1 116 ? 57.856 -40.409  23.953 1.00 64.85  ? 116 HIS A ND1 1 
ATOM 948  C CD2 . HIS A 1 116 ? 59.959 -40.990  24.024 1.00 77.14  ? 116 HIS A CD2 1 
ATOM 949  C CE1 . HIS A 1 116 ? 57.910 -41.610  24.502 1.00 73.25  ? 116 HIS A CE1 1 
ATOM 950  N NE2 . HIS A 1 116 ? 59.175 -41.984  24.557 1.00 89.87  ? 116 HIS A NE2 1 
ATOM 951  N N   . LEU A 1 117 ? 56.598 -37.523  22.238 1.00 46.21  ? 117 LEU A N   1 
ATOM 952  C CA  . LEU A 1 117 ? 55.158 -37.590  22.439 1.00 44.45  ? 117 LEU A CA  1 
ATOM 953  C C   . LEU A 1 117 ? 54.398 -37.502  21.119 1.00 40.63  ? 117 LEU A C   1 
ATOM 954  O O   . LEU A 1 117 ? 53.324 -38.100  20.986 1.00 41.29  ? 117 LEU A O   1 
ATOM 955  C CB  . LEU A 1 117 ? 54.735 -36.486  23.407 1.00 41.79  ? 117 LEU A CB  1 
ATOM 956  C CG  . LEU A 1 117 ? 53.248 -36.307  23.684 1.00 40.54  ? 117 LEU A CG  1 
ATOM 957  C CD1 . LEU A 1 117 ? 53.050 -36.015  25.150 1.00 39.87  ? 117 LEU A CD1 1 
ATOM 958  C CD2 . LEU A 1 117 ? 52.712 -35.177  22.853 1.00 45.82  ? 117 LEU A CD2 1 
ATOM 959  N N   . GLN A 1 118 ? 54.926 -36.767  20.137 1.00 45.62  ? 118 GLN A N   1 
ATOM 960  C CA  . GLN A 1 118 ? 54.314 -36.763  18.810 1.00 45.45  ? 118 GLN A CA  1 
ATOM 961  C C   . GLN A 1 118 ? 54.353 -38.152  18.189 1.00 47.11  ? 118 GLN A C   1 
ATOM 962  O O   . GLN A 1 118 ? 53.334 -38.658  17.694 1.00 51.69  ? 118 GLN A O   1 
ATOM 963  C CB  . GLN A 1 118 ? 55.017 -35.759  17.896 1.00 55.85  ? 118 GLN A CB  1 
ATOM 964  C CG  . GLN A 1 118 ? 54.649 -34.309  18.134 1.00 55.47  ? 118 GLN A CG  1 
ATOM 965  C CD  . GLN A 1 118 ? 54.906 -33.458  16.909 1.00 56.25  ? 118 GLN A CD  1 
ATOM 966  O OE1 . GLN A 1 118 ? 54.150 -33.504  15.936 1.00 57.16  ? 118 GLN A OE1 1 
ATOM 967  N NE2 . GLN A 1 118 ? 55.990 -32.693  16.938 1.00 58.23  ? 118 GLN A NE2 1 
ATOM 968  N N   . LYS A 1 119 ? 55.535 -38.778  18.188 1.00 48.80  ? 119 LYS A N   1 
ATOM 969  C CA  . LYS A 1 119 ? 55.649 -40.122  17.634 1.00 40.59  ? 119 LYS A CA  1 
ATOM 970  C C   . LYS A 1 119 ? 54.728 -41.088  18.367 1.00 39.31  ? 119 LYS A C   1 
ATOM 971  O O   . LYS A 1 119 ? 54.056 -41.914  17.738 1.00 41.15  ? 119 LYS A O   1 
ATOM 972  C CB  . LYS A 1 119 ? 57.101 -40.593  17.693 1.00 37.05  ? 119 LYS A CB  1 
ATOM 973  C CG  . LYS A 1 119 ? 57.480 -41.533  16.561 1.00 52.84  ? 119 LYS A CG  1 
ATOM 974  C CD  . LYS A 1 119 ? 58.985 -41.757  16.492 1.00 69.27  ? 119 LYS A CD  1 
ATOM 975  C CE  . LYS A 1 119 ? 59.706 -40.534  15.939 1.00 66.49  ? 119 LYS A CE  1 
ATOM 976  N NZ  . LYS A 1 119 ? 61.161 -40.792  15.735 1.00 64.98  ? 119 LYS A NZ  1 
ATOM 977  N N   . GLU A 1 120 ? 54.668 -40.980  19.698 1.00 41.95  ? 120 GLU A N   1 
ATOM 978  C CA  . GLU A 1 120 ? 53.710 -41.768  20.470 1.00 36.83  ? 120 GLU A CA  1 
ATOM 979  C C   . GLU A 1 120 ? 52.279 -41.541  19.991 1.00 35.26  ? 120 GLU A C   1 
ATOM 980  O O   . GLU A 1 120 ? 51.495 -42.490  19.899 1.00 38.20  ? 120 GLU A O   1 
ATOM 981  C CB  . GLU A 1 120 ? 53.839 -41.437  21.958 1.00 36.49  ? 120 GLU A CB  1 
ATOM 982  C CG  . GLU A 1 120 ? 53.083 -42.375  22.888 1.00 37.14  ? 120 GLU A CG  1 
ATOM 983  C CD  . GLU A 1 120 ? 53.486 -42.206  24.347 1.00 50.87  ? 120 GLU A CD  1 
ATOM 984  O OE1 . GLU A 1 120 ? 54.276 -41.285  24.646 1.00 54.33  ? 120 GLU A OE1 1 
ATOM 985  O OE2 . GLU A 1 120 ? 52.995 -42.979  25.198 1.00 51.83  ? 120 GLU A OE2 1 
ATOM 986  N N   . ILE A 1 121 ? 51.918 -40.293  19.681 1.00 39.81  ? 121 ILE A N   1 
ATOM 987  C CA  . ILE A 1 121 ? 50.553 -40.005  19.243 1.00 40.73  ? 121 ILE A CA  1 
ATOM 988  C C   . ILE A 1 121 ? 50.256 -40.691  17.912 1.00 41.20  ? 121 ILE A C   1 
ATOM 989  O O   . ILE A 1 121 ? 49.221 -41.353  17.755 1.00 43.67  ? 121 ILE A O   1 
ATOM 990  C CB  . ILE A 1 121 ? 50.318 -38.485  19.162 1.00 39.97  ? 121 ILE A CB  1 
ATOM 991  C CG1 . ILE A 1 121 ? 50.182 -37.884  20.563 1.00 35.20  ? 121 ILE A CG1 1 
ATOM 992  C CG2 . ILE A 1 121 ? 49.078 -38.178  18.339 1.00 42.21  ? 121 ILE A CG2 1 
ATOM 993  C CD1 . ILE A 1 121 ? 50.153 -36.375  20.572 1.00 38.11  ? 121 ILE A CD1 1 
ATOM 994  N N   . GLU A 1 122 ? 51.153 -40.541  16.931 1.00 43.32  ? 122 GLU A N   1 
ATOM 995  C CA  . GLU A 1 122 ? 50.938 -41.182  15.633 1.00 47.03  ? 122 GLU A CA  1 
ATOM 996  C C   . GLU A 1 122 ? 50.851 -42.699  15.777 1.00 45.20  ? 122 GLU A C   1 
ATOM 997  O O   . GLU A 1 122 ? 49.954 -43.348  15.220 1.00 38.88  ? 122 GLU A O   1 
ATOM 998  C CB  . GLU A 1 122 ? 52.055 -40.805  14.660 1.00 49.73  ? 122 GLU A CB  1 
ATOM 999  C CG  . GLU A 1 122 ? 51.725 -41.141  13.213 1.00 57.83  ? 122 GLU A CG  1 
ATOM 1000 C CD  . GLU A 1 122 ? 52.934 -41.079  12.303 1.00 61.33  ? 122 GLU A CD  1 
ATOM 1001 O OE1 . GLU A 1 122 ? 54.072 -41.135  12.820 1.00 67.09  ? 122 GLU A OE1 1 
ATOM 1002 O OE2 . GLU A 1 122 ? 52.745 -40.991  11.071 1.00 53.74  ? 122 GLU A OE2 1 
ATOM 1003 N N   . GLN A 1 123 ? 51.791 -43.278  16.524 1.00 45.27  ? 123 GLN A N   1 
ATOM 1004 C CA  . GLN A 1 123 ? 51.851 -44.721  16.690 1.00 35.25  ? 123 GLN A CA  1 
ATOM 1005 C C   . GLN A 1 123 ? 50.646 -45.253  17.458 1.00 36.38  ? 123 GLN A C   1 
ATOM 1006 O O   . GLN A 1 123 ? 50.231 -46.396  17.237 1.00 43.20  ? 123 GLN A O   1 
ATOM 1007 C CB  . GLN A 1 123 ? 53.170 -45.069  17.378 1.00 28.48  ? 123 GLN A CB  1 
ATOM 1008 C CG  . GLN A 1 123 ? 53.119 -46.170  18.394 1.00 38.91  ? 123 GLN A CG  1 
ATOM 1009 C CD  . GLN A 1 123 ? 54.313 -46.124  19.322 1.00 49.07  ? 123 GLN A CD  1 
ATOM 1010 O OE1 . GLN A 1 123 ? 55.460 -46.223  18.884 1.00 47.00  ? 123 GLN A OE1 1 
ATOM 1011 N NE2 . GLN A 1 123 ? 54.049 -45.964  20.614 1.00 50.39  ? 123 GLN A NE2 1 
ATOM 1012 N N   . LEU A 1 124 ? 50.049 -44.439  18.331 1.00 36.15  ? 124 LEU A N   1 
ATOM 1013 C CA  . LEU A 1 124 ? 48.803 -44.844  18.974 1.00 35.92  ? 124 LEU A CA  1 
ATOM 1014 C C   . LEU A 1 124 ? 47.611 -44.711  18.038 1.00 33.53  ? 124 LEU A C   1 
ATOM 1015 O O   . LEU A 1 124 ? 46.645 -45.469  18.166 1.00 35.89  ? 124 LEU A O   1 
ATOM 1016 C CB  . LEU A 1 124 ? 48.561 -44.038  20.251 1.00 35.41  ? 124 LEU A CB  1 
ATOM 1017 C CG  . LEU A 1 124 ? 49.463 -44.402  21.434 1.00 49.32  ? 124 LEU A CG  1 
ATOM 1018 C CD1 . LEU A 1 124 ? 49.410 -43.329  22.517 1.00 47.80  ? 124 LEU A CD1 1 
ATOM 1019 C CD2 . LEU A 1 124 ? 49.107 -45.776  22.002 1.00 37.10  ? 124 LEU A CD2 1 
ATOM 1020 N N   . GLN A 1 125 ? 47.646 -43.758  17.104 1.00 43.09  ? 125 GLN A N   1 
ATOM 1021 C CA  . GLN A 1 125 ? 46.618 -43.738  16.069 1.00 42.86  ? 125 GLN A CA  1 
ATOM 1022 C C   . GLN A 1 125 ? 46.675 -45.008  15.236 1.00 38.27  ? 125 GLN A C   1 
ATOM 1023 O O   . GLN A 1 125 ? 45.641 -45.630  14.958 1.00 41.60  ? 125 GLN A O   1 
ATOM 1024 C CB  . GLN A 1 125 ? 46.780 -42.512  15.171 1.00 51.38  ? 125 GLN A CB  1 
ATOM 1025 C CG  . GLN A 1 125 ? 46.242 -41.228  15.760 1.00 46.23  ? 125 GLN A CG  1 
ATOM 1026 C CD  . GLN A 1 125 ? 46.493 -40.035  14.863 1.00 55.38  ? 125 GLN A CD  1 
ATOM 1027 O OE1 . GLN A 1 125 ? 47.627 -39.774  14.461 1.00 54.08  ? 125 GLN A OE1 1 
ATOM 1028 N NE2 . GLN A 1 125 ? 45.431 -39.305  14.539 1.00 62.09  ? 125 GLN A NE2 1 
ATOM 1029 N N   . GLU A 1 126 ? 47.883 -45.417  14.845 1.00 39.62  ? 126 GLU A N   1 
ATOM 1030 C CA  . GLU A 1 126 ? 48.030 -46.655  14.088 1.00 50.47  ? 126 GLU A CA  1 
ATOM 1031 C C   . GLU A 1 126 ? 47.602 -47.860  14.920 1.00 51.92  ? 126 GLU A C   1 
ATOM 1032 O O   . GLU A 1 126 ? 46.969 -48.792  14.403 1.00 46.21  ? 126 GLU A O   1 
ATOM 1033 C CB  . GLU A 1 126 ? 49.477 -46.809  13.620 1.00 52.27  ? 126 GLU A CB  1 
ATOM 1034 C CG  . GLU A 1 126 ? 49.621 -47.412  12.236 1.00 65.33  ? 126 GLU A CG  1 
ATOM 1035 C CD  . GLU A 1 126 ? 49.045 -46.517  11.151 1.00 81.11  ? 126 GLU A CD  1 
ATOM 1036 O OE1 . GLU A 1 126 ? 49.087 -45.276  11.313 1.00 82.26  ? 126 GLU A OE1 1 
ATOM 1037 O OE2 . GLU A 1 126 ? 48.547 -47.052  10.137 1.00 82.51  ? 126 GLU A OE2 1 
ATOM 1038 N N   . LYS A 1 127 ? 47.929 -47.852  16.216 1.00 49.95  ? 127 LYS A N   1 
ATOM 1039 C CA  . LYS A 1 127 ? 47.578 -48.970  17.087 1.00 38.94  ? 127 LYS A CA  1 
ATOM 1040 C C   . LYS A 1 127 ? 46.064 -49.103  17.226 1.00 37.08  ? 127 LYS A C   1 
ATOM 1041 O O   . LYS A 1 127 ? 45.518 -50.208  17.136 1.00 48.60  ? 127 LYS A O   1 
ATOM 1042 C CB  . LYS A 1 127 ? 48.241 -48.796  18.455 1.00 36.25  ? 127 LYS A CB  1 
ATOM 1043 C CG  . LYS A 1 127 ? 48.195 -50.041  19.324 1.00 50.41  ? 127 LYS A CG  1 
ATOM 1044 C CD  . LYS A 1 127 ? 49.060 -51.150  18.727 1.00 62.52  ? 127 LYS A CD  1 
ATOM 1045 C CE  . LYS A 1 127 ? 48.648 -52.528  19.228 1.00 55.08  ? 127 LYS A CE  1 
ATOM 1046 N NZ  . LYS A 1 127 ? 48.723 -52.630  20.713 1.00 61.15  ? 127 LYS A NZ  1 
ATOM 1047 N N   . TYR A 1 128 ? 45.373 -47.985  17.464 1.00 36.30  ? 128 TYR A N   1 
ATOM 1048 C CA  . TYR A 1 128 ? 43.911 -47.979  17.435 1.00 36.76  ? 128 TYR A CA  1 
ATOM 1049 C C   . TYR A 1 128 ? 43.386 -48.523  16.111 1.00 35.48  ? 128 TYR A C   1 
ATOM 1050 O O   . TYR A 1 128 ? 42.439 -49.328  16.080 1.00 33.57  ? 128 TYR A O   1 
ATOM 1051 C CB  . TYR A 1 128 ? 43.410 -46.551  17.677 1.00 36.12  ? 128 TYR A CB  1 
ATOM 1052 C CG  . TYR A 1 128 ? 41.912 -46.357  17.609 1.00 36.73  ? 128 TYR A CG  1 
ATOM 1053 C CD1 . TYR A 1 128 ? 41.299 -45.938  16.433 1.00 35.26  ? 128 TYR A CD1 1 
ATOM 1054 C CD2 . TYR A 1 128 ? 41.113 -46.553  18.728 1.00 40.28  ? 128 TYR A CD2 1 
ATOM 1055 C CE1 . TYR A 1 128 ? 39.930 -45.745  16.363 1.00 34.23  ? 128 TYR A CE1 1 
ATOM 1056 C CE2 . TYR A 1 128 ? 39.740 -46.361  18.669 1.00 46.43  ? 128 TYR A CE2 1 
ATOM 1057 C CZ  . TYR A 1 128 ? 39.155 -45.956  17.483 1.00 40.73  ? 128 TYR A CZ  1 
ATOM 1058 O OH  . TYR A 1 128 ? 37.792 -45.763  17.414 1.00 39.05  ? 128 TYR A OH  1 
ATOM 1059 N N   . LYS A 1 129 ? 44.008 -48.102  15.006 1.00 40.80  ? 129 LYS A N   1 
ATOM 1060 C CA  . LYS A 1 129 ? 43.550 -48.517  13.685 1.00 52.31  ? 129 LYS A CA  1 
ATOM 1061 C C   . LYS A 1 129 ? 43.691 -50.025  13.471 1.00 53.83  ? 129 LYS A C   1 
ATOM 1062 O O   . LYS A 1 129 ? 42.862 -50.627  12.778 1.00 55.70  ? 129 LYS A O   1 
ATOM 1063 C CB  . LYS A 1 129 ? 44.310 -47.731  12.612 1.00 56.84  ? 129 LYS A CB  1 
ATOM 1064 C CG  . LYS A 1 129 ? 43.783 -47.921  11.201 1.00 62.25  ? 129 LYS A CG  1 
ATOM 1065 C CD  . LYS A 1 129 ? 43.715 -46.594  10.453 1.00 64.47  ? 129 LYS A CD  1 
ATOM 1066 C CE  . LYS A 1 129 ? 44.957 -45.745  10.678 1.00 68.71  ? 129 LYS A CE  1 
ATOM 1067 N NZ  . LYS A 1 129 ? 46.154 -46.326  10.010 1.00 65.08  ? 129 LYS A NZ  1 
ATOM 1068 N N   . THR A 1 130 ? 44.720 -50.659  14.049 1.00 47.31  ? 130 THR A N   1 
ATOM 1069 C CA  . THR A 1 130 ? 44.817 -52.115  13.932 1.00 36.60  ? 130 THR A CA  1 
ATOM 1070 C C   . THR A 1 130 ? 43.888 -52.826  14.913 1.00 35.18  ? 130 THR A C   1 
ATOM 1071 O O   . THR A 1 130 ? 43.255 -53.828  14.556 1.00 38.45  ? 130 THR A O   1 
ATOM 1072 C CB  . THR A 1 130 ? 46.256 -52.588  14.150 1.00 38.49  ? 130 THR A CB  1 
ATOM 1073 O OG1 . THR A 1 130 ? 46.625 -52.396  15.521 1.00 41.94  ? 130 THR A OG1 1 
ATOM 1074 C CG2 . THR A 1 130 ? 47.215 -51.823  13.255 1.00 41.51  ? 130 THR A CG2 1 
ATOM 1075 N N   . GLU A 1 131 ? 43.789 -52.324  16.147 1.00 34.49  ? 131 GLU A N   1 
ATOM 1076 C CA  . GLU A 1 131 ? 42.952 -52.979  17.147 1.00 34.39  ? 131 GLU A CA  1 
ATOM 1077 C C   . GLU A 1 131 ? 41.495 -53.036  16.711 1.00 35.98  ? 131 GLU A C   1 
ATOM 1078 O O   . GLU A 1 131 ? 40.800 -54.021  16.985 1.00 40.86  ? 131 GLU A O   1 
ATOM 1079 C CB  . GLU A 1 131 ? 43.078 -52.273  18.497 1.00 32.61  ? 131 GLU A CB  1 
ATOM 1080 C CG  . GLU A 1 131 ? 44.417 -52.469  19.165 1.00 41.47  ? 131 GLU A CG  1 
ATOM 1081 C CD  . GLU A 1 131 ? 44.649 -53.908  19.576 1.00 51.21  ? 131 GLU A CD  1 
ATOM 1082 O OE1 . GLU A 1 131 ? 43.656 -54.624  19.832 1.00 43.49  ? 131 GLU A OE1 1 
ATOM 1083 O OE2 . GLU A 1 131 ? 45.822 -54.330  19.633 1.00 58.75  ? 131 GLU A OE2 1 
ATOM 1084 N N   . LEU A 1 132 ? 41.007 -51.999  16.028 1.00 39.91  ? 132 LEU A N   1 
ATOM 1085 C CA  . LEU A 1 132 ? 39.609 -52.039  15.610 1.00 42.12  ? 132 LEU A CA  1 
ATOM 1086 C C   . LEU A 1 132 ? 39.370 -53.118  14.553 1.00 38.43  ? 132 LEU A C   1 
ATOM 1087 O O   . LEU A 1 132 ? 38.400 -53.884  14.645 1.00 36.37  ? 132 LEU A O   1 
ATOM 1088 C CB  . LEU A 1 132 ? 39.177 -50.667  15.102 1.00 45.68  ? 132 LEU A CB  1 
ATOM 1089 C CG  . LEU A 1 132 ? 37.718 -50.298  15.365 1.00 56.01  ? 132 LEU A CG  1 
ATOM 1090 C CD1 . LEU A 1 132 ? 37.528 -48.790  15.290 1.00 73.35  ? 132 LEU A CD1 1 
ATOM 1091 C CD2 . LEU A 1 132 ? 36.790 -51.029  14.431 1.00 58.71  ? 132 LEU A CD2 1 
ATOM 1092 N N   . CYS A 1 133 ? 40.250 -53.215  13.555 1.00 39.42  ? 133 CYS A N   1 
ATOM 1093 C CA  . CYS A 1 133 ? 40.037 -54.210  12.512 1.00 44.46  ? 133 CYS A CA  1 
ATOM 1094 C C   . CYS A 1 133 ? 40.336 -55.627  12.990 1.00 38.53  ? 133 CYS A C   1 
ATOM 1095 O O   . CYS A 1 133 ? 39.833 -56.583  12.392 1.00 41.35  ? 133 CYS A O   1 
ATOM 1096 C CB  . CYS A 1 133 ? 40.867 -53.869  11.272 1.00 51.15  ? 133 CYS A CB  1 
ATOM 1097 S SG  . CYS A 1 133 ? 42.628 -53.650  11.562 1.00 65.70  ? 133 CYS A SG  1 
ATOM 1098 N N   . THR A 1 134 ? 41.127 -55.797  14.054 1.00 36.76  ? 134 THR A N   1 
ATOM 1099 C CA  . THR A 1 134 ? 41.243 -57.140  14.611 1.00 36.39  ? 134 THR A CA  1 
ATOM 1100 C C   . THR A 1 134 ? 40.063 -57.472  15.512 1.00 33.19  ? 134 THR A C   1 
ATOM 1101 O O   . THR A 1 134 ? 39.717 -58.647  15.652 1.00 38.37  ? 134 THR A O   1 
ATOM 1102 C CB  . THR A 1 134 ? 42.560 -57.313  15.365 1.00 31.41  ? 134 THR A CB  1 
ATOM 1103 O OG1 . THR A 1 134 ? 42.633 -56.376  16.442 1.00 30.39  ? 134 THR A OG1 1 
ATOM 1104 C CG2 . THR A 1 134 ? 43.723 -57.085  14.415 1.00 38.15  ? 134 THR A CG2 1 
ATOM 1105 N N   . LYS A 1 135 ? 39.434 -56.464  16.124 1.00 33.81  ? 135 LYS A N   1 
ATOM 1106 C CA  . LYS A 1 135 ? 38.102 -56.672  16.684 1.00 35.53  ? 135 LYS A CA  1 
ATOM 1107 C C   . LYS A 1 135 ? 37.171 -57.236  15.625 1.00 34.34  ? 135 LYS A C   1 
ATOM 1108 O O   . LYS A 1 135 ? 36.486 -58.242  15.845 1.00 35.07  ? 135 LYS A O   1 
ATOM 1109 C CB  . LYS A 1 135 ? 37.527 -55.361  17.224 1.00 39.43  ? 135 LYS A CB  1 
ATOM 1110 C CG  . LYS A 1 135 ? 36.002 -55.386  17.380 1.00 34.63  ? 135 LYS A CG  1 
ATOM 1111 C CD  . LYS A 1 135 ? 35.385 -54.048  16.973 1.00 44.34  ? 135 LYS A CD  1 
ATOM 1112 C CE  . LYS A 1 135 ? 33.873 -54.139  16.751 1.00 41.24  ? 135 LYS A CE  1 
ATOM 1113 N NZ  . LYS A 1 135 ? 33.083 -54.212  18.014 1.00 33.80  ? 135 LYS A NZ  1 
ATOM 1114 N N   . GLN A 1 136 ? 37.141 -56.593  14.457 1.00 42.41  ? 136 GLN A N   1 
ATOM 1115 C CA  . GLN A 1 136 ? 36.263 -57.066  13.394 1.00 46.84  ? 136 GLN A CA  1 
ATOM 1116 C C   . GLN A 1 136 ? 36.678 -58.445  12.891 1.00 46.17  ? 136 GLN A C   1 
ATOM 1117 O O   . GLN A 1 136 ? 35.819 -59.234  12.478 1.00 49.41  ? 136 GLN A O   1 
ATOM 1118 C CB  . GLN A 1 136 ? 36.242 -56.050  12.251 1.00 44.71  ? 136 GLN A CB  1 
ATOM 1119 C CG  . GLN A 1 136 ? 34.916 -55.974  11.509 1.00 52.07  ? 136 GLN A CG  1 
ATOM 1120 C CD  . GLN A 1 136 ? 33.787 -55.406  12.359 1.00 51.38  ? 136 GLN A CD  1 
ATOM 1121 O OE1 . GLN A 1 136 ? 34.000 -54.949  13.485 1.00 47.01  ? 136 GLN A OE1 1 
ATOM 1122 N NE2 . GLN A 1 136 ? 32.574 -55.433  11.817 1.00 48.99  ? 136 GLN A NE2 1 
ATOM 1123 N N   . ALA A 1 137 ? 37.976 -58.760  12.934 1.00 42.47  ? 137 ALA A N   1 
ATOM 1124 C CA  . ALA A 1 137 ? 38.435 -60.073  12.488 1.00 45.32  ? 137 ALA A CA  1 
ATOM 1125 C C   . ALA A 1 137 ? 38.025 -61.173  13.460 1.00 45.00  ? 137 ALA A C   1 
ATOM 1126 O O   . ALA A 1 137 ? 37.574 -62.245  13.039 1.00 41.10  ? 137 ALA A O   1 
ATOM 1127 C CB  . ALA A 1 137 ? 39.952 -60.059  12.306 1.00 45.64  ? 137 ALA A CB  1 
ATOM 1128 N N   . LEU A 1 138 ? 38.173 -60.924  14.762 1.00 41.81  ? 138 LEU A N   1 
ATOM 1129 C CA  . LEU A 1 138 ? 37.735 -61.888  15.765 1.00 32.78  ? 138 LEU A CA  1 
ATOM 1130 C C   . LEU A 1 138 ? 36.231 -62.101  15.691 1.00 35.88  ? 138 LEU A C   1 
ATOM 1131 O O   . LEU A 1 138 ? 35.752 -63.240  15.630 1.00 45.05  ? 138 LEU A O   1 
ATOM 1132 C CB  . LEU A 1 138 ? 38.135 -61.402  17.158 1.00 28.63  ? 138 LEU A CB  1 
ATOM 1133 C CG  . LEU A 1 138 ? 39.628 -61.269  17.441 1.00 27.45  ? 138 LEU A CG  1 
ATOM 1134 C CD1 . LEU A 1 138 ? 39.847 -60.744  18.844 1.00 40.84  ? 138 LEU A CD1 1 
ATOM 1135 C CD2 . LEU A 1 138 ? 40.321 -62.600  17.258 1.00 39.92  ? 138 LEU A CD2 1 
ATOM 1136 N N   . LEU A 1 139 ? 35.469 -61.004  15.703 1.00 35.11  ? 139 LEU A N   1 
ATOM 1137 C CA  . LEU A 1 139 ? 34.016 -61.098  15.619 1.00 37.78  ? 139 LEU A CA  1 
ATOM 1138 C C   . LEU A 1 139 ? 33.585 -61.846  14.362 1.00 44.95  ? 139 LEU A C   1 
ATOM 1139 O O   . LEU A 1 139 ? 32.688 -62.701  14.410 1.00 48.61  ? 139 LEU A O   1 
ATOM 1140 C CB  . LEU A 1 139 ? 33.417 -59.689  15.671 1.00 39.64  ? 139 LEU A CB  1 
ATOM 1141 C CG  . LEU A 1 139 ? 31.907 -59.450  15.703 1.00 40.05  ? 139 LEU A CG  1 
ATOM 1142 C CD1 . LEU A 1 139 ? 31.604 -58.177  16.475 1.00 26.98  ? 139 LEU A CD1 1 
ATOM 1143 C CD2 . LEU A 1 139 ? 31.342 -59.347  14.288 1.00 45.95  ? 139 LEU A CD2 1 
ATOM 1144 N N   . ALA A 1 140 ? 34.241 -61.563  13.232 1.00 46.18  ? 140 ALA A N   1 
ATOM 1145 C CA  . ALA A 1 140 ? 33.900 -62.251  11.992 1.00 56.18  ? 140 ALA A CA  1 
ATOM 1146 C C   . ALA A 1 140 ? 34.239 -63.735  12.068 1.00 49.29  ? 140 ALA A C   1 
ATOM 1147 O O   . ALA A 1 140 ? 33.493 -64.575  11.550 1.00 50.28  ? 140 ALA A O   1 
ATOM 1148 C CB  . ALA A 1 140 ? 34.619 -61.592  10.816 1.00 66.80  ? 140 ALA A CB  1 
ATOM 1149 N N   . GLU A 1 141 ? 35.348 -64.081  12.725 1.00 52.19  ? 141 GLU A N   1 
ATOM 1150 C CA  . GLU A 1 141 ? 35.704 -65.490  12.861 1.00 50.64  ? 141 GLU A CA  1 
ATOM 1151 C C   . GLU A 1 141 ? 34.719 -66.226  13.754 1.00 43.37  ? 141 GLU A C   1 
ATOM 1152 O O   . GLU A 1 141 ? 34.438 -67.405  13.522 1.00 49.81  ? 141 GLU A O   1 
ATOM 1153 C CB  . GLU A 1 141 ? 37.121 -65.647  13.410 1.00 51.89  ? 141 GLU A CB  1 
ATOM 1154 C CG  . GLU A 1 141 ? 37.386 -67.030  13.993 1.00 44.03  ? 141 GLU A CG  1 
ATOM 1155 C CD  . GLU A 1 141 ? 38.853 -67.325  14.185 1.00 45.67  ? 141 GLU A CD  1 
ATOM 1156 O OE1 . GLU A 1 141 ? 39.686 -66.586  13.624 1.00 55.23  ? 141 GLU A OE1 1 
ATOM 1157 O OE2 . GLU A 1 141 ? 39.173 -68.298  14.896 1.00 42.89  ? 141 GLU A OE2 1 
ATOM 1158 N N   . LEU A 1 142 ? 34.193 -65.561  14.779 1.00 39.73  ? 142 LEU A N   1 
ATOM 1159 C CA  . LEU A 1 142 ? 33.235 -66.229  15.649 1.00 43.00  ? 142 LEU A CA  1 
ATOM 1160 C C   . LEU A 1 142 ? 31.892 -66.404  14.950 1.00 45.06  ? 142 LEU A C   1 
ATOM 1161 O O   . LEU A 1 142 ? 31.254 -67.461  15.069 1.00 45.59  ? 142 LEU A O   1 
ATOM 1162 C CB  . LEU A 1 142 ? 33.082 -65.434  16.946 1.00 43.54  ? 142 LEU A CB  1 
ATOM 1163 C CG  . LEU A 1 142 ? 32.231 -66.021  18.071 1.00 54.83  ? 142 LEU A CG  1 
ATOM 1164 C CD1 . LEU A 1 142 ? 32.889 -65.729  19.411 1.00 48.57  ? 142 LEU A CD1 1 
ATOM 1165 C CD2 . LEU A 1 142 ? 30.810 -65.473  18.040 1.00 55.43  ? 142 LEU A CD2 1 
ATOM 1166 N N   . GLU A 1 143 ? 31.458 -65.390  14.193 1.00 52.69  ? 143 GLU A N   1 
ATOM 1167 C CA  . GLU A 1 143 ? 30.222 -65.526  13.425 1.00 53.54  ? 143 GLU A CA  1 
ATOM 1168 C C   . GLU A 1 143 ? 30.349 -66.615  12.366 1.00 54.87  ? 143 GLU A C   1 
ATOM 1169 O O   . GLU A 1 143 ? 29.397 -67.362  12.109 1.00 60.60  ? 143 GLU A O   1 
ATOM 1170 C CB  . GLU A 1 143 ? 29.851 -64.190  12.784 1.00 48.68  ? 143 GLU A CB  1 
ATOM 1171 C CG  . GLU A 1 143 ? 29.059 -63.278  13.704 1.00 58.83  ? 143 GLU A CG  1 
ATOM 1172 C CD  . GLU A 1 143 ? 27.662 -63.803  13.974 1.00 69.21  ? 143 GLU A CD  1 
ATOM 1173 O OE1 . GLU A 1 143 ? 26.937 -64.093  12.999 1.00 69.00  ? 143 GLU A OE1 1 
ATOM 1174 O OE2 . GLU A 1 143 ? 27.290 -63.927  15.161 1.00 68.43  ? 143 GLU A OE2 1 
ATOM 1175 N N   . GLU A 1 144 ? 31.520 -66.705  11.734 1.00 51.98  ? 144 GLU A N   1 
ATOM 1176 C CA  . GLU A 1 144 ? 31.829 -67.811  10.833 1.00 52.12  ? 144 GLU A CA  1 
ATOM 1177 C C   . GLU A 1 144 ? 31.858 -69.151  11.564 1.00 48.48  ? 144 GLU A C   1 
ATOM 1178 O O   . GLU A 1 144 ? 31.471 -70.184  11.003 1.00 43.38  ? 144 GLU A O   1 
ATOM 1179 C CB  . GLU A 1 144 ? 33.174 -67.510  10.168 1.00 54.23  ? 144 GLU A CB  1 
ATOM 1180 C CG  . GLU A 1 144 ? 34.094 -68.688  9.945  1.00 57.01  ? 144 GLU A CG  1 
ATOM 1181 C CD  . GLU A 1 144 ? 35.504 -68.233  9.609  1.00 61.64  ? 144 GLU A CD  1 
ATOM 1182 O OE1 . GLU A 1 144 ? 35.671 -67.448  8.651  1.00 70.87  ? 144 GLU A OE1 1 
ATOM 1183 O OE2 . GLU A 1 144 ? 36.443 -68.642  10.325 1.00 59.65  ? 144 GLU A OE2 1 
ATOM 1184 N N   . GLN A 1 145 ? 32.294 -69.139  12.819 1.00 50.59  ? 145 GLN A N   1 
ATOM 1185 C CA  . GLN A 1 145 ? 32.477 -70.343  13.618 1.00 40.86  ? 145 GLN A CA  1 
ATOM 1186 C C   . GLN A 1 145 ? 31.143 -70.946  14.057 1.00 39.90  ? 145 GLN A C   1 
ATOM 1187 O O   . GLN A 1 145 ? 31.029 -72.176  14.207 1.00 39.66  ? 145 GLN A O   1 
ATOM 1188 C CB  . GLN A 1 145 ? 33.377 -69.955  14.790 1.00 37.23  ? 145 GLN A CB  1 
ATOM 1189 C CG  . GLN A 1 145 ? 33.536 -70.895  15.932 1.00 42.98  ? 145 GLN A CG  1 
ATOM 1190 C CD  . GLN A 1 145 ? 34.368 -70.244  17.020 1.00 46.07  ? 145 GLN A CD  1 
ATOM 1191 O OE1 . GLN A 1 145 ? 33.832 -69.600  17.922 1.00 44.12  ? 145 GLN A OE1 1 
ATOM 1192 N NE2 . GLN A 1 145 ? 35.688 -70.367  16.915 1.00 45.18  ? 145 GLN A NE2 1 
ATOM 1193 N N   . LYS A 1 146 ? 30.126 -70.097  14.256 1.00 48.42  ? 146 LYS A N   1 
ATOM 1194 C CA  . LYS A 1 146 ? 28.763 -70.579  14.482 1.00 47.22  ? 146 LYS A CA  1 
ATOM 1195 C C   . LYS A 1 146 ? 28.358 -71.637  13.460 1.00 45.21  ? 146 LYS A C   1 
ATOM 1196 O O   . LYS A 1 146 ? 27.725 -72.643  13.808 1.00 46.97  ? 146 LYS A O   1 
ATOM 1197 C CB  . LYS A 1 146 ? 27.774 -69.410  14.418 1.00 53.33  ? 146 LYS A CB  1 
ATOM 1198 C CG  . LYS A 1 146 ? 27.320 -68.823  15.746 1.00 50.46  ? 146 LYS A CG  1 
ATOM 1199 C CD  . LYS A 1 146 ? 26.056 -67.987  15.527 1.00 54.64  ? 146 LYS A CD  1 
ATOM 1200 C CE  . LYS A 1 146 ? 25.628 -67.228  16.775 1.00 71.26  ? 146 LYS A CE  1 
ATOM 1201 N NZ  . LYS A 1 146 ? 26.493 -66.044  17.044 1.00 70.93  ? 146 LYS A NZ  1 
ATOM 1202 N N   . ILE A 1 147 ? 28.720 -71.427  12.192 1.00 46.12  ? 147 ILE A N   1 
ATOM 1203 C CA  . ILE A 1 147 ? 28.197 -72.262  11.114 1.00 50.85  ? 147 ILE A CA  1 
ATOM 1204 C C   . ILE A 1 147 ? 28.757 -73.678  11.207 1.00 43.36  ? 147 ILE A C   1 
ATOM 1205 O O   . ILE A 1 147 ? 28.015 -74.665  11.110 1.00 42.91  ? 147 ILE A O   1 
ATOM 1206 C CB  . ILE A 1 147 ? 28.504 -71.618  9.749  1.00 52.71  ? 147 ILE A CB  1 
ATOM 1207 C CG1 . ILE A 1 147 ? 28.090 -70.144  9.746  1.00 49.84  ? 147 ILE A CG1 1 
ATOM 1208 C CG2 . ILE A 1 147 ? 27.793 -72.363  8.629  1.00 53.07  ? 147 ILE A CG2 1 
ATOM 1209 C CD1 . ILE A 1 147 ? 26.607 -69.919  9.965  1.00 60.11  ? 147 ILE A CD1 1 
ATOM 1210 N N   . VAL A 1 148 ? 30.070 -73.805  11.417 1.00 37.57  ? 148 VAL A N   1 
ATOM 1211 C CA  . VAL A 1 148 ? 30.642 -75.139  11.543 1.00 35.64  ? 148 VAL A CA  1 
ATOM 1212 C C   . VAL A 1 148 ? 30.178 -75.796  12.832 1.00 41.42  ? 148 VAL A C   1 
ATOM 1213 O O   . VAL A 1 148 ? 29.980 -77.019  12.874 1.00 45.86  ? 148 VAL A O   1 
ATOM 1214 C CB  . VAL A 1 148 ? 32.179 -75.098  11.444 1.00 30.94  ? 148 VAL A CB  1 
ATOM 1215 C CG1 . VAL A 1 148 ? 32.603 -74.453  10.140 1.00 38.85  ? 148 VAL A CG1 1 
ATOM 1216 C CG2 . VAL A 1 148 ? 32.781 -74.363  12.625 1.00 35.16  ? 148 VAL A CG2 1 
ATOM 1217 N N   . GLN A 1 149 ? 29.975 -75.010  13.895 1.00 39.61  ? 149 GLN A N   1 
ATOM 1218 C CA  . GLN A 1 149 ? 29.432 -75.588  15.121 1.00 39.67  ? 149 GLN A CA  1 
ATOM 1219 C C   . GLN A 1 149 ? 28.063 -76.222  14.872 1.00 40.06  ? 149 GLN A C   1 
ATOM 1220 O O   . GLN A 1 149 ? 27.805 -77.359  15.295 1.00 40.71  ? 149 GLN A O   1 
ATOM 1221 C CB  . GLN A 1 149 ? 29.355 -74.515  16.206 1.00 45.68  ? 149 GLN A CB  1 
ATOM 1222 C CG  . GLN A 1 149 ? 29.397 -75.044  17.630 1.00 52.38  ? 149 GLN A CG  1 
ATOM 1223 C CD  . GLN A 1 149 ? 29.973 -74.028  18.601 1.00 56.82  ? 149 GLN A CD  1 
ATOM 1224 O OE1 . GLN A 1 149 ? 30.840 -73.231  18.238 1.00 48.67  ? 149 GLN A OE1 1 
ATOM 1225 N NE2 . GLN A 1 149 ? 29.495 -74.052  19.842 1.00 57.97  ? 149 GLN A NE2 1 
ATOM 1226 N N   . ALA A 1 150 ? 27.188 -75.522  14.140 1.00 43.56  ? 150 ALA A N   1 
ATOM 1227 C CA  . ALA A 1 150 ? 25.855 -76.061  13.872 1.00 44.56  ? 150 ALA A CA  1 
ATOM 1228 C C   . ALA A 1 150 ? 25.888 -77.221  12.882 1.00 45.90  ? 150 ALA A C   1 
ATOM 1229 O O   . ALA A 1 150 ? 25.029 -78.111  12.946 1.00 48.30  ? 150 ALA A O   1 
ATOM 1230 C CB  . ALA A 1 150 ? 24.932 -74.956  13.360 1.00 48.07  ? 150 ALA A CB  1 
ATOM 1231 N N   . LYS A 1 151 ? 26.854 -77.235  11.959 1.00 42.46  ? 151 LYS A N   1 
ATOM 1232 C CA  . LYS A 1 151 ? 26.927 -78.343  11.010 1.00 47.41  ? 151 LYS A CA  1 
ATOM 1233 C C   . LYS A 1 151 ? 27.413 -79.618  11.698 1.00 48.88  ? 151 LYS A C   1 
ATOM 1234 O O   . LYS A 1 151 ? 26.879 -80.713  11.457 1.00 43.61  ? 151 LYS A O   1 
ATOM 1235 C CB  . LYS A 1 151 ? 27.840 -77.967  9.842  1.00 47.34  ? 151 LYS A CB  1 
ATOM 1236 C CG  . LYS A 1 151 ? 27.871 -78.977  8.703  1.00 61.21  ? 151 LYS A CG  1 
ATOM 1237 C CD  . LYS A 1 151 ? 26.645 -78.838  7.808  1.00 61.01  ? 151 LYS A CD  1 
ATOM 1238 C CE  . LYS A 1 151 ? 26.640 -79.877  6.694  1.00 68.69  ? 151 LYS A CE  1 
ATOM 1239 N NZ  . LYS A 1 151 ? 27.919 -79.894  5.928  1.00 71.77  ? 151 LYS A NZ  1 
ATOM 1240 N N   . LEU A 1 152 ? 28.412 -79.494  12.579 1.00 44.00  ? 152 LEU A N   1 
ATOM 1241 C CA  . LEU A 1 152 ? 28.822 -80.650  13.367 1.00 41.09  ? 152 LEU A CA  1 
ATOM 1242 C C   . LEU A 1 152 ? 27.686 -81.120  14.266 1.00 43.51  ? 152 LEU A C   1 
ATOM 1243 O O   . LEU A 1 152 ? 27.473 -82.330  14.426 1.00 44.87  ? 152 LEU A O   1 
ATOM 1244 C CB  . LEU A 1 152 ? 30.063 -80.318  14.194 1.00 44.80  ? 152 LEU A CB  1 
ATOM 1245 C CG  . LEU A 1 152 ? 31.361 -80.115  13.412 1.00 48.31  ? 152 LEU A CG  1 
ATOM 1246 C CD1 . LEU A 1 152 ? 32.561 -80.101  14.346 1.00 47.12  ? 152 LEU A CD1 1 
ATOM 1247 C CD2 . LEU A 1 152 ? 31.516 -81.195  12.361 1.00 43.19  ? 152 LEU A CD2 1 
ATOM 1248 N N   . LYS A 1 153 ? 26.924 -80.180  14.841 1.00 43.97  ? 153 LYS A N   1 
ATOM 1249 C CA  . LYS A 1 153 ? 25.726 -80.592  15.567 1.00 44.26  ? 153 LYS A CA  1 
ATOM 1250 C C   . LYS A 1 153 ? 24.744 -81.314  14.656 1.00 44.73  ? 153 LYS A C   1 
ATOM 1251 O O   . LYS A 1 153 ? 23.966 -82.154  15.124 1.00 46.51  ? 153 LYS A O   1 
ATOM 1252 C CB  . LYS A 1 153 ? 25.037 -79.397  16.226 1.00 41.92  ? 153 LYS A CB  1 
ATOM 1253 C CG  . LYS A 1 153 ? 25.599 -79.011  17.579 1.00 43.52  ? 153 LYS A CG  1 
ATOM 1254 C CD  . LYS A 1 153 ? 24.637 -78.084  18.301 1.00 47.71  ? 153 LYS A CD  1 
ATOM 1255 C CE  . LYS A 1 153 ? 24.645 -78.346  19.797 1.00 61.61  ? 153 LYS A CE  1 
ATOM 1256 N NZ  . LYS A 1 153 ? 23.382 -77.895  20.445 1.00 64.66  ? 153 LYS A NZ  1 
ATOM 1257 N N   . GLN A 1 154 ? 24.771 -81.019  13.355 1.00 45.19  ? 154 GLN A N   1 
ATOM 1258 C CA  . GLN A 1 154 ? 23.868 -81.717  12.447 1.00 48.85  ? 154 GLN A CA  1 
ATOM 1259 C C   . GLN A 1 154 ? 24.319 -83.155  12.224 1.00 46.87  ? 154 GLN A C   1 
ATOM 1260 O O   . GLN A 1 154 ? 23.493 -84.078  12.231 1.00 42.48  ? 154 GLN A O   1 
ATOM 1261 C CB  . GLN A 1 154 ? 23.760 -80.969  11.120 1.00 55.85  ? 154 GLN A CB  1 
ATOM 1262 C CG  . GLN A 1 154 ? 22.888 -81.674  10.096 1.00 60.19  ? 154 GLN A CG  1 
ATOM 1263 C CD  . GLN A 1 154 ? 23.357 -81.455  8.676  1.00 59.17  ? 154 GLN A CD  1 
ATOM 1264 O OE1 . GLN A 1 154 ? 24.531 -81.651  8.363  1.00 61.96  ? 154 GLN A OE1 1 
ATOM 1265 N NE2 . GLN A 1 154 ? 22.440 -81.048  7.805  1.00 69.06  ? 154 GLN A NE2 1 
ATOM 1266 N N   . THR A 1 155 ? 25.625 -83.374  12.029 1.00 48.93  ? 155 THR A N   1 
ATOM 1267 C CA  . THR A 1 155 ? 26.094 -84.749  11.859 1.00 42.84  ? 155 THR A CA  1 
ATOM 1268 C C   . THR A 1 155 ? 25.880 -85.562  13.130 1.00 39.13  ? 155 THR A C   1 
ATOM 1269 O O   . THR A 1 155 ? 25.431 -86.715  13.069 1.00 45.48  ? 155 THR A O   1 
ATOM 1270 C CB  . THR A 1 155 ? 27.571 -84.777  11.459 1.00 41.32  ? 155 THR A CB  1 
ATOM 1271 O OG1 . THR A 1 155 ? 28.380 -84.411  12.583 1.00 44.65  ? 155 THR A OG1 1 
ATOM 1272 C CG2 . THR A 1 155 ? 27.836 -83.810  10.312 1.00 47.76  ? 155 THR A CG2 1 
ATOM 1273 N N   . LEU A 1 156 ? 26.180 -84.974  14.292 1.00 37.76  ? 156 LEU A N   1 
ATOM 1274 C CA  . LEU A 1 156 ? 25.896 -85.655  15.553 1.00 41.41  ? 156 LEU A CA  1 
ATOM 1275 C C   . LEU A 1 156 ? 24.407 -85.961  15.684 1.00 43.31  ? 156 LEU A C   1 
ATOM 1276 O O   . LEU A 1 156 ? 24.021 -87.031  16.179 1.00 43.77  ? 156 LEU A O   1 
ATOM 1277 C CB  . LEU A 1 156 ? 26.384 -84.802  16.724 1.00 44.83  ? 156 LEU A CB  1 
ATOM 1278 C CG  . LEU A 1 156 ? 27.807 -85.077  17.226 1.00 41.68  ? 156 LEU A CG  1 
ATOM 1279 C CD1 . LEU A 1 156 ? 28.130 -84.210  18.434 1.00 36.68  ? 156 LEU A CD1 1 
ATOM 1280 C CD2 . LEU A 1 156 ? 28.014 -86.552  17.550 1.00 42.47  ? 156 LEU A CD2 1 
ATOM 1281 N N   . THR A 1 157 ? 23.556 -85.039  15.224 1.00 48.23  ? 157 THR A N   1 
ATOM 1282 C CA  . THR A 1 157 ? 22.123 -85.309  15.185 1.00 49.05  ? 157 THR A CA  1 
ATOM 1283 C C   . THR A 1 157 ? 21.828 -86.523  14.319 1.00 45.70  ? 157 THR A C   1 
ATOM 1284 O O   . THR A 1 157 ? 20.963 -87.340  14.654 1.00 44.35  ? 157 THR A O   1 
ATOM 1285 C CB  . THR A 1 157 ? 21.363 -84.089  14.658 1.00 46.55  ? 157 THR A CB  1 
ATOM 1286 O OG1 . THR A 1 157 ? 21.699 -82.934  15.436 1.00 49.55  ? 157 THR A OG1 1 
ATOM 1287 C CG2 . THR A 1 157 ? 19.860 -84.324  14.719 1.00 42.58  ? 157 THR A CG2 1 
ATOM 1288 N N   . PHE A 1 158 ? 22.547 -86.664  13.204 1.00 46.09  ? 158 PHE A N   1 
ATOM 1289 C CA  . PHE A 1 158 ? 22.324 -87.815  12.337 1.00 48.92  ? 158 PHE A CA  1 
ATOM 1290 C C   . PHE A 1 158 ? 22.733 -89.118  13.014 1.00 48.76  ? 158 PHE A C   1 
ATOM 1291 O O   . PHE A 1 158 ? 22.048 -90.135  12.866 1.00 49.04  ? 158 PHE A O   1 
ATOM 1292 C CB  . PHE A 1 158 ? 23.080 -87.651  11.024 1.00 53.49  ? 158 PHE A CB  1 
ATOM 1293 C CG  . PHE A 1 158 ? 23.450 -88.953  10.388 1.00 48.11  ? 158 PHE A CG  1 
ATOM 1294 C CD1 . PHE A 1 158 ? 22.474 -89.815  9.924  1.00 48.38  ? 158 PHE A CD1 1 
ATOM 1295 C CD2 . PHE A 1 158 ? 24.774 -89.325  10.274 1.00 50.30  ? 158 PHE A CD2 1 
ATOM 1296 C CE1 . PHE A 1 158 ? 22.816 -91.015  9.359  1.00 49.56  ? 158 PHE A CE1 1 
ATOM 1297 C CE2 . PHE A 1 158 ? 25.120 -90.523  9.698  1.00 46.58  ? 158 PHE A CE2 1 
ATOM 1298 C CZ  . PHE A 1 158 ? 24.146 -91.370  9.247  1.00 44.80  ? 158 PHE A CZ  1 
ATOM 1299 N N   . PHE A 1 159 ? 23.851 -89.125  13.743 1.00 48.24  ? 159 PHE A N   1 
ATOM 1300 C CA  . PHE A 1 159 ? 24.229 -90.355  14.435 1.00 44.05  ? 159 PHE A CA  1 
ATOM 1301 C C   . PHE A 1 159 ? 23.224 -90.717  15.522 1.00 46.18  ? 159 PHE A C   1 
ATOM 1302 O O   . PHE A 1 159 ? 22.855 -91.890  15.663 1.00 48.91  ? 159 PHE A O   1 
ATOM 1303 C CB  . PHE A 1 159 ? 25.635 -90.243  15.019 1.00 44.88  ? 159 PHE A CB  1 
ATOM 1304 C CG  . PHE A 1 159 ? 26.716 -90.692  14.081 1.00 47.48  ? 159 PHE A CG  1 
ATOM 1305 C CD1 . PHE A 1 159 ? 26.494 -90.766  12.722 1.00 49.57  ? 159 PHE A CD1 1 
ATOM 1306 C CD2 . PHE A 1 159 ? 27.946 -91.080  14.567 1.00 49.05  ? 159 PHE A CD2 1 
ATOM 1307 C CE1 . PHE A 1 159 ? 27.497 -91.193  11.866 1.00 52.10  ? 159 PHE A CE1 1 
ATOM 1308 C CE2 . PHE A 1 159 ? 28.947 -91.509  13.721 1.00 46.60  ? 159 PHE A CE2 1 
ATOM 1309 C CZ  . PHE A 1 159 ? 28.723 -91.566  12.369 1.00 45.49  ? 159 PHE A CZ  1 
ATOM 1310 N N   . ASP A 1 160 ? 22.766 -89.732  16.300 1.00 52.87  ? 160 ASP A N   1 
ATOM 1311 C CA  . ASP A 1 160 ? 21.767 -90.031  17.323 1.00 53.98  ? 160 ASP A CA  1 
ATOM 1312 C C   . ASP A 1 160 ? 20.465 -90.519  16.697 1.00 51.44  ? 160 ASP A C   1 
ATOM 1313 O O   . ASP A 1 160 ? 19.802 -91.411  17.240 1.00 51.47  ? 160 ASP A O   1 
ATOM 1314 C CB  . ASP A 1 160 ? 21.523 -88.804  18.203 1.00 60.12  ? 160 ASP A CB  1 
ATOM 1315 C CG  . ASP A 1 160 ? 22.557 -88.662  19.308 1.00 67.14  ? 160 ASP A CG  1 
ATOM 1316 O OD1 . ASP A 1 160 ? 23.318 -89.626  19.543 1.00 71.65  ? 160 ASP A OD1 1 
ATOM 1317 O OD2 . ASP A 1 160 ? 22.611 -87.588  19.943 1.00 72.69  ? 160 ASP A OD2 1 
ATOM 1318 N N   . GLU A 1 161 ? 20.085 -89.951  15.550 1.00 52.47  ? 161 GLU A N   1 
ATOM 1319 C CA  . GLU A 1 161 ? 18.903 -90.430  14.842 1.00 53.89  ? 161 GLU A CA  1 
ATOM 1320 C C   . GLU A 1 161 ? 19.111 -91.835  14.292 1.00 51.80  ? 161 GLU A C   1 
ATOM 1321 O O   . GLU A 1 161 ? 18.149 -92.601  14.163 1.00 49.18  ? 161 GLU A O   1 
ATOM 1322 C CB  . GLU A 1 161 ? 18.548 -89.467  13.709 1.00 52.69  ? 161 GLU A CB  1 
ATOM 1323 C CG  . GLU A 1 161 ? 17.919 -88.165  14.164 1.00 49.92  ? 161 GLU A CG  1 
ATOM 1324 C CD  . GLU A 1 161 ? 17.435 -87.322  13.002 1.00 63.65  ? 161 GLU A CD  1 
ATOM 1325 O OE1 . GLU A 1 161 ? 16.983 -87.908  11.995 1.00 68.13  ? 161 GLU A OE1 1 
ATOM 1326 O OE2 . GLU A 1 161 ? 17.517 -86.077  13.092 1.00 62.59  ? 161 GLU A OE2 1 
ATOM 1327 N N   . LEU A 1 162 ? 20.354 -92.188  13.956 1.00 48.15  ? 162 LEU A N   1 
ATOM 1328 C CA  . LEU A 1 162 ? 20.634 -93.536  13.478 1.00 46.61  ? 162 LEU A CA  1 
ATOM 1329 C C   . LEU A 1 162 ? 20.528 -94.549  14.608 1.00 54.27  ? 162 LEU A C   1 
ATOM 1330 O O   . LEU A 1 162 ? 19.933 -95.618  14.436 1.00 57.15  ? 162 LEU A O   1 
ATOM 1331 C CB  . LEU A 1 162 ? 22.018 -93.598  12.841 1.00 47.37  ? 162 LEU A CB  1 
ATOM 1332 C CG  . LEU A 1 162 ? 22.158 -94.778  11.885 1.00 47.55  ? 162 LEU A CG  1 
ATOM 1333 C CD1 . LEU A 1 162 ? 21.248 -94.581  10.686 1.00 49.22  ? 162 LEU A CD1 1 
ATOM 1334 C CD2 . LEU A 1 162 ? 23.593 -94.968  11.455 1.00 37.89  ? 162 LEU A CD2 1 
ATOM 1335 N N   . HIS A 1 163 ? 21.102 -94.232  15.771 1.00 53.64  ? 163 HIS A N   1 
ATOM 1336 C CA  . HIS A 1 163 ? 20.936 -95.099  16.930 1.00 51.09  ? 163 HIS A CA  1 
ATOM 1337 C C   . HIS A 1 163 ? 19.477 -95.161  17.361 1.00 53.47  ? 163 HIS A C   1 
ATOM 1338 O O   . HIS A 1 163 ? 19.045 -96.153  17.957 1.00 56.46  ? 163 HIS A O   1 
ATOM 1339 C CB  . HIS A 1 163 ? 21.819 -94.606  18.076 1.00 54.22  ? 163 HIS A CB  1 
ATOM 1340 C CG  . HIS A 1 163 ? 21.885 -95.542  19.242 1.00 59.29  ? 163 HIS A CG  1 
ATOM 1341 N ND1 . HIS A 1 163 ? 20.832 -95.722  20.113 1.00 62.62  ? 163 HIS A ND1 1 
ATOM 1342 C CD2 . HIS A 1 163 ? 22.886 -96.335  19.692 1.00 61.30  ? 163 HIS A CD2 1 
ATOM 1343 C CE1 . HIS A 1 163 ? 21.178 -96.594  21.044 1.00 65.31  ? 163 HIS A CE1 1 
ATOM 1344 N NE2 . HIS A 1 163 ? 22.419 -96.981  20.812 1.00 70.86  ? 163 HIS A NE2 1 
ATOM 1345 N N   . ASN A 1 164 ? 18.705 -94.113  17.063 1.00 60.88  ? 164 ASN A N   1 
ATOM 1346 C CA  . ASN A 1 164 ? 17.275 -94.138  17.351 1.00 60.55  ? 164 ASN A CA  1 
ATOM 1347 C C   . ASN A 1 164 ? 16.548 -95.088  16.410 1.00 55.89  ? 164 ASN A C   1 
ATOM 1348 O O   . ASN A 1 164 ? 15.712 -95.887  16.847 1.00 57.33  ? 164 ASN A O   1 
ATOM 1349 C CB  . ASN A 1 164 ? 16.695 -92.727  17.236 1.00 59.88  ? 164 ASN A CB  1 
ATOM 1350 C CG  . ASN A 1 164 ? 17.016 -91.862  18.439 1.00 64.01  ? 164 ASN A CG  1 
ATOM 1351 O OD1 . ASN A 1 164 ? 17.895 -92.187  19.236 1.00 60.44  ? 164 ASN A OD1 1 
ATOM 1352 N ND2 . ASN A 1 164 ? 16.309 -90.744  18.568 1.00 71.82  ? 164 ASN A ND2 1 
ATOM 1353 N N   . VAL A 1 165 ? 16.863 -95.020  15.113 1.00 57.62  ? 165 VAL A N   1 
ATOM 1354 C CA  . VAL A 1 165 ? 16.225 -95.884  14.126 1.00 63.91  ? 165 VAL A CA  1 
ATOM 1355 C C   . VAL A 1 165 ? 16.689 -97.326  14.284 1.00 63.46  ? 165 VAL A C   1 
ATOM 1356 O O   . VAL A 1 165 ? 15.982 -98.256  13.877 1.00 60.99  ? 165 VAL A O   1 
ATOM 1357 C CB  . VAL A 1 165 ? 16.498 -95.322  12.713 1.00 67.25  ? 165 VAL A CB  1 
ATOM 1358 C CG1 . VAL A 1 165 ? 16.342 -96.386  11.630 1.00 67.29  ? 165 VAL A CG1 1 
ATOM 1359 C CG2 . VAL A 1 165 ? 15.586 -94.136  12.429 1.00 62.85  ? 165 VAL A CG2 1 
ATOM 1360 N N   . GLY A 1 166 ? 17.845 -97.539  14.906 1.00 63.83  ? 166 GLY A N   1 
ATOM 1361 C CA  . GLY A 1 166 ? 18.271 -98.870  15.284 1.00 60.60  ? 166 GLY A CA  1 
ATOM 1362 C C   . GLY A 1 166 ? 17.525 -99.340  16.514 1.00 60.57  ? 166 GLY A C   1 
ATOM 1363 O O   . GLY A 1 166 ? 17.134 -100.506 16.601 1.00 59.67  ? 166 GLY A O   1 
ATOM 1364 N N   . ARG A 1 167 ? 17.318 -98.430  17.471 1.00 66.59  ? 167 ARG A N   1 
ATOM 1365 C CA  . ARG A 1 167 ? 16.584 -98.778  18.684 1.00 67.48  ? 167 ARG A CA  1 
ATOM 1366 C C   . ARG A 1 167 ? 15.187 -99.272  18.344 1.00 63.29  ? 167 ARG A C   1 
ATOM 1367 O O   . ARG A 1 167 ? 14.752 -100.326 18.821 1.00 71.34  ? 167 ARG A O   1 
ATOM 1368 C CB  . ARG A 1 167 ? 16.509 -97.571  19.618 1.00 73.49  ? 167 ARG A CB  1 
ATOM 1369 C CG  . ARG A 1 167 ? 15.401 -97.673  20.652 1.00 77.70  ? 167 ARG A CG  1 
ATOM 1370 C CD  . ARG A 1 167 ? 15.066 -96.314  21.226 1.00 71.44  ? 167 ARG A CD  1 
ATOM 1371 N NE  . ARG A 1 167 ? 16.253 -95.650  21.751 1.00 70.18  ? 167 ARG A NE  1 
ATOM 1372 C CZ  . ARG A 1 167 ? 16.262 -94.410  22.224 1.00 82.19  ? 167 ARG A CZ  1 
ATOM 1373 N NH1 . ARG A 1 167 ? 15.143 -93.698  22.237 1.00 85.29  ? 167 ARG A NH1 1 
ATOM 1374 N NH2 . ARG A 1 167 ? 17.388 -93.883  22.684 1.00 88.38  ? 167 ARG A NH2 1 
ATOM 1375 N N   . ASP A 1 168 ? 14.467 -98.522  17.519 1.00 65.89  ? 168 ASP A N   1 
ATOM 1376 C CA  . ASP A 1 168 ? 13.283 -99.069  16.885 1.00 71.66  ? 168 ASP A CA  1 
ATOM 1377 C C   . ASP A 1 168 ? 13.702 -100.129 15.874 1.00 75.70  ? 168 ASP A C   1 
ATOM 1378 O O   . ASP A 1 168 ? 14.809 -100.094 15.333 1.00 70.12  ? 168 ASP A O   1 
ATOM 1379 C CB  . ASP A 1 168 ? 12.475 -97.962  16.209 1.00 77.21  ? 168 ASP A CB  1 
ATOM 1380 C CG  . ASP A 1 168 ? 12.139 -96.824  17.159 1.00 74.35  ? 168 ASP A CG  1 
ATOM 1381 O OD1 . ASP A 1 168 ? 12.966 -95.899  17.306 1.00 60.40  ? 168 ASP A OD1 1 
ATOM 1382 O OD2 . ASP A 1 168 ? 11.047 -96.862  17.766 1.00 80.00  ? 168 ASP A OD2 1 
ATOM 1383 N N   . HIS A 1 169 ? 12.819 -101.102 15.658 1.00 86.10  ? 169 HIS A N   1 
ATOM 1384 C CA  . HIS A 1 169 ? 12.991 -102.281 14.806 1.00 76.22  ? 169 HIS A CA  1 
ATOM 1385 C C   . HIS A 1 169 ? 13.834 -103.357 15.490 1.00 69.38  ? 169 HIS A C   1 
ATOM 1386 O O   . HIS A 1 169 ? 14.113 -104.382 14.860 1.00 78.37  ? 169 HIS A O   1 
ATOM 1387 C CB  . HIS A 1 169 ? 13.594 -101.960 13.425 1.00 74.91  ? 169 HIS A CB  1 
ATOM 1388 C CG  . HIS A 1 169 ? 12.858 -100.890 12.674 1.00 83.28  ? 169 HIS A CG  1 
ATOM 1389 N ND1 . HIS A 1 169 ? 11.722 -101.145 11.935 1.00 84.74  ? 169 HIS A ND1 1 
ATOM 1390 C CD2 . HIS A 1 169 ? 13.093 -99.562  12.552 1.00 75.45  ? 169 HIS A CD2 1 
ATOM 1391 C CE1 . HIS A 1 169 ? 11.293 -100.021 11.387 1.00 79.73  ? 169 HIS A CE1 1 
ATOM 1392 N NE2 . HIS A 1 169 ? 12.107 -99.046  11.747 1.00 72.14  ? 169 HIS A NE2 1 
ATOM 1393 N N   . GLY A 1 170 ? 14.268 -103.160 16.738 1.00 65.94  ? 170 GLY A N   1 
ATOM 1394 C CA  . GLY A 1 170 ? 14.671 -104.246 17.609 1.00 67.26  ? 170 GLY A CA  1 
ATOM 1395 C C   . GLY A 1 170 ? 16.145 -104.318 17.964 1.00 66.91  ? 170 GLY A C   1 
ATOM 1396 O O   . GLY A 1 170 ? 16.482 -104.910 18.997 1.00 77.47  ? 170 GLY A O   1 
ATOM 1397 N N   . THR A 1 171 ? 17.034 -103.735 17.165 1.00 66.50  ? 171 THR A N   1 
ATOM 1398 C CA  . THR A 1 171 ? 18.476 -103.876 17.389 1.00 70.53  ? 171 THR A CA  1 
ATOM 1399 C C   . THR A 1 171 ? 19.108 -102.511 17.655 1.00 70.68  ? 171 THR A C   1 
ATOM 1400 O O   . THR A 1 171 ? 19.545 -101.821 16.730 1.00 72.67  ? 171 THR A O   1 
ATOM 1401 C CB  . THR A 1 171 ? 19.140 -104.577 16.197 1.00 65.43  ? 171 THR A CB  1 
ATOM 1402 O OG1 . THR A 1 171 ? 18.643 -104.026 14.970 1.00 56.38  ? 171 THR A OG1 1 
ATOM 1403 C CG2 . THR A 1 171 ? 18.855 -106.071 16.239 1.00 64.16  ? 171 THR A CG2 1 
ATOM 1404 N N   . SER A 1 172 ? 19.181 -102.141 18.936 1.00 68.49  ? 172 SER A N   1 
ATOM 1405 C CA  . SER A 1 172 ? 19.747 -100.852 19.324 1.00 66.75  ? 172 SER A CA  1 
ATOM 1406 C C   . SER A 1 172 ? 21.271 -100.867 19.276 1.00 70.78  ? 172 SER A C   1 
ATOM 1407 O O   . SER A 1 172 ? 21.890 -99.883  18.853 1.00 71.25  ? 172 SER A O   1 
ATOM 1408 C CB  . SER A 1 172 ? 19.261 -100.466 20.721 1.00 65.20  ? 172 SER A CB  1 
ATOM 1409 O OG  . SER A 1 172 ? 19.663 -101.427 21.680 1.00 76.98  ? 172 SER A OG  1 
ATOM 1410 N N   . ASP A 1 173 ? 21.891 -101.965 19.705 1.00 66.54  ? 173 ASP A N   1 
ATOM 1411 C CA  . ASP A 1 173 ? 23.341 -102.122 19.663 1.00 64.32  ? 173 ASP A CA  1 
ATOM 1412 C C   . ASP A 1 173 ? 23.674 -103.224 18.664 1.00 57.22  ? 173 ASP A C   1 
ATOM 1413 O O   . ASP A 1 173 ? 23.405 -104.403 18.916 1.00 53.87  ? 173 ASP A O   1 
ATOM 1414 C CB  . ASP A 1 173 ? 23.901 -102.451 21.045 1.00 60.91  ? 173 ASP A CB  1 
ATOM 1415 C CG  . ASP A 1 173 ? 25.417 -102.479 21.066 1.00 61.42  ? 173 ASP A CG  1 
ATOM 1416 O OD1 . ASP A 1 173 ? 26.027 -101.410 21.273 1.00 75.88  ? 173 ASP A OD1 1 
ATOM 1417 O OD2 . ASP A 1 173 ? 26.000 -103.564 20.865 1.00 55.07  ? 173 ASP A OD2 1 
ATOM 1418 N N   . PHE A 1 174 ? 24.260 -102.832 17.531 1.00 59.46  ? 174 PHE A N   1 
ATOM 1419 C CA  . PHE A 1 174 ? 24.586 -103.800 16.490 1.00 43.12  ? 174 PHE A CA  1 
ATOM 1420 C C   . PHE A 1 174 ? 25.667 -104.768 16.951 1.00 39.67  ? 174 PHE A C   1 
ATOM 1421 O O   . PHE A 1 174 ? 25.565 -105.975 16.711 1.00 48.79  ? 174 PHE A O   1 
ATOM 1422 C CB  . PHE A 1 174 ? 25.010 -103.077 15.209 1.00 46.19  ? 174 PHE A CB  1 
ATOM 1423 C CG  . PHE A 1 174 ? 23.856 -102.535 14.396 1.00 45.39  ? 174 PHE A CG  1 
ATOM 1424 C CD1 . PHE A 1 174 ? 24.019 -102.245 13.051 1.00 35.50  ? 174 PHE A CD1 1 
ATOM 1425 C CD2 . PHE A 1 174 ? 22.619 -102.301 14.976 1.00 48.89  ? 174 PHE A CD2 1 
ATOM 1426 C CE1 . PHE A 1 174 ? 22.967 -101.746 12.298 1.00 27.48  ? 174 PHE A CE1 1 
ATOM 1427 C CE2 . PHE A 1 174 ? 21.566 -101.803 14.226 1.00 40.04  ? 174 PHE A CE2 1 
ATOM 1428 C CZ  . PHE A 1 174 ? 21.742 -101.527 12.887 1.00 29.37  ? 174 PHE A CZ  1 
ATOM 1429 N N   . ARG A 1 175 ? 26.712 -104.257 17.608 1.00 41.25  ? 175 ARG A N   1 
ATOM 1430 C CA  . ARG A 1 175 ? 27.831 -105.102 18.019 1.00 46.88  ? 175 ARG A CA  1 
ATOM 1431 C C   . ARG A 1 175 ? 27.348 -106.304 18.827 1.00 56.67  ? 175 ARG A C   1 
ATOM 1432 O O   . ARG A 1 175 ? 27.732 -107.446 18.551 1.00 57.38  ? 175 ARG A O   1 
ATOM 1433 C CB  . ARG A 1 175 ? 28.850 -104.272 18.809 1.00 51.72  ? 175 ARG A CB  1 
ATOM 1434 C CG  . ARG A 1 175 ? 30.059 -105.056 19.316 1.00 64.31  ? 175 ARG A CG  1 
ATOM 1435 C CD  . ARG A 1 175 ? 29.948 -105.460 20.780 1.00 74.29  ? 175 ARG A CD  1 
ATOM 1436 N NE  . ARG A 1 175 ? 31.031 -106.363 21.171 1.00 82.25  ? 175 ARG A NE  1 
ATOM 1437 C CZ  . ARG A 1 175 ? 32.154 -105.976 21.769 1.00 86.66  ? 175 ARG A CZ  1 
ATOM 1438 N NH1 . ARG A 1 175 ? 32.356 -104.695 22.047 1.00 83.38  ? 175 ARG A NH1 1 
ATOM 1439 N NH2 . ARG A 1 175 ? 33.082 -106.872 22.087 1.00 81.92  ? 175 ARG A NH2 1 
ATOM 1440 N N   . GLU A 1 176 ? 26.508 -106.062 19.837 1.00 58.81  ? 176 GLU A N   1 
ATOM 1441 C CA  . GLU A 1 176 ? 25.940 -107.165 20.609 1.00 53.66  ? 176 GLU A CA  1 
ATOM 1442 C C   . GLU A 1 176 ? 25.172 -108.126 19.712 1.00 49.55  ? 176 GLU A C   1 
ATOM 1443 O O   . GLU A 1 176 ? 25.345 -109.348 19.801 1.00 56.40  ? 176 GLU A O   1 
ATOM 1444 C CB  . GLU A 1 176 ? 25.040 -106.630 21.724 1.00 63.68  ? 176 GLU A CB  1 
ATOM 1445 C CG  . GLU A 1 176 ? 25.798 -106.063 22.910 1.00 71.92  ? 176 GLU A CG  1 
ATOM 1446 C CD  . GLU A 1 176 ? 26.457 -107.149 23.744 1.00 85.85  ? 176 GLU A CD  1 
ATOM 1447 O OE1 . GLU A 1 176 ? 26.091 -108.335 23.584 1.00 84.74  ? 176 GLU A OE1 1 
ATOM 1448 O OE2 . GLU A 1 176 ? 27.346 -106.819 24.556 1.00 102.19 ? 176 GLU A OE2 1 
ATOM 1449 N N   . SER A 1 177 ? 24.301 -107.590 18.853 1.00 44.18  ? 177 SER A N   1 
ATOM 1450 C CA  . SER A 1 177 ? 23.585 -108.427 17.897 1.00 42.59  ? 177 SER A CA  1 
ATOM 1451 C C   . SER A 1 177 ? 24.549 -109.289 17.092 1.00 41.01  ? 177 SER A C   1 
ATOM 1452 O O   . SER A 1 177 ? 24.316 -110.486 16.897 1.00 48.03  ? 177 SER A O   1 
ATOM 1453 C CB  . SER A 1 177 ? 22.727 -107.563 16.972 1.00 40.27  ? 177 SER A CB  1 
ATOM 1454 O OG  . SER A 1 177 ? 21.874 -106.714 17.717 1.00 47.73  ? 177 SER A OG  1 
ATOM 1455 N N   . LEU A 1 178 ? 25.628 -108.687 16.590 1.00 37.03  ? 178 LEU A N   1 
ATOM 1456 C CA  . LEU A 1 178 ? 26.596 -109.450 15.809 1.00 42.04  ? 178 LEU A CA  1 
ATOM 1457 C C   . LEU A 1 178 ? 27.277 -110.533 16.641 1.00 46.83  ? 178 LEU A C   1 
ATOM 1458 O O   . LEU A 1 178 ? 27.446 -111.658 16.167 1.00 51.59  ? 178 LEU A O   1 
ATOM 1459 C CB  . LEU A 1 178 ? 27.630 -108.522 15.171 1.00 43.55  ? 178 LEU A CB  1 
ATOM 1460 C CG  . LEU A 1 178 ? 27.283 -107.749 13.890 1.00 37.20  ? 178 LEU A CG  1 
ATOM 1461 C CD1 . LEU A 1 178 ? 27.527 -108.652 12.693 1.00 36.71  ? 178 LEU A CD1 1 
ATOM 1462 C CD2 . LEU A 1 178 ? 25.854 -107.234 13.851 1.00 30.54  ? 178 LEU A CD2 1 
ATOM 1463 N N   . VAL A 1 179 ? 27.689 -110.223 17.873 1.00 45.74  ? 179 VAL A N   1 
ATOM 1464 C CA  . VAL A 1 179 ? 28.436 -111.221 18.639 1.00 51.60  ? 179 VAL A CA  1 
ATOM 1465 C C   . VAL A 1 179 ? 27.529 -112.377 19.060 1.00 47.44  ? 179 VAL A C   1 
ATOM 1466 O O   . VAL A 1 179 ? 27.944 -113.545 19.053 1.00 47.81  ? 179 VAL A O   1 
ATOM 1467 C CB  . VAL A 1 179 ? 29.144 -110.568 19.845 1.00 59.91  ? 179 VAL A CB  1 
ATOM 1468 C CG1 . VAL A 1 179 ? 28.162 -110.221 20.958 1.00 57.71  ? 179 VAL A CG1 1 
ATOM 1469 C CG2 . VAL A 1 179 ? 30.245 -111.482 20.369 1.00 66.51  ? 179 VAL A CG2 1 
ATOM 1470 N N   . SER A 1 180 ? 26.263 -112.086 19.365 1.00 46.05  ? 180 SER A N   1 
ATOM 1471 C CA  . SER A 1 180 ? 25.336 -113.160 19.697 1.00 43.60  ? 180 SER A CA  1 
ATOM 1472 C C   . SER A 1 180 ? 24.978 -113.958 18.457 1.00 43.69  ? 180 SER A C   1 
ATOM 1473 O O   . SER A 1 180 ? 24.822 -115.182 18.516 1.00 50.89  ? 180 SER A O   1 
ATOM 1474 C CB  . SER A 1 180 ? 24.079 -112.583 20.347 1.00 43.53  ? 180 SER A CB  1 
ATOM 1475 O OG  . SER A 1 180 ? 23.098 -113.586 20.532 1.00 50.10  ? 180 SER A OG  1 
ATOM 1476 N N   . LEU A 1 181 ? 24.859 -113.277 17.323 1.00 42.60  ? 181 LEU A N   1 
ATOM 1477 C CA  . LEU A 1 181 ? 24.450 -113.933 16.093 1.00 43.26  ? 181 LEU A CA  1 
ATOM 1478 C C   . LEU A 1 181 ? 25.567 -114.799 15.519 1.00 42.68  ? 181 LEU A C   1 
ATOM 1479 O O   . LEU A 1 181 ? 25.292 -115.843 14.916 1.00 44.71  ? 181 LEU A O   1 
ATOM 1480 C CB  . LEU A 1 181 ? 23.996 -112.868 15.103 1.00 38.64  ? 181 LEU A CB  1 
ATOM 1481 C CG  . LEU A 1 181 ? 23.452 -113.284 13.752 1.00 45.72  ? 181 LEU A CG  1 
ATOM 1482 C CD1 . LEU A 1 181 ? 22.024 -112.811 13.633 1.00 41.51  ? 181 LEU A CD1 1 
ATOM 1483 C CD2 . LEU A 1 181 ? 24.312 -112.632 12.706 1.00 48.56  ? 181 LEU A CD2 1 
ATOM 1484 N N   . VAL A 1 182 ? 26.827 -114.399 15.711 1.00 42.64  ? 182 VAL A N   1 
ATOM 1485 C CA  . VAL A 1 182 ? 27.935 -115.278 15.353 1.00 45.17  ? 182 VAL A CA  1 
ATOM 1486 C C   . VAL A 1 182 ? 28.047 -116.410 16.360 1.00 47.26  ? 182 VAL A C   1 
ATOM 1487 O O   . VAL A 1 182 ? 28.437 -117.527 16.001 1.00 50.02  ? 182 VAL A O   1 
ATOM 1488 C CB  . VAL A 1 182 ? 29.269 -114.510 15.216 1.00 45.15  ? 182 VAL A CB  1 
ATOM 1489 C CG1 . VAL A 1 182 ? 29.133 -113.365 14.239 1.00 41.78  ? 182 VAL A CG1 1 
ATOM 1490 C CG2 . VAL A 1 182 ? 29.781 -114.017 16.563 1.00 46.87  ? 182 VAL A CG2 1 
ATOM 1491 N N   . GLN A 1 183 ? 27.753 -116.145 17.634 1.00 45.83  ? 183 GLN A N   1 
ATOM 1492 C CA  . GLN A 1 183 ? 27.831 -117.202 18.635 1.00 48.63  ? 183 GLN A CA  1 
ATOM 1493 C C   . GLN A 1 183 ? 26.838 -118.317 18.308 1.00 48.48  ? 183 GLN A C   1 
ATOM 1494 O O   . GLN A 1 183 ? 27.215 -119.484 18.116 1.00 47.69  ? 183 GLN A O   1 
ATOM 1495 C CB  . GLN A 1 183 ? 27.569 -116.619 20.025 1.00 51.25  ? 183 GLN A CB  1 
ATOM 1496 C CG  . GLN A 1 183 ? 28.356 -117.290 21.135 1.00 63.73  ? 183 GLN A CG  1 
ATOM 1497 C CD  . GLN A 1 183 ? 29.848 -117.024 21.017 1.00 72.17  ? 183 GLN A CD  1 
ATOM 1498 O OE1 . GLN A 1 183 ? 30.604 -117.851 20.503 1.00 59.54  ? 183 GLN A OE1 1 
ATOM 1499 N NE2 . GLN A 1 183 ? 30.277 -115.856 21.489 1.00 75.29  ? 183 GLN A NE2 1 
ATOM 1500 N N   . ASN A 1 184 ? 25.552 -117.965 18.231 1.00 44.39  ? 184 ASN A N   1 
ATOM 1501 C CA  . ASN A 1 184 ? 24.524 -118.935 17.885 1.00 41.34  ? 184 ASN A CA  1 
ATOM 1502 C C   . ASN A 1 184 ? 24.660 -119.448 16.457 1.00 45.58  ? 184 ASN A C   1 
ATOM 1503 O O   . ASN A 1 184 ? 24.207 -120.561 16.166 1.00 57.33  ? 184 ASN A O   1 
ATOM 1504 C CB  . ASN A 1 184 ? 23.144 -118.317 18.095 1.00 41.28  ? 184 ASN A CB  1 
ATOM 1505 C CG  . ASN A 1 184 ? 22.799 -118.149 19.557 1.00 53.21  ? 184 ASN A CG  1 
ATOM 1506 O OD1 . ASN A 1 184 ? 23.682 -118.021 20.407 1.00 54.22  ? 184 ASN A OD1 1 
ATOM 1507 N ND2 . ASN A 1 184 ? 21.507 -118.157 19.863 1.00 59.92  ? 184 ASN A ND2 1 
ATOM 1508 N N   . SER A 1 185 ? 25.308 -118.691 15.572 1.00 42.04  ? 185 SER A N   1 
ATOM 1509 C CA  . SER A 1 185 ? 25.621 -119.235 14.257 1.00 41.75  ? 185 SER A CA  1 
ATOM 1510 C C   . SER A 1 185 ? 26.649 -120.352 14.379 1.00 43.27  ? 185 SER A C   1 
ATOM 1511 O O   . SER A 1 185 ? 26.590 -121.345 13.646 1.00 45.69  ? 185 SER A O   1 
ATOM 1512 C CB  . SER A 1 185 ? 26.120 -118.127 13.331 1.00 50.05  ? 185 SER A CB  1 
ATOM 1513 O OG  . SER A 1 185 ? 25.962 -118.490 11.971 1.00 51.38  ? 185 SER A OG  1 
ATOM 1514 N N   . ARG A 1 186 ? 27.614 -120.186 15.286 1.00 46.17  ? 186 ARG A N   1 
ATOM 1515 C CA  . ARG A 1 186 ? 28.629 -121.207 15.523 1.00 46.04  ? 186 ARG A CA  1 
ATOM 1516 C C   . ARG A 1 186 ? 28.011 -122.469 16.117 1.00 44.98  ? 186 ARG A C   1 
ATOM 1517 O O   . ARG A 1 186 ? 28.299 -123.587 15.665 1.00 49.51  ? 186 ARG A O   1 
ATOM 1518 C CB  . ARG A 1 186 ? 29.704 -120.634 16.448 1.00 44.80  ? 186 ARG A CB  1 
ATOM 1519 C CG  . ARG A 1 186 ? 30.513 -121.636 17.243 1.00 35.07  ? 186 ARG A CG  1 
ATOM 1520 C CD  . ARG A 1 186 ? 31.686 -120.930 17.917 1.00 40.10  ? 186 ARG A CD  1 
ATOM 1521 N NE  . ARG A 1 186 ? 32.404 -120.040 17.004 1.00 53.71  ? 186 ARG A NE  1 
ATOM 1522 C CZ  . ARG A 1 186 ? 33.038 -118.927 17.377 1.00 50.52  ? 186 ARG A CZ  1 
ATOM 1523 N NH1 . ARG A 1 186 ? 33.666 -118.185 16.474 1.00 37.56  ? 186 ARG A NH1 1 
ATOM 1524 N NH2 . ARG A 1 186 ? 33.037 -118.547 18.649 1.00 49.57  ? 186 ARG A NH2 1 
ATOM 1525 N N   . LYS A 1 187 ? 27.137 -122.311 17.120 1.00 42.35  ? 187 LYS A N   1 
ATOM 1526 C CA  . LYS A 1 187 ? 26.414 -123.473 17.636 1.00 39.72  ? 187 LYS A CA  1 
ATOM 1527 C C   . LYS A 1 187 ? 25.629 -124.161 16.530 1.00 45.96  ? 187 LYS A C   1 
ATOM 1528 O O   . LYS A 1 187 ? 25.685 -125.387 16.386 1.00 50.91  ? 187 LYS A O   1 
ATOM 1529 C CB  . LYS A 1 187 ? 25.469 -123.083 18.771 1.00 42.69  ? 187 LYS A CB  1 
ATOM 1530 C CG  . LYS A 1 187 ? 26.117 -122.913 20.128 1.00 46.97  ? 187 LYS A CG  1 
ATOM 1531 C CD  . LYS A 1 187 ? 25.107 -123.246 21.220 1.00 45.86  ? 187 LYS A CD  1 
ATOM 1532 C CE  . LYS A 1 187 ? 24.006 -122.200 21.318 1.00 46.63  ? 187 LYS A CE  1 
ATOM 1533 N NZ  . LYS A 1 187 ? 22.979 -122.555 22.341 1.00 40.78  ? 187 LYS A NZ  1 
ATOM 1534 N N   . LEU A 1 188 ? 24.885 -123.383 15.738 1.00 47.56  ? 188 LEU A N   1 
ATOM 1535 C CA  . LEU A 1 188 ? 24.056 -123.983 14.697 1.00 53.40  ? 188 LEU A CA  1 
ATOM 1536 C C   . LEU A 1 188 ? 24.918 -124.736 13.694 1.00 50.83  ? 188 LEU A C   1 
ATOM 1537 O O   . LEU A 1 188 ? 24.539 -125.812 13.226 1.00 46.99  ? 188 LEU A O   1 
ATOM 1538 C CB  . LEU A 1 188 ? 23.210 -122.916 13.998 1.00 50.98  ? 188 LEU A CB  1 
ATOM 1539 C CG  . LEU A 1 188 ? 22.136 -123.436 13.029 1.00 50.59  ? 188 LEU A CG  1 
ATOM 1540 C CD1 . LEU A 1 188 ? 20.906 -122.539 13.059 1.00 59.23  ? 188 LEU A CD1 1 
ATOM 1541 C CD2 . LEU A 1 188 ? 22.644 -123.572 11.603 1.00 45.48  ? 188 LEU A CD2 1 
ATOM 1542 N N   . GLN A 1 189 ? 26.044 -124.145 13.297 1.00 53.37  ? 189 GLN A N   1 
ATOM 1543 C CA  . GLN A 1 189 ? 27.038 -124.857 12.501 1.00 53.79  ? 189 GLN A CA  1 
ATOM 1544 C C   . GLN A 1 189 ? 27.375 -126.214 13.116 1.00 53.48  ? 189 GLN A C   1 
ATOM 1545 O O   . GLN A 1 189 ? 27.299 -127.251 12.444 1.00 56.76  ? 189 GLN A O   1 
ATOM 1546 C CB  . GLN A 1 189 ? 28.294 -123.993 12.375 1.00 53.88  ? 189 GLN A CB  1 
ATOM 1547 C CG  . GLN A 1 189 ? 29.402 -124.596 11.539 1.00 60.93  ? 189 GLN A CG  1 
ATOM 1548 C CD  . GLN A 1 189 ? 29.496 -123.957 10.169 1.00 67.33  ? 189 GLN A CD  1 
ATOM 1549 O OE1 . GLN A 1 189 ? 28.513 -123.420 9.654  1.00 60.98  ? 189 GLN A OE1 1 
ATOM 1550 N NE2 . GLN A 1 189 ? 30.685 -123.999 9.575  1.00 63.82  ? 189 GLN A NE2 1 
ATOM 1551 N N   . ASN A 1 190 ? 27.745 -126.222 14.403 1.00 54.06  ? 190 ASN A N   1 
ATOM 1552 C CA  . ASN A 1 190 ? 28.179 -127.459 15.054 1.00 52.28  ? 190 ASN A CA  1 
ATOM 1553 C C   . ASN A 1 190 ? 27.076 -128.517 15.062 1.00 59.03  ? 190 ASN A C   1 
ATOM 1554 O O   . ASN A 1 190 ? 27.279 -129.656 14.612 1.00 62.92  ? 190 ASN A O   1 
ATOM 1555 C CB  . ASN A 1 190 ? 28.631 -127.154 16.482 1.00 53.78  ? 190 ASN A CB  1 
ATOM 1556 C CG  . ASN A 1 190 ? 29.544 -128.221 17.045 1.00 75.06  ? 190 ASN A CG  1 
ATOM 1557 O OD1 . ASN A 1 190 ? 30.750 -128.213 16.797 1.00 86.26  ? 190 ASN A OD1 1 
ATOM 1558 N ND2 . ASN A 1 190 ? 28.974 -129.152 17.806 1.00 77.16  ? 190 ASN A ND2 1 
ATOM 1559 N N   . ILE A 1 191 ? 25.882 -128.142 15.528 1.00 57.08  ? 191 ILE A N   1 
ATOM 1560 C CA  . ILE A 1 191 ? 24.803 -129.117 15.645 1.00 57.16  ? 191 ILE A CA  1 
ATOM 1561 C C   . ILE A 1 191 ? 24.331 -129.525 14.259 1.00 55.94  ? 191 ILE A C   1 
ATOM 1562 O O   . ILE A 1 191 ? 23.883 -130.658 14.046 1.00 63.11  ? 191 ILE A O   1 
ATOM 1563 C CB  . ILE A 1 191 ? 23.664 -128.537 16.509 1.00 57.55  ? 191 ILE A CB  1 
ATOM 1564 C CG1 . ILE A 1 191 ? 23.981 -128.683 18.002 1.00 62.19  ? 191 ILE A CG1 1 
ATOM 1565 C CG2 . ILE A 1 191 ? 22.344 -129.206 16.199 1.00 60.20  ? 191 ILE A CG2 1 
ATOM 1566 C CD1 . ILE A 1 191 ? 24.923 -127.636 18.569 1.00 53.94  ? 191 ILE A CD1 1 
ATOM 1567 N N   . ARG A 1 192 ? 24.473 -128.629 13.288 1.00 56.76  ? 192 ARG A N   1 
ATOM 1568 C CA  . ARG A 1 192 ? 24.126 -128.947 11.914 1.00 59.60  ? 192 ARG A CA  1 
ATOM 1569 C C   . ARG A 1 192 ? 25.049 -130.021 11.353 1.00 60.05  ? 192 ARG A C   1 
ATOM 1570 O O   . ARG A 1 192 ? 24.592 -130.949 10.674 1.00 58.02  ? 192 ARG A O   1 
ATOM 1571 C CB  . ARG A 1 192 ? 24.190 -127.676 11.072 1.00 53.83  ? 192 ARG A CB  1 
ATOM 1572 C CG  . ARG A 1 192 ? 24.743 -127.887 9.688  1.00 56.60  ? 192 ARG A CG  1 
ATOM 1573 C CD  . ARG A 1 192 ? 24.176 -126.904 8.717  1.00 60.85  ? 192 ARG A CD  1 
ATOM 1574 N NE  . ARG A 1 192 ? 22.920 -127.399 8.194  1.00 71.25  ? 192 ARG A NE  1 
ATOM 1575 C CZ  . ARG A 1 192 ? 22.433 -127.069 7.009  1.00 75.04  ? 192 ARG A CZ  1 
ATOM 1576 N NH1 . ARG A 1 192 ? 23.096 -126.242 6.214  1.00 67.88  ? 192 ARG A NH1 1 
ATOM 1577 N NH2 . ARG A 1 192 ? 21.276 -127.572 6.623  1.00 72.95  ? 192 ARG A NH2 1 
ATOM 1578 N N   . ASP A 1 193 ? 26.351 -129.923 11.641 1.00 59.99  ? 193 ASP A N   1 
ATOM 1579 C CA  . ASP A 1 193 ? 27.272 -130.968 11.207 1.00 55.20  ? 193 ASP A CA  1 
ATOM 1580 C C   . ASP A 1 193 ? 26.972 -132.288 11.903 1.00 62.34  ? 193 ASP A C   1 
ATOM 1581 O O   . ASP A 1 193 ? 27.045 -133.353 11.279 1.00 67.96  ? 193 ASP A O   1 
ATOM 1582 C CB  . ASP A 1 193 ? 28.717 -130.537 11.454 1.00 56.62  ? 193 ASP A CB  1 
ATOM 1583 C CG  . ASP A 1 193 ? 29.726 -131.440 10.761 1.00 60.29  ? 193 ASP A CG  1 
ATOM 1584 O OD1 . ASP A 1 193 ? 30.540 -130.917 9.971  1.00 64.76  ? 193 ASP A OD1 1 
ATOM 1585 O OD2 . ASP A 1 193 ? 29.711 -132.666 10.996 1.00 67.68  ? 193 ASP A OD2 1 
ATOM 1586 N N   . ASN A 1 194 ? 26.640 -132.246 13.199 1.00 63.54  ? 194 ASN A N   1 
ATOM 1587 C CA  . ASN A 1 194 ? 26.263 -133.485 13.879 1.00 59.56  ? 194 ASN A CA  1 
ATOM 1588 C C   . ASN A 1 194 ? 25.027 -134.121 13.245 1.00 62.11  ? 194 ASN A C   1 
ATOM 1589 O O   . ASN A 1 194 ? 24.958 -135.349 13.097 1.00 68.19  ? 194 ASN A O   1 
ATOM 1590 C CB  . ASN A 1 194 ? 26.025 -133.226 15.368 1.00 62.03  ? 194 ASN A CB  1 
ATOM 1591 C CG  . ASN A 1 194 ? 25.929 -134.511 16.181 1.00 72.66  ? 194 ASN A CG  1 
ATOM 1592 O OD1 . ASN A 1 194 ? 26.661 -135.470 15.939 1.00 66.47  ? 194 ASN A OD1 1 
ATOM 1593 N ND2 . ASN A 1 194 ? 25.022 -134.530 17.152 1.00 76.74  ? 194 ASN A ND2 1 
ATOM 1594 N N   . VAL A 1 195 ? 24.059 -133.302 12.822 1.00 61.40  ? 195 VAL A N   1 
ATOM 1595 C CA  . VAL A 1 195 ? 22.836 -133.848 12.236 1.00 60.40  ? 195 VAL A CA  1 
ATOM 1596 C C   . VAL A 1 195 ? 23.085 -134.375 10.826 1.00 60.79  ? 195 VAL A C   1 
ATOM 1597 O O   . VAL A 1 195 ? 22.497 -135.387 10.422 1.00 60.18  ? 195 VAL A O   1 
ATOM 1598 C CB  . VAL A 1 195 ? 21.718 -132.787 12.265 1.00 57.81  ? 195 VAL A CB  1 
ATOM 1599 C CG1 . VAL A 1 195 ? 20.634 -133.098 11.239 1.00 55.81  ? 195 VAL A CG1 1 
ATOM 1600 C CG2 . VAL A 1 195 ? 21.121 -132.690 13.661 1.00 55.75  ? 195 VAL A CG2 1 
ATOM 1601 N N   . GLU A 1 196 ? 23.969 -133.730 10.060 1.00 63.73  ? 196 GLU A N   1 
ATOM 1602 C CA  . GLU A 1 196 ? 24.272 -134.228 8.723  1.00 63.75  ? 196 GLU A CA  1 
ATOM 1603 C C   . GLU A 1 196 ? 25.177 -135.450 8.754  1.00 68.26  ? 196 GLU A C   1 
ATOM 1604 O O   . GLU A 1 196 ? 25.161 -136.241 7.805  1.00 68.18  ? 196 GLU A O   1 
ATOM 1605 C CB  . GLU A 1 196 ? 24.925 -133.139 7.868  1.00 64.10  ? 196 GLU A CB  1 
ATOM 1606 C CG  . GLU A 1 196 ? 24.080 -131.897 7.662  1.00 67.99  ? 196 GLU A CG  1 
ATOM 1607 C CD  . GLU A 1 196 ? 24.851 -130.780 6.983  1.00 69.14  ? 196 GLU A CD  1 
ATOM 1608 O OE1 . GLU A 1 196 ? 25.945 -130.424 7.474  1.00 61.62  ? 196 GLU A OE1 1 
ATOM 1609 O OE2 . GLU A 1 196 ? 24.366 -130.265 5.952  1.00 71.63  ? 196 GLU A OE2 1 
ATOM 1610 N N   . LYS A 1 197 ? 25.961 -135.620 9.818  1.00 70.78  ? 197 LYS A N   1 
ATOM 1611 C CA  . LYS A 1 197 ? 26.817 -136.787 9.963  1.00 71.09  ? 197 LYS A CA  1 
ATOM 1612 C C   . LYS A 1 197 ? 26.133 -137.933 10.692 1.00 69.49  ? 197 LYS A C   1 
ATOM 1613 O O   . LYS A 1 197 ? 26.667 -139.047 10.702 1.00 72.19  ? 197 LYS A O   1 
ATOM 1614 C CB  . LYS A 1 197 ? 28.118 -136.407 10.681 1.00 71.62  ? 197 LYS A CB  1 
ATOM 1615 C CG  . LYS A 1 197 ? 29.362 -136.976 10.013 1.00 78.94  ? 197 LYS A CG  1 
ATOM 1616 C CD  . LYS A 1 197 ? 29.336 -136.755 8.508  1.00 86.50  ? 197 LYS A CD  1 
ATOM 1617 C CE  . LYS A 1 197 ? 30.452 -137.528 7.818  1.00 93.90  ? 197 LYS A CE  1 
ATOM 1618 N NZ  . LYS A 1 197 ? 30.316 -137.499 6.335  1.00 92.35  ? 197 LYS A NZ  1 
ATOM 1619 N N   . GLU A 1 198 ? 24.976 -137.693 11.303 1.00 72.28  ? 198 GLU A N   1 
ATOM 1620 C CA  . GLU A 1 198 ? 24.089 -138.773 11.710 1.00 72.57  ? 198 GLU A CA  1 
ATOM 1621 C C   . GLU A 1 198 ? 22.997 -139.038 10.684 1.00 68.16  ? 198 GLU A C   1 
ATOM 1622 O O   . GLU A 1 198 ? 22.128 -139.882 10.925 1.00 63.15  ? 198 GLU A O   1 
ATOM 1623 C CB  . GLU A 1 198 ? 23.455 -138.465 13.072 1.00 71.36  ? 198 GLU A CB  1 
ATOM 1624 C CG  . GLU A 1 198 ? 24.460 -138.316 14.199 1.00 75.10  ? 198 GLU A CG  1 
ATOM 1625 C CD  . GLU A 1 198 ? 25.463 -139.450 14.232 1.00 73.64  ? 198 GLU A CD  1 
ATOM 1626 O OE1 . GLU A 1 198 ? 25.036 -140.624 14.273 1.00 78.15  ? 198 GLU A OE1 1 
ATOM 1627 O OE2 . GLU A 1 198 ? 26.680 -139.166 14.210 1.00 70.50  ? 198 GLU A OE2 1 
ATOM 1628 N N   . SER A 1 199 ? 23.025 -138.343 9.546  1.00 67.00  ? 199 SER A N   1 
ATOM 1629 C CA  . SER A 1 199 ? 21.954 -138.445 8.565  1.00 68.28  ? 199 SER A CA  1 
ATOM 1630 C C   . SER A 1 199 ? 22.090 -139.654 7.652  1.00 70.32  ? 199 SER A C   1 
ATOM 1631 O O   . SER A 1 199 ? 21.163 -139.933 6.884  1.00 77.76  ? 199 SER A O   1 
ATOM 1632 C CB  . SER A 1 199 ? 21.903 -137.170 7.718  1.00 69.38  ? 199 SER A CB  1 
ATOM 1633 O OG  . SER A 1 199 ? 20.930 -137.271 6.692  1.00 69.45  ? 199 SER A OG  1 
ATOM 1634 N N   . LYS A 1 200 ? 23.209 -140.368 7.701  1.00 67.72  ? 200 LYS A N   1 
ATOM 1635 C CA  . LYS A 1 200 ? 23.364 -141.556 6.872  1.00 74.05  ? 200 LYS A CA  1 
ATOM 1636 C C   . LYS A 1 200 ? 23.708 -142.781 7.721  1.00 65.17  ? 200 LYS A C   1 
ATOM 1637 O O   . LYS A 1 200 ? 22.891 -143.255 8.511  1.00 56.05  ? 200 LYS A O   1 
ATOM 1638 C CB  . LYS A 1 200 ? 24.427 -141.337 5.796  1.00 72.79  ? 200 LYS A CB  1 
ATOM 1639 C CG  . LYS A 1 200 ? 24.396 -142.402 4.709  1.00 81.06  ? 200 LYS A CG  1 
ATOM 1640 C CD  . LYS A 1 200 ? 22.959 -142.701 4.290  1.00 69.58  ? 200 LYS A CD  1 
ATOM 1641 C CE  . LYS A 1 200 ? 22.795 -144.137 3.825  1.00 72.34  ? 200 LYS A CE  1 
ATOM 1642 N NZ  . LYS A 1 200 ? 21.374 -144.576 3.917  1.00 72.00  ? 200 LYS A NZ  1 
ATOM 1643 N N   . THR B 2 2   ? 57.287 -1.581   48.190 1.00 63.20  ? 31  THR B N   1 
ATOM 1644 C CA  . THR B 2 2   ? 56.725 -1.715   46.852 1.00 68.65  ? 31  THR B CA  1 
ATOM 1645 C C   . THR B 2 2   ? 56.591 -0.354   46.165 1.00 62.91  ? 31  THR B C   1 
ATOM 1646 O O   . THR B 2 2   ? 57.068 -0.168   45.042 1.00 55.86  ? 31  THR B O   1 
ATOM 1647 C CB  . THR B 2 2   ? 55.347 -2.406   46.896 1.00 69.04  ? 31  THR B CB  1 
ATOM 1648 O OG1 . THR B 2 2   ? 54.416 -1.577   47.604 1.00 73.10  ? 31  THR B OG1 1 
ATOM 1649 C CG2 . THR B 2 2   ? 55.452 -3.755   47.594 1.00 56.05  ? 31  THR B CG2 1 
ATOM 1650 N N   . ILE B 2 3   ? 55.933 0.586    46.850 1.00 56.32  ? 32  ILE B N   1 
ATOM 1651 C CA  . ILE B 2 3   ? 55.789 1.973    46.408 1.00 53.11  ? 32  ILE B CA  1 
ATOM 1652 C C   . ILE B 2 3   ? 55.005 2.029    45.098 1.00 53.28  ? 32  ILE B C   1 
ATOM 1653 O O   . ILE B 2 3   ? 54.975 3.062    44.418 1.00 52.63  ? 32  ILE B O   1 
ATOM 1654 C CB  . ILE B 2 3   ? 57.164 2.662    46.287 1.00 52.54  ? 32  ILE B CB  1 
ATOM 1655 C CG1 . ILE B 2 3   ? 58.024 2.347    47.507 1.00 50.91  ? 32  ILE B CG1 1 
ATOM 1656 C CG2 . ILE B 2 3   ? 57.024 4.173    46.244 1.00 56.78  ? 32  ILE B CG2 1 
ATOM 1657 C CD1 . ILE B 2 3   ? 57.461 2.899    48.799 1.00 47.48  ? 32  ILE B CD1 1 
ATOM 1658 N N   . SER B 2 4   ? 54.368 0.917    44.731 1.00 59.78  ? 33  SER B N   1 
ATOM 1659 C CA  . SER B 2 4   ? 53.387 0.864    43.641 1.00 64.54  ? 33  SER B CA  1 
ATOM 1660 C C   . SER B 2 4   ? 53.910 1.457    42.331 1.00 61.02  ? 33  SER B C   1 
ATOM 1661 O O   . SER B 2 4   ? 53.118 1.844    41.466 1.00 59.31  ? 33  SER B O   1 
ATOM 1662 C CB  . SER B 2 4   ? 52.082 1.562    44.041 1.00 71.01  ? 33  SER B CB  1 
ATOM 1663 O OG  . SER B 2 4   ? 52.274 2.958    44.201 1.00 56.20  ? 33  SER B OG  1 
ATOM 1664 N N   . ARG B 2 5   ? 55.232 1.567    42.178 1.00 56.82  ? 34  ARG B N   1 
ATOM 1665 C CA  . ARG B 2 5   ? 55.869 1.990    40.931 1.00 52.82  ? 34  ARG B CA  1 
ATOM 1666 C C   . ARG B 2 5   ? 55.473 3.386    40.456 1.00 42.89  ? 34  ARG B C   1 
ATOM 1667 O O   . ARG B 2 5   ? 56.238 4.022    39.723 1.00 40.82  ? 34  ARG B O   1 
ATOM 1668 C CB  . ARG B 2 5   ? 55.584 0.976    39.816 1.00 55.45  ? 34  ARG B CB  1 
ATOM 1669 C CG  . ARG B 2 5   ? 56.759 0.056    39.506 1.00 52.57  ? 34  ARG B CG  1 
ATOM 1670 C CD  . ARG B 2 5   ? 56.471 -0.875   38.333 1.00 43.17  ? 34  ARG B CD  1 
ATOM 1671 N NE  . ARG B 2 5   ? 57.658 -1.633   37.944 1.00 38.71  ? 34  ARG B NE  1 
ATOM 1672 C CZ  . ARG B 2 5   ? 58.067 -2.747   38.544 1.00 32.89  ? 34  ARG B CZ  1 
ATOM 1673 N NH1 . ARG B 2 5   ? 57.381 -3.243   39.565 1.00 27.50  ? 34  ARG B NH1 1 
ATOM 1674 N NH2 . ARG B 2 5   ? 59.164 -3.364   38.122 1.00 30.16  ? 34  ARG B NH2 1 
ATOM 1675 N N   . VAL B 2 6   ? 54.291 3.870    40.836 1.00 43.46  ? 35  VAL B N   1 
ATOM 1676 C CA  . VAL B 2 6   ? 53.866 5.205    40.425 1.00 42.78  ? 35  VAL B CA  1 
ATOM 1677 C C   . VAL B 2 6   ? 54.411 6.275    41.364 1.00 41.30  ? 35  VAL B C   1 
ATOM 1678 O O   . VAL B 2 6   ? 54.951 7.292    40.925 1.00 35.82  ? 35  VAL B O   1 
ATOM 1679 C CB  . VAL B 2 6   ? 52.329 5.266    40.333 1.00 40.06  ? 35  VAL B CB  1 
ATOM 1680 C CG1 . VAL B 2 6   ? 51.833 4.502    39.116 1.00 31.22  ? 35  VAL B CG1 1 
ATOM 1681 C CG2 . VAL B 2 6   ? 51.701 4.717    41.602 1.00 48.12  ? 35  VAL B CG2 1 
ATOM 1682 N N   . LYS B 2 7   ? 54.334 6.048    42.672 1.00 43.07  ? 36  LYS B N   1 
ATOM 1683 C CA  . LYS B 2 7   ? 55.004 6.945    43.598 1.00 47.86  ? 36  LYS B CA  1 
ATOM 1684 C C   . LYS B 2 7   ? 56.506 6.924    43.390 1.00 44.35  ? 36  LYS B C   1 
ATOM 1685 O O   . LYS B 2 7   ? 57.189 7.889    43.750 1.00 50.75  ? 36  LYS B O   1 
ATOM 1686 C CB  . LYS B 2 7   ? 54.663 6.567    45.040 1.00 50.70  ? 36  LYS B CB  1 
ATOM 1687 C CG  . LYS B 2 7   ? 53.378 7.172    45.574 1.00 63.04  ? 36  LYS B CG  1 
ATOM 1688 C CD  . LYS B 2 7   ? 53.519 8.682    45.749 1.00 73.48  ? 36  LYS B CD  1 
ATOM 1689 C CE  . LYS B 2 7   ? 52.244 9.410    45.365 1.00 61.73  ? 36  LYS B CE  1 
ATOM 1690 N NZ  . LYS B 2 7   ? 52.088 9.451    43.887 1.00 48.14  ? 36  LYS B NZ  1 
ATOM 1691 N N   . LEU B 2 8   ? 57.033 5.843    42.816 1.00 41.35  ? 37  LEU B N   1 
ATOM 1692 C CA  . LEU B 2 8   ? 58.441 5.833    42.449 1.00 43.46  ? 37  LEU B CA  1 
ATOM 1693 C C   . LEU B 2 8   ? 58.722 6.766    41.281 1.00 36.26  ? 37  LEU B C   1 
ATOM 1694 O O   . LEU B 2 8   ? 59.732 7.477    41.286 1.00 36.83  ? 37  LEU B O   1 
ATOM 1695 C CB  . LEU B 2 8   ? 58.890 4.414    42.102 1.00 46.92  ? 37  LEU B CB  1 
ATOM 1696 C CG  . LEU B 2 8   ? 59.062 3.431    43.255 1.00 43.26  ? 37  LEU B CG  1 
ATOM 1697 C CD1 . LEU B 2 8   ? 59.581 2.110    42.739 1.00 47.81  ? 37  LEU B CD1 1 
ATOM 1698 C CD2 . LEU B 2 8   ? 60.026 4.013    44.272 1.00 44.16  ? 37  LEU B CD2 1 
ATOM 1699 N N   . LEU B 2 9   ? 57.849 6.796    40.274 1.00 32.02  ? 38  LEU B N   1 
ATOM 1700 C CA  . LEU B 2 9   ? 58.194 7.644    39.142 1.00 35.15  ? 38  LEU B CA  1 
ATOM 1701 C C   . LEU B 2 9   ? 57.928 9.111    39.463 1.00 42.33  ? 38  LEU B C   1 
ATOM 1702 O O   . LEU B 2 9   ? 58.749 9.975    39.133 1.00 39.93  ? 38  LEU B O   1 
ATOM 1703 C CB  . LEU B 2 9   ? 57.492 7.195    37.860 1.00 32.02  ? 38  LEU B CB  1 
ATOM 1704 C CG  . LEU B 2 9   ? 56.158 7.692    37.315 1.00 36.61  ? 38  LEU B CG  1 
ATOM 1705 C CD1 . LEU B 2 9   ? 56.029 7.135    35.915 1.00 32.33  ? 38  LEU B CD1 1 
ATOM 1706 C CD2 . LEU B 2 9   ? 54.979 7.292    38.107 1.00 36.73  ? 38  LEU B CD2 1 
ATOM 1707 N N   . ASP B 2 10  ? 56.795 9.413    40.107 1.00 44.96  ? 39  ASP B N   1 
ATOM 1708 C CA  . ASP B 2 10  ? 56.577 10.780   40.573 1.00 37.51  ? 39  ASP B CA  1 
ATOM 1709 C C   . ASP B 2 10  ? 57.669 11.202   41.548 1.00 36.40  ? 39  ASP B C   1 
ATOM 1710 O O   . ASP B 2 10  ? 58.106 12.358   41.542 1.00 37.31  ? 39  ASP B O   1 
ATOM 1711 C CB  . ASP B 2 10  ? 55.202 10.916   41.232 1.00 35.67  ? 39  ASP B CB  1 
ATOM 1712 C CG  . ASP B 2 10  ? 54.066 10.886   40.230 1.00 40.60  ? 39  ASP B CG  1 
ATOM 1713 O OD1 . ASP B 2 10  ? 52.910 10.643   40.641 1.00 37.95  ? 39  ASP B OD1 1 
ATOM 1714 O OD2 . ASP B 2 10  ? 54.329 11.098   39.030 1.00 45.86  ? 39  ASP B OD2 1 
ATOM 1715 N N   . THR B 2 11  ? 58.139 10.269   42.379 1.00 40.35  ? 40  THR B N   1 
ATOM 1716 C CA  . THR B 2 11  ? 59.229 10.577   43.299 1.00 39.53  ? 40  THR B CA  1 
ATOM 1717 C C   . THR B 2 11  ? 60.510 10.921   42.547 1.00 39.96  ? 40  THR B C   1 
ATOM 1718 O O   . THR B 2 11  ? 61.190 11.899   42.877 1.00 48.97  ? 40  THR B O   1 
ATOM 1719 C CB  . THR B 2 11  ? 59.462 9.401    44.251 1.00 39.80  ? 40  THR B CB  1 
ATOM 1720 O OG1 . THR B 2 11  ? 58.391 9.339    45.201 1.00 45.22  ? 40  THR B OG1 1 
ATOM 1721 C CG2 . THR B 2 11  ? 60.787 9.551    44.991 1.00 32.54  ? 40  THR B CG2 1 
ATOM 1722 N N   . MET B 2 12  ? 60.854 10.139   41.520 1.00 33.70  ? 41  MET B N   1 
ATOM 1723 C CA  . MET B 2 12  ? 62.120 10.383   40.838 1.00 38.30  ? 41  MET B CA  1 
ATOM 1724 C C   . MET B 2 12  ? 62.062 11.616   39.944 1.00 41.62  ? 41  MET B C   1 
ATOM 1725 O O   . MET B 2 12  ? 63.080 12.298   39.778 1.00 40.42  ? 41  MET B O   1 
ATOM 1726 C CB  . MET B 2 12  ? 62.562 9.153    40.049 1.00 41.09  ? 41  MET B CB  1 
ATOM 1727 C CG  . MET B 2 12  ? 61.576 8.634    39.045 1.00 44.20  ? 41  MET B CG  1 
ATOM 1728 S SD  . MET B 2 12  ? 62.112 7.026    38.448 1.00 53.52  ? 41  MET B SD  1 
ATOM 1729 C CE  . MET B 2 12  ? 62.597 6.250    39.990 1.00 46.04  ? 41  MET B CE  1 
ATOM 1730 N N   . VAL B 2 13  ? 60.904 11.919   39.348 1.00 39.98  ? 42  VAL B N   1 
ATOM 1731 C CA  . VAL B 2 13  ? 60.825 13.170   38.597 1.00 36.80  ? 42  VAL B CA  1 
ATOM 1732 C C   . VAL B 2 13  ? 60.831 14.351   39.557 1.00 35.23  ? 42  VAL B C   1 
ATOM 1733 O O   . VAL B 2 13  ? 61.370 15.415   39.235 1.00 35.19  ? 42  VAL B O   1 
ATOM 1734 C CB  . VAL B 2 13  ? 59.598 13.208   37.666 1.00 34.77  ? 42  VAL B CB  1 
ATOM 1735 C CG1 . VAL B 2 13  ? 59.722 12.155   36.571 1.00 37.53  ? 42  VAL B CG1 1 
ATOM 1736 C CG2 . VAL B 2 13  ? 58.308 13.061   38.447 1.00 41.49  ? 42  VAL B CG2 1 
ATOM 1737 N N   . ASP B 2 14  ? 60.243 14.190   40.747 1.00 39.29  ? 43  ASP B N   1 
ATOM 1738 C CA  . ASP B 2 14  ? 60.367 15.225   41.771 1.00 38.98  ? 43  ASP B CA  1 
ATOM 1739 C C   . ASP B 2 14  ? 61.829 15.469   42.116 1.00 40.08  ? 43  ASP B C   1 
ATOM 1740 O O   . ASP B 2 14  ? 62.283 16.618   42.164 1.00 47.23  ? 43  ASP B O   1 
ATOM 1741 C CB  . ASP B 2 14  ? 59.573 14.844   43.022 1.00 39.49  ? 43  ASP B CB  1 
ATOM 1742 C CG  . ASP B 2 14  ? 58.087 15.103   42.870 1.00 46.09  ? 43  ASP B CG  1 
ATOM 1743 O OD1 . ASP B 2 14  ? 57.286 14.346   43.459 1.00 47.42  ? 43  ASP B OD1 1 
ATOM 1744 O OD2 . ASP B 2 14  ? 57.723 16.063   42.158 1.00 46.08  ? 43  ASP B OD2 1 
ATOM 1745 N N   . THR B 2 15  ? 62.586 14.395   42.361 1.00 38.44  ? 44  THR B N   1 
ATOM 1746 C CA  . THR B 2 15  ? 64.021 14.545   42.582 1.00 41.92  ? 44  THR B CA  1 
ATOM 1747 C C   . THR B 2 15  ? 64.684 15.238   41.400 1.00 40.47  ? 44  THR B C   1 
ATOM 1748 O O   . THR B 2 15  ? 65.568 16.084   41.582 1.00 41.73  ? 44  THR B O   1 
ATOM 1749 C CB  . THR B 2 15  ? 64.668 13.180   42.833 1.00 46.81  ? 44  THR B CB  1 
ATOM 1750 O OG1 . THR B 2 15  ? 63.896 12.446   43.793 1.00 53.93  ? 44  THR B OG1 1 
ATOM 1751 C CG2 . THR B 2 15  ? 66.093 13.347   43.350 1.00 42.72  ? 44  THR B CG2 1 
ATOM 1752 N N   . PHE B 2 16  ? 64.257 14.904   40.180 1.00 37.30  ? 45  PHE B N   1 
ATOM 1753 C CA  . PHE B 2 16  ? 64.828 15.522   38.988 1.00 34.55  ? 45  PHE B CA  1 
ATOM 1754 C C   . PHE B 2 16  ? 64.606 17.030   38.978 1.00 38.67  ? 45  PHE B C   1 
ATOM 1755 O O   . PHE B 2 16  ? 65.504 17.794   38.604 1.00 39.53  ? 45  PHE B O   1 
ATOM 1756 C CB  . PHE B 2 16  ? 64.241 14.870   37.739 1.00 32.39  ? 45  PHE B CB  1 
ATOM 1757 C CG  . PHE B 2 16  ? 64.662 15.520   36.456 1.00 33.17  ? 45  PHE B CG  1 
ATOM 1758 C CD1 . PHE B 2 16  ? 65.954 15.373   35.981 1.00 36.59  ? 45  PHE B CD1 1 
ATOM 1759 C CD2 . PHE B 2 16  ? 63.753 16.236   35.700 1.00 34.39  ? 45  PHE B CD2 1 
ATOM 1760 C CE1 . PHE B 2 16  ? 66.340 15.961   34.791 1.00 33.69  ? 45  PHE B CE1 1 
ATOM 1761 C CE2 . PHE B 2 16  ? 64.131 16.821   34.507 1.00 36.29  ? 45  PHE B CE2 1 
ATOM 1762 C CZ  . PHE B 2 16  ? 65.427 16.682   34.052 1.00 33.60  ? 45  PHE B CZ  1 
ATOM 1763 N N   . LEU B 2 17  ? 63.412 17.479   39.378 1.00 43.53  ? 46  LEU B N   1 
ATOM 1764 C CA  . LEU B 2 17  ? 63.148 18.914   39.439 1.00 35.22  ? 46  LEU B CA  1 
ATOM 1765 C C   . LEU B 2 17  ? 63.941 19.575   40.557 1.00 32.72  ? 46  LEU B C   1 
ATOM 1766 O O   . LEU B 2 17  ? 64.511 20.653   40.361 1.00 34.24  ? 46  LEU B O   1 
ATOM 1767 C CB  . LEU B 2 17  ? 61.657 19.172   39.621 1.00 31.93  ? 46  LEU B CB  1 
ATOM 1768 C CG  . LEU B 2 17  ? 60.807 18.691   38.450 1.00 31.29  ? 46  LEU B CG  1 
ATOM 1769 C CD1 . LEU B 2 17  ? 59.350 19.090   38.641 1.00 32.81  ? 46  LEU B CD1 1 
ATOM 1770 C CD2 . LEU B 2 17  ? 61.380 19.196   37.135 1.00 24.16  ? 46  LEU B CD2 1 
ATOM 1771 N N   . GLN B 2 18  ? 63.980 18.949   41.739 1.00 35.71  ? 47  GLN B N   1 
ATOM 1772 C CA  . GLN B 2 18  ? 64.801 19.468   42.828 1.00 40.75  ? 47  GLN B CA  1 
ATOM 1773 C C   . GLN B 2 18  ? 66.237 19.678   42.375 1.00 37.88  ? 47  GLN B C   1 
ATOM 1774 O O   . GLN B 2 18  ? 66.867 20.683   42.722 1.00 45.63  ? 47  GLN B O   1 
ATOM 1775 C CB  . GLN B 2 18  ? 64.767 18.517   44.025 1.00 46.88  ? 47  GLN B CB  1 
ATOM 1776 C CG  . GLN B 2 18  ? 63.406 18.342   44.676 1.00 59.86  ? 47  GLN B CG  1 
ATOM 1777 C CD  . GLN B 2 18  ? 63.378 17.171   45.646 1.00 77.77  ? 47  GLN B CD  1 
ATOM 1778 O OE1 . GLN B 2 18  ? 64.419 16.602   45.982 1.00 78.24  ? 47  GLN B OE1 1 
ATOM 1779 N NE2 . GLN B 2 18  ? 62.184 16.806   46.102 1.00 76.43  ? 47  GLN B NE2 1 
ATOM 1780 N N   . LYS B 2 19  ? 66.768 18.740   41.592 1.00 33.77  ? 48  LYS B N   1 
ATOM 1781 C CA  . LYS B 2 19  ? 68.138 18.871   41.113 1.00 35.56  ? 48  LYS B CA  1 
ATOM 1782 C C   . LYS B 2 19  ? 68.255 19.936   40.025 1.00 39.54  ? 48  LYS B C   1 
ATOM 1783 O O   . LYS B 2 19  ? 69.262 20.650   39.960 1.00 45.25  ? 48  LYS B O   1 
ATOM 1784 C CB  . LYS B 2 19  ? 68.641 17.522   40.599 1.00 41.05  ? 48  LYS B CB  1 
ATOM 1785 C CG  . LYS B 2 19  ? 68.669 16.373   41.606 1.00 44.74  ? 48  LYS B CG  1 
ATOM 1786 C CD  . LYS B 2 19  ? 69.747 16.558   42.669 1.00 41.77  ? 48  LYS B CD  1 
ATOM 1787 C CE  . LYS B 2 19  ? 69.579 15.564   43.812 1.00 25.17  ? 48  LYS B CE  1 
ATOM 1788 N NZ  . LYS B 2 19  ? 70.624 15.716   44.868 1.00 10.91  ? 48  LYS B NZ  1 
ATOM 1789 N N   . LEU B 2 20  ? 67.244 20.060   39.157 1.00 34.27  ? 49  LEU B N   1 
ATOM 1790 C CA  . LEU B 2 20  ? 67.290 21.117   38.148 1.00 33.24  ? 49  LEU B CA  1 
ATOM 1791 C C   . LEU B 2 20  ? 67.110 22.494   38.774 1.00 38.02  ? 49  LEU B C   1 
ATOM 1792 O O   . LEU B 2 20  ? 67.839 23.432   38.435 1.00 40.56  ? 49  LEU B O   1 
ATOM 1793 C CB  . LEU B 2 20  ? 66.235 20.885   37.067 1.00 32.77  ? 49  LEU B CB  1 
ATOM 1794 C CG  . LEU B 2 20  ? 66.771 20.484   35.689 1.00 37.52  ? 49  LEU B CG  1 
ATOM 1795 C CD1 . LEU B 2 20  ? 65.672 20.541   34.635 1.00 27.78  ? 49  LEU B CD1 1 
ATOM 1796 C CD2 . LEU B 2 20  ? 67.950 21.361   35.287 1.00 34.06  ? 49  LEU B CD2 1 
ATOM 1797 N N   . VAL B 2 21  ? 66.145 22.635   39.687 1.00 40.45  ? 50  VAL B N   1 
ATOM 1798 C CA  . VAL B 2 21  ? 65.956 23.900   40.391 1.00 31.97  ? 50  VAL B CA  1 
ATOM 1799 C C   . VAL B 2 21  ? 67.158 24.198   41.279 1.00 39.83  ? 50  VAL B C   1 
ATOM 1800 O O   . VAL B 2 21  ? 67.449 25.364   41.575 1.00 44.52  ? 50  VAL B O   1 
ATOM 1801 C CB  . VAL B 2 21  ? 64.639 23.863   41.188 1.00 30.40  ? 50  VAL B CB  1 
ATOM 1802 C CG1 . VAL B 2 21  ? 64.483 25.101   42.054 1.00 37.71  ? 50  VAL B CG1 1 
ATOM 1803 C CG2 . VAL B 2 21  ? 63.461 23.726   40.243 1.00 26.03  ? 50  VAL B CG2 1 
ATOM 1804 N N   . ALA B 2 22  ? 67.879 23.159   41.715 1.00 37.61  ? 51  ALA B N   1 
ATOM 1805 C CA  . ALA B 2 22  ? 69.143 23.376   42.410 1.00 40.27  ? 51  ALA B CA  1 
ATOM 1806 C C   . ALA B 2 22  ? 70.122 24.133   41.522 1.00 43.32  ? 51  ALA B C   1 
ATOM 1807 O O   . ALA B 2 22  ? 70.743 25.112   41.954 1.00 42.50  ? 51  ALA B O   1 
ATOM 1808 C CB  . ALA B 2 22  ? 69.737 22.039   42.857 1.00 37.04  ? 51  ALA B CB  1 
ATOM 1809 N N   . ALA B 2 23  ? 70.255 23.710   40.268 1.00 38.60  ? 52  ALA B N   1 
ATOM 1810 C CA  . ALA B 2 23  ? 70.928 24.554   39.298 1.00 46.25  ? 52  ALA B CA  1 
ATOM 1811 C C   . ALA B 2 23  ? 70.052 25.766   38.994 1.00 48.56  ? 52  ALA B C   1 
ATOM 1812 O O   . ALA B 2 23  ? 68.848 25.775   39.262 1.00 48.96  ? 52  ALA B O   1 
ATOM 1813 C CB  . ALA B 2 23  ? 71.232 23.769   38.022 1.00 42.89  ? 52  ALA B CB  1 
ATOM 1814 N N   . GLY B 2 24  ? 70.657 26.791   38.405 1.00 48.96  ? 53  GLY B N   1 
ATOM 1815 C CA  . GLY B 2 24  ? 69.924 28.043   38.253 1.00 50.93  ? 53  GLY B CA  1 
ATOM 1816 C C   . GLY B 2 24  ? 69.363 28.528   39.570 1.00 55.70  ? 53  GLY B C   1 
ATOM 1817 O O   . GLY B 2 24  ? 68.216 28.990   39.634 1.00 53.46  ? 53  GLY B O   1 
ATOM 1818 N N   . SER B 2 25  ? 70.155 28.414   40.637 1.00 59.32  ? 54  SER B N   1 
ATOM 1819 C CA  . SER B 2 25  ? 69.766 28.780   41.995 1.00 57.63  ? 54  SER B CA  1 
ATOM 1820 C C   . SER B 2 25  ? 69.496 30.268   42.166 1.00 52.32  ? 54  SER B C   1 
ATOM 1821 O O   . SER B 2 25  ? 69.949 30.870   43.146 1.00 56.48  ? 54  SER B O   1 
ATOM 1822 C CB  . SER B 2 25  ? 70.862 28.341   42.973 1.00 64.30  ? 54  SER B CB  1 
ATOM 1823 O OG  . SER B 2 25  ? 72.130 28.856   42.589 1.00 48.39  ? 54  SER B OG  1 
ATOM 1824 N N   . TYR B 2 26  ? 68.755 30.867   41.231 1.00 52.93  ? 55  TYR B N   1 
ATOM 1825 C CA  . TYR B 2 26  ? 68.471 32.300   41.217 1.00 51.00  ? 55  TYR B CA  1 
ATOM 1826 C C   . TYR B 2 26  ? 69.752 33.125   41.152 1.00 42.10  ? 55  TYR B C   1 
ATOM 1827 O O   . TYR B 2 26  ? 69.841 34.065   40.359 1.00 45.15  ? 55  TYR B O   1 
ATOM 1828 C CB  . TYR B 2 26  ? 67.647 32.706   42.442 1.00 54.24  ? 55  TYR B CB  1 
ATOM 1829 C CG  . TYR B 2 26  ? 67.228 34.158   42.441 1.00 52.87  ? 55  TYR B CG  1 
ATOM 1830 C CD1 . TYR B 2 26  ? 66.940 34.821   41.252 1.00 51.49  ? 55  TYR B CD1 1 
ATOM 1831 C CD2 . TYR B 2 26  ? 67.157 34.878   43.626 1.00 53.24  ? 55  TYR B CD2 1 
ATOM 1832 C CE1 . TYR B 2 26  ? 66.564 36.149   41.248 1.00 50.03  ? 55  TYR B CE1 1 
ATOM 1833 C CE2 . TYR B 2 26  ? 66.790 36.208   43.630 1.00 59.61  ? 55  TYR B CE2 1 
ATOM 1834 C CZ  . TYR B 2 26  ? 66.499 36.839   42.438 1.00 58.33  ? 55  TYR B CZ  1 
ATOM 1835 O OH  . TYR B 2 26  ? 66.134 38.165   42.442 1.00 64.62  ? 55  TYR B OH  1 
ATOM 1836 N N   . GLN B 2 27  ? 70.756 32.779   41.964 1.00 40.40  ? 56  GLN B N   1 
ATOM 1837 C CA  . GLN B 2 27  ? 72.061 33.411   41.825 1.00 34.40  ? 56  GLN B CA  1 
ATOM 1838 C C   . GLN B 2 27  ? 72.644 33.129   40.452 1.00 40.59  ? 56  GLN B C   1 
ATOM 1839 O O   . GLN B 2 27  ? 73.193 34.025   39.803 1.00 45.10  ? 56  GLN B O   1 
ATOM 1840 C CB  . GLN B 2 27  ? 73.019 32.917   42.906 1.00 35.86  ? 56  GLN B CB  1 
ATOM 1841 C CG  . GLN B 2 27  ? 74.466 33.287   42.612 1.00 46.48  ? 56  GLN B CG  1 
ATOM 1842 C CD  . GLN B 2 27  ? 75.468 32.414   43.333 1.00 52.54  ? 56  GLN B CD  1 
ATOM 1843 O OE1 . GLN B 2 27  ? 75.253 32.012   44.477 1.00 57.06  ? 56  GLN B OE1 1 
ATOM 1844 N NE2 . GLN B 2 27  ? 76.578 32.115   42.664 1.00 50.28  ? 56  GLN B NE2 1 
ATOM 1845 N N   . ARG B 2 28  ? 72.528 31.883   39.990 1.00 46.63  ? 57  ARG B N   1 
ATOM 1846 C CA  . ARG B 2 28  ? 72.999 31.543   38.655 1.00 51.36  ? 57  ARG B CA  1 
ATOM 1847 C C   . ARG B 2 28  ? 72.169 32.238   37.587 1.00 47.55  ? 57  ARG B C   1 
ATOM 1848 O O   . ARG B 2 28  ? 72.660 32.480   36.478 1.00 49.53  ? 57  ARG B O   1 
ATOM 1849 C CB  . ARG B 2 28  ? 72.962 30.027   38.465 1.00 50.80  ? 57  ARG B CB  1 
ATOM 1850 C CG  . ARG B 2 28  ? 74.004 29.478   37.511 1.00 47.88  ? 57  ARG B CG  1 
ATOM 1851 C CD  . ARG B 2 28  ? 75.330 29.323   38.228 1.00 48.43  ? 57  ARG B CD  1 
ATOM 1852 N NE  . ARG B 2 28  ? 75.163 28.638   39.506 1.00 48.86  ? 57  ARG B NE  1 
ATOM 1853 C CZ  . ARG B 2 28  ? 76.161 28.134   40.225 1.00 49.93  ? 57  ARG B CZ  1 
ATOM 1854 N NH1 . ARG B 2 28  ? 77.411 28.224   39.788 1.00 44.61  ? 57  ARG B NH1 1 
ATOM 1855 N NH2 . ARG B 2 28  ? 75.908 27.538   41.382 1.00 52.13  ? 57  ARG B NH2 1 
ATOM 1856 N N   . PHE B 2 29  ? 70.919 32.575   37.904 1.00 41.60  ? 58  PHE B N   1 
ATOM 1857 C CA  . PHE B 2 29  ? 70.079 33.281   36.947 1.00 39.95  ? 58  PHE B CA  1 
ATOM 1858 C C   . PHE B 2 29  ? 70.457 34.752   36.845 1.00 43.16  ? 58  PHE B C   1 
ATOM 1859 O O   . PHE B 2 29  ? 70.478 35.308   35.744 1.00 47.80  ? 58  PHE B O   1 
ATOM 1860 C CB  . PHE B 2 29  ? 68.608 33.134   37.336 1.00 40.08  ? 58  PHE B CB  1 
ATOM 1861 C CG  . PHE B 2 29  ? 67.652 33.748   36.352 1.00 38.91  ? 58  PHE B CG  1 
ATOM 1862 C CD1 . PHE B 2 29  ? 67.658 33.361   35.023 1.00 38.73  ? 58  PHE B CD1 1 
ATOM 1863 C CD2 . PHE B 2 29  ? 66.729 34.694   36.761 1.00 39.98  ? 58  PHE B CD2 1 
ATOM 1864 C CE1 . PHE B 2 29  ? 66.774 33.918   34.118 1.00 37.50  ? 58  PHE B CE1 1 
ATOM 1865 C CE2 . PHE B 2 29  ? 65.839 35.250   35.861 1.00 44.12  ? 58  PHE B CE2 1 
ATOM 1866 C CZ  . PHE B 2 29  ? 65.862 34.861   34.537 1.00 40.10  ? 58  PHE B CZ  1 
ATOM 1867 N N   . THR B 2 30  ? 70.777 35.392   37.971 1.00 46.05  ? 59  THR B N   1 
ATOM 1868 C CA  . THR B 2 30  ? 71.081 36.819   37.948 1.00 39.20  ? 59  THR B CA  1 
ATOM 1869 C C   . THR B 2 30  ? 72.527 37.089   37.551 1.00 44.97  ? 59  THR B C   1 
ATOM 1870 O O   . THR B 2 30  ? 72.792 38.014   36.777 1.00 49.87  ? 59  THR B O   1 
ATOM 1871 C CB  . THR B 2 30  ? 70.786 37.458   39.308 1.00 27.58  ? 59  THR B CB  1 
ATOM 1872 O OG1 . THR B 2 30  ? 71.611 36.864   40.315 1.00 32.06  ? 59  THR B OG1 1 
ATOM 1873 C CG2 . THR B 2 30  ? 69.333 37.276   39.676 1.00 27.33  ? 59  THR B CG2 1 
ATOM 1874 N N   . ASP B 2 31  ? 73.476 36.308   38.075 1.00 42.49  ? 60  ASP B N   1 
ATOM 1875 C CA  . ASP B 2 31  ? 74.883 36.659   37.914 1.00 51.84  ? 60  ASP B CA  1 
ATOM 1876 C C   . ASP B 2 31  ? 75.322 36.646   36.453 1.00 52.25  ? 60  ASP B C   1 
ATOM 1877 O O   . ASP B 2 31  ? 76.299 37.319   36.107 1.00 60.57  ? 60  ASP B O   1 
ATOM 1878 C CB  . ASP B 2 31  ? 75.763 35.724   38.752 1.00 55.73  ? 60  ASP B CB  1 
ATOM 1879 C CG  . ASP B 2 31  ? 75.838 34.322   38.188 1.00 59.31  ? 60  ASP B CG  1 
ATOM 1880 O OD1 . ASP B 2 31  ? 76.893 33.673   38.363 1.00 58.49  ? 60  ASP B OD1 1 
ATOM 1881 O OD2 . ASP B 2 31  ? 74.850 33.868   37.576 1.00 60.65  ? 60  ASP B OD2 1 
ATOM 1882 N N   . CYS B 2 32  ? 74.628 35.910   35.588 1.00 47.07  ? 61  CYS B N   1 
ATOM 1883 C CA  . CYS B 2 32  ? 74.825 36.085   34.156 1.00 52.29  ? 61  CYS B CA  1 
ATOM 1884 C C   . CYS B 2 32  ? 73.889 37.134   33.577 1.00 48.49  ? 61  CYS B C   1 
ATOM 1885 O O   . CYS B 2 32  ? 74.205 37.725   32.538 1.00 49.10  ? 61  CYS B O   1 
ATOM 1886 C CB  . CYS B 2 32  ? 74.661 34.750   33.409 1.00 55.96  ? 61  CYS B CB  1 
ATOM 1887 S SG  . CYS B 2 32  ? 73.061 33.913   33.548 1.00 40.36  ? 61  CYS B SG  1 
ATOM 1888 N N   . TYR B 2 33  ? 72.758 37.388   34.241 1.00 42.93  ? 62  TYR B N   1 
ATOM 1889 C CA  . TYR B 2 33  ? 71.761 38.359   33.807 1.00 47.76  ? 62  TYR B CA  1 
ATOM 1890 C C   . TYR B 2 33  ? 71.956 39.729   34.453 1.00 54.45  ? 62  TYR B C   1 
ATOM 1891 O O   . TYR B 2 33  ? 70.976 40.469   34.617 1.00 47.94  ? 62  TYR B O   1 
ATOM 1892 C CB  . TYR B 2 33  ? 70.363 37.837   34.131 1.00 41.84  ? 62  TYR B CB  1 
ATOM 1893 C CG  . TYR B 2 33  ? 69.624 37.238   32.963 1.00 51.03  ? 62  TYR B CG  1 
ATOM 1894 C CD1 . TYR B 2 33  ? 69.613 35.863   32.761 1.00 59.98  ? 62  TYR B CD1 1 
ATOM 1895 C CD2 . TYR B 2 33  ? 68.931 38.036   32.068 1.00 52.69  ? 62  TYR B CD2 1 
ATOM 1896 C CE1 . TYR B 2 33  ? 68.937 35.300   31.697 1.00 56.14  ? 62  TYR B CE1 1 
ATOM 1897 C CE2 . TYR B 2 33  ? 68.257 37.483   31.003 1.00 53.98  ? 62  TYR B CE2 1 
ATOM 1898 C CZ  . TYR B 2 33  ? 68.258 36.115   30.821 1.00 57.29  ? 62  TYR B CZ  1 
ATOM 1899 O OH  . TYR B 2 33  ? 67.581 35.561   29.759 1.00 57.79  ? 62  TYR B OH  1 
ATOM 1900 N N   . LYS B 2 34  ? 73.187 40.071   34.856 1.00 57.24  ? 63  LYS B N   1 
ATOM 1901 C CA  . LYS B 2 34  ? 73.423 41.312   35.593 1.00 51.74  ? 63  LYS B CA  1 
ATOM 1902 C C   . LYS B 2 34  ? 72.861 42.518   34.852 1.00 54.27  ? 63  LYS B C   1 
ATOM 1903 O O   . LYS B 2 34  ? 72.149 43.344   35.435 1.00 49.87  ? 63  LYS B O   1 
ATOM 1904 C CB  . LYS B 2 34  ? 74.919 41.486   35.870 1.00 55.22  ? 63  LYS B CB  1 
ATOM 1905 C CG  . LYS B 2 34  ? 75.540 40.349   36.676 1.00 56.04  ? 63  LYS B CG  1 
ATOM 1906 C CD  . LYS B 2 34  ? 74.987 40.326   38.102 1.00 56.83  ? 63  LYS B CD  1 
ATOM 1907 C CE  . LYS B 2 34  ? 76.061 39.996   39.134 1.00 52.99  ? 63  LYS B CE  1 
ATOM 1908 N NZ  . LYS B 2 34  ? 75.477 39.654   40.465 1.00 43.39  ? 63  LYS B NZ  1 
ATOM 1909 N N   . CYS B 2 35  ? 73.147 42.622   33.558 1.00 52.59  ? 64  CYS B N   1 
ATOM 1910 C CA  . CYS B 2 35  ? 72.434 43.582   32.731 1.00 46.20  ? 64  CYS B CA  1 
ATOM 1911 C C   . CYS B 2 35  ? 70.950 43.256   32.781 1.00 49.40  ? 64  CYS B C   1 
ATOM 1912 O O   . CYS B 2 35  ? 70.550 42.140   32.434 1.00 52.96  ? 64  CYS B O   1 
ATOM 1913 C CB  . CYS B 2 35  ? 72.957 43.539   31.298 1.00 48.03  ? 64  CYS B CB  1 
ATOM 1914 S SG  . CYS B 2 35  ? 73.058 41.879   30.602 1.00 67.61  ? 64  CYS B SG  1 
ATOM 1915 N N   . PHE B 2 36  ? 70.158 44.231   33.241 1.00 43.59  ? 65  PHE B N   1 
ATOM 1916 C CA  . PHE B 2 36  ? 68.732 44.142   33.565 1.00 46.20  ? 65  PHE B CA  1 
ATOM 1917 C C   . PHE B 2 36  ? 68.528 43.746   35.023 1.00 49.66  ? 65  PHE B C   1 
ATOM 1918 O O   . PHE B 2 36  ? 67.465 44.014   35.590 1.00 55.65  ? 65  PHE B O   1 
ATOM 1919 C CB  . PHE B 2 36  ? 67.970 43.169   32.652 1.00 48.79  ? 65  PHE B CB  1 
ATOM 1920 C CG  . PHE B 2 36  ? 66.526 42.974   33.036 1.00 41.99  ? 65  PHE B CG  1 
ATOM 1921 C CD1 . PHE B 2 36  ? 65.558 43.872   32.620 1.00 44.52  ? 65  PHE B CD1 1 
ATOM 1922 C CD2 . PHE B 2 36  ? 66.138 41.898   33.818 1.00 43.26  ? 65  PHE B CD2 1 
ATOM 1923 C CE1 . PHE B 2 36  ? 64.232 43.697   32.973 1.00 46.70  ? 65  PHE B CE1 1 
ATOM 1924 C CE2 . PHE B 2 36  ? 64.814 41.724   34.177 1.00 43.06  ? 65  PHE B CE2 1 
ATOM 1925 C CZ  . PHE B 2 36  ? 63.861 42.622   33.753 1.00 40.67  ? 65  PHE B CZ  1 
ATOM 1926 N N   . TYR B 2 37  ? 69.526 43.132   35.657 1.00 50.88  ? 66  TYR B N   1 
ATOM 1927 C CA  . TYR B 2 37  ? 69.350 42.813   37.070 1.00 49.78  ? 66  TYR B CA  1 
ATOM 1928 C C   . TYR B 2 37  ? 69.544 44.045   37.946 1.00 55.21  ? 66  TYR B C   1 
ATOM 1929 O O   . TYR B 2 37  ? 68.875 44.176   38.978 1.00 56.31  ? 66  TYR B O   1 
ATOM 1930 C CB  . TYR B 2 37  ? 70.284 41.677   37.498 1.00 42.90  ? 66  TYR B CB  1 
ATOM 1931 C CG  . TYR B 2 37  ? 70.262 41.412   38.990 1.00 38.93  ? 66  TYR B CG  1 
ATOM 1932 C CD1 . TYR B 2 37  ? 69.064 41.195   39.661 1.00 34.93  ? 66  TYR B CD1 1 
ATOM 1933 C CD2 . TYR B 2 37  ? 71.442 41.359   39.724 1.00 37.37  ? 66  TYR B CD2 1 
ATOM 1934 C CE1 . TYR B 2 37  ? 69.042 40.963   41.025 1.00 30.24  ? 66  TYR B CE1 1 
ATOM 1935 C CE2 . TYR B 2 37  ? 71.430 41.120   41.086 1.00 26.90  ? 66  TYR B CE2 1 
ATOM 1936 C CZ  . TYR B 2 37  ? 70.228 40.925   41.730 1.00 27.58  ? 66  TYR B CZ  1 
ATOM 1937 O OH  . TYR B 2 37  ? 70.216 40.690   43.085 1.00 29.43  ? 66  TYR B OH  1 
ATOM 1938 N N   . GLN B 2 38  ? 70.425 44.965   37.545 1.00 56.96  ? 67  GLN B N   1 
ATOM 1939 C CA  . GLN B 2 38  ? 70.593 46.205   38.296 1.00 63.57  ? 67  GLN B CA  1 
ATOM 1940 C C   . GLN B 2 38  ? 69.328 47.053   38.280 1.00 58.32  ? 67  GLN B C   1 
ATOM 1941 O O   . GLN B 2 38  ? 69.151 47.904   39.158 1.00 59.32  ? 67  GLN B O   1 
ATOM 1942 C CB  . GLN B 2 38  ? 71.764 47.023   37.747 1.00 73.04  ? 67  GLN B CB  1 
ATOM 1943 C CG  . GLN B 2 38  ? 73.120 46.352   37.888 1.00 76.47  ? 67  GLN B CG  1 
ATOM 1944 C CD  . GLN B 2 38  ? 73.588 45.715   36.596 1.00 67.18  ? 67  GLN B CD  1 
ATOM 1945 O OE1 . GLN B 2 38  ? 73.031 45.969   35.526 1.00 66.32  ? 67  GLN B OE1 1 
ATOM 1946 N NE2 . GLN B 2 38  ? 74.616 44.880   36.688 1.00 57.68  ? 67  GLN B NE2 1 
ATOM 1947 N N   . LEU B 2 39  ? 68.461 46.856   37.291 1.00 55.43  ? 68  LEU B N   1 
ATOM 1948 C CA  . LEU B 2 39  ? 67.204 47.582   37.180 1.00 54.05  ? 68  LEU B CA  1 
ATOM 1949 C C   . LEU B 2 39  ? 66.056 46.673   37.607 1.00 61.79  ? 68  LEU B C   1 
ATOM 1950 O O   . LEU B 2 39  ? 65.895 45.576   37.063 1.00 55.65  ? 68  LEU B O   1 
ATOM 1951 C CB  . LEU B 2 39  ? 66.975 48.061   35.743 1.00 41.90  ? 68  LEU B CB  1 
ATOM 1952 C CG  . LEU B 2 39  ? 68.012 48.876   34.958 1.00 39.14  ? 68  LEU B CG  1 
ATOM 1953 C CD1 . LEU B 2 39  ? 69.275 48.097   34.614 1.00 38.22  ? 68  LEU B CD1 1 
ATOM 1954 C CD2 . LEU B 2 39  ? 67.372 49.392   33.680 1.00 41.23  ? 68  LEU B CD2 1 
ATOM 1955 N N   . GLN B 2 40  ? 65.259 47.135   38.573 1.00 70.87  ? 69  GLN B N   1 
ATOM 1956 C CA  . GLN B 2 40  ? 64.113 46.388   39.087 1.00 62.76  ? 69  GLN B CA  1 
ATOM 1957 C C   . GLN B 2 40  ? 64.474 44.962   39.494 1.00 58.22  ? 69  GLN B C   1 
ATOM 1958 O O   . GLN B 2 40  ? 64.086 44.010   38.806 1.00 59.68  ? 69  GLN B O   1 
ATOM 1959 C CB  . GLN B 2 40  ? 62.995 46.360   38.047 1.00 57.69  ? 69  GLN B CB  1 
ATOM 1960 C CG  . GLN B 2 40  ? 62.482 47.731   37.680 1.00 71.21  ? 69  GLN B CG  1 
ATOM 1961 C CD  . GLN B 2 40  ? 63.022 48.191   36.346 1.00 77.70  ? 69  GLN B CD  1 
ATOM 1962 O OE1 . GLN B 2 40  ? 63.297 47.375   35.465 1.00 54.33  ? 69  GLN B OE1 1 
ATOM 1963 N NE2 . GLN B 2 40  ? 63.186 49.504   36.190 1.00 85.89  ? 69  GLN B NE2 1 
ATOM 1964 N N   . PRO B 2 41  ? 65.218 44.762   40.586 1.00 53.69  ? 70  PRO B N   1 
ATOM 1965 C CA  . PRO B 2 41  ? 65.460 43.392   41.061 1.00 57.07  ? 70  PRO B CA  1 
ATOM 1966 C C   . PRO B 2 41  ? 64.212 42.707   41.596 1.00 60.82  ? 70  PRO B C   1 
ATOM 1967 O O   . PRO B 2 41  ? 64.276 41.525   41.951 1.00 58.76  ? 70  PRO B O   1 
ATOM 1968 C CB  . PRO B 2 41  ? 66.506 43.584   42.173 1.00 56.51  ? 70  PRO B CB  1 
ATOM 1969 C CG  . PRO B 2 41  ? 67.024 44.980   42.002 1.00 47.78  ? 70  PRO B CG  1 
ATOM 1970 C CD  . PRO B 2 41  ? 65.890 45.758   41.433 1.00 57.56  ? 70  PRO B CD  1 
ATOM 1971 N N   . ALA B 2 42  ? 63.080 43.411   41.654 1.00 63.01  ? 71  ALA B N   1 
ATOM 1972 C CA  . ALA B 2 42  ? 61.808 42.761   41.935 1.00 55.78  ? 71  ALA B CA  1 
ATOM 1973 C C   . ALA B 2 42  ? 61.263 42.085   40.684 1.00 55.24  ? 71  ALA B C   1 
ATOM 1974 O O   . ALA B 2 42  ? 60.688 40.995   40.763 1.00 63.85  ? 71  ALA B O   1 
ATOM 1975 C CB  . ALA B 2 42  ? 60.803 43.773   42.486 1.00 55.55  ? 71  ALA B CB  1 
ATOM 1976 N N   . MET B 2 43  ? 61.424 42.727   39.523 1.00 50.60  ? 72  MET B N   1 
ATOM 1977 C CA  . MET B 2 43  ? 60.981 42.118   38.274 1.00 56.35  ? 72  MET B CA  1 
ATOM 1978 C C   . MET B 2 43  ? 61.823 40.896   37.922 1.00 63.15  ? 72  MET B C   1 
ATOM 1979 O O   . MET B 2 43  ? 61.295 39.898   37.416 1.00 66.66  ? 72  MET B O   1 
ATOM 1980 C CB  . MET B 2 43  ? 61.036 43.150   37.144 1.00 55.38  ? 72  MET B CB  1 
ATOM 1981 C CG  . MET B 2 43  ? 60.123 42.861   35.954 1.00 61.25  ? 72  MET B CG  1 
ATOM 1982 S SD  . MET B 2 43  ? 58.542 43.732   36.021 1.00 75.84  ? 72  MET B SD  1 
ATOM 1983 C CE  . MET B 2 43  ? 57.538 42.735   34.923 1.00 69.16  ? 72  MET B CE  1 
ATOM 1984 N N   . THR B 2 44  ? 63.134 40.952   38.179 1.00 55.90  ? 73  THR B N   1 
ATOM 1985 C CA  . THR B 2 44  ? 63.995 39.804   37.902 1.00 52.88  ? 73  THR B CA  1 
ATOM 1986 C C   . THR B 2 44  ? 63.571 38.583   38.711 1.00 55.48  ? 73  THR B C   1 
ATOM 1987 O O   . THR B 2 44  ? 63.466 37.472   38.177 1.00 59.78  ? 73  THR B O   1 
ATOM 1988 C CB  . THR B 2 44  ? 65.456 40.157   38.187 1.00 50.07  ? 73  THR B CB  1 
ATOM 1989 O OG1 . THR B 2 44  ? 65.666 40.232   39.603 1.00 55.58  ? 73  THR B OG1 1 
ATOM 1990 C CG2 . THR B 2 44  ? 65.821 41.487   37.548 1.00 49.24  ? 73  THR B CG2 1 
ATOM 1991 N N   . GLN B 2 45  ? 63.320 38.770   40.009 1.00 56.97  ? 74  GLN B N   1 
ATOM 1992 C CA  . GLN B 2 45  ? 62.911 37.646   40.843 1.00 59.00  ? 74  GLN B CA  1 
ATOM 1993 C C   . GLN B 2 45  ? 61.496 37.189   40.516 1.00 60.03  ? 74  GLN B C   1 
ATOM 1994 O O   . GLN B 2 45  ? 61.194 35.996   40.623 1.00 64.25  ? 74  GLN B O   1 
ATOM 1995 C CB  . GLN B 2 45  ? 63.018 38.020   42.322 1.00 63.11  ? 74  GLN B CB  1 
ATOM 1996 C CG  . GLN B 2 45  ? 63.223 36.833   43.253 1.00 57.14  ? 74  GLN B CG  1 
ATOM 1997 C CD  . GLN B 2 45  ? 61.934 36.118   43.605 1.00 69.46  ? 74  GLN B CD  1 
ATOM 1998 O OE1 . GLN B 2 45  ? 60.837 36.604   43.324 1.00 72.15  ? 74  GLN B OE1 1 
ATOM 1999 N NE2 . GLN B 2 45  ? 62.061 34.943   44.214 1.00 75.11  ? 74  GLN B NE2 1 
ATOM 2000 N N   . GLN B 2 46  ? 60.619 38.113   40.126 1.00 57.36  ? 75  GLN B N   1 
ATOM 2001 C CA  . GLN B 2 46  ? 59.260 37.730   39.759 1.00 60.40  ? 75  GLN B CA  1 
ATOM 2002 C C   . GLN B 2 46  ? 59.261 36.874   38.498 1.00 56.98  ? 75  GLN B C   1 
ATOM 2003 O O   . GLN B 2 46  ? 58.587 35.837   38.434 1.00 61.76  ? 75  GLN B O   1 
ATOM 2004 C CB  . GLN B 2 46  ? 58.393 38.979   39.586 1.00 68.65  ? 75  GLN B CB  1 
ATOM 2005 C CG  . GLN B 2 46  ? 57.029 38.735   38.956 1.00 75.30  ? 75  GLN B CG  1 
ATOM 2006 C CD  . GLN B 2 46  ? 56.178 39.994   38.911 1.00 83.99  ? 75  GLN B CD  1 
ATOM 2007 O OE1 . GLN B 2 46  ? 56.645 41.088   39.237 1.00 81.68  ? 75  GLN B OE1 1 
ATOM 2008 N NE2 . GLN B 2 46  ? 54.917 39.842   38.520 1.00 86.22  ? 75  GLN B NE2 1 
ATOM 2009 N N   . ILE B 2 47  ? 60.022 37.290   37.482 1.00 52.80  ? 76  ILE B N   1 
ATOM 2010 C CA  . ILE B 2 47  ? 60.066 36.520   36.244 1.00 57.59  ? 76  ILE B CA  1 
ATOM 2011 C C   . ILE B 2 47  ? 60.823 35.212   36.444 1.00 54.04  ? 76  ILE B C   1 
ATOM 2012 O O   . ILE B 2 47  ? 60.511 34.205   35.797 1.00 52.58  ? 76  ILE B O   1 
ATOM 2013 C CB  . ILE B 2 47  ? 60.672 37.362   35.107 1.00 55.16  ? 76  ILE B CB  1 
ATOM 2014 C CG1 . ILE B 2 47  ? 60.487 36.651   33.772 1.00 58.98  ? 76  ILE B CG1 1 
ATOM 2015 C CG2 . ILE B 2 47  ? 62.153 37.620   35.339 1.00 47.98  ? 76  ILE B CG2 1 
ATOM 2016 C CD1 . ILE B 2 47  ? 61.259 37.287   32.671 1.00 64.52  ? 76  ILE B CD1 1 
ATOM 2017 N N   . TYR B 2 48  ? 61.821 35.193   37.334 1.00 53.72  ? 77  TYR B N   1 
ATOM 2018 C CA  . TYR B 2 48  ? 62.493 33.937   37.655 1.00 49.16  ? 77  TYR B CA  1 
ATOM 2019 C C   . TYR B 2 48  ? 61.543 32.970   38.350 1.00 44.50  ? 77  TYR B C   1 
ATOM 2020 O O   . TYR B 2 48  ? 61.539 31.772   38.051 1.00 44.90  ? 77  TYR B O   1 
ATOM 2021 C CB  . TYR B 2 48  ? 63.716 34.205   38.529 1.00 50.26  ? 77  TYR B CB  1 
ATOM 2022 C CG  . TYR B 2 48  ? 64.318 32.968   39.159 1.00 48.19  ? 77  TYR B CG  1 
ATOM 2023 C CD1 . TYR B 2 48  ? 63.964 32.574   40.445 1.00 48.14  ? 77  TYR B CD1 1 
ATOM 2024 C CD2 . TYR B 2 48  ? 65.244 32.196   38.470 1.00 46.66  ? 77  TYR B CD2 1 
ATOM 2025 C CE1 . TYR B 2 48  ? 64.516 31.448   41.025 1.00 46.38  ? 77  TYR B CE1 1 
ATOM 2026 C CE2 . TYR B 2 48  ? 65.801 31.069   39.042 1.00 47.74  ? 77  TYR B CE2 1 
ATOM 2027 C CZ  . TYR B 2 48  ? 65.434 30.699   40.319 1.00 46.30  ? 77  TYR B CZ  1 
ATOM 2028 O OH  . TYR B 2 48  ? 65.987 29.576   40.891 1.00 46.61  ? 77  TYR B OH  1 
ATOM 2029 N N   . ASP B 2 49  ? 60.734 33.477   39.281 1.00 48.12  ? 78  ASP B N   1 
ATOM 2030 C CA  . ASP B 2 49  ? 59.763 32.633   39.968 1.00 45.93  ? 78  ASP B CA  1 
ATOM 2031 C C   . ASP B 2 49  ? 58.728 32.086   38.996 1.00 46.66  ? 78  ASP B C   1 
ATOM 2032 O O   . ASP B 2 49  ? 58.388 30.897   39.045 1.00 51.63  ? 78  ASP B O   1 
ATOM 2033 C CB  . ASP B 2 49  ? 59.089 33.420   41.090 1.00 53.49  ? 78  ASP B CB  1 
ATOM 2034 C CG  . ASP B 2 49  ? 59.982 33.578   42.303 1.00 59.10  ? 78  ASP B CG  1 
ATOM 2035 O OD1 . ASP B 2 49  ? 59.451 33.766   43.419 1.00 52.30  ? 78  ASP B OD1 1 
ATOM 2036 O OD2 . ASP B 2 49  ? 61.218 33.503   42.139 1.00 59.23  ? 78  ASP B OD2 1 
ATOM 2037 N N   . LYS B 2 50  ? 58.211 32.939   38.107 1.00 46.83  ? 79  LYS B N   1 
ATOM 2038 C CA  . LYS B 2 50  ? 57.287 32.453   37.087 1.00 48.30  ? 79  LYS B CA  1 
ATOM 2039 C C   . LYS B 2 50  ? 57.956 31.407   36.203 1.00 48.38  ? 79  LYS B C   1 
ATOM 2040 O O   . LYS B 2 50  ? 57.330 30.408   35.825 1.00 50.64  ? 79  LYS B O   1 
ATOM 2041 C CB  . LYS B 2 50  ? 56.766 33.622   36.249 1.00 51.05  ? 79  LYS B CB  1 
ATOM 2042 C CG  . LYS B 2 50  ? 55.648 33.255   35.282 1.00 55.58  ? 79  LYS B CG  1 
ATOM 2043 C CD  . LYS B 2 50  ? 56.170 33.030   33.871 1.00 60.30  ? 79  LYS B CD  1 
ATOM 2044 C CE  . LYS B 2 50  ? 55.117 32.371   32.997 1.00 52.87  ? 79  LYS B CE  1 
ATOM 2045 N NZ  . LYS B 2 50  ? 53.822 33.100   33.056 1.00 54.11  ? 79  LYS B NZ  1 
ATOM 2046 N N   . PHE B 2 51  ? 59.233 31.615   35.877 1.00 46.89  ? 80  PHE B N   1 
ATOM 2047 C CA  . PHE B 2 51  ? 59.971 30.653   35.065 1.00 42.78  ? 80  PHE B CA  1 
ATOM 2048 C C   . PHE B 2 51  ? 60.041 29.296   35.752 1.00 40.35  ? 80  PHE B C   1 
ATOM 2049 O O   . PHE B 2 51  ? 59.711 28.264   35.155 1.00 43.82  ? 80  PHE B O   1 
ATOM 2050 C CB  . PHE B 2 51  ? 61.373 31.191   34.773 1.00 43.20  ? 80  PHE B CB  1 
ATOM 2051 C CG  . PHE B 2 51  ? 62.430 30.128   34.659 1.00 45.02  ? 80  PHE B CG  1 
ATOM 2052 C CD1 . PHE B 2 51  ? 62.556 29.375   33.503 1.00 46.44  ? 80  PHE B CD1 1 
ATOM 2053 C CD2 . PHE B 2 51  ? 63.318 29.902   35.699 1.00 44.72  ? 80  PHE B CD2 1 
ATOM 2054 C CE1 . PHE B 2 51  ? 63.533 28.401   33.395 1.00 44.00  ? 80  PHE B CE1 1 
ATOM 2055 C CE2 . PHE B 2 51  ? 64.298 28.932   35.596 1.00 42.19  ? 80  PHE B CE2 1 
ATOM 2056 C CZ  . PHE B 2 51  ? 64.407 28.182   34.441 1.00 43.97  ? 80  PHE B CZ  1 
ATOM 2057 N N   . ILE B 2 52  ? 60.463 29.282   37.018 1.00 42.07  ? 81  ILE B N   1 
ATOM 2058 C CA  . ILE B 2 52  ? 60.670 28.020   37.720 1.00 39.44  ? 81  ILE B CA  1 
ATOM 2059 C C   . ILE B 2 52  ? 59.332 27.319   37.946 1.00 37.53  ? 81  ILE B C   1 
ATOM 2060 O O   . ILE B 2 52  ? 59.216 26.095   37.782 1.00 36.46  ? 81  ILE B O   1 
ATOM 2061 C CB  . ILE B 2 52  ? 61.440 28.275   39.036 1.00 31.95  ? 81  ILE B CB  1 
ATOM 2062 C CG1 . ILE B 2 52  ? 62.274 27.064   39.426 1.00 31.09  ? 81  ILE B CG1 1 
ATOM 2063 C CG2 . ILE B 2 52  ? 60.519 28.653   40.191 1.00 33.83  ? 81  ILE B CG2 1 
ATOM 2064 C CD1 . ILE B 2 52  ? 63.624 27.046   38.757 1.00 41.37  ? 81  ILE B CD1 1 
ATOM 2065 N N   . ALA B 2 53  ? 58.287 28.093   38.253 1.00 36.74  ? 82  ALA B N   1 
ATOM 2066 C CA  . ALA B 2 53  ? 56.979 27.510   38.516 1.00 36.85  ? 82  ALA B CA  1 
ATOM 2067 C C   . ALA B 2 53  ? 56.385 26.909   37.252 1.00 36.63  ? 82  ALA B C   1 
ATOM 2068 O O   . ALA B 2 53  ? 55.968 25.745   37.246 1.00 40.68  ? 82  ALA B O   1 
ATOM 2069 C CB  . ALA B 2 53  ? 56.044 28.566   39.105 1.00 35.91  ? 82  ALA B CB  1 
ATOM 2070 N N   . GLN B 2 54  ? 56.344 27.684   36.163 1.00 36.52  ? 83  GLN B N   1 
ATOM 2071 C CA  . GLN B 2 54  ? 55.755 27.165   34.933 1.00 39.38  ? 83  GLN B CA  1 
ATOM 2072 C C   . GLN B 2 54  ? 56.597 26.049   34.333 1.00 42.78  ? 83  GLN B C   1 
ATOM 2073 O O   . GLN B 2 54  ? 56.058 25.177   33.639 1.00 52.95  ? 83  GLN B O   1 
ATOM 2074 C CB  . GLN B 2 54  ? 55.553 28.287   33.915 1.00 46.53  ? 83  GLN B CB  1 
ATOM 2075 C CG  . GLN B 2 54  ? 54.410 28.011   32.940 1.00 53.31  ? 83  GLN B CG  1 
ATOM 2076 C CD  . GLN B 2 54  ? 54.319 29.031   31.814 1.00 76.37  ? 83  GLN B CD  1 
ATOM 2077 O OE1 . GLN B 2 54  ? 55.327 29.590   31.378 1.00 81.13  ? 83  GLN B OE1 1 
ATOM 2078 N NE2 . GLN B 2 54  ? 53.101 29.275   31.336 1.00 70.34  ? 83  GLN B NE2 1 
ATOM 2079 N N   . LEU B 2 55  ? 57.906 26.045   34.590 1.00 36.77  ? 84  LEU B N   1 
ATOM 2080 C CA  . LEU B 2 55  ? 58.726 24.920   34.150 1.00 40.94  ? 84  LEU B CA  1 
ATOM 2081 C C   . LEU B 2 55  ? 58.343 23.642   34.890 1.00 38.52  ? 84  LEU B C   1 
ATOM 2082 O O   . LEU B 2 55  ? 58.004 22.627   34.266 1.00 35.62  ? 84  LEU B O   1 
ATOM 2083 C CB  . LEU B 2 55  ? 60.209 25.226   34.349 1.00 36.40  ? 84  LEU B CB  1 
ATOM 2084 C CG  . LEU B 2 55  ? 61.105 23.990   34.221 1.00 28.78  ? 84  LEU B CG  1 
ATOM 2085 C CD1 . LEU B 2 55  ? 61.155 23.508   32.775 1.00 27.71  ? 84  LEU B CD1 1 
ATOM 2086 C CD2 . LEU B 2 55  ? 62.499 24.260   34.754 1.00 24.58  ? 84  LEU B CD2 1 
ATOM 2087 N N   . GLN B 2 56  ? 58.373 23.675   36.226 1.00 36.11  ? 85  GLN B N   1 
ATOM 2088 C CA  . GLN B 2 56  ? 58.137 22.440   36.969 1.00 35.62  ? 85  GLN B CA  1 
ATOM 2089 C C   . GLN B 2 56  ? 56.696 21.960   36.818 1.00 33.63  ? 85  GLN B C   1 
ATOM 2090 O O   . GLN B 2 56  ? 56.447 20.752   36.745 1.00 38.04  ? 85  GLN B O   1 
ATOM 2091 C CB  . GLN B 2 56  ? 58.499 22.623   38.443 1.00 38.45  ? 85  GLN B CB  1 
ATOM 2092 C CG  . GLN B 2 56  ? 57.696 23.677   39.181 1.00 43.34  ? 85  GLN B CG  1 
ATOM 2093 C CD  . GLN B 2 56  ? 58.127 23.813   40.626 1.00 47.00  ? 85  GLN B CD  1 
ATOM 2094 O OE1 . GLN B 2 56  ? 58.030 22.864   41.404 1.00 58.29  ? 85  GLN B OE1 1 
ATOM 2095 N NE2 . GLN B 2 56  ? 58.606 24.996   40.995 1.00 43.51  ? 85  GLN B NE2 1 
ATOM 2096 N N   . THR B 2 57  ? 55.732 22.879   36.755 1.00 34.73  ? 86  THR B N   1 
ATOM 2097 C CA  . THR B 2 57  ? 54.351 22.442   36.577 1.00 36.87  ? 86  THR B CA  1 
ATOM 2098 C C   . THR B 2 57  ? 54.065 22.025   35.141 1.00 42.80  ? 86  THR B C   1 
ATOM 2099 O O   . THR B 2 57  ? 53.193 21.179   34.911 1.00 45.97  ? 86  THR B O   1 
ATOM 2100 C CB  . THR B 2 57  ? 53.372 23.536   37.005 1.00 39.46  ? 86  THR B CB  1 
ATOM 2101 O OG1 . THR B 2 57  ? 53.544 24.691   36.176 1.00 45.34  ? 86  THR B OG1 1 
ATOM 2102 C CG2 . THR B 2 57  ? 53.593 23.908   38.467 1.00 41.98  ? 86  THR B CG2 1 
ATOM 2103 N N   . SER B 2 58  ? 54.777 22.597   34.167 1.00 38.20  ? 87  SER B N   1 
ATOM 2104 C CA  . SER B 2 58  ? 54.642 22.114   32.797 1.00 40.00  ? 87  SER B CA  1 
ATOM 2105 C C   . SER B 2 58  ? 55.188 20.698   32.668 1.00 42.36  ? 87  SER B C   1 
ATOM 2106 O O   . SER B 2 58  ? 54.597 19.851   31.984 1.00 45.45  ? 87  SER B O   1 
ATOM 2107 C CB  . SER B 2 58  ? 55.364 23.057   31.835 1.00 42.65  ? 87  SER B CB  1 
ATOM 2108 O OG  . SER B 2 58  ? 54.997 22.801   30.490 1.00 52.19  ? 87  SER B OG  1 
ATOM 2109 N N   . ILE B 2 59  ? 56.299 20.419   33.348 1.00 40.94  ? 88  ILE B N   1 
ATOM 2110 C CA  . ILE B 2 59  ? 56.933 19.112   33.235 1.00 40.10  ? 88  ILE B CA  1 
ATOM 2111 C C   . ILE B 2 59  ? 56.127 18.060   34.007 1.00 37.65  ? 88  ILE B C   1 
ATOM 2112 O O   . ILE B 2 59  ? 55.960 16.917   33.548 1.00 33.71  ? 88  ILE B O   1 
ATOM 2113 C CB  . ILE B 2 59  ? 58.398 19.233   33.704 1.00 31.45  ? 88  ILE B CB  1 
ATOM 2114 C CG1 . ILE B 2 59  ? 59.302 18.240   32.998 1.00 33.97  ? 88  ILE B CG1 1 
ATOM 2115 C CG2 . ILE B 2 59  ? 58.532 18.991   35.185 1.00 30.52  ? 88  ILE B CG2 1 
ATOM 2116 C CD1 . ILE B 2 59  ? 60.749 18.692   32.980 1.00 31.71  ? 88  ILE B CD1 1 
ATOM 2117 N N   . ARG B 2 60  ? 55.570 18.444   35.164 1.00 35.70  ? 89  ARG B N   1 
ATOM 2118 C CA  . ARG B 2 60  ? 54.712 17.536   35.918 1.00 31.35  ? 89  ARG B CA  1 
ATOM 2119 C C   . ARG B 2 60  ? 53.401 17.280   35.190 1.00 37.34  ? 89  ARG B C   1 
ATOM 2120 O O   . ARG B 2 60  ? 52.898 16.151   35.184 1.00 41.40  ? 89  ARG B O   1 
ATOM 2121 C CB  . ARG B 2 60  ? 54.439 18.102   37.311 1.00 34.80  ? 89  ARG B CB  1 
ATOM 2122 C CG  . ARG B 2 60  ? 55.637 18.087   38.240 1.00 41.70  ? 89  ARG B CG  1 
ATOM 2123 C CD  . ARG B 2 60  ? 55.291 18.682   39.594 1.00 44.01  ? 89  ARG B CD  1 
ATOM 2124 N NE  . ARG B 2 60  ? 56.464 18.783   40.457 1.00 50.87  ? 89  ARG B NE  1 
ATOM 2125 C CZ  . ARG B 2 60  ? 56.409 18.929   41.776 1.00 59.86  ? 89  ARG B CZ  1 
ATOM 2126 N NH1 . ARG B 2 60  ? 55.235 18.990   42.389 1.00 58.15  ? 89  ARG B NH1 1 
ATOM 2127 N NH2 . ARG B 2 60  ? 57.528 19.011   42.482 1.00 68.76  ? 89  ARG B NH2 1 
ATOM 2128 N N   . GLU B 2 61  ? 52.825 18.317   34.579 1.00 41.21  ? 90  GLU B N   1 
ATOM 2129 C CA  . GLU B 2 61  ? 51.648 18.101   33.745 1.00 45.44  ? 90  GLU B CA  1 
ATOM 2130 C C   . GLU B 2 61  ? 51.973 17.227   32.545 1.00 40.39  ? 90  GLU B C   1 
ATOM 2131 O O   . GLU B 2 61  ? 51.090 16.537   32.025 1.00 44.26  ? 90  GLU B O   1 
ATOM 2132 C CB  . GLU B 2 61  ? 51.058 19.435   33.293 1.00 50.51  ? 90  GLU B CB  1 
ATOM 2133 C CG  . GLU B 2 61  ? 50.123 20.060   34.315 1.00 55.95  ? 90  GLU B CG  1 
ATOM 2134 C CD  . GLU B 2 61  ? 49.660 21.446   33.917 1.00 80.13  ? 90  GLU B CD  1 
ATOM 2135 O OE1 . GLU B 2 61  ? 49.921 21.861   32.767 1.00 73.20  ? 90  GLU B OE1 1 
ATOM 2136 O OE2 . GLU B 2 61  ? 49.039 22.126   34.762 1.00 104.91 ? 90  GLU B OE2 1 
ATOM 2137 N N   . GLU B 2 62  ? 53.230 17.234   32.093 1.00 40.05  ? 91  GLU B N   1 
ATOM 2138 C CA  . GLU B 2 62  ? 53.611 16.348   30.998 1.00 43.23  ? 91  GLU B CA  1 
ATOM 2139 C C   . GLU B 2 62  ? 53.636 14.888   31.443 1.00 43.31  ? 91  GLU B C   1 
ATOM 2140 O O   . GLU B 2 62  ? 53.023 14.027   30.798 1.00 44.58  ? 91  GLU B O   1 
ATOM 2141 C CB  . GLU B 2 62  ? 54.968 16.765   30.430 1.00 46.37  ? 91  GLU B CB  1 
ATOM 2142 C CG  . GLU B 2 62  ? 55.486 15.884   29.292 1.00 43.62  ? 91  GLU B CG  1 
ATOM 2143 C CD  . GLU B 2 62  ? 54.613 15.924   28.044 1.00 46.83  ? 91  GLU B CD  1 
ATOM 2144 O OE1 . GLU B 2 62  ? 53.945 16.953   27.801 1.00 54.40  ? 91  GLU B OE1 1 
ATOM 2145 O OE2 . GLU B 2 62  ? 54.624 14.929   27.287 1.00 40.57  ? 91  GLU B OE2 1 
ATOM 2146 N N   . ILE B 2 63  ? 54.326 14.585   32.551 1.00 42.53  ? 92  ILE B N   1 
ATOM 2147 C CA  . ILE B 2 63  ? 54.370 13.190   32.999 1.00 36.28  ? 92  ILE B CA  1 
ATOM 2148 C C   . ILE B 2 63  ? 52.983 12.705   33.406 1.00 36.38  ? 92  ILE B C   1 
ATOM 2149 O O   . ILE B 2 63  ? 52.625 11.543   33.176 1.00 39.83  ? 92  ILE B O   1 
ATOM 2150 C CB  . ILE B 2 63  ? 55.394 13.000   34.135 1.00 35.63  ? 92  ILE B CB  1 
ATOM 2151 C CG1 . ILE B 2 63  ? 55.115 13.945   35.309 1.00 44.34  ? 92  ILE B CG1 1 
ATOM 2152 C CG2 . ILE B 2 63  ? 56.815 13.156   33.610 1.00 30.57  ? 92  ILE B CG2 1 
ATOM 2153 C CD1 . ILE B 2 63  ? 54.328 13.318   36.455 1.00 41.06  ? 92  ILE B CD1 1 
ATOM 2154 N N   . SER B 2 64  ? 52.173 13.583   33.999 1.00 37.62  ? 93  SER B N   1 
ATOM 2155 C CA  . SER B 2 64  ? 50.794 13.207   34.279 1.00 40.48  ? 93  SER B CA  1 
ATOM 2156 C C   . SER B 2 64  ? 49.976 13.054   33.006 1.00 39.88  ? 93  SER B C   1 
ATOM 2157 O O   . SER B 2 64  ? 48.972 12.336   33.015 1.00 41.77  ? 93  SER B O   1 
ATOM 2158 C CB  . SER B 2 64  ? 50.150 14.229   35.212 1.00 46.99  ? 93  SER B CB  1 
ATOM 2159 O OG  . SER B 2 64  ? 50.728 14.150   36.505 1.00 54.07  ? 93  SER B OG  1 
ATOM 2160 N N   . ASP B 2 65  ? 50.382 13.708   31.914 1.00 43.33  ? 94  ASP B N   1 
ATOM 2161 C CA  . ASP B 2 65  ? 49.706 13.497   30.637 1.00 46.13  ? 94  ASP B CA  1 
ATOM 2162 C C   . ASP B 2 65  ? 50.063 12.138   30.049 1.00 44.46  ? 94  ASP B C   1 
ATOM 2163 O O   . ASP B 2 65  ? 49.213 11.477   29.441 1.00 44.19  ? 94  ASP B O   1 
ATOM 2164 C CB  . ASP B 2 65  ? 50.043 14.621   29.655 1.00 49.73  ? 94  ASP B CB  1 
ATOM 2165 C CG  . ASP B 2 65  ? 49.116 15.817   29.796 1.00 61.82  ? 94  ASP B CG  1 
ATOM 2166 O OD1 . ASP B 2 65  ? 49.091 16.664   28.876 1.00 74.17  ? 94  ASP B OD1 1 
ATOM 2167 O OD2 . ASP B 2 65  ? 48.398 15.901   30.817 1.00 66.41  ? 94  ASP B OD2 1 
ATOM 2168 N N   . ILE B 2 66  ? 51.318 11.704   30.213 1.00 41.50  ? 95  ILE B N   1 
ATOM 2169 C CA  . ILE B 2 66  ? 51.712 10.388   29.715 1.00 39.36  ? 95  ILE B CA  1 
ATOM 2170 C C   . ILE B 2 66  ? 51.316 9.271    30.668 1.00 44.58  ? 95  ILE B C   1 
ATOM 2171 O O   . ILE B 2 66  ? 51.398 8.092    30.299 1.00 42.82  ? 95  ILE B O   1 
ATOM 2172 C CB  . ILE B 2 66  ? 53.230 10.347   29.450 1.00 36.80  ? 95  ILE B CB  1 
ATOM 2173 C CG1 . ILE B 2 66  ? 53.702 11.677   28.863 1.00 36.40  ? 95  ILE B CG1 1 
ATOM 2174 C CG2 . ILE B 2 66  ? 53.579 9.233    28.480 1.00 41.26  ? 95  ILE B CG2 1 
ATOM 2175 C CD1 . ILE B 2 66  ? 55.188 11.731   28.584 1.00 36.39  ? 95  ILE B CD1 1 
ATOM 2176 N N   . LYS B 2 67  ? 50.851 9.606    31.876 1.00 46.41  ? 96  LYS B N   1 
ATOM 2177 C CA  . LYS B 2 67  ? 50.232 8.593    32.728 1.00 41.62  ? 96  LYS B CA  1 
ATOM 2178 C C   . LYS B 2 67  ? 48.844 8.224    32.220 1.00 43.77  ? 96  LYS B C   1 
ATOM 2179 O O   . LYS B 2 67  ? 48.390 7.092    32.423 1.00 52.48  ? 96  LYS B O   1 
ATOM 2180 C CB  . LYS B 2 67  ? 50.169 9.088    34.175 1.00 43.14  ? 96  LYS B CB  1 
ATOM 2181 C CG  . LYS B 2 67  ? 51.452 8.850    34.966 1.00 42.17  ? 96  LYS B CG  1 
ATOM 2182 C CD  . LYS B 2 67  ? 51.578 9.796    36.160 1.00 53.94  ? 96  LYS B CD  1 
ATOM 2183 C CE  . LYS B 2 67  ? 50.629 9.438    37.291 1.00 52.77  ? 96  LYS B CE  1 
ATOM 2184 N NZ  . LYS B 2 67  ? 50.783 10.367   38.450 1.00 55.71  ? 96  LYS B NZ  1 
ATOM 2185 N N   . GLU B 2 68  ? 48.164 9.158    31.559 1.00 44.19  ? 97  GLU B N   1 
ATOM 2186 C CA  . GLU B 2 68  ? 46.858 8.925    30.961 1.00 44.77  ? 97  GLU B CA  1 
ATOM 2187 C C   . GLU B 2 68  ? 46.968 8.555    29.488 1.00 46.12  ? 97  GLU B C   1 
ATOM 2188 O O   . GLU B 2 68  ? 45.943 8.429    28.812 1.00 42.26  ? 97  GLU B O   1 
ATOM 2189 C CB  . GLU B 2 68  ? 45.978 10.168   31.103 1.00 53.72  ? 97  GLU B CB  1 
ATOM 2190 C CG  . GLU B 2 68  ? 45.458 10.449   32.504 1.00 58.87  ? 97  GLU B CG  1 
ATOM 2191 C CD  . GLU B 2 68  ? 45.041 11.907   32.675 1.00 70.02  ? 97  GLU B CD  1 
ATOM 2192 O OE1 . GLU B 2 68  ? 45.144 12.677   31.695 1.00 68.03  ? 97  GLU B OE1 1 
ATOM 2193 O OE2 . GLU B 2 68  ? 44.641 12.294   33.792 1.00 64.20  ? 97  GLU B OE2 1 
ATOM 2194 N N   . GLU B 2 69  ? 48.190 8.388    28.978 1.00 53.78  ? 98  GLU B N   1 
ATOM 2195 C CA  . GLU B 2 69  ? 48.381 8.100    27.559 1.00 60.12  ? 98  GLU B CA  1 
ATOM 2196 C C   . GLU B 2 69  ? 47.852 6.718    27.203 1.00 62.78  ? 98  GLU B C   1 
ATOM 2197 O O   . GLU B 2 69  ? 46.988 6.575    26.330 1.00 72.62  ? 98  GLU B O   1 
ATOM 2198 C CB  . GLU B 2 69  ? 49.868 8.217    27.203 1.00 62.05  ? 98  GLU B CB  1 
ATOM 2199 C CG  . GLU B 2 69  ? 50.258 7.575    25.872 1.00 72.88  ? 98  GLU B CG  1 
ATOM 2200 C CD  . GLU B 2 69  ? 51.144 6.343    26.038 1.00 70.94  ? 98  GLU B CD  1 
ATOM 2201 O OE1 . GLU B 2 69  ? 52.167 6.425    26.754 1.00 66.06  ? 98  GLU B OE1 1 
ATOM 2202 O OE2 . GLU B 2 69  ? 50.819 5.291    25.448 1.00 65.16  ? 98  GLU B OE2 1 
ATOM 2203 N N   . GLY B 2 70  ? 48.356 5.689    27.874 1.00 52.81  ? 99  GLY B N   1 
ATOM 2204 C CA  . GLY B 2 70  ? 47.960 4.329    27.589 1.00 54.25  ? 99  GLY B CA  1 
ATOM 2205 C C   . GLY B 2 70  ? 47.594 3.600    28.860 1.00 47.39  ? 99  GLY B C   1 
ATOM 2206 O O   . GLY B 2 70  ? 47.896 2.412    29.009 1.00 49.50  ? 99  GLY B O   1 
ATOM 2207 N N   . ASN B 2 71  ? 46.982 4.322    29.801 1.00 43.30  ? 100 ASN B N   1 
ATOM 2208 C CA  . ASN B 2 71  ? 46.664 3.787    31.122 1.00 44.69  ? 100 ASN B CA  1 
ATOM 2209 C C   . ASN B 2 71  ? 47.939 3.278    31.790 1.00 40.75  ? 100 ASN B C   1 
ATOM 2210 O O   . ASN B 2 71  ? 47.984 2.181    32.347 1.00 44.61  ? 100 ASN B O   1 
ATOM 2211 C CB  . ASN B 2 71  ? 45.604 2.683    31.042 1.00 45.64  ? 100 ASN B CB  1 
ATOM 2212 C CG  . ASN B 2 71  ? 44.229 3.213    30.679 1.00 55.59  ? 100 ASN B CG  1 
ATOM 2213 O OD1 . ASN B 2 71  ? 43.868 4.335    31.034 1.00 68.25  ? 100 ASN B OD1 1 
ATOM 2214 N ND2 . ASN B 2 71  ? 43.454 2.403    29.966 1.00 53.99  ? 100 ASN B ND2 1 
ATOM 2215 N N   . LEU B 2 72  ? 48.987 4.103    31.735 1.00 37.72  ? 101 LEU B N   1 
ATOM 2216 C CA  . LEU B 2 72  ? 50.265 3.700    32.307 1.00 34.05  ? 101 LEU B CA  1 
ATOM 2217 C C   . LEU B 2 72  ? 50.188 3.541    33.817 1.00 35.95  ? 101 LEU B C   1 
ATOM 2218 O O   . LEU B 2 72  ? 50.928 2.735    34.388 1.00 34.35  ? 101 LEU B O   1 
ATOM 2219 C CB  . LEU B 2 72  ? 51.351 4.698    31.924 1.00 33.86  ? 101 LEU B CB  1 
ATOM 2220 C CG  . LEU B 2 72  ? 52.222 4.186    30.779 1.00 34.43  ? 101 LEU B CG  1 
ATOM 2221 C CD1 . LEU B 2 72  ? 51.459 4.241    29.460 1.00 43.04  ? 101 LEU B CD1 1 
ATOM 2222 C CD2 . LEU B 2 72  ? 53.519 4.970    30.697 1.00 33.27  ? 101 LEU B CD2 1 
ATOM 2223 N N   . GLU B 2 73  ? 49.314 4.293    34.484 1.00 37.84  ? 102 GLU B N   1 
ATOM 2224 C CA  . GLU B 2 73  ? 49.053 4.009    35.889 1.00 42.06  ? 102 GLU B CA  1 
ATOM 2225 C C   . GLU B 2 73  ? 48.501 2.600    36.053 1.00 37.53  ? 102 GLU B C   1 
ATOM 2226 O O   . GLU B 2 73  ? 48.932 1.850    36.939 1.00 39.99  ? 102 GLU B O   1 
ATOM 2227 C CB  . GLU B 2 73  ? 48.083 5.042    36.467 1.00 56.95  ? 102 GLU B CB  1 
ATOM 2228 C CG  . GLU B 2 73  ? 48.659 6.451    36.590 1.00 59.06  ? 102 GLU B CG  1 
ATOM 2229 C CD  . GLU B 2 73  ? 47.747 7.398    37.356 1.00 61.12  ? 102 GLU B CD  1 
ATOM 2230 O OE1 . GLU B 2 73  ? 48.107 7.792    38.485 1.00 61.72  ? 102 GLU B OE1 1 
ATOM 2231 O OE2 . GLU B 2 73  ? 46.673 7.752    36.824 1.00 61.08  ? 102 GLU B OE2 1 
ATOM 2232 N N   . ALA B 2 74  ? 47.574 2.210    35.176 1.00 39.04  ? 103 ALA B N   1 
ATOM 2233 C CA  . ALA B 2 74  ? 46.948 0.899    35.288 1.00 41.20  ? 103 ALA B CA  1 
ATOM 2234 C C   . ALA B 2 74  ? 47.915 -0.220   34.923 1.00 35.77  ? 103 ALA B C   1 
ATOM 2235 O O   . ALA B 2 74  ? 47.921 -1.270   35.572 1.00 35.05  ? 103 ALA B O   1 
ATOM 2236 C CB  . ALA B 2 74  ? 45.703 0.838    34.403 1.00 46.42  ? 103 ALA B CB  1 
ATOM 2237 N N   . VAL B 2 75  ? 48.750 -0.017   33.902 1.00 33.27  ? 104 VAL B N   1 
ATOM 2238 C CA  . VAL B 2 75  ? 49.636 -1.098   33.487 1.00 28.88  ? 104 VAL B CA  1 
ATOM 2239 C C   . VAL B 2 75  ? 50.851 -1.191   34.401 1.00 28.01  ? 104 VAL B C   1 
ATOM 2240 O O   . VAL B 2 75  ? 51.382 -2.283   34.614 1.00 37.64  ? 104 VAL B O   1 
ATOM 2241 C CB  . VAL B 2 75  ? 50.050 -0.950   32.012 1.00 23.69  ? 104 VAL B CB  1 
ATOM 2242 C CG1 . VAL B 2 75  ? 48.818 -0.837   31.126 1.00 27.01  ? 104 VAL B CG1 1 
ATOM 2243 C CG2 . VAL B 2 75  ? 50.982 0.231    31.816 1.00 32.32  ? 104 VAL B CG2 1 
ATOM 2244 N N   . LEU B 2 76  ? 51.309 -0.077   34.966 1.00 28.82  ? 105 LEU B N   1 
ATOM 2245 C CA  . LEU B 2 76  ? 52.379 -0.176   35.949 1.00 27.39  ? 105 LEU B CA  1 
ATOM 2246 C C   . LEU B 2 76  ? 51.861 -0.746   37.256 1.00 32.42  ? 105 LEU B C   1 
ATOM 2247 O O   . LEU B 2 76  ? 52.608 -1.418   37.973 1.00 37.51  ? 105 LEU B O   1 
ATOM 2248 C CB  . LEU B 2 76  ? 53.032 1.185    36.175 1.00 37.68  ? 105 LEU B CB  1 
ATOM 2249 C CG  . LEU B 2 76  ? 53.818 1.733    34.985 1.00 38.78  ? 105 LEU B CG  1 
ATOM 2250 C CD1 . LEU B 2 76  ? 54.286 3.154    35.246 1.00 39.02  ? 105 LEU B CD1 1 
ATOM 2251 C CD2 . LEU B 2 76  ? 54.999 0.824    34.708 1.00 36.88  ? 105 LEU B CD2 1 
ATOM 2252 N N   . ASN B 2 77  ? 50.594 -0.490   37.583 1.00 34.01  ? 106 ASN B N   1 
ATOM 2253 C CA  . ASN B 2 77  ? 49.994 -1.149   38.737 1.00 37.38  ? 106 ASN B CA  1 
ATOM 2254 C C   . ASN B 2 77  ? 49.833 -2.645   38.492 1.00 39.23  ? 106 ASN B C   1 
ATOM 2255 O O   . ASN B 2 77  ? 50.096 -3.461   39.386 1.00 38.03  ? 106 ASN B O   1 
ATOM 2256 C CB  . ASN B 2 77  ? 48.652 -0.497   39.068 1.00 41.44  ? 106 ASN B CB  1 
ATOM 2257 C CG  . ASN B 2 77  ? 48.815 0.815    39.819 1.00 42.66  ? 106 ASN B CG  1 
ATOM 2258 O OD1 . ASN B 2 77  ? 49.935 1.267    40.066 1.00 37.50  ? 106 ASN B OD1 1 
ATOM 2259 N ND2 . ASN B 2 77  ? 47.697 1.437    40.178 1.00 39.20  ? 106 ASN B ND2 1 
ATOM 2260 N N   . ALA B 2 78  ? 49.412 -3.024   37.281 1.00 42.92  ? 107 ALA B N   1 
ATOM 2261 C CA  . ALA B 2 78  ? 49.331 -4.439   36.930 1.00 36.25  ? 107 ALA B CA  1 
ATOM 2262 C C   . ALA B 2 78  ? 50.703 -5.090   36.993 1.00 32.10  ? 107 ALA B C   1 
ATOM 2263 O O   . ALA B 2 78  ? 50.829 -6.249   37.403 1.00 40.38  ? 107 ALA B O   1 
ATOM 2264 C CB  . ALA B 2 78  ? 48.719 -4.607   35.539 1.00 26.64  ? 107 ALA B CB  1 
ATOM 2265 N N   . LEU B 2 79  ? 51.744 -4.357   36.594 1.00 29.65  ? 108 LEU B N   1 
ATOM 2266 C CA  . LEU B 2 79  ? 53.104 -4.864   36.736 1.00 29.63  ? 108 LEU B CA  1 
ATOM 2267 C C   . LEU B 2 79  ? 53.485 -4.997   38.204 1.00 34.97  ? 108 LEU B C   1 
ATOM 2268 O O   . LEU B 2 79  ? 54.208 -5.924   38.577 1.00 38.81  ? 108 LEU B O   1 
ATOM 2269 C CB  . LEU B 2 79  ? 54.089 -3.952   36.007 1.00 30.62  ? 108 LEU B CB  1 
ATOM 2270 C CG  . LEU B 2 79  ? 55.574 -4.294   36.136 1.00 28.05  ? 108 LEU B CG  1 
ATOM 2271 C CD1 . LEU B 2 79  ? 55.836 -5.721   35.702 1.00 27.28  ? 108 LEU B CD1 1 
ATOM 2272 C CD2 . LEU B 2 79  ? 56.423 -3.329   35.327 1.00 32.87  ? 108 LEU B CD2 1 
ATOM 2273 N N   . ASP B 2 80  ? 53.023 -4.074   39.050 1.00 31.46  ? 109 ASP B N   1 
ATOM 2274 C CA  . ASP B 2 80  ? 53.222 -4.230   40.487 1.00 36.72  ? 109 ASP B CA  1 
ATOM 2275 C C   . ASP B 2 80  ? 52.609 -5.532   40.986 1.00 35.79  ? 109 ASP B C   1 
ATOM 2276 O O   . ASP B 2 80  ? 53.243 -6.280   41.741 1.00 36.48  ? 109 ASP B O   1 
ATOM 2277 C CB  . ASP B 2 80  ? 52.628 -3.037   41.235 1.00 49.75  ? 109 ASP B CB  1 
ATOM 2278 C CG  . ASP B 2 80  ? 53.397 -1.757   40.996 1.00 49.18  ? 109 ASP B CG  1 
ATOM 2279 O OD1 . ASP B 2 80  ? 52.759 -0.750   40.626 1.00 48.62  ? 109 ASP B OD1 1 
ATOM 2280 O OD2 . ASP B 2 80  ? 54.634 -1.761   41.183 1.00 46.04  ? 109 ASP B OD2 1 
ATOM 2281 N N   . LYS B 2 81  ? 51.367 -5.813   40.581 1.00 36.37  ? 110 LYS B N   1 
ATOM 2282 C CA  . LYS B 2 81  ? 50.723 -7.068   40.961 1.00 40.31  ? 110 LYS B CA  1 
ATOM 2283 C C   . LYS B 2 81  ? 51.522 -8.268   40.465 1.00 39.49  ? 110 LYS B C   1 
ATOM 2284 O O   . LYS B 2 81  ? 51.814 -9.195   41.230 1.00 40.54  ? 110 LYS B O   1 
ATOM 2285 C CB  . LYS B 2 81  ? 49.292 -7.114   40.418 1.00 42.69  ? 110 LYS B CB  1 
ATOM 2286 C CG  . LYS B 2 81  ? 48.530 -8.385   40.790 1.00 48.07  ? 110 LYS B CG  1 
ATOM 2287 C CD  . LYS B 2 81  ? 47.209 -8.511   40.036 1.00 47.11  ? 110 LYS B CD  1 
ATOM 2288 C CE  . LYS B 2 81  ? 46.105 -7.704   40.706 1.00 44.15  ? 110 LYS B CE  1 
ATOM 2289 N NZ  . LYS B 2 81  ? 44.742 -8.204   40.363 1.00 39.51  ? 110 LYS B NZ  1 
ATOM 2290 N N   . ILE B 2 82  ? 51.891 -8.262   39.182 1.00 33.44  ? 111 ILE B N   1 
ATOM 2291 C CA  . ILE B 2 82  ? 52.646 -9.372   38.611 1.00 33.56  ? 111 ILE B CA  1 
ATOM 2292 C C   . ILE B 2 82  ? 53.976 -9.551   39.329 1.00 34.43  ? 111 ILE B C   1 
ATOM 2293 O O   . ILE B 2 82  ? 54.468 -10.676  39.469 1.00 36.98  ? 111 ILE B O   1 
ATOM 2294 C CB  . ILE B 2 82  ? 52.826 -9.157   37.094 1.00 27.87  ? 111 ILE B CB  1 
ATOM 2295 C CG1 . ILE B 2 82  ? 51.476 -9.279   36.387 1.00 28.66  ? 111 ILE B CG1 1 
ATOM 2296 C CG2 . ILE B 2 82  ? 53.815 -10.142  36.502 1.00 28.26  ? 111 ILE B CG2 1 
ATOM 2297 C CD1 . ILE B 2 82  ? 51.517 -8.903   34.929 1.00 33.62  ? 111 ILE B CD1 1 
ATOM 2298 N N   . VAL B 2 83  ? 54.567 -8.463   39.820 1.00 31.83  ? 112 VAL B N   1 
ATOM 2299 C CA  . VAL B 2 83  ? 55.820 -8.587   40.554 1.00 35.65  ? 112 VAL B CA  1 
ATOM 2300 C C   . VAL B 2 83  ? 55.571 -9.165   41.941 1.00 41.95  ? 112 VAL B C   1 
ATOM 2301 O O   . VAL B 2 83  ? 56.366 -9.968   42.440 1.00 45.91  ? 112 VAL B O   1 
ATOM 2302 C CB  . VAL B 2 83  ? 56.551 -7.233   40.613 1.00 34.46  ? 112 VAL B CB  1 
ATOM 2303 C CG1 . VAL B 2 83  ? 57.713 -7.298   41.589 1.00 40.88  ? 112 VAL B CG1 1 
ATOM 2304 C CG2 . VAL B 2 83  ? 57.072 -6.870   39.233 1.00 33.15  ? 112 VAL B CG2 1 
ATOM 2305 N N   . GLU B 2 84  ? 54.462 -8.786   42.580 1.00 41.82  ? 113 GLU B N   1 
ATOM 2306 C CA  . GLU B 2 84  ? 54.170 -9.325   43.906 1.00 42.21  ? 113 GLU B CA  1 
ATOM 2307 C C   . GLU B 2 84  ? 53.850 -10.813  43.841 1.00 55.57  ? 113 GLU B C   1 
ATOM 2308 O O   . GLU B 2 84  ? 54.391 -11.609  44.617 1.00 64.04  ? 113 GLU B O   1 
ATOM 2309 C CB  . GLU B 2 84  ? 53.020 -8.555   44.552 1.00 45.58  ? 113 GLU B CB  1 
ATOM 2310 C CG  . GLU B 2 84  ? 53.471 -7.310   45.291 1.00 73.84  ? 113 GLU B CG  1 
ATOM 2311 C CD  . GLU B 2 84  ? 54.518 -7.614   46.349 1.00 73.16  ? 113 GLU B CD  1 
ATOM 2312 O OE1 . GLU B 2 84  ? 55.723 -7.451   46.059 1.00 67.72  ? 113 GLU B OE1 1 
ATOM 2313 O OE2 . GLU B 2 84  ? 54.136 -8.023   47.468 1.00 72.65  ? 113 GLU B OE2 1 
ATOM 2314 N N   . GLU B 2 85  ? 52.975 -11.209  42.915 1.00 51.86  ? 114 GLU B N   1 
ATOM 2315 C CA  . GLU B 2 85  ? 52.618 -12.617  42.790 1.00 48.11  ? 114 GLU B CA  1 
ATOM 2316 C C   . GLU B 2 85  ? 53.806 -13.463  42.344 1.00 48.34  ? 114 GLU B C   1 
ATOM 2317 O O   . GLU B 2 85  ? 53.929 -14.620  42.755 1.00 60.17  ? 114 GLU B O   1 
ATOM 2318 C CB  . GLU B 2 85  ? 51.456 -12.766  41.808 1.00 45.62  ? 114 GLU B CB  1 
ATOM 2319 C CG  . GLU B 2 85  ? 50.291 -11.829  42.093 1.00 43.29  ? 114 GLU B CG  1 
ATOM 2320 C CD  . GLU B 2 85  ? 49.088 -12.100  41.212 1.00 54.32  ? 114 GLU B CD  1 
ATOM 2321 O OE1 . GLU B 2 85  ? 47.946 -11.949  41.692 1.00 52.60  ? 114 GLU B OE1 1 
ATOM 2322 O OE2 . GLU B 2 85  ? 49.290 -12.465  40.034 1.00 63.38  ? 114 GLU B OE2 1 
ATOM 2323 N N   . GLY B 2 86  ? 54.685 -12.902  41.513 1.00 48.11  ? 115 GLY B N   1 
ATOM 2324 C CA  . GLY B 2 86  ? 55.832 -13.649  41.024 1.00 47.37  ? 115 GLY B CA  1 
ATOM 2325 C C   . GLY B 2 86  ? 56.916 -13.865  42.060 1.00 50.08  ? 115 GLY B C   1 
ATOM 2326 O O   . GLY B 2 86  ? 57.722 -14.791  41.929 1.00 58.84  ? 115 GLY B O   1 
ATOM 2327 N N   . LYS B 2 87  ? 56.987 -12.998  43.070 1.00 51.09  ? 116 LYS B N   1 
ATOM 2328 C CA  . LYS B 2 87  ? 57.967 -13.181  44.132 1.00 55.19  ? 116 LYS B CA  1 
ATOM 2329 C C   . LYS B 2 87  ? 57.670 -14.464  44.896 1.00 71.04  ? 116 LYS B C   1 
ATOM 2330 O O   . LYS B 2 87  ? 56.505 -14.782  45.150 1.00 74.65  ? 116 LYS B O   1 
ATOM 2331 C CB  . LYS B 2 87  ? 57.943 -11.991  45.093 1.00 59.71  ? 116 LYS B CB  1 
ATOM 2332 C CG  . LYS B 2 87  ? 58.512 -10.691  44.536 1.00 71.83  ? 116 LYS B CG  1 
ATOM 2333 C CD  . LYS B 2 87  ? 59.933 -10.855  44.024 1.00 73.00  ? 116 LYS B CD  1 
ATOM 2334 C CE  . LYS B 2 87  ? 60.539 -9.512   43.632 1.00 51.55  ? 116 LYS B CE  1 
ATOM 2335 N NZ  . LYS B 2 87  ? 61.927 -9.662   43.107 1.00 49.45  ? 116 LYS B NZ  1 
ATOM 2336 N N   . VAL B 2 88  ? 58.751 -15.160  45.288 1.00 81.31  ? 117 VAL B N   1 
ATOM 2337 C CA  . VAL B 2 88  ? 58.836 -16.450  45.992 1.00 86.35  ? 117 VAL B CA  1 
ATOM 2338 C C   . VAL B 2 88  ? 59.576 -17.453  45.113 1.00 72.86  ? 117 VAL B C   1 
ATOM 2339 O O   . VAL B 2 88  ? 59.996 -18.516  45.585 1.00 77.15  ? 117 VAL B O   1 
ATOM 2340 C CB  . VAL B 2 88  ? 57.479 -17.040  46.429 1.00 86.09  ? 117 VAL B CB  1 
ATOM 2341 C CG1 . VAL B 2 88  ? 56.852 -17.834  45.296 1.00 62.22  ? 117 VAL B CG1 1 
ATOM 2342 C CG2 . VAL B 2 88  ? 57.650 -17.910  47.671 1.00 84.52  ? 117 VAL B CG2 1 
ATOM 2343 N N   . ARG B 2 89  ? 59.747 -17.126  43.833 1.00 63.16  ? 118 ARG B N   1 
ATOM 2344 C CA  . ARG B 2 89  ? 60.503 -17.993  42.935 1.00 72.07  ? 118 ARG B CA  1 
ATOM 2345 C C   . ARG B 2 89  ? 62.001 -17.703  43.008 1.00 71.08  ? 118 ARG B C   1 
ATOM 2346 O O   . ARG B 2 89  ? 62.805 -18.611  43.244 1.00 78.55  ? 118 ARG B O   1 
ATOM 2347 C CB  . ARG B 2 89  ? 59.990 -17.846  41.499 1.00 69.35  ? 118 ARG B CB  1 
ATOM 2348 C CG  . ARG B 2 89  ? 60.475 -18.948  40.571 1.00 73.16  ? 118 ARG B CG  1 
ATOM 2349 C CD  . ARG B 2 89  ? 59.345 -19.515  39.726 1.00 84.34  ? 118 ARG B CD  1 
ATOM 2350 N NE  . ARG B 2 89  ? 58.184 -19.914  40.520 1.00 89.13  ? 118 ARG B NE  1 
ATOM 2351 C CZ  . ARG B 2 89  ? 57.203 -20.686  40.062 1.00 82.10  ? 118 ARG B CZ  1 
ATOM 2352 N NH1 . ARG B 2 89  ? 56.177 -21.004  40.839 1.00 74.79  ? 118 ARG B NH1 1 
ATOM 2353 N NH2 . ARG B 2 89  ? 57.251 -21.147  38.821 1.00 77.15  ? 118 ARG B NH2 1 
ATOM 2354 N N   . LYS B 2 90  ? 62.387 -16.446  42.779 1.00 63.41  ? 119 LYS B N   1 
ATOM 2355 C CA  . LYS B 2 90  ? 63.761 -15.972  42.936 1.00 64.58  ? 119 LYS B CA  1 
ATOM 2356 C C   . LYS B 2 90  ? 64.731 -16.605  41.943 1.00 62.21  ? 119 LYS B C   1 
ATOM 2357 O O   . LYS B 2 90  ? 65.887 -16.179  41.853 1.00 70.09  ? 119 LYS B O   1 
ATOM 2358 C CB  . LYS B 2 90  ? 64.250 -16.187  44.373 1.00 70.28  ? 119 LYS B CB  1 
ATOM 2359 C CG  . LYS B 2 90  ? 63.632 -15.218  45.375 1.00 74.25  ? 119 LYS B CG  1 
ATOM 2360 C CD  . LYS B 2 90  ? 64.128 -13.791  45.132 1.00 70.35  ? 119 LYS B CD  1 
ATOM 2361 C CE  . LYS B 2 90  ? 63.216 -12.752  45.776 1.00 59.58  ? 119 LYS B CE  1 
ATOM 2362 N NZ  . LYS B 2 90  ? 61.776 -13.121  45.667 1.00 55.03  ? 119 LYS B NZ  1 
ATOM 2363 N N   . GLU B 2 91  ? 64.287 -17.626  41.194 1.00 59.46  ? 120 GLU B N   1 
ATOM 2364 C CA  . GLU B 2 91  ? 65.225 -18.060  40.174 1.00 57.95  ? 120 GLU B CA  1 
ATOM 2365 C C   . GLU B 2 91  ? 64.909 -17.388  38.844 1.00 56.29  ? 120 GLU B C   1 
ATOM 2366 O O   . GLU B 2 91  ? 63.757 -17.018  38.588 1.00 51.86  ? 120 GLU B O   1 
ATOM 2367 C CB  . GLU B 2 91  ? 65.186 -19.579  40.003 1.00 55.07  ? 120 GLU B CB  1 
ATOM 2368 C CG  . GLU B 2 91  ? 65.651 -20.339  41.227 1.00 72.56  ? 120 GLU B CG  1 
ATOM 2369 C CD  . GLU B 2 91  ? 65.356 -21.822  41.141 1.00 88.23  ? 120 GLU B CD  1 
ATOM 2370 O OE1 . GLU B 2 91  ? 64.271 -22.188  40.644 1.00 83.88  ? 120 GLU B OE1 1 
ATOM 2371 O OE2 . GLU B 2 91  ? 66.217 -22.624  41.565 1.00 82.23  ? 120 GLU B OE2 1 
ATOM 2372 N N   . PRO B 2 92  ? 65.915 -17.205  37.988 1.00 53.01  ? 121 PRO B N   1 
ATOM 2373 C CA  . PRO B 2 92  ? 65.671 -16.583  36.678 1.00 46.10  ? 121 PRO B CA  1 
ATOM 2374 C C   . PRO B 2 92  ? 64.605 -17.328  35.893 1.00 48.08  ? 121 PRO B C   1 
ATOM 2375 O O   . PRO B 2 92  ? 64.749 -18.512  35.580 1.00 65.40  ? 121 PRO B O   1 
ATOM 2376 C CB  . PRO B 2 92  ? 67.040 -16.662  35.994 1.00 45.78  ? 121 PRO B CB  1 
ATOM 2377 C CG  . PRO B 2 92  ? 68.015 -16.681  37.122 1.00 54.29  ? 121 PRO B CG  1 
ATOM 2378 C CD  . PRO B 2 92  ? 67.348 -17.455  38.223 1.00 52.81  ? 121 PRO B CD  1 
ATOM 2379 N N   . ALA B 2 93  ? 63.528 -16.619  35.571 1.00 42.46  ? 122 ALA B N   1 
ATOM 2380 C CA  . ALA B 2 93  ? 62.426 -17.216  34.839 1.00 41.28  ? 122 ALA B CA  1 
ATOM 2381 C C   . ALA B 2 93  ? 62.796 -17.404  33.371 1.00 37.84  ? 122 ALA B C   1 
ATOM 2382 O O   . ALA B 2 93  ? 63.782 -16.855  32.871 1.00 37.08  ? 122 ALA B O   1 
ATOM 2383 C CB  . ALA B 2 93  ? 61.166 -16.361  34.961 1.00 43.25  ? 122 ALA B CB  1 
ATOM 2384 N N   . TRP B 2 94  ? 61.999 -18.219  32.690 1.00 40.32  ? 123 TRP B N   1 
ATOM 2385 C CA  . TRP B 2 94  ? 62.193 -18.444  31.265 1.00 44.25  ? 123 TRP B CA  1 
ATOM 2386 C C   . TRP B 2 94  ? 61.998 -17.154  30.478 1.00 43.03  ? 123 TRP B C   1 
ATOM 2387 O O   . TRP B 2 94  ? 61.060 -16.390  30.721 1.00 48.37  ? 123 TRP B O   1 
ATOM 2388 C CB  . TRP B 2 94  ? 61.228 -19.519  30.758 1.00 46.61  ? 123 TRP B CB  1 
ATOM 2389 C CG  . TRP B 2 94  ? 61.183 -19.632  29.258 1.00 42.51  ? 123 TRP B CG  1 
ATOM 2390 C CD1 . TRP B 2 94  ? 61.969 -20.425  28.473 1.00 45.33  ? 123 TRP B CD1 1 
ATOM 2391 C CD2 . TRP B 2 94  ? 60.299 -18.938  28.367 1.00 41.83  ? 123 TRP B CD2 1 
ATOM 2392 N NE1 . TRP B 2 94  ? 61.636 -20.261  27.150 1.00 45.55  ? 123 TRP B NE1 1 
ATOM 2393 C CE2 . TRP B 2 94  ? 60.614 -19.354  27.059 1.00 40.32  ? 123 TRP B CE2 1 
ATOM 2394 C CE3 . TRP B 2 94  ? 59.279 -17.999  28.549 1.00 43.30  ? 123 TRP B CE3 1 
ATOM 2395 C CZ2 . TRP B 2 94  ? 59.942 -18.870  25.941 1.00 34.96  ? 123 TRP B CZ2 1 
ATOM 2396 C CZ3 . TRP B 2 94  ? 58.613 -17.521  27.436 1.00 42.30  ? 123 TRP B CZ3 1 
ATOM 2397 C CH2 . TRP B 2 94  ? 58.948 -17.957  26.149 1.00 38.84  ? 123 TRP B CH2 1 
ATOM 2398 N N   . ARG B 2 95  ? 62.901 -16.911  29.535 1.00 40.16  ? 124 ARG B N   1 
ATOM 2399 C CA  . ARG B 2 95  ? 62.758 -15.808  28.604 1.00 40.79  ? 124 ARG B CA  1 
ATOM 2400 C C   . ARG B 2 95  ? 62.709 -16.346  27.181 1.00 43.26  ? 124 ARG B C   1 
ATOM 2401 O O   . ARG B 2 95  ? 63.271 -17.410  26.898 1.00 43.65  ? 124 ARG B O   1 
ATOM 2402 C CB  . ARG B 2 95  ? 63.916 -14.811  28.726 1.00 41.62  ? 124 ARG B CB  1 
ATOM 2403 C CG  . ARG B 2 95  ? 63.574 -13.524  29.460 1.00 46.14  ? 124 ARG B CG  1 
ATOM 2404 C CD  . ARG B 2 95  ? 63.371 -13.737  30.944 1.00 48.08  ? 124 ARG B CD  1 
ATOM 2405 N NE  . ARG B 2 95  ? 62.475 -12.730  31.502 1.00 44.95  ? 124 ARG B NE  1 
ATOM 2406 C CZ  . ARG B 2 95  ? 62.058 -12.720  32.762 1.00 45.53  ? 124 ARG B CZ  1 
ATOM 2407 N NH1 . ARG B 2 95  ? 61.246 -11.766  33.188 1.00 46.29  ? 124 ARG B NH1 1 
ATOM 2408 N NH2 . ARG B 2 95  ? 62.462 -13.661  33.601 1.00 48.73  ? 124 ARG B NH2 1 
ATOM 2409 N N   . PRO B 2 96  ? 62.034 -15.642  26.261 1.00 40.91  ? 125 PRO B N   1 
ATOM 2410 C CA  . PRO B 2 96  ? 61.987 -16.110  24.872 1.00 40.63  ? 125 PRO B CA  1 
ATOM 2411 C C   . PRO B 2 96  ? 63.382 -16.297  24.309 1.00 43.61  ? 125 PRO B C   1 
ATOM 2412 O O   . PRO B 2 96  ? 64.117 -15.330  24.081 1.00 45.90  ? 125 PRO B O   1 
ATOM 2413 C CB  . PRO B 2 96  ? 61.214 -15.001  24.143 1.00 31.64  ? 125 PRO B CB  1 
ATOM 2414 C CG  . PRO B 2 96  ? 61.170 -13.850  25.093 1.00 41.83  ? 125 PRO B CG  1 
ATOM 2415 C CD  . PRO B 2 96  ? 61.195 -14.452  26.458 1.00 41.50  ? 125 PRO B CD  1 
ATOM 2416 N N   . SER B 2 97  ? 63.753 -17.563  24.115 1.00 41.01  ? 126 SER B N   1 
ATOM 2417 C CA  . SER B 2 97  ? 65.074 -17.941  23.635 1.00 39.77  ? 126 SER B CA  1 
ATOM 2418 C C   . SER B 2 97  ? 65.309 -17.584  22.174 1.00 40.68  ? 126 SER B C   1 
ATOM 2419 O O   . SER B 2 97  ? 66.421 -17.796  21.678 1.00 34.28  ? 126 SER B O   1 
ATOM 2420 C CB  . SER B 2 97  ? 65.275 -19.441  23.834 1.00 48.47  ? 126 SER B CB  1 
ATOM 2421 O OG  . SER B 2 97  ? 64.103 -20.148  23.463 1.00 44.79  ? 126 SER B OG  1 
ATOM 2422 N N   . GLY B 2 98  ? 64.300 -17.083  21.468 1.00 43.70  ? 127 GLY B N   1 
ATOM 2423 C CA  . GLY B 2 98  ? 64.472 -16.714  20.082 1.00 43.13  ? 127 GLY B CA  1 
ATOM 2424 C C   . GLY B 2 98  ? 64.231 -17.834  19.101 1.00 47.88  ? 127 GLY B C   1 
ATOM 2425 O O   . GLY B 2 98  ? 64.357 -17.616  17.889 1.00 45.90  ? 127 GLY B O   1 
ATOM 2426 N N   . ILE B 2 99  ? 63.902 -19.027  19.584 1.00 55.23  ? 128 ILE B N   1 
ATOM 2427 C CA  . ILE B 2 99  ? 63.600 -20.161  18.718 1.00 47.03  ? 128 ILE B CA  1 
ATOM 2428 C C   . ILE B 2 99  ? 62.103 -20.427  18.808 1.00 45.04  ? 128 ILE B C   1 
ATOM 2429 O O   . ILE B 2 99  ? 61.631 -20.970  19.818 1.00 41.11  ? 128 ILE B O   1 
ATOM 2430 C CB  . ILE B 2 99  ? 64.413 -21.402  19.114 1.00 46.20  ? 128 ILE B CB  1 
ATOM 2431 C CG1 . ILE B 2 99  ? 65.907 -21.074  19.154 1.00 47.26  ? 128 ILE B CG1 1 
ATOM 2432 C CG2 . ILE B 2 99  ? 64.140 -22.538  18.142 1.00 44.14  ? 128 ILE B CG2 1 
ATOM 2433 C CD1 . ILE B 2 99  ? 66.415 -20.331  17.934 1.00 52.99  ? 128 ILE B CD1 1 
ATOM 2434 N N   . PRO B 2 100 ? 61.322 -20.040  17.797 1.00 47.90  ? 129 PRO B N   1 
ATOM 2435 C CA  . PRO B 2 100 ? 59.861 -20.179  17.906 1.00 42.75  ? 129 PRO B CA  1 
ATOM 2436 C C   . PRO B 2 100 ? 59.414 -21.617  18.061 1.00 44.37  ? 129 PRO B C   1 
ATOM 2437 O O   . PRO B 2 100 ? 58.361 -21.875  18.663 1.00 41.43  ? 129 PRO B O   1 
ATOM 2438 C CB  . PRO B 2 100 ? 59.351 -19.570  16.591 1.00 45.23  ? 129 PRO B CB  1 
ATOM 2439 C CG  . PRO B 2 100 ? 60.503 -18.759  16.055 1.00 47.31  ? 129 PRO B CG  1 
ATOM 2440 C CD  . PRO B 2 100 ? 61.735 -19.470  16.505 1.00 50.59  ? 129 PRO B CD  1 
ATOM 2441 N N   . GLU B 2 101 ? 60.196 -22.566  17.542 1.00 44.41  ? 130 GLU B N   1 
ATOM 2442 C CA  . GLU B 2 101 ? 59.815 -23.968  17.643 1.00 37.08  ? 130 GLU B CA  1 
ATOM 2443 C C   . GLU B 2 101 ? 59.843 -24.443  19.088 1.00 33.72  ? 130 GLU B C   1 
ATOM 2444 O O   . GLU B 2 101 ? 58.932 -25.150  19.522 1.00 38.11  ? 130 GLU B O   1 
ATOM 2445 C CB  . GLU B 2 101 ? 60.728 -24.828  16.770 1.00 41.20  ? 130 GLU B CB  1 
ATOM 2446 C CG  . GLU B 2 101 ? 60.426 -24.747  15.273 1.00 49.64  ? 130 GLU B CG  1 
ATOM 2447 C CD  . GLU B 2 101 ? 59.242 -25.608  14.843 1.00 56.00  ? 130 GLU B CD  1 
ATOM 2448 O OE1 . GLU B 2 101 ? 59.332 -26.240  13.768 1.00 54.02  ? 130 GLU B OE1 1 
ATOM 2449 O OE2 . GLU B 2 101 ? 58.228 -25.660  15.573 1.00 53.62  ? 130 GLU B OE2 1 
ATOM 2450 N N   . LYS B 2 102 ? 60.866 -24.055  19.854 1.00 29.77  ? 131 LYS B N   1 
ATOM 2451 C CA  . LYS B 2 102 ? 60.965 -24.510  21.240 1.00 34.62  ? 131 LYS B CA  1 
ATOM 2452 C C   . LYS B 2 102 ? 59.816 -23.971  22.086 1.00 39.40  ? 131 LYS B C   1 
ATOM 2453 O O   . LYS B 2 102 ? 59.114 -24.733  22.771 1.00 48.55  ? 131 LYS B O   1 
ATOM 2454 C CB  . LYS B 2 102 ? 62.309 -24.093  21.837 1.00 28.26  ? 131 LYS B CB  1 
ATOM 2455 C CG  . LYS B 2 102 ? 62.483 -24.517  23.287 1.00 34.72  ? 131 LYS B CG  1 
ATOM 2456 C CD  . LYS B 2 102 ? 63.826 -24.085  23.855 1.00 41.87  ? 131 LYS B CD  1 
ATOM 2457 C CE  . LYS B 2 102 ? 64.960 -24.961  23.354 1.00 32.25  ? 131 LYS B CE  1 
ATOM 2458 N NZ  . LYS B 2 102 ? 66.234 -24.676  24.075 1.00 32.11  ? 131 LYS B NZ  1 
ATOM 2459 N N   . ASP B 2 103 ? 59.605 -22.657  22.045 1.00 38.16  ? 132 ASP B N   1 
ATOM 2460 C CA  . ASP B 2 103 ? 58.544 -22.058  22.845 1.00 40.63  ? 132 ASP B CA  1 
ATOM 2461 C C   . ASP B 2 103 ? 57.185 -22.589  22.411 1.00 35.76  ? 132 ASP B C   1 
ATOM 2462 O O   . ASP B 2 103 ? 56.312 -22.865  23.249 1.00 36.33  ? 132 ASP B O   1 
ATOM 2463 C CB  . ASP B 2 103 ? 58.608 -20.534  22.727 1.00 47.50  ? 132 ASP B CB  1 
ATOM 2464 C CG  . ASP B 2 103 ? 60.020 -19.988  22.916 1.00 44.46  ? 132 ASP B CG  1 
ATOM 2465 O OD1 . ASP B 2 103 ? 60.237 -18.790  22.648 1.00 40.60  ? 132 ASP B OD1 1 
ATOM 2466 O OD2 . ASP B 2 103 ? 60.918 -20.757  23.319 1.00 49.40  ? 132 ASP B OD2 1 
ATOM 2467 N N   . LEU B 2 104 ? 57.002 -22.768  21.102 1.00 36.19  ? 133 LEU B N   1 
ATOM 2468 C CA  . LEU B 2 104 ? 55.756 -23.334  20.605 1.00 40.28  ? 133 LEU B CA  1 
ATOM 2469 C C   . LEU B 2 104 ? 55.570 -24.773  21.078 1.00 42.35  ? 133 LEU B C   1 
ATOM 2470 O O   . LEU B 2 104 ? 54.437 -25.203  21.323 1.00 37.91  ? 133 LEU B O   1 
ATOM 2471 C CB  . LEU B 2 104 ? 55.710 -23.241  19.081 1.00 36.74  ? 133 LEU B CB  1 
ATOM 2472 C CG  . LEU B 2 104 ? 54.817 -22.094  18.601 1.00 32.84  ? 133 LEU B CG  1 
ATOM 2473 C CD1 . LEU B 2 104 ? 54.740 -22.055  17.092 1.00 48.88  ? 133 LEU B CD1 1 
ATOM 2474 C CD2 . LEU B 2 104 ? 53.425 -22.202  19.203 1.00 29.15  ? 133 LEU B CD2 1 
ATOM 2475 N N   . HIS B 2 105 ? 56.662 -25.530  21.212 1.00 41.47  ? 134 HIS B N   1 
ATOM 2476 C CA  . HIS B 2 105 ? 56.571 -26.853  21.821 1.00 40.39  ? 134 HIS B CA  1 
ATOM 2477 C C   . HIS B 2 105 ? 56.064 -26.752  23.250 1.00 38.97  ? 134 HIS B C   1 
ATOM 2478 O O   . HIS B 2 105 ? 55.153 -27.486  23.657 1.00 42.62  ? 134 HIS B O   1 
ATOM 2479 C CB  . HIS B 2 105 ? 57.941 -27.541  21.813 1.00 35.48  ? 134 HIS B CB  1 
ATOM 2480 C CG  . HIS B 2 105 ? 58.469 -27.844  20.448 1.00 36.34  ? 134 HIS B CG  1 
ATOM 2481 N ND1 . HIS B 2 105 ? 59.805 -28.080  20.206 1.00 35.85  ? 134 HIS B ND1 1 
ATOM 2482 C CD2 . HIS B 2 105 ? 57.844 -27.954  19.252 1.00 42.30  ? 134 HIS B CD2 1 
ATOM 2483 C CE1 . HIS B 2 105 ? 59.981 -28.318  18.918 1.00 43.32  ? 134 HIS B CE1 1 
ATOM 2484 N NE2 . HIS B 2 105 ? 58.806 -28.249  18.317 1.00 43.07  ? 134 HIS B NE2 1 
ATOM 2485 N N   . SER B 2 106 ? 56.625 -25.819  24.020 1.00 36.01  ? 135 SER B N   1 
ATOM 2486 C CA  . SER B 2 106 ? 56.235 -25.711  25.420 1.00 41.61  ? 135 SER B CA  1 
ATOM 2487 C C   . SER B 2 106 ? 54.764 -25.331  25.566 1.00 44.18  ? 135 SER B C   1 
ATOM 2488 O O   . SER B 2 106 ? 54.073 -25.840  26.458 1.00 37.85  ? 135 SER B O   1 
ATOM 2489 C CB  . SER B 2 106 ? 57.131 -24.704  26.138 1.00 42.93  ? 135 SER B CB  1 
ATOM 2490 O OG  . SER B 2 106 ? 56.904 -24.748  27.536 1.00 43.85  ? 135 SER B OG  1 
ATOM 2491 N N   . VAL B 2 107 ? 54.257 -24.451  24.695 1.00 46.90  ? 136 VAL B N   1 
ATOM 2492 C CA  . VAL B 2 107 ? 52.862 -24.034  24.836 1.00 44.02  ? 136 VAL B CA  1 
ATOM 2493 C C   . VAL B 2 107 ? 51.908 -25.087  24.275 1.00 40.59  ? 136 VAL B C   1 
ATOM 2494 O O   . VAL B 2 107 ? 50.834 -25.326  24.839 1.00 38.45  ? 136 VAL B O   1 
ATOM 2495 C CB  . VAL B 2 107 ? 52.635 -22.656  24.183 1.00 36.50  ? 136 VAL B CB  1 
ATOM 2496 C CG1 . VAL B 2 107 ? 53.135 -22.641  22.763 1.00 29.71  ? 136 VAL B CG1 1 
ATOM 2497 C CG2 . VAL B 2 107 ? 51.161 -22.271  24.235 1.00 35.18  ? 136 VAL B CG2 1 
ATOM 2498 N N   . MET B 2 108 ? 52.274 -25.737  23.169 1.00 38.76  ? 137 MET B N   1 
ATOM 2499 C CA  . MET B 2 108 ? 51.394 -26.731  22.563 1.00 38.34  ? 137 MET B CA  1 
ATOM 2500 C C   . MET B 2 108 ? 51.430 -28.076  23.276 1.00 41.62  ? 137 MET B C   1 
ATOM 2501 O O   . MET B 2 108 ? 50.591 -28.935  22.978 1.00 34.92  ? 137 MET B O   1 
ATOM 2502 C CB  . MET B 2 108 ? 51.755 -26.935  21.088 1.00 34.58  ? 137 MET B CB  1 
ATOM 2503 C CG  . MET B 2 108 ? 51.550 -25.713  20.213 1.00 35.34  ? 137 MET B CG  1 
ATOM 2504 S SD  . MET B 2 108 ? 52.094 -25.977  18.511 1.00 31.24  ? 137 MET B SD  1 
ATOM 2505 C CE  . MET B 2 108 ? 51.182 -27.451  18.091 1.00 48.55  ? 137 MET B CE  1 
ATOM 2506 N N   . ALA B 2 109 ? 52.363 -28.274  24.208 1.00 45.00  ? 138 ALA B N   1 
ATOM 2507 C CA  . ALA B 2 109 ? 52.505 -29.565  24.882 1.00 42.66  ? 138 ALA B CA  1 
ATOM 2508 C C   . ALA B 2 109 ? 51.223 -30.079  25.532 1.00 42.31  ? 138 ALA B C   1 
ATOM 2509 O O   . ALA B 2 109 ? 50.837 -31.224  25.245 1.00 46.69  ? 138 ALA B O   1 
ATOM 2510 C CB  . ALA B 2 109 ? 53.642 -29.474  25.910 1.00 40.34  ? 138 ALA B CB  1 
ATOM 2511 N N   . PRO B 2 110 ? 50.520 -29.321  26.388 1.00 37.74  ? 139 PRO B N   1 
ATOM 2512 C CA  . PRO B 2 110 ? 49.406 -29.932  27.141 1.00 36.92  ? 139 PRO B CA  1 
ATOM 2513 C C   . PRO B 2 110 ? 48.298 -30.498  26.267 1.00 42.29  ? 139 PRO B C   1 
ATOM 2514 O O   . PRO B 2 110 ? 47.741 -31.557  26.589 1.00 51.39  ? 139 PRO B O   1 
ATOM 2515 C CB  . PRO B 2 110 ? 48.901 -28.775  28.014 1.00 44.21  ? 139 PRO B CB  1 
ATOM 2516 C CG  . PRO B 2 110 ? 50.041 -27.815  28.078 1.00 49.14  ? 139 PRO B CG  1 
ATOM 2517 C CD  . PRO B 2 110 ? 50.693 -27.902  26.745 1.00 41.83  ? 139 PRO B CD  1 
ATOM 2518 N N   . TYR B 2 111 ? 47.962 -29.826  25.166 1.00 37.26  ? 140 TYR B N   1 
ATOM 2519 C CA  . TYR B 2 111 ? 46.896 -30.328  24.307 1.00 39.67  ? 140 TYR B CA  1 
ATOM 2520 C C   . TYR B 2 111 ? 47.315 -31.605  23.592 1.00 47.09  ? 140 TYR B C   1 
ATOM 2521 O O   . TYR B 2 111 ? 46.486 -32.498  23.368 1.00 48.63  ? 140 TYR B O   1 
ATOM 2522 C CB  . TYR B 2 111 ? 46.491 -29.246  23.310 1.00 44.39  ? 140 TYR B CB  1 
ATOM 2523 C CG  . TYR B 2 111 ? 45.938 -28.012  23.984 1.00 51.32  ? 140 TYR B CG  1 
ATOM 2524 C CD1 . TYR B 2 111 ? 45.002 -28.116  25.006 1.00 57.18  ? 140 TYR B CD1 1 
ATOM 2525 C CD2 . TYR B 2 111 ? 46.376 -26.748  23.627 1.00 44.82  ? 140 TYR B CD2 1 
ATOM 2526 C CE1 . TYR B 2 111 ? 44.499 -26.993  25.633 1.00 49.27  ? 140 TYR B CE1 1 
ATOM 2527 C CE2 . TYR B 2 111 ? 45.883 -25.623  24.252 1.00 47.66  ? 140 TYR B CE2 1 
ATOM 2528 C CZ  . TYR B 2 111 ? 44.945 -25.748  25.252 1.00 51.25  ? 140 TYR B CZ  1 
ATOM 2529 O OH  . TYR B 2 111 ? 44.455 -24.619  25.870 1.00 66.28  ? 140 TYR B OH  1 
ATOM 2530 N N   . PHE B 2 112 ? 48.598 -31.722  23.253 1.00 45.52  ? 141 PHE B N   1 
ATOM 2531 C CA  . PHE B 2 112 ? 49.085 -32.968  22.679 1.00 39.70  ? 141 PHE B CA  1 
ATOM 2532 C C   . PHE B 2 112 ? 49.135 -34.076  23.723 1.00 38.76  ? 141 PHE B C   1 
ATOM 2533 O O   . PHE B 2 112 ? 48.952 -35.250  23.384 1.00 40.37  ? 141 PHE B O   1 
ATOM 2534 C CB  . PHE B 2 112 ? 50.458 -32.753  22.050 1.00 38.79  ? 141 PHE B CB  1 
ATOM 2535 C CG  . PHE B 2 112 ? 50.415 -32.062  20.718 1.00 41.37  ? 141 PHE B CG  1 
ATOM 2536 C CD1 . PHE B 2 112 ? 49.206 -31.683  20.156 1.00 38.28  ? 141 PHE B CD1 1 
ATOM 2537 C CD2 . PHE B 2 112 ? 51.583 -31.797  20.024 1.00 39.36  ? 141 PHE B CD2 1 
ATOM 2538 C CE1 . PHE B 2 112 ? 49.165 -31.047  18.933 1.00 35.33  ? 141 PHE B CE1 1 
ATOM 2539 C CE2 . PHE B 2 112 ? 51.548 -31.163  18.800 1.00 39.83  ? 141 PHE B CE2 1 
ATOM 2540 C CZ  . PHE B 2 112 ? 50.336 -30.790  18.253 1.00 37.05  ? 141 PHE B CZ  1 
ATOM 2541 N N   . LEU B 2 113 ? 49.372 -33.729  24.992 1.00 38.12  ? 142 LEU B N   1 
ATOM 2542 C CA  . LEU B 2 113 ? 49.302 -34.730  26.052 1.00 34.84  ? 142 LEU B CA  1 
ATOM 2543 C C   . LEU B 2 113 ? 47.884 -35.259  26.217 1.00 37.90  ? 142 LEU B C   1 
ATOM 2544 O O   . LEU B 2 113 ? 47.672 -36.475  26.298 1.00 45.07  ? 142 LEU B O   1 
ATOM 2545 C CB  . LEU B 2 113 ? 49.810 -34.154  27.373 1.00 37.11  ? 142 LEU B CB  1 
ATOM 2546 C CG  . LEU B 2 113 ? 51.315 -33.945  27.532 1.00 43.61  ? 142 LEU B CG  1 
ATOM 2547 C CD1 . LEU B 2 113 ? 51.624 -32.597  28.165 1.00 48.47  ? 142 LEU B CD1 1 
ATOM 2548 C CD2 . LEU B 2 113 ? 51.900 -35.075  28.366 1.00 41.97  ? 142 LEU B CD2 1 
ATOM 2549 N N   . GLN B 2 114 ? 46.892 -34.364  26.268 1.00 41.67  ? 143 GLN B N   1 
ATOM 2550 C CA  . GLN B 2 114 ? 45.518 -34.840  26.394 1.00 46.30  ? 143 GLN B CA  1 
ATOM 2551 C C   . GLN B 2 114 ? 45.095 -35.630  25.161 1.00 41.21  ? 143 GLN B C   1 
ATOM 2552 O O   . GLN B 2 114 ? 44.323 -36.592  25.275 1.00 42.83  ? 143 GLN B O   1 
ATOM 2553 C CB  . GLN B 2 114 ? 44.560 -33.670  26.660 1.00 50.85  ? 143 GLN B CB  1 
ATOM 2554 C CG  . GLN B 2 114 ? 44.335 -32.717  25.493 1.00 54.37  ? 143 GLN B CG  1 
ATOM 2555 C CD  . GLN B 2 114 ? 43.313 -31.633  25.797 1.00 62.20  ? 143 GLN B CD  1 
ATOM 2556 O OE1 . GLN B 2 114 ? 43.241 -31.123  26.916 1.00 62.47  ? 143 GLN B OE1 1 
ATOM 2557 N NE2 . GLN B 2 114 ? 42.523 -31.268  24.792 1.00 64.84  ? 143 GLN B NE2 1 
ATOM 2558 N N   . GLN B 2 115 ? 45.613 -35.264  23.985 1.00 40.30  ? 144 GLN B N   1 
ATOM 2559 C CA  . GLN B 2 115 ? 45.372 -36.066  22.787 1.00 43.27  ? 144 GLN B CA  1 
ATOM 2560 C C   . GLN B 2 115 ? 45.947 -37.473  22.942 1.00 41.97  ? 144 GLN B C   1 
ATOM 2561 O O   . GLN B 2 115 ? 45.261 -38.474  22.684 1.00 41.20  ? 144 GLN B O   1 
ATOM 2562 C CB  . GLN B 2 115 ? 45.971 -35.357  21.571 1.00 47.40  ? 144 GLN B CB  1 
ATOM 2563 C CG  . GLN B 2 115 ? 45.564 -35.937  20.228 1.00 48.35  ? 144 GLN B CG  1 
ATOM 2564 C CD  . GLN B 2 115 ? 46.378 -35.367  19.079 1.00 48.04  ? 144 GLN B CD  1 
ATOM 2565 O OE1 . GLN B 2 115 ? 47.349 -34.640  19.289 1.00 46.03  ? 144 GLN B OE1 1 
ATOM 2566 N NE2 . GLN B 2 115 ? 45.984 -35.697  17.855 1.00 53.97  ? 144 GLN B NE2 1 
ATOM 2567 N N   . ARG B 2 116 ? 47.208 -37.562  23.377 1.00 44.43  ? 145 ARG B N   1 
ATOM 2568 C CA  . ARG B 2 116 ? 47.844 -38.857  23.608 1.00 41.82  ? 145 ARG B CA  1 
ATOM 2569 C C   . ARG B 2 116 ? 47.035 -39.713  24.570 1.00 41.38  ? 145 ARG B C   1 
ATOM 2570 O O   . ARG B 2 116 ? 46.795 -40.895  24.311 1.00 43.63  ? 145 ARG B O   1 
ATOM 2571 C CB  . ARG B 2 116 ? 49.259 -38.667  24.153 1.00 39.28  ? 145 ARG B CB  1 
ATOM 2572 C CG  . ARG B 2 116 ? 49.820 -39.934  24.772 1.00 35.77  ? 145 ARG B CG  1 
ATOM 2573 C CD  . ARG B 2 116 ? 51.259 -39.779  25.210 1.00 39.85  ? 145 ARG B CD  1 
ATOM 2574 N NE  . ARG B 2 116 ? 51.390 -38.923  26.383 1.00 45.34  ? 145 ARG B NE  1 
ATOM 2575 C CZ  . ARG B 2 116 ? 51.259 -39.345  27.636 1.00 48.73  ? 145 ARG B CZ  1 
ATOM 2576 N NH1 . ARG B 2 116 ? 50.973 -40.615  27.881 1.00 53.20  ? 145 ARG B NH1 1 
ATOM 2577 N NH2 . ARG B 2 116 ? 51.402 -38.495  28.644 1.00 48.17  ? 145 ARG B NH2 1 
ATOM 2578 N N   . ASP B 2 117 ? 46.611 -39.132  25.693 1.00 39.52  ? 146 ASP B N   1 
ATOM 2579 C CA  . ASP B 2 117 ? 45.932 -39.928  26.708 1.00 42.20  ? 146 ASP B CA  1 
ATOM 2580 C C   . ASP B 2 117 ? 44.538 -40.344  26.253 1.00 41.13  ? 146 ASP B C   1 
ATOM 2581 O O   . ASP B 2 117 ? 44.086 -41.455  26.562 1.00 49.31  ? 146 ASP B O   1 
ATOM 2582 C CB  . ASP B 2 117 ? 45.877 -39.154  28.022 1.00 46.10  ? 146 ASP B CB  1 
ATOM 2583 C CG  . ASP B 2 117 ? 47.218 -39.127  28.732 1.00 51.45  ? 146 ASP B CG  1 
ATOM 2584 O OD1 . ASP B 2 117 ? 47.382 -39.861  29.732 1.00 56.68  ? 146 ASP B OD1 1 
ATOM 2585 O OD2 . ASP B 2 117 ? 48.114 -38.383  28.283 1.00 47.11  ? 146 ASP B OD2 1 
ATOM 2586 N N   . THR B 2 118 ? 43.847 -39.481  25.506 1.00 36.57  ? 147 THR B N   1 
ATOM 2587 C CA  . THR B 2 118 ? 42.547 -39.869  24.966 1.00 42.63  ? 147 THR B CA  1 
ATOM 2588 C C   . THR B 2 118 ? 42.679 -41.040  23.996 1.00 45.43  ? 147 THR B C   1 
ATOM 2589 O O   . THR B 2 118 ? 41.978 -42.056  24.129 1.00 46.46  ? 147 THR B O   1 
ATOM 2590 C CB  . THR B 2 118 ? 41.875 -38.672  24.292 1.00 39.36  ? 147 THR B CB  1 
ATOM 2591 O OG1 . THR B 2 118 ? 41.657 -37.641  25.263 1.00 37.84  ? 147 THR B OG1 1 
ATOM 2592 C CG2 . THR B 2 118 ? 40.542 -39.078  23.692 1.00 44.75  ? 147 THR B CG2 1 
ATOM 2593 N N   . LEU B 2 119 ? 43.575 -40.921  23.009 1.00 42.76  ? 148 LEU B N   1 
ATOM 2594 C CA  . LEU B 2 119 ? 43.780 -42.039  22.090 1.00 39.74  ? 148 LEU B CA  1 
ATOM 2595 C C   . LEU B 2 119 ? 44.234 -43.294  22.820 1.00 46.26  ? 148 LEU B C   1 
ATOM 2596 O O   . LEU B 2 119 ? 43.794 -44.401  22.493 1.00 53.83  ? 148 LEU B O   1 
ATOM 2597 C CB  . LEU B 2 119 ? 44.795 -41.673  21.014 1.00 37.14  ? 148 LEU B CB  1 
ATOM 2598 C CG  . LEU B 2 119 ? 44.279 -40.696  19.972 1.00 40.76  ? 148 LEU B CG  1 
ATOM 2599 C CD1 . LEU B 2 119 ? 45.395 -40.284  19.036 1.00 44.83  ? 148 LEU B CD1 1 
ATOM 2600 C CD2 . LEU B 2 119 ? 43.147 -41.356  19.224 1.00 30.54  ? 148 LEU B CD2 1 
ATOM 2601 N N   . ARG B 2 120 ? 45.092 -43.143  23.831 1.00 44.14  ? 149 ARG B N   1 
ATOM 2602 C CA  . ARG B 2 120 ? 45.608 -44.320  24.518 1.00 45.15  ? 149 ARG B CA  1 
ATOM 2603 C C   . ARG B 2 120 ? 44.521 -45.017  25.323 1.00 41.81  ? 149 ARG B C   1 
ATOM 2604 O O   . ARG B 2 120 ? 44.552 -46.244  25.466 1.00 45.04  ? 149 ARG B O   1 
ATOM 2605 C CB  . ARG B 2 120 ? 46.794 -43.946  25.411 1.00 42.59  ? 149 ARG B CB  1 
ATOM 2606 C CG  . ARG B 2 120 ? 46.446 -43.570  26.843 1.00 44.81  ? 149 ARG B CG  1 
ATOM 2607 C CD  . ARG B 2 120 ? 47.556 -43.957  27.815 1.00 48.61  ? 149 ARG B CD  1 
ATOM 2608 N NE  . ARG B 2 120 ? 48.841 -43.335  27.495 1.00 56.44  ? 149 ARG B NE  1 
ATOM 2609 C CZ  . ARG B 2 120 ? 49.826 -43.940  26.835 1.00 57.70  ? 149 ARG B CZ  1 
ATOM 2610 N NH1 . ARG B 2 120 ? 49.675 -45.188  26.413 1.00 63.74  ? 149 ARG B NH1 1 
ATOM 2611 N NH2 . ARG B 2 120 ? 50.961 -43.296  26.592 1.00 53.60  ? 149 ARG B NH2 1 
ATOM 2612 N N   . ARG B 2 121 ? 43.546 -44.268  25.840 1.00 41.51  ? 150 ARG B N   1 
ATOM 2613 C CA  . ARG B 2 121 ? 42.469 -44.929  26.562 1.00 46.56  ? 150 ARG B CA  1 
ATOM 2614 C C   . ARG B 2 121 ? 41.435 -45.520  25.612 1.00 48.77  ? 150 ARG B C   1 
ATOM 2615 O O   . ARG B 2 121 ? 40.793 -46.524  25.951 1.00 51.19  ? 150 ARG B O   1 
ATOM 2616 C CB  . ARG B 2 121 ? 41.816 -43.963  27.547 1.00 53.41  ? 150 ARG B CB  1 
ATOM 2617 C CG  . ARG B 2 121 ? 41.385 -44.639  28.843 1.00 59.04  ? 150 ARG B CG  1 
ATOM 2618 C CD  . ARG B 2 121 ? 40.753 -43.652  29.807 1.00 72.68  ? 150 ARG B CD  1 
ATOM 2619 N NE  . ARG B 2 121 ? 39.913 -42.689  29.102 1.00 90.94  ? 150 ARG B NE  1 
ATOM 2620 C CZ  . ARG B 2 121 ? 38.745 -42.985  28.541 1.00 85.48  ? 150 ARG B CZ  1 
ATOM 2621 N NH1 . ARG B 2 121 ? 38.054 -42.039  27.918 1.00 81.63  ? 150 ARG B NH1 1 
ATOM 2622 N NH2 . ARG B 2 121 ? 38.273 -44.226  28.593 1.00 76.32  ? 150 ARG B NH2 1 
ATOM 2623 N N   . HIS B 2 122 ? 41.263 -44.929  24.426 1.00 46.29  ? 151 HIS B N   1 
ATOM 2624 C CA  . HIS B 2 122 ? 40.488 -45.605  23.388 1.00 46.61  ? 151 HIS B CA  1 
ATOM 2625 C C   . HIS B 2 122 ? 41.118 -46.950  23.039 1.00 46.72  ? 151 HIS B C   1 
ATOM 2626 O O   . HIS B 2 122 ? 40.439 -47.987  23.013 1.00 49.09  ? 151 HIS B O   1 
ATOM 2627 C CB  . HIS B 2 122 ? 40.379 -44.717  22.147 1.00 49.91  ? 151 HIS B CB  1 
ATOM 2628 C CG  . HIS B 2 122 ? 39.432 -43.567  22.303 1.00 55.83  ? 151 HIS B CG  1 
ATOM 2629 N ND1 . HIS B 2 122 ? 39.375 -42.525  21.401 1.00 61.55  ? 151 HIS B ND1 1 
ATOM 2630 C CD2 . HIS B 2 122 ? 38.502 -43.297  23.249 1.00 61.75  ? 151 HIS B CD2 1 
ATOM 2631 C CE1 . HIS B 2 122 ? 38.453 -41.661  21.788 1.00 63.30  ? 151 HIS B CE1 1 
ATOM 2632 N NE2 . HIS B 2 122 ? 37.908 -42.105  22.906 1.00 64.19  ? 151 HIS B NE2 1 
ATOM 2633 N N   . VAL B 2 123 ? 42.426 -46.944  22.764 1.00 44.07  ? 152 VAL B N   1 
ATOM 2634 C CA  . VAL B 2 123 ? 43.147 -48.179  22.467 1.00 41.68  ? 152 VAL B CA  1 
ATOM 2635 C C   . VAL B 2 123 ? 43.013 -49.165  23.621 1.00 41.39  ? 152 VAL B C   1 
ATOM 2636 O O   . VAL B 2 123 ? 42.867 -50.372  23.411 1.00 43.95  ? 152 VAL B O   1 
ATOM 2637 C CB  . VAL B 2 123 ? 44.624 -47.869  22.157 1.00 41.41  ? 152 VAL B CB  1 
ATOM 2638 C CG1 . VAL B 2 123 ? 45.417 -49.156  21.967 1.00 46.48  ? 152 VAL B CG1 1 
ATOM 2639 C CG2 . VAL B 2 123 ? 44.733 -46.982  20.931 1.00 36.81  ? 152 VAL B CG2 1 
ATOM 2640 N N   . GLN B 2 124 ? 43.065 -48.665  24.858 1.00 41.99  ? 153 GLN B N   1 
ATOM 2641 C CA  . GLN B 2 124 ? 42.871 -49.519  26.025 1.00 38.35  ? 153 GLN B CA  1 
ATOM 2642 C C   . GLN B 2 124 ? 41.509 -50.205  25.983 1.00 39.70  ? 153 GLN B C   1 
ATOM 2643 O O   . GLN B 2 124 ? 41.403 -51.422  26.187 1.00 47.35  ? 153 GLN B O   1 
ATOM 2644 C CB  . GLN B 2 124 ? 43.027 -48.683  27.298 1.00 42.96  ? 153 GLN B CB  1 
ATOM 2645 C CG  . GLN B 2 124 ? 43.585 -49.423  28.502 1.00 45.79  ? 153 GLN B CG  1 
ATOM 2646 C CD  . GLN B 2 124 ? 42.590 -50.395  29.102 1.00 57.32  ? 153 GLN B CD  1 
ATOM 2647 O OE1 . GLN B 2 124 ? 41.600 -49.989  29.713 1.00 48.67  ? 153 GLN B OE1 1 
ATOM 2648 N NE2 . GLN B 2 124 ? 42.848 -51.687  28.935 1.00 68.63  ? 153 GLN B NE2 1 
ATOM 2649 N N   . LYS B 2 125 ? 40.452 -49.436  25.703 1.00 41.12  ? 154 LYS B N   1 
ATOM 2650 C CA  . LYS B 2 125 ? 39.108 -50.008  25.645 1.00 45.25  ? 154 LYS B CA  1 
ATOM 2651 C C   . LYS B 2 125 ? 39.009 -51.084  24.567 1.00 46.21  ? 154 LYS B C   1 
ATOM 2652 O O   . LYS B 2 125 ? 38.603 -52.224  24.842 1.00 48.70  ? 154 LYS B O   1 
ATOM 2653 C CB  . LYS B 2 125 ? 38.074 -48.904  25.407 1.00 53.31  ? 154 LYS B CB  1 
ATOM 2654 C CG  . LYS B 2 125 ? 36.627 -49.392  25.475 1.00 58.99  ? 154 LYS B CG  1 
ATOM 2655 C CD  . LYS B 2 125 ? 35.641 -48.379  24.899 1.00 62.15  ? 154 LYS B CD  1 
ATOM 2656 C CE  . LYS B 2 125 ? 34.200 -48.840  25.105 1.00 56.66  ? 154 LYS B CE  1 
ATOM 2657 N NZ  . LYS B 2 125 ? 33.205 -47.967  24.420 1.00 54.88  ? 154 LYS B NZ  1 
ATOM 2658 N N   . GLN B 2 126 ? 39.370 -50.740  23.326 1.00 44.93  ? 155 GLN B N   1 
ATOM 2659 C CA  . GLN B 2 126 ? 39.279 -51.728  22.255 1.00 38.71  ? 155 GLN B CA  1 
ATOM 2660 C C   . GLN B 2 126 ? 40.164 -52.935  22.528 1.00 42.99  ? 155 GLN B C   1 
ATOM 2661 O O   . GLN B 2 126 ? 39.837 -54.049  22.105 1.00 52.20  ? 155 GLN B O   1 
ATOM 2662 C CB  . GLN B 2 126 ? 39.651 -51.102  20.912 1.00 42.29  ? 155 GLN B CB  1 
ATOM 2663 C CG  . GLN B 2 126 ? 39.098 -51.862  19.712 1.00 42.17  ? 155 GLN B CG  1 
ATOM 2664 C CD  . GLN B 2 126 ? 37.615 -51.616  19.484 1.00 48.41  ? 155 GLN B CD  1 
ATOM 2665 O OE1 . GLN B 2 126 ? 37.232 -50.857  18.594 1.00 58.39  ? 155 GLN B OE1 1 
ATOM 2666 N NE2 . GLN B 2 126 ? 36.773 -52.254  20.292 1.00 39.48  ? 155 GLN B NE2 1 
ATOM 2667 N N   . GLU B 2 127 ? 41.268 -52.744  23.251 1.00 42.70  ? 156 GLU B N   1 
ATOM 2668 C CA  . GLU B 2 127 ? 42.155 -53.861  23.560 1.00 42.49  ? 156 GLU B CA  1 
ATOM 2669 C C   . GLU B 2 127 ? 41.501 -54.823  24.541 1.00 45.36  ? 156 GLU B C   1 
ATOM 2670 O O   . GLU B 2 127 ? 41.555 -56.044  24.354 1.00 53.23  ? 156 GLU B O   1 
ATOM 2671 C CB  . GLU B 2 127 ? 43.484 -53.352  24.113 1.00 41.54  ? 156 GLU B CB  1 
ATOM 2672 C CG  . GLU B 2 127 ? 44.543 -53.107  23.054 1.00 46.68  ? 156 GLU B CG  1 
ATOM 2673 C CD  . GLU B 2 127 ? 45.929 -52.937  23.646 1.00 57.01  ? 156 GLU B CD  1 
ATOM 2674 O OE1 . GLU B 2 127 ? 46.065 -53.060  24.884 1.00 63.77  ? 156 GLU B OE1 1 
ATOM 2675 O OE2 . GLU B 2 127 ? 46.879 -52.678  22.877 1.00 54.56  ? 156 GLU B OE2 1 
ATOM 2676 N N   . ALA B 2 128 ? 40.890 -54.292  25.604 1.00 41.67  ? 157 ALA B N   1 
ATOM 2677 C CA  . ALA B 2 128 ? 40.183 -55.157  26.546 1.00 42.35  ? 157 ALA B CA  1 
ATOM 2678 C C   . ALA B 2 128 ? 39.039 -55.895  25.860 1.00 46.40  ? 157 ALA B C   1 
ATOM 2679 O O   . ALA B 2 128 ? 38.873 -57.114  26.033 1.00 51.79  ? 157 ALA B O   1 
ATOM 2680 C CB  . ALA B 2 128 ? 39.665 -54.340  27.728 1.00 46.20  ? 157 ALA B CB  1 
ATOM 2681 N N   . GLU B 2 129 ? 38.238 -55.173  25.065 1.00 42.36  ? 158 GLU B N   1 
ATOM 2682 C CA  . GLU B 2 129 ? 37.156 -55.843  24.350 1.00 45.45  ? 158 GLU B CA  1 
ATOM 2683 C C   . GLU B 2 129 ? 37.696 -56.920  23.419 1.00 42.68  ? 158 GLU B C   1 
ATOM 2684 O O   . GLU B 2 129 ? 37.053 -57.960  23.234 1.00 42.27  ? 158 GLU B O   1 
ATOM 2685 C CB  . GLU B 2 129 ? 36.311 -54.840  23.567 1.00 43.32  ? 158 GLU B CB  1 
ATOM 2686 C CG  . GLU B 2 129 ? 35.105 -55.489  22.897 1.00 40.07  ? 158 GLU B CG  1 
ATOM 2687 C CD  . GLU B 2 129 ? 34.639 -54.754  21.660 1.00 48.71  ? 158 GLU B CD  1 
ATOM 2688 O OE1 . GLU B 2 129 ? 35.499 -54.304  20.874 1.00 58.99  ? 158 GLU B OE1 1 
ATOM 2689 O OE2 . GLU B 2 129 ? 33.409 -54.631  21.472 1.00 47.15  ? 158 GLU B OE2 1 
ATOM 2690 N N   . ASN B 2 130 ? 38.876 -56.698  22.836 1.00 41.47  ? 159 ASN B N   1 
ATOM 2691 C CA  . ASN B 2 130 ? 39.475 -57.729  21.996 1.00 41.29  ? 159 ASN B CA  1 
ATOM 2692 C C   . ASN B 2 130 ? 39.941 -58.920  22.819 1.00 44.17  ? 159 ASN B C   1 
ATOM 2693 O O   . ASN B 2 130 ? 39.886 -60.053  22.335 1.00 48.22  ? 159 ASN B O   1 
ATOM 2694 C CB  . ASN B 2 130 ? 40.629 -57.157  21.177 1.00 42.93  ? 159 ASN B CB  1 
ATOM 2695 C CG  . ASN B 2 130 ? 40.149 -56.322  20.011 1.00 43.91  ? 159 ASN B CG  1 
ATOM 2696 O OD1 . ASN B 2 130 ? 38.998 -55.887  19.980 1.00 43.78  ? 159 ASN B OD1 1 
ATOM 2697 N ND2 . ASN B 2 130 ? 41.024 -56.107  19.035 1.00 43.10  ? 159 ASN B ND2 1 
ATOM 2698 N N   . GLN B 2 131 ? 40.415 -58.695  24.046 1.00 44.90  ? 160 GLN B N   1 
ATOM 2699 C CA  . GLN B 2 131 ? 40.768 -59.826  24.900 1.00 49.98  ? 160 GLN B CA  1 
ATOM 2700 C C   . GLN B 2 131 ? 39.544 -60.678  25.200 1.00 47.58  ? 160 GLN B C   1 
ATOM 2701 O O   . GLN B 2 131 ? 39.597 -61.913  25.111 1.00 44.44  ? 160 GLN B O   1 
ATOM 2702 C CB  . GLN B 2 131 ? 41.400 -59.334  26.203 1.00 56.41  ? 160 GLN B CB  1 
ATOM 2703 C CG  . GLN B 2 131 ? 41.862 -60.446  27.151 1.00 53.84  ? 160 GLN B CG  1 
ATOM 2704 C CD  . GLN B 2 131 ? 43.120 -61.159  26.694 1.00 50.93  ? 160 GLN B CD  1 
ATOM 2705 O OE1 . GLN B 2 131 ? 43.667 -60.870  25.631 1.00 58.02  ? 160 GLN B OE1 1 
ATOM 2706 N NE2 . GLN B 2 131 ? 43.587 -62.102  27.503 1.00 59.76  ? 160 GLN B NE2 1 
ATOM 2707 N N   . GLN B 2 132 ? 38.421 -60.034  25.524 1.00 47.65  ? 161 GLN B N   1 
ATOM 2708 C CA  . GLN B 2 132 ? 37.197 -60.789  25.771 1.00 49.98  ? 161 GLN B CA  1 
ATOM 2709 C C   . GLN B 2 132 ? 36.758 -61.535  24.515 1.00 41.65  ? 161 GLN B C   1 
ATOM 2710 O O   . GLN B 2 132 ? 36.462 -62.739  24.554 1.00 46.89  ? 161 GLN B O   1 
ATOM 2711 C CB  . GLN B 2 132 ? 36.094 -59.837  26.240 1.00 49.09  ? 161 GLN B CB  1 
ATOM 2712 C CG  . GLN B 2 132 ? 36.528 -58.877  27.340 1.00 45.87  ? 161 GLN B CG  1 
ATOM 2713 C CD  . GLN B 2 132 ? 36.628 -59.537  28.698 1.00 61.05  ? 161 GLN B CD  1 
ATOM 2714 O OE1 . GLN B 2 132 ? 35.642 -60.046  29.230 1.00 71.89  ? 161 GLN B OE1 1 
ATOM 2715 N NE2 . GLN B 2 132 ? 37.828 -59.530  29.271 1.00 57.88  ? 161 GLN B NE2 1 
ATOM 2716 N N   . LEU B 2 133 ? 36.754 -60.836  23.380 1.00 37.62  ? 162 LEU B N   1 
ATOM 2717 C CA  . LEU B 2 133 ? 36.287 -61.417  22.127 1.00 38.68  ? 162 LEU B CA  1 
ATOM 2718 C C   . LEU B 2 133 ? 37.142 -62.611  21.715 1.00 41.04  ? 162 LEU B C   1 
ATOM 2719 O O   . LEU B 2 133 ? 36.620 -63.659  21.315 1.00 45.08  ? 162 LEU B O   1 
ATOM 2720 C CB  . LEU B 2 133 ? 36.292 -60.339  21.042 1.00 44.79  ? 162 LEU B CB  1 
ATOM 2721 C CG  . LEU B 2 133 ? 35.186 -60.362  19.988 1.00 46.43  ? 162 LEU B CG  1 
ATOM 2722 C CD1 . LEU B 2 133 ? 33.842 -60.088  20.646 1.00 49.40  ? 162 LEU B CD1 1 
ATOM 2723 C CD2 . LEU B 2 133 ? 35.465 -59.340  18.898 1.00 40.84  ? 162 LEU B CD2 1 
ATOM 2724 N N   . ALA B 2 134 ? 38.466 -62.473  21.814 1.00 39.37  ? 163 ALA B N   1 
ATOM 2725 C CA  . ALA B 2 134 ? 39.346 -63.584  21.474 1.00 39.40  ? 163 ALA B CA  1 
ATOM 2726 C C   . ALA B 2 134 ? 39.166 -64.746  22.434 1.00 48.40  ? 163 ALA B C   1 
ATOM 2727 O O   . ALA B 2 134 ? 39.164 -65.905  22.009 1.00 49.69  ? 163 ALA B O   1 
ATOM 2728 C CB  . ALA B 2 134 ? 40.803 -63.133  21.467 1.00 37.24  ? 163 ALA B CB  1 
ATOM 2729 N N   . ASP B 2 135 ? 39.003 -64.464  23.729 1.00 48.00  ? 164 ASP B N   1 
ATOM 2730 C CA  . ASP B 2 135 ? 38.713 -65.546  24.663 1.00 44.68  ? 164 ASP B CA  1 
ATOM 2731 C C   . ASP B 2 135 ? 37.493 -66.333  24.206 1.00 40.38  ? 164 ASP B C   1 
ATOM 2732 O O   . ASP B 2 135 ? 37.504 -67.573  24.196 1.00 44.03  ? 164 ASP B O   1 
ATOM 2733 C CB  . ASP B 2 135 ? 38.506 -64.986  26.070 1.00 51.40  ? 164 ASP B CB  1 
ATOM 2734 C CG  . ASP B 2 135 ? 39.797 -64.489  26.693 1.00 55.95  ? 164 ASP B CG  1 
ATOM 2735 O OD1 . ASP B 2 135 ? 40.880 -64.791  26.145 1.00 53.45  ? 164 ASP B OD1 1 
ATOM 2736 O OD2 . ASP B 2 135 ? 39.731 -63.801  27.733 1.00 61.96  ? 164 ASP B OD2 1 
ATOM 2737 N N   . ALA B 2 136 ? 36.442 -65.625  23.785 1.00 34.54  ? 165 ALA B N   1 
ATOM 2738 C CA  . ALA B 2 136 ? 35.281 -66.304  23.222 1.00 40.50  ? 165 ALA B CA  1 
ATOM 2739 C C   . ALA B 2 136 ? 35.652 -67.115  21.982 1.00 41.99  ? 165 ALA B C   1 
ATOM 2740 O O   . ALA B 2 136 ? 35.136 -68.221  21.780 1.00 45.03  ? 165 ALA B O   1 
ATOM 2741 C CB  . ALA B 2 136 ? 34.186 -65.291  22.895 1.00 44.10  ? 165 ALA B CB  1 
ATOM 2742 N N   . VAL B 2 137 ? 36.535 -66.580  21.135 1.00 40.56  ? 166 VAL B N   1 
ATOM 2743 C CA  . VAL B 2 137 ? 36.915 -67.293  19.914 1.00 43.31  ? 166 VAL B CA  1 
ATOM 2744 C C   . VAL B 2 137 ? 37.616 -68.606  20.249 1.00 43.16  ? 166 VAL B C   1 
ATOM 2745 O O   . VAL B 2 137 ? 37.315 -69.655  19.666 1.00 46.93  ? 166 VAL B O   1 
ATOM 2746 C CB  . VAL B 2 137 ? 37.789 -66.398  19.016 1.00 45.12  ? 166 VAL B CB  1 
ATOM 2747 C CG1 . VAL B 2 137 ? 38.334 -67.199  17.846 1.00 43.89  ? 166 VAL B CG1 1 
ATOM 2748 C CG2 . VAL B 2 137 ? 36.983 -65.212  18.512 1.00 35.37  ? 166 VAL B CG2 1 
ATOM 2749 N N   . LEU B 2 138 ? 38.563 -68.569  21.193 1.00 40.81  ? 167 LEU B N   1 
ATOM 2750 C CA  . LEU B 2 138 ? 39.236 -69.793  21.622 1.00 48.36  ? 167 LEU B CA  1 
ATOM 2751 C C   . LEU B 2 138 ? 38.247 -70.785  22.218 1.00 41.43  ? 167 LEU B C   1 
ATOM 2752 O O   . LEU B 2 138 ? 38.338 -71.993  21.965 1.00 36.52  ? 167 LEU B O   1 
ATOM 2753 C CB  . LEU B 2 138 ? 40.348 -69.479  22.623 1.00 49.78  ? 167 LEU B CB  1 
ATOM 2754 C CG  . LEU B 2 138 ? 41.698 -69.024  22.065 1.00 42.99  ? 167 LEU B CG  1 
ATOM 2755 C CD1 . LEU B 2 138 ? 41.720 -67.544  21.819 1.00 43.31  ? 167 LEU B CD1 1 
ATOM 2756 C CD2 . LEU B 2 138 ? 42.825 -69.413  23.011 1.00 42.78  ? 167 LEU B CD2 1 
ATOM 2757 N N   . ALA B 2 139 ? 37.306 -70.296  23.028 1.00 39.70  ? 168 ALA B N   1 
ATOM 2758 C CA  . ALA B 2 139 ? 36.253 -71.172  23.526 1.00 40.93  ? 168 ALA B CA  1 
ATOM 2759 C C   . ALA B 2 139 ? 35.538 -71.865  22.372 1.00 44.69  ? 168 ALA B C   1 
ATOM 2760 O O   . ALA B 2 139 ? 35.339 -73.085  22.388 1.00 51.93  ? 168 ALA B O   1 
ATOM 2761 C CB  . ALA B 2 139 ? 35.265 -70.372  24.374 1.00 40.66  ? 168 ALA B CB  1 
ATOM 2762 N N   . GLY B 2 140 ? 35.170 -71.098  21.343 1.00 41.41  ? 169 GLY B N   1 
ATOM 2763 C CA  . GLY B 2 140 ? 34.475 -71.680  20.208 1.00 39.78  ? 169 GLY B CA  1 
ATOM 2764 C C   . GLY B 2 140 ? 35.304 -72.678  19.424 1.00 41.29  ? 169 GLY B C   1 
ATOM 2765 O O   . GLY B 2 140 ? 34.763 -73.654  18.892 1.00 47.40  ? 169 GLY B O   1 
ATOM 2766 N N   . ARG B 2 141 ? 36.619 -72.463  19.340 1.00 39.79  ? 170 ARG B N   1 
ATOM 2767 C CA  . ARG B 2 141 ? 37.445 -73.409  18.595 1.00 48.17  ? 170 ARG B CA  1 
ATOM 2768 C C   . ARG B 2 141 ? 37.688 -74.687  19.390 1.00 46.77  ? 170 ARG B C   1 
ATOM 2769 O O   . ARG B 2 141 ? 37.812 -75.766  18.796 1.00 46.58  ? 170 ARG B O   1 
ATOM 2770 C CB  . ARG B 2 141 ? 38.763 -72.763  18.155 1.00 50.61  ? 170 ARG B CB  1 
ATOM 2771 C CG  . ARG B 2 141 ? 39.730 -72.400  19.258 1.00 50.68  ? 170 ARG B CG  1 
ATOM 2772 C CD  . ARG B 2 141 ? 40.951 -71.698  18.683 1.00 47.06  ? 170 ARG B CD  1 
ATOM 2773 N NE  . ARG B 2 141 ? 40.582 -70.666  17.715 1.00 53.28  ? 170 ARG B NE  1 
ATOM 2774 C CZ  . ARG B 2 141 ? 41.441 -69.812  17.167 1.00 51.31  ? 170 ARG B CZ  1 
ATOM 2775 N NH1 . ARG B 2 141 ? 41.018 -68.905  16.295 1.00 46.19  ? 170 ARG B NH1 1 
ATOM 2776 N NH2 . ARG B 2 141 ? 42.726 -69.862  17.490 1.00 44.84  ? 170 ARG B NH2 1 
ATOM 2777 N N   . ARG B 2 142 ? 37.765 -74.598  20.721 1.00 47.26  ? 171 ARG B N   1 
ATOM 2778 C CA  . ARG B 2 142 ? 37.764 -75.823  21.514 1.00 44.95  ? 171 ARG B CA  1 
ATOM 2779 C C   . ARG B 2 142 ? 36.422 -76.539  21.425 1.00 44.37  ? 171 ARG B C   1 
ATOM 2780 O O   . ARG B 2 142 ? 36.375 -77.773  21.501 1.00 49.68  ? 171 ARG B O   1 
ATOM 2781 C CB  . ARG B 2 142 ? 38.109 -75.520  22.971 1.00 40.36  ? 171 ARG B CB  1 
ATOM 2782 C CG  . ARG B 2 142 ? 39.595 -75.383  23.216 1.00 45.29  ? 171 ARG B CG  1 
ATOM 2783 C CD  . ARG B 2 142 ? 39.894 -74.996  24.650 1.00 49.52  ? 171 ARG B CD  1 
ATOM 2784 N NE  . ARG B 2 142 ? 41.172 -74.300  24.749 1.00 71.52  ? 171 ARG B NE  1 
ATOM 2785 C CZ  . ARG B 2 142 ? 41.314 -72.981  24.648 1.00 68.28  ? 171 ARG B CZ  1 
ATOM 2786 N NH1 . ARG B 2 142 ? 40.252 -72.208  24.458 1.00 50.80  ? 171 ARG B NH1 1 
ATOM 2787 N NH2 . ARG B 2 142 ? 42.518 -72.432  24.746 1.00 73.86  ? 171 ARG B NH2 1 
ATOM 2788 N N   . GLN B 2 143 ? 35.327 -75.793  21.249 1.00 43.33  ? 172 GLN B N   1 
ATOM 2789 C CA  . GLN B 2 143 ? 34.030 -76.437  21.069 1.00 41.11  ? 172 GLN B CA  1 
ATOM 2790 C C   . GLN B 2 143 ? 33.958 -77.178  19.739 1.00 39.14  ? 172 GLN B C   1 
ATOM 2791 O O   . GLN B 2 143 ? 33.463 -78.309  19.683 1.00 48.11  ? 172 GLN B O   1 
ATOM 2792 C CB  . GLN B 2 143 ? 32.900 -75.412  21.177 1.00 46.77  ? 172 GLN B CB  1 
ATOM 2793 C CG  . GLN B 2 143 ? 32.732 -74.820  22.569 1.00 53.17  ? 172 GLN B CG  1 
ATOM 2794 C CD  . GLN B 2 143 ? 33.020 -75.825  23.672 1.00 64.29  ? 172 GLN B CD  1 
ATOM 2795 O OE1 . GLN B 2 143 ? 32.291 -76.803  23.846 1.00 70.84  ? 172 GLN B OE1 1 
ATOM 2796 N NE2 . GLN B 2 143 ? 34.091 -75.588  24.423 1.00 61.20  ? 172 GLN B NE2 1 
ATOM 2797 N N   . VAL B 2 144 ? 34.443 -76.566  18.655 1.00 38.87  ? 173 VAL B N   1 
ATOM 2798 C CA  . VAL B 2 144 ? 34.452 -77.273  17.375 1.00 44.97  ? 173 VAL B CA  1 
ATOM 2799 C C   . VAL B 2 144 ? 35.418 -78.456  17.423 1.00 46.42  ? 173 VAL B C   1 
ATOM 2800 O O   . VAL B 2 144 ? 35.166 -79.502  16.805 1.00 43.07  ? 173 VAL B O   1 
ATOM 2801 C CB  . VAL B 2 144 ? 34.764 -76.303  16.213 1.00 42.11  ? 173 VAL B CB  1 
ATOM 2802 C CG1 . VAL B 2 144 ? 36.246 -75.980  16.126 1.00 40.97  ? 173 VAL B CG1 1 
ATOM 2803 C CG2 . VAL B 2 144 ? 34.267 -76.876  14.893 1.00 44.73  ? 173 VAL B CG2 1 
ATOM 2804 N N   . GLU B 2 145 ? 36.526 -78.320  18.161 1.00 44.64  ? 174 GLU B N   1 
ATOM 2805 C CA  . GLU B 2 145 ? 37.477 -79.419  18.292 1.00 44.91  ? 174 GLU B CA  1 
ATOM 2806 C C   . GLU B 2 145 ? 36.838 -80.613  18.993 1.00 52.64  ? 174 GLU B C   1 
ATOM 2807 O O   . GLU B 2 145 ? 36.888 -81.745  18.494 1.00 55.02  ? 174 GLU B O   1 
ATOM 2808 C CB  . GLU B 2 145 ? 38.713 -78.944  19.058 1.00 42.99  ? 174 GLU B CB  1 
ATOM 2809 C CG  . GLU B 2 145 ? 39.684 -80.051  19.452 1.00 54.17  ? 174 GLU B CG  1 
ATOM 2810 C CD  . GLU B 2 145 ? 41.007 -79.511  19.978 1.00 69.46  ? 174 GLU B CD  1 
ATOM 2811 O OE1 . GLU B 2 145 ? 40.992 -78.466  20.663 1.00 69.60  ? 174 GLU B OE1 1 
ATOM 2812 O OE2 . GLU B 2 145 ? 42.060 -80.133  19.716 1.00 74.63  ? 174 GLU B OE2 1 
ATOM 2813 N N   . GLU B 2 146 ? 36.220 -80.374  20.154 1.00 54.24  ? 175 GLU B N   1 
ATOM 2814 C CA  . GLU B 2 146 ? 35.589 -81.462  20.895 1.00 50.73  ? 175 GLU B CA  1 
ATOM 2815 C C   . GLU B 2 146 ? 34.387 -82.027  20.150 1.00 44.83  ? 175 GLU B C   1 
ATOM 2816 O O   . GLU B 2 146 ? 34.089 -83.224  20.269 1.00 50.77  ? 175 GLU B O   1 
ATOM 2817 C CB  . GLU B 2 146 ? 35.173 -80.962  22.278 1.00 58.92  ? 175 GLU B CB  1 
ATOM 2818 C CG  . GLU B 2 146 ? 34.959 -82.044  23.316 1.00 70.99  ? 175 GLU B CG  1 
ATOM 2819 C CD  . GLU B 2 146 ? 34.638 -81.464  24.682 1.00 84.52  ? 175 GLU B CD  1 
ATOM 2820 O OE1 . GLU B 2 146 ? 34.743 -80.228  24.844 1.00 64.62  ? 175 GLU B OE1 1 
ATOM 2821 O OE2 . GLU B 2 146 ? 34.284 -82.243  25.592 1.00 105.09 ? 175 GLU B OE2 1 
ATOM 2822 N N   . LEU B 2 147 ? 33.704 -81.194  19.362 1.00 40.37  ? 176 LEU B N   1 
ATOM 2823 C CA  . LEU B 2 147 ? 32.611 -81.689  18.534 1.00 42.52  ? 176 LEU B CA  1 
ATOM 2824 C C   . LEU B 2 147 ? 33.124 -82.663  17.485 1.00 45.22  ? 176 LEU B C   1 
ATOM 2825 O O   . LEU B 2 147 ? 32.590 -83.767  17.331 1.00 42.77  ? 176 LEU B O   1 
ATOM 2826 C CB  . LEU B 2 147 ? 31.878 -80.526  17.870 1.00 43.19  ? 176 LEU B CB  1 
ATOM 2827 C CG  . LEU B 2 147 ? 30.822 -79.830  18.720 1.00 49.55  ? 176 LEU B CG  1 
ATOM 2828 C CD1 . LEU B 2 147 ? 30.149 -78.715  17.936 1.00 49.90  ? 176 LEU B CD1 1 
ATOM 2829 C CD2 . LEU B 2 147 ? 29.806 -80.852  19.201 1.00 49.56  ? 176 LEU B CD2 1 
ATOM 2830 N N   . GLN B 2 148 ? 34.174 -82.276  16.757 1.00 45.46  ? 177 GLN B N   1 
ATOM 2831 C CA  . GLN B 2 148 ? 34.722 -83.189  15.764 1.00 43.22  ? 177 GLN B CA  1 
ATOM 2832 C C   . GLN B 2 148 ? 35.297 -84.433  16.422 1.00 40.59  ? 177 GLN B C   1 
ATOM 2833 O O   . GLN B 2 148 ? 35.280 -85.516  15.825 1.00 49.54  ? 177 GLN B O   1 
ATOM 2834 C CB  . GLN B 2 148 ? 35.789 -82.481  14.932 1.00 48.95  ? 177 GLN B CB  1 
ATOM 2835 C CG  . GLN B 2 148 ? 36.213 -83.250  13.690 1.00 59.91  ? 177 GLN B CG  1 
ATOM 2836 C CD  . GLN B 2 148 ? 37.223 -82.491  12.852 1.00 61.38  ? 177 GLN B CD  1 
ATOM 2837 O OE1 . GLN B 2 148 ? 37.878 -81.567  13.337 1.00 53.66  ? 177 GLN B OE1 1 
ATOM 2838 N NE2 . GLN B 2 148 ? 37.353 -82.877  11.585 1.00 53.23  ? 177 GLN B NE2 1 
ATOM 2839 N N   . LEU B 2 149 ? 35.775 -84.305  17.662 1.00 38.37  ? 178 LEU B N   1 
ATOM 2840 C CA  . LEU B 2 149 ? 36.248 -85.472  18.396 1.00 41.02  ? 178 LEU B CA  1 
ATOM 2841 C C   . LEU B 2 149 ? 35.107 -86.441  18.691 1.00 42.28  ? 178 LEU B C   1 
ATOM 2842 O O   . LEU B 2 149 ? 35.267 -87.658  18.539 1.00 45.67  ? 178 LEU B O   1 
ATOM 2843 C CB  . LEU B 2 149 ? 36.936 -85.024  19.687 1.00 42.25  ? 178 LEU B CB  1 
ATOM 2844 C CG  . LEU B 2 149 ? 37.858 -86.004  20.419 1.00 44.44  ? 178 LEU B CG  1 
ATOM 2845 C CD1 . LEU B 2 149 ? 38.901 -85.245  21.224 1.00 36.69  ? 178 LEU B CD1 1 
ATOM 2846 C CD2 . LEU B 2 149 ? 37.070 -86.940  21.332 1.00 50.71  ? 178 LEU B CD2 1 
ATOM 2847 N N   . GLN B 2 150 ? 33.943 -85.924  19.092 1.00 38.93  ? 179 GLN B N   1 
ATOM 2848 C CA  . GLN B 2 150 ? 32.801 -86.806  19.317 1.00 41.62  ? 179 GLN B CA  1 
ATOM 2849 C C   . GLN B 2 150 ? 32.305 -87.412  18.010 1.00 39.86  ? 179 GLN B C   1 
ATOM 2850 O O   . GLN B 2 150 ? 31.943 -88.597  17.962 1.00 48.06  ? 179 GLN B O   1 
ATOM 2851 C CB  . GLN B 2 150 ? 31.680 -86.040  20.017 1.00 49.98  ? 179 GLN B CB  1 
ATOM 2852 C CG  . GLN B 2 150 ? 32.035 -85.598  21.428 1.00 59.64  ? 179 GLN B CG  1 
ATOM 2853 C CD  . GLN B 2 150 ? 30.871 -84.950  22.151 1.00 62.85  ? 179 GLN B CD  1 
ATOM 2854 O OE1 . GLN B 2 150 ? 29.876 -84.565  21.535 1.00 60.51  ? 179 GLN B OE1 1 
ATOM 2855 N NE2 . GLN B 2 150 ? 30.987 -84.831  23.469 1.00 63.27  ? 179 GLN B NE2 1 
ATOM 2856 N N   . VAL B 2 151 ? 32.287 -86.612  16.942 1.00 38.04  ? 180 VAL B N   1 
ATOM 2857 C CA  . VAL B 2 151 ? 31.890 -87.108  15.628 1.00 39.88  ? 180 VAL B CA  1 
ATOM 2858 C C   . VAL B 2 151 ? 32.749 -88.300  15.225 1.00 37.99  ? 180 VAL B C   1 
ATOM 2859 O O   . VAL B 2 151 ? 32.233 -89.378  14.902 1.00 34.64  ? 180 VAL B O   1 
ATOM 2860 C CB  . VAL B 2 151 ? 31.964 -85.979  14.585 1.00 35.29  ? 180 VAL B CB  1 
ATOM 2861 C CG1 . VAL B 2 151 ? 31.931 -86.548  13.178 1.00 25.25  ? 180 VAL B CG1 1 
ATOM 2862 C CG2 . VAL B 2 151 ? 30.818 -85.006  14.790 1.00 44.09  ? 180 VAL B CG2 1 
ATOM 2863 N N   . GLN B 2 152 ? 34.074 -88.130  15.243 1.00 35.62  ? 181 GLN B N   1 
ATOM 2864 C CA  . GLN B 2 152 ? 34.929 -89.248  14.864 1.00 35.77  ? 181 GLN B CA  1 
ATOM 2865 C C   . GLN B 2 152 ? 34.819 -90.393  15.862 1.00 46.09  ? 181 GLN B C   1 
ATOM 2866 O O   . GLN B 2 152 ? 35.011 -91.557  15.489 1.00 50.67  ? 181 GLN B O   1 
ATOM 2867 C CB  . GLN B 2 152 ? 36.384 -88.804  14.726 1.00 31.87  ? 181 GLN B CB  1 
ATOM 2868 C CG  . GLN B 2 152 ? 37.166 -88.818  16.023 1.00 39.37  ? 181 GLN B CG  1 
ATOM 2869 C CD  . GLN B 2 152 ? 38.614 -89.206  15.815 1.00 48.82  ? 181 GLN B CD  1 
ATOM 2870 O OE1 . GLN B 2 152 ? 39.134 -89.134  14.702 1.00 53.80  ? 181 GLN B OE1 1 
ATOM 2871 N NE2 . GLN B 2 152 ? 39.275 -89.624  16.889 1.00 53.36  ? 181 GLN B NE2 1 
ATOM 2872 N N   . ALA B 2 153 ? 34.506 -90.091  17.125 1.00 43.95  ? 182 ALA B N   1 
ATOM 2873 C CA  . ALA B 2 153 ? 34.366 -91.144  18.125 1.00 42.69  ? 182 ALA B CA  1 
ATOM 2874 C C   . ALA B 2 153 ? 33.235 -92.095  17.754 1.00 36.81  ? 182 ALA B C   1 
ATOM 2875 O O   . ALA B 2 153 ? 33.441 -93.307  17.609 1.00 37.05  ? 182 ALA B O   1 
ATOM 2876 C CB  . ALA B 2 153 ? 34.132 -90.529  19.506 1.00 46.19  ? 182 ALA B CB  1 
ATOM 2877 N N   . GLN B 2 154 ? 32.026 -91.554  17.576 1.00 37.14  ? 183 GLN B N   1 
ATOM 2878 C CA  . GLN B 2 154 ? 30.908 -92.403  17.174 1.00 38.16  ? 183 GLN B CA  1 
ATOM 2879 C C   . GLN B 2 154 ? 31.107 -92.970  15.772 1.00 35.98  ? 183 GLN B C   1 
ATOM 2880 O O   . GLN B 2 154 ? 30.580 -94.047  15.455 1.00 37.56  ? 183 GLN B O   1 
ATOM 2881 C CB  . GLN B 2 154 ? 29.601 -91.623  17.259 1.00 33.97  ? 183 GLN B CB  1 
ATOM 2882 C CG  . GLN B 2 154 ? 28.964 -91.580  18.631 1.00 40.27  ? 183 GLN B CG  1 
ATOM 2883 C CD  . GLN B 2 154 ? 27.496 -91.197  18.567 1.00 51.19  ? 183 GLN B CD  1 
ATOM 2884 O OE1 . GLN B 2 154 ? 26.733 -91.746  17.770 1.00 43.20  ? 183 GLN B OE1 1 
ATOM 2885 N NE2 . GLN B 2 154 ? 27.092 -90.252  19.410 1.00 63.16  ? 183 GLN B NE2 1 
ATOM 2886 N N   . GLN B 2 155 ? 31.860 -92.268  14.923 1.00 35.93  ? 184 GLN B N   1 
ATOM 2887 C CA  . GLN B 2 155 ? 32.192 -92.814  13.612 1.00 39.47  ? 184 GLN B CA  1 
ATOM 2888 C C   . GLN B 2 155 ? 32.952 -94.125  13.756 1.00 32.23  ? 184 GLN B C   1 
ATOM 2889 O O   . GLN B 2 155 ? 32.567 -95.148  13.178 1.00 33.13  ? 184 GLN B O   1 
ATOM 2890 C CB  . GLN B 2 155 ? 33.002 -91.801  12.801 1.00 47.48  ? 184 GLN B CB  1 
ATOM 2891 C CG  . GLN B 2 155 ? 33.110 -92.146  11.319 1.00 41.76  ? 184 GLN B CG  1 
ATOM 2892 C CD  . GLN B 2 155 ? 34.355 -91.573  10.667 1.00 40.86  ? 184 GLN B CD  1 
ATOM 2893 O OE1 . GLN B 2 155 ? 35.317 -91.212  11.346 1.00 46.86  ? 184 GLN B OE1 1 
ATOM 2894 N NE2 . GLN B 2 155 ? 34.347 -91.499  9.341  1.00 42.12  ? 184 GLN B NE2 1 
ATOM 2895 N N   . GLN B 2 156 ? 34.032 -94.116  14.542 1.00 32.42  ? 185 GLN B N   1 
ATOM 2896 C CA  . GLN B 2 156 ? 34.759 -95.353  14.798 1.00 38.68  ? 185 GLN B CA  1 
ATOM 2897 C C   . GLN B 2 156 ? 33.884 -96.366  15.524 1.00 39.18  ? 185 GLN B C   1 
ATOM 2898 O O   . GLN B 2 156 ? 34.066 -97.580  15.356 1.00 34.87  ? 185 GLN B O   1 
ATOM 2899 C CB  . GLN B 2 156 ? 36.014 -95.068  15.623 1.00 36.45  ? 185 GLN B CB  1 
ATOM 2900 C CG  . GLN B 2 156 ? 36.973 -94.075  14.997 1.00 40.33  ? 185 GLN B CG  1 
ATOM 2901 C CD  . GLN B 2 156 ? 38.073 -93.650  15.956 1.00 47.15  ? 185 GLN B CD  1 
ATOM 2902 O OE1 . GLN B 2 156 ? 37.888 -93.655  17.174 1.00 43.72  ? 185 GLN B OE1 1 
ATOM 2903 N NE2 . GLN B 2 156 ? 39.225 -93.275  15.408 1.00 44.69  ? 185 GLN B NE2 1 
ATOM 2904 N N   . ALA B 2 157 ? 32.915 -95.890  16.313 1.00 37.40  ? 186 ALA B N   1 
ATOM 2905 C CA  . ALA B 2 157 ? 31.970 -96.802  16.949 1.00 31.19  ? 186 ALA B CA  1 
ATOM 2906 C C   . ALA B 2 157 ? 31.180 -97.593  15.914 1.00 30.92  ? 186 ALA B C   1 
ATOM 2907 O O   . ALA B 2 157 ? 30.922 -98.786  16.102 1.00 40.93  ? 186 ALA B O   1 
ATOM 2908 C CB  . ALA B 2 157 ? 31.029 -96.031  17.873 1.00 29.42  ? 186 ALA B CB  1 
ATOM 2909 N N   . TRP B 2 158 ? 30.789 -96.955  14.811 1.00 31.36  ? 187 TRP B N   1 
ATOM 2910 C CA  . TRP B 2 158 ? 30.148 -97.714  13.741 1.00 28.66  ? 187 TRP B CA  1 
ATOM 2911 C C   . TRP B 2 158 ? 31.137 -98.450  12.850 1.00 33.67  ? 187 TRP B C   1 
ATOM 2912 O O   . TRP B 2 158 ? 30.734 -99.385  12.150 1.00 37.73  ? 187 TRP B O   1 
ATOM 2913 C CB  . TRP B 2 158 ? 29.270 -96.805  12.891 1.00 30.41  ? 187 TRP B CB  1 
ATOM 2914 C CG  . TRP B 2 158 ? 27.921 -96.626  13.473 1.00 35.45  ? 187 TRP B CG  1 
ATOM 2915 C CD1 . TRP B 2 158 ? 27.512 -95.628  14.308 1.00 48.11  ? 187 TRP B CD1 1 
ATOM 2916 C CD2 . TRP B 2 158 ? 26.780 -97.455  13.246 1.00 35.80  ? 187 TRP B CD2 1 
ATOM 2917 N NE1 . TRP B 2 158 ? 26.186 -95.794  14.627 1.00 58.23  ? 187 TRP B NE1 1 
ATOM 2918 C CE2 . TRP B 2 158 ? 25.713 -96.909  13.986 1.00 48.56  ? 187 TRP B CE2 1 
ATOM 2919 C CE3 . TRP B 2 158 ? 26.557 -98.608  12.492 1.00 35.49  ? 187 TRP B CE3 1 
ATOM 2920 C CZ2 . TRP B 2 158 ? 24.442 -97.478  13.994 1.00 38.02  ? 187 TRP B CZ2 1 
ATOM 2921 C CZ3 . TRP B 2 158 ? 25.299 -99.171  12.502 1.00 37.20  ? 187 TRP B CZ3 1 
ATOM 2922 C CH2 . TRP B 2 158 ? 24.256 -98.607  13.248 1.00 36.14  ? 187 TRP B CH2 1 
ATOM 2923 N N   . GLN B 2 159 ? 32.410 -98.054  12.843 1.00 35.40  ? 188 GLN B N   1 
ATOM 2924 C CA  . GLN B 2 159 ? 33.402 -98.807  12.083 1.00 37.35  ? 188 GLN B CA  1 
ATOM 2925 C C   . GLN B 2 159 ? 33.856 -100.069 12.801 1.00 40.24  ? 188 GLN B C   1 
ATOM 2926 O O   . GLN B 2 159 ? 34.441 -100.953 12.163 1.00 37.08  ? 188 GLN B O   1 
ATOM 2927 C CB  . GLN B 2 159 ? 34.627 -97.938  11.795 1.00 38.34  ? 188 GLN B CB  1 
ATOM 2928 C CG  . GLN B 2 159 ? 34.328 -96.627  11.094 1.00 39.61  ? 188 GLN B CG  1 
ATOM 2929 C CD  . GLN B 2 159 ? 35.554 -95.742  10.987 1.00 42.43  ? 188 GLN B CD  1 
ATOM 2930 O OE1 . GLN B 2 159 ? 35.633 -94.692  11.628 1.00 45.45  ? 188 GLN B OE1 1 
ATOM 2931 N NE2 . GLN B 2 159 ? 36.516 -96.158  10.173 1.00 45.20  ? 188 GLN B NE2 1 
ATOM 2932 N N   . ALA B 2 160 ? 33.587 -100.177 14.105 1.00 45.67  ? 189 ALA B N   1 
ATOM 2933 C CA  . ALA B 2 160 ? 34.034 -101.332 14.877 1.00 43.64  ? 189 ALA B CA  1 
ATOM 2934 C C   . ALA B 2 160 ? 33.293 -102.610 14.512 1.00 43.62  ? 189 ALA B C   1 
ATOM 2935 O O   . ALA B 2 160 ? 33.781 -103.698 14.828 1.00 47.49  ? 189 ALA B O   1 
ATOM 2936 C CB  . ALA B 2 160 ? 33.876 -101.060 16.373 1.00 42.36  ? 189 ALA B CB  1 
ATOM 2937 N N   . LEU B 2 161 ? 32.130 -102.507 13.865 1.00 40.84  ? 190 LEU B N   1 
ATOM 2938 C CA  . LEU B 2 161 ? 31.369 -103.699 13.503 1.00 43.40  ? 190 LEU B CA  1 
ATOM 2939 C C   . LEU B 2 161 ? 32.105 -104.579 12.500 1.00 41.05  ? 190 LEU B C   1 
ATOM 2940 O O   . LEU B 2 161 ? 31.783 -105.767 12.374 1.00 40.96  ? 190 LEU B O   1 
ATOM 2941 C CB  . LEU B 2 161 ? 30.006 -103.294 12.940 1.00 38.58  ? 190 LEU B CB  1 
ATOM 2942 C CG  . LEU B 2 161 ? 29.173 -102.366 13.827 1.00 31.03  ? 190 LEU B CG  1 
ATOM 2943 C CD1 . LEU B 2 161 ? 27.985 -101.802 13.061 1.00 31.13  ? 190 LEU B CD1 1 
ATOM 2944 C CD2 . LEU B 2 161 ? 28.716 -103.082 15.083 1.00 42.50  ? 190 LEU B CD2 1 
ATOM 2945 N N   . HIS B 2 162 ? 33.097 -104.024 11.801 1.00 42.41  ? 191 HIS B N   1 
ATOM 2946 C CA  . HIS B 2 162 ? 33.758 -104.747 10.719 1.00 42.48  ? 191 HIS B CA  1 
ATOM 2947 C C   . HIS B 2 162 ? 34.422 -106.025 11.217 1.00 46.74  ? 191 HIS B C   1 
ATOM 2948 O O   . HIS B 2 162 ? 34.348 -107.068 10.555 1.00 52.35  ? 191 HIS B O   1 
ATOM 2949 C CB  . HIS B 2 162 ? 34.777 -103.831 10.047 1.00 50.39  ? 191 HIS B CB  1 
ATOM 2950 C CG  . HIS B 2 162 ? 35.778 -104.554 9.204  1.00 45.22  ? 191 HIS B CG  1 
ATOM 2951 N ND1 . HIS B 2 162 ? 35.444 -105.170 8.019  1.00 38.94  ? 191 HIS B ND1 1 
ATOM 2952 C CD2 . HIS B 2 162 ? 37.108 -104.747 9.369  1.00 47.48  ? 191 HIS B CD2 1 
ATOM 2953 C CE1 . HIS B 2 162 ? 36.525 -105.716 7.491  1.00 46.13  ? 191 HIS B CE1 1 
ATOM 2954 N NE2 . HIS B 2 162 ? 37.548 -105.473 8.291  1.00 42.77  ? 191 HIS B NE2 1 
ATOM 2955 N N   . ARG B 2 163 ? 35.070 -105.970 12.383 1.00 42.72  ? 192 ARG B N   1 
ATOM 2956 C CA  . ARG B 2 163 ? 35.692 -107.167 12.941 1.00 39.91  ? 192 ARG B CA  1 
ATOM 2957 C C   . ARG B 2 163 ? 34.647 -108.241 13.230 1.00 48.08  ? 192 ARG B C   1 
ATOM 2958 O O   . ARG B 2 163 ? 34.857 -109.426 12.933 1.00 47.65  ? 192 ARG B O   1 
ATOM 2959 C CB  . ARG B 2 163 ? 36.470 -106.801 14.206 1.00 38.69  ? 192 ARG B CB  1 
ATOM 2960 C CG  . ARG B 2 163 ? 35.606 -106.147 15.266 1.00 57.04  ? 192 ARG B CG  1 
ATOM 2961 C CD  . ARG B 2 163 ? 36.342 -105.796 16.544 1.00 77.49  ? 192 ARG B CD  1 
ATOM 2962 N NE  . ARG B 2 163 ? 35.411 -105.210 17.507 1.00 93.13  ? 192 ARG B NE  1 
ATOM 2963 C CZ  . ARG B 2 163 ? 35.749 -104.750 18.706 1.00 101.20 ? 192 ARG B CZ  1 
ATOM 2964 N NH1 . ARG B 2 163 ? 34.820 -104.236 19.504 1.00 90.79  ? 192 ARG B NH1 1 
ATOM 2965 N NH2 . ARG B 2 163 ? 37.011 -104.804 19.111 1.00 114.51 ? 192 ARG B NH2 1 
ATOM 2966 N N   . GLU B 2 164 ? 33.514 -107.841 13.811 1.00 48.99  ? 193 GLU B N   1 
ATOM 2967 C CA  . GLU B 2 164 ? 32.441 -108.785 14.096 1.00 47.79  ? 193 GLU B CA  1 
ATOM 2968 C C   . GLU B 2 164 ? 31.937 -109.440 12.817 1.00 43.04  ? 193 GLU B C   1 
ATOM 2969 O O   . GLU B 2 164 ? 31.704 -110.655 12.778 1.00 47.72  ? 193 GLU B O   1 
ATOM 2970 C CB  . GLU B 2 164 ? 31.302 -108.058 14.809 1.00 41.91  ? 193 GLU B CB  1 
ATOM 2971 C CG  . GLU B 2 164 ? 31.721 -107.263 16.051 1.00 49.35  ? 193 GLU B CG  1 
ATOM 2972 C CD  . GLU B 2 164 ? 32.688 -107.994 16.973 1.00 64.54  ? 193 GLU B CD  1 
ATOM 2973 O OE1 . GLU B 2 164 ? 32.631 -109.240 17.064 1.00 74.03  ? 193 GLU B OE1 1 
ATOM 2974 O OE2 . GLU B 2 164 ? 33.517 -107.310 17.612 1.00 64.13  ? 193 GLU B OE2 1 
ATOM 2975 N N   . GLN B 2 165 ? 31.789 -108.651 11.751 1.00 38.60  ? 194 GLN B N   1 
ATOM 2976 C CA  . GLN B 2 165 ? 31.380 -109.209 10.468 1.00 38.36  ? 194 GLN B CA  1 
ATOM 2977 C C   . GLN B 2 165 ? 32.430 -110.165 9.915  1.00 41.82  ? 194 GLN B C   1 
ATOM 2978 O O   . GLN B 2 165 ? 32.092 -111.178 9.289  1.00 42.93  ? 194 GLN B O   1 
ATOM 2979 C CB  . GLN B 2 165 ? 31.109 -108.078 9.483  1.00 40.95  ? 194 GLN B CB  1 
ATOM 2980 C CG  . GLN B 2 165 ? 30.216 -106.984 10.042 1.00 44.74  ? 194 GLN B CG  1 
ATOM 2981 C CD  . GLN B 2 165 ? 29.876 -105.940 9.007  1.00 47.96  ? 194 GLN B CD  1 
ATOM 2982 O OE1 . GLN B 2 165 ? 29.354 -106.262 7.943  1.00 47.74  ? 194 GLN B OE1 1 
ATOM 2983 N NE2 . GLN B 2 165 ? 30.172 -104.678 9.310  1.00 45.24  ? 194 GLN B NE2 1 
ATOM 2984 N N   . ARG B 2 166 ? 33.711 -109.872 10.147 1.00 42.22  ? 195 ARG B N   1 
ATOM 2985 C CA  . ARG B 2 166 ? 34.760 -110.737 9.618  1.00 44.34  ? 195 ARG B CA  1 
ATOM 2986 C C   . ARG B 2 166 ? 34.779 -112.071 10.345 1.00 47.26  ? 195 ARG B C   1 
ATOM 2987 O O   . ARG B 2 166 ? 35.039 -113.115 9.734  1.00 47.91  ? 195 ARG B O   1 
ATOM 2988 C CB  . ARG B 2 166 ? 36.124 -110.057 9.703  1.00 46.51  ? 195 ARG B CB  1 
ATOM 2989 C CG  . ARG B 2 166 ? 36.347 -109.049 8.599  1.00 55.69  ? 195 ARG B CG  1 
ATOM 2990 C CD  . ARG B 2 166 ? 37.819 -108.730 8.401  1.00 62.62  ? 195 ARG B CD  1 
ATOM 2991 N NE  . ARG B 2 166 ? 38.661 -109.175 9.507  1.00 54.73  ? 195 ARG B NE  1 
ATOM 2992 C CZ  . ARG B 2 166 ? 39.580 -110.125 9.406  1.00 54.61  ? 195 ARG B CZ  1 
ATOM 2993 N NH1 . ARG B 2 166 ? 39.780 -110.727 8.245  1.00 57.58  ? 195 ARG B NH1 1 
ATOM 2994 N NH2 . ARG B 2 166 ? 40.305 -110.460 10.461 1.00 58.66  ? 195 ARG B NH2 1 
ATOM 2995 N N   . GLU B 2 167 ? 34.516 -112.060 11.654 1.00 51.89  ? 196 GLU B N   1 
ATOM 2996 C CA  . GLU B 2 167 ? 34.441 -113.327 12.371 1.00 49.12  ? 196 GLU B CA  1 
ATOM 2997 C C   . GLU B 2 167 ? 33.144 -114.063 12.059 1.00 48.46  ? 196 GLU B C   1 
ATOM 2998 O O   . GLU B 2 167 ? 33.110 -115.300 12.102 1.00 51.89  ? 196 GLU B O   1 
ATOM 2999 C CB  . GLU B 2 167 ? 34.568 -113.067 13.875 1.00 54.44  ? 196 GLU B CB  1 
ATOM 3000 C CG  . GLU B 2 167 ? 34.115 -114.198 14.786 1.00 50.55  ? 196 GLU B CG  1 
ATOM 3001 C CD  . GLU B 2 167 ? 33.899 -113.738 16.217 1.00 63.13  ? 196 GLU B CD  1 
ATOM 3002 O OE1 . GLU B 2 167 ? 33.810 -112.511 16.444 1.00 70.08  ? 196 GLU B OE1 1 
ATOM 3003 O OE2 . GLU B 2 167 ? 33.829 -114.603 17.115 1.00 59.13  ? 196 GLU B OE2 1 
ATOM 3004 N N   . LEU B 2 168 ? 32.094 -113.338 11.661 1.00 45.02  ? 197 LEU B N   1 
ATOM 3005 C CA  . LEU B 2 168 ? 30.909 -113.999 11.120 1.00 39.05  ? 197 LEU B CA  1 
ATOM 3006 C C   . LEU B 2 168 ? 31.230 -114.746 9.832  1.00 38.08  ? 197 LEU B C   1 
ATOM 3007 O O   . LEU B 2 168 ? 30.875 -115.920 9.676  1.00 38.43  ? 197 LEU B O   1 
ATOM 3008 C CB  . LEU B 2 168 ? 29.795 -112.986 10.880 1.00 35.43  ? 197 LEU B CB  1 
ATOM 3009 C CG  . LEU B 2 168 ? 28.573 -113.612 10.209 1.00 35.87  ? 197 LEU B CG  1 
ATOM 3010 C CD1 . LEU B 2 168 ? 27.333 -113.347 11.027 1.00 37.16  ? 197 LEU B CD1 1 
ATOM 3011 C CD2 . LEU B 2 168 ? 28.402 -113.087 8.796  1.00 46.26  ? 197 LEU B CD2 1 
ATOM 3012 N N   . VAL B 2 169 ? 31.901 -114.076 8.891  1.00 43.39  ? 198 VAL B N   1 
ATOM 3013 C CA  . VAL B 2 169 ? 32.262 -114.722 7.632  1.00 46.03  ? 198 VAL B CA  1 
ATOM 3014 C C   . VAL B 2 169 ? 33.242 -115.859 7.871  1.00 46.31  ? 198 VAL B C   1 
ATOM 3015 O O   . VAL B 2 169 ? 33.225 -116.867 7.153  1.00 49.10  ? 198 VAL B O   1 
ATOM 3016 C CB  . VAL B 2 169 ? 32.832 -113.678 6.650  1.00 48.92  ? 198 VAL B CB  1 
ATOM 3017 C CG1 . VAL B 2 169 ? 33.232 -114.326 5.334  1.00 50.88  ? 198 VAL B CG1 1 
ATOM 3018 C CG2 . VAL B 2 169 ? 31.813 -112.579 6.409  1.00 46.47  ? 198 VAL B CG2 1 
ATOM 3019 N N   . ALA B 2 170 ? 34.098 -115.729 8.885  1.00 45.81  ? 199 ALA B N   1 
ATOM 3020 C CA  . ALA B 2 170 ? 35.016 -116.813 9.214  1.00 53.84  ? 199 ALA B CA  1 
ATOM 3021 C C   . ALA B 2 170 ? 34.265 -118.027 9.750  1.00 56.47  ? 199 ALA B C   1 
ATOM 3022 O O   . ALA B 2 170 ? 34.602 -119.170 9.415  1.00 51.45  ? 199 ALA B O   1 
ATOM 3023 C CB  . ALA B 2 170 ? 36.057 -116.329 10.222 1.00 55.48  ? 199 ALA B CB  1 
ATOM 3024 N N   . VAL B 2 171 ? 33.240 -117.802 10.578 1.00 52.55  ? 200 VAL B N   1 
ATOM 3025 C CA  . VAL B 2 171 ? 32.444 -118.916 11.086 1.00 48.00  ? 200 VAL B CA  1 
ATOM 3026 C C   . VAL B 2 171 ? 31.688 -119.586 9.947  1.00 46.69  ? 200 VAL B C   1 
ATOM 3027 O O   . VAL B 2 171 ? 31.544 -120.814 9.911  1.00 48.70  ? 200 VAL B O   1 
ATOM 3028 C CB  . VAL B 2 171 ? 31.486 -118.430 12.189 1.00 43.75  ? 200 VAL B CB  1 
ATOM 3029 C CG1 . VAL B 2 171 ? 30.344 -119.423 12.395 1.00 48.48  ? 200 VAL B CG1 1 
ATOM 3030 C CG2 . VAL B 2 171 ? 32.237 -118.208 13.485 1.00 39.50  ? 200 VAL B CG2 1 
ATOM 3031 N N   . LEU B 2 172 ? 31.222 -118.794 8.989  1.00 46.69  ? 201 LEU B N   1 
ATOM 3032 C CA  . LEU B 2 172 ? 30.345 -119.261 7.931  1.00 44.51  ? 201 LEU B CA  1 
ATOM 3033 C C   . LEU B 2 172 ? 31.108 -119.810 6.735  1.00 51.05  ? 201 LEU B C   1 
ATOM 3034 O O   . LEU B 2 172 ? 30.508 -120.017 5.676  1.00 52.72  ? 201 LEU B O   1 
ATOM 3035 C CB  . LEU B 2 172 ? 29.432 -118.119 7.486  1.00 41.55  ? 201 LEU B CB  1 
ATOM 3036 C CG  . LEU B 2 172 ? 27.955 -118.460 7.337  1.00 41.10  ? 201 LEU B CG  1 
ATOM 3037 C CD1 . LEU B 2 172 ? 27.543 -119.371 8.471  1.00 50.63  ? 201 LEU B CD1 1 
ATOM 3038 C CD2 . LEU B 2 172 ? 27.132 -117.191 7.355  1.00 46.12  ? 201 LEU B CD2 1 
ATOM 3039 N N   . ARG B 2 173 ? 32.408 -120.052 6.876  1.00 52.63  ? 202 ARG B N   1 
ATOM 3040 C CA  . ARG B 2 173 ? 33.249 -120.512 5.779  1.00 63.46  ? 202 ARG B CA  1 
ATOM 3041 C C   . ARG B 2 173 ? 33.734 -121.928 6.067  1.00 67.17  ? 202 ARG B C   1 
ATOM 3042 O O   . ARG B 2 173 ? 34.288 -122.195 7.140  1.00 66.18  ? 202 ARG B O   1 
ATOM 3043 C CB  . ARG B 2 173 ? 34.430 -119.561 5.567  1.00 68.30  ? 202 ARG B CB  1 
ATOM 3044 C CG  . ARG B 2 173 ? 35.443 -120.020 4.525  1.00 78.77  ? 202 ARG B CG  1 
ATOM 3045 C CD  . ARG B 2 173 ? 36.260 -118.841 4.006  1.00 77.55  ? 202 ARG B CD  1 
ATOM 3046 N NE  . ARG B 2 173 ? 36.524 -117.857 5.052  1.00 79.44  ? 202 ARG B NE  1 
ATOM 3047 C CZ  . ARG B 2 173 ? 37.680 -117.739 5.698  1.00 76.53  ? 202 ARG B CZ  1 
ATOM 3048 N NH1 . ARG B 2 173 ? 38.696 -118.536 5.398  1.00 75.22  ? 202 ARG B NH1 1 
ATOM 3049 N NH2 . ARG B 2 173 ? 37.823 -116.815 6.639  1.00 64.80  ? 202 ARG B NH2 1 
ATOM 3050 N N   . GLU B 2 174 ? 33.517 -122.827 5.109  1.00 70.17  ? 203 GLU B N   1 
ATOM 3051 C CA  . GLU B 2 174 ? 33.882 -124.234 5.255  1.00 68.40  ? 203 GLU B CA  1 
ATOM 3052 C C   . GLU B 2 174 ? 35.378 -124.447 5.058  1.00 67.61  ? 203 GLU B C   1 
ATOM 3053 O O   . GLU B 2 174 ? 35.794 -125.289 4.261  1.00 57.66  ? 203 GLU B O   1 
ATOM 3054 C CB  . GLU B 2 174 ? 33.093 -125.088 4.270  1.00 55.95  ? 203 GLU B CB  1 
ATOM 3055 N N   . SER C 3 19  ? 82.176 2.456    23.268 1.00 54.03  ? 203 SER D N   1 
ATOM 3056 C CA  . SER C 3 19  ? 82.552 2.208    21.880 1.00 68.97  ? 203 SER D CA  1 
ATOM 3057 C C   . SER C 3 19  ? 81.324 2.197    20.974 1.00 71.68  ? 203 SER D C   1 
ATOM 3058 O O   . SER C 3 19  ? 80.558 1.232    20.961 1.00 74.72  ? 203 SER D O   1 
ATOM 3059 C CB  . SER C 3 19  ? 83.310 0.885    21.756 1.00 69.92  ? 203 SER D CB  1 
ATOM 3060 O OG  . SER C 3 19  ? 83.493 0.529    20.397 1.00 64.85  ? 203 SER D OG  1 
ATOM 3061 N N   . LEU C 3 20  ? 81.151 3.280    20.213 1.00 68.68  ? 204 LEU D N   1 
ATOM 3062 C CA  . LEU C 3 20  ? 79.984 3.408    19.344 1.00 69.60  ? 204 LEU D CA  1 
ATOM 3063 C C   . LEU C 3 20  ? 79.970 2.335    18.259 1.00 70.83  ? 204 LEU D C   1 
ATOM 3064 O O   . LEU C 3 20  ? 78.904 1.809    17.908 1.00 67.44  ? 204 LEU D O   1 
ATOM 3065 C CB  . LEU C 3 20  ? 79.965 4.810    18.728 1.00 61.58  ? 204 LEU D CB  1 
ATOM 3066 C CG  . LEU C 3 20  ? 78.773 5.305    17.901 1.00 62.65  ? 204 LEU D CG  1 
ATOM 3067 C CD1 . LEU C 3 20  ? 78.901 4.922    16.429 1.00 69.91  ? 204 LEU D CD1 1 
ATOM 3068 C CD2 . LEU C 3 20  ? 77.466 4.794    18.485 1.00 73.69  ? 204 LEU D CD2 1 
ATOM 3069 N N   . GLU C 3 21  ? 81.143 1.997    17.716 1.00 72.93  ? 205 GLU D N   1 
ATOM 3070 C CA  . GLU C 3 21  ? 81.220 1.009    16.643 1.00 71.09  ? 205 GLU D CA  1 
ATOM 3071 C C   . GLU C 3 21  ? 80.707 -0.355   17.092 1.00 75.32  ? 205 GLU D C   1 
ATOM 3072 O O   . GLU C 3 21  ? 79.923 -1.001   16.385 1.00 75.07  ? 205 GLU D O   1 
ATOM 3073 C CB  . GLU C 3 21  ? 82.658 0.904    16.133 1.00 73.77  ? 205 GLU D CB  1 
ATOM 3074 C CG  . GLU C 3 21  ? 83.700 0.778    17.232 1.00 73.03  ? 205 GLU D CG  1 
ATOM 3075 C CD  . GLU C 3 21  ? 84.902 -0.037   16.807 1.00 75.52  ? 205 GLU D CD  1 
ATOM 3076 O OE1 . GLU C 3 21  ? 85.632 -0.522   17.696 1.00 79.65  ? 205 GLU D OE1 1 
ATOM 3077 O OE2 . GLU C 3 21  ? 85.111 -0.202   15.586 1.00 75.63  ? 205 GLU D OE2 1 
ATOM 3078 N N   . ALA C 3 22  ? 81.143 -0.816   18.267 1.00 78.71  ? 206 ALA D N   1 
ATOM 3079 C CA  . ALA C 3 22  ? 80.715 -2.127   18.743 1.00 75.28  ? 206 ALA D CA  1 
ATOM 3080 C C   . ALA C 3 22  ? 79.217 -2.154   19.006 1.00 66.16  ? 206 ALA D C   1 
ATOM 3081 O O   . ALA C 3 22  ? 78.536 -3.132   18.678 1.00 60.81  ? 206 ALA D O   1 
ATOM 3082 C CB  . ALA C 3 22  ? 81.488 -2.505   20.007 1.00 69.80  ? 206 ALA D CB  1 
ATOM 3083 N N   . SER C 3 23  ? 78.685 -1.076   19.580 1.00 73.50  ? 207 SER D N   1 
ATOM 3084 C CA  . SER C 3 23  ? 77.260 -1.019   19.882 1.00 71.86  ? 207 SER D CA  1 
ATOM 3085 C C   . SER C 3 23  ? 76.417 -1.021   18.610 1.00 67.51  ? 207 SER D C   1 
ATOM 3086 O O   . SER C 3 23  ? 75.443 -1.778   18.501 1.00 65.51  ? 207 SER D O   1 
ATOM 3087 C CB  . SER C 3 23  ? 76.968 0.209    20.738 1.00 71.65  ? 207 SER D CB  1 
ATOM 3088 O OG  . SER C 3 23  ? 77.443 1.384    20.108 1.00 78.97  ? 207 SER D OG  1 
ATOM 3089 N N   . VAL C 3 24  ? 76.776 -0.185   17.629 1.00 68.75  ? 208 VAL D N   1 
ATOM 3090 C CA  . VAL C 3 24  ? 76.020 -0.182   16.379 1.00 69.17  ? 208 VAL D CA  1 
ATOM 3091 C C   . VAL C 3 24  ? 76.177 -1.520   15.671 1.00 61.08  ? 208 VAL D C   1 
ATOM 3092 O O   . VAL C 3 24  ? 75.281 -1.954   14.936 1.00 58.31  ? 208 VAL D O   1 
ATOM 3093 C CB  . VAL C 3 24  ? 76.439 1.002    15.479 1.00 68.26  ? 208 VAL D CB  1 
ATOM 3094 C CG1 . VAL C 3 24  ? 77.880 0.867    15.024 1.00 70.13  ? 208 VAL D CG1 1 
ATOM 3095 C CG2 . VAL C 3 24  ? 75.507 1.120    14.280 1.00 62.37  ? 208 VAL D CG2 1 
ATOM 3096 N N   . ALA C 3 25  ? 77.303 -2.203   15.890 1.00 60.00  ? 209 ALA D N   1 
ATOM 3097 C CA  . ALA C 3 25  ? 77.485 -3.531   15.316 1.00 64.12  ? 209 ALA D CA  1 
ATOM 3098 C C   . ALA C 3 25  ? 76.507 -4.528   15.929 1.00 63.04  ? 209 ALA D C   1 
ATOM 3099 O O   . ALA C 3 25  ? 75.798 -5.239   15.206 1.00 54.25  ? 209 ALA D O   1 
ATOM 3100 C CB  . ALA C 3 25  ? 78.929 -3.994   15.512 1.00 60.11  ? 209 ALA D CB  1 
ATOM 3101 N N   . GLU C 3 26  ? 76.461 -4.598   17.266 1.00 67.04  ? 210 GLU D N   1 
ATOM 3102 C CA  . GLU C 3 26  ? 75.514 -5.488   17.932 1.00 55.72  ? 210 GLU D CA  1 
ATOM 3103 C C   . GLU C 3 26  ? 74.083 -5.174   17.520 1.00 56.47  ? 210 GLU D C   1 
ATOM 3104 O O   . GLU C 3 26  ? 73.261 -6.083   17.353 1.00 55.33  ? 210 GLU D O   1 
ATOM 3105 C CB  . GLU C 3 26  ? 75.647 -5.376   19.453 1.00 46.08  ? 210 GLU D CB  1 
ATOM 3106 C CG  . GLU C 3 26  ? 77.011 -5.721   20.016 1.00 53.26  ? 210 GLU D CG  1 
ATOM 3107 C CD  . GLU C 3 26  ? 77.115 -5.416   21.502 1.00 59.86  ? 210 GLU D CD  1 
ATOM 3108 O OE1 . GLU C 3 26  ? 77.802 -4.439   21.866 1.00 68.45  ? 210 GLU D OE1 1 
ATOM 3109 O OE2 . GLU C 3 26  ? 76.500 -6.144   22.308 1.00 61.42  ? 210 GLU D OE2 1 
ATOM 3110 N N   . MET C 3 27  ? 73.765 -3.889   17.352 1.00 58.87  ? 211 MET D N   1 
ATOM 3111 C CA  . MET C 3 27  ? 72.417 -3.520   16.935 1.00 55.09  ? 211 MET D CA  1 
ATOM 3112 C C   . MET C 3 27  ? 72.133 -3.986   15.512 1.00 55.10  ? 211 MET D C   1 
ATOM 3113 O O   . MET C 3 27  ? 71.040 -4.496   15.222 1.00 50.91  ? 211 MET D O   1 
ATOM 3114 C CB  . MET C 3 27  ? 72.233 -2.010   17.072 1.00 53.24  ? 211 MET D CB  1 
ATOM 3115 C CG  . MET C 3 27  ? 70.931 -1.479   16.509 1.00 61.66  ? 211 MET D CG  1 
ATOM 3116 S SD  . MET C 3 27  ? 70.817 0.316    16.667 1.00 80.71  ? 211 MET D SD  1 
ATOM 3117 C CE  . MET C 3 27  ? 70.505 0.474    18.426 1.00 70.44  ? 211 MET D CE  1 
ATOM 3118 N N   . LYS C 3 28  ? 73.111 -3.844   14.615 1.00 59.03  ? 212 LYS D N   1 
ATOM 3119 C CA  . LYS C 3 28  ? 72.935 -4.279   13.236 1.00 58.22  ? 212 LYS D CA  1 
ATOM 3120 C C   . LYS C 3 28  ? 73.044 -5.786   13.066 1.00 58.89  ? 212 LYS D C   1 
ATOM 3121 O O   . LYS C 3 28  ? 72.779 -6.285   11.968 1.00 66.33  ? 212 LYS D O   1 
ATOM 3122 C CB  . LYS C 3 28  ? 73.939 -3.580   12.317 1.00 59.46  ? 212 LYS D CB  1 
ATOM 3123 C CG  . LYS C 3 28  ? 73.398 -2.283   11.737 1.00 71.42  ? 212 LYS D CG  1 
ATOM 3124 C CD  . LYS C 3 28  ? 74.125 -1.869   10.470 1.00 76.92  ? 212 LYS D CD  1 
ATOM 3125 C CE  . LYS C 3 28  ? 75.548 -1.426   10.760 1.00 75.95  ? 212 LYS D CE  1 
ATOM 3126 N NZ  . LYS C 3 28  ? 76.228 -0.948   9.525  1.00 65.89  ? 212 LYS D NZ  1 
ATOM 3127 N N   . GLU C 3 29  ? 73.432 -6.522   14.107 1.00 54.76  ? 213 GLU D N   1 
ATOM 3128 C CA  . GLU C 3 29  ? 73.251 -7.967   14.075 1.00 49.72  ? 213 GLU D CA  1 
ATOM 3129 C C   . GLU C 3 29  ? 71.891 -8.356   14.644 1.00 46.91  ? 213 GLU D C   1 
ATOM 3130 O O   . GLU C 3 29  ? 71.218 -9.244   14.102 1.00 48.52  ? 213 GLU D O   1 
ATOM 3131 C CB  . GLU C 3 29  ? 74.390 -8.670   14.829 1.00 53.08  ? 213 GLU D CB  1 
ATOM 3132 C CG  . GLU C 3 29  ? 74.156 -8.913   16.317 1.00 52.47  ? 213 GLU D CG  1 
ATOM 3133 C CD  . GLU C 3 29  ? 75.397 -9.396   17.044 1.00 60.46  ? 213 GLU D CD  1 
ATOM 3134 O OE1 . GLU C 3 29  ? 76.505 -9.278   16.479 1.00 64.22  ? 213 GLU D OE1 1 
ATOM 3135 O OE2 . GLU C 3 29  ? 75.262 -9.888   18.185 1.00 61.16  ? 213 GLU D OE2 1 
ATOM 3136 N N   . TYR C 3 30  ? 71.455 -7.669   15.703 1.00 45.83  ? 214 TYR D N   1 
ATOM 3137 C CA  . TYR C 3 30  ? 70.145 -7.948   16.273 1.00 40.06  ? 214 TYR D CA  1 
ATOM 3138 C C   . TYR C 3 30  ? 69.042 -7.699   15.255 1.00 39.67  ? 214 TYR D C   1 
ATOM 3139 O O   . TYR C 3 30  ? 68.071 -8.457   15.194 1.00 38.39  ? 214 TYR D O   1 
ATOM 3140 C CB  . TYR C 3 30  ? 69.913 -7.099   17.520 1.00 41.78  ? 214 TYR D CB  1 
ATOM 3141 C CG  . TYR C 3 30  ? 70.492 -7.652   18.803 1.00 40.90  ? 214 TYR D CG  1 
ATOM 3142 C CD1 . TYR C 3 30  ? 71.650 -8.417   18.803 1.00 41.61  ? 214 TYR D CD1 1 
ATOM 3143 C CD2 . TYR C 3 30  ? 69.877 -7.395   20.021 1.00 41.00  ? 214 TYR D CD2 1 
ATOM 3144 C CE1 . TYR C 3 30  ? 72.176 -8.913   19.985 1.00 48.18  ? 214 TYR D CE1 1 
ATOM 3145 C CE2 . TYR C 3 30  ? 70.393 -7.884   21.202 1.00 37.35  ? 214 TYR D CE2 1 
ATOM 3146 C CZ  . TYR C 3 30  ? 71.540 -8.640   21.183 1.00 44.82  ? 214 TYR D CZ  1 
ATOM 3147 O OH  . TYR C 3 30  ? 72.046 -9.119   22.369 1.00 41.33  ? 214 TYR D OH  1 
ATOM 3148 N N   . ILE C 3 31  ? 69.173 -6.648   14.439 1.00 50.55  ? 215 ILE D N   1 
ATOM 3149 C CA  . ILE C 3 31  ? 68.132 -6.358   13.452 1.00 53.21  ? 215 ILE D CA  1 
ATOM 3150 C C   . ILE C 3 31  ? 67.895 -7.570   12.552 1.00 40.85  ? 215 ILE D C   1 
ATOM 3151 O O   . ILE C 3 31  ? 66.745 -7.940   12.270 1.00 40.23  ? 215 ILE D O   1 
ATOM 3152 C CB  . ILE C 3 31  ? 68.482 -5.084   12.649 1.00 49.42  ? 215 ILE D CB  1 
ATOM 3153 C CG1 . ILE C 3 31  ? 67.350 -4.713   11.685 1.00 41.53  ? 215 ILE D CG1 1 
ATOM 3154 C CG2 . ILE C 3 31  ? 69.788 -5.231   11.890 1.00 50.80  ? 215 ILE D CG2 1 
ATOM 3155 C CD1 . ILE C 3 31  ? 66.068 -4.311   12.357 1.00 39.91  ? 215 ILE D CD1 1 
ATOM 3156 N N   . THR C 3 32  ? 68.971 -8.239   12.133 1.00 37.69  ? 216 THR D N   1 
ATOM 3157 C CA  . THR C 3 32  ? 68.832 -9.380   11.234 1.00 49.03  ? 216 THR D CA  1 
ATOM 3158 C C   . THR C 3 32  ? 68.380 -10.634  11.979 1.00 47.47  ? 216 THR D C   1 
ATOM 3159 O O   . THR C 3 32  ? 67.590 -11.426  11.446 1.00 39.12  ? 216 THR D O   1 
ATOM 3160 C CB  . THR C 3 32  ? 70.152 -9.631   10.502 1.00 54.03  ? 216 THR D CB  1 
ATOM 3161 O OG1 . THR C 3 32  ? 71.243 -9.528   11.425 1.00 49.10  ? 216 THR D OG1 1 
ATOM 3162 C CG2 . THR C 3 32  ? 70.342 -8.605   9.390  1.00 54.50  ? 216 THR D CG2 1 
ATOM 3163 N N   . LYS C 3 33  ? 68.869 -10.832  13.208 1.00 49.30  ? 217 LYS D N   1 
ATOM 3164 C CA  . LYS C 3 33  ? 68.394 -11.948  14.025 1.00 36.13  ? 217 LYS D CA  1 
ATOM 3165 C C   . LYS C 3 33  ? 66.884 -11.875  14.234 1.00 38.24  ? 217 LYS D C   1 
ATOM 3166 O O   . LYS C 3 33  ? 66.152 -12.827  13.929 1.00 43.84  ? 217 LYS D O   1 
ATOM 3167 C CB  . LYS C 3 33  ? 69.127 -11.956  15.367 1.00 32.70  ? 217 LYS D CB  1 
ATOM 3168 C CG  . LYS C 3 33  ? 68.778 -13.118  16.275 1.00 33.80  ? 217 LYS D CG  1 
ATOM 3169 C CD  . LYS C 3 33  ? 70.030 -13.761  16.857 1.00 41.72  ? 217 LYS D CD  1 
ATOM 3170 C CE  . LYS C 3 33  ? 70.802 -12.796  17.737 1.00 32.72  ? 217 LYS D CE  1 
ATOM 3171 N NZ  . LYS C 3 33  ? 70.118 -12.570  19.040 1.00 46.94  ? 217 LYS D NZ  1 
ATOM 3172 N N   . PHE C 3 34  ? 66.397 -10.732  14.724 1.00 40.06  ? 218 PHE D N   1 
ATOM 3173 C CA  . PHE C 3 34  ? 64.965 -10.560  14.932 1.00 39.11  ? 218 PHE D CA  1 
ATOM 3174 C C   . PHE C 3 34  ? 64.200 -10.589  13.614 1.00 42.09  ? 218 PHE D C   1 
ATOM 3175 O O   . PHE C 3 34  ? 63.023 -10.965  13.595 1.00 40.83  ? 218 PHE D O   1 
ATOM 3176 C CB  . PHE C 3 34  ? 64.692 -9.243   15.668 1.00 40.15  ? 218 PHE D CB  1 
ATOM 3177 C CG  . PHE C 3 34  ? 65.224 -9.198   17.082 1.00 43.04  ? 218 PHE D CG  1 
ATOM 3178 C CD1 . PHE C 3 34  ? 64.733 -10.052  18.052 1.00 47.71  ? 218 PHE D CD1 1 
ATOM 3179 C CD2 . PHE C 3 34  ? 66.200 -8.282   17.445 1.00 46.79  ? 218 PHE D CD2 1 
ATOM 3180 C CE1 . PHE C 3 34  ? 65.217 -10.001  19.354 1.00 50.96  ? 218 PHE D CE1 1 
ATOM 3181 C CE2 . PHE C 3 34  ? 66.691 -8.233   18.741 1.00 40.37  ? 218 PHE D CE2 1 
ATOM 3182 C CZ  . PHE C 3 34  ? 66.196 -9.089   19.695 1.00 39.11  ? 218 PHE D CZ  1 
ATOM 3183 N N   . SER C 3 35  ? 64.845 -10.209  12.507 1.00 42.32  ? 219 SER D N   1 
ATOM 3184 C CA  . SER C 3 35  ? 64.218 -10.385  11.200 1.00 43.70  ? 219 SER D CA  1 
ATOM 3185 C C   . SER C 3 35  ? 63.949 -11.858  10.919 1.00 46.36  ? 219 SER D C   1 
ATOM 3186 O O   . SER C 3 35  ? 62.828 -12.243  10.557 1.00 49.39  ? 219 SER D O   1 
ATOM 3187 C CB  . SER C 3 35  ? 65.097 -9.778   10.105 1.00 44.21  ? 219 SER D CB  1 
ATOM 3188 O OG  . SER C 3 35  ? 65.053 -8.363   10.138 1.00 46.50  ? 219 SER D OG  1 
ATOM 3189 N N   . LEU C 3 36  ? 64.971 -12.702  11.091 1.00 45.36  ? 220 LEU D N   1 
ATOM 3190 C CA  . LEU C 3 36  ? 64.797 -14.130  10.847 1.00 41.95  ? 220 LEU D CA  1 
ATOM 3191 C C   . LEU C 3 36  ? 63.768 -14.729  11.795 1.00 44.21  ? 220 LEU D C   1 
ATOM 3192 O O   . LEU C 3 36  ? 62.998 -15.617  11.408 1.00 48.11  ? 220 LEU D O   1 
ATOM 3193 C CB  . LEU C 3 36  ? 66.135 -14.855  10.991 1.00 36.50  ? 220 LEU D CB  1 
ATOM 3194 C CG  . LEU C 3 36  ? 67.033 -15.013  9.762  1.00 36.01  ? 220 LEU D CG  1 
ATOM 3195 C CD1 . LEU C 3 36  ? 67.275 -13.680  9.072  1.00 41.77  ? 220 LEU D CD1 1 
ATOM 3196 C CD2 . LEU C 3 36  ? 68.356 -15.654  10.159 1.00 41.07  ? 220 LEU D CD2 1 
ATOM 3197 N N   . GLU C 3 37  ? 63.719 -14.239  13.036 1.00 43.46  ? 221 GLU D N   1 
ATOM 3198 C CA  . GLU C 3 37  ? 62.725 -14.755  13.970 1.00 41.93  ? 221 GLU D CA  1 
ATOM 3199 C C   . GLU C 3 37  ? 61.312 -14.359  13.554 1.00 44.05  ? 221 GLU D C   1 
ATOM 3200 O O   . GLU C 3 37  ? 60.402 -15.193  13.578 1.00 41.98  ? 221 GLU D O   1 
ATOM 3201 C CB  . GLU C 3 37  ? 63.025 -14.275  15.388 1.00 41.74  ? 221 GLU D CB  1 
ATOM 3202 C CG  . GLU C 3 37  ? 62.343 -15.112  16.459 1.00 46.16  ? 221 GLU D CG  1 
ATOM 3203 C CD  . GLU C 3 37  ? 62.537 -14.559  17.857 1.00 47.21  ? 221 GLU D CD  1 
ATOM 3204 O OE1 . GLU C 3 37  ? 61.562 -14.574  18.638 1.00 46.98  ? 221 GLU D OE1 1 
ATOM 3205 O OE2 . GLU C 3 37  ? 63.662 -14.114  18.174 1.00 39.63  ? 221 GLU D OE2 1 
ATOM 3206 N N   . ARG C 3 38  ? 61.109 -13.098  13.163 1.00 49.92  ? 222 ARG D N   1 
ATOM 3207 C CA  . ARG C 3 38  ? 59.801 -12.675  12.666 1.00 48.16  ? 222 ARG D CA  1 
ATOM 3208 C C   . ARG C 3 38  ? 59.366 -13.520  11.477 1.00 43.59  ? 222 ARG D C   1 
ATOM 3209 O O   . ARG C 3 38  ? 58.227 -14.007  11.424 1.00 43.37  ? 222 ARG D O   1 
ATOM 3210 C CB  . ARG C 3 38  ? 59.843 -11.199  12.267 1.00 51.32  ? 222 ARG D CB  1 
ATOM 3211 C CG  . ARG C 3 38  ? 58.612 -10.754  11.489 1.00 53.05  ? 222 ARG D CG  1 
ATOM 3212 C CD  . ARG C 3 38  ? 58.506 -9.248   11.371 1.00 55.23  ? 222 ARG D CD  1 
ATOM 3213 N NE  . ARG C 3 38  ? 59.574 -8.689   10.545 1.00 64.03  ? 222 ARG D NE  1 
ATOM 3214 C CZ  . ARG C 3 38  ? 59.708 -7.393   10.275 1.00 86.59  ? 222 ARG D CZ  1 
ATOM 3215 N NH1 . ARG C 3 38  ? 60.711 -6.973   9.515  1.00 87.86  ? 222 ARG D NH1 1 
ATOM 3216 N NH2 . ARG C 3 38  ? 58.835 -6.515   10.755 1.00 76.69  ? 222 ARG D NH2 1 
ATOM 3217 N N   . GLN C 3 39  ? 60.269 -13.707  10.514 1.00 43.21  ? 223 GLN D N   1 
ATOM 3218 C CA  . GLN C 3 39  ? 59.967 -14.541  9.356  1.00 50.30  ? 223 GLN D CA  1 
ATOM 3219 C C   . GLN C 3 39  ? 59.560 -15.945  9.788  1.00 55.57  ? 223 GLN D C   1 
ATOM 3220 O O   . GLN C 3 39  ? 58.572 -16.500  9.290  1.00 55.87  ? 223 GLN D O   1 
ATOM 3221 C CB  . GLN C 3 39  ? 61.173 -14.570  8.417  1.00 56.35  ? 223 GLN D CB  1 
ATOM 3222 C CG  . GLN C 3 39  ? 60.967 -15.334  7.119  1.00 61.62  ? 223 GLN D CG  1 
ATOM 3223 C CD  . GLN C 3 39  ? 62.066 -15.054  6.106  1.00 65.82  ? 223 GLN D CD  1 
ATOM 3224 O OE1 . GLN C 3 39  ? 63.248 -15.243  6.391  1.00 71.20  ? 223 GLN D OE1 1 
ATOM 3225 N NE2 . GLN C 3 39  ? 61.680 -14.578  4.925  1.00 59.60  ? 223 GLN D NE2 1 
ATOM 3226 N N   . THR C 3 40  ? 60.312 -16.534  10.725 1.00 53.16  ? 224 THR D N   1 
ATOM 3227 C CA  . THR C 3 40  ? 59.987 -17.878  11.194 1.00 51.61  ? 224 THR D CA  1 
ATOM 3228 C C   . THR C 3 40  ? 58.618 -17.913  11.864 1.00 46.44  ? 224 THR D C   1 
ATOM 3229 O O   . THR C 3 40  ? 57.876 -18.893  11.723 1.00 48.09  ? 224 THR D O   1 
ATOM 3230 C CB  . THR C 3 40  ? 61.063 -18.376  12.160 1.00 46.58  ? 224 THR D CB  1 
ATOM 3231 O OG1 . THR C 3 40  ? 62.361 -18.096  11.623 1.00 49.82  ? 224 THR D OG1 1 
ATOM 3232 C CG2 . THR C 3 40  ? 60.929 -19.870  12.377 1.00 45.94  ? 224 THR D CG2 1 
ATOM 3233 N N   . TRP C 3 41  ? 58.261 -16.849  12.588 1.00 43.48  ? 225 TRP D N   1 
ATOM 3234 C CA  . TRP C 3 41  ? 56.955 -16.801  13.240 1.00 41.49  ? 225 TRP D CA  1 
ATOM 3235 C C   . TRP C 3 41  ? 55.835 -16.747  12.211 1.00 43.24  ? 225 TRP D C   1 
ATOM 3236 O O   . TRP C 3 41  ? 54.833 -17.463  12.330 1.00 45.86  ? 225 TRP D O   1 
ATOM 3237 C CB  . TRP C 3 41  ? 56.863 -15.600  14.186 1.00 41.34  ? 225 TRP D CB  1 
ATOM 3238 C CG  . TRP C 3 41  ? 57.475 -15.816  15.543 1.00 41.07  ? 225 TRP D CG  1 
ATOM 3239 C CD1 . TRP C 3 41  ? 58.710 -15.409  15.965 1.00 43.99  ? 225 TRP D CD1 1 
ATOM 3240 C CD2 . TRP C 3 41  ? 56.882 -16.507  16.650 1.00 34.89  ? 225 TRP D CD2 1 
ATOM 3241 N NE1 . TRP C 3 41  ? 58.915 -15.793  17.268 1.00 44.51  ? 225 TRP D NE1 1 
ATOM 3242 C CE2 . TRP C 3 41  ? 57.810 -16.471  17.711 1.00 39.57  ? 225 TRP D CE2 1 
ATOM 3243 C CE3 . TRP C 3 41  ? 55.657 -17.148  16.847 1.00 34.90  ? 225 TRP D CE3 1 
ATOM 3244 C CZ2 . TRP C 3 41  ? 57.549 -17.053  18.951 1.00 35.01  ? 225 TRP D CZ2 1 
ATOM 3245 C CZ3 . TRP C 3 41  ? 55.399 -17.725  18.080 1.00 36.23  ? 225 TRP D CZ3 1 
ATOM 3246 C CH2 . TRP C 3 41  ? 56.341 -17.672  19.115 1.00 33.58  ? 225 TRP D CH2 1 
ATOM 3247 N N   . ASP C 3 42  ? 55.979 -15.892  11.198 1.00 41.60  ? 226 ASP D N   1 
ATOM 3248 C CA  . ASP C 3 42  ? 54.944 -15.793  10.176 1.00 41.43  ? 226 ASP D CA  1 
ATOM 3249 C C   . ASP C 3 42  ? 54.799 -17.110  9.423  1.00 46.87  ? 226 ASP D C   1 
ATOM 3250 O O   . ASP C 3 42  ? 53.684 -17.621  9.245  1.00 52.58  ? 226 ASP D O   1 
ATOM 3251 C CB  . ASP C 3 42  ? 55.269 -14.650  9.218  1.00 48.18  ? 226 ASP D CB  1 
ATOM 3252 C CG  . ASP C 3 42  ? 55.233 -13.299  9.897  1.00 42.80  ? 226 ASP D CG  1 
ATOM 3253 O OD1 . ASP C 3 42  ? 54.461 -13.141  10.868 1.00 37.53  ? 226 ASP D OD1 1 
ATOM 3254 O OD2 . ASP C 3 42  ? 55.973 -12.396  9.456  1.00 46.78  ? 226 ASP D OD2 1 
ATOM 3255 N N   . GLN C 3 43  ? 55.928 -17.684  8.996  1.00 46.55  ? 227 GLN D N   1 
ATOM 3256 C CA  . GLN C 3 43  ? 55.915 -18.976  8.315  1.00 55.22  ? 227 GLN D CA  1 
ATOM 3257 C C   . GLN C 3 43  ? 55.217 -20.039  9.154  1.00 50.20  ? 227 GLN D C   1 
ATOM 3258 O O   . GLN C 3 43  ? 54.356 -20.775  8.659  1.00 45.95  ? 227 GLN D O   1 
ATOM 3259 C CB  . GLN C 3 43  ? 57.348 -19.409  8.002  1.00 54.17  ? 227 GLN D CB  1 
ATOM 3260 C CG  . GLN C 3 43  ? 57.449 -20.657  7.145  1.00 60.99  ? 227 GLN D CG  1 
ATOM 3261 C CD  . GLN C 3 43  ? 58.853 -20.889  6.627  1.00 68.61  ? 227 GLN D CD  1 
ATOM 3262 O OE1 . GLN C 3 43  ? 59.832 -20.486  7.257  1.00 69.05  ? 227 GLN D OE1 1 
ATOM 3263 N NE2 . GLN C 3 43  ? 58.960 -21.553  5.481  1.00 67.25  ? 227 GLN D NE2 1 
ATOM 3264 N N   . LEU C 3 44  ? 55.589 -20.134  10.429 1.00 48.50  ? 228 LEU D N   1 
ATOM 3265 C CA  . LEU C 3 44  ? 55.031 -21.157  11.305 1.00 46.97  ? 228 LEU D CA  1 
ATOM 3266 C C   . LEU C 3 44  ? 53.526 -20.967  11.482 1.00 49.61  ? 228 LEU D C   1 
ATOM 3267 O O   . LEU C 3 44  ? 52.745 -21.927  11.383 1.00 52.21  ? 228 LEU D O   1 
ATOM 3268 C CB  . LEU C 3 44  ? 55.761 -21.103  12.646 1.00 40.22  ? 228 LEU D CB  1 
ATOM 3269 C CG  . LEU C 3 44  ? 56.172 -22.415  13.301 1.00 45.64  ? 228 LEU D CG  1 
ATOM 3270 C CD1 . LEU C 3 44  ? 56.914 -23.261  12.285 1.00 57.97  ? 228 LEU D CD1 1 
ATOM 3271 C CD2 . LEU C 3 44  ? 57.069 -22.131  14.490 1.00 36.76  ? 228 LEU D CD2 1 
ATOM 3272 N N   . LEU C 3 45  ? 53.100 -19.723  11.725 1.00 42.73  ? 229 LEU D N   1 
ATOM 3273 C CA  . LEU C 3 45  ? 51.683 -19.455  11.951 1.00 42.79  ? 229 LEU D CA  1 
ATOM 3274 C C   . LEU C 3 45  ? 50.850 -19.783  10.718 1.00 48.01  ? 229 LEU D C   1 
ATOM 3275 O O   . LEU C 3 45  ? 49.822 -20.462  10.816 1.00 54.83  ? 229 LEU D O   1 
ATOM 3276 C CB  . LEU C 3 45  ? 51.472 -18.002  12.369 1.00 38.62  ? 229 LEU D CB  1 
ATOM 3277 C CG  . LEU C 3 45  ? 50.000 -17.586  12.400 1.00 35.96  ? 229 LEU D CG  1 
ATOM 3278 C CD1 . LEU C 3 45  ? 49.667 -16.867  13.692 1.00 43.49  ? 229 LEU D CD1 1 
ATOM 3279 C CD2 . LEU C 3 45  ? 49.681 -16.699  11.209 1.00 41.64  ? 229 LEU D CD2 1 
ATOM 3280 N N   . LEU C 3 46  ? 51.273 -19.310  9.542  1.00 49.34  ? 230 LEU D N   1 
ATOM 3281 C CA  . LEU C 3 46  ? 50.509 -19.649  8.345  1.00 54.89  ? 230 LEU D CA  1 
ATOM 3282 C C   . LEU C 3 46  ? 50.564 -21.147  8.061  1.00 55.87  ? 230 LEU D C   1 
ATOM 3283 O O   . LEU C 3 46  ? 49.614 -21.705  7.494  1.00 52.38  ? 230 LEU D O   1 
ATOM 3284 C CB  . LEU C 3 46  ? 50.997 -18.831  7.142  1.00 56.69  ? 230 LEU D CB  1 
ATOM 3285 C CG  . LEU C 3 46  ? 52.431 -18.904  6.601  1.00 60.48  ? 230 LEU D CG  1 
ATOM 3286 C CD1 . LEU C 3 46  ? 52.689 -20.153  5.759  1.00 62.50  ? 230 LEU D CD1 1 
ATOM 3287 C CD2 . LEU C 3 46  ? 52.740 -17.646  5.801  1.00 51.19  ? 230 LEU D CD2 1 
ATOM 3288 N N   . HIS C 3 47  ? 51.653 -21.810  8.461  1.00 57.16  ? 231 HIS D N   1 
ATOM 3289 C CA  . HIS C 3 47  ? 51.729 -23.265  8.367  1.00 58.03  ? 231 HIS D CA  1 
ATOM 3290 C C   . HIS C 3 47  ? 50.578 -23.917  9.122  1.00 49.51  ? 231 HIS D C   1 
ATOM 3291 O O   . HIS C 3 47  ? 49.762 -24.639  8.536  1.00 47.76  ? 231 HIS D O   1 
ATOM 3292 C CB  . HIS C 3 47  ? 53.079 -23.757  8.901  1.00 57.03  ? 231 HIS D CB  1 
ATOM 3293 C CG  . HIS C 3 47  ? 53.203 -25.251  8.965  1.00 54.98  ? 231 HIS D CG  1 
ATOM 3294 N ND1 . HIS C 3 47  ? 52.536 -26.019  9.896  1.00 51.09  ? 231 HIS D ND1 1 
ATOM 3295 C CD2 . HIS C 3 47  ? 53.925 -26.116  8.214  1.00 53.03  ? 231 HIS D CD2 1 
ATOM 3296 C CE1 . HIS C 3 47  ? 52.837 -27.292  9.712  1.00 45.64  ? 231 HIS D CE1 1 
ATOM 3297 N NE2 . HIS C 3 47  ? 53.679 -27.378  8.698  1.00 53.61  ? 231 HIS D NE2 1 
ATOM 3298 N N   . TYR C 3 48  ? 50.497 -23.674  10.434 1.00 42.52  ? 232 TYR D N   1 
ATOM 3299 C CA  . TYR C 3 48  ? 49.422 -24.290  11.207 1.00 43.35  ? 232 TYR D CA  1 
ATOM 3300 C C   . TYR C 3 48  ? 48.052 -23.827  10.726 1.00 43.13  ? 232 TYR D C   1 
ATOM 3301 O O   . TYR C 3 48  ? 47.067 -24.570  10.840 1.00 43.94  ? 232 TYR D O   1 
ATOM 3302 C CB  . TYR C 3 48  ? 49.612 -23.996  12.693 1.00 43.26  ? 232 TYR D CB  1 
ATOM 3303 C CG  . TYR C 3 48  ? 50.828 -24.686  13.275 1.00 53.10  ? 232 TYR D CG  1 
ATOM 3304 C CD1 . TYR C 3 48  ? 50.820 -26.051  13.538 1.00 50.06  ? 232 TYR D CD1 1 
ATOM 3305 C CD2 . TYR C 3 48  ? 51.987 -23.975  13.555 1.00 49.73  ? 232 TYR D CD2 1 
ATOM 3306 C CE1 . TYR C 3 48  ? 51.931 -26.687  14.065 1.00 46.14  ? 232 TYR D CE1 1 
ATOM 3307 C CE2 . TYR C 3 48  ? 53.102 -24.602  14.085 1.00 51.65  ? 232 TYR D CE2 1 
ATOM 3308 C CZ  . TYR C 3 48  ? 53.069 -25.957  14.337 1.00 50.35  ? 232 TYR D CZ  1 
ATOM 3309 O OH  . TYR C 3 48  ? 54.177 -26.582  14.862 1.00 56.87  ? 232 TYR D OH  1 
ATOM 3310 N N   . GLN C 3 49  ? 47.978 -22.623  10.155 1.00 49.44  ? 233 GLN D N   1 
ATOM 3311 C CA  . GLN C 3 49  ? 46.715 -22.118  9.627  1.00 50.57  ? 233 GLN D CA  1 
ATOM 3312 C C   . GLN C 3 49  ? 46.224 -22.973  8.465  1.00 49.82  ? 233 GLN D C   1 
ATOM 3313 O O   . GLN C 3 49  ? 45.107 -23.503  8.493  1.00 52.39  ? 233 GLN D O   1 
ATOM 3314 C CB  . GLN C 3 49  ? 46.875 -20.661  9.189  1.00 51.47  ? 233 GLN D CB  1 
ATOM 3315 C CG  . GLN C 3 49  ? 46.769 -19.651  10.312 1.00 48.71  ? 233 GLN D CG  1 
ATOM 3316 C CD  . GLN C 3 49  ? 46.969 -18.233  9.830  1.00 45.40  ? 233 GLN D CD  1 
ATOM 3317 O OE1 . GLN C 3 49  ? 47.582 -18.001  8.787  1.00 46.73  ? 233 GLN D OE1 1 
ATOM 3318 N NE2 . GLN C 3 49  ? 46.446 -17.272  10.582 1.00 41.75  ? 233 GLN D NE2 1 
ATOM 3319 N N   . GLN C 3 50  ? 47.049 -23.116  7.425  1.00 49.39  ? 234 GLN D N   1 
ATOM 3320 C CA  . GLN C 3 50  ? 46.620 -23.903  6.276  1.00 53.42  ? 234 GLN D CA  1 
ATOM 3321 C C   . GLN C 3 50  ? 46.539 -25.389  6.597  1.00 56.14  ? 234 GLN D C   1 
ATOM 3322 O O   . GLN C 3 50  ? 45.783 -26.109  5.935  1.00 56.57  ? 234 GLN D O   1 
ATOM 3323 C CB  . GLN C 3 50  ? 47.544 -23.662  5.081  1.00 56.20  ? 234 GLN D CB  1 
ATOM 3324 C CG  . GLN C 3 50  ? 48.993 -24.048  5.297  1.00 68.95  ? 234 GLN D CG  1 
ATOM 3325 C CD  . GLN C 3 50  ? 49.899 -23.442  4.244  1.00 76.35  ? 234 GLN D CD  1 
ATOM 3326 O OE1 . GLN C 3 50  ? 49.538 -22.463  3.591  1.00 69.38  ? 234 GLN D OE1 1 
ATOM 3327 N NE2 . GLN C 3 50  ? 51.083 -24.021  4.073  1.00 85.10  ? 234 GLN D NE2 1 
ATOM 3328 N N   . GLU C 3 51  ? 47.292 -25.862  7.594  1.00 50.25  ? 235 GLU D N   1 
ATOM 3329 C CA  . GLU C 3 51  ? 47.103 -27.225  8.079  1.00 45.06  ? 235 GLU D CA  1 
ATOM 3330 C C   . GLU C 3 51  ? 45.694 -27.412  8.625  1.00 48.43  ? 235 GLU D C   1 
ATOM 3331 O O   . GLU C 3 51  ? 44.992 -28.364  8.261  1.00 56.19  ? 235 GLU D O   1 
ATOM 3332 C CB  . GLU C 3 51  ? 48.137 -27.547  9.155  1.00 41.56  ? 235 GLU D CB  1 
ATOM 3333 C CG  . GLU C 3 51  ? 48.013 -28.945  9.730  1.00 42.35  ? 235 GLU D CG  1 
ATOM 3334 C CD  . GLU C 3 51  ? 48.514 -29.031  11.156 1.00 41.87  ? 235 GLU D CD  1 
ATOM 3335 O OE1 . GLU C 3 51  ? 48.138 -28.158  11.968 1.00 40.01  ? 235 GLU D OE1 1 
ATOM 3336 O OE2 . GLU C 3 51  ? 49.290 -29.963  11.463 1.00 37.58  ? 235 GLU D OE2 1 
ATOM 3337 N N   . ALA C 3 52  ? 45.262 -26.505  9.503  1.00 49.19  ? 236 ALA D N   1 
ATOM 3338 C CA  . ALA C 3 52  ? 43.898 -26.576  10.016 1.00 48.36  ? 236 ALA D CA  1 
ATOM 3339 C C   . ALA C 3 52  ? 42.877 -26.462  8.888  1.00 53.44  ? 236 ALA D C   1 
ATOM 3340 O O   . ALA C 3 52  ? 41.862 -27.169  8.887  1.00 62.03  ? 236 ALA D O   1 
ATOM 3341 C CB  . ALA C 3 52  ? 43.670 -25.487  11.062 1.00 48.15  ? 236 ALA D CB  1 
ATOM 3342 N N   . LYS C 3 53  ? 43.122 -25.569  7.924  1.00 57.44  ? 237 LYS D N   1 
ATOM 3343 C CA  . LYS C 3 53  ? 42.184 -25.397  6.817  1.00 63.11  ? 237 LYS D CA  1 
ATOM 3344 C C   . LYS C 3 53  ? 42.042 -26.680  6.006  1.00 61.75  ? 237 LYS D C   1 
ATOM 3345 O O   . LYS C 3 53  ? 40.927 -27.094  5.665  1.00 67.85  ? 237 LYS D O   1 
ATOM 3346 C CB  . LYS C 3 53  ? 42.628 -24.248  5.909  1.00 69.87  ? 237 LYS D CB  1 
ATOM 3347 C CG  . LYS C 3 53  ? 41.564 -23.845  4.888  1.00 75.58  ? 237 LYS D CG  1 
ATOM 3348 C CD  . LYS C 3 53  ? 42.096 -22.896  3.819  1.00 60.94  ? 237 LYS D CD  1 
ATOM 3349 C CE  . LYS C 3 53  ? 42.432 -21.529  4.380  1.00 64.30  ? 237 LYS D CE  1 
ATOM 3350 N NZ  . LYS C 3 53  ? 43.414 -20.822  3.509  1.00 66.11  ? 237 LYS D NZ  1 
ATOM 3351 N N   . GLU C 3 54  ? 43.166 -27.321  5.677  1.00 59.10  ? 238 GLU D N   1 
ATOM 3352 C CA  . GLU C 3 54  ? 43.104 -28.512  4.835  1.00 69.08  ? 238 GLU D CA  1 
ATOM 3353 C C   . GLU C 3 54  ? 42.525 -29.702  5.593  1.00 67.11  ? 238 GLU D C   1 
ATOM 3354 O O   . GLU C 3 54  ? 41.790 -30.510  5.013  1.00 73.45  ? 238 GLU D O   1 
ATOM 3355 C CB  . GLU C 3 54  ? 44.489 -28.838  4.269  1.00 72.79  ? 238 GLU D CB  1 
ATOM 3356 C CG  . GLU C 3 54  ? 45.535 -29.245  5.296  1.00 67.09  ? 238 GLU D CG  1 
ATOM 3357 C CD  . GLU C 3 54  ? 45.677 -30.748  5.433  1.00 62.53  ? 238 GLU D CD  1 
ATOM 3358 O OE1 . GLU C 3 54  ? 46.650 -31.191  6.078  1.00 59.74  ? 238 GLU D OE1 1 
ATOM 3359 O OE2 . GLU C 3 54  ? 44.818 -31.485  4.904  1.00 62.62  ? 238 GLU D OE2 1 
ATOM 3360 N N   . ILE C 3 55  ? 42.831 -29.827  6.888  1.00 64.38  ? 239 ILE D N   1 
ATOM 3361 C CA  . ILE C 3 55  ? 42.286 -30.950  7.645  1.00 66.10  ? 239 ILE D CA  1 
ATOM 3362 C C   . ILE C 3 55  ? 40.795 -30.751  7.901  1.00 65.20  ? 239 ILE D C   1 
ATOM 3363 O O   . ILE C 3 55  ? 40.038 -31.725  7.989  1.00 69.76  ? 239 ILE D O   1 
ATOM 3364 C CB  . ILE C 3 55  ? 43.075 -31.153  8.954  1.00 65.57  ? 239 ILE D CB  1 
ATOM 3365 C CG1 . ILE C 3 55  ? 44.537 -31.486  8.648  1.00 62.72  ? 239 ILE D CG1 1 
ATOM 3366 C CG2 . ILE C 3 55  ? 42.470 -32.275  9.788  1.00 53.69  ? 239 ILE D CG2 1 
ATOM 3367 C CD1 . ILE C 3 55  ? 44.730 -32.833  8.003  1.00 63.44  ? 239 ILE D CD1 1 
ATOM 3368 N N   . LEU C 3 56  ? 40.341 -29.500  8.008  1.00 66.12  ? 240 LEU D N   1 
ATOM 3369 C CA  . LEU C 3 56  ? 38.915 -29.246  8.181  1.00 68.22  ? 240 LEU D CA  1 
ATOM 3370 C C   . LEU C 3 56  ? 38.152 -29.327  6.864  1.00 71.91  ? 240 LEU D C   1 
ATOM 3371 O O   . LEU C 3 56  ? 36.954 -29.631  6.875  1.00 74.03  ? 240 LEU D O   1 
ATOM 3372 C CB  . LEU C 3 56  ? 38.698 -27.875  8.831  1.00 65.59  ? 240 LEU D CB  1 
ATOM 3373 C CG  . LEU C 3 56  ? 37.450 -27.640  9.692  1.00 65.79  ? 240 LEU D CG  1 
ATOM 3374 C CD1 . LEU C 3 56  ? 37.675 -26.438  10.596 1.00 78.71  ? 240 LEU D CD1 1 
ATOM 3375 C CD2 . LEU C 3 56  ? 36.183 -27.438  8.866  1.00 59.37  ? 240 LEU D CD2 1 
ATOM 3376 N N   . SER C 3 57  ? 38.820 -29.096  5.734  1.00 71.71  ? 241 SER D N   1 
ATOM 3377 C CA  . SER C 3 57  ? 38.197 -29.262  4.428  1.00 79.95  ? 241 SER D CA  1 
ATOM 3378 C C   . SER C 3 57  ? 38.341 -30.680  3.887  1.00 87.22  ? 241 SER D C   1 
ATOM 3379 O O   . SER C 3 57  ? 37.731 -31.002  2.861  1.00 96.07  ? 241 SER D O   1 
ATOM 3380 C CB  . SER C 3 57  ? 38.801 -28.263  3.429  1.00 72.59  ? 241 SER D CB  1 
ATOM 3381 O OG  . SER C 3 57  ? 37.914 -27.993  2.355  1.00 55.90  ? 241 SER D OG  1 
ATOM 3382 N N   . ARG C 3 58  ? 39.115 -31.532  4.563  1.00 85.95  ? 242 ARG D N   1 
ATOM 3383 C CA  . ARG C 3 58  ? 39.371 -32.888  4.090  1.00 88.45  ? 242 ARG D CA  1 
ATOM 3384 C C   . ARG C 3 58  ? 38.252 -33.846  4.485  1.00 103.78 ? 242 ARG D C   1 
ATOM 3385 O O   . ARG C 3 58  ? 37.996 -34.825  3.773  1.00 112.77 ? 242 ARG D O   1 
ATOM 3386 C CB  . ARG C 3 58  ? 40.720 -33.375  4.634  1.00 83.90  ? 242 ARG D CB  1 
ATOM 3387 C CG  . ARG C 3 58  ? 41.127 -34.781  4.217  1.00 86.46  ? 242 ARG D CG  1 
ATOM 3388 C CD  . ARG C 3 58  ? 42.578 -35.077  4.598  1.00 87.08  ? 242 ARG D CD  1 
ATOM 3389 N NE  . ARG C 3 58  ? 42.720 -35.548  5.975  1.00 86.86  ? 242 ARG D NE  1 
ATOM 3390 C CZ  . ARG C 3 58  ? 43.887 -35.805  6.563  1.00 84.04  ? 242 ARG D CZ  1 
ATOM 3391 N NH1 . ARG C 3 58  ? 45.023 -35.628  5.899  1.00 74.96  ? 242 ARG D NH1 1 
ATOM 3392 N NH2 . ARG C 3 58  ? 43.921 -36.234  7.819  1.00 72.29  ? 242 ARG D NH2 1 
ATOM 3393 N N   . GLY C 3 59  ? 37.580 -33.579  5.607  1.00 103.92 ? 243 GLY D N   1 
ATOM 3394 C CA  . GLY C 3 59  ? 36.566 -34.491  6.111  1.00 107.28 ? 243 GLY D CA  1 
ATOM 3395 C C   . GLY C 3 59  ? 35.273 -34.491  5.320  1.00 113.82 ? 243 GLY D C   1 
ATOM 3396 O O   . GLY C 3 59  ? 34.584 -35.514  5.257  1.00 106.53 ? 243 GLY D O   1 
ATOM 3397 N N   . SER C 3 60  ? 34.920 -33.357  4.710  1.00 114.42 ? 244 SER D N   1 
ATOM 3398 C CA  . SER C 3 60  ? 33.650 -33.268  3.995  1.00 116.04 ? 244 SER D CA  1 
ATOM 3399 C C   . SER C 3 60  ? 33.703 -34.032  2.677  1.00 118.88 ? 244 SER D C   1 
ATOM 3400 O O   . SER C 3 60  ? 32.984 -35.020  2.488  1.00 118.38 ? 244 SER D O   1 
ATOM 3401 C CB  . SER C 3 60  ? 33.287 -31.801  3.751  1.00 106.12 ? 244 SER D CB  1 
ATOM 3402 O OG  . SER C 3 60  ? 31.983 -31.681  3.210  1.00 92.69  ? 244 SER D OG  1 
ATOM 3403 N N   . THR C 3 61  ? 34.549 -33.590  1.753  1.00 119.28 ? 245 THR D N   1 
ATOM 3404 C CA  . THR C 3 61  ? 34.661 -34.244  0.454  1.00 120.21 ? 245 THR D CA  1 
ATOM 3405 C C   . THR C 3 61  ? 35.392 -35.583  0.570  1.00 108.00 ? 245 THR D C   1 
ATOM 3406 O O   . THR C 3 61  ? 34.769 -36.645  0.632  1.00 88.19  ? 245 THR D O   1 
ATOM 3407 C CB  . THR C 3 61  ? 35.388 -33.343  -0.564 1.00 111.95 ? 245 THR D CB  1 
ATOM 3408 O OG1 . THR C 3 61  ? 36.574 -32.802  0.033  1.00 108.29 ? 245 THR D OG1 1 
ATOM 3409 C CG2 . THR C 3 61  ? 34.484 -32.199  -1.004 1.00 98.56  ? 245 THR D CG2 1 
ATOM 3410 N N   . LEU C 3 76  ? 49.241 -55.350  10.748 1.00 72.19  ? 260 LEU D N   1 
ATOM 3411 C CA  . LEU C 3 76  ? 48.412 -56.186  11.605 1.00 75.85  ? 260 LEU D CA  1 
ATOM 3412 C C   . LEU C 3 76  ? 49.291 -56.902  12.637 1.00 78.07  ? 260 LEU D C   1 
ATOM 3413 O O   . LEU C 3 76  ? 49.378 -58.132  12.676 1.00 74.30  ? 260 LEU D O   1 
ATOM 3414 C CB  . LEU C 3 76  ? 47.609 -57.178  10.758 1.00 72.45  ? 260 LEU D CB  1 
ATOM 3415 C CG  . LEU C 3 76  ? 46.606 -58.122  11.418 1.00 63.31  ? 260 LEU D CG  1 
ATOM 3416 C CD1 . LEU C 3 76  ? 45.213 -57.850  10.885 1.00 53.95  ? 260 LEU D CD1 1 
ATOM 3417 C CD2 . LEU C 3 76  ? 47.016 -59.560  11.147 1.00 61.37  ? 260 LEU D CD2 1 
ATOM 3418 N N   . GLY C 3 77  ? 49.958 -56.098  13.462 1.00 74.02  ? 261 GLY D N   1 
ATOM 3419 C CA  . GLY C 3 77  ? 50.755 -56.591  14.568 1.00 71.37  ? 261 GLY D CA  1 
ATOM 3420 C C   . GLY C 3 77  ? 50.049 -56.370  15.890 1.00 71.42  ? 261 GLY D C   1 
ATOM 3421 O O   . GLY C 3 77  ? 50.689 -56.146  16.923 1.00 67.44  ? 261 GLY D O   1 
ATOM 3422 N N   . SER C 3 78  ? 48.720 -56.430  15.857 1.00 72.44  ? 262 SER D N   1 
ATOM 3423 C CA  . SER C 3 78  ? 47.877 -56.030  16.973 1.00 66.44  ? 262 SER D CA  1 
ATOM 3424 C C   . SER C 3 78  ? 48.072 -56.940  18.181 1.00 61.41  ? 262 SER D C   1 
ATOM 3425 O O   . SER C 3 78  ? 48.783 -57.949  18.136 1.00 58.38  ? 262 SER D O   1 
ATOM 3426 C CB  . SER C 3 78  ? 46.406 -56.072  16.573 1.00 60.76  ? 262 SER D CB  1 
ATOM 3427 O OG  . SER C 3 78  ? 45.970 -57.419  16.458 1.00 42.11  ? 262 SER D OG  1 
ATOM 3428 N N   . SER C 3 79  ? 47.432 -56.546  19.283 1.00 60.21  ? 263 SER D N   1 
ATOM 3429 C CA  . SER C 3 79  ? 47.366 -57.392  20.463 1.00 59.69  ? 263 SER D CA  1 
ATOM 3430 C C   . SER C 3 79  ? 46.870 -58.776  20.076 1.00 56.06  ? 263 SER D C   1 
ATOM 3431 O O   . SER C 3 79  ? 46.050 -58.928  19.164 1.00 52.23  ? 263 SER D O   1 
ATOM 3432 C CB  . SER C 3 79  ? 46.441 -56.774  21.516 1.00 49.78  ? 263 SER D CB  1 
ATOM 3433 O OG  . SER C 3 79  ? 46.067 -57.735  22.488 1.00 57.89  ? 263 SER D OG  1 
ATOM 3434 N N   . GLN C 3 80  ? 47.381 -59.785  20.778 1.00 54.75  ? 264 GLN D N   1 
ATOM 3435 C CA  . GLN C 3 80  ? 47.055 -61.195  20.555 1.00 59.53  ? 264 GLN D CA  1 
ATOM 3436 C C   . GLN C 3 80  ? 47.014 -61.535  19.061 1.00 61.81  ? 264 GLN D C   1 
ATOM 3437 O O   . GLN C 3 80  ? 46.007 -61.978  18.507 1.00 56.88  ? 264 GLN D O   1 
ATOM 3438 C CB  . GLN C 3 80  ? 45.755 -61.571  21.274 1.00 52.76  ? 264 GLN D CB  1 
ATOM 3439 C CG  . GLN C 3 80  ? 44.514 -60.840  20.811 1.00 40.21  ? 264 GLN D CG  1 
ATOM 3440 C CD  . GLN C 3 80  ? 43.383 -60.961  21.780 1.00 46.81  ? 264 GLN D CD  1 
ATOM 3441 O OE1 . GLN C 3 80  ? 43.524 -61.558  22.846 1.00 53.62  ? 264 GLN D OE1 1 
ATOM 3442 N NE2 . GLN C 3 80  ? 42.256 -60.357  21.441 1.00 54.01  ? 264 GLN D NE2 1 
ATOM 3443 N N   . ASN C 3 81  ? 48.157 -61.314  18.409 1.00 63.19  ? 265 ASN D N   1 
ATOM 3444 C CA  . ASN C 3 81  ? 48.288 -61.704  17.010 1.00 58.09  ? 265 ASN D CA  1 
ATOM 3445 C C   . ASN C 3 81  ? 48.280 -63.219  16.849 1.00 57.07  ? 265 ASN D C   1 
ATOM 3446 O O   . ASN C 3 81  ? 47.891 -63.723  15.789 1.00 56.74  ? 265 ASN D O   1 
ATOM 3447 C CB  . ASN C 3 81  ? 49.566 -61.114  16.410 1.00 60.25  ? 265 ASN D CB  1 
ATOM 3448 C CG  . ASN C 3 81  ? 49.364 -60.592  14.995 1.00 66.56  ? 265 ASN D CG  1 
ATOM 3449 O OD1 . ASN C 3 81  ? 48.260 -60.204  14.613 1.00 70.19  ? 265 ASN D OD1 1 
ATOM 3450 N ND2 . ASN C 3 81  ? 50.437 -60.585  14.209 1.00 64.32  ? 265 ASN D ND2 1 
ATOM 3451 N N   . GLU C 3 82  ? 48.708 -63.957  17.880 1.00 55.14  ? 266 GLU D N   1 
ATOM 3452 C CA  . GLU C 3 82  ? 48.671 -65.415  17.814 1.00 50.58  ? 266 GLU D CA  1 
ATOM 3453 C C   . GLU C 3 82  ? 47.248 -65.916  17.619 1.00 45.16  ? 266 GLU D C   1 
ATOM 3454 O O   . GLU C 3 82  ? 46.992 -66.781  16.773 1.00 45.77  ? 266 GLU D O   1 
ATOM 3455 C CB  . GLU C 3 82  ? 49.281 -66.023  19.077 1.00 53.14  ? 266 GLU D CB  1 
ATOM 3456 C CG  . GLU C 3 82  ? 50.763 -65.758  19.253 1.00 60.47  ? 266 GLU D CG  1 
ATOM 3457 C CD  . GLU C 3 82  ? 51.413 -66.725  20.225 1.00 61.90  ? 266 GLU D CD  1 
ATOM 3458 O OE1 . GLU C 3 82  ? 50.707 -67.624  20.732 1.00 53.07  ? 266 GLU D OE1 1 
ATOM 3459 O OE2 . GLU C 3 82  ? 52.632 -66.594  20.471 1.00 65.07  ? 266 GLU D OE2 1 
ATOM 3460 N N   . VAL C 3 83  ? 46.303 -65.368  18.386 1.00 37.32  ? 267 VAL D N   1 
ATOM 3461 C CA  . VAL C 3 83  ? 44.907 -65.765  18.242 1.00 36.71  ? 267 VAL D CA  1 
ATOM 3462 C C   . VAL C 3 83  ? 44.437 -65.537  16.813 1.00 45.73  ? 267 VAL D C   1 
ATOM 3463 O O   . VAL C 3 83  ? 43.705 -66.356  16.244 1.00 44.95  ? 267 VAL D O   1 
ATOM 3464 C CB  . VAL C 3 83  ? 44.035 -65.001  19.254 1.00 34.52  ? 267 VAL D CB  1 
ATOM 3465 C CG1 . VAL C 3 83  ? 42.574 -65.398  19.111 1.00 33.34  ? 267 VAL D CG1 1 
ATOM 3466 C CG2 . VAL C 3 83  ? 44.536 -65.246  20.669 1.00 36.85  ? 267 VAL D CG2 1 
ATOM 3467 N N   . LEU C 3 84  ? 44.865 -64.431  16.203 1.00 57.09  ? 268 LEU D N   1 
ATOM 3468 C CA  . LEU C 3 84  ? 44.477 -64.144  14.826 1.00 53.17  ? 268 LEU D CA  1 
ATOM 3469 C C   . LEU C 3 84  ? 45.161 -65.094  13.848 1.00 46.99  ? 268 LEU D C   1 
ATOM 3470 O O   . LEU C 3 84  ? 44.555 -65.514  12.856 1.00 42.73  ? 268 LEU D O   1 
ATOM 3471 C CB  . LEU C 3 84  ? 44.805 -62.691  14.491 1.00 44.60  ? 268 LEU D CB  1 
ATOM 3472 C CG  . LEU C 3 84  ? 43.738 -61.940  13.705 1.00 51.23  ? 268 LEU D CG  1 
ATOM 3473 C CD1 . LEU C 3 84  ? 42.532 -61.682  14.575 1.00 47.65  ? 268 LEU D CD1 1 
ATOM 3474 C CD2 . LEU C 3 84  ? 44.276 -60.642  13.143 1.00 60.27  ? 268 LEU D CD2 1 
ATOM 3475 N N   . ASN C 3 85  ? 46.426 -65.432  14.102 1.00 45.99  ? 269 ASN D N   1 
ATOM 3476 C CA  . ASN C 3 85  ? 47.164 -66.315  13.209 1.00 50.72  ? 269 ASN D CA  1 
ATOM 3477 C C   . ASN C 3 85  ? 46.846 -67.788  13.432 1.00 53.83  ? 269 ASN D C   1 
ATOM 3478 O O   . ASN C 3 85  ? 47.030 -68.594  12.512 1.00 49.87  ? 269 ASN D O   1 
ATOM 3479 C CB  . ASN C 3 85  ? 48.665 -66.090  13.376 1.00 53.60  ? 269 ASN D CB  1 
ATOM 3480 C CG  . ASN C 3 85  ? 49.111 -64.751  12.844 1.00 50.05  ? 269 ASN D CG  1 
ATOM 3481 O OD1 . ASN C 3 85  ? 48.476 -64.181  11.955 1.00 51.43  ? 269 ASN D OD1 1 
ATOM 3482 N ND2 . ASN C 3 85  ? 50.205 -64.235  13.387 1.00 52.87  ? 269 ASN D ND2 1 
ATOM 3483 N N   . THR C 3 86  ? 46.368 -68.156  14.618 1.00 56.68  ? 270 THR D N   1 
ATOM 3484 C CA  . THR C 3 86  ? 45.910 -69.519  14.880 1.00 56.60  ? 270 THR D CA  1 
ATOM 3485 C C   . THR C 3 86  ? 44.450 -69.595  14.451 1.00 51.14  ? 270 THR D C   1 
ATOM 3486 O O   . THR C 3 86  ? 43.549 -69.174  15.180 1.00 46.46  ? 270 THR D O   1 
ATOM 3487 C CB  . THR C 3 86  ? 46.091 -69.884  16.351 1.00 53.42  ? 270 THR D CB  1 
ATOM 3488 O OG1 . THR C 3 86  ? 47.489 -69.909  16.667 1.00 56.77  ? 270 THR D OG1 1 
ATOM 3489 C CG2 . THR C 3 86  ? 45.510 -71.262  16.629 1.00 55.42  ? 270 THR D CG2 1 
ATOM 3490 N N   . LYS C 3 87  ? 44.216 -70.137  13.258 1.00 45.93  ? 271 LYS D N   1 
ATOM 3491 C CA  . LYS C 3 87  ? 42.893 -70.130  12.637 1.00 50.14  ? 271 LYS D CA  1 
ATOM 3492 C C   . LYS C 3 87  ? 42.702 -71.450  11.913 1.00 61.33  ? 271 LYS D C   1 
ATOM 3493 O O   . LYS C 3 87  ? 43.064 -71.589  10.738 1.00 67.27  ? 271 LYS D O   1 
ATOM 3494 C CB  . LYS C 3 87  ? 42.724 -68.954  11.676 1.00 45.09  ? 271 LYS D CB  1 
ATOM 3495 C CG  . LYS C 3 87  ? 41.310 -68.401  11.648 1.00 46.90  ? 271 LYS D CG  1 
ATOM 3496 C CD  . LYS C 3 87  ? 40.997 -67.709  10.330 1.00 58.00  ? 271 LYS D CD  1 
ATOM 3497 C CE  . LYS C 3 87  ? 39.636 -67.023  10.377 1.00 60.93  ? 271 LYS D CE  1 
ATOM 3498 N NZ  . LYS C 3 87  ? 38.688 -67.573  9.370  1.00 63.52  ? 271 LYS D NZ  1 
ATOM 3499 N N   . PRO C 3 88  ? 42.158 -72.457  12.596 1.00 56.54  ? 272 PRO D N   1 
ATOM 3500 C CA  . PRO C 3 88  ? 42.024 -73.777  11.971 1.00 56.80  ? 272 PRO D CA  1 
ATOM 3501 C C   . PRO C 3 88  ? 41.146 -73.725  10.728 1.00 56.17  ? 272 PRO D C   1 
ATOM 3502 O O   . PRO C 3 88  ? 40.190 -72.952  10.645 1.00 57.04  ? 272 PRO D O   1 
ATOM 3503 C CB  . PRO C 3 88  ? 41.388 -74.627  13.078 1.00 57.97  ? 272 PRO D CB  1 
ATOM 3504 C CG  . PRO C 3 88  ? 40.732 -73.634  13.996 1.00 51.29  ? 272 PRO D CG  1 
ATOM 3505 C CD  . PRO C 3 88  ? 41.615 -72.428  13.964 1.00 48.80  ? 272 PRO D CD  1 
ATOM 3506 N N   . ASP C 3 89  ? 41.485 -74.570  9.756  1.00 59.78  ? 273 ASP D N   1 
ATOM 3507 C CA  . ASP C 3 89  ? 40.783 -74.599  8.475  1.00 61.28  ? 273 ASP D CA  1 
ATOM 3508 C C   . ASP C 3 89  ? 39.423 -75.256  8.668  1.00 55.63  ? 273 ASP D C   1 
ATOM 3509 O O   . ASP C 3 89  ? 39.338 -76.462  8.919  1.00 66.55  ? 273 ASP D O   1 
ATOM 3510 C CB  . ASP C 3 89  ? 41.622 -75.349  7.441  1.00 61.74  ? 273 ASP D CB  1 
ATOM 3511 C CG  . ASP C 3 89  ? 41.114 -75.166  6.015  1.00 64.99  ? 273 ASP D CG  1 
ATOM 3512 O OD1 . ASP C 3 89  ? 41.959 -75.012  5.106  1.00 66.08  ? 273 ASP D OD1 1 
ATOM 3513 O OD2 . ASP C 3 89  ? 39.885 -75.188  5.795  1.00 65.49  ? 273 ASP D OD2 1 
ATOM 3514 N N   . TYR C 3 90  ? 38.356 -74.466  8.535  1.00 45.74  ? 274 TYR D N   1 
ATOM 3515 C CA  . TYR C 3 90  ? 37.012 -74.993  8.735  1.00 50.78  ? 274 TYR D CA  1 
ATOM 3516 C C   . TYR C 3 90  ? 36.471 -75.662  7.476  1.00 54.43  ? 274 TYR D C   1 
ATOM 3517 O O   . TYR C 3 90  ? 35.754 -76.669  7.563  1.00 57.87  ? 274 TYR D O   1 
ATOM 3518 C CB  . TYR C 3 90  ? 36.086 -73.869  9.203  1.00 47.48  ? 274 TYR D CB  1 
ATOM 3519 C CG  . TYR C 3 90  ? 36.518 -73.238  10.515 1.00 53.76  ? 274 TYR D CG  1 
ATOM 3520 C CD1 . TYR C 3 90  ? 37.240 -72.052  10.538 1.00 60.99  ? 274 TYR D CD1 1 
ATOM 3521 C CD2 . TYR C 3 90  ? 36.211 -73.837  11.730 1.00 58.34  ? 274 TYR D CD2 1 
ATOM 3522 C CE1 . TYR C 3 90  ? 37.640 -71.476  11.737 1.00 56.67  ? 274 TYR D CE1 1 
ATOM 3523 C CE2 . TYR C 3 90  ? 36.605 -73.268  12.932 1.00 55.19  ? 274 TYR D CE2 1 
ATOM 3524 C CZ  . TYR C 3 90  ? 37.319 -72.090  12.929 1.00 50.91  ? 274 TYR D CZ  1 
ATOM 3525 O OH  . TYR C 3 90  ? 37.711 -71.529  14.123 1.00 48.27  ? 274 TYR D OH  1 
ATOM 3526 N N   . GLN C 3 91  ? 36.805 -75.123  6.300  1.00 57.60  ? 275 GLN D N   1 
ATOM 3527 C CA  . GLN C 3 91  ? 36.393 -75.750  5.048  1.00 60.57  ? 275 GLN D CA  1 
ATOM 3528 C C   . GLN C 3 91  ? 36.824 -77.209  4.989  1.00 63.14  ? 275 GLN D C   1 
ATOM 3529 O O   . GLN C 3 91  ? 36.026 -78.095  4.659  1.00 66.23  ? 275 GLN D O   1 
ATOM 3530 C CB  . GLN C 3 91  ? 36.966 -74.984  3.857  1.00 62.47  ? 275 GLN D CB  1 
ATOM 3531 C CG  . GLN C 3 91  ? 36.143 -73.792  3.431  1.00 71.28  ? 275 GLN D CG  1 
ATOM 3532 C CD  . GLN C 3 91  ? 36.009 -73.708  1.926  1.00 79.66  ? 275 GLN D CD  1 
ATOM 3533 O OE1 . GLN C 3 91  ? 34.927 -73.442  1.402  1.00 84.38  ? 275 GLN D OE1 1 
ATOM 3534 N NE2 . GLN C 3 91  ? 37.108 -73.952  1.219  1.00 79.09  ? 275 GLN D NE2 1 
ATOM 3535 N N   . LYS C 3 92  ? 38.091 -77.477  5.316  1.00 60.46  ? 276 LYS D N   1 
ATOM 3536 C CA  . LYS C 3 92  ? 38.560 -78.857  5.339  1.00 59.09  ? 276 LYS D CA  1 
ATOM 3537 C C   . LYS C 3 92  ? 37.774 -79.686  6.346  1.00 56.00  ? 276 LYS D C   1 
ATOM 3538 O O   . LYS C 3 92  ? 37.619 -80.897  6.161  1.00 60.22  ? 276 LYS D O   1 
ATOM 3539 C CB  . LYS C 3 92  ? 40.065 -78.899  5.627  1.00 51.33  ? 276 LYS D CB  1 
ATOM 3540 C CG  . LYS C 3 92  ? 40.468 -79.471  6.974  1.00 54.21  ? 276 LYS D CG  1 
ATOM 3541 C CD  . LYS C 3 92  ? 41.935 -79.890  6.955  1.00 64.46  ? 276 LYS D CD  1 
ATOM 3542 C CE  . LYS C 3 92  ? 42.263 -80.864  8.080  1.00 69.28  ? 276 LYS D CE  1 
ATOM 3543 N NZ  . LYS C 3 92  ? 43.629 -81.450  7.941  1.00 52.89  ? 276 LYS D NZ  1 
ATOM 3544 N N   . ILE C 3 93  ? 37.255 -79.054  7.401  1.00 48.94  ? 277 ILE D N   1 
ATOM 3545 C CA  . ILE C 3 93  ? 36.429 -79.776  8.362  1.00 50.19  ? 277 ILE D CA  1 
ATOM 3546 C C   . ILE C 3 93  ? 35.113 -80.202  7.720  1.00 54.08  ? 277 ILE D C   1 
ATOM 3547 O O   . ILE C 3 93  ? 34.699 -81.365  7.831  1.00 66.57  ? 277 ILE D O   1 
ATOM 3548 C CB  . ILE C 3 93  ? 36.200 -78.928  9.626  1.00 43.34  ? 277 ILE D CB  1 
ATOM 3549 C CG1 . ILE C 3 93  ? 37.522 -78.700  10.362 1.00 37.74  ? 277 ILE D CG1 1 
ATOM 3550 C CG2 . ILE C 3 93  ? 35.189 -79.594  10.544 1.00 53.39  ? 277 ILE D CG2 1 
ATOM 3551 C CD1 . ILE C 3 93  ? 37.403 -77.780  11.553 1.00 33.44  ? 277 ILE D CD1 1 
ATOM 3552 N N   . LEU C 3 94  ? 34.443 -79.281  7.020  1.00 47.95  ? 278 LEU D N   1 
ATOM 3553 C CA  . LEU C 3 94  ? 33.187 -79.655  6.371  1.00 55.18  ? 278 LEU D CA  1 
ATOM 3554 C C   . LEU C 3 94  ? 33.415 -80.705  5.286  1.00 58.49  ? 278 LEU D C   1 
ATOM 3555 O O   . LEU C 3 94  ? 32.597 -81.621  5.109  1.00 62.69  ? 278 LEU D O   1 
ATOM 3556 C CB  . LEU C 3 94  ? 32.489 -78.422  5.793  1.00 68.81  ? 278 LEU D CB  1 
ATOM 3557 C CG  . LEU C 3 94  ? 32.008 -77.343  6.772  1.00 60.99  ? 278 LEU D CG  1 
ATOM 3558 C CD1 . LEU C 3 94  ? 32.881 -76.099  6.726  1.00 44.24  ? 278 LEU D CD1 1 
ATOM 3559 C CD2 . LEU C 3 94  ? 30.551 -76.988  6.508  1.00 64.67  ? 278 LEU D CD2 1 
ATOM 3560 N N   . GLN C 3 95  ? 34.533 -80.600  4.562  1.00 54.92  ? 279 GLN D N   1 
ATOM 3561 C CA  . GLN C 3 95  ? 34.902 -81.647  3.612  1.00 60.98  ? 279 GLN D CA  1 
ATOM 3562 C C   . GLN C 3 95  ? 35.062 -82.989  4.318  1.00 59.03  ? 279 GLN D C   1 
ATOM 3563 O O   . GLN C 3 95  ? 34.555 -84.022  3.852  1.00 65.45  ? 279 GLN D O   1 
ATOM 3564 C CB  . GLN C 3 95  ? 36.193 -81.259  2.892  1.00 64.15  ? 279 GLN D CB  1 
ATOM 3565 C CG  . GLN C 3 95  ? 36.091 -79.986  2.070  1.00 70.73  ? 279 GLN D CG  1 
ATOM 3566 C CD  . GLN C 3 95  ? 37.324 -79.744  1.223  1.00 76.23  ? 279 GLN D CD  1 
ATOM 3567 O OE1 . GLN C 3 95  ? 38.421 -80.187  1.565  1.00 70.77  ? 279 GLN D OE1 1 
ATOM 3568 N NE2 . GLN C 3 95  ? 37.151 -79.035  0.113  1.00 75.06  ? 279 GLN D NE2 1 
ATOM 3569 N N   . ASN C 3 96  ? 35.760 -82.988  5.459  1.00 52.69  ? 280 ASN D N   1 
ATOM 3570 C CA  . ASN C 3 96  ? 35.953 -84.220  6.214  1.00 51.84  ? 280 ASN D CA  1 
ATOM 3571 C C   . ASN C 3 96  ? 34.625 -84.809  6.666  1.00 53.61  ? 280 ASN D C   1 
ATOM 3572 O O   . ASN C 3 96  ? 34.494 -86.034  6.755  1.00 58.66  ? 280 ASN D O   1 
ATOM 3573 C CB  . ASN C 3 96  ? 36.865 -83.976  7.417  1.00 49.12  ? 280 ASN D CB  1 
ATOM 3574 C CG  . ASN C 3 96  ? 38.303 -83.701  7.015  1.00 53.76  ? 280 ASN D CG  1 
ATOM 3575 O OD1 . ASN C 3 96  ? 38.615 -83.560  5.831  1.00 47.42  ? 280 ASN D OD1 1 
ATOM 3576 N ND2 . ASN C 3 96  ? 39.190 -83.628  8.002  1.00 61.25  ? 280 ASN D ND2 1 
ATOM 3577 N N   . GLN C 3 97  ? 33.628 -83.966  6.945  1.00 48.16  ? 281 GLN D N   1 
ATOM 3578 C CA  . GLN C 3 97  ? 32.286 -84.487  7.187  1.00 51.72  ? 281 GLN D CA  1 
ATOM 3579 C C   . GLN C 3 97  ? 31.733 -85.169  5.942  1.00 50.87  ? 281 GLN D C   1 
ATOM 3580 O O   . GLN C 3 97  ? 31.240 -86.308  6.001  1.00 52.00  ? 281 GLN D O   1 
ATOM 3581 C CB  . GLN C 3 97  ? 31.357 -83.360  7.636  1.00 50.31  ? 281 GLN D CB  1 
ATOM 3582 C CG  . GLN C 3 97  ? 31.882 -82.582  8.818  1.00 56.13  ? 281 GLN D CG  1 
ATOM 3583 C CD  . GLN C 3 97  ? 32.275 -83.487  9.963  1.00 61.28  ? 281 GLN D CD  1 
ATOM 3584 O OE1 . GLN C 3 97  ? 31.432 -84.171  10.546 1.00 62.34  ? 281 GLN D OE1 1 
ATOM 3585 N NE2 . GLN C 3 97  ? 33.564 -83.500  10.291 1.00 59.84  ? 281 GLN D NE2 1 
ATOM 3586 N N   . SER C 3 98  ? 31.830 -84.491  4.793  1.00 53.04  ? 282 SER D N   1 
ATOM 3587 C CA  . SER C 3 98  ? 31.274 -85.046  3.563  1.00 56.68  ? 282 SER D CA  1 
ATOM 3588 C C   . SER C 3 98  ? 31.864 -86.408  3.231  1.00 51.88  ? 282 SER D C   1 
ATOM 3589 O O   . SER C 3 98  ? 31.163 -87.265  2.682  1.00 54.72  ? 282 SER D O   1 
ATOM 3590 C CB  . SER C 3 98  ? 31.496 -84.087  2.395  1.00 70.02  ? 282 SER D CB  1 
ATOM 3591 O OG  . SER C 3 98  ? 31.199 -84.727  1.164  1.00 70.61  ? 282 SER D OG  1 
ATOM 3592 N N   . LYS C 3 99  ? 33.138 -86.637  3.555  1.00 50.37  ? 283 LYS D N   1 
ATOM 3593 C CA  . LYS C 3 99  ? 33.712 -87.960  3.325  1.00 56.28  ? 283 LYS D CA  1 
ATOM 3594 C C   . LYS C 3 99  ? 33.470 -88.930  4.478  1.00 55.04  ? 283 LYS D C   1 
ATOM 3595 O O   . LYS C 3 99  ? 33.458 -90.152  4.255  1.00 54.92  ? 283 LYS D O   1 
ATOM 3596 C CB  . LYS C 3 99  ? 35.210 -87.836  3.020  1.00 49.36  ? 283 LYS D CB  1 
ATOM 3597 C CG  . LYS C 3 99  ? 36.057 -87.187  4.094  1.00 37.37  ? 283 LYS D CG  1 
ATOM 3598 C CD  . LYS C 3 99  ? 37.486 -87.042  3.593  1.00 35.94  ? 283 LYS D CD  1 
ATOM 3599 C CE  . LYS C 3 99  ? 38.418 -86.506  4.659  1.00 43.88  ? 283 LYS D CE  1 
ATOM 3600 N NZ  . LYS C 3 99  ? 39.808 -86.357  4.142  1.00 42.55  ? 283 LYS D NZ  1 
ATOM 3601 N N   . VAL C 3 100 ? 33.255 -88.417  5.693  1.00 49.46  ? 284 VAL D N   1 
ATOM 3602 C CA  . VAL C 3 100 ? 32.823 -89.268  6.799  1.00 45.50  ? 284 VAL D CA  1 
ATOM 3603 C C   . VAL C 3 100 ? 31.533 -89.988  6.433  1.00 41.02  ? 284 VAL D C   1 
ATOM 3604 O O   . VAL C 3 100 ? 31.397 -91.201  6.637  1.00 38.39  ? 284 VAL D O   1 
ATOM 3605 C CB  . VAL C 3 100 ? 32.656 -88.439  8.086  1.00 43.77  ? 284 VAL D CB  1 
ATOM 3606 C CG1 . VAL C 3 100 ? 31.634 -89.086  9.010  1.00 36.59  ? 284 VAL D CG1 1 
ATOM 3607 C CG2 . VAL C 3 100 ? 33.991 -88.291  8.802  1.00 43.03  ? 284 VAL D CG2 1 
ATOM 3608 N N   . PHE C 3 101 ? 30.563 -89.249  5.885  1.00 43.94  ? 285 PHE D N   1 
ATOM 3609 C CA  . PHE C 3 101 ? 29.312 -89.887  5.481  1.00 41.97  ? 285 PHE D CA  1 
ATOM 3610 C C   . PHE C 3 101 ? 29.527 -90.956  4.416  1.00 43.84  ? 285 PHE D C   1 
ATOM 3611 O O   . PHE C 3 101 ? 28.800 -91.957  4.387  1.00 44.36  ? 285 PHE D O   1 
ATOM 3612 C CB  . PHE C 3 101 ? 28.312 -88.844  4.993  1.00 46.49  ? 285 PHE D CB  1 
ATOM 3613 C CG  . PHE C 3 101 ? 27.554 -88.185  6.100  1.00 53.19  ? 285 PHE D CG  1 
ATOM 3614 C CD1 . PHE C 3 101 ? 28.217 -87.476  7.088  1.00 54.28  ? 285 PHE D CD1 1 
ATOM 3615 C CD2 . PHE C 3 101 ? 26.177 -88.299  6.171  1.00 56.58  ? 285 PHE D CD2 1 
ATOM 3616 C CE1 . PHE C 3 101 ? 27.518 -86.874  8.117  1.00 56.91  ? 285 PHE D CE1 1 
ATOM 3617 C CE2 . PHE C 3 101 ? 25.472 -87.702  7.197  1.00 65.09  ? 285 PHE D CE2 1 
ATOM 3618 C CZ  . PHE C 3 101 ? 26.144 -86.987  8.171  1.00 62.33  ? 285 PHE D CZ  1 
ATOM 3619 N N   . ASP C 3 102 ? 30.506 -90.766  3.531  1.00 45.53  ? 286 ASP D N   1 
ATOM 3620 C CA  . ASP C 3 102 ? 30.795 -91.785  2.527  1.00 51.79  ? 286 ASP D CA  1 
ATOM 3621 C C   . ASP C 3 102 ? 31.334 -93.054  3.181  1.00 44.70  ? 286 ASP D C   1 
ATOM 3622 O O   . ASP C 3 102 ? 30.850 -94.167  2.910  1.00 39.07  ? 286 ASP D O   1 
ATOM 3623 C CB  . ASP C 3 102 ? 31.784 -91.228  1.503  1.00 54.64  ? 286 ASP D CB  1 
ATOM 3624 C CG  . ASP C 3 102 ? 31.175 -90.133  0.641  1.00 60.72  ? 286 ASP D CG  1 
ATOM 3625 O OD1 . ASP C 3 102 ? 29.930 -90.003  0.620  1.00 57.54  ? 286 ASP D OD1 1 
ATOM 3626 O OD2 . ASP C 3 102 ? 31.943 -89.397  -0.013 1.00 70.36  ? 286 ASP D OD2 1 
ATOM 3627 N N   . CYS C 3 103 ? 32.337 -92.899  4.054  1.00 41.43  ? 287 CYS D N   1 
ATOM 3628 C CA  . CYS C 3 103 ? 32.832 -94.032  4.831  1.00 36.81  ? 287 CYS D CA  1 
ATOM 3629 C C   . CYS C 3 103 ? 31.690 -94.767  5.517  1.00 32.54  ? 287 CYS D C   1 
ATOM 3630 O O   . CYS C 3 103 ? 31.633 -96.002  5.499  1.00 32.38  ? 287 CYS D O   1 
ATOM 3631 C CB  . CYS C 3 103 ? 33.851 -93.563  5.866  1.00 40.20  ? 287 CYS D CB  1 
ATOM 3632 S SG  . CYS C 3 103 ? 34.307 -94.859  7.038  1.00 47.90  ? 287 CYS D SG  1 
ATOM 3633 N N   . MET C 3 104 ? 30.771 -94.019  6.129  1.00 32.04  ? 288 MET D N   1 
ATOM 3634 C CA  . MET C 3 104 ? 29.624 -94.639  6.779  1.00 28.79  ? 288 MET D CA  1 
ATOM 3635 C C   . MET C 3 104 ? 28.768 -95.405  5.777  1.00 36.77  ? 288 MET D C   1 
ATOM 3636 O O   . MET C 3 104 ? 28.267 -96.499  6.081  1.00 39.62  ? 288 MET D O   1 
ATOM 3637 C CB  . MET C 3 104 ? 28.792 -93.561  7.468  1.00 27.22  ? 288 MET D CB  1 
ATOM 3638 C CG  . MET C 3 104 ? 27.767 -94.069  8.445  1.00 24.64  ? 288 MET D CG  1 
ATOM 3639 S SD  . MET C 3 104 ? 28.467 -94.245  10.089 1.00 37.56  ? 288 MET D SD  1 
ATOM 3640 C CE  . MET C 3 104 ? 26.987 -94.577  11.027 1.00 38.39  ? 288 MET D CE  1 
ATOM 3641 N N   . GLU C 3 105 ? 28.612 -94.865  4.566  1.00 41.26  ? 289 GLU D N   1 
ATOM 3642 C CA  . GLU C 3 105 ? 27.791 -95.542  3.568  1.00 44.90  ? 289 GLU D CA  1 
ATOM 3643 C C   . GLU C 3 105 ? 28.384 -96.898  3.207  1.00 42.99  ? 289 GLU D C   1 
ATOM 3644 O O   . GLU C 3 105 ? 27.676 -97.914  3.190  1.00 43.43  ? 289 GLU D O   1 
ATOM 3645 C CB  . GLU C 3 105 ? 27.622 -94.675  2.323  1.00 40.99  ? 289 GLU D CB  1 
ATOM 3646 C CG  . GLU C 3 105 ? 26.874 -95.390  1.211  1.00 38.51  ? 289 GLU D CG  1 
ATOM 3647 C CD  . GLU C 3 105 ? 27.476 -95.156  -0.154 1.00 59.07  ? 289 GLU D CD  1 
ATOM 3648 O OE1 . GLU C 3 105 ? 27.212 -95.973  -1.061 1.00 64.00  ? 289 GLU D OE1 1 
ATOM 3649 O OE2 . GLU C 3 105 ? 28.206 -94.153  -0.321 1.00 62.43  ? 289 GLU D OE2 1 
ATOM 3650 N N   . LEU C 3 106 ? 29.691 -96.943  2.925  1.00 42.72  ? 290 LEU D N   1 
ATOM 3651 C CA  . LEU C 3 106 ? 30.287 -98.235  2.591  1.00 40.27  ? 290 LEU D CA  1 
ATOM 3652 C C   . LEU C 3 106 ? 30.342 -99.160  3.805  1.00 35.94  ? 290 LEU D C   1 
ATOM 3653 O O   . LEU C 3 106 ? 30.334 -100.388 3.647  1.00 35.86  ? 290 LEU D O   1 
ATOM 3654 C CB  . LEU C 3 106 ? 31.680 -98.039  1.988  1.00 38.22  ? 290 LEU D CB  1 
ATOM 3655 C CG  . LEU C 3 106 ? 32.879 -97.779  2.904  1.00 37.63  ? 290 LEU D CG  1 
ATOM 3656 C CD1 . LEU C 3 106 ? 33.634 -99.068  3.210  1.00 37.94  ? 290 LEU D CD1 1 
ATOM 3657 C CD2 . LEU C 3 106 ? 33.805 -96.745  2.280  1.00 40.52  ? 290 LEU D CD2 1 
ATOM 3658 N N   . VAL C 3 107 ? 30.382 -98.595  5.016  1.00 36.19  ? 291 VAL D N   1 
ATOM 3659 C CA  . VAL C 3 107 ? 30.205 -99.401  6.223  1.00 33.16  ? 291 VAL D CA  1 
ATOM 3660 C C   . VAL C 3 107 ? 28.888 -100.162 6.155  1.00 33.58  ? 291 VAL D C   1 
ATOM 3661 O O   . VAL C 3 107 ? 28.844 -101.388 6.323  1.00 40.00  ? 291 VAL D O   1 
ATOM 3662 C CB  . VAL C 3 107 ? 30.281 -98.517  7.483  1.00 30.14  ? 291 VAL D CB  1 
ATOM 3663 C CG1 . VAL C 3 107 ? 29.516 -99.150  8.635  1.00 24.46  ? 291 VAL D CG1 1 
ATOM 3664 C CG2 . VAL C 3 107 ? 31.728 -98.284  7.886  1.00 32.32  ? 291 VAL D CG2 1 
ATOM 3665 N N   . MET C 3 108 ? 27.793 -99.447  5.888  1.00 35.52  ? 292 MET D N   1 
ATOM 3666 C CA  . MET C 3 108 ? 26.507 -100.130 5.820  1.00 37.50  ? 292 MET D CA  1 
ATOM 3667 C C   . MET C 3 108 ? 26.384 -101.026 4.592  1.00 40.02  ? 292 MET D C   1 
ATOM 3668 O O   . MET C 3 108 ? 25.579 -101.962 4.608  1.00 41.23  ? 292 MET D O   1 
ATOM 3669 C CB  . MET C 3 108 ? 25.363 -99.120  5.854  1.00 41.40  ? 292 MET D CB  1 
ATOM 3670 C CG  . MET C 3 108 ? 24.022 -99.756  6.170  1.00 45.38  ? 292 MET D CG  1 
ATOM 3671 S SD  . MET C 3 108 ? 22.929 -98.669  7.096  1.00 61.99  ? 292 MET D SD  1 
ATOM 3672 C CE  . MET C 3 108 ? 23.881 -98.429  8.594  1.00 44.95  ? 292 MET D CE  1 
ATOM 3673 N N   . ASP C 3 109 ? 27.149 -100.765 3.528  1.00 40.33  ? 293 ASP D N   1 
ATOM 3674 C CA  . ASP C 3 109 ? 27.177 -101.703 2.407  1.00 40.93  ? 293 ASP D CA  1 
ATOM 3675 C C   . ASP C 3 109 ? 27.781 -103.039 2.828  1.00 39.20  ? 293 ASP D C   1 
ATOM 3676 O O   . ASP C 3 109 ? 27.209 -104.105 2.560  1.00 30.22  ? 293 ASP D O   1 
ATOM 3677 C CB  . ASP C 3 109 ? 27.957 -101.109 1.233  1.00 35.96  ? 293 ASP D CB  1 
ATOM 3678 C CG  . ASP C 3 109 ? 27.139 -100.129 0.424  1.00 41.31  ? 293 ASP D CG  1 
ATOM 3679 O OD1 . ASP C 3 109 ? 25.922 -100.018 0.676  1.00 42.48  ? 293 ASP D OD1 1 
ATOM 3680 O OD2 . ASP C 3 109 ? 27.711 -99.487  -0.481 1.00 49.56  ? 293 ASP D OD2 1 
ATOM 3681 N N   . GLU C 3 110 ? 28.938 -102.997 3.496  1.00 44.62  ? 294 GLU D N   1 
ATOM 3682 C CA  . GLU C 3 110 ? 29.550 -104.222 4.004  1.00 38.75  ? 294 GLU D CA  1 
ATOM 3683 C C   . GLU C 3 110 ? 28.624 -104.936 4.978  1.00 39.20  ? 294 GLU D C   1 
ATOM 3684 O O   . GLU C 3 110 ? 28.501 -106.168 4.945  1.00 46.46  ? 294 GLU D O   1 
ATOM 3685 C CB  . GLU C 3 110 ? 30.878 -103.892 4.683  1.00 42.61  ? 294 GLU D CB  1 
ATOM 3686 C CG  . GLU C 3 110 ? 31.391 -104.965 5.629  1.00 40.75  ? 294 GLU D CG  1 
ATOM 3687 C CD  . GLU C 3 110 ? 32.191 -104.386 6.785  1.00 48.80  ? 294 GLU D CD  1 
ATOM 3688 O OE1 . GLU C 3 110 ? 32.862 -105.163 7.497  1.00 44.99  ? 294 GLU D OE1 1 
ATOM 3689 O OE2 . GLU C 3 110 ? 32.149 -103.151 6.982  1.00 54.24  ? 294 GLU D OE2 1 
ATOM 3690 N N   . LEU C 3 111 ? 27.950 -104.176 5.844  1.00 37.60  ? 295 LEU D N   1 
ATOM 3691 C CA  . LEU C 3 111 ? 26.997 -104.781 6.769  1.00 40.02  ? 295 LEU D CA  1 
ATOM 3692 C C   . LEU C 3 111 ? 25.882 -105.491 6.011  1.00 41.07  ? 295 LEU D C   1 
ATOM 3693 O O   . LEU C 3 111 ? 25.598 -106.672 6.251  1.00 39.02  ? 295 LEU D O   1 
ATOM 3694 C CB  . LEU C 3 111 ? 26.428 -103.712 7.700  1.00 44.21  ? 295 LEU D CB  1 
ATOM 3695 C CG  . LEU C 3 111 ? 25.661 -104.215 8.921  1.00 41.96  ? 295 LEU D CG  1 
ATOM 3696 C CD1 . LEU C 3 111 ? 26.559 -105.097 9.774  1.00 35.44  ? 295 LEU D CD1 1 
ATOM 3697 C CD2 . LEU C 3 111 ? 25.125 -103.047 9.729  1.00 46.62  ? 295 LEU D CD2 1 
ATOM 3698 N N   . GLN C 3 112 ? 25.268 -104.790 5.059  1.00 41.64  ? 296 GLN D N   1 
ATOM 3699 C CA  . GLN C 3 112 ? 24.174 -105.337 4.272  1.00 47.61  ? 296 GLN D CA  1 
ATOM 3700 C C   . GLN C 3 112 ? 24.612 -106.480 3.365  1.00 43.33  ? 296 GLN D C   1 
ATOM 3701 O O   . GLN C 3 112 ? 23.754 -107.206 2.852  1.00 34.92  ? 296 GLN D O   1 
ATOM 3702 C CB  . GLN C 3 112 ? 23.561 -104.209 3.441  1.00 50.76  ? 296 GLN D CB  1 
ATOM 3703 C CG  . GLN C 3 112 ? 22.102 -104.379 3.084  1.00 60.33  ? 296 GLN D CG  1 
ATOM 3704 C CD  . GLN C 3 112 ? 21.551 -103.158 2.372  1.00 64.51  ? 296 GLN D CD  1 
ATOM 3705 O OE1 . GLN C 3 112 ? 22.277 -102.461 1.661  1.00 58.55  ? 296 GLN D OE1 1 
ATOM 3706 N NE2 . GLN C 3 112 ? 20.264 -102.891 2.561  1.00 77.17  ? 296 GLN D NE2 1 
ATOM 3707 N N   . GLY C 3 113 ? 25.914 -106.670 3.171  1.00 39.27  ? 297 GLY D N   1 
ATOM 3708 C CA  . GLY C 3 113 ? 26.394 -107.877 2.532  1.00 37.34  ? 297 GLY D CA  1 
ATOM 3709 C C   . GLY C 3 113 ? 26.507 -109.021 3.517  1.00 41.67  ? 297 GLY D C   1 
ATOM 3710 O O   . GLY C 3 113 ? 26.068 -110.149 3.243  1.00 50.95  ? 297 GLY D O   1 
ATOM 3711 N N   . SER C 3 114 ? 27.085 -108.728 4.686  1.00 36.90  ? 298 SER D N   1 
ATOM 3712 C CA  . SER C 3 114 ? 27.240 -109.763 5.701  1.00 36.58  ? 298 SER D CA  1 
ATOM 3713 C C   . SER C 3 114 ? 25.896 -110.345 6.121  1.00 35.28  ? 298 SER D C   1 
ATOM 3714 O O   . SER C 3 114 ? 25.801 -111.551 6.388  1.00 39.74  ? 298 SER D O   1 
ATOM 3715 C CB  . SER C 3 114 ? 27.989 -109.204 6.912  1.00 34.95  ? 298 SER D CB  1 
ATOM 3716 O OG  . SER C 3 114 ? 29.386 -109.161 6.673  1.00 28.92  ? 298 SER D OG  1 
ATOM 3717 N N   . VAL C 3 115 ? 24.843 -109.523 6.158  1.00 37.58  ? 299 VAL D N   1 
ATOM 3718 C CA  . VAL C 3 115 ? 23.523 -110.047 6.508  1.00 41.46  ? 299 VAL D CA  1 
ATOM 3719 C C   . VAL C 3 115 ? 23.073 -111.089 5.489  1.00 44.22  ? 299 VAL D C   1 
ATOM 3720 O O   . VAL C 3 115 ? 22.626 -112.185 5.857  1.00 47.73  ? 299 VAL D O   1 
ATOM 3721 C CB  . VAL C 3 115 ? 22.498 -108.904 6.673  1.00 47.38  ? 299 VAL D CB  1 
ATOM 3722 C CG1 . VAL C 3 115 ? 23.028 -107.867 7.648  1.00 48.20  ? 299 VAL D CG1 1 
ATOM 3723 C CG2 . VAL C 3 115 ? 22.141 -108.242 5.347  1.00 46.32  ? 299 VAL D CG2 1 
ATOM 3724 N N   . LYS C 3 116 ? 23.226 -110.786 4.193  1.00 48.37  ? 300 LYS D N   1 
ATOM 3725 C CA  . LYS C 3 116 ? 22.816 -111.733 3.162  1.00 46.92  ? 300 LYS D CA  1 
ATOM 3726 C C   . LYS C 3 116 ? 23.605 -113.024 3.279  1.00 48.05  ? 300 LYS D C   1 
ATOM 3727 O O   . LYS C 3 116 ? 23.027 -114.123 3.249  1.00 54.16  ? 300 LYS D O   1 
ATOM 3728 C CB  . LYS C 3 116 ? 22.980 -111.118 1.774  1.00 47.40  ? 300 LYS D CB  1 
ATOM 3729 C CG  . LYS C 3 116 ? 21.844 -110.189 1.381  1.00 56.25  ? 300 LYS D CG  1 
ATOM 3730 C CD  . LYS C 3 116 ? 21.930 -109.812 -0.085 1.00 65.60  ? 300 LYS D CD  1 
ATOM 3731 C CE  . LYS C 3 116 ? 21.605 -110.993 -0.982 1.00 60.90  ? 300 LYS D CE  1 
ATOM 3732 N NZ  . LYS C 3 116 ? 21.545 -110.589 -2.414 1.00 65.37  ? 300 LYS D NZ  1 
ATOM 3733 N N   . GLN C 3 117 ? 24.924 -112.905 3.462  1.00 44.68  ? 301 GLN D N   1 
ATOM 3734 C CA  . GLN C 3 117 ? 25.737 -114.089 3.697  1.00 44.85  ? 301 GLN D CA  1 
ATOM 3735 C C   . GLN C 3 117 ? 25.227 -114.890 4.892  1.00 47.17  ? 301 GLN D C   1 
ATOM 3736 O O   . GLN C 3 117 ? 25.343 -116.121 4.902  1.00 54.90  ? 301 GLN D O   1 
ATOM 3737 C CB  . GLN C 3 117 ? 27.204 -113.688 3.883  1.00 45.25  ? 301 GLN D CB  1 
ATOM 3738 C CG  . GLN C 3 117 ? 28.156 -114.861 4.100  1.00 65.45  ? 301 GLN D CG  1 
ATOM 3739 C CD  . GLN C 3 117 ? 29.457 -114.721 3.316  1.00 75.22  ? 301 GLN D CD  1 
ATOM 3740 O OE1 . GLN C 3 117 ? 30.174 -113.728 3.454  1.00 77.15  ? 301 GLN D OE1 1 
ATOM 3741 N NE2 . GLN C 3 117 ? 29.759 -115.715 2.481  1.00 56.42  ? 301 GLN D NE2 1 
ATOM 3742 N N   . LEU C 3 118 ? 24.629 -114.230 5.891  1.00 46.08  ? 302 LEU D N   1 
ATOM 3743 C CA  . LEU C 3 118 ? 24.109 -114.990 7.026  1.00 47.72  ? 302 LEU D CA  1 
ATOM 3744 C C   . LEU C 3 118 ? 22.797 -115.708 6.709  1.00 47.92  ? 302 LEU D C   1 
ATOM 3745 O O   . LEU C 3 118 ? 22.720 -116.940 6.806  1.00 50.68  ? 302 LEU D O   1 
ATOM 3746 C CB  . LEU C 3 118 ? 23.902 -114.084 8.239  1.00 49.26  ? 302 LEU D CB  1 
ATOM 3747 C CG  . LEU C 3 118 ? 23.048 -114.807 9.290  1.00 47.27  ? 302 LEU D CG  1 
ATOM 3748 C CD1 . LEU C 3 118 ? 23.868 -115.826 10.087 1.00 49.73  ? 302 LEU D CD1 1 
ATOM 3749 C CD2 . LEU C 3 118 ? 22.290 -113.853 10.189 1.00 47.73  ? 302 LEU D CD2 1 
ATOM 3750 N N   . GLN C 3 119 ? 21.735 -114.968 6.354  1.00 48.84  ? 303 GLN D N   1 
ATOM 3751 C CA  . GLN C 3 119 ? 20.474 -115.703 6.303  1.00 55.56  ? 303 GLN D CA  1 
ATOM 3752 C C   . GLN C 3 119 ? 20.365 -116.563 5.051  1.00 52.70  ? 303 GLN D C   1 
ATOM 3753 O O   . GLN C 3 119 ? 19.398 -117.318 4.928  1.00 47.81  ? 303 GLN D O   1 
ATOM 3754 C CB  . GLN C 3 119 ? 19.205 -114.836 6.445  1.00 59.06  ? 303 GLN D CB  1 
ATOM 3755 C CG  . GLN C 3 119 ? 18.721 -113.947 5.305  1.00 59.68  ? 303 GLN D CG  1 
ATOM 3756 C CD  . GLN C 3 119 ? 19.401 -112.617 5.205  1.00 54.89  ? 303 GLN D CD  1 
ATOM 3757 O OE1 . GLN C 3 119 ? 20.446 -112.514 4.596  1.00 46.87  ? 303 GLN D OE1 1 
ATOM 3758 N NE2 . GLN C 3 119 ? 18.810 -111.587 5.801  1.00 60.45  ? 303 GLN D NE2 1 
ATOM 3759 N N   . ALA C 3 120 ? 21.284 -116.424 4.090  1.00 50.93  ? 304 ALA D N   1 
ATOM 3760 C CA  . ALA C 3 120 ? 21.414 -117.479 3.091  1.00 51.27  ? 304 ALA D CA  1 
ATOM 3761 C C   . ALA C 3 120 ? 21.741 -118.802 3.775  1.00 59.75  ? 304 ALA D C   1 
ATOM 3762 O O   . ALA C 3 120 ? 21.105 -119.835 3.514  1.00 71.00  ? 304 ALA D O   1 
ATOM 3763 C CB  . ALA C 3 120 ? 22.487 -117.109 2.067  1.00 49.82  ? 304 ALA D CB  1 
ATOM 3764 N N   . PHE C 3 121 ? 22.715 -118.775 4.689  1.00 57.47  ? 305 PHE D N   1 
ATOM 3765 C CA  . PHE C 3 121 ? 23.036 -119.956 5.482  1.00 57.91  ? 305 PHE D CA  1 
ATOM 3766 C C   . PHE C 3 121 ? 21.851 -120.382 6.337  1.00 55.50  ? 305 PHE D C   1 
ATOM 3767 O O   . PHE C 3 121 ? 21.608 -121.581 6.521  1.00 58.33  ? 305 PHE D O   1 
ATOM 3768 C CB  . PHE C 3 121 ? 24.255 -119.681 6.360  1.00 54.61  ? 305 PHE D CB  1 
ATOM 3769 C CG  . PHE C 3 121 ? 24.563 -120.783 7.331  1.00 57.91  ? 305 PHE D CG  1 
ATOM 3770 C CD1 . PHE C 3 121 ? 24.298 -120.620 8.681  1.00 54.32  ? 305 PHE D CD1 1 
ATOM 3771 C CD2 . PHE C 3 121 ? 25.112 -121.978 6.901  1.00 62.71  ? 305 PHE D CD2 1 
ATOM 3772 C CE1 . PHE C 3 121 ? 24.583 -121.625 9.584  1.00 49.55  ? 305 PHE D CE1 1 
ATOM 3773 C CE2 . PHE C 3 121 ? 25.395 -122.990 7.801  1.00 60.55  ? 305 PHE D CE2 1 
ATOM 3774 C CZ  . PHE C 3 121 ? 25.129 -122.812 9.144  1.00 52.94  ? 305 PHE D CZ  1 
ATOM 3775 N N   . MET C 3 122 ? 21.099 -119.415 6.869  1.00 56.79  ? 306 MET D N   1 
ATOM 3776 C CA  . MET C 3 122 ? 19.923 -119.765 7.659  1.00 57.30  ? 306 MET D CA  1 
ATOM 3777 C C   . MET C 3 122 ? 18.883 -120.481 6.806  1.00 64.78  ? 306 MET D C   1 
ATOM 3778 O O   . MET C 3 122 ? 18.258 -121.449 7.255  1.00 72.03  ? 306 MET D O   1 
ATOM 3779 C CB  . MET C 3 122 ? 19.312 -118.514 8.293  1.00 64.48  ? 306 MET D CB  1 
ATOM 3780 C CG  . MET C 3 122 ? 20.009 -118.026 9.552  1.00 63.09  ? 306 MET D CG  1 
ATOM 3781 S SD  . MET C 3 122 ? 18.835 -117.309 10.721 1.00 61.80  ? 306 MET D SD  1 
ATOM 3782 C CE  . MET C 3 122 ? 18.087 -116.034 9.711  1.00 53.33  ? 306 MET D CE  1 
ATOM 3783 N N   . ASP C 3 123 ? 18.681 -120.012 5.574  1.00 66.75  ? 307 ASP D N   1 
ATOM 3784 C CA  . ASP C 3 123 ? 17.696 -120.623 4.688  1.00 65.02  ? 307 ASP D CA  1 
ATOM 3785 C C   . ASP C 3 123 ? 18.103 -122.039 4.297  1.00 65.43  ? 307 ASP D C   1 
ATOM 3786 O O   . ASP C 3 123 ? 17.280 -122.963 4.337  1.00 73.40  ? 307 ASP D O   1 
ATOM 3787 C CB  . ASP C 3 123 ? 17.503 -119.753 3.446  1.00 67.43  ? 307 ASP D CB  1 
ATOM 3788 C CG  . ASP C 3 123 ? 16.763 -118.465 3.749  1.00 74.41  ? 307 ASP D CG  1 
ATOM 3789 O OD1 . ASP C 3 123 ? 15.836 -118.493 4.586  1.00 80.49  ? 307 ASP D OD1 1 
ATOM 3790 O OD2 . ASP C 3 123 ? 17.112 -117.422 3.156  1.00 76.50  ? 307 ASP D OD2 1 
ATOM 3791 N N   . GLU C 3 124 ? 19.366 -122.236 3.904  1.00 58.44  ? 308 GLU D N   1 
ATOM 3792 C CA  . GLU C 3 124 ? 19.779 -123.597 3.578  1.00 63.49  ? 308 GLU D CA  1 
ATOM 3793 C C   . GLU C 3 124 ? 19.749 -124.500 4.808  1.00 66.01  ? 308 GLU D C   1 
ATOM 3794 O O   . GLU C 3 124 ? 19.470 -125.702 4.689  1.00 69.20  ? 308 GLU D O   1 
ATOM 3795 C CB  . GLU C 3 124 ? 21.171 -123.604 2.942  1.00 62.25  ? 308 GLU D CB  1 
ATOM 3796 C CG  . GLU C 3 124 ? 22.322 -123.745 3.924  1.00 71.30  ? 308 GLU D CG  1 
ATOM 3797 C CD  . GLU C 3 124 ? 23.612 -124.167 3.248  1.00 82.44  ? 308 GLU D CD  1 
ATOM 3798 O OE1 . GLU C 3 124 ? 23.634 -124.239 2.000  1.00 81.67  ? 308 GLU D OE1 1 
ATOM 3799 O OE2 . GLU C 3 124 ? 24.599 -124.440 3.964  1.00 86.02  ? 308 GLU D OE2 1 
ATOM 3800 N N   . SER C 3 125 ? 19.978 -123.933 5.995  1.00 62.87  ? 309 SER D N   1 
ATOM 3801 C CA  . SER C 3 125 ? 19.960 -124.736 7.213  1.00 61.62  ? 309 SER D CA  1 
ATOM 3802 C C   . SER C 3 125 ? 18.546 -125.188 7.547  1.00 64.44  ? 309 SER D C   1 
ATOM 3803 O O   . SER C 3 125 ? 18.314 -126.366 7.845  1.00 69.64  ? 309 SER D O   1 
ATOM 3804 C CB  . SER C 3 125 ? 20.575 -123.951 8.371  1.00 59.27  ? 309 SER D CB  1 
ATOM 3805 O OG  . SER C 3 125 ? 19.801 -122.808 8.680  1.00 68.89  ? 309 SER D OG  1 
ATOM 3806 N N   . THR C 3 126 ? 17.582 -124.266 7.492  1.00 64.14  ? 310 THR D N   1 
ATOM 3807 C CA  . THR C 3 126 ? 16.203 -124.642 7.777  1.00 72.93  ? 310 THR D CA  1 
ATOM 3808 C C   . THR C 3 126 ? 15.654 -125.570 6.699  1.00 76.18  ? 310 THR D C   1 
ATOM 3809 O O   . THR C 3 126 ? 14.843 -126.458 6.999  1.00 79.02  ? 310 THR D O   1 
ATOM 3810 C CB  . THR C 3 126 ? 15.328 -123.390 7.935  1.00 71.67  ? 310 THR D CB  1 
ATOM 3811 O OG1 . THR C 3 126 ? 14.053 -123.752 8.483  1.00 73.42  ? 310 THR D OG1 1 
ATOM 3812 C CG2 . THR C 3 126 ? 15.125 -122.668 6.607  1.00 66.86  ? 310 THR D CG2 1 
ATOM 3813 N N   . GLN C 3 127 ? 16.111 -125.411 5.453  1.00 73.00  ? 311 GLN D N   1 
ATOM 3814 C CA  . GLN C 3 127 ? 15.642 -126.282 4.381  1.00 74.65  ? 311 GLN D CA  1 
ATOM 3815 C C   . GLN C 3 127 ? 16.150 -127.708 4.567  1.00 76.48  ? 311 GLN D C   1 
ATOM 3816 O O   . GLN C 3 127 ? 15.367 -128.667 4.530  1.00 74.70  ? 311 GLN D O   1 
ATOM 3817 C CB  . GLN C 3 127 ? 16.084 -125.719 3.030  1.00 65.87  ? 311 GLN D CB  1 
ATOM 3818 C CG  . GLN C 3 127 ? 16.154 -126.748 1.918  1.00 71.55  ? 311 GLN D CG  1 
ATOM 3819 C CD  . GLN C 3 127 ? 17.334 -126.522 0.994  1.00 78.54  ? 311 GLN D CD  1 
ATOM 3820 O OE1 . GLN C 3 127 ? 17.671 -125.383 0.669  1.00 88.41  ? 311 GLN D OE1 1 
ATOM 3821 N NE2 . GLN C 3 127 ? 17.973 -127.607 0.572  1.00 85.25  ? 311 GLN D NE2 1 
ATOM 3822 N N   . CYS C 3 128 ? 17.457 -127.872 4.794  1.00 75.34  ? 312 CYS D N   1 
ATOM 3823 C CA  . CYS C 3 128 ? 17.981 -129.216 5.013  1.00 71.93  ? 312 CYS D CA  1 
ATOM 3824 C C   . CYS C 3 128 ? 17.543 -129.803 6.348  1.00 66.62  ? 312 CYS D C   1 
ATOM 3825 O O   . CYS C 3 128 ? 17.575 -131.026 6.509  1.00 74.43  ? 312 CYS D O   1 
ATOM 3826 C CB  . CYS C 3 128 ? 19.503 -129.221 4.914  1.00 73.84  ? 312 CYS D CB  1 
ATOM 3827 S SG  . CYS C 3 128 ? 20.252 -130.864 4.823  1.00 89.07  ? 312 CYS D SG  1 
ATOM 3828 N N   . PHE C 3 129 ? 17.128 -128.971 7.303  1.00 67.73  ? 313 PHE D N   1 
ATOM 3829 C CA  . PHE C 3 129 ? 16.599 -129.502 8.552  1.00 66.87  ? 313 PHE D CA  1 
ATOM 3830 C C   . PHE C 3 129 ? 15.128 -129.870 8.459  1.00 69.29  ? 313 PHE D C   1 
ATOM 3831 O O   . PHE C 3 129 ? 14.654 -130.669 9.273  1.00 71.14  ? 313 PHE D O   1 
ATOM 3832 C CB  . PHE C 3 129 ? 16.807 -128.509 9.692  1.00 67.66  ? 313 PHE D CB  1 
ATOM 3833 C CG  . PHE C 3 129 ? 18.166 -128.588 10.311 1.00 65.11  ? 313 PHE D CG  1 
ATOM 3834 C CD1 . PHE C 3 129 ? 19.183 -129.295 9.689  1.00 65.96  ? 313 PHE D CD1 1 
ATOM 3835 C CD2 . PHE C 3 129 ? 18.420 -127.985 11.528 1.00 62.02  ? 313 PHE D CD2 1 
ATOM 3836 C CE1 . PHE C 3 129 ? 20.434 -129.378 10.261 1.00 67.70  ? 313 PHE D CE1 1 
ATOM 3837 C CE2 . PHE C 3 129 ? 19.670 -128.066 12.107 1.00 66.56  ? 313 PHE D CE2 1 
ATOM 3838 C CZ  . PHE C 3 129 ? 20.678 -128.763 11.472 1.00 66.77  ? 313 PHE D CZ  1 
ATOM 3839 N N   . GLN C 3 130 ? 14.395 -129.313 7.502  1.00 73.59  ? 314 GLN D N   1 
ATOM 3840 C CA  . GLN C 3 130 ? 13.084 -129.859 7.188  1.00 80.55  ? 314 GLN D CA  1 
ATOM 3841 C C   . GLN C 3 130 ? 13.168 -131.016 6.202  1.00 75.22  ? 314 GLN D C   1 
ATOM 3842 O O   . GLN C 3 130 ? 12.189 -131.754 6.044  1.00 75.41  ? 314 GLN D O   1 
ATOM 3843 C CB  . GLN C 3 130 ? 12.162 -128.765 6.641  1.00 87.20  ? 314 GLN D CB  1 
ATOM 3844 C CG  . GLN C 3 130 ? 10.683 -129.120 6.712  1.00 91.33  ? 314 GLN D CG  1 
ATOM 3845 C CD  . GLN C 3 130 ? 10.342 -129.941 7.946  1.00 91.30  ? 314 GLN D CD  1 
ATOM 3846 O OE1 . GLN C 3 130 ? 10.502 -129.480 9.077  1.00 102.73 ? 314 GLN D OE1 1 
ATOM 3847 N NE2 . GLN C 3 130 ? 9.876  -131.168 7.732  1.00 75.05  ? 314 GLN D NE2 1 
ATOM 3848 N N   . LYS C 3 131 ? 14.318 -131.204 5.555  1.00 73.72  ? 315 LYS D N   1 
ATOM 3849 C CA  . LYS C 3 131 ? 14.540 -132.336 4.664  1.00 74.76  ? 315 LYS D CA  1 
ATOM 3850 C C   . LYS C 3 131 ? 14.709 -133.656 5.410  1.00 73.09  ? 315 LYS D C   1 
ATOM 3851 O O   . LYS C 3 131 ? 14.988 -134.675 4.767  1.00 77.18  ? 315 LYS D O   1 
ATOM 3852 C CB  . LYS C 3 131 ? 15.771 -132.077 3.790  1.00 74.31  ? 315 LYS D CB  1 
ATOM 3853 C CG  . LYS C 3 131 ? 15.447 -131.664 2.364  1.00 73.70  ? 315 LYS D CG  1 
ATOM 3854 C CD  . LYS C 3 131 ? 14.883 -132.823 1.563  1.00 89.54  ? 315 LYS D CD  1 
ATOM 3855 C CE  . LYS C 3 131 ? 14.110 -132.324 0.352  1.00 90.76  ? 315 LYS D CE  1 
ATOM 3856 N NZ  . LYS C 3 131 ? 12.814 -131.699 0.737  1.00 83.74  ? 315 LYS D NZ  1 
ATOM 3857 N N   . VAL C 3 132 ? 14.565 -133.663 6.738  1.00 69.94  ? 316 VAL D N   1 
ATOM 3858 C CA  . VAL C 3 132 ? 14.797 -134.863 7.538  1.00 73.66  ? 316 VAL D CA  1 
ATOM 3859 C C   . VAL C 3 132 ? 13.685 -135.898 7.446  1.00 83.41  ? 316 VAL D C   1 
ATOM 3860 O O   . VAL C 3 132 ? 13.847 -137.012 7.962  1.00 81.30  ? 316 VAL D O   1 
ATOM 3861 C CB  . VAL C 3 132 ? 14.999 -134.475 9.014  1.00 63.29  ? 316 VAL D CB  1 
ATOM 3862 C CG1 . VAL C 3 132 ? 16.167 -133.516 9.149  1.00 59.22  ? 316 VAL D CG1 1 
ATOM 3863 C CG2 . VAL C 3 132 ? 13.724 -133.854 9.560  1.00 59.51  ? 316 VAL D CG2 1 
ATOM 3864 N N   . SER C 3 133 ? 12.563 -135.574 6.813  1.00 76.33  ? 317 SER D N   1 
ATOM 3865 C CA  . SER C 3 133 ? 11.471 -136.534 6.692  1.00 71.35  ? 317 SER D CA  1 
ATOM 3866 C C   . SER C 3 133 ? 11.765 -137.566 5.607  1.00 68.64  ? 317 SER D C   1 
ATOM 3867 O O   . SER C 3 133 ? 12.479 -138.542 5.845  1.00 68.26  ? 317 SER D O   1 
ATOM 3868 C CB  . SER C 3 133 ? 10.155 -135.814 6.401  1.00 64.97  ? 317 SER D CB  1 
ATOM 3869 O OG  . SER C 3 133 ? 9.901  -134.822 7.381  1.00 54.88  ? 317 SER D OG  1 
ATOM 3870 N N   . MET D 4 14  ? 77.028 9.135    11.018 1.00 89.14  ? 104 MET N N   1 
ATOM 3871 C CA  . MET D 4 14  ? 76.048 8.708    12.010 1.00 87.24  ? 104 MET N CA  1 
ATOM 3872 C C   . MET D 4 14  ? 74.907 9.716    12.144 1.00 82.24  ? 104 MET N C   1 
ATOM 3873 O O   . MET D 4 14  ? 74.362 10.186   11.144 1.00 80.98  ? 104 MET N O   1 
ATOM 3874 C CB  . MET D 4 14  ? 76.718 8.496    13.369 1.00 91.89  ? 104 MET N CB  1 
ATOM 3875 C CG  . MET D 4 14  ? 77.860 7.493    13.363 1.00 95.29  ? 104 MET N CG  1 
ATOM 3876 S SD  . MET D 4 14  ? 79.450 8.282    13.054 1.00 128.61 ? 104 MET N SD  1 
ATOM 3877 C CE  . MET D 4 14  ? 79.540 9.411    14.443 1.00 111.41 ? 104 MET N CE  1 
ATOM 3878 N N   . ASP D 4 15  ? 74.557 10.032   13.394 1.00 83.25  ? 105 ASP N N   1 
ATOM 3879 C CA  . ASP D 4 15  ? 73.486 10.969   13.730 1.00 90.66  ? 105 ASP N CA  1 
ATOM 3880 C C   . ASP D 4 15  ? 72.159 10.570   13.089 1.00 89.52  ? 105 ASP N C   1 
ATOM 3881 O O   . ASP D 4 15  ? 71.426 9.743    13.641 1.00 91.52  ? 105 ASP N O   1 
ATOM 3882 C CB  . ASP D 4 15  ? 73.872 12.395   13.326 1.00 101.11 ? 105 ASP N CB  1 
ATOM 3883 C CG  . ASP D 4 15  ? 74.371 13.220   14.503 1.00 100.42 ? 105 ASP N CG  1 
ATOM 3884 O OD1 . ASP D 4 15  ? 74.584 12.639   15.590 1.00 93.49  ? 105 ASP N OD1 1 
ATOM 3885 O OD2 . ASP D 4 15  ? 74.551 14.446   14.342 1.00 93.43  ? 105 ASP N OD2 1 
ATOM 3886 N N   . SER D 4 16  ? 71.832 11.167   11.938 1.00 91.00  ? 106 SER N N   1 
ATOM 3887 C CA  . SER D 4 16  ? 70.584 10.837   11.250 1.00 87.96  ? 106 SER N CA  1 
ATOM 3888 C C   . SER D 4 16  ? 70.517 9.355    10.885 1.00 78.74  ? 106 SER N C   1 
ATOM 3889 O O   . SER D 4 16  ? 69.449 8.730    10.975 1.00 69.98  ? 106 SER N O   1 
ATOM 3890 C CB  . SER D 4 16  ? 70.422 11.716   10.009 1.00 81.61  ? 106 SER N CB  1 
ATOM 3891 O OG  . SER D 4 16  ? 71.662 11.916   9.352  1.00 75.01  ? 106 SER N OG  1 
ATOM 3892 N N   . ASP D 4 17  ? 71.655 8.767    10.499 1.00 76.31  ? 107 ASP N N   1 
ATOM 3893 C CA  . ASP D 4 17  ? 71.678 7.341    10.187 1.00 75.56  ? 107 ASP N CA  1 
ATOM 3894 C C   . ASP D 4 17  ? 71.380 6.514    11.428 1.00 69.33  ? 107 ASP N C   1 
ATOM 3895 O O   . ASP D 4 17  ? 70.685 5.494    11.352 1.00 67.90  ? 107 ASP N O   1 
ATOM 3896 C CB  . ASP D 4 17  ? 73.037 6.948    9.608  1.00 74.83  ? 107 ASP N CB  1 
ATOM 3897 C CG  . ASP D 4 17  ? 73.528 7.922    8.561  1.00 77.60  ? 107 ASP N CG  1 
ATOM 3898 O OD1 . ASP D 4 17  ? 72.686 8.528    7.867  1.00 76.59  ? 107 ASP N OD1 1 
ATOM 3899 O OD2 . ASP D 4 17  ? 74.761 8.080    8.435  1.00 83.90  ? 107 ASP N OD2 1 
ATOM 3900 N N   . ILE D 4 18  ? 71.901 6.940    12.579 1.00 65.10  ? 108 ILE N N   1 
ATOM 3901 C CA  . ILE D 4 18  ? 71.645 6.223    13.820 1.00 59.04  ? 108 ILE N CA  1 
ATOM 3902 C C   . ILE D 4 18  ? 70.187 6.389    14.237 1.00 60.21  ? 108 ILE N C   1 
ATOM 3903 O O   . ILE D 4 18  ? 69.611 5.495    14.867 1.00 61.69  ? 108 ILE N O   1 
ATOM 3904 C CB  . ILE D 4 18  ? 72.631 6.689    14.911 1.00 60.98  ? 108 ILE N CB  1 
ATOM 3905 C CG1 . ILE D 4 18  ? 74.002 6.041    14.696 1.00 56.26  ? 108 ILE N CG1 1 
ATOM 3906 C CG2 . ILE D 4 18  ? 72.113 6.377    16.308 1.00 62.28  ? 108 ILE N CG2 1 
ATOM 3907 C CD1 . ILE D 4 18  ? 75.037 6.438    15.729 1.00 60.33  ? 108 ILE N CD1 1 
ATOM 3908 N N   . LYS D 4 19  ? 69.558 7.517    13.890 1.00 59.66  ? 109 LYS N N   1 
ATOM 3909 C CA  . LYS D 4 19  ? 68.140 7.683    14.203 1.00 55.80  ? 109 LYS N CA  1 
ATOM 3910 C C   . LYS D 4 19  ? 67.262 6.803    13.321 1.00 57.89  ? 109 LYS N C   1 
ATOM 3911 O O   . LYS D 4 19  ? 66.264 6.246    13.794 1.00 56.20  ? 109 LYS N O   1 
ATOM 3912 C CB  . LYS D 4 19  ? 67.725 9.148    14.079 1.00 45.58  ? 109 LYS N CB  1 
ATOM 3913 C CG  . LYS D 4 19  ? 67.816 9.899    15.388 1.00 50.42  ? 109 LYS N CG  1 
ATOM 3914 C CD  . LYS D 4 19  ? 66.899 9.272    16.425 1.00 43.45  ? 109 LYS N CD  1 
ATOM 3915 C CE  . LYS D 4 19  ? 67.429 9.488    17.828 1.00 38.04  ? 109 LYS N CE  1 
ATOM 3916 N NZ  . LYS D 4 19  ? 68.625 8.649    18.108 1.00 33.18  ? 109 LYS N NZ  1 
ATOM 3917 N N   . VAL D 4 20  ? 67.605 6.668    12.037 1.00 60.50  ? 110 VAL N N   1 
ATOM 3918 C CA  . VAL D 4 20  ? 66.841 5.763    11.180 1.00 58.99  ? 110 VAL N CA  1 
ATOM 3919 C C   . VAL D 4 20  ? 67.046 4.316    11.617 1.00 57.54  ? 110 VAL N C   1 
ATOM 3920 O O   . VAL D 4 20  ? 66.087 3.535    11.720 1.00 52.85  ? 110 VAL N O   1 
ATOM 3921 C CB  . VAL D 4 20  ? 67.226 5.972    9.704  1.00 55.37  ? 110 VAL N CB  1 
ATOM 3922 C CG1 . VAL D 4 20  ? 66.515 4.961    8.822  1.00 63.16  ? 110 VAL N CG1 1 
ATOM 3923 C CG2 . VAL D 4 20  ? 66.892 7.384    9.268  1.00 59.26  ? 110 VAL N CG2 1 
ATOM 3924 N N   . LEU D 4 21  ? 68.297 3.944    11.900 1.00 53.69  ? 111 LEU N N   1 
ATOM 3925 C CA  . LEU D 4 21  ? 68.603 2.577    12.302 1.00 52.69  ? 111 LEU N CA  1 
ATOM 3926 C C   . LEU D 4 21  ? 67.952 2.235    13.638 1.00 50.33  ? 111 LEU N C   1 
ATOM 3927 O O   . LEU D 4 21  ? 67.397 1.143    13.804 1.00 56.36  ? 111 LEU N O   1 
ATOM 3928 C CB  . LEU D 4 21  ? 70.119 2.394    12.373 1.00 56.51  ? 111 LEU N CB  1 
ATOM 3929 C CG  . LEU D 4 21  ? 70.689 0.981    12.502 1.00 69.78  ? 111 LEU N CG  1 
ATOM 3930 C CD1 . LEU D 4 21  ? 70.338 0.142    11.281 1.00 67.82  ? 111 LEU N CD1 1 
ATOM 3931 C CD2 . LEU D 4 21  ? 72.194 1.036    12.704 1.00 66.87  ? 111 LEU N CD2 1 
ATOM 3932 N N   . GLU D 4 22  ? 68.000 3.158    14.600 1.00 44.64  ? 112 GLU N N   1 
ATOM 3933 C CA  . GLU D 4 22  ? 67.339 2.922    15.878 1.00 44.62  ? 112 GLU N CA  1 
ATOM 3934 C C   . GLU D 4 22  ? 65.827 2.921    15.728 1.00 41.87  ? 112 GLU N C   1 
ATOM 3935 O O   . GLU D 4 22  ? 65.131 2.255    16.501 1.00 42.68  ? 112 GLU N O   1 
ATOM 3936 C CB  . GLU D 4 22  ? 67.746 3.975    16.908 1.00 52.02  ? 112 GLU N CB  1 
ATOM 3937 C CG  . GLU D 4 22  ? 68.985 3.631    17.715 1.00 65.81  ? 112 GLU N CG  1 
ATOM 3938 C CD  . GLU D 4 22  ? 69.117 4.479    18.970 1.00 62.14  ? 112 GLU N CD  1 
ATOM 3939 O OE1 . GLU D 4 22  ? 69.794 4.033    19.922 1.00 66.66  ? 112 GLU N OE1 1 
ATOM 3940 O OE2 . GLU D 4 22  ? 68.524 5.577    19.013 1.00 55.19  ? 112 GLU N OE2 1 
ATOM 3941 N N   . ASP D 4 23  ? 65.301 3.669    14.757 1.00 47.82  ? 113 ASP N N   1 
ATOM 3942 C CA  . ASP D 4 23  ? 63.862 3.660    14.524 1.00 47.89  ? 113 ASP N CA  1 
ATOM 3943 C C   . ASP D 4 23  ? 63.404 2.294    14.032 1.00 46.13  ? 113 ASP N C   1 
ATOM 3944 O O   . ASP D 4 23  ? 62.503 1.677    14.620 1.00 47.08  ? 113 ASP N O   1 
ATOM 3945 C CB  . ASP D 4 23  ? 63.484 4.749    13.519 1.00 48.56  ? 113 ASP N CB  1 
ATOM 3946 C CG  . ASP D 4 23  ? 62.871 5.969    14.179 1.00 42.94  ? 113 ASP N CG  1 
ATOM 3947 O OD1 . ASP D 4 23  ? 63.103 6.177    15.389 1.00 39.60  ? 113 ASP N OD1 1 
ATOM 3948 O OD2 . ASP D 4 23  ? 62.143 6.711    13.488 1.00 43.87  ? 113 ASP N OD2 1 
ATOM 3949 N N   . GLN D 4 24  ? 64.022 1.800    12.954 1.00 49.95  ? 114 GLN N N   1 
ATOM 3950 C CA  . GLN D 4 24  ? 63.677 0.467    12.473 1.00 53.25  ? 114 GLN N CA  1 
ATOM 3951 C C   . GLN D 4 24  ? 63.962 -0.595   13.529 1.00 48.02  ? 114 GLN N C   1 
ATOM 3952 O O   . GLN D 4 24  ? 63.226 -1.585   13.624 1.00 54.88  ? 114 GLN N O   1 
ATOM 3953 C CB  . GLN D 4 24  ? 64.409 0.159    11.162 1.00 55.86  ? 114 GLN N CB  1 
ATOM 3954 C CG  . GLN D 4 24  ? 65.874 -0.223   11.289 1.00 49.60  ? 114 GLN N CG  1 
ATOM 3955 C CD  . GLN D 4 24  ? 66.415 -0.854   10.018 1.00 53.47  ? 114 GLN N CD  1 
ATOM 3956 O OE1 . GLN D 4 24  ? 67.623 -0.876   9.785  1.00 54.45  ? 114 GLN N OE1 1 
ATOM 3957 N NE2 . GLN D 4 24  ? 65.516 -1.375   9.187  1.00 55.97  ? 114 GLN N NE2 1 
ATOM 3958 N N   . PHE D 4 25  ? 65.014 -0.408   14.332 1.00 42.91  ? 115 PHE N N   1 
ATOM 3959 C CA  . PHE D 4 25  ? 65.321 -1.371   15.386 1.00 45.54  ? 115 PHE N CA  1 
ATOM 3960 C C   . PHE D 4 25  ? 64.204 -1.420   16.422 1.00 41.61  ? 115 PHE N C   1 
ATOM 3961 O O   . PHE D 4 25  ? 63.769 -2.501   16.829 1.00 43.56  ? 115 PHE N O   1 
ATOM 3962 C CB  . PHE D 4 25  ? 66.656 -1.034   16.048 1.00 48.10  ? 115 PHE N CB  1 
ATOM 3963 C CG  . PHE D 4 25  ? 67.151 -2.106   16.977 1.00 50.32  ? 115 PHE N CG  1 
ATOM 3964 C CD1 . PHE D 4 25  ? 67.574 -3.329   16.478 1.00 47.62  ? 115 PHE N CD1 1 
ATOM 3965 C CD2 . PHE D 4 25  ? 67.178 -1.900   18.345 1.00 50.18  ? 115 PHE N CD2 1 
ATOM 3966 C CE1 . PHE D 4 25  ? 68.025 -4.316   17.324 1.00 43.96  ? 115 PHE N CE1 1 
ATOM 3967 C CE2 . PHE D 4 25  ? 67.628 -2.888   19.199 1.00 48.30  ? 115 PHE N CE2 1 
ATOM 3968 C CZ  . PHE D 4 25  ? 68.053 -4.097   18.687 1.00 49.66  ? 115 PHE N CZ  1 
ATOM 3969 N N   . ASP D 4 26  ? 63.731 -0.254   16.870 1.00 42.54  ? 116 ASP N N   1 
ATOM 3970 C CA  . ASP D 4 26  ? 62.575 -0.229   17.760 1.00 39.07  ? 116 ASP N CA  1 
ATOM 3971 C C   . ASP D 4 26  ? 61.378 -0.921   17.132 1.00 38.06  ? 116 ASP N C   1 
ATOM 3972 O O   . ASP D 4 26  ? 60.683 -1.705   17.794 1.00 41.42  ? 116 ASP N O   1 
ATOM 3973 C CB  . ASP D 4 26  ? 62.204 1.209    18.109 1.00 47.57  ? 116 ASP N CB  1 
ATOM 3974 C CG  . ASP D 4 26  ? 60.963 1.288    18.969 1.00 47.90  ? 116 ASP N CG  1 
ATOM 3975 O OD1 . ASP D 4 26  ? 61.082 1.101    20.188 1.00 46.71  ? 116 ASP N OD1 1 
ATOM 3976 O OD2 . ASP D 4 26  ? 59.866 1.546    18.428 1.00 42.15  ? 116 ASP N OD2 1 
ATOM 3977 N N   . GLU D 4 27  ? 61.128 -0.650   15.850 1.00 38.85  ? 117 GLU N N   1 
ATOM 3978 C CA  . GLU D 4 27  ? 60.009 -1.295   15.176 1.00 42.56  ? 117 GLU N CA  1 
ATOM 3979 C C   . GLU D 4 27  ? 60.134 -2.813   15.225 1.00 44.74  ? 117 GLU N C   1 
ATOM 3980 O O   . GLU D 4 27  ? 59.155 -3.515   15.506 1.00 44.04  ? 117 GLU N O   1 
ATOM 3981 C CB  . GLU D 4 27  ? 59.904 -0.805   13.734 1.00 44.88  ? 117 GLU N CB  1 
ATOM 3982 C CG  . GLU D 4 27  ? 58.937 -1.622   12.898 1.00 61.57  ? 117 GLU N CG  1 
ATOM 3983 C CD  . GLU D 4 27  ? 57.503 -1.507   13.393 1.00 63.73  ? 117 GLU N CD  1 
ATOM 3984 O OE1 . GLU D 4 27  ? 57.125 -0.418   13.877 1.00 58.08  ? 117 GLU N OE1 1 
ATOM 3985 O OE2 . GLU D 4 27  ? 56.755 -2.506   13.300 1.00 60.33  ? 117 GLU N OE2 1 
ATOM 3986 N N   . ILE D 4 28  ? 61.330 -3.344   14.963 1.00 43.75  ? 118 ILE N N   1 
ATOM 3987 C CA  . ILE D 4 28  ? 61.476 -4.794   14.952 1.00 41.54  ? 118 ILE N CA  1 
ATOM 3988 C C   . ILE D 4 28  ? 61.434 -5.361   16.367 1.00 35.30  ? 118 ILE N C   1 
ATOM 3989 O O   . ILE D 4 28  ? 61.032 -6.513   16.563 1.00 39.88  ? 118 ILE N O   1 
ATOM 3990 C CB  . ILE D 4 28  ? 62.762 -5.211   14.213 1.00 40.65  ? 118 ILE N CB  1 
ATOM 3991 C CG1 . ILE D 4 28  ? 62.655 -6.664   13.754 1.00 45.94  ? 118 ILE N CG1 1 
ATOM 3992 C CG2 . ILE D 4 28  ? 63.975 -5.071   15.110 1.00 40.81  ? 118 ILE N CG2 1 
ATOM 3993 C CD1 . ILE D 4 28  ? 63.485 -6.976   12.540 1.00 47.58  ? 118 ILE N CD1 1 
ATOM 3994 N N   . ILE D 4 29  ? 61.829 -4.582   17.376 1.00 29.50  ? 119 ILE N N   1 
ATOM 3995 C CA  . ILE D 4 29  ? 61.741 -5.076   18.745 1.00 25.95  ? 119 ILE N CA  1 
ATOM 3996 C C   . ILE D 4 29  ? 60.286 -5.209   19.160 1.00 24.80  ? 119 ILE N C   1 
ATOM 3997 O O   . ILE D 4 29  ? 59.851 -6.267   19.629 1.00 33.62  ? 119 ILE N O   1 
ATOM 3998 C CB  . ILE D 4 29  ? 62.520 -4.170   19.716 1.00 30.94  ? 119 ILE N CB  1 
ATOM 3999 C CG1 . ILE D 4 29  ? 64.008 -4.161   19.374 1.00 36.76  ? 119 ILE N CG1 1 
ATOM 4000 C CG2 . ILE D 4 29  ? 62.317 -4.631   21.149 1.00 27.31  ? 119 ILE N CG2 1 
ATOM 4001 C CD1 . ILE D 4 29  ? 64.595 -5.533   19.229 1.00 45.17  ? 119 ILE N CD1 1 
ATOM 4002 N N   . VAL D 4 30  ? 59.502 -4.147   18.975 1.00 28.58  ? 120 VAL N N   1 
ATOM 4003 C CA  . VAL D 4 30  ? 58.098 -4.241   19.358 1.00 31.97  ? 120 VAL N CA  1 
ATOM 4004 C C   . VAL D 4 30  ? 57.363 -5.239   18.468 1.00 30.33  ? 120 VAL N C   1 
ATOM 4005 O O   . VAL D 4 30  ? 56.385 -5.863   18.900 1.00 28.68  ? 120 VAL N O   1 
ATOM 4006 C CB  . VAL D 4 30  ? 57.436 -2.851   19.334 1.00 34.55  ? 120 VAL N CB  1 
ATOM 4007 C CG1 . VAL D 4 30  ? 57.425 -2.277   17.920 1.00 41.19  ? 120 VAL N CG1 1 
ATOM 4008 C CG2 . VAL D 4 30  ? 56.030 -2.929   19.906 1.00 29.91  ? 120 VAL N CG2 1 
ATOM 4009 N N   . ASP D 4 31  ? 57.821 -5.426   17.229 1.00 32.11  ? 121 ASP N N   1 
ATOM 4010 C CA  . ASP D 4 31  ? 57.162 -6.380   16.342 1.00 40.55  ? 121 ASP N CA  1 
ATOM 4011 C C   . ASP D 4 31  ? 57.421 -7.813   16.789 1.00 36.38  ? 121 ASP N C   1 
ATOM 4012 O O   . ASP D 4 31  ? 56.487 -8.613   16.920 1.00 33.52  ? 121 ASP N O   1 
ATOM 4013 C CB  . ASP D 4 31  ? 57.630 -6.178   14.900 1.00 48.38  ? 121 ASP N CB  1 
ATOM 4014 C CG  . ASP D 4 31  ? 56.665 -6.773   13.884 1.00 57.66  ? 121 ASP N CG  1 
ATOM 4015 O OD1 . ASP D 4 31  ? 56.392 -6.106   12.862 1.00 72.99  ? 121 ASP N OD1 1 
ATOM 4016 O OD2 . ASP D 4 31  ? 56.174 -7.901   14.105 1.00 45.67  ? 121 ASP N OD2 1 
ATOM 4017 N N   . ILE D 4 32  ? 58.689 -8.156   17.031 1.00 35.69  ? 122 ILE N N   1 
ATOM 4018 C CA  . ILE D 4 32  ? 59.011 -9.514   17.452 1.00 26.44  ? 122 ILE N CA  1 
ATOM 4019 C C   . ILE D 4 32  ? 58.434 -9.791   18.834 1.00 25.76  ? 122 ILE N C   1 
ATOM 4020 O O   . ILE D 4 32  ? 58.114 -10.940  19.161 1.00 33.68  ? 122 ILE N O   1 
ATOM 4021 C CB  . ILE D 4 32  ? 60.532 -9.747   17.403 1.00 25.47  ? 122 ILE N CB  1 
ATOM 4022 C CG1 . ILE D 4 32  ? 60.840 -11.240  17.422 1.00 41.14  ? 122 ILE N CG1 1 
ATOM 4023 C CG2 . ILE D 4 32  ? 61.223 -9.088   18.578 1.00 29.60  ? 122 ILE N CG2 1 
ATOM 4024 C CD1 . ILE D 4 32  ? 60.242 -11.989  16.250 1.00 47.62  ? 122 ILE N CD1 1 
ATOM 4025 N N   . ALA D 4 33  ? 58.289 -8.756   19.666 1.00 30.06  ? 123 ALA N N   1 
ATOM 4026 C CA  . ALA D 4 33  ? 57.622 -8.932   20.953 1.00 29.01  ? 123 ALA N CA  1 
ATOM 4027 C C   . ALA D 4 33  ? 56.133 -9.206   20.766 1.00 29.34  ? 123 ALA N C   1 
ATOM 4028 O O   . ALA D 4 33  ? 55.556 -10.049  21.467 1.00 31.05  ? 123 ALA N O   1 
ATOM 4029 C CB  . ALA D 4 33  ? 57.848 -7.702   21.832 1.00 26.15  ? 123 ALA N CB  1 
ATOM 4030 N N   . THR D 4 34  ? 55.494 -8.494   19.832 1.00 31.58  ? 124 THR N N   1 
ATOM 4031 C CA  . THR D 4 34  ? 54.096 -8.772   19.518 1.00 29.51  ? 124 THR N CA  1 
ATOM 4032 C C   . THR D 4 34  ? 53.923 -10.200  19.022 1.00 33.26  ? 124 THR N C   1 
ATOM 4033 O O   . THR D 4 34  ? 52.983 -10.897  19.425 1.00 37.20  ? 124 THR N O   1 
ATOM 4034 C CB  . THR D 4 34  ? 53.579 -7.785   18.470 1.00 28.84  ? 124 THR N CB  1 
ATOM 4035 O OG1 . THR D 4 34  ? 53.894 -6.447   18.873 1.00 38.94  ? 124 THR N OG1 1 
ATOM 4036 C CG2 . THR D 4 34  ? 52.070 -7.924   18.298 1.00 21.41  ? 124 THR N CG2 1 
ATOM 4037 N N   . LYS D 4 35  ? 54.815 -10.651  18.137 1.00 29.54  ? 125 LYS N N   1 
ATOM 4038 C CA  . LYS D 4 35  ? 54.793 -12.041  17.698 1.00 30.75  ? 125 LYS N CA  1 
ATOM 4039 C C   . LYS D 4 35  ? 54.907 -12.987  18.889 1.00 33.53  ? 125 LYS N C   1 
ATOM 4040 O O   . LYS D 4 35  ? 54.029 -13.829  19.118 1.00 34.53  ? 125 LYS N O   1 
ATOM 4041 C CB  . LYS D 4 35  ? 55.923 -12.292  16.697 1.00 33.83  ? 125 LYS N CB  1 
ATOM 4042 C CG  . LYS D 4 35  ? 55.869 -11.421  15.450 1.00 38.81  ? 125 LYS N CG  1 
ATOM 4043 C CD  . LYS D 4 35  ? 54.687 -11.777  14.568 1.00 39.09  ? 125 LYS N CD  1 
ATOM 4044 C CE  . LYS D 4 35  ? 54.498 -10.760  13.451 1.00 43.69  ? 125 LYS N CE  1 
ATOM 4045 N NZ  . LYS D 4 35  ? 55.519 -10.903  12.382 1.00 40.88  ? 125 LYS N NZ  1 
ATOM 4046 N N   . ARG D 4 36  ? 55.983 -12.841  19.671 1.00 27.93  ? 126 ARG N N   1 
ATOM 4047 C CA  . ARG D 4 36  ? 56.205 -13.702  20.830 1.00 25.24  ? 126 ARG N CA  1 
ATOM 4048 C C   . ARG D 4 36  ? 54.977 -13.776  21.729 1.00 29.68  ? 126 ARG N C   1 
ATOM 4049 O O   . ARG D 4 36  ? 54.693 -14.827  22.318 1.00 26.50  ? 126 ARG N O   1 
ATOM 4050 C CB  . ARG D 4 36  ? 57.411 -13.213  21.633 1.00 24.89  ? 126 ARG N CB  1 
ATOM 4051 C CG  . ARG D 4 36  ? 58.759 -13.702  21.134 1.00 29.31  ? 126 ARG N CG  1 
ATOM 4052 C CD  . ARG D 4 36  ? 59.872 -12.732  21.510 1.00 32.25  ? 126 ARG N CD  1 
ATOM 4053 N NE  . ARG D 4 36  ? 61.199 -13.299  21.269 1.00 45.19  ? 126 ARG N NE  1 
ATOM 4054 C CZ  . ARG D 4 36  ? 62.327 -12.595  21.263 1.00 43.79  ? 126 ARG N CZ  1 
ATOM 4055 N NH1 . ARG D 4 36  ? 62.292 -11.290  21.477 1.00 49.99  ? 126 ARG N NH1 1 
ATOM 4056 N NH2 . ARG D 4 36  ? 63.492 -13.193  21.043 1.00 39.72  ? 126 ARG N NH2 1 
ATOM 4057 N N   . LYS D 4 37  ? 54.242 -12.672  21.861 1.00 31.90  ? 127 LYS N N   1 
ATOM 4058 C CA  . LYS D 4 37  ? 53.067 -12.689  22.732 1.00 33.92  ? 127 LYS N CA  1 
ATOM 4059 C C   . LYS D 4 37  ? 51.876 -13.357  22.052 1.00 32.21  ? 127 LYS N C   1 
ATOM 4060 O O   . LYS D 4 37  ? 51.407 -14.412  22.489 1.00 40.43  ? 127 LYS N O   1 
ATOM 4061 C CB  . LYS D 4 37  ? 52.702 -11.274  23.189 1.00 30.89  ? 127 LYS N CB  1 
ATOM 4062 C CG  . LYS D 4 37  ? 51.434 -11.256  24.032 1.00 34.06  ? 127 LYS N CG  1 
ATOM 4063 C CD  . LYS D 4 37  ? 51.226 -9.943   24.759 1.00 41.96  ? 127 LYS N CD  1 
ATOM 4064 C CE  . LYS D 4 37  ? 49.819 -9.879   25.338 1.00 49.45  ? 127 LYS N CE  1 
ATOM 4065 N NZ  . LYS D 4 37  ? 49.722 -8.985   26.526 1.00 57.95  ? 127 LYS N NZ  1 
ATOM 4066 N N   . GLN D 4 38  ? 51.370 -12.753  20.980 1.00 32.88  ? 128 GLN N N   1 
ATOM 4067 C CA  . GLN D 4 38  ? 50.044 -13.090  20.485 1.00 40.89  ? 128 GLN N CA  1 
ATOM 4068 C C   . GLN D 4 38  ? 50.042 -14.158  19.396 1.00 37.11  ? 128 GLN N C   1 
ATOM 4069 O O   . GLN D 4 38  ? 48.962 -14.623  19.017 1.00 43.47  ? 128 GLN N O   1 
ATOM 4070 C CB  . GLN D 4 38  ? 49.353 -11.824  19.960 1.00 52.41  ? 128 GLN N CB  1 
ATOM 4071 C CG  . GLN D 4 38  ? 48.219 -11.310  20.839 1.00 55.22  ? 128 GLN N CG  1 
ATOM 4072 C CD  . GLN D 4 38  ? 46.872 -11.906  20.474 1.00 70.26  ? 128 GLN N CD  1 
ATOM 4073 O OE1 . GLN D 4 38  ? 46.727 -12.564  19.444 1.00 71.26  ? 128 GLN N OE1 1 
ATOM 4074 N NE2 . GLN D 4 38  ? 45.875 -11.671  21.320 1.00 66.43  ? 128 GLN N NE2 1 
ATOM 4075 N N   . TYR D 4 39  ? 51.208 -14.563  18.879 1.00 34.09  ? 129 TYR N N   1 
ATOM 4076 C CA  . TYR D 4 39  ? 51.218 -15.644  17.891 1.00 37.58  ? 129 TYR N CA  1 
ATOM 4077 C C   . TYR D 4 39  ? 50.929 -17.012  18.504 1.00 37.90  ? 129 TYR N C   1 
ATOM 4078 O O   . TYR D 4 39  ? 50.116 -17.760  17.929 1.00 39.64  ? 129 TYR N O   1 
ATOM 4079 C CB  . TYR D 4 39  ? 52.535 -15.628  17.109 1.00 36.47  ? 129 TYR N CB  1 
ATOM 4080 C CG  . TYR D 4 39  ? 52.425 -14.968  15.749 1.00 37.87  ? 129 TYR N CG  1 
ATOM 4081 C CD1 . TYR D 4 39  ? 51.651 -13.826  15.567 1.00 34.45  ? 129 TYR N CD1 1 
ATOM 4082 C CD2 . TYR D 4 39  ? 53.096 -15.487  14.647 1.00 35.72  ? 129 TYR N CD2 1 
ATOM 4083 C CE1 . TYR D 4 39  ? 51.544 -13.224  14.325 1.00 35.05  ? 129 TYR N CE1 1 
ATOM 4084 C CE2 . TYR D 4 39  ? 52.998 -14.889  13.402 1.00 39.75  ? 129 TYR N CE2 1 
ATOM 4085 C CZ  . TYR D 4 39  ? 52.221 -13.759  13.247 1.00 39.19  ? 129 TYR N CZ  1 
ATOM 4086 O OH  . TYR D 4 39  ? 52.123 -13.162  12.010 1.00 37.89  ? 129 TYR N OH  1 
ATOM 4087 N N   . PRO D 4 40  ? 51.536 -17.414  19.631 1.00 34.45  ? 130 PRO N N   1 
ATOM 4088 C CA  . PRO D 4 40  ? 51.203 -18.734  20.197 1.00 33.42  ? 130 PRO N CA  1 
ATOM 4089 C C   . PRO D 4 40  ? 49.724 -18.934  20.483 1.00 34.88  ? 130 PRO N C   1 
ATOM 4090 O O   . PRO D 4 40  ? 49.262 -20.079  20.494 1.00 40.32  ? 130 PRO N O   1 
ATOM 4091 C CB  . PRO D 4 40  ? 52.037 -18.781  21.485 1.00 25.71  ? 130 PRO N CB  1 
ATOM 4092 C CG  . PRO D 4 40  ? 53.178 -17.894  21.215 1.00 26.04  ? 130 PRO N CG  1 
ATOM 4093 C CD  . PRO D 4 40  ? 52.643 -16.781  20.373 1.00 34.58  ? 130 PRO N CD  1 
ATOM 4094 N N   . ARG D 4 41  ? 48.970 -17.866  20.731 1.00 35.20  ? 131 ARG N N   1 
ATOM 4095 C CA  . ARG D 4 41  ? 47.544 -18.019  21.001 1.00 40.79  ? 131 ARG N CA  1 
ATOM 4096 C C   . ARG D 4 41  ? 46.756 -18.307  19.723 1.00 38.37  ? 131 ARG N C   1 
ATOM 4097 O O   . ARG D 4 41  ? 45.850 -19.150  19.725 1.00 35.99  ? 131 ARG N O   1 
ATOM 4098 C CB  . ARG D 4 41  ? 47.014 -16.769  21.704 1.00 51.17  ? 131 ARG N CB  1 
ATOM 4099 C CG  . ARG D 4 41  ? 47.547 -16.598  23.126 1.00 55.67  ? 131 ARG N CG  1 
ATOM 4100 C CD  . ARG D 4 41  ? 47.497 -15.143  23.579 1.00 65.24  ? 131 ARG N CD  1 
ATOM 4101 N NE  . ARG D 4 41  ? 46.134 -14.671  23.812 1.00 76.93  ? 131 ARG N NE  1 
ATOM 4102 C CZ  . ARG D 4 41  ? 45.814 -13.406  24.078 1.00 70.51  ? 131 ARG N CZ  1 
ATOM 4103 N NH1 . ARG D 4 41  ? 46.760 -12.477  24.142 1.00 62.68  ? 131 ARG N NH1 1 
ATOM 4104 N NH2 . ARG D 4 41  ? 44.547 -13.068  24.277 1.00 63.97  ? 131 ARG N NH2 1 
ATOM 4105 N N   . LYS D 4 42  ? 47.085 -17.621  18.626 1.00 39.93  ? 132 LYS N N   1 
ATOM 4106 C CA  . LYS D 4 42  ? 46.402 -17.877  17.360 1.00 42.05  ? 132 LYS N CA  1 
ATOM 4107 C C   . LYS D 4 42  ? 46.792 -19.240  16.807 1.00 41.74  ? 132 LYS N C   1 
ATOM 4108 O O   . LYS D 4 42  ? 45.930 -20.031  16.392 1.00 43.22  ? 132 LYS N O   1 
ATOM 4109 C CB  . LYS D 4 42  ? 46.739 -16.777  16.350 1.00 41.52  ? 132 LYS N CB  1 
ATOM 4110 C CG  . LYS D 4 42  ? 46.222 -15.386  16.710 1.00 55.19  ? 132 LYS N CG  1 
ATOM 4111 C CD  . LYS D 4 42  ? 46.344 -14.427  15.526 1.00 65.36  ? 132 LYS N CD  1 
ATOM 4112 C CE  . LYS D 4 42  ? 46.154 -12.970  15.941 1.00 65.50  ? 132 LYS N CE  1 
ATOM 4113 N NZ  . LYS D 4 42  ? 44.822 -12.717  16.561 1.00 65.60  ? 132 LYS N NZ  1 
ATOM 4114 N N   . ILE D 4 43  ? 48.095 -19.531  16.802 1.00 38.88  ? 133 ILE N N   1 
ATOM 4115 C CA  . ILE D 4 43  ? 48.574 -20.853  16.412 1.00 38.26  ? 133 ILE N CA  1 
ATOM 4116 C C   . ILE D 4 43  ? 47.917 -21.928  17.266 1.00 37.53  ? 133 ILE N C   1 
ATOM 4117 O O   . ILE D 4 43  ? 47.472 -22.962  16.755 1.00 33.34  ? 133 ILE N O   1 
ATOM 4118 C CB  . ILE D 4 43  ? 50.110 -20.907  16.517 1.00 37.13  ? 133 ILE N CB  1 
ATOM 4119 C CG1 . ILE D 4 43  ? 50.747 -19.942  15.516 1.00 39.98  ? 133 ILE N CG1 1 
ATOM 4120 C CG2 . ILE D 4 43  ? 50.617 -22.322  16.303 1.00 39.11  ? 133 ILE N CG2 1 
ATOM 4121 C CD1 . ILE D 4 43  ? 52.232 -19.753  15.720 1.00 39.26  ? 133 ILE N CD1 1 
ATOM 4122 N N   . LEU D 4 44  ? 47.828 -21.689  18.576 1.00 39.34  ? 134 LEU N N   1 
ATOM 4123 C CA  . LEU D 4 44  ? 47.177 -22.634  19.477 1.00 32.82  ? 134 LEU N CA  1 
ATOM 4124 C C   . LEU D 4 44  ? 45.729 -22.870  19.071 1.00 32.89  ? 134 LEU N C   1 
ATOM 4125 O O   . LEU D 4 44  ? 45.257 -24.010  19.049 1.00 39.02  ? 134 LEU N O   1 
ATOM 4126 C CB  . LEU D 4 44  ? 47.251 -22.113  20.911 1.00 33.78  ? 134 LEU N CB  1 
ATOM 4127 C CG  . LEU D 4 44  ? 47.015 -23.101  22.048 1.00 27.03  ? 134 LEU N CG  1 
ATOM 4128 C CD1 . LEU D 4 44  ? 48.269 -23.929  22.269 1.00 32.00  ? 134 LEU N CD1 1 
ATOM 4129 C CD2 . LEU D 4 44  ? 46.605 -22.370  23.314 1.00 30.87  ? 134 LEU N CD2 1 
ATOM 4130 N N   . GLU D 4 45  ? 45.001 -21.795  18.766 1.00 37.87  ? 135 GLU N N   1 
ATOM 4131 C CA  . GLU D 4 45  ? 43.632 -21.926  18.276 1.00 38.38  ? 135 GLU N CA  1 
ATOM 4132 C C   . GLU D 4 45  ? 43.570 -22.837  17.052 1.00 34.10  ? 135 GLU N C   1 
ATOM 4133 O O   . GLU D 4 45  ? 42.745 -23.762  16.982 1.00 39.50  ? 135 GLU N O   1 
ATOM 4134 C CB  . GLU D 4 45  ? 43.089 -20.530  17.964 1.00 51.85  ? 135 GLU N CB  1 
ATOM 4135 C CG  . GLU D 4 45  ? 41.646 -20.449  17.518 1.00 62.60  ? 135 GLU N CG  1 
ATOM 4136 C CD  . GLU D 4 45  ? 41.190 -19.005  17.356 1.00 73.01  ? 135 GLU N CD  1 
ATOM 4137 O OE1 . GLU D 4 45  ? 40.294 -18.570  18.111 1.00 70.25  ? 135 GLU N OE1 1 
ATOM 4138 O OE2 . GLU D 4 45  ? 41.742 -18.298  16.485 1.00 69.59  ? 135 GLU N OE2 1 
ATOM 4139 N N   . CYS D 4 46  ? 44.473 -22.610  16.092 1.00 34.30  ? 136 CYS N N   1 
ATOM 4140 C CA  . CYS D 4 46  ? 44.513 -23.445  14.893 1.00 39.57  ? 136 CYS N CA  1 
ATOM 4141 C C   . CYS D 4 46  ? 44.772 -24.910  15.230 1.00 45.82  ? 136 CYS N C   1 
ATOM 4142 O O   . CYS D 4 46  ? 44.058 -25.802  14.756 1.00 45.80  ? 136 CYS N O   1 
ATOM 4143 C CB  . CYS D 4 46  ? 45.573 -22.929  13.921 1.00 41.75  ? 136 CYS N CB  1 
ATOM 4144 S SG  . CYS D 4 46  ? 45.021 -21.559  12.890 1.00 45.60  ? 136 CYS N SG  1 
ATOM 4145 N N   . VAL D 4 47  ? 45.798 -25.183  16.040 1.00 42.36  ? 137 VAL N N   1 
ATOM 4146 C CA  . VAL D 4 47  ? 46.148 -26.573  16.303 1.00 34.74  ? 137 VAL N CA  1 
ATOM 4147 C C   . VAL D 4 47  ? 45.067 -27.262  17.124 1.00 32.09  ? 137 VAL N C   1 
ATOM 4148 O O   . VAL D 4 47  ? 44.877 -28.474  17.004 1.00 39.59  ? 137 VAL N O   1 
ATOM 4149 C CB  . VAL D 4 47  ? 47.531 -26.674  16.976 1.00 36.32  ? 137 VAL N CB  1 
ATOM 4150 C CG1 . VAL D 4 47  ? 48.554 -25.855  16.206 1.00 38.28  ? 137 VAL N CG1 1 
ATOM 4151 C CG2 . VAL D 4 47  ? 47.470 -26.239  18.431 1.00 38.35  ? 137 VAL N CG2 1 
ATOM 4152 N N   . ILE D 4 48  ? 44.338 -26.522  17.961 1.00 34.67  ? 138 ILE N N   1 
ATOM 4153 C CA  . ILE D 4 48  ? 43.199 -27.121  18.651 1.00 40.72  ? 138 ILE N CA  1 
ATOM 4154 C C   . ILE D 4 48  ? 42.131 -27.529  17.648 1.00 37.13  ? 138 ILE N C   1 
ATOM 4155 O O   . ILE D 4 48  ? 41.564 -28.631  17.729 1.00 39.07  ? 138 ILE N O   1 
ATOM 4156 C CB  . ILE D 4 48  ? 42.640 -26.162  19.719 1.00 38.80  ? 138 ILE N CB  1 
ATOM 4157 C CG1 . ILE D 4 48  ? 43.664 -25.945  20.838 1.00 37.69  ? 138 ILE N CG1 1 
ATOM 4158 C CG2 . ILE D 4 48  ? 41.325 -26.691  20.276 1.00 43.18  ? 138 ILE N CG2 1 
ATOM 4159 C CD1 . ILE D 4 48  ? 43.177 -25.040  21.950 1.00 38.09  ? 138 ILE N CD1 1 
ATOM 4160 N N   . LYS D 4 49  ? 41.862 -26.664  16.665 1.00 36.63  ? 139 LYS N N   1 
ATOM 4161 C CA  . LYS D 4 49  ? 40.929 -27.049  15.611 1.00 41.04  ? 139 LYS N CA  1 
ATOM 4162 C C   . LYS D 4 49  ? 41.409 -28.300  14.882 1.00 44.94  ? 139 LYS N C   1 
ATOM 4163 O O   . LYS D 4 49  ? 40.636 -29.239  14.660 1.00 44.19  ? 139 LYS N O   1 
ATOM 4164 C CB  . LYS D 4 49  ? 40.736 -25.896  14.624 1.00 44.78  ? 139 LYS N CB  1 
ATOM 4165 C CG  . LYS D 4 49  ? 39.576 -24.969  14.950 1.00 48.49  ? 139 LYS N CG  1 
ATOM 4166 C CD  . LYS D 4 49  ? 39.248 -24.086  13.756 1.00 61.11  ? 139 LYS N CD  1 
ATOM 4167 C CE  . LYS D 4 49  ? 37.961 -23.305  13.966 1.00 72.79  ? 139 LYS N CE  1 
ATOM 4168 N NZ  . LYS D 4 49  ? 37.548 -22.593  12.722 1.00 70.99  ? 139 LYS N NZ  1 
ATOM 4169 N N   . THR D 4 50  ? 42.693 -28.337  14.516 1.00 46.66  ? 140 THR N N   1 
ATOM 4170 C CA  . THR D 4 50  ? 43.192 -29.443  13.705 1.00 48.61  ? 140 THR N CA  1 
ATOM 4171 C C   . THR D 4 50  ? 43.252 -30.745  14.501 1.00 48.22  ? 140 THR N C   1 
ATOM 4172 O O   . THR D 4 50  ? 43.108 -31.830  13.924 1.00 48.57  ? 140 THR N O   1 
ATOM 4173 C CB  . THR D 4 50  ? 44.560 -29.083  13.110 1.00 49.65  ? 140 THR N CB  1 
ATOM 4174 O OG1 . THR D 4 50  ? 44.778 -29.841  11.915 1.00 58.59  ? 140 THR N OG1 1 
ATOM 4175 C CG2 . THR D 4 50  ? 45.689 -29.378  14.084 1.00 50.39  ? 140 THR N CG2 1 
ATOM 4176 N N   . ILE D 4 51  ? 43.440 -30.661  15.821 1.00 49.10  ? 141 ILE N N   1 
ATOM 4177 C CA  . ILE D 4 51  ? 43.471 -31.863  16.648 1.00 47.04  ? 141 ILE N CA  1 
ATOM 4178 C C   . ILE D 4 51  ? 42.064 -32.415  16.822 1.00 46.35  ? 141 ILE N C   1 
ATOM 4179 O O   . ILE D 4 51  ? 41.833 -33.625  16.691 1.00 48.17  ? 141 ILE N O   1 
ATOM 4180 C CB  . ILE D 4 51  ? 44.137 -31.571  18.006 1.00 43.25  ? 141 ILE N CB  1 
ATOM 4181 C CG1 . ILE D 4 51  ? 45.641 -31.345  17.829 1.00 49.75  ? 141 ILE N CG1 1 
ATOM 4182 C CG2 . ILE D 4 51  ? 43.876 -32.702  18.987 1.00 47.69  ? 141 ILE N CG2 1 
ATOM 4183 C CD1 . ILE D 4 51  ? 46.357 -32.458  17.089 1.00 55.08  ? 141 ILE N CD1 1 
ATOM 4184 N N   . LYS D 4 52  ? 41.099 -31.536  17.112 1.00 46.03  ? 142 LYS N N   1 
ATOM 4185 C CA  . LYS D 4 52  ? 39.713 -31.988  17.164 1.00 45.34  ? 142 LYS N CA  1 
ATOM 4186 C C   . LYS D 4 52  ? 39.299 -32.606  15.833 1.00 49.09  ? 142 LYS N C   1 
ATOM 4187 O O   . LYS D 4 52  ? 38.625 -33.644  15.801 1.00 56.74  ? 142 LYS N O   1 
ATOM 4188 C CB  . LYS D 4 52  ? 38.793 -30.824  17.538 1.00 45.32  ? 142 LYS N CB  1 
ATOM 4189 C CG  . LYS D 4 52  ? 37.324 -31.044  17.208 1.00 48.94  ? 142 LYS N CG  1 
ATOM 4190 C CD  . LYS D 4 52  ? 36.454 -29.947  17.811 1.00 58.78  ? 142 LYS N CD  1 
ATOM 4191 C CE  . LYS D 4 52  ? 34.980 -30.335  17.803 1.00 56.61  ? 142 LYS N CE  1 
ATOM 4192 N NZ  . LYS D 4 52  ? 34.449 -30.561  16.430 1.00 50.13  ? 142 LYS N NZ  1 
ATOM 4193 N N   . ALA D 4 53  ? 39.723 -31.996  14.723 1.00 46.30  ? 143 ALA N N   1 
ATOM 4194 C CA  . ALA D 4 53  ? 39.413 -32.540  13.404 1.00 48.85  ? 143 ALA N CA  1 
ATOM 4195 C C   . ALA D 4 53  ? 40.037 -33.917  13.195 1.00 51.35  ? 143 ALA N C   1 
ATOM 4196 O O   . ALA D 4 53  ? 39.388 -34.820  12.654 1.00 53.86  ? 143 ALA N O   1 
ATOM 4197 C CB  . ALA D 4 53  ? 39.878 -31.572  12.317 1.00 55.27  ? 143 ALA N CB  1 
ATOM 4198 N N   . LYS D 4 54  ? 41.298 -34.097  13.600 1.00 52.04  ? 144 LYS N N   1 
ATOM 4199 C CA  . LYS D 4 54  ? 41.954 -35.390  13.405 1.00 51.07  ? 144 LYS N CA  1 
ATOM 4200 C C   . LYS D 4 54  ? 41.294 -36.484  14.238 1.00 52.94  ? 144 LYS N C   1 
ATOM 4201 O O   . LYS D 4 54  ? 40.938 -37.547  13.713 1.00 52.74  ? 144 LYS N O   1 
ATOM 4202 C CB  . LYS D 4 54  ? 43.444 -35.296  13.733 1.00 48.29  ? 144 LYS N CB  1 
ATOM 4203 C CG  . LYS D 4 54  ? 44.297 -34.749  12.604 1.00 52.78  ? 144 LYS N CG  1 
ATOM 4204 C CD  . LYS D 4 54  ? 45.772 -35.046  12.842 1.00 57.36  ? 144 LYS N CD  1 
ATOM 4205 C CE  . LYS D 4 54  ? 46.427 -33.995  13.723 1.00 65.24  ? 144 LYS N CE  1 
ATOM 4206 N NZ  . LYS D 4 54  ? 47.831 -34.360  14.066 1.00 65.67  ? 144 LYS N NZ  1 
ATOM 4207 N N   . GLN D 4 55  ? 41.132 -36.253  15.543 1.00 53.85  ? 145 GLN N N   1 
ATOM 4208 C CA  . GLN D 4 55  ? 40.483 -37.270  16.362 1.00 51.11  ? 145 GLN N CA  1 
ATOM 4209 C C   . GLN D 4 55  ? 39.035 -37.491  15.947 1.00 53.59  ? 145 GLN N C   1 
ATOM 4210 O O   . GLN D 4 55  ? 38.470 -38.548  16.244 1.00 52.05  ? 145 GLN N O   1 
ATOM 4211 C CB  . GLN D 4 55  ? 40.555 -36.897  17.844 1.00 56.05  ? 145 GLN N CB  1 
ATOM 4212 C CG  . GLN D 4 55  ? 39.767 -35.657  18.228 1.00 59.92  ? 145 GLN N CG  1 
ATOM 4213 C CD  . GLN D 4 55  ? 39.808 -35.384  19.721 1.00 61.91  ? 145 GLN N CD  1 
ATOM 4214 O OE1 . GLN D 4 55  ? 40.880 -35.345  20.328 1.00 62.07  ? 145 GLN N OE1 1 
ATOM 4215 N NE2 . GLN D 4 55  ? 38.637 -35.201  20.322 1.00 58.14  ? 145 GLN N NE2 1 
ATOM 4216 N N   . GLU D 4 56  ? 38.428 -36.522  15.258 1.00 61.95  ? 146 GLU N N   1 
ATOM 4217 C CA  . GLU D 4 56  ? 37.071 -36.706  14.757 1.00 67.03  ? 146 GLU N CA  1 
ATOM 4218 C C   . GLU D 4 56  ? 37.050 -37.598  13.520 1.00 67.61  ? 146 GLU N C   1 
ATOM 4219 O O   . GLU D 4 56  ? 36.242 -38.529  13.433 1.00 67.06  ? 146 GLU N O   1 
ATOM 4220 C CB  . GLU D 4 56  ? 36.446 -35.342  14.452 1.00 67.72  ? 146 GLU N CB  1 
ATOM 4221 C CG  . GLU D 4 56  ? 34.942 -35.280  14.640 1.00 76.41  ? 146 GLU N CG  1 
ATOM 4222 C CD  . GLU D 4 56  ? 34.186 -35.618  13.371 1.00 83.49  ? 146 GLU N CD  1 
ATOM 4223 O OE1 . GLU D 4 56  ? 34.771 -35.481  12.275 1.00 81.47  ? 146 GLU N OE1 1 
ATOM 4224 O OE2 . GLU D 4 56  ? 33.009 -36.025  13.470 1.00 89.64  ? 146 GLU N OE2 1 
ATOM 4225 N N   . ILE D 4 57  ? 37.955 -37.350  12.566 1.00 67.28  ? 147 ILE N N   1 
ATOM 4226 C CA  . ILE D 4 57  ? 38.021 -38.182  11.370 1.00 63.33  ? 147 ILE N CA  1 
ATOM 4227 C C   . ILE D 4 57  ? 38.523 -39.581  11.693 1.00 58.47  ? 147 ILE N C   1 
ATOM 4228 O O   . ILE D 4 57  ? 38.281 -40.517  10.922 1.00 61.00  ? 147 ILE N O   1 
ATOM 4229 C CB  . ILE D 4 57  ? 38.882 -37.515  10.272 1.00 55.52  ? 147 ILE N CB  1 
ATOM 4230 C CG1 . ILE D 4 57  ? 40.347 -37.370  10.702 1.00 54.84  ? 147 ILE N CG1 1 
ATOM 4231 C CG2 . ILE D 4 57  ? 38.294 -36.167  9.880  1.00 46.77  ? 147 ILE N CG2 1 
ATOM 4232 C CD1 . ILE D 4 57  ? 41.275 -38.473  10.204 1.00 47.09  ? 147 ILE N CD1 1 
ATOM 4233 N N   . LEU D 4 58  ? 39.215 -39.753  12.821 1.00 58.93  ? 148 LEU N N   1 
ATOM 4234 C CA  . LEU D 4 58  ? 39.632 -41.089  13.234 1.00 59.86  ? 148 LEU N CA  1 
ATOM 4235 C C   . LEU D 4 58  ? 38.430 -41.981  13.527 1.00 57.80  ? 148 LEU N C   1 
ATOM 4236 O O   . LEU D 4 58  ? 38.363 -43.122  13.059 1.00 60.47  ? 148 LEU N O   1 
ATOM 4237 C CB  . LEU D 4 58  ? 40.532 -40.996  14.461 1.00 54.12  ? 148 LEU N CB  1 
ATOM 4238 C CG  . LEU D 4 58  ? 41.019 -42.339  14.992 1.00 36.08  ? 148 LEU N CG  1 
ATOM 4239 C CD1 . LEU D 4 58  ? 42.275 -42.786  14.262 1.00 40.58  ? 148 LEU N CD1 1 
ATOM 4240 C CD2 . LEU D 4 58  ? 41.247 -42.256  16.479 1.00 43.49  ? 148 LEU N CD2 1 
ATOM 4241 N N   . LYS D 4 59  ? 37.467 -41.475  14.301 1.00 61.97  ? 149 LYS N N   1 
ATOM 4242 C CA  . LYS D 4 59  ? 36.300 -42.272  14.664 1.00 61.17  ? 149 LYS N CA  1 
ATOM 4243 C C   . LYS D 4 59  ? 35.418 -42.610  13.469 1.00 67.03  ? 149 LYS N C   1 
ATOM 4244 O O   . LYS D 4 59  ? 34.632 -43.558  13.551 1.00 67.68  ? 149 LYS N O   1 
ATOM 4245 C CB  . LYS D 4 59  ? 35.478 -41.553  15.731 1.00 60.84  ? 149 LYS N CB  1 
ATOM 4246 C CG  . LYS D 4 59  ? 35.472 -42.272  17.066 1.00 65.21  ? 149 LYS N CG  1 
ATOM 4247 C CD  . LYS D 4 59  ? 35.182 -41.320  18.208 1.00 70.89  ? 149 LYS N CD  1 
ATOM 4248 C CE  . LYS D 4 59  ? 35.181 -42.052  19.540 1.00 78.67  ? 149 LYS N CE  1 
ATOM 4249 N NZ  . LYS D 4 59  ? 35.119 -41.112  20.694 1.00 70.62  ? 149 LYS N NZ  1 
ATOM 4250 N N   . GLN D 4 60  ? 35.510 -41.851  12.374 1.00 70.27  ? 150 GLN N N   1 
ATOM 4251 C CA  . GLN D 4 60  ? 34.748 -42.191  11.177 1.00 71.28  ? 150 GLN N CA  1 
ATOM 4252 C C   . GLN D 4 60  ? 35.235 -43.480  10.531 1.00 75.68  ? 150 GLN N C   1 
ATOM 4253 O O   . GLN D 4 60  ? 34.514 -44.059  9.712  1.00 80.28  ? 150 GLN N O   1 
ATOM 4254 C CB  . GLN D 4 60  ? 34.817 -41.053  10.156 1.00 76.99  ? 150 GLN N CB  1 
ATOM 4255 C CG  . GLN D 4 60  ? 34.449 -39.678  10.697 1.00 81.22  ? 150 GLN N CG  1 
ATOM 4256 C CD  . GLN D 4 60  ? 32.950 -39.485  10.864 1.00 89.79  ? 150 GLN N CD  1 
ATOM 4257 O OE1 . GLN D 4 60  ? 32.177 -40.445  10.848 1.00 97.09  ? 150 GLN N OE1 1 
ATOM 4258 N NE2 . GLN D 4 60  ? 32.532 -38.234  11.021 1.00 82.86  ? 150 GLN N NE2 1 
ATOM 4259 N N   . TYR D 4 61  ? 36.441 -43.932  10.872 1.00 76.57  ? 151 TYR N N   1 
ATOM 4260 C CA  . TYR D 4 61  ? 36.961 -45.205  10.391 1.00 79.27  ? 151 TYR N CA  1 
ATOM 4261 C C   . TYR D 4 61  ? 36.439 -46.397  11.186 1.00 77.94  ? 151 TYR N C   1 
ATOM 4262 O O   . TYR D 4 61  ? 36.660 -47.538  10.766 1.00 77.09  ? 151 TYR N O   1 
ATOM 4263 C CB  . TYR D 4 61  ? 38.494 -45.169  10.424 1.00 75.02  ? 151 TYR N CB  1 
ATOM 4264 C CG  . TYR D 4 61  ? 39.177 -46.458  10.026 1.00 70.54  ? 151 TYR N CG  1 
ATOM 4265 C CD1 . TYR D 4 61  ? 39.822 -47.243  10.972 1.00 67.97  ? 151 TYR N CD1 1 
ATOM 4266 C CD2 . TYR D 4 61  ? 39.169 -46.894  8.707  1.00 74.93  ? 151 TYR N CD2 1 
ATOM 4267 C CE1 . TYR D 4 61  ? 40.446 -48.421  10.616 1.00 67.54  ? 151 TYR N CE1 1 
ATOM 4268 C CE2 . TYR D 4 61  ? 39.793 -48.074  8.342  1.00 72.18  ? 151 TYR N CE2 1 
ATOM 4269 C CZ  . TYR D 4 61  ? 40.429 -48.832  9.301  1.00 66.56  ? 151 TYR N CZ  1 
ATOM 4270 O OH  . TYR D 4 61  ? 41.050 -50.006  8.946  1.00 74.08  ? 151 TYR N OH  1 
ATOM 4271 N N   . HIS D 4 62  ? 35.742 -46.155  12.300 1.00 84.05  ? 152 HIS N N   1 
ATOM 4272 C CA  . HIS D 4 62  ? 35.205 -47.237  13.126 1.00 92.20  ? 152 HIS N CA  1 
ATOM 4273 C C   . HIS D 4 62  ? 34.482 -48.319  12.331 1.00 96.95  ? 152 HIS N C   1 
ATOM 4274 O O   . HIS D 4 62  ? 34.641 -49.504  12.672 1.00 97.42  ? 152 HIS N O   1 
ATOM 4275 C CB  . HIS D 4 62  ? 34.281 -46.641  14.203 1.00 92.29  ? 152 HIS N CB  1 
ATOM 4276 C CG  . HIS D 4 62  ? 34.002 -47.560  15.359 1.00 96.26  ? 152 HIS N CG  1 
ATOM 4277 N ND1 . HIS D 4 62  ? 34.221 -48.921  15.310 1.00 100.01 ? 152 HIS N ND1 1 
ATOM 4278 C CD2 . HIS D 4 62  ? 33.519 -47.304  16.599 1.00 86.33  ? 152 HIS N CD2 1 
ATOM 4279 C CE1 . HIS D 4 62  ? 33.886 -49.463  16.468 1.00 84.67  ? 152 HIS N CE1 1 
ATOM 4280 N NE2 . HIS D 4 62  ? 33.456 -48.503  17.267 1.00 80.83  ? 152 HIS N NE2 1 
ATOM 4281 N N   . PRO D 4 63  ? 33.596 -47.976  11.175 1.00 91.85  ? 153 PRO N N   1 
ATOM 4282 C CA  . PRO D 4 63  ? 33.125 -49.067  10.293 1.00 94.40  ? 153 PRO N CA  1 
ATOM 4283 C C   . PRO D 4 63  ? 34.207 -49.559  9.332  1.00 89.25  ? 153 PRO N C   1 
ATOM 4284 O O   . PRO D 4 63  ? 34.304 -49.162  8.171  1.00 83.09  ? 153 PRO N O   1 
ATOM 4285 C CB  . PRO D 4 63  ? 31.948 -48.421  9.558  1.00 90.67  ? 153 PRO N CB  1 
ATOM 4286 C CG  . PRO D 4 63  ? 32.252 -46.964  9.564  1.00 98.99  ? 153 PRO N CG  1 
ATOM 4287 C CD  . PRO D 4 63  ? 32.935 -46.694  10.872 1.00 90.22  ? 153 PRO N CD  1 
ATOM 4288 N N   . VAL D 4 64  ? 35.071 -50.444  9.838  1.00 86.50  ? 154 VAL N N   1 
ATOM 4289 C CA  . VAL D 4 64  ? 36.061 -51.088  8.978  1.00 78.83  ? 154 VAL N CA  1 
ATOM 4290 C C   . VAL D 4 64  ? 35.391 -52.139  8.102  1.00 90.38  ? 154 VAL N C   1 
ATOM 4291 O O   . VAL D 4 64  ? 35.639 -52.214  6.893  1.00 91.32  ? 154 VAL N O   1 
ATOM 4292 C CB  . VAL D 4 64  ? 37.193 -51.700  9.823  1.00 65.01  ? 154 VAL N CB  1 
ATOM 4293 C CG1 . VAL D 4 64  ? 38.309 -52.210  8.925  1.00 64.66  ? 154 VAL N CG1 1 
ATOM 4294 C CG2 . VAL D 4 64  ? 37.718 -50.689  10.821 1.00 59.46  ? 154 VAL N CG2 1 
ATOM 4295 N N   . VAL D 4 65  ? 34.527 -52.958  8.711  1.00 89.34  ? 155 VAL N N   1 
ATOM 4296 C CA  . VAL D 4 65  ? 33.682 -53.959  8.059  1.00 90.37  ? 155 VAL N CA  1 
ATOM 4297 C C   . VAL D 4 65  ? 34.423 -54.718  6.965  1.00 91.68  ? 155 VAL N C   1 
ATOM 4298 O O   . VAL D 4 65  ? 34.292 -54.411  5.775  1.00 95.20  ? 155 VAL N O   1 
ATOM 4299 C CB  . VAL D 4 65  ? 32.400 -53.314  7.499  1.00 95.62  ? 155 VAL N CB  1 
ATOM 4300 C CG1 . VAL D 4 65  ? 31.406 -54.387  7.060  1.00 86.68  ? 155 VAL N CG1 1 
ATOM 4301 C CG2 . VAL D 4 65  ? 31.772 -52.397  8.539  1.00 97.01  ? 155 VAL N CG2 1 
ATOM 4302 N N   . HIS D 4 66  ? 35.193 -55.676  7.351  1.00 91.66  ? 156 HIS N N   1 
ATOM 4303 C CA  . HIS D 4 66  ? 35.640 -56.581  6.306  1.00 96.25  ? 156 HIS N CA  1 
ATOM 4304 C C   . HIS D 4 66  ? 34.725 -57.798  6.265  1.00 103.18 ? 156 HIS N C   1 
ATOM 4305 O O   . HIS D 4 66  ? 34.330 -58.311  7.320  1.00 92.44  ? 156 HIS N O   1 
ATOM 4306 C CB  . HIS D 4 66  ? 37.080 -57.031  6.551  1.00 98.98  ? 156 HIS N CB  1 
ATOM 4307 C CG  . HIS D 4 66  ? 37.237 -57.949  7.721  1.00 95.49  ? 156 HIS N CG  1 
ATOM 4308 N ND1 . HIS D 4 66  ? 36.487 -57.826  8.871  1.00 79.61  ? 156 HIS N ND1 1 
ATOM 4309 C CD2 . HIS D 4 66  ? 38.059 -59.005  7.921  1.00 89.11  ? 156 HIS N CD2 1 
ATOM 4310 C CE1 . HIS D 4 66  ? 36.835 -58.768  9.727  1.00 69.88  ? 156 HIS N CE1 1 
ATOM 4311 N NE2 . HIS D 4 66  ? 37.790 -59.495  9.177  1.00 78.84  ? 156 HIS N NE2 1 
ATOM 4312 N N   . PRO D 4 67  ? 34.343 -58.287  5.081  1.00 109.25 ? 157 PRO N N   1 
ATOM 4313 C CA  . PRO D 4 67  ? 33.345 -59.364  5.037  1.00 108.11 ? 157 PRO N CA  1 
ATOM 4314 C C   . PRO D 4 67  ? 33.863 -60.672  5.615  1.00 109.09 ? 157 PRO N C   1 
ATOM 4315 O O   . PRO D 4 67  ? 33.224 -61.249  6.502  1.00 105.89 ? 157 PRO N O   1 
ATOM 4316 C CB  . PRO D 4 67  ? 33.033 -59.494  3.540  1.00 100.41 ? 157 PRO N CB  1 
ATOM 4317 C CG  . PRO D 4 67  ? 34.238 -58.945  2.847  1.00 98.74  ? 157 PRO N CG  1 
ATOM 4318 C CD  . PRO D 4 67  ? 34.767 -57.857  3.737  1.00 102.36 ? 157 PRO N CD  1 
ATOM 4319 N N   . LEU D 4 68  ? 35.039 -61.113  5.160  1.00 107.43 ? 158 LEU N N   1 
ATOM 4320 C CA  . LEU D 4 68  ? 35.601 -62.427  5.495  1.00 104.78 ? 158 LEU N CA  1 
ATOM 4321 C C   . LEU D 4 68  ? 34.641 -63.484  4.960  1.00 106.58 ? 158 LEU N C   1 
ATOM 4322 O O   . LEU D 4 68  ? 34.454 -63.554  3.732  1.00 106.67 ? 158 LEU N O   1 
ATOM 4323 C CB  . LEU D 4 68  ? 35.892 -62.492  7.000  1.00 98.46  ? 158 LEU N CB  1 
ATOM 4324 C CG  . LEU D 4 68  ? 36.801 -63.613  7.514  1.00 96.37  ? 158 LEU N CG  1 
ATOM 4325 C CD1 . LEU D 4 68  ? 38.104 -63.700  6.721  1.00 86.51  ? 158 LEU N CD1 1 
ATOM 4326 C CD2 . LEU D 4 68  ? 37.069 -63.454  9.006  1.00 82.57  ? 158 LEU N CD2 1 
ATOM 4327 N N   . ASP D 4 69  ? 34.036 -64.312  5.806  1.00 106.57 ? 159 ASP N N   1 
ATOM 4328 C CA  . ASP D 4 69  ? 32.994 -65.295  5.464  1.00 105.03 ? 159 ASP N CA  1 
ATOM 4329 C C   . ASP D 4 69  ? 33.570 -66.356  4.528  1.00 97.94  ? 159 ASP N C   1 
ATOM 4330 O O   . ASP D 4 69  ? 34.630 -66.920  4.843  1.00 89.27  ? 159 ASP N O   1 
ATOM 4331 C CB  . ASP D 4 69  ? 31.770 -64.565  4.923  1.00 100.70 ? 159 ASP N CB  1 
ATOM 4332 C CG  . ASP D 4 69  ? 31.390 -63.375  5.760  1.00 110.55 ? 159 ASP N CG  1 
ATOM 4333 O OD1 . ASP D 4 69  ? 31.504 -63.462  6.998  1.00 110.49 ? 159 ASP N OD1 1 
ATOM 4334 O OD2 . ASP D 4 69  ? 30.992 -62.342  5.176  1.00 117.82 ? 159 ASP N OD2 1 
ATOM 4335 N N   . LEU D 4 70  ? 32.927 -66.628  3.387  1.00 99.90  ? 160 LEU N N   1 
ATOM 4336 C CA  . LEU D 4 70  ? 33.121 -67.804  2.541  1.00 98.12  ? 160 LEU N CA  1 
ATOM 4337 C C   . LEU D 4 70  ? 32.767 -69.038  3.364  1.00 97.51  ? 160 LEU N C   1 
ATOM 4338 O O   . LEU D 4 70  ? 32.790 -68.996  4.598  1.00 105.92 ? 160 LEU N O   1 
ATOM 4339 C CB  . LEU D 4 70  ? 34.538 -67.891  1.937  1.00 99.08  ? 160 LEU N CB  1 
ATOM 4340 C CG  . LEU D 4 70  ? 35.834 -68.470  2.528  1.00 93.33  ? 160 LEU N CG  1 
ATOM 4341 C CD1 . LEU D 4 70  ? 35.752 -69.973  2.767  1.00 80.64  ? 160 LEU N CD1 1 
ATOM 4342 C CD2 . LEU D 4 70  ? 36.973 -68.206  1.560  1.00 89.72  ? 160 LEU N CD2 1 
ATOM 4343 N N   . LYS D 4 71  ? 32.441 -70.139  2.702  1.00 92.04  ? 161 LYS N N   1 
ATOM 4344 C CA  . LYS D 4 71  ? 32.161 -71.380  3.408  1.00 86.36  ? 161 LYS N CA  1 
ATOM 4345 C C   . LYS D 4 71  ? 32.053 -72.488  2.378  1.00 91.44  ? 161 LYS N C   1 
ATOM 4346 O O   . LYS D 4 71  ? 31.896 -72.232  1.181  1.00 94.43  ? 161 LYS N O   1 
ATOM 4347 C CB  . LYS D 4 71  ? 30.885 -71.294  4.260  1.00 84.64  ? 161 LYS N CB  1 
ATOM 4348 C CG  . LYS D 4 71  ? 29.668 -70.715  3.561  1.00 88.92  ? 161 LYS N CG  1 
ATOM 4349 C CD  . LYS D 4 71  ? 28.490 -70.646  4.523  1.00 87.07  ? 161 LYS N CD  1 
ATOM 4350 C CE  . LYS D 4 71  ? 27.165 -70.821  3.805  1.00 86.66  ? 161 LYS N CE  1 
ATOM 4351 N NZ  . LYS D 4 71  ? 26.062 -71.147  4.753  1.00 80.74  ? 161 LYS N NZ  1 
ATOM 4352 N N   . TYR D 4 72  ? 32.156 -73.722  2.852  1.00 87.55  ? 162 TYR N N   1 
ATOM 4353 C CA  . TYR D 4 72  ? 31.961 -74.855  1.967  1.00 87.83  ? 162 TYR N CA  1 
ATOM 4354 C C   . TYR D 4 72  ? 30.489 -75.228  1.859  1.00 95.55  ? 162 TYR N C   1 
ATOM 4355 O O   . TYR D 4 72  ? 30.152 -76.166  1.129  1.00 99.85  ? 162 TYR N O   1 
ATOM 4356 C CB  . TYR D 4 72  ? 32.785 -76.055  2.450  1.00 87.38  ? 162 TYR N CB  1 
ATOM 4357 C CG  . TYR D 4 72  ? 33.192 -76.989  1.329  1.00 98.33  ? 162 TYR N CG  1 
ATOM 4358 C CD1 . TYR D 4 72  ? 34.058 -76.555  0.332  1.00 96.90  ? 162 TYR N CD1 1 
ATOM 4359 C CD2 . TYR D 4 72  ? 32.721 -78.297  1.266  1.00 90.84  ? 162 TYR N CD2 1 
ATOM 4360 C CE1 . TYR D 4 72  ? 34.439 -77.388  -0.699 1.00 91.44  ? 162 TYR N CE1 1 
ATOM 4361 C CE2 . TYR D 4 72  ? 33.101 -79.144  0.231  1.00 86.71  ? 162 TYR N CE2 1 
ATOM 4362 C CZ  . TYR D 4 72  ? 33.962 -78.678  -0.748 1.00 84.18  ? 162 TYR N CZ  1 
ATOM 4363 O OH  . TYR D 4 72  ? 34.356 -79.494  -1.784 1.00 79.88  ? 162 TYR N OH  1 
ATOM 4364 N N   . ASP D 4 73  ? 29.610 -74.496  2.566  1.00 95.03  ? 163 ASP N N   1 
ATOM 4365 C CA  . ASP D 4 73  ? 28.154 -74.607  2.520  1.00 95.44  ? 163 ASP N CA  1 
ATOM 4366 C C   . ASP D 4 73  ? 27.682 -75.987  2.966  1.00 94.56  ? 163 ASP N C   1 
ATOM 4367 O O   . ASP D 4 73  ? 28.506 -76.883  3.191  1.00 85.73  ? 163 ASP N O   1 
ATOM 4368 C CB  . ASP D 4 73  ? 27.641 -74.287  1.112  1.00 95.74  ? 163 ASP N CB  1 
ATOM 4369 C CG  . ASP D 4 73  ? 27.992 -72.882  0.668  1.00 89.53  ? 163 ASP N CG  1 
ATOM 4370 O OD1 . ASP D 4 73  ? 27.138 -72.232  0.029  1.00 87.01  ? 163 ASP N OD1 1 
ATOM 4371 O OD2 . ASP D 4 73  ? 29.115 -72.426  0.958  1.00 87.52  ? 163 ASP N OD2 1 
ATOM 4372 N N   . PRO D 4 74  ? 26.379 -76.202  3.142  1.00 92.41  ? 164 PRO N N   1 
ATOM 4373 C CA  . PRO D 4 74  ? 25.919 -77.568  3.399  1.00 87.04  ? 164 PRO N CA  1 
ATOM 4374 C C   . PRO D 4 74  ? 25.469 -78.300  2.144  1.00 81.33  ? 164 PRO N C   1 
ATOM 4375 O O   . PRO D 4 74  ? 24.875 -77.736  1.223  1.00 71.00  ? 164 PRO N O   1 
ATOM 4376 C CB  . PRO D 4 74  ? 24.744 -77.360  4.367  1.00 85.80  ? 164 PRO N CB  1 
ATOM 4377 C CG  . PRO D 4 74  ? 24.270 -75.953  4.142  1.00 76.82  ? 164 PRO N CG  1 
ATOM 4378 C CD  . PRO D 4 74  ? 25.302 -75.212  3.336  1.00 74.94  ? 164 PRO N CD  1 
ATOM 4379 N N   . ASP D 4 75  ? 25.773 -79.596  2.130  1.00 91.63  ? 165 ASP N N   1 
ATOM 4380 C CA  . ASP D 4 75  ? 25.208 -80.560  1.193  1.00 88.42  ? 165 ASP N CA  1 
ATOM 4381 C C   . ASP D 4 75  ? 24.237 -81.346  2.060  1.00 89.32  ? 165 ASP N C   1 
ATOM 4382 O O   . ASP D 4 75  ? 24.627 -82.329  2.706  1.00 82.69  ? 165 ASP N O   1 
ATOM 4383 C CB  . ASP D 4 75  ? 26.266 -81.467  0.555  1.00 69.54  ? 165 ASP N CB  1 
ATOM 4384 C CG  . ASP D 4 75  ? 27.375 -81.854  1.519  1.00 70.32  ? 165 ASP N CG  1 
ATOM 4385 O OD1 . ASP D 4 75  ? 28.414 -82.365  1.048  1.00 70.17  ? 165 ASP N OD1 1 
ATOM 4386 O OD2 . ASP D 4 75  ? 27.225 -81.633  2.738  1.00 73.26  ? 165 ASP N OD2 1 
ATOM 4387 N N   . PRO D 4 76  ? 22.967 -80.915  2.141  1.00 94.60  ? 166 PRO N N   1 
ATOM 4388 C CA  . PRO D 4 76  ? 22.067 -81.366  3.216  1.00 91.18  ? 166 PRO N CA  1 
ATOM 4389 C C   . PRO D 4 76  ? 21.764 -82.855  3.287  1.00 86.92  ? 166 PRO N C   1 
ATOM 4390 O O   . PRO D 4 76  ? 22.610 -83.716  3.028  1.00 82.70  ? 166 PRO N O   1 
ATOM 4391 C CB  . PRO D 4 76  ? 20.780 -80.572  2.939  1.00 87.63  ? 166 PRO N CB  1 
ATOM 4392 C CG  . PRO D 4 76  ? 20.864 -80.176  1.498  1.00 86.85  ? 166 PRO N CG  1 
ATOM 4393 C CD  . PRO D 4 76  ? 22.317 -79.951  1.236  1.00 92.48  ? 166 PRO N CD  1 
ATOM 4394 N N   . ALA D 4 77  ? 20.526 -83.171  3.653  1.00 93.82  ? 167 ALA N N   1 
ATOM 4395 C CA  . ALA D 4 77  ? 20.118 -84.539  3.961  1.00 90.52  ? 167 ALA N CA  1 
ATOM 4396 C C   . ALA D 4 77  ? 19.065 -85.071  2.991  1.00 89.59  ? 167 ALA N C   1 
ATOM 4397 O O   . ALA D 4 77  ? 17.957 -85.427  3.409  1.00 87.57  ? 167 ALA N O   1 
ATOM 4398 C CB  . ALA D 4 77  ? 19.599 -84.607  5.395  1.00 89.99  ? 167 ALA N CB  1 
ATOM 4399 N N   . PRO D 4 78  ? 19.370 -85.150  1.680  1.00 90.03  ? 168 PRO N N   1 
ATOM 4400 C CA  . PRO D 4 78  ? 18.488 -85.921  0.799  1.00 92.52  ? 168 PRO N CA  1 
ATOM 4401 C C   . PRO D 4 78  ? 18.805 -87.399  0.916  1.00 94.38  ? 168 PRO N C   1 
ATOM 4402 O O   . PRO D 4 78  ? 17.905 -88.245  0.966  1.00 90.40  ? 168 PRO N O   1 
ATOM 4403 C CB  . PRO D 4 78  ? 18.807 -85.378  -0.602 1.00 93.79  ? 168 PRO N CB  1 
ATOM 4404 C CG  . PRO D 4 78  ? 19.700 -84.187  -0.384 1.00 97.05  ? 168 PRO N CG  1 
ATOM 4405 C CD  . PRO D 4 78  ? 20.414 -84.481  0.890  1.00 93.99  ? 168 PRO N CD  1 
ATOM 4406 N N   . HIS D 4 79  ? 20.101 -87.708  0.966  1.00 91.77  ? 169 HIS N N   1 
ATOM 4407 C CA  . HIS D 4 79  ? 20.567 -89.082  1.068  1.00 91.95  ? 169 HIS N CA  1 
ATOM 4408 C C   . HIS D 4 79  ? 20.757 -89.534  2.505  1.00 91.87  ? 169 HIS N C   1 
ATOM 4409 O O   . HIS D 4 79  ? 20.782 -90.743  2.748  1.00 90.56  ? 169 HIS N O   1 
ATOM 4410 C CB  . HIS D 4 79  ? 21.898 -89.256  0.333  1.00 91.06  ? 169 HIS N CB  1 
ATOM 4411 C CG  . HIS D 4 79  ? 23.089 -88.901  1.168  1.00 87.43  ? 169 HIS N CG  1 
ATOM 4412 N ND1 . HIS D 4 79  ? 24.039 -89.828  1.543  1.00 80.02  ? 169 HIS N ND1 1 
ATOM 4413 C CD2 . HIS D 4 79  ? 23.464 -87.729  1.731  1.00 88.63  ? 169 HIS N CD2 1 
ATOM 4414 C CE1 . HIS D 4 79  ? 24.958 -89.236  2.284  1.00 74.61  ? 169 HIS N CE1 1 
ATOM 4415 N NE2 . HIS D 4 79  ? 24.632 -87.963  2.414  1.00 90.52  ? 169 HIS N NE2 1 
ATOM 4416 N N   . MET D 4 80  ? 20.858 -88.599  3.456  1.00 86.20  ? 170 MET N N   1 
ATOM 4417 C CA  . MET D 4 80  ? 21.042 -88.965  4.858  1.00 81.61  ? 170 MET N CA  1 
ATOM 4418 C C   . MET D 4 80  ? 19.902 -89.856  5.332  1.00 77.32  ? 170 MET N C   1 
ATOM 4419 O O   . MET D 4 80  ? 20.124 -90.908  5.951  1.00 79.26  ? 170 MET N O   1 
ATOM 4420 C CB  . MET D 4 80  ? 21.133 -87.701  5.711  1.00 83.44  ? 170 MET N CB  1 
ATOM 4421 C CG  . MET D 4 80  ? 21.616 -87.906  7.129  1.00 75.33  ? 170 MET N CG  1 
ATOM 4422 S SD  . MET D 4 80  ? 21.698 -86.332  8.012  1.00 84.92  ? 170 MET N SD  1 
ATOM 4423 C CE  . MET D 4 80  ? 22.836 -85.416  6.977  1.00 73.55  ? 170 MET N CE  1 
ATOM 4424 N N   . GLU D 4 81  ? 18.668 -89.462  5.016  1.00 74.56  ? 171 GLU N N   1 
ATOM 4425 C CA  . GLU D 4 81  ? 17.521 -90.288  5.352  1.00 76.55  ? 171 GLU N CA  1 
ATOM 4426 C C   . GLU D 4 81  ? 17.484 -91.574  4.536  1.00 78.74  ? 171 GLU N C   1 
ATOM 4427 O O   . GLU D 4 81  ? 16.834 -92.538  4.954  1.00 74.72  ? 171 GLU N O   1 
ATOM 4428 C CB  . GLU D 4 81  ? 16.218 -89.507  5.170  1.00 69.78  ? 171 GLU N CB  1 
ATOM 4429 C CG  . GLU D 4 81  ? 15.755 -88.798  6.431  1.00 64.30  ? 171 GLU N CG  1 
ATOM 4430 C CD  . GLU D 4 81  ? 14.243 -88.777  6.566  1.00 69.22  ? 171 GLU N CD  1 
ATOM 4431 O OE1 . GLU D 4 81  ? 13.549 -88.659  5.534  1.00 69.55  ? 171 GLU N OE1 1 
ATOM 4432 O OE2 . GLU D 4 81  ? 13.747 -88.903  7.707  1.00 67.04  ? 171 GLU N OE2 1 
ATOM 4433 N N   . ASN D 4 82  ? 18.163 -91.617  3.386  1.00 76.84  ? 172 ASN N N   1 
ATOM 4434 C CA  . ASN D 4 82  ? 18.199 -92.853  2.613  1.00 80.18  ? 172 ASN N CA  1 
ATOM 4435 C C   . ASN D 4 82  ? 19.081 -93.908  3.272  1.00 79.61  ? 172 ASN N C   1 
ATOM 4436 O O   . ASN D 4 82  ? 18.679 -95.076  3.384  1.00 78.68  ? 172 ASN N O   1 
ATOM 4437 C CB  . ASN D 4 82  ? 18.683 -92.560  1.191  1.00 81.87  ? 172 ASN N CB  1 
ATOM 4438 C CG  . ASN D 4 82  ? 19.337 -93.761  0.535  1.00 90.16  ? 172 ASN N CG  1 
ATOM 4439 O OD1 . ASN D 4 82  ? 20.559 -93.909  0.569  1.00 75.73  ? 172 ASN N OD1 1 
ATOM 4440 N ND2 . ASN D 4 82  ? 18.526 -94.628  -0.063 1.00 106.10 ? 172 ASN N ND2 1 
ATOM 4441 N N   . LEU D 4 83  ? 20.271 -93.525  3.750  1.00 73.37  ? 173 LEU N N   1 
ATOM 4442 C CA  . LEU D 4 83  ? 21.058 -94.519  4.472  1.00 68.53  ? 173 LEU N CA  1 
ATOM 4443 C C   . LEU D 4 83  ? 20.489 -94.789  5.859  1.00 62.78  ? 173 LEU N C   1 
ATOM 4444 O O   . LEU D 4 83  ? 20.709 -95.874  6.402  1.00 68.17  ? 173 LEU N O   1 
ATOM 4445 C CB  . LEU D 4 83  ? 22.552 -94.172  4.541  1.00 62.04  ? 173 LEU N CB  1 
ATOM 4446 C CG  . LEU D 4 83  ? 23.271 -92.908  4.999  1.00 68.99  ? 173 LEU N CG  1 
ATOM 4447 C CD1 . LEU D 4 83  ? 23.053 -91.726  4.116  1.00 84.65  ? 173 LEU N CD1 1 
ATOM 4448 C CD2 . LEU D 4 83  ? 22.933 -92.611  6.429  1.00 65.67  ? 173 LEU N CD2 1 
ATOM 4449 N N   . LYS D 4 84  ? 19.781 -93.832  6.469  1.00 60.54  ? 174 LYS N N   1 
ATOM 4450 C CA  . LYS D 4 84  ? 19.138 -94.199  7.729  1.00 62.53  ? 174 LYS N CA  1 
ATOM 4451 C C   . LYS D 4 84  ? 17.957 -95.132  7.485  1.00 69.99  ? 174 LYS N C   1 
ATOM 4452 O O   . LYS D 4 84  ? 17.624 -95.952  8.351  1.00 78.09  ? 174 LYS N O   1 
ATOM 4453 C CB  . LYS D 4 84  ? 18.693 -92.959  8.517  1.00 60.17  ? 174 LYS N CB  1 
ATOM 4454 C CG  . LYS D 4 84  ? 17.371 -92.330  8.090  1.00 68.84  ? 174 LYS N CG  1 
ATOM 4455 C CD  . LYS D 4 84  ? 16.171 -92.871  8.869  1.00 69.41  ? 174 LYS N CD  1 
ATOM 4456 C CE  . LYS D 4 84  ? 14.860 -92.360  8.287  1.00 72.56  ? 174 LYS N CE  1 
ATOM 4457 N NZ  . LYS D 4 84  ? 13.713 -93.256  8.610  1.00 72.87  ? 174 LYS N NZ  1 
ATOM 4458 N N   . CYS D 4 85  ? 17.331 -95.047  6.308  1.00 69.48  ? 175 CYS N N   1 
ATOM 4459 C CA  . CYS D 4 85  ? 16.244 -95.967  5.993  1.00 75.70  ? 175 CYS N CA  1 
ATOM 4460 C C   . CYS D 4 85  ? 16.775 -97.366  5.705  1.00 66.60  ? 175 CYS N C   1 
ATOM 4461 O O   . CYS D 4 85  ? 16.234 -98.360  6.211  1.00 68.27  ? 175 CYS N O   1 
ATOM 4462 C CB  . CYS D 4 85  ? 15.432 -95.438  4.810  1.00 78.91  ? 175 CYS N CB  1 
ATOM 4463 S SG  . CYS D 4 85  ? 14.201 -94.181  5.250  1.00 72.31  ? 175 CYS N SG  1 
ATOM 4464 N N   . ARG D 4 86  ? 17.849 -97.471  4.918  1.00 65.09  ? 176 ARG N N   1 
ATOM 4465 C CA  . ARG D 4 86  ? 18.487 -98.775  4.775  1.00 71.92  ? 176 ARG N CA  1 
ATOM 4466 C C   . ARG D 4 86  ? 19.009 -99.274  6.119  1.00 65.06  ? 176 ARG N C   1 
ATOM 4467 O O   . ARG D 4 86  ? 19.096 -100.489 6.345  1.00 63.72  ? 176 ARG N O   1 
ATOM 4468 C CB  . ARG D 4 86  ? 19.604 -98.723  3.730  1.00 66.27  ? 176 ARG N CB  1 
ATOM 4469 C CG  . ARG D 4 86  ? 20.850 -97.999  4.172  1.00 58.76  ? 176 ARG N CG  1 
ATOM 4470 C CD  . ARG D 4 86  ? 22.080 -98.501  3.445  1.00 58.04  ? 176 ARG N CD  1 
ATOM 4471 N NE  . ARG D 4 86  ? 22.070 -98.166  2.027  1.00 50.42  ? 176 ARG N NE  1 
ATOM 4472 C CZ  . ARG D 4 86  ? 22.956 -98.630  1.153  1.00 55.95  ? 176 ARG N CZ  1 
ATOM 4473 N NH1 . ARG D 4 86  ? 23.920 -99.445  1.560  1.00 47.06  ? 176 ARG N NH1 1 
ATOM 4474 N NH2 . ARG D 4 86  ? 22.880 -98.279  -0.123 1.00 63.45  ? 176 ARG N NH2 1 
ATOM 4475 N N   . GLY D 4 87  ? 19.352 -98.351  7.022  1.00 59.27  ? 177 GLY N N   1 
ATOM 4476 C CA  . GLY D 4 87  ? 19.670 -98.740  8.385  1.00 59.36  ? 177 GLY N CA  1 
ATOM 4477 C C   . GLY D 4 87  ? 18.488 -99.354  9.109  1.00 63.04  ? 177 GLY N C   1 
ATOM 4478 O O   . GLY D 4 87  ? 18.649 -100.296 9.890  1.00 65.07  ? 177 GLY N O   1 
ATOM 4479 N N   . GLU D 4 88  ? 17.282 -98.833  8.864  1.00 62.73  ? 178 GLU N N   1 
ATOM 4480 C CA  . GLU D 4 88  ? 16.100 -99.480  9.424  1.00 66.99  ? 178 GLU N CA  1 
ATOM 4481 C C   . GLU D 4 88  ? 15.938 -100.881 8.843  1.00 69.60  ? 178 GLU N C   1 
ATOM 4482 O O   . GLU D 4 88  ? 15.619 -101.833 9.570  1.00 67.75  ? 178 GLU N O   1 
ATOM 4483 C CB  . GLU D 4 88  ? 14.846 -98.626  9.187  1.00 70.68  ? 178 GLU N CB  1 
ATOM 4484 C CG  . GLU D 4 88  ? 13.935 -99.067  8.043  1.00 75.84  ? 178 GLU N CG  1 
ATOM 4485 C CD  . GLU D 4 88  ? 12.617 -98.321  8.012  1.00 85.94  ? 178 GLU N CD  1 
ATOM 4486 O OE1 . GLU D 4 88  ? 12.128 -97.922  9.089  1.00 89.79  ? 178 GLU N OE1 1 
ATOM 4487 O OE2 . GLU D 4 88  ? 12.065 -98.142  6.905  1.00 92.84  ? 178 GLU N OE2 1 
ATOM 4488 N N   . THR D 4 89  ? 16.175 -101.029 7.534  1.00 63.70  ? 179 THR N N   1 
ATOM 4489 C CA  . THR D 4 89  ? 16.030 -102.335 6.897  1.00 57.29  ? 179 THR N CA  1 
ATOM 4490 C C   . THR D 4 89  ? 16.985 -103.358 7.504  1.00 60.15  ? 179 THR N C   1 
ATOM 4491 O O   . THR D 4 89  ? 16.561 -104.439 7.932  1.00 65.49  ? 179 THR N O   1 
ATOM 4492 C CB  . THR D 4 89  ? 16.255 -102.214 5.390  1.00 58.66  ? 179 THR N CB  1 
ATOM 4493 O OG1 . THR D 4 89  ? 17.614 -101.840 5.134  1.00 60.42  ? 179 THR N OG1 1 
ATOM 4494 C CG2 . THR D 4 89  ? 15.321 -101.170 4.794  1.00 59.68  ? 179 THR N CG2 1 
ATOM 4495 N N   . VAL D 4 90  ? 18.281 -103.035 7.560  1.00 57.78  ? 180 VAL N N   1 
ATOM 4496 C CA  . VAL D 4 90  ? 19.236 -103.992 8.118  1.00 54.98  ? 180 VAL N CA  1 
ATOM 4497 C C   . VAL D 4 90  ? 18.981 -104.209 9.604  1.00 53.05  ? 180 VAL N C   1 
ATOM 4498 O O   . VAL D 4 90  ? 19.197 -105.312 10.122 1.00 55.93  ? 180 VAL N O   1 
ATOM 4499 C CB  . VAL D 4 90  ? 20.687 -103.548 7.849  1.00 49.47  ? 180 VAL N CB  1 
ATOM 4500 C CG1 . VAL D 4 90  ? 20.907 -103.333 6.362  1.00 54.24  ? 180 VAL N CG1 1 
ATOM 4501 C CG2 . VAL D 4 90  ? 21.031 -102.293 8.631  1.00 55.70  ? 180 VAL N CG2 1 
ATOM 4502 N N   . ALA D 4 91  ? 18.513 -103.178 10.312 1.00 55.05  ? 181 ALA N N   1 
ATOM 4503 C CA  . ALA D 4 91  ? 18.225 -103.329 11.734 1.00 59.13  ? 181 ALA N CA  1 
ATOM 4504 C C   . ALA D 4 91  ? 17.132 -104.366 11.959 1.00 58.57  ? 181 ALA N C   1 
ATOM 4505 O O   . ALA D 4 91  ? 17.319 -105.332 12.712 1.00 49.82  ? 181 ALA N O   1 
ATOM 4506 C CB  . ALA D 4 91  ? 17.827 -101.980 12.336 1.00 64.98  ? 181 ALA N CB  1 
ATOM 4507 N N   . LYS D 4 92  ? 15.981 -104.187 11.302 1.00 63.19  ? 182 LYS N N   1 
ATOM 4508 C CA  . LYS D 4 92  ? 14.903 -105.159 11.447 1.00 67.45  ? 182 LYS N CA  1 
ATOM 4509 C C   . LYS D 4 92  ? 15.311 -106.531 10.928 1.00 60.38  ? 182 LYS N C   1 
ATOM 4510 O O   . LYS D 4 92  ? 14.910 -107.555 11.498 1.00 63.63  ? 182 LYS N O   1 
ATOM 4511 C CB  . LYS D 4 92  ? 13.646 -104.668 10.722 1.00 69.60  ? 182 LYS N CB  1 
ATOM 4512 C CG  . LYS D 4 92  ? 12.375 -105.434 11.086 1.00 76.46  ? 182 LYS N CG  1 
ATOM 4513 C CD  . LYS D 4 92  ? 12.169 -105.488 12.593 1.00 83.03  ? 182 LYS N CD  1 
ATOM 4514 C CE  . LYS D 4 92  ? 11.155 -106.553 12.987 1.00 71.85  ? 182 LYS N CE  1 
ATOM 4515 N NZ  . LYS D 4 92  ? 11.374 -107.033 14.383 1.00 64.11  ? 182 LYS N NZ  1 
ATOM 4516 N N   . GLU D 4 93  ? 16.133 -106.575 9.876  1.00 54.83  ? 183 GLU N N   1 
ATOM 4517 C CA  . GLU D 4 93  ? 16.539 -107.861 9.319  1.00 56.02  ? 183 GLU N CA  1 
ATOM 4518 C C   . GLU D 4 93  ? 17.376 -108.655 10.313 1.00 50.02  ? 183 GLU N C   1 
ATOM 4519 O O   . GLU D 4 93  ? 17.108 -109.836 10.557 1.00 51.80  ? 183 GLU N O   1 
ATOM 4520 C CB  . GLU D 4 93  ? 17.299 -107.660 8.007  1.00 60.41  ? 183 GLU N CB  1 
ATOM 4521 C CG  . GLU D 4 93  ? 16.393 -107.453 6.803  1.00 67.94  ? 183 GLU N CG  1 
ATOM 4522 C CD  . GLU D 4 93  ? 17.075 -107.795 5.491  1.00 82.62  ? 183 GLU N CD  1 
ATOM 4523 O OE1 . GLU D 4 93  ? 16.375 -107.859 4.458  1.00 92.86  ? 183 GLU N OE1 1 
ATOM 4524 O OE2 . GLU D 4 93  ? 18.307 -108.003 5.493  1.00 80.78  ? 183 GLU N OE2 1 
ATOM 4525 N N   . ILE D 4 94  ? 18.393 -108.024 10.906 1.00 48.32  ? 184 ILE N N   1 
ATOM 4526 C CA  . ILE D 4 94  ? 19.201 -108.752 11.878 1.00 45.53  ? 184 ILE N CA  1 
ATOM 4527 C C   . ILE D 4 94  ? 18.442 -108.989 13.177 1.00 49.13  ? 184 ILE N C   1 
ATOM 4528 O O   . ILE D 4 94  ? 18.761 -109.934 13.909 1.00 55.40  ? 184 ILE N O   1 
ATOM 4529 C CB  . ILE D 4 94  ? 20.538 -108.032 12.149 1.00 42.67  ? 184 ILE N CB  1 
ATOM 4530 C CG1 . ILE D 4 94  ? 20.328 -106.764 12.975 1.00 47.36  ? 184 ILE N CG1 1 
ATOM 4531 C CG2 . ILE D 4 94  ? 21.259 -107.724 10.850 1.00 48.82  ? 184 ILE N CG2 1 
ATOM 4532 C CD1 . ILE D 4 94  ? 21.555 -106.341 13.743 1.00 41.61  ? 184 ILE N CD1 1 
ATOM 4533 N N   . SER D 4 95  ? 17.430 -108.174 13.482 1.00 53.78  ? 185 SER N N   1 
ATOM 4534 C CA  . SER D 4 95  ? 16.593 -108.463 14.642 1.00 57.57  ? 185 SER N CA  1 
ATOM 4535 C C   . SER D 4 95  ? 15.816 -109.758 14.439 1.00 54.61  ? 185 SER N C   1 
ATOM 4536 O O   . SER D 4 95  ? 15.909 -110.691 15.248 1.00 55.53  ? 185 SER N O   1 
ATOM 4537 C CB  . SER D 4 95  ? 15.641 -107.299 14.917 1.00 60.54  ? 185 SER N CB  1 
ATOM 4538 O OG  . SER D 4 95  ? 14.893 -107.536 16.098 1.00 56.73  ? 185 SER N OG  1 
ATOM 4539 N N   . GLU D 4 96  ? 15.047 -109.837 13.349 1.00 56.99  ? 186 GLU N N   1 
ATOM 4540 C CA  . GLU D 4 96  ? 14.266 -111.045 13.103 1.00 60.56  ? 186 GLU N CA  1 
ATOM 4541 C C   . GLU D 4 96  ? 15.156 -112.248 12.820 1.00 55.96  ? 186 GLU N C   1 
ATOM 4542 O O   . GLU D 4 96  ? 14.750 -113.386 13.076 1.00 58.46  ? 186 GLU N O   1 
ATOM 4543 C CB  . GLU D 4 96  ? 13.284 -110.824 11.953 1.00 65.54  ? 186 GLU N CB  1 
ATOM 4544 C CG  . GLU D 4 96  ? 12.119 -109.914 12.313 1.00 78.29  ? 186 GLU N CG  1 
ATOM 4545 C CD  . GLU D 4 96  ? 10.983 -110.653 13.008 1.00 79.07  ? 186 GLU N CD  1 
ATOM 4546 O OE1 . GLU D 4 96  ? 10.975 -111.903 12.985 1.00 62.53  ? 186 GLU N OE1 1 
ATOM 4547 O OE2 . GLU D 4 96  ? 10.098 -109.980 13.580 1.00 89.04  ? 186 GLU N OE2 1 
ATOM 4548 N N   . ALA D 4 97  ? 16.364 -112.025 12.297 1.00 51.23  ? 187 ALA N N   1 
ATOM 4549 C CA  . ALA D 4 97  ? 17.306 -113.129 12.149 1.00 46.72  ? 187 ALA N CA  1 
ATOM 4550 C C   . ALA D 4 97  ? 17.762 -113.642 13.508 1.00 52.00  ? 187 ALA N C   1 
ATOM 4551 O O   . ALA D 4 97  ? 17.815 -114.859 13.736 1.00 61.64  ? 187 ALA N O   1 
ATOM 4552 C CB  . ALA D 4 97  ? 18.504 -112.693 11.308 1.00 41.15  ? 187 ALA N CB  1 
ATOM 4553 N N   . MET D 4 98  ? 18.071 -112.728 14.434 1.00 52.82  ? 188 MET N N   1 
ATOM 4554 C CA  . MET D 4 98  ? 18.422 -113.148 15.786 1.00 55.99  ? 188 MET N CA  1 
ATOM 4555 C C   . MET D 4 98  ? 17.260 -113.848 16.474 1.00 55.10  ? 188 MET N C   1 
ATOM 4556 O O   . MET D 4 98  ? 17.475 -114.666 17.374 1.00 51.57  ? 188 MET N O   1 
ATOM 4557 C CB  . MET D 4 98  ? 18.870 -111.954 16.627 1.00 52.78  ? 188 MET N CB  1 
ATOM 4558 C CG  . MET D 4 98  ? 20.356 -111.681 16.585 1.00 52.03  ? 188 MET N CG  1 
ATOM 4559 S SD  . MET D 4 98  ? 20.850 -110.650 17.972 1.00 71.60  ? 188 MET N SD  1 
ATOM 4560 C CE  . MET D 4 98  ? 20.537 -111.762 19.339 1.00 60.83  ? 188 MET N CE  1 
ATOM 4561 N N   . LYS D 4 99  ? 16.026 -113.534 16.078 1.00 58.71  ? 189 LYS N N   1 
ATOM 4562 C CA  . LYS D 4 99  ? 14.882 -114.200 16.687 1.00 58.12  ? 189 LYS N CA  1 
ATOM 4563 C C   . LYS D 4 99  ? 14.596 -115.557 16.054 1.00 59.33  ? 189 LYS N C   1 
ATOM 4564 O O   . LYS D 4 99  ? 14.117 -116.463 16.745 1.00 69.33  ? 189 LYS N O   1 
ATOM 4565 C CB  . LYS D 4 99  ? 13.649 -113.297 16.605 1.00 65.05  ? 189 LYS N CB  1 
ATOM 4566 C CG  . LYS D 4 99  ? 13.809 -111.978 17.359 1.00 73.88  ? 189 LYS N CG  1 
ATOM 4567 C CD  . LYS D 4 99  ? 12.693 -110.992 17.037 1.00 69.47  ? 189 LYS N CD  1 
ATOM 4568 C CE  . LYS D 4 99  ? 11.418 -111.308 17.799 1.00 65.79  ? 189 LYS N CE  1 
ATOM 4569 N NZ  . LYS D 4 99  ? 10.365 -110.284 17.548 1.00 54.70  ? 189 LYS N NZ  1 
ATOM 4570 N N   . SER D 4 100 ? 14.895 -115.732 14.764 1.00 58.70  ? 190 SER N N   1 
ATOM 4571 C CA  . SER D 4 100 ? 14.539 -116.964 14.068 1.00 59.25  ? 190 SER N CA  1 
ATOM 4572 C C   . SER D 4 100 ? 15.649 -118.005 14.065 1.00 53.31  ? 190 SER N C   1 
ATOM 4573 O O   . SER D 4 100 ? 15.366 -119.185 13.827 1.00 57.93  ? 190 SER N O   1 
ATOM 4574 C CB  . SER D 4 100 ? 14.145 -116.673 12.615 1.00 61.27  ? 190 SER N CB  1 
ATOM 4575 O OG  . SER D 4 100 ? 15.263 -116.252 11.853 1.00 59.29  ? 190 SER N OG  1 
ATOM 4576 N N   . LEU D 4 101 ? 16.901 -117.607 14.308 1.00 48.65  ? 191 LEU N N   1 
ATOM 4577 C CA  . LEU D 4 101 ? 17.985 -118.588 14.269 1.00 51.54  ? 191 LEU N CA  1 
ATOM 4578 C C   . LEU D 4 101 ? 17.945 -119.558 15.450 1.00 56.25  ? 191 LEU N C   1 
ATOM 4579 O O   . LEU D 4 101 ? 18.042 -120.778 15.223 1.00 58.87  ? 191 LEU N O   1 
ATOM 4580 C CB  . LEU D 4 101 ? 19.328 -117.862 14.153 1.00 48.00  ? 191 LEU N CB  1 
ATOM 4581 C CG  . LEU D 4 101 ? 20.594 -118.704 14.017 1.00 49.65  ? 191 LEU N CG  1 
ATOM 4582 C CD1 . LEU D 4 101 ? 21.616 -117.979 13.162 1.00 49.32  ? 191 LEU N CD1 1 
ATOM 4583 C CD2 . LEU D 4 101 ? 21.176 -119.008 15.375 1.00 48.03  ? 191 LEU N CD2 1 
ATOM 4584 N N   . PRO D 4 102 ? 17.816 -119.114 16.708 1.00 54.32  ? 192 PRO N N   1 
ATOM 4585 C CA  . PRO D 4 102 ? 17.763 -120.085 17.817 1.00 55.88  ? 192 PRO N CA  1 
ATOM 4586 C C   . PRO D 4 102 ? 16.605 -121.068 17.731 1.00 59.33  ? 192 PRO N C   1 
ATOM 4587 O O   . PRO D 4 102 ? 16.701 -122.162 18.304 1.00 61.89  ? 192 PRO N O   1 
ATOM 4588 C CB  . PRO D 4 102 ? 17.645 -119.192 19.058 1.00 60.32  ? 192 PRO N CB  1 
ATOM 4589 C CG  . PRO D 4 102 ? 18.248 -117.908 18.647 1.00 56.55  ? 192 PRO N CG  1 
ATOM 4590 C CD  . PRO D 4 102 ? 17.859 -117.732 17.215 1.00 55.55  ? 192 PRO N CD  1 
ATOM 4591 N N   . ALA D 4 103 ? 15.513 -120.719 17.048 1.00 57.01  ? 193 ALA N N   1 
ATOM 4592 C CA  . ALA D 4 103 ? 14.477 -121.712 16.788 1.00 64.96  ? 193 ALA N CA  1 
ATOM 4593 C C   . ALA D 4 103 ? 15.029 -122.838 15.927 1.00 63.27  ? 193 ALA N C   1 
ATOM 4594 O O   . ALA D 4 103 ? 14.736 -124.019 16.160 1.00 63.66  ? 193 ALA N O   1 
ATOM 4595 C CB  . ALA D 4 103 ? 13.271 -121.055 16.117 1.00 68.23  ? 193 ALA N CB  1 
ATOM 4596 N N   . LEU D 4 104 ? 15.854 -122.488 14.939 1.00 58.43  ? 194 LEU N N   1 
ATOM 4597 C CA  . LEU D 4 104 ? 16.558 -123.494 14.160 1.00 58.58  ? 194 LEU N CA  1 
ATOM 4598 C C   . LEU D 4 104 ? 17.593 -124.234 14.996 1.00 56.22  ? 194 LEU N C   1 
ATOM 4599 O O   . LEU D 4 104 ? 17.934 -125.375 14.667 1.00 61.02  ? 194 LEU N O   1 
ATOM 4600 C CB  . LEU D 4 104 ? 17.227 -122.847 12.946 1.00 50.74  ? 194 LEU N CB  1 
ATOM 4601 C CG  . LEU D 4 104 ? 16.416 -122.694 11.656 1.00 57.35  ? 194 LEU N CG  1 
ATOM 4602 C CD1 . LEU D 4 104 ? 15.074 -122.012 11.892 1.00 58.35  ? 194 LEU N CD1 1 
ATOM 4603 C CD2 . LEU D 4 104 ? 17.228 -121.926 10.631 1.00 58.83  ? 194 LEU N CD2 1 
ATOM 4604 N N   . ILE D 4 105 ? 18.094 -123.622 16.073 1.00 56.15  ? 195 ILE N N   1 
ATOM 4605 C CA  . ILE D 4 105 ? 18.925 -124.376 17.008 1.00 54.56  ? 195 ILE N CA  1 
ATOM 4606 C C   . ILE D 4 105 ? 18.089 -125.413 17.748 1.00 64.17  ? 195 ILE N C   1 
ATOM 4607 O O   . ILE D 4 105 ? 18.547 -126.534 18.000 1.00 70.51  ? 195 ILE N O   1 
ATOM 4608 C CB  . ILE D 4 105 ? 19.645 -123.433 17.989 1.00 62.33  ? 195 ILE N CB  1 
ATOM 4609 C CG1 . ILE D 4 105 ? 20.555 -122.461 17.238 1.00 68.92  ? 195 ILE N CG1 1 
ATOM 4610 C CG2 . ILE D 4 105 ? 20.451 -124.227 19.007 1.00 57.84  ? 195 ILE N CG2 1 
ATOM 4611 C CD1 . ILE D 4 105 ? 21.243 -121.460 18.141 1.00 68.28  ? 195 ILE N CD1 1 
ATOM 4612 N N   . GLU D 4 106 ? 16.845 -125.067 18.092 1.00 63.60  ? 196 GLU N N   1 
ATOM 4613 C CA  . GLU D 4 106 ? 15.978 -126.037 18.756 1.00 70.98  ? 196 GLU N CA  1 
ATOM 4614 C C   . GLU D 4 106 ? 15.616 -127.185 17.823 1.00 64.17  ? 196 GLU N C   1 
ATOM 4615 O O   . GLU D 4 106 ? 15.645 -128.354 18.231 1.00 55.77  ? 196 GLU N O   1 
ATOM 4616 C CB  . GLU D 4 106 ? 14.720 -125.347 19.286 1.00 73.01  ? 196 GLU N CB  1 
ATOM 4617 C CG  . GLU D 4 106 ? 14.934 -124.546 20.568 1.00 80.02  ? 196 GLU N CG  1 
ATOM 4618 C CD  . GLU D 4 106 ? 15.161 -125.427 21.791 1.00 91.20  ? 196 GLU N CD  1 
ATOM 4619 O OE1 . GLU D 4 106 ? 16.192 -126.133 21.851 1.00 82.50  ? 196 GLU N OE1 1 
ATOM 4620 O OE2 . GLU D 4 106 ? 14.304 -125.407 22.701 1.00 101.25 ? 196 GLU N OE2 1 
ATOM 4621 N N   . GLN D 4 107 ? 15.292 -126.878 16.562 1.00 63.79  ? 197 GLN N N   1 
ATOM 4622 C CA  . GLN D 4 107 ? 15.144 -127.939 15.571 1.00 61.15  ? 197 GLN N CA  1 
ATOM 4623 C C   . GLN D 4 107 ? 16.427 -128.742 15.423 1.00 65.33  ? 197 GLN N C   1 
ATOM 4624 O O   . GLN D 4 107 ? 16.379 -129.936 15.111 1.00 74.12  ? 197 GLN N O   1 
ATOM 4625 C CB  . GLN D 4 107 ? 14.743 -127.363 14.214 1.00 61.59  ? 197 GLN N CB  1 
ATOM 4626 C CG  . GLN D 4 107 ? 13.446 -126.585 14.202 1.00 73.74  ? 197 GLN N CG  1 
ATOM 4627 C CD  . GLN D 4 107 ? 13.141 -126.016 12.830 1.00 79.79  ? 197 GLN N CD  1 
ATOM 4628 O OE1 . GLN D 4 107 ? 13.963 -126.099 11.915 1.00 73.18  ? 197 GLN N OE1 1 
ATOM 4629 N NE2 . GLN D 4 107 ? 11.955 -125.437 12.677 1.00 89.52  ? 197 GLN N NE2 1 
ATOM 4630 N N   . GLY D 4 108 ? 17.576 -128.108 15.634 1.00 64.57  ? 198 GLY N N   1 
ATOM 4631 C CA  . GLY D 4 108 ? 18.847 -128.788 15.515 1.00 63.35  ? 198 GLY N CA  1 
ATOM 4632 C C   . GLY D 4 108 ? 19.074 -129.822 16.598 1.00 70.37  ? 198 GLY N C   1 
ATOM 4633 O O   . GLY D 4 108 ? 19.330 -130.992 16.299 1.00 74.49  ? 198 GLY N O   1 
ATOM 4634 N N   . GLU D 4 109 ? 18.982 -129.411 17.861 1.00 71.23  ? 199 GLU N N   1 
ATOM 4635 C CA  . GLU D 4 109 ? 19.212 -130.344 18.957 1.00 78.46  ? 199 GLU N CA  1 
ATOM 4636 C C   . GLU D 4 109 ? 17.993 -131.199 19.272 1.00 77.08  ? 199 GLU N C   1 
ATOM 4637 O O   . GLU D 4 109 ? 18.072 -132.067 20.150 1.00 69.97  ? 199 GLU N O   1 
ATOM 4638 C CB  . GLU D 4 109 ? 19.663 -129.587 20.209 1.00 83.85  ? 199 GLU N CB  1 
ATOM 4639 C CG  . GLU D 4 109 ? 18.850 -128.346 20.526 1.00 76.22  ? 199 GLU N CG  1 
ATOM 4640 C CD  . GLU D 4 109 ? 19.617 -127.366 21.389 1.00 77.84  ? 199 GLU N CD  1 
ATOM 4641 O OE1 . GLU D 4 109 ? 20.843 -127.548 21.548 1.00 79.91  ? 199 GLU N OE1 1 
ATOM 4642 O OE2 . GLU D 4 109 ? 18.997 -126.414 21.907 1.00 68.98  ? 199 GLU N OE2 1 
ATOM 4643 N N   . GLY D 4 110 ? 16.875 -130.983 18.577 1.00 76.26  ? 200 GLY N N   1 
ATOM 4644 C CA  . GLY D 4 110 ? 15.777 -131.928 18.651 1.00 72.77  ? 200 GLY N CA  1 
ATOM 4645 C C   . GLY D 4 110 ? 16.053 -133.198 17.873 1.00 76.88  ? 200 GLY N C   1 
ATOM 4646 O O   . GLY D 4 110 ? 15.501 -134.257 18.187 1.00 86.47  ? 200 GLY N O   1 
ATOM 4647 N N   . PHE D 4 111 ? 16.914 -133.117 16.860 1.00 72.22  ? 201 PHE N N   1 
ATOM 4648 C CA  . PHE D 4 111 ? 17.257 -134.256 16.021 1.00 74.43  ? 201 PHE N CA  1 
ATOM 4649 C C   . PHE D 4 111 ? 18.533 -134.949 16.474 1.00 77.90  ? 201 PHE N C   1 
ATOM 4650 O O   . PHE D 4 111 ? 18.921 -135.958 15.876 1.00 84.52  ? 201 PHE N O   1 
ATOM 4651 C CB  . PHE D 4 111 ? 17.418 -133.814 14.560 1.00 73.45  ? 201 PHE N CB  1 
ATOM 4652 C CG  . PHE D 4 111 ? 16.156 -133.290 13.931 1.00 70.81  ? 201 PHE N CG  1 
ATOM 4653 C CD1 . PHE D 4 111 ? 14.918 -133.542 14.499 1.00 69.27  ? 201 PHE N CD1 1 
ATOM 4654 C CD2 . PHE D 4 111 ? 16.212 -132.552 12.760 1.00 64.54  ? 201 PHE N CD2 1 
ATOM 4655 C CE1 . PHE D 4 111 ? 13.760 -133.058 13.917 1.00 66.27  ? 201 PHE N CE1 1 
ATOM 4656 C CE2 . PHE D 4 111 ? 15.060 -132.067 12.176 1.00 70.98  ? 201 PHE N CE2 1 
ATOM 4657 C CZ  . PHE D 4 111 ? 13.832 -132.322 12.754 1.00 69.58  ? 201 PHE N CZ  1 
ATOM 4658 N N   . SER D 4 112 ? 19.181 -134.444 17.521 1.00 80.11  ? 202 SER N N   1 
ATOM 4659 C CA  . SER D 4 112 ? 20.487 -134.930 17.941 1.00 83.36  ? 202 SER N CA  1 
ATOM 4660 C C   . SER D 4 112 ? 20.416 -136.140 18.862 1.00 91.25  ? 202 SER N C   1 
ATOM 4661 O O   . SER D 4 112 ? 21.464 -136.710 19.186 1.00 95.56  ? 202 SER N O   1 
ATOM 4662 C CB  . SER D 4 112 ? 21.263 -133.810 18.644 1.00 89.14  ? 202 SER N CB  1 
ATOM 4663 O OG  . SER D 4 112 ? 20.497 -133.235 19.689 1.00 85.72  ? 202 SER N OG  1 
ATOM 4664 N N   . GLN D 4 113 ? 19.221 -136.550 19.286 1.00 89.77  ? 203 GLN N N   1 
ATOM 4665 C CA  . GLN D 4 113 ? 19.069 -137.700 20.170 1.00 87.82  ? 203 GLN N CA  1 
ATOM 4666 C C   . GLN D 4 113 ? 18.387 -138.854 19.438 1.00 82.59  ? 203 GLN N C   1 
ATOM 4667 O O   . GLN D 4 113 ? 19.020 -139.881 19.184 1.00 86.19  ? 203 GLN N O   1 
ATOM 4668 C CB  . GLN D 4 113 ? 18.278 -137.309 21.419 1.00 84.96  ? 203 GLN N CB  1 
ATOM 4669 C CG  . GLN D 4 113 ? 18.737 -136.018 22.069 1.00 85.43  ? 203 GLN N CG  1 
ATOM 4670 C CD  . GLN D 4 113 ? 17.877 -135.631 23.254 1.00 92.06  ? 203 GLN N CD  1 
ATOM 4671 O OE1 . GLN D 4 113 ? 16.744 -136.093 23.392 1.00 78.79  ? 203 GLN N OE1 1 
ATOM 4672 N NE2 . GLN D 4 113 ? 18.410 -134.772 24.116 1.00 109.23 ? 203 GLN N NE2 1 
ATOM 4673 N N   . VAL D 4 114 ? 17.120 -138.705 19.079 1.00 80.83  ? 204 VAL N N   1 
ATOM 4674 C CA  . VAL D 4 114 ? 16.399 -139.765 18.390 1.00 96.22  ? 204 VAL N CA  1 
ATOM 4675 C C   . VAL D 4 114 ? 15.760 -139.194 17.132 1.00 89.66  ? 204 VAL N C   1 
ATOM 4676 O O   . VAL D 4 114 ? 15.989 -138.035 16.786 1.00 76.15  ? 204 VAL N O   1 
ATOM 4677 C CB  . VAL D 4 114 ? 15.347 -140.421 19.312 1.00 102.92 ? 204 VAL N CB  1 
ATOM 4678 C CG1 . VAL D 4 114 ? 14.195 -139.464 19.575 1.00 98.24  ? 204 VAL N CG1 1 
ATOM 4679 C CG2 . VAL D 4 114 ? 14.847 -141.734 18.712 1.00 83.14  ? 204 VAL N CG2 1 
ATOM 4680 N N   . LEU E 5 11  ? 64.708 30.363   19.414 1.00 65.65  ? 6   LEU P N   1 
ATOM 4681 C CA  . LEU E 5 11  ? 66.158 30.238   19.324 1.00 69.19  ? 6   LEU P CA  1 
ATOM 4682 C C   . LEU E 5 11  ? 66.592 28.816   18.972 1.00 72.98  ? 6   LEU P C   1 
ATOM 4683 O O   . LEU E 5 11  ? 67.524 28.628   18.193 1.00 73.45  ? 6   LEU P O   1 
ATOM 4684 C CB  . LEU E 5 11  ? 66.816 30.702   20.635 1.00 63.30  ? 6   LEU P CB  1 
ATOM 4685 C CG  . LEU E 5 11  ? 66.244 30.329   22.012 1.00 55.69  ? 6   LEU P CG  1 
ATOM 4686 C CD1 . LEU E 5 11  ? 66.419 28.867   22.349 1.00 60.59  ? 6   LEU P CD1 1 
ATOM 4687 C CD2 . LEU E 5 11  ? 66.871 31.187   23.101 1.00 47.36  ? 6   LEU P CD2 1 
ATOM 4688 N N   . ASP E 5 12  ? 65.890 27.828   19.528 1.00 68.50  ? 7   ASP P N   1 
ATOM 4689 C CA  . ASP E 5 12  ? 66.240 26.419   19.380 1.00 63.92  ? 7   ASP P CA  1 
ATOM 4690 C C   . ASP E 5 12  ? 67.734 26.176   19.584 1.00 65.31  ? 7   ASP P C   1 
ATOM 4691 O O   . ASP E 5 12  ? 68.259 26.422   20.675 1.00 59.92  ? 7   ASP P O   1 
ATOM 4692 C CB  . ASP E 5 12  ? 65.784 25.899   18.016 1.00 65.00  ? 7   ASP P CB  1 
ATOM 4693 C CG  . ASP E 5 12  ? 64.319 25.487   18.009 1.00 70.89  ? 7   ASP P CG  1 
ATOM 4694 O OD1 . ASP E 5 12  ? 63.997 24.465   17.368 1.00 73.32  ? 7   ASP P OD1 1 
ATOM 4695 O OD2 . ASP E 5 12  ? 63.491 26.176   18.644 1.00 67.12  ? 7   ASP P OD2 1 
ATOM 4696 N N   . HIS E 5 13  ? 68.423 25.706   18.538 1.00 65.55  ? 8   HIS P N   1 
ATOM 4697 C CA  . HIS E 5 13  ? 69.824 25.271   18.622 1.00 62.03  ? 8   HIS P CA  1 
ATOM 4698 C C   . HIS E 5 13  ? 70.005 24.184   19.678 1.00 73.61  ? 8   HIS P C   1 
ATOM 4699 O O   . HIS E 5 13  ? 71.084 24.046   20.265 1.00 80.80  ? 8   HIS P O   1 
ATOM 4700 C CB  . HIS E 5 13  ? 70.778 26.436   18.911 1.00 71.79  ? 8   HIS P CB  1 
ATOM 4701 C CG  . HIS E 5 13  ? 70.517 27.669   18.098 1.00 83.40  ? 8   HIS P CG  1 
ATOM 4702 N ND1 . HIS E 5 13  ? 69.949 27.637   16.842 1.00 83.25  ? 8   HIS P ND1 1 
ATOM 4703 C CD2 . HIS E 5 13  ? 70.743 28.976   18.374 1.00 74.90  ? 8   HIS P CD2 1 
ATOM 4704 C CE1 . HIS E 5 13  ? 69.843 28.870   16.377 1.00 76.40  ? 8   HIS P CE1 1 
ATOM 4705 N NE2 . HIS E 5 13  ? 70.314 29.701   17.289 1.00 72.26  ? 8   HIS P NE2 1 
ATOM 4706 N N   . LEU E 5 14  ? 68.947 23.414   19.920 1.00 71.13  ? 9   LEU P N   1 
ATOM 4707 C CA  . LEU E 5 14  ? 68.889 22.406   20.967 1.00 54.55  ? 9   LEU P CA  1 
ATOM 4708 C C   . LEU E 5 14  ? 69.424 21.070   20.461 1.00 61.10  ? 9   LEU P C   1 
ATOM 4709 O O   . LEU E 5 14  ? 69.382 20.767   19.266 1.00 57.60  ? 9   LEU P O   1 
ATOM 4710 C CB  . LEU E 5 14  ? 67.452 22.244   21.471 1.00 46.64  ? 9   LEU P CB  1 
ATOM 4711 C CG  . LEU E 5 14  ? 66.328 21.578   20.664 1.00 51.28  ? 9   LEU P CG  1 
ATOM 4712 C CD1 . LEU E 5 14  ? 65.053 21.626   21.490 1.00 44.27  ? 9   LEU P CD1 1 
ATOM 4713 C CD2 . LEU E 5 14  ? 66.085 22.191   19.291 1.00 60.53  ? 9   LEU P CD2 1 
ATOM 4714 N N   . LYS E 5 15  ? 69.930 20.266   21.395 1.00 65.54  ? 10  LYS P N   1 
ATOM 4715 C CA  . LYS E 5 15  ? 70.509 18.977   21.038 1.00 65.08  ? 10  LYS P CA  1 
ATOM 4716 C C   . LYS E 5 15  ? 69.414 18.047   20.534 1.00 58.57  ? 10  LYS P C   1 
ATOM 4717 O O   . LYS E 5 15  ? 68.422 17.806   21.229 1.00 48.63  ? 10  LYS P O   1 
ATOM 4718 C CB  . LYS E 5 15  ? 71.227 18.359   22.235 1.00 61.73  ? 10  LYS P CB  1 
ATOM 4719 C CG  . LYS E 5 15  ? 72.381 17.445   21.843 1.00 63.25  ? 10  LYS P CG  1 
ATOM 4720 C CD  . LYS E 5 15  ? 72.736 16.480   22.960 1.00 68.54  ? 10  LYS P CD  1 
ATOM 4721 C CE  . LYS E 5 15  ? 71.755 15.317   22.996 1.00 60.78  ? 10  LYS P CE  1 
ATOM 4722 N NZ  . LYS E 5 15  ? 71.871 14.518   24.246 1.00 60.14  ? 10  LYS P NZ  1 
ATOM 4723 N N   . ASN E 5 16  ? 69.587 17.537   19.320 1.00 63.14  ? 11  ASN P N   1 
ATOM 4724 C CA  . ASN E 5 16  ? 68.665 16.578   18.734 1.00 68.17  ? 11  ASN P CA  1 
ATOM 4725 C C   . ASN E 5 16  ? 69.368 15.241   18.566 1.00 76.86  ? 11  ASN P C   1 
ATOM 4726 O O   . ASN E 5 16  ? 70.519 15.189   18.118 1.00 77.01  ? 11  ASN P O   1 
ATOM 4727 C CB  . ASN E 5 16  ? 68.120 17.076   17.395 1.00 67.30  ? 11  ASN P CB  1 
ATOM 4728 C CG  . ASN E 5 16  ? 66.620 17.280   17.428 1.00 74.00  ? 11  ASN P CG  1 
ATOM 4729 O OD1 . ASN E 5 16  ? 65.921 16.681   18.247 1.00 62.32  ? 11  ASN P OD1 1 
ATOM 4730 N ND2 . ASN E 5 16  ? 66.118 18.139   16.548 1.00 90.14  ? 11  ASN P ND2 1 
ATOM 4731 N N   . GLY E 5 17  ? 68.672 14.168   18.931 1.00 68.28  ? 12  GLY P N   1 
ATOM 4732 C CA  . GLY E 5 17  ? 69.249 12.843   18.930 1.00 52.20  ? 12  GLY P CA  1 
ATOM 4733 C C   . GLY E 5 17  ? 68.832 12.057   20.155 1.00 62.20  ? 12  GLY P C   1 
ATOM 4734 O O   . GLY E 5 17  ? 67.741 11.480   20.180 1.00 65.60  ? 12  GLY P O   1 
ATOM 4735 N N   . TYR E 5 18  ? 69.677 12.062   21.188 1.00 66.86  ? 13  TYR P N   1 
ATOM 4736 C CA  . TYR E 5 18  ? 69.506 11.210   22.362 1.00 63.52  ? 13  TYR P CA  1 
ATOM 4737 C C   . TYR E 5 18  ? 69.312 9.760    21.941 1.00 63.18  ? 13  TYR P C   1 
ATOM 4738 O O   . TYR E 5 18  ? 68.190 9.240    21.948 1.00 62.66  ? 13  TYR P O   1 
ATOM 4739 C CB  . TYR E 5 18  ? 68.338 11.678   23.235 1.00 58.02  ? 13  TYR P CB  1 
ATOM 4740 C CG  . TYR E 5 18  ? 68.513 11.345   24.706 1.00 57.20  ? 13  TYR P CG  1 
ATOM 4741 C CD1 . TYR E 5 18  ? 69.513 11.948   25.464 1.00 58.01  ? 13  TYR P CD1 1 
ATOM 4742 C CD2 . TYR E 5 18  ? 67.686 10.420   25.333 1.00 51.77  ? 13  TYR P CD2 1 
ATOM 4743 C CE1 . TYR E 5 18  ? 69.679 11.642   26.808 1.00 56.22  ? 13  TYR P CE1 1 
ATOM 4744 C CE2 . TYR E 5 18  ? 67.844 10.109   26.675 1.00 51.60  ? 13  TYR P CE2 1 
ATOM 4745 C CZ  . TYR E 5 18  ? 68.842 10.723   27.407 1.00 49.82  ? 13  TYR P CZ  1 
ATOM 4746 O OH  . TYR E 5 18  ? 69.003 10.418   28.741 1.00 38.75  ? 13  TYR P OH  1 
ATOM 4747 N N   . ARG E 5 19  ? 70.408 9.112    21.562 1.00 61.21  ? 14  ARG P N   1 
ATOM 4748 C CA  . ARG E 5 19  ? 70.353 7.721    21.149 1.00 62.35  ? 14  ARG P CA  1 
ATOM 4749 C C   . ARG E 5 19  ? 69.826 6.851    22.282 1.00 60.94  ? 14  ARG P C   1 
ATOM 4750 O O   . ARG E 5 19  ? 70.178 7.036    23.451 1.00 55.76  ? 14  ARG P O   1 
ATOM 4751 C CB  . ARG E 5 19  ? 71.736 7.257    20.715 1.00 62.97  ? 14  ARG P CB  1 
ATOM 4752 C CG  . ARG E 5 19  ? 72.436 8.208    19.762 1.00 62.80  ? 14  ARG P CG  1 
ATOM 4753 C CD  . ARG E 5 19  ? 73.935 8.097    19.931 1.00 68.05  ? 14  ARG P CD  1 
ATOM 4754 N NE  . ARG E 5 19  ? 74.298 8.223    21.339 1.00 73.24  ? 14  ARG P NE  1 
ATOM 4755 C CZ  . ARG E 5 19  ? 75.509 7.984    21.828 1.00 72.73  ? 14  ARG P CZ  1 
ATOM 4756 N NH1 . ARG E 5 19  ? 76.490 7.603    21.022 1.00 79.06  ? 14  ARG P NH1 1 
ATOM 4757 N NH2 . ARG E 5 19  ? 75.738 8.127    23.127 1.00 73.76  ? 14  ARG P NH2 1 
ATOM 4758 N N   . ARG E 5 20  ? 68.976 5.892    21.923 1.00 61.22  ? 15  ARG P N   1 
ATOM 4759 C CA  . ARG E 5 20  ? 68.206 5.164    22.922 1.00 61.31  ? 15  ARG P CA  1 
ATOM 4760 C C   . ARG E 5 20  ? 69.040 4.099    23.628 1.00 71.21  ? 15  ARG P C   1 
ATOM 4761 O O   . ARG E 5 20  ? 69.025 4.011    24.861 1.00 78.07  ? 15  ARG P O   1 
ATOM 4762 C CB  . ARG E 5 20  ? 66.971 4.552    22.262 1.00 53.47  ? 15  ARG P CB  1 
ATOM 4763 C CG  . ARG E 5 20  ? 65.862 5.560    22.027 1.00 42.62  ? 15  ARG P CG  1 
ATOM 4764 C CD  . ARG E 5 20  ? 64.914 5.125    20.927 1.00 42.27  ? 15  ARG P CD  1 
ATOM 4765 N NE  . ARG E 5 20  ? 65.345 5.608    19.619 1.00 42.92  ? 15  ARG P NE  1 
ATOM 4766 C CZ  . ARG E 5 20  ? 64.543 5.726    18.566 1.00 42.74  ? 15  ARG P CZ  1 
ATOM 4767 N NH1 . ARG E 5 20  ? 63.261 5.401    18.668 1.00 41.01  ? 15  ARG P NH1 1 
ATOM 4768 N NH2 . ARG E 5 20  ? 65.021 6.176    17.413 1.00 40.06  ? 15  ARG P NH2 1 
ATOM 4769 N N   . ARG E 5 21  ? 69.776 3.281    22.872 1.00 66.84  ? 16  ARG P N   1 
ATOM 4770 C CA  . ARG E 5 21  ? 70.480 2.119    23.425 1.00 70.70  ? 16  ARG P CA  1 
ATOM 4771 C C   . ARG E 5 21  ? 71.945 2.146    22.995 1.00 72.22  ? 16  ARG P C   1 
ATOM 4772 O O   . ARG E 5 21  ? 72.311 1.498    22.012 1.00 65.28  ? 16  ARG P O   1 
ATOM 4773 C CB  . ARG E 5 21  ? 69.800 0.828    22.984 1.00 73.77  ? 16  ARG P CB  1 
ATOM 4774 C CG  . ARG E 5 21  ? 68.385 1.035    22.485 1.00 67.22  ? 16  ARG P CG  1 
ATOM 4775 C CD  . ARG E 5 21  ? 67.835 -0.190   21.789 1.00 57.79  ? 16  ARG P CD  1 
ATOM 4776 N NE  . ARG E 5 21  ? 66.825 0.192    20.808 1.00 60.59  ? 16  ARG P NE  1 
ATOM 4777 C CZ  . ARG E 5 21  ? 65.567 0.502    21.110 1.00 58.00  ? 16  ARG P CZ  1 
ATOM 4778 N NH1 . ARG E 5 21  ? 65.152 0.467    22.370 1.00 57.78  ? 16  ARG P NH1 1 
ATOM 4779 N NH2 . ARG E 5 21  ? 64.720 0.843    20.149 1.00 48.95  ? 16  ARG P NH2 1 
ATOM 4780 N N   . PHE E 5 22  ? 72.777 2.873    23.741 1.00 85.28  ? 17  PHE P N   1 
ATOM 4781 C CA  . PHE E 5 22  ? 74.209 2.926    23.475 1.00 79.83  ? 17  PHE P CA  1 
ATOM 4782 C C   . PHE E 5 22  ? 74.961 3.106    24.787 1.00 69.28  ? 17  PHE P C   1 
ATOM 4783 O O   . PHE E 5 22  ? 74.378 3.423    25.828 1.00 59.91  ? 17  PHE P O   1 
ATOM 4784 C CB  . PHE E 5 22  ? 74.565 4.048    22.494 1.00 76.27  ? 17  PHE P CB  1 
ATOM 4785 C CG  . PHE E 5 22  ? 74.264 3.716    21.059 1.00 83.39  ? 17  PHE P CG  1 
ATOM 4786 C CD1 . PHE E 5 22  ? 73.627 4.628    20.244 1.00 83.01  ? 17  PHE P CD1 1 
ATOM 4787 C CD2 . PHE E 5 22  ? 74.620 2.493    20.528 1.00 86.24  ? 17  PHE P CD2 1 
ATOM 4788 C CE1 . PHE E 5 22  ? 73.346 4.327    18.925 1.00 81.78  ? 17  PHE P CE1 1 
ATOM 4789 C CE2 . PHE E 5 22  ? 74.344 2.180    19.209 1.00 80.08  ? 17  PHE P CE2 1 
ATOM 4790 C CZ  . PHE E 5 22  ? 73.706 3.100    18.407 1.00 83.01  ? 17  PHE P CZ  1 
ATOM 4791 N N   . CYS E 5 23  ? 76.274 2.904    24.718 1.00 70.30  ? 18  CYS P N   1 
ATOM 4792 C CA  . CYS E 5 23  ? 77.142 2.983    25.889 1.00 75.64  ? 18  CYS P CA  1 
ATOM 4793 C C   . CYS E 5 23  ? 77.116 4.367    26.527 1.00 62.77  ? 18  CYS P C   1 
ATOM 4794 O O   . CYS E 5 23  ? 76.432 4.581    27.529 1.00 63.74  ? 18  CYS P O   1 
ATOM 4795 C CB  . CYS E 5 23  ? 78.581 2.599    25.513 1.00 83.77  ? 18  CYS P CB  1 
ATOM 4796 S SG  . CYS E 5 23  ? 79.252 3.405    24.027 1.00 58.06  ? 18  CYS P SG  1 
ATOM 4797 N N   . SER F 1 2   ? 9.092  -21.611  26.217 1.00 36.01  ? 2   SER C N   1 
ATOM 4798 C CA  . SER F 1 2   ? 9.603  -22.940  25.907 1.00 50.40  ? 2   SER C CA  1 
ATOM 4799 C C   . SER F 1 2   ? 10.838 -22.844  25.019 1.00 57.62  ? 2   SER C C   1 
ATOM 4800 O O   . SER F 1 2   ? 11.335 -21.745  24.774 1.00 63.38  ? 2   SER C O   1 
ATOM 4801 C CB  . SER F 1 2   ? 8.522  -23.771  25.217 1.00 55.38  ? 2   SER C CB  1 
ATOM 4802 O OG  . SER F 1 2   ? 7.252  -23.515  25.793 1.00 40.10  ? 2   SER C OG  1 
ATOM 4803 N N   . VAL F 1 3   ? 11.328 -24.002  24.558 1.00 59.64  ? 3   VAL C N   1 
ATOM 4804 C CA  . VAL F 1 3   ? 12.441 -24.141  23.612 1.00 60.31  ? 3   VAL C CA  1 
ATOM 4805 C C   . VAL F 1 3   ? 13.610 -23.237  24.008 1.00 50.86  ? 3   VAL C C   1 
ATOM 4806 O O   . VAL F 1 3   ? 13.914 -22.248  23.333 1.00 49.38  ? 3   VAL C O   1 
ATOM 4807 C CB  . VAL F 1 3   ? 11.984 -23.931  22.144 1.00 59.11  ? 3   VAL C CB  1 
ATOM 4808 C CG1 . VAL F 1 3   ? 11.387 -22.548  21.876 1.00 62.97  ? 3   VAL C CG1 1 
ATOM 4809 C CG2 . VAL F 1 3   ? 13.118 -24.245  21.164 1.00 51.87  ? 3   VAL C CG2 1 
ATOM 4810 N N   . ASP F 1 4   ? 14.280 -23.576  25.104 1.00 52.55  ? 4   ASP C N   1 
ATOM 4811 C CA  . ASP F 1 4   ? 15.414 -22.789  25.575 1.00 51.98  ? 4   ASP C CA  1 
ATOM 4812 C C   . ASP F 1 4   ? 16.692 -23.193  24.849 1.00 49.42  ? 4   ASP C C   1 
ATOM 4813 O O   . ASP F 1 4   ? 17.204 -24.300  25.060 1.00 57.28  ? 4   ASP C O   1 
ATOM 4814 C CB  . ASP F 1 4   ? 15.592 -22.962  27.085 1.00 53.66  ? 4   ASP C CB  1 
ATOM 4815 C CG  . ASP F 1 4   ? 16.726 -22.121  27.643 1.00 50.92  ? 4   ASP C CG  1 
ATOM 4816 O OD1 . ASP F 1 4   ? 17.148 -21.153  26.974 1.00 52.58  ? 4   ASP C OD1 1 
ATOM 4817 O OD2 . ASP F 1 4   ? 17.201 -22.438  28.754 1.00 47.92  ? 4   ASP C OD2 1 
ATOM 4818 N N   . PRO F 1 5   ? 17.239 -22.326  23.990 1.00 43.46  ? 5   PRO C N   1 
ATOM 4819 C CA  . PRO F 1 5   ? 18.486 -22.667  23.291 1.00 43.15  ? 5   PRO C CA  1 
ATOM 4820 C C   . PRO F 1 5   ? 19.708 -22.645  24.185 1.00 39.31  ? 5   PRO C C   1 
ATOM 4821 O O   . PRO F 1 5   ? 20.761 -23.141  23.762 1.00 44.57  ? 5   PRO C O   1 
ATOM 4822 C CB  . PRO F 1 5   ? 18.581 -21.591  22.205 1.00 46.30  ? 5   PRO C CB  1 
ATOM 4823 C CG  . PRO F 1 5   ? 17.919 -20.410  22.819 1.00 49.69  ? 5   PRO C CG  1 
ATOM 4824 C CD  . PRO F 1 5   ? 16.786 -20.963  23.662 1.00 56.22  ? 5   PRO C CD  1 
ATOM 4825 N N   . MET F 1 6   ? 19.604 -22.087  25.391 1.00 37.60  ? 6   MET C N   1 
ATOM 4826 C CA  . MET F 1 6   ? 20.742 -21.919  26.292 1.00 42.03  ? 6   MET C CA  1 
ATOM 4827 C C   . MET F 1 6   ? 21.920 -21.299  25.547 1.00 43.22  ? 6   MET C C   1 
ATOM 4828 O O   . MET F 1 6   ? 23.041 -21.816  25.539 1.00 37.09  ? 6   MET C O   1 
ATOM 4829 C CB  . MET F 1 6   ? 21.120 -23.246  26.946 1.00 42.78  ? 6   MET C CB  1 
ATOM 4830 C CG  . MET F 1 6   ? 19.943 -23.898  27.661 1.00 49.51  ? 6   MET C CG  1 
ATOM 4831 S SD  . MET F 1 6   ? 20.378 -24.869  29.116 1.00 49.65  ? 6   MET C SD  1 
ATOM 4832 C CE  . MET F 1 6   ? 18.769 -25.495  29.591 1.00 55.89  ? 6   MET C CE  1 
ATOM 4833 N N   . THR F 1 7   ? 21.632 -20.168  24.895 1.00 47.96  ? 7   THR C N   1 
ATOM 4834 C CA  . THR F 1 7   ? 22.637 -19.461  24.107 1.00 41.92  ? 7   THR C CA  1 
ATOM 4835 C C   . THR F 1 7   ? 23.784 -18.971  24.979 1.00 35.96  ? 7   THR C C   1 
ATOM 4836 O O   . THR F 1 7   ? 24.951 -19.025  24.572 1.00 28.72  ? 7   THR C O   1 
ATOM 4837 C CB  . THR F 1 7   ? 21.980 -18.302  23.350 1.00 35.69  ? 7   THR C CB  1 
ATOM 4838 O OG1 . THR F 1 7   ? 22.985 -17.466  22.779 1.00 37.15  ? 7   THR C OG1 1 
ATOM 4839 C CG2 . THR F 1 7   ? 21.083 -17.482  24.273 1.00 34.07  ? 7   THR C CG2 1 
ATOM 4840 N N   . TYR F 1 8   ? 23.476 -18.495  26.185 1.00 34.80  ? 8   TYR C N   1 
ATOM 4841 C CA  . TYR F 1 8   ? 24.528 -18.026  27.070 1.00 36.01  ? 8   TYR C CA  1 
ATOM 4842 C C   . TYR F 1 8   ? 25.239 -19.178  27.761 1.00 36.20  ? 8   TYR C C   1 
ATOM 4843 O O   . TYR F 1 8   ? 26.339 -18.984  28.289 1.00 36.59  ? 8   TYR C O   1 
ATOM 4844 C CB  . TYR F 1 8   ? 23.955 -17.067  28.113 1.00 41.53  ? 8   TYR C CB  1 
ATOM 4845 C CG  . TYR F 1 8   ? 24.977 -16.109  28.684 1.00 50.61  ? 8   TYR C CG  1 
ATOM 4846 C CD1 . TYR F 1 8   ? 25.506 -15.085  27.905 1.00 54.12  ? 8   TYR C CD1 1 
ATOM 4847 C CD2 . TYR F 1 8   ? 25.423 -16.234  29.991 1.00 46.05  ? 8   TYR C CD2 1 
ATOM 4848 C CE1 . TYR F 1 8   ? 26.444 -14.201  28.417 1.00 49.35  ? 8   TYR C CE1 1 
ATOM 4849 C CE2 . TYR F 1 8   ? 26.362 -15.357  30.513 1.00 53.90  ? 8   TYR C CE2 1 
ATOM 4850 C CZ  . TYR F 1 8   ? 26.869 -14.343  29.723 1.00 52.93  ? 8   TYR C CZ  1 
ATOM 4851 O OH  . TYR F 1 8   ? 27.804 -13.472  30.241 1.00 43.24  ? 8   TYR C OH  1 
ATOM 4852 N N   . GLU F 1 9   ? 24.633 -20.370  27.768 1.00 41.72  ? 9   GLU C N   1 
ATOM 4853 C CA  . GLU F 1 9   ? 25.314 -21.548  28.293 1.00 36.45  ? 9   GLU C CA  1 
ATOM 4854 C C   . GLU F 1 9   ? 26.374 -22.047  27.321 1.00 34.78  ? 9   GLU C C   1 
ATOM 4855 O O   . GLU F 1 9   ? 27.436 -22.516  27.743 1.00 35.42  ? 9   GLU C O   1 
ATOM 4856 C CB  . GLU F 1 9   ? 24.301 -22.642  28.618 1.00 33.03  ? 9   GLU C CB  1 
ATOM 4857 C CG  . GLU F 1 9   ? 23.702 -22.515  30.015 1.00 34.74  ? 9   GLU C CG  1 
ATOM 4858 C CD  . GLU F 1 9   ? 22.666 -21.408  30.148 1.00 38.30  ? 9   GLU C CD  1 
ATOM 4859 O OE1 . GLU F 1 9   ? 22.564 -20.546  29.252 1.00 48.20  ? 9   GLU C OE1 1 
ATOM 4860 O OE2 . GLU F 1 9   ? 21.954 -21.392  31.173 1.00 37.75  ? 9   GLU C OE2 1 
ATOM 4861 N N   . ALA F 1 10  ? 26.120 -21.936  26.021 1.00 31.65  ? 10  ALA C N   1 
ATOM 4862 C CA  . ALA F 1 10  ? 27.224 -21.977  25.081 1.00 26.89  ? 10  ALA C CA  1 
ATOM 4863 C C   . ALA F 1 10  ? 28.050 -20.705  25.255 1.00 41.62  ? 10  ALA C C   1 
ATOM 4864 O O   . ALA F 1 10  ? 27.816 -19.903  26.165 1.00 43.05  ? 10  ALA C O   1 
ATOM 4865 C CB  . ALA F 1 10  ? 26.711 -22.129  23.654 1.00 28.13  ? 10  ALA C CB  1 
ATOM 4866 N N   . GLN F 1 11  ? 29.052 -20.531  24.392 1.00 43.73  ? 11  GLN C N   1 
ATOM 4867 C CA  . GLN F 1 11  ? 29.976 -19.398  24.473 1.00 41.57  ? 11  GLN C CA  1 
ATOM 4868 C C   . GLN F 1 11  ? 30.882 -19.546  25.696 1.00 39.13  ? 11  GLN C C   1 
ATOM 4869 O O   . GLN F 1 11  ? 32.014 -19.053  25.700 1.00 39.20  ? 11  GLN C O   1 
ATOM 4870 C CB  . GLN F 1 11  ? 29.208 -18.066  24.488 1.00 38.28  ? 11  GLN C CB  1 
ATOM 4871 C CG  . GLN F 1 11  ? 30.015 -16.838  24.858 1.00 41.23  ? 11  GLN C CG  1 
ATOM 4872 C CD  . GLN F 1 11  ? 29.137 -15.691  25.316 1.00 36.65  ? 11  GLN C CD  1 
ATOM 4873 O OE1 . GLN F 1 11  ? 27.987 -15.564  24.892 1.00 34.70  ? 11  GLN C OE1 1 
ATOM 4874 N NE2 . GLN F 1 11  ? 29.675 -14.848  26.185 1.00 37.54  ? 11  GLN C NE2 1 
ATOM 4875 N N   . PHE F 1 12  ? 30.408 -20.242  26.730 1.00 37.67  ? 12  PHE C N   1 
ATOM 4876 C CA  . PHE F 1 12  ? 31.254 -20.652  27.844 1.00 37.39  ? 12  PHE C CA  1 
ATOM 4877 C C   . PHE F 1 12  ? 31.714 -22.097  27.692 1.00 36.00  ? 12  PHE C C   1 
ATOM 4878 O O   . PHE F 1 12  ? 32.917 -22.369  27.633 1.00 34.84  ? 12  PHE C O   1 
ATOM 4879 C CB  . PHE F 1 12  ? 30.530 -20.483  29.181 1.00 34.58  ? 12  PHE C CB  1 
ATOM 4880 C CG  . PHE F 1 12  ? 31.321 -20.990  30.348 1.00 35.36  ? 12  PHE C CG  1 
ATOM 4881 C CD1 . PHE F 1 12  ? 32.623 -20.565  30.554 1.00 40.38  ? 12  PHE C CD1 1 
ATOM 4882 C CD2 . PHE F 1 12  ? 30.775 -21.909  31.224 1.00 33.41  ? 12  PHE C CD2 1 
ATOM 4883 C CE1 . PHE F 1 12  ? 33.361 -21.038  31.622 1.00 44.70  ? 12  PHE C CE1 1 
ATOM 4884 C CE2 . PHE F 1 12  ? 31.505 -22.385  32.295 1.00 36.02  ? 12  PHE C CE2 1 
ATOM 4885 C CZ  . PHE F 1 12  ? 32.801 -21.949  32.495 1.00 44.74  ? 12  PHE C CZ  1 
ATOM 4886 N N   . PHE F 1 13  ? 30.767 -23.036  27.644 1.00 32.90  ? 13  PHE C N   1 
ATOM 4887 C CA  . PHE F 1 13  ? 31.123 -24.428  27.395 1.00 33.01  ? 13  PHE C CA  1 
ATOM 4888 C C   . PHE F 1 13  ? 31.557 -24.629  25.951 1.00 34.19  ? 13  PHE C C   1 
ATOM 4889 O O   . PHE F 1 13  ? 32.621 -25.200  25.681 1.00 36.03  ? 13  PHE C O   1 
ATOM 4890 C CB  . PHE F 1 13  ? 29.944 -25.347  27.720 1.00 28.05  ? 13  PHE C CB  1 
ATOM 4891 C CG  . PHE F 1 13  ? 29.567 -25.380  29.172 1.00 26.64  ? 13  PHE C CG  1 
ATOM 4892 C CD1 . PHE F 1 13  ? 30.330 -26.091  30.084 1.00 28.83  ? 13  PHE C CD1 1 
ATOM 4893 C CD2 . PHE F 1 13  ? 28.430 -24.733  29.620 1.00 26.47  ? 13  PHE C CD2 1 
ATOM 4894 C CE1 . PHE F 1 13  ? 29.977 -26.135  31.420 1.00 30.49  ? 13  PHE C CE1 1 
ATOM 4895 C CE2 . PHE F 1 13  ? 28.072 -24.772  30.952 1.00 25.98  ? 13  PHE C CE2 1 
ATOM 4896 C CZ  . PHE F 1 13  ? 28.847 -25.474  31.854 1.00 28.25  ? 13  PHE C CZ  1 
ATOM 4897 N N   . GLY F 1 14  ? 30.747 -24.161  25.010 1.00 35.67  ? 14  GLY C N   1 
ATOM 4898 C CA  . GLY F 1 14  ? 31.019 -24.346  23.606 1.00 36.66  ? 14  GLY C CA  1 
ATOM 4899 C C   . GLY F 1 14  ? 30.347 -25.537  22.960 1.00 37.43  ? 14  GLY C C   1 
ATOM 4900 O O   . GLY F 1 14  ? 30.697 -25.872  21.823 1.00 41.96  ? 14  GLY C O   1 
ATOM 4901 N N   . PHE F 1 15  ? 29.408 -26.198  23.642 1.00 30.69  ? 15  PHE C N   1 
ATOM 4902 C CA  . PHE F 1 15  ? 28.678 -27.302  23.030 1.00 34.97  ? 15  PHE C CA  1 
ATOM 4903 C C   . PHE F 1 15  ? 27.171 -27.267  23.248 1.00 39.19  ? 15  PHE C C   1 
ATOM 4904 O O   . PHE F 1 15  ? 26.455 -27.952  22.506 1.00 51.15  ? 15  PHE C O   1 
ATOM 4905 C CB  . PHE F 1 15  ? 29.216 -28.657  23.521 1.00 35.62  ? 15  PHE C CB  1 
ATOM 4906 C CG  . PHE F 1 15  ? 29.643 -28.671  24.957 1.00 34.84  ? 15  PHE C CG  1 
ATOM 4907 C CD1 . PHE F 1 15  ? 30.977 -28.530  25.309 1.00 35.70  ? 15  PHE C CD1 1 
ATOM 4908 C CD2 . PHE F 1 15  ? 28.709 -28.880  25.958 1.00 32.25  ? 15  PHE C CD2 1 
ATOM 4909 C CE1 . PHE F 1 15  ? 31.364 -28.560  26.638 1.00 29.89  ? 15  PHE C CE1 1 
ATOM 4910 C CE2 . PHE F 1 15  ? 29.087 -28.920  27.284 1.00 31.24  ? 15  PHE C CE2 1 
ATOM 4911 C CZ  . PHE F 1 15  ? 30.417 -28.760  27.626 1.00 28.35  ? 15  PHE C CZ  1 
ATOM 4912 N N   . THR F 1 16  ? 26.669 -26.530  24.248 1.00 33.17  ? 16  THR C N   1 
ATOM 4913 C CA  . THR F 1 16  ? 25.275 -26.486  24.698 1.00 38.51  ? 16  THR C CA  1 
ATOM 4914 C C   . THR F 1 16  ? 24.933 -27.786  25.417 1.00 43.83  ? 16  THR C C   1 
ATOM 4915 O O   . THR F 1 16  ? 25.341 -28.873  24.984 1.00 38.61  ? 16  THR C O   1 
ATOM 4916 C CB  . THR F 1 16  ? 24.279 -26.242  23.557 1.00 36.71  ? 16  THR C CB  1 
ATOM 4917 O OG1 . THR F 1 16  ? 24.234 -27.382  22.691 1.00 36.93  ? 16  THR C OG1 1 
ATOM 4918 C CG2 . THR F 1 16  ? 24.681 -25.026  22.755 1.00 45.99  ? 16  THR C CG2 1 
ATOM 4919 N N   . PRO F 1 17  ? 24.166 -27.712  26.505 1.00 43.50  ? 17  PRO C N   1 
ATOM 4920 C CA  . PRO F 1 17  ? 23.957 -28.910  27.328 1.00 43.75  ? 17  PRO C CA  1 
ATOM 4921 C C   . PRO F 1 17  ? 23.062 -29.948  26.681 1.00 42.83  ? 17  PRO C C   1 
ATOM 4922 O O   . PRO F 1 17  ? 23.241 -31.139  26.955 1.00 40.35  ? 17  PRO C O   1 
ATOM 4923 C CB  . PRO F 1 17  ? 23.333 -28.343  28.609 1.00 46.29  ? 17  PRO C CB  1 
ATOM 4924 C CG  . PRO F 1 17  ? 22.633 -27.129  28.147 1.00 43.11  ? 17  PRO C CG  1 
ATOM 4925 C CD  . PRO F 1 17  ? 23.493 -26.533  27.073 1.00 40.68  ? 17  PRO C CD  1 
ATOM 4926 N N   . GLN F 1 18  ? 22.092 -29.543  25.857 1.00 42.94  ? 18  GLN C N   1 
ATOM 4927 C CA  . GLN F 1 18  ? 21.169 -30.510  25.269 1.00 41.79  ? 18  GLN C CA  1 
ATOM 4928 C C   . GLN F 1 18  ? 21.913 -31.534  24.420 1.00 42.59  ? 18  GLN C C   1 
ATOM 4929 O O   . GLN F 1 18  ? 21.680 -32.744  24.537 1.00 45.48  ? 18  GLN C O   1 
ATOM 4930 C CB  . GLN F 1 18  ? 20.112 -29.789  24.431 1.00 44.60  ? 18  GLN C CB  1 
ATOM 4931 C CG  . GLN F 1 18  ? 19.310 -28.736  25.177 1.00 51.74  ? 18  GLN C CG  1 
ATOM 4932 C CD  . GLN F 1 18  ? 19.978 -27.375  25.193 1.00 45.14  ? 18  GLN C CD  1 
ATOM 4933 O OE1 . GLN F 1 18  ? 21.061 -27.187  24.637 1.00 43.12  ? 18  GLN C OE1 1 
ATOM 4934 N NE2 . GLN F 1 18  ? 19.319 -26.410  25.817 1.00 40.62  ? 18  GLN C NE2 1 
ATOM 4935 N N   . THR F 1 19  ? 22.818 -31.065  23.559 1.00 38.94  ? 19  THR C N   1 
ATOM 4936 C CA  . THR F 1 19  ? 23.621 -31.986  22.763 1.00 36.87  ? 19  THR C CA  1 
ATOM 4937 C C   . THR F 1 19  ? 24.438 -32.908  23.658 1.00 39.65  ? 19  THR C C   1 
ATOM 4938 O O   . THR F 1 19  ? 24.530 -34.117  23.409 1.00 49.53  ? 19  THR C O   1 
ATOM 4939 C CB  . THR F 1 19  ? 24.533 -31.199  21.826 1.00 35.47  ? 19  THR C CB  1 
ATOM 4940 O OG1 . THR F 1 19  ? 23.738 -30.321  21.023 1.00 40.96  ? 19  THR C OG1 1 
ATOM 4941 C CG2 . THR F 1 19  ? 25.310 -32.136  20.920 1.00 39.46  ? 19  THR C CG2 1 
ATOM 4942 N N   . CYS F 1 20  ? 25.014 -32.355  24.724 1.00 33.40  ? 20  CYS C N   1 
ATOM 4943 C CA  . CYS F 1 20  ? 25.804 -33.158  25.646 1.00 31.36  ? 20  CYS C CA  1 
ATOM 4944 C C   . CYS F 1 20  ? 24.963 -34.256  26.287 1.00 37.48  ? 20  CYS C C   1 
ATOM 4945 O O   . CYS F 1 20  ? 25.411 -35.403  26.418 1.00 37.19  ? 20  CYS C O   1 
ATOM 4946 C CB  . CYS F 1 20  ? 26.413 -32.248  26.707 1.00 34.95  ? 20  CYS C CB  1 
ATOM 4947 S SG  . CYS F 1 20  ? 27.514 -33.067  27.840 1.00 27.89  ? 20  CYS C SG  1 
ATOM 4948 N N   . MET F 1 21  ? 23.741 -33.922  26.701 1.00 37.72  ? 21  MET C N   1 
ATOM 4949 C CA  . MET F 1 21  ? 22.852 -34.917  27.288 1.00 36.63  ? 21  MET C CA  1 
ATOM 4950 C C   . MET F 1 21  ? 22.424 -35.959  26.269 1.00 38.76  ? 21  MET C C   1 
ATOM 4951 O O   . MET F 1 21  ? 22.185 -37.113  26.635 1.00 49.04  ? 21  MET C O   1 
ATOM 4952 C CB  . MET F 1 21  ? 21.634 -34.240  27.906 1.00 36.86  ? 21  MET C CB  1 
ATOM 4953 C CG  . MET F 1 21  ? 22.030 -33.333  29.033 1.00 45.09  ? 21  MET C CG  1 
ATOM 4954 S SD  . MET F 1 21  ? 22.744 -34.301  30.367 1.00 55.06  ? 21  MET C SD  1 
ATOM 4955 C CE  . MET F 1 21  ? 24.397 -33.617  30.363 1.00 43.32  ? 21  MET C CE  1 
ATOM 4956 N N   . LEU F 1 22  ? 22.284 -35.572  24.999 1.00 33.10  ? 22  LEU C N   1 
ATOM 4957 C CA  . LEU F 1 22  ? 22.017 -36.566  23.967 1.00 31.20  ? 22  LEU C CA  1 
ATOM 4958 C C   . LEU F 1 22  ? 23.184 -37.537  23.835 1.00 34.76  ? 22  LEU C C   1 
ATOM 4959 O O   . LEU F 1 22  ? 22.983 -38.754  23.724 1.00 42.55  ? 22  LEU C O   1 
ATOM 4960 C CB  . LEU F 1 22  ? 21.723 -35.875  22.636 1.00 36.83  ? 22  LEU C CB  1 
ATOM 4961 C CG  . LEU F 1 22  ? 21.423 -36.757  21.421 1.00 39.81  ? 22  LEU C CG  1 
ATOM 4962 C CD1 . LEU F 1 22  ? 20.318 -36.137  20.579 1.00 40.63  ? 22  LEU C CD1 1 
ATOM 4963 C CD2 . LEU F 1 22  ? 22.671 -36.971  20.577 1.00 37.25  ? 22  LEU C CD2 1 
ATOM 4964 N N   . ARG F 1 23  ? 24.415 -37.018  23.859 1.00 30.11  ? 23  ARG C N   1 
ATOM 4965 C CA  . ARG F 1 23  ? 25.588 -37.886  23.784 1.00 39.03  ? 23  ARG C CA  1 
ATOM 4966 C C   . ARG F 1 23  ? 25.633 -38.852  24.964 1.00 38.01  ? 23  ARG C C   1 
ATOM 4967 O O   . ARG F 1 23  ? 25.769 -40.072  24.788 1.00 36.76  ? 23  ARG C O   1 
ATOM 4968 C CB  . ARG F 1 23  ? 26.859 -37.037  23.733 1.00 39.69  ? 23  ARG C CB  1 
ATOM 4969 C CG  . ARG F 1 23  ? 26.901 -36.058  22.571 1.00 42.90  ? 23  ARG C CG  1 
ATOM 4970 C CD  . ARG F 1 23  ? 26.802 -36.791  21.244 1.00 60.93  ? 23  ARG C CD  1 
ATOM 4971 N NE  . ARG F 1 23  ? 26.125 -36.004  20.218 1.00 57.64  ? 23  ARG C NE  1 
ATOM 4972 C CZ  . ARG F 1 23  ? 25.685 -36.506  19.068 1.00 70.05  ? 23  ARG C CZ  1 
ATOM 4973 N NH1 . ARG F 1 23  ? 25.845 -37.799  18.803 1.00 75.15  ? 23  ARG C NH1 1 
ATOM 4974 N NH2 . ARG F 1 23  ? 25.079 -35.720  18.186 1.00 64.04  ? 23  ARG C NH2 1 
ATOM 4975 N N   . ILE F 1 24  ? 25.516 -38.318  26.181 1.00 38.01  ? 24  ILE C N   1 
ATOM 4976 C CA  . ILE F 1 24  ? 25.510 -39.163  27.371 1.00 32.08  ? 24  ILE C CA  1 
ATOM 4977 C C   . ILE F 1 24  ? 24.388 -40.188  27.288 1.00 30.09  ? 24  ILE C C   1 
ATOM 4978 O O   . ILE F 1 24  ? 24.545 -41.341  27.711 1.00 36.27  ? 24  ILE C O   1 
ATOM 4979 C CB  . ILE F 1 24  ? 25.395 -38.294  28.635 1.00 37.87  ? 24  ILE C CB  1 
ATOM 4980 C CG1 . ILE F 1 24  ? 26.601 -37.358  28.743 1.00 40.76  ? 24  ILE C CG1 1 
ATOM 4981 C CG2 . ILE F 1 24  ? 25.284 -39.164  29.873 1.00 24.43  ? 24  ILE C CG2 1 
ATOM 4982 C CD1 . ILE F 1 24  ? 26.568 -36.453  29.953 1.00 37.34  ? 24  ILE C CD1 1 
ATOM 4983 N N   . TYR F 1 25  ? 23.241 -39.788  26.739 1.00 28.44  ? 25  TYR C N   1 
ATOM 4984 C CA  . TYR F 1 25  ? 22.125 -40.715  26.607 1.00 33.24  ? 25  TYR C CA  1 
ATOM 4985 C C   . TYR F 1 25  ? 22.493 -41.884  25.707 1.00 35.77  ? 25  TYR C C   1 
ATOM 4986 O O   . TYR F 1 25  ? 22.340 -43.048  26.095 1.00 39.22  ? 25  TYR C O   1 
ATOM 4987 C CB  . TYR F 1 25  ? 20.892 -40.002  26.059 1.00 35.38  ? 25  TYR C CB  1 
ATOM 4988 C CG  . TYR F 1 25  ? 19.711 -40.929  25.864 1.00 38.59  ? 25  TYR C CG  1 
ATOM 4989 C CD1 . TYR F 1 25  ? 18.855 -41.223  26.915 1.00 45.08  ? 25  TYR C CD1 1 
ATOM 4990 C CD2 . TYR F 1 25  ? 19.463 -41.524  24.634 1.00 36.25  ? 25  TYR C CD2 1 
ATOM 4991 C CE1 . TYR F 1 25  ? 17.776 -42.071  26.749 1.00 51.25  ? 25  TYR C CE1 1 
ATOM 4992 C CE2 . TYR F 1 25  ? 18.388 -42.375  24.457 1.00 44.45  ? 25  TYR C CE2 1 
ATOM 4993 C CZ  . TYR F 1 25  ? 17.547 -42.646  25.518 1.00 52.34  ? 25  TYR C CZ  1 
ATOM 4994 O OH  . TYR F 1 25  ? 16.473 -43.494  25.349 1.00 54.67  ? 25  TYR C OH  1 
ATOM 4995 N N   . ILE F 1 26  ? 22.971 -41.596  24.492 1.00 32.21  ? 26  ILE C N   1 
ATOM 4996 C CA  . ILE F 1 26  ? 23.255 -42.690  23.567 1.00 35.67  ? 26  ILE C CA  1 
ATOM 4997 C C   . ILE F 1 26  ? 24.348 -43.595  24.123 1.00 33.98  ? 26  ILE C C   1 
ATOM 4998 O O   . ILE F 1 26  ? 24.305 -44.818  23.933 1.00 38.30  ? 26  ILE C O   1 
ATOM 4999 C CB  . ILE F 1 26  ? 23.610 -42.157  22.163 1.00 29.54  ? 26  ILE C CB  1 
ATOM 5000 C CG1 . ILE F 1 26  ? 24.873 -41.299  22.191 1.00 34.69  ? 26  ILE C CG1 1 
ATOM 5001 C CG2 . ILE F 1 26  ? 22.448 -41.356  21.600 1.00 24.75  ? 26  ILE C CG2 1 
ATOM 5002 C CD1 . ILE F 1 26  ? 25.386 -40.911  20.819 1.00 43.52  ? 26  ILE C CD1 1 
ATOM 5003 N N   . ALA F 1 27  ? 25.315 -43.030  24.853 1.00 30.87  ? 27  ALA C N   1 
ATOM 5004 C CA  . ALA F 1 27  ? 26.340 -43.867  25.473 1.00 30.32  ? 27  ALA C CA  1 
ATOM 5005 C C   . ALA F 1 27  ? 25.735 -44.787  26.529 1.00 36.65  ? 27  ALA C C   1 
ATOM 5006 O O   . ALA F 1 27  ? 25.963 -46.004  26.515 1.00 37.05  ? 27  ALA C O   1 
ATOM 5007 C CB  . ALA F 1 27  ? 27.437 -42.998  26.084 1.00 30.90  ? 27  ALA C CB  1 
ATOM 5008 N N   . PHE F 1 28  ? 24.957 -44.218  27.456 1.00 35.52  ? 28  PHE C N   1 
ATOM 5009 C CA  . PHE F 1 28  ? 24.343 -45.018  28.513 1.00 34.68  ? 28  PHE C CA  1 
ATOM 5010 C C   . PHE F 1 28  ? 23.485 -46.132  27.931 1.00 32.45  ? 28  PHE C C   1 
ATOM 5011 O O   . PHE F 1 28  ? 23.590 -47.296  28.339 1.00 35.37  ? 28  PHE C O   1 
ATOM 5012 C CB  . PHE F 1 28  ? 23.505 -44.124  29.430 1.00 32.69  ? 28  PHE C CB  1 
ATOM 5013 C CG  . PHE F 1 28  ? 24.317 -43.278  30.371 1.00 26.45  ? 28  PHE C CG  1 
ATOM 5014 C CD1 . PHE F 1 28  ? 25.691 -43.174  30.232 1.00 24.46  ? 28  PHE C CD1 1 
ATOM 5015 C CD2 . PHE F 1 28  ? 23.703 -42.618  31.422 1.00 24.92  ? 28  PHE C CD2 1 
ATOM 5016 C CE1 . PHE F 1 28  ? 26.434 -42.415  31.111 1.00 24.98  ? 28  PHE C CE1 1 
ATOM 5017 C CE2 . PHE F 1 28  ? 24.439 -41.857  32.305 1.00 26.01  ? 28  PHE C CE2 1 
ATOM 5018 C CZ  . PHE F 1 28  ? 25.807 -41.757  32.150 1.00 27.84  ? 28  PHE C CZ  1 
ATOM 5019 N N   . GLN F 1 29  ? 22.622 -45.780  26.979 1.00 31.50  ? 29  GLN C N   1 
ATOM 5020 C CA  . GLN F 1 29  ? 21.780 -46.757  26.301 1.00 37.98  ? 29  GLN C CA  1 
ATOM 5021 C C   . GLN F 1 29  ? 22.620 -47.873  25.689 1.00 42.79  ? 29  GLN C C   1 
ATOM 5022 O O   . GLN F 1 29  ? 22.337 -49.068  25.875 1.00 36.62  ? 29  GLN C O   1 
ATOM 5023 C CB  . GLN F 1 29  ? 20.965 -46.037  25.228 1.00 33.27  ? 29  GLN C CB  1 
ATOM 5024 C CG  . GLN F 1 29  ? 19.722 -46.746  24.760 1.00 38.22  ? 29  GLN C CG  1 
ATOM 5025 C CD  . GLN F 1 29  ? 19.160 -46.114  23.508 1.00 42.87  ? 29  GLN C CD  1 
ATOM 5026 O OE1 . GLN F 1 29  ? 19.909 -45.669  22.638 1.00 48.24  ? 29  GLN C OE1 1 
ATOM 5027 N NE2 . GLN F 1 29  ? 17.839 -46.044  23.420 1.00 43.89  ? 29  GLN C NE2 1 
ATOM 5028 N N   . ASP F 1 30  ? 23.680 -47.493  24.966 1.00 43.00  ? 30  ASP C N   1 
ATOM 5029 C CA  . ASP F 1 30  ? 24.554 -48.491  24.360 1.00 42.29  ? 30  ASP C CA  1 
ATOM 5030 C C   . ASP F 1 30  ? 25.132 -49.433  25.407 1.00 43.82  ? 30  ASP C C   1 
ATOM 5031 O O   . ASP F 1 30  ? 25.208 -50.645  25.179 1.00 48.34  ? 30  ASP C O   1 
ATOM 5032 C CB  . ASP F 1 30  ? 25.675 -47.814  23.573 1.00 38.69  ? 30  ASP C CB  1 
ATOM 5033 C CG  . ASP F 1 30  ? 25.201 -47.266  22.243 1.00 49.63  ? 30  ASP C CG  1 
ATOM 5034 O OD1 . ASP F 1 30  ? 23.971 -47.187  22.032 1.00 52.07  ? 30  ASP C OD1 1 
ATOM 5035 O OD2 . ASP F 1 30  ? 26.061 -46.938  21.398 1.00 56.27  ? 30  ASP C OD2 1 
ATOM 5036 N N   . TYR F 1 31  ? 25.533 -48.904  26.566 1.00 43.66  ? 31  TYR C N   1 
ATOM 5037 C CA  . TYR F 1 31  ? 26.112 -49.779  27.582 1.00 44.72  ? 31  TYR C CA  1 
ATOM 5038 C C   . TYR F 1 31  ? 25.068 -50.724  28.164 1.00 43.27  ? 31  TYR C C   1 
ATOM 5039 O O   . TYR F 1 31  ? 25.350 -51.908  28.388 1.00 49.94  ? 31  TYR C O   1 
ATOM 5040 C CB  . TYR F 1 31  ? 26.782 -48.956  28.685 1.00 46.85  ? 31  TYR C CB  1 
ATOM 5041 C CG  . TYR F 1 31  ? 28.125 -48.391  28.276 1.00 43.77  ? 31  TYR C CG  1 
ATOM 5042 C CD1 . TYR F 1 31  ? 29.014 -49.149  27.524 1.00 50.07  ? 31  TYR C CD1 1 
ATOM 5043 C CD2 . TYR F 1 31  ? 28.521 -47.123  28.670 1.00 37.91  ? 31  TYR C CD2 1 
ATOM 5044 C CE1 . TYR F 1 31  ? 30.244 -48.647  27.148 1.00 49.58  ? 31  TYR C CE1 1 
ATOM 5045 C CE2 . TYR F 1 31  ? 29.754 -46.616  28.303 1.00 39.59  ? 31  TYR C CE2 1 
ATOM 5046 C CZ  . TYR F 1 31  ? 30.611 -47.382  27.543 1.00 43.86  ? 31  TYR C CZ  1 
ATOM 5047 O OH  . TYR F 1 31  ? 31.840 -46.886  27.172 1.00 50.19  ? 31  TYR C OH  1 
ATOM 5048 N N   . LEU F 1 32  ? 23.854 -50.227  28.408 1.00 41.93  ? 32  LEU C N   1 
ATOM 5049 C CA  . LEU F 1 32  ? 22.786 -51.099  28.890 1.00 41.99  ? 32  LEU C CA  1 
ATOM 5050 C C   . LEU F 1 32  ? 22.544 -52.262  27.930 1.00 41.96  ? 32  LEU C C   1 
ATOM 5051 O O   . LEU F 1 32  ? 22.530 -53.432  28.340 1.00 41.78  ? 32  LEU C O   1 
ATOM 5052 C CB  . LEU F 1 32  ? 21.515 -50.280  29.108 1.00 40.70  ? 32  LEU C CB  1 
ATOM 5053 C CG  . LEU F 1 32  ? 20.312 -50.982  29.726 1.00 35.60  ? 32  LEU C CG  1 
ATOM 5054 C CD1 . LEU F 1 32  ? 19.612 -50.062  30.702 1.00 35.94  ? 32  LEU C CD1 1 
ATOM 5055 C CD2 . LEU F 1 32  ? 19.366 -51.368  28.620 1.00 34.01  ? 32  LEU C CD2 1 
ATOM 5056 N N   . PHE F 1 33  ? 22.372 -51.963  26.637 1.00 44.92  ? 33  PHE C N   1 
ATOM 5057 C CA  . PHE F 1 33  ? 22.194 -53.040  25.665 1.00 39.78  ? 33  PHE C CA  1 
ATOM 5058 C C   . PHE F 1 33  ? 23.425 -53.934  25.575 1.00 42.27  ? 33  PHE C C   1 
ATOM 5059 O O   . PHE F 1 33  ? 23.303 -55.127  25.269 1.00 47.82  ? 33  PHE C O   1 
ATOM 5060 C CB  . PHE F 1 33  ? 21.847 -52.464  24.295 1.00 38.91  ? 33  PHE C CB  1 
ATOM 5061 C CG  . PHE F 1 33  ? 20.414 -52.051  24.165 1.00 38.57  ? 33  PHE C CG  1 
ATOM 5062 C CD1 . PHE F 1 33  ? 19.953 -50.895  24.769 1.00 40.04  ? 33  PHE C CD1 1 
ATOM 5063 C CD2 . PHE F 1 33  ? 19.526 -52.816  23.431 1.00 42.85  ? 33  PHE C CD2 1 
ATOM 5064 C CE1 . PHE F 1 33  ? 18.631 -50.514  24.649 1.00 42.46  ? 33  PHE C CE1 1 
ATOM 5065 C CE2 . PHE F 1 33  ? 18.204 -52.440  23.304 1.00 50.74  ? 33  PHE C CE2 1 
ATOM 5066 C CZ  . PHE F 1 33  ? 17.755 -51.286  23.915 1.00 48.64  ? 33  PHE C CZ  1 
ATOM 5067 N N   . GLU F 1 34  ? 24.613 -53.387  25.846 1.00 43.98  ? 34  GLU C N   1 
ATOM 5068 C CA  . GLU F 1 34  ? 25.813 -54.217  25.884 1.00 45.01  ? 34  GLU C CA  1 
ATOM 5069 C C   . GLU F 1 34  ? 25.703 -55.272  26.972 1.00 47.96  ? 34  GLU C C   1 
ATOM 5070 O O   . GLU F 1 34  ? 25.901 -56.465  26.718 1.00 54.27  ? 34  GLU C O   1 
ATOM 5071 C CB  . GLU F 1 34  ? 27.062 -53.362  26.112 1.00 47.93  ? 34  GLU C CB  1 
ATOM 5072 C CG  . GLU F 1 34  ? 27.615 -52.653  24.887 1.00 56.96  ? 34  GLU C CG  1 
ATOM 5073 C CD  . GLU F 1 34  ? 28.985 -52.043  25.146 1.00 57.56  ? 34  GLU C CD  1 
ATOM 5074 O OE1 . GLU F 1 34  ? 29.586 -52.353  26.199 1.00 47.96  ? 34  GLU C OE1 1 
ATOM 5075 O OE2 . GLU F 1 34  ? 29.460 -51.253  24.301 1.00 63.95  ? 34  GLU C OE2 1 
ATOM 5076 N N   . VAL F 1 35  ? 25.385 -54.851  28.199 1.00 51.04  ? 35  VAL C N   1 
ATOM 5077 C CA  . VAL F 1 35  ? 25.338 -55.818  29.291 1.00 51.98  ? 35  VAL C CA  1 
ATOM 5078 C C   . VAL F 1 35  ? 24.176 -56.787  29.112 1.00 48.58  ? 35  VAL C C   1 
ATOM 5079 O O   . VAL F 1 35  ? 24.257 -57.942  29.547 1.00 51.88  ? 35  VAL C O   1 
ATOM 5080 C CB  . VAL F 1 35  ? 25.274 -55.111  30.657 1.00 55.72  ? 35  VAL C CB  1 
ATOM 5081 C CG1 . VAL F 1 35  ? 25.742 -56.058  31.740 1.00 52.31  ? 35  VAL C CG1 1 
ATOM 5082 C CG2 . VAL F 1 35  ? 26.128 -53.855  30.661 1.00 47.18  ? 35  VAL C CG2 1 
ATOM 5083 N N   . MET F 1 36  ? 23.083 -56.354  28.475 1.00 48.26  ? 36  MET C N   1 
ATOM 5084 C CA  . MET F 1 36  ? 21.990 -57.291  28.216 1.00 48.42  ? 36  MET C CA  1 
ATOM 5085 C C   . MET F 1 36  ? 22.390 -58.343  27.187 1.00 48.00  ? 36  MET C C   1 
ATOM 5086 O O   . MET F 1 36  ? 22.077 -59.532  27.347 1.00 47.98  ? 36  MET C O   1 
ATOM 5087 C CB  . MET F 1 36  ? 20.744 -56.537  27.763 1.00 47.03  ? 36  MET C CB  1 
ATOM 5088 C CG  . MET F 1 36  ? 19.992 -55.858  28.890 1.00 47.57  ? 36  MET C CG  1 
ATOM 5089 S SD  . MET F 1 36  ? 18.874 -56.985  29.752 1.00 76.25  ? 36  MET C SD  1 
ATOM 5090 C CE  . MET F 1 36  ? 19.876 -57.509  31.139 1.00 40.52  ? 36  MET C CE  1 
ATOM 5091 N N   . GLN F 1 37  ? 23.078 -57.930  26.122 1.00 49.57  ? 37  GLN C N   1 
ATOM 5092 C CA  . GLN F 1 37  ? 23.658 -58.915  25.217 1.00 52.19  ? 37  GLN C CA  1 
ATOM 5093 C C   . GLN F 1 37  ? 24.609 -59.842  25.960 1.00 53.91  ? 37  GLN C C   1 
ATOM 5094 O O   . GLN F 1 37  ? 24.663 -61.045  25.679 1.00 58.53  ? 37  GLN C O   1 
ATOM 5095 C CB  . GLN F 1 37  ? 24.373 -58.221  24.062 1.00 61.67  ? 37  GLN C CB  1 
ATOM 5096 C CG  . GLN F 1 37  ? 23.475 -57.943  22.877 1.00 69.77  ? 37  GLN C CG  1 
ATOM 5097 C CD  . GLN F 1 37  ? 23.438 -59.115  21.915 1.00 81.23  ? 37  GLN C CD  1 
ATOM 5098 O OE1 . GLN F 1 37  ? 24.417 -59.852  21.780 1.00 75.78  ? 37  GLN C OE1 1 
ATOM 5099 N NE2 . GLN F 1 37  ? 22.305 -59.299  21.249 1.00 80.79  ? 37  GLN C NE2 1 
ATOM 5100 N N   . ALA F 1 38  ? 25.370 -59.297  26.912 1.00 51.86  ? 38  ALA C N   1 
ATOM 5101 C CA  . ALA F 1 38  ? 26.302 -60.112  27.683 1.00 51.61  ? 38  ALA C CA  1 
ATOM 5102 C C   . ALA F 1 38  ? 25.572 -61.192  28.471 1.00 50.14  ? 38  ALA C C   1 
ATOM 5103 O O   . ALA F 1 38  ? 25.949 -62.367  28.424 1.00 49.82  ? 38  ALA C O   1 
ATOM 5104 C CB  . ALA F 1 38  ? 27.124 -59.224  28.616 1.00 58.45  ? 38  ALA C CB  1 
ATOM 5105 N N   . VAL F 1 39  ? 24.515 -60.817  29.197 1.00 51.76  ? 39  VAL C N   1 
ATOM 5106 C CA  . VAL F 1 39  ? 23.821 -61.801  30.021 1.00 48.40  ? 39  VAL C CA  1 
ATOM 5107 C C   . VAL F 1 39  ? 23.113 -62.830  29.146 1.00 49.04  ? 39  VAL C C   1 
ATOM 5108 O O   . VAL F 1 39  ? 23.120 -64.028  29.455 1.00 50.75  ? 39  VAL C O   1 
ATOM 5109 C CB  . VAL F 1 39  ? 22.851 -61.110  31.001 1.00 47.15  ? 39  VAL C CB  1 
ATOM 5110 C CG1 . VAL F 1 39  ? 21.855 -60.261  30.265 1.00 49.60  ? 39  VAL C CG1 1 
ATOM 5111 C CG2 . VAL F 1 39  ? 22.115 -62.136  31.844 1.00 45.95  ? 39  VAL C CG2 1 
ATOM 5112 N N   . GLU F 1 40  ? 22.527 -62.400  28.024 1.00 48.82  ? 40  GLU C N   1 
ATOM 5113 C CA  . GLU F 1 40  ? 21.872 -63.375  27.157 1.00 49.09  ? 40  GLU C CA  1 
ATOM 5114 C C   . GLU F 1 40  ? 22.882 -64.354  26.570 1.00 50.04  ? 40  GLU C C   1 
ATOM 5115 O O   . GLU F 1 40  ? 22.675 -65.573  26.611 1.00 49.97  ? 40  GLU C O   1 
ATOM 5116 C CB  . GLU F 1 40  ? 21.092 -62.688  26.042 1.00 46.46  ? 40  GLU C CB  1 
ATOM 5117 C CG  . GLU F 1 40  ? 20.401 -63.703  25.144 1.00 48.72  ? 40  GLU C CG  1 
ATOM 5118 C CD  . GLU F 1 40  ? 19.612 -63.074  24.021 1.00 59.36  ? 40  GLU C CD  1 
ATOM 5119 O OE1 . GLU F 1 40  ? 20.162 -62.939  22.907 1.00 69.35  ? 40  GLU C OE1 1 
ATOM 5120 O OE2 . GLU F 1 40  ? 18.436 -62.723  24.250 1.00 57.71  ? 40  GLU C OE2 1 
ATOM 5121 N N   . GLN F 1 41  ? 23.989 -63.842  26.030 1.00 52.08  ? 41  GLN C N   1 
ATOM 5122 C CA  . GLN F 1 41  ? 24.991 -64.718  25.437 1.00 55.25  ? 41  GLN C CA  1 
ATOM 5123 C C   . GLN F 1 41  ? 25.768 -65.514  26.474 1.00 57.16  ? 41  GLN C C   1 
ATOM 5124 O O   . GLN F 1 41  ? 26.478 -66.451  26.100 1.00 66.97  ? 41  GLN C O   1 
ATOM 5125 C CB  . GLN F 1 41  ? 25.963 -63.908  24.580 1.00 56.11  ? 41  GLN C CB  1 
ATOM 5126 C CG  . GLN F 1 41  ? 25.366 -63.422  23.278 1.00 61.94  ? 41  GLN C CG  1 
ATOM 5127 C CD  . GLN F 1 41  ? 25.349 -64.501  22.219 1.00 71.44  ? 41  GLN C CD  1 
ATOM 5128 O OE1 . GLN F 1 41  ? 26.381 -65.096  21.905 1.00 75.42  ? 41  GLN C OE1 1 
ATOM 5129 N NE2 . GLN F 1 41  ? 24.171 -64.766  21.664 1.00 75.33  ? 41  GLN C NE2 1 
ATOM 5130 N N   . VAL F 1 42  ? 25.666 -65.162  27.755 1.00 52.84  ? 42  VAL C N   1 
ATOM 5131 C CA  . VAL F 1 42  ? 26.251 -65.999  28.796 1.00 55.39  ? 42  VAL C CA  1 
ATOM 5132 C C   . VAL F 1 42  ? 25.284 -67.109  29.190 1.00 55.63  ? 42  VAL C C   1 
ATOM 5133 O O   . VAL F 1 42  ? 25.698 -68.238  29.477 1.00 57.01  ? 42  VAL C O   1 
ATOM 5134 C CB  . VAL F 1 42  ? 26.669 -65.140  30.005 1.00 57.10  ? 42  VAL C CB  1 
ATOM 5135 C CG1 . VAL F 1 42  ? 26.874 -66.004  31.234 1.00 49.42  ? 42  VAL C CG1 1 
ATOM 5136 C CG2 . VAL F 1 42  ? 27.948 -64.378  29.689 1.00 61.00  ? 42  VAL C CG2 1 
ATOM 5137 N N   . ILE F 1 43  ? 23.982 -66.817  29.191 1.00 54.57  ? 43  ILE C N   1 
ATOM 5138 C CA  . ILE F 1 43  ? 23.005 -67.848  29.528 1.00 54.51  ? 43  ILE C CA  1 
ATOM 5139 C C   . ILE F 1 43  ? 22.851 -68.855  28.394 1.00 59.17  ? 43  ILE C C   1 
ATOM 5140 O O   . ILE F 1 43  ? 22.600 -70.041  28.640 1.00 58.69  ? 43  ILE C O   1 
ATOM 5141 C CB  . ILE F 1 43  ? 21.660 -67.194  29.892 1.00 50.67  ? 43  ILE C CB  1 
ATOM 5142 C CG1 . ILE F 1 43  ? 21.826 -66.300  31.120 1.00 50.08  ? 43  ILE C CG1 1 
ATOM 5143 C CG2 . ILE F 1 43  ? 20.600 -68.247  30.156 1.00 49.33  ? 43  ILE C CG2 1 
ATOM 5144 C CD1 . ILE F 1 43  ? 20.624 -65.449  31.418 1.00 46.33  ? 43  ILE C CD1 1 
ATOM 5145 N N   . LEU F 1 44  ? 23.029 -68.422  27.143 1.00 63.02  ? 44  LEU C N   1 
ATOM 5146 C CA  . LEU F 1 44  ? 22.871 -69.344  26.021 1.00 57.31  ? 44  LEU C CA  1 
ATOM 5147 C C   . LEU F 1 44  ? 23.972 -70.397  25.998 1.00 64.93  ? 44  LEU C C   1 
ATOM 5148 O O   . LEU F 1 44  ? 23.708 -71.567  25.701 1.00 66.36  ? 44  LEU C O   1 
ATOM 5149 C CB  . LEU F 1 44  ? 22.840 -68.575  24.701 1.00 56.93  ? 44  LEU C CB  1 
ATOM 5150 C CG  . LEU F 1 44  ? 21.462 -68.104  24.234 1.00 56.87  ? 44  LEU C CG  1 
ATOM 5151 C CD1 . LEU F 1 44  ? 21.488 -67.733  22.760 1.00 64.21  ? 44  LEU C CD1 1 
ATOM 5152 C CD2 . LEU F 1 44  ? 20.414 -69.170  24.500 1.00 53.03  ? 44  LEU C CD2 1 
ATOM 5153 N N   . LYS F 1 45  ? 25.211 -70.007  26.309 1.00 69.90  ? 45  LYS C N   1 
ATOM 5154 C CA  . LYS F 1 45  ? 26.309 -70.969  26.270 1.00 68.81  ? 45  LYS C CA  1 
ATOM 5155 C C   . LYS F 1 45  ? 26.238 -71.944  27.438 1.00 72.56  ? 45  LYS C C   1 
ATOM 5156 O O   . LYS F 1 45  ? 26.473 -73.145  27.263 1.00 84.20  ? 45  LYS C O   1 
ATOM 5157 C CB  . LYS F 1 45  ? 27.656 -70.244  26.255 1.00 71.79  ? 45  LYS C CB  1 
ATOM 5158 C CG  . LYS F 1 45  ? 27.793 -69.174  25.177 1.00 85.03  ? 45  LYS C CG  1 
ATOM 5159 C CD  . LYS F 1 45  ? 27.291 -69.660  23.821 1.00 90.20  ? 45  LYS C CD  1 
ATOM 5160 C CE  . LYS F 1 45  ? 27.441 -68.581  22.755 1.00 98.27  ? 45  LYS C CE  1 
ATOM 5161 N NZ  . LYS F 1 45  ? 26.287 -68.556  21.810 1.00 95.91  ? 45  LYS C NZ  1 
ATOM 5162 N N   . LYS F 1 46  ? 25.913 -71.455  28.638 1.00 71.45  ? 46  LYS C N   1 
ATOM 5163 C CA  . LYS F 1 46  ? 25.728 -72.350  29.774 1.00 67.79  ? 46  LYS C CA  1 
ATOM 5164 C C   . LYS F 1 46  ? 24.471 -73.200  29.646 1.00 73.40  ? 46  LYS C C   1 
ATOM 5165 O O   . LYS F 1 46  ? 24.274 -74.113  30.455 1.00 74.34  ? 46  LYS C O   1 
ATOM 5166 C CB  . LYS F 1 46  ? 25.694 -71.551  31.078 1.00 66.52  ? 46  LYS C CB  1 
ATOM 5167 C CG  . LYS F 1 46  ? 27.063 -71.059  31.539 1.00 69.51  ? 46  LYS C CG  1 
ATOM 5168 C CD  . LYS F 1 46  ? 28.089 -72.186  31.562 1.00 66.56  ? 46  LYS C CD  1 
ATOM 5169 C CE  . LYS F 1 46  ? 29.463 -71.687  31.996 1.00 60.64  ? 46  LYS C CE  1 
ATOM 5170 N NZ  . LYS F 1 46  ? 30.513 -72.738  31.856 1.00 63.75  ? 46  LYS C NZ  1 
ATOM 5171 N N   . LEU F 1 47  ? 23.623 -72.921  28.656 1.00 79.23  ? 47  LEU C N   1 
ATOM 5172 C CA  . LEU F 1 47  ? 22.487 -73.771  28.330 1.00 78.21  ? 47  LEU C CA  1 
ATOM 5173 C C   . LEU F 1 47  ? 22.814 -74.839  27.296 1.00 77.87  ? 47  LEU C C   1 
ATOM 5174 O O   . LEU F 1 47  ? 22.063 -75.811  27.176 1.00 72.85  ? 47  LEU C O   1 
ATOM 5175 C CB  . LEU F 1 47  ? 21.313 -72.932  27.814 1.00 72.48  ? 47  LEU C CB  1 
ATOM 5176 C CG  . LEU F 1 47  ? 20.325 -72.390  28.845 1.00 72.11  ? 47  LEU C CG  1 
ATOM 5177 C CD1 . LEU F 1 47  ? 19.152 -71.736  28.141 1.00 73.45  ? 47  LEU C CD1 1 
ATOM 5178 C CD2 . LEU F 1 47  ? 19.841 -73.502  29.754 1.00 68.39  ? 47  LEU C CD2 1 
ATOM 5179 N N   . ASP F 1 48  ? 23.887 -74.674  26.522 1.00 82.65  ? 48  ASP C N   1 
ATOM 5180 C CA  . ASP F 1 48  ? 24.226 -75.708  25.551 1.00 82.45  ? 48  ASP C CA  1 
ATOM 5181 C C   . ASP F 1 48  ? 24.642 -77.004  26.232 1.00 76.13  ? 48  ASP C C   1 
ATOM 5182 O O   . ASP F 1 48  ? 24.486 -78.081  25.646 1.00 77.46  ? 48  ASP C O   1 
ATOM 5183 C CB  . ASP F 1 48  ? 25.350 -75.220  24.633 1.00 88.69  ? 48  ASP C CB  1 
ATOM 5184 C CG  . ASP F 1 48  ? 24.872 -74.925  23.223 1.00 91.75  ? 48  ASP C CG  1 
ATOM 5185 O OD1 . ASP F 1 48  ? 25.715 -74.588  22.364 1.00 93.19  ? 48  ASP C OD1 1 
ATOM 5186 O OD2 . ASP F 1 48  ? 23.655 -75.044  22.970 1.00 91.19  ? 48  ASP C OD2 1 
ATOM 5187 N N   . GLY F 1 49  ? 25.161 -76.924  27.456 1.00 70.55  ? 49  GLY C N   1 
ATOM 5188 C CA  . GLY F 1 49  ? 25.579 -78.110  28.174 1.00 80.96  ? 49  GLY C CA  1 
ATOM 5189 C C   . GLY F 1 49  ? 24.554 -78.738  29.095 1.00 84.03  ? 49  GLY C C   1 
ATOM 5190 O O   . GLY F 1 49  ? 24.928 -79.339  30.108 1.00 77.66  ? 49  GLY C O   1 
ATOM 5191 N N   . ILE F 1 50  ? 23.273 -78.627  28.773 1.00 88.38  ? 50  ILE C N   1 
ATOM 5192 C CA  . ILE F 1 50  ? 22.213 -79.265  29.548 1.00 84.80  ? 50  ILE C CA  1 
ATOM 5193 C C   . ILE F 1 50  ? 21.582 -80.352  28.682 1.00 90.75  ? 50  ILE C C   1 
ATOM 5194 O O   . ILE F 1 50  ? 21.292 -80.100  27.509 1.00 94.47  ? 50  ILE C O   1 
ATOM 5195 C CB  . ILE F 1 50  ? 21.156 -78.266  30.066 1.00 88.60  ? 50  ILE C CB  1 
ATOM 5196 C CG1 . ILE F 1 50  ? 20.400 -77.557  28.943 1.00 95.93  ? 50  ILE C CG1 1 
ATOM 5197 C CG2 . ILE F 1 50  ? 21.818 -77.237  30.976 1.00 79.01  ? 50  ILE C CG2 1 
ATOM 5198 C CD1 . ILE F 1 50  ? 19.025 -78.133  28.633 1.00 86.76  ? 50  ILE C CD1 1 
ATOM 5199 N N   . PRO F 1 51  ? 21.461 -81.564  29.186 1.00 96.34  ? 51  PRO C N   1 
ATOM 5200 C CA  . PRO F 1 51  ? 20.603 -82.565  28.547 1.00 94.97  ? 51  PRO C CA  1 
ATOM 5201 C C   . PRO F 1 51  ? 19.216 -82.531  29.161 1.00 104.76 ? 51  PRO C C   1 
ATOM 5202 O O   . PRO F 1 51  ? 18.878 -81.560  29.845 1.00 116.97 ? 51  PRO C O   1 
ATOM 5203 C CB  . PRO F 1 51  ? 21.327 -83.881  28.845 1.00 94.63  ? 51  PRO C CB  1 
ATOM 5204 C CG  . PRO F 1 51  ? 22.163 -83.594  30.090 1.00 86.29  ? 51  PRO C CG  1 
ATOM 5205 C CD  . PRO F 1 51  ? 22.169 -82.113  30.352 1.00 94.61  ? 51  PRO C CD  1 
ATOM 5206 N N   . ASP F 1 52  ? 18.400 -83.554  28.905 1.00 111.39 ? 52  ASP C N   1 
ATOM 5207 C CA  . ASP F 1 52  ? 17.053 -83.646  29.467 1.00 125.50 ? 52  ASP C CA  1 
ATOM 5208 C C   . ASP F 1 52  ? 16.197 -82.482  28.958 1.00 125.52 ? 52  ASP C C   1 
ATOM 5209 O O   . ASP F 1 52  ? 15.840 -81.565  29.702 1.00 121.65 ? 52  ASP C O   1 
ATOM 5210 C CB  . ASP F 1 52  ? 17.091 -83.685  31.004 1.00 125.85 ? 52  ASP C CB  1 
ATOM 5211 C CG  . ASP F 1 52  ? 16.985 -85.097  31.566 1.00 110.46 ? 52  ASP C CG  1 
ATOM 5212 O OD1 . ASP F 1 52  ? 17.920 -85.521  32.280 1.00 105.77 ? 52  ASP C OD1 1 
ATOM 5213 O OD2 . ASP F 1 52  ? 15.970 -85.778  31.306 1.00 106.48 ? 52  ASP C OD2 1 
ATOM 5214 N N   . CYS F 1 53  ? 15.918 -82.520  27.646 1.00 123.74 ? 53  CYS C N   1 
ATOM 5215 C CA  . CYS F 1 53  ? 15.082 -81.542  26.950 1.00 123.15 ? 53  CYS C CA  1 
ATOM 5216 C C   . CYS F 1 53  ? 15.805 -80.218  26.710 1.00 114.86 ? 53  CYS C C   1 
ATOM 5217 O O   . CYS F 1 53  ? 16.928 -80.016  27.185 1.00 109.12 ? 53  CYS C O   1 
ATOM 5218 C CB  . CYS F 1 53  ? 13.769 -81.312  27.708 1.00 130.91 ? 53  CYS C CB  1 
ATOM 5219 S SG  . CYS F 1 53  ? 12.976 -79.715  27.410 1.00 128.81 ? 53  CYS C SG  1 
ATOM 5220 N N   . ASP F 1 54  ? 15.168 -79.316  25.959 1.00 112.74 ? 54  ASP C N   1 
ATOM 5221 C CA  . ASP F 1 54  ? 15.724 -78.017  25.600 1.00 106.43 ? 54  ASP C CA  1 
ATOM 5222 C C   . ASP F 1 54  ? 14.819 -76.933  26.165 1.00 100.73 ? 54  ASP C C   1 
ATOM 5223 O O   . ASP F 1 54  ? 13.593 -77.009  26.046 1.00 95.82  ? 54  ASP C O   1 
ATOM 5224 C CB  . ASP F 1 54  ? 15.827 -77.864  24.068 1.00 106.05 ? 54  ASP C CB  1 
ATOM 5225 C CG  . ASP F 1 54  ? 17.110 -77.179  23.622 1.00 97.11  ? 54  ASP C CG  1 
ATOM 5226 O OD1 . ASP F 1 54  ? 17.847 -76.662  24.484 1.00 100.40 ? 54  ASP C OD1 1 
ATOM 5227 O OD2 . ASP F 1 54  ? 17.376 -77.155  22.398 1.00 82.26  ? 54  ASP C OD2 1 
ATOM 5228 N N   . ILE F 1 55  ? 15.432 -75.906  26.750 1.00 96.70  ? 55  ILE C N   1 
ATOM 5229 C CA  . ILE F 1 55  ? 14.683 -74.827  27.386 1.00 94.07  ? 55  ILE C CA  1 
ATOM 5230 C C   . ILE F 1 55  ? 15.140 -73.478  26.842 1.00 94.23  ? 55  ILE C C   1 
ATOM 5231 O O   . ILE F 1 55  ? 15.583 -72.606  27.599 1.00 93.30  ? 55  ILE C O   1 
ATOM 5232 C CB  . ILE F 1 55  ? 14.832 -74.906  28.917 1.00 95.23  ? 55  ILE C CB  1 
ATOM 5233 C CG1 . ILE F 1 55  ? 16.284 -75.218  29.294 1.00 88.91  ? 55  ILE C CG1 1 
ATOM 5234 C CG2 . ILE F 1 55  ? 13.898 -75.968  29.485 1.00 94.38  ? 55  ILE C CG2 1 
ATOM 5235 C CD1 . ILE F 1 55  ? 16.522 -75.309  30.782 1.00 79.19  ? 55  ILE C CD1 1 
ATOM 5236 N N   . SER F 1 56  ? 14.993 -73.292  25.530 1.00 90.75  ? 56  SER C N   1 
ATOM 5237 C CA  . SER F 1 56  ? 15.622 -72.194  24.796 1.00 80.78  ? 56  SER C CA  1 
ATOM 5238 C C   . SER F 1 56  ? 15.214 -72.302  23.315 1.00 72.15  ? 56  SER C C   1 
ATOM 5239 O O   . SER F 1 56  ? 14.390 -73.149  22.977 1.00 76.72  ? 56  SER C O   1 
ATOM 5240 C CB  . SER F 1 56  ? 17.145 -72.262  24.977 1.00 81.88  ? 56  SER C CB  1 
ATOM 5241 O OG  . SER F 1 56  ? 17.629 -73.575  24.755 1.00 99.03  ? 56  SER C OG  1 
ATOM 5242 N N   . PRO F 1 57  ? 15.753 -71.441  22.425 1.00 74.84  ? 57  PRO C N   1 
ATOM 5243 C CA  . PRO F 1 57  ? 16.494 -70.178  22.558 1.00 72.54  ? 57  PRO C CA  1 
ATOM 5244 C C   . PRO F 1 57  ? 15.748 -68.969  22.008 1.00 72.74  ? 57  PRO C C   1 
ATOM 5245 O O   . PRO F 1 57  ? 15.989 -67.844  22.441 1.00 66.58  ? 57  PRO C O   1 
ATOM 5246 C CB  . PRO F 1 57  ? 17.751 -70.441  21.736 1.00 66.69  ? 57  PRO C CB  1 
ATOM 5247 C CG  . PRO F 1 57  ? 17.262 -71.314  20.620 1.00 78.96  ? 57  PRO C CG  1 
ATOM 5248 C CD  . PRO F 1 57  ? 16.051 -72.083  21.131 1.00 83.26  ? 57  PRO C CD  1 
ATOM 5249 N N   . VAL F 1 58  ? 14.868 -69.203  21.033 1.00 78.86  ? 58  VAL C N   1 
ATOM 5250 C CA  . VAL F 1 58  ? 14.099 -68.112  20.448 1.00 78.41  ? 58  VAL C CA  1 
ATOM 5251 C C   . VAL F 1 58  ? 13.211 -67.469  21.503 1.00 74.44  ? 58  VAL C C   1 
ATOM 5252 O O   . VAL F 1 58  ? 12.877 -66.281  21.408 1.00 80.67  ? 58  VAL C O   1 
ATOM 5253 C CB  . VAL F 1 58  ? 13.291 -68.633  19.241 1.00 81.89  ? 58  VAL C CB  1 
ATOM 5254 C CG1 . VAL F 1 58  ? 12.340 -69.745  19.668 1.00 80.56  ? 58  VAL C CG1 1 
ATOM 5255 C CG2 . VAL F 1 58  ? 12.548 -67.498  18.543 1.00 88.16  ? 58  VAL C CG2 1 
ATOM 5256 N N   . GLN F 1 59  ? 12.841 -68.225  22.537 1.00 73.66  ? 59  GLN C N   1 
ATOM 5257 C CA  . GLN F 1 59  ? 12.019 -67.689  23.613 1.00 72.19  ? 59  GLN C CA  1 
ATOM 5258 C C   . GLN F 1 59  ? 12.844 -67.042  24.715 1.00 70.64  ? 59  GLN C C   1 
ATOM 5259 O O   . GLN F 1 59  ? 12.364 -66.102  25.361 1.00 73.66  ? 59  GLN C O   1 
ATOM 5260 C CB  . GLN F 1 59  ? 11.138 -68.790  24.208 1.00 81.63  ? 59  GLN C CB  1 
ATOM 5261 C CG  . GLN F 1 59  ? 9.894  -69.102  23.382 1.00 94.02  ? 59  GLN C CG  1 
ATOM 5262 C CD  . GLN F 1 59  ? 8.916  -67.938  23.306 1.00 91.23  ? 59  GLN C CD  1 
ATOM 5263 O OE1 . GLN F 1 59  ? 9.026  -66.962  24.050 1.00 87.38  ? 59  GLN C OE1 1 
ATOM 5264 N NE2 . GLN F 1 59  ? 7.950  -68.039  22.398 1.00 91.19  ? 59  GLN C NE2 1 
ATOM 5265 N N   . ILE F 1 60  ? 14.071 -67.517  24.952 1.00 62.55  ? 60  ILE C N   1 
ATOM 5266 C CA  . ILE F 1 60  ? 14.935 -66.826  25.904 1.00 64.33  ? 60  ILE C CA  1 
ATOM 5267 C C   . ILE F 1 60  ? 15.273 -65.435  25.382 1.00 63.97  ? 60  ILE C C   1 
ATOM 5268 O O   . ILE F 1 60  ? 15.473 -64.493  26.165 1.00 61.09  ? 60  ILE C O   1 
ATOM 5269 C CB  . ILE F 1 60  ? 16.194 -67.669  26.203 1.00 55.46  ? 60  ILE C CB  1 
ATOM 5270 C CG1 . ILE F 1 60  ? 16.710 -67.377  27.609 1.00 54.69  ? 60  ILE C CG1 1 
ATOM 5271 C CG2 . ILE F 1 60  ? 17.302 -67.394  25.209 1.00 60.30  ? 60  ILE C CG2 1 
ATOM 5272 C CD1 . ILE F 1 60  ? 17.747 -68.356  28.073 1.00 50.10  ? 60  ILE C CD1 1 
ATOM 5273 N N   . ARG F 1 61  ? 15.309 -65.273  24.055 1.00 67.72  ? 61  ARG C N   1 
ATOM 5274 C CA  . ARG F 1 61  ? 15.483 -63.950  23.470 1.00 64.59  ? 61  ARG C CA  1 
ATOM 5275 C C   . ARG F 1 61  ? 14.320 -63.039  23.838 1.00 58.58  ? 61  ARG C C   1 
ATOM 5276 O O   . ARG F 1 61  ? 14.523 -61.896  24.258 1.00 62.04  ? 61  ARG C O   1 
ATOM 5277 C CB  . ARG F 1 61  ? 15.646 -64.050  21.951 1.00 66.68  ? 61  ARG C CB  1 
ATOM 5278 C CG  . ARG F 1 61  ? 15.536 -62.705  21.230 1.00 63.04  ? 61  ARG C CG  1 
ATOM 5279 C CD  . ARG F 1 61  ? 16.611 -61.717  21.675 1.00 51.66  ? 61  ARG C CD  1 
ATOM 5280 N NE  . ARG F 1 61  ? 17.945 -62.030  21.173 1.00 47.33  ? 61  ARG C NE  1 
ATOM 5281 C CZ  . ARG F 1 61  ? 18.429 -61.585  20.019 1.00 57.28  ? 61  ARG C CZ  1 
ATOM 5282 N NH1 . ARG F 1 61  ? 19.658 -61.913  19.641 1.00 62.04  ? 61  ARG C NH1 1 
ATOM 5283 N NH2 . ARG F 1 61  ? 17.684 -60.809  19.242 1.00 66.60  ? 61  ARG C NH2 1 
ATOM 5284 N N   . LYS F 1 62  ? 13.088 -63.533  23.698 1.00 56.55  ? 62  LYS C N   1 
ATOM 5285 C CA  . LYS F 1 62  ? 11.937 -62.724  24.074 1.00 63.90  ? 62  LYS C CA  1 
ATOM 5286 C C   . LYS F 1 62  ? 11.875 -62.490  25.579 1.00 57.33  ? 62  LYS C C   1 
ATOM 5287 O O   . LYS F 1 62  ? 11.279 -61.499  26.021 1.00 53.89  ? 62  LYS C O   1 
ATOM 5288 C CB  . LYS F 1 62  ? 10.653 -63.396  23.585 1.00 69.30  ? 62  LYS C CB  1 
ATOM 5289 C CG  . LYS F 1 62  ? 9.523  -62.435  23.258 1.00 69.17  ? 62  LYS C CG  1 
ATOM 5290 C CD  . LYS F 1 62  ? 9.839  -61.637  22.000 1.00 60.09  ? 62  LYS C CD  1 
ATOM 5291 C CE  . LYS F 1 62  ? 8.615  -60.897  21.487 1.00 63.08  ? 62  LYS C CE  1 
ATOM 5292 N NZ  . LYS F 1 62  ? 7.528  -61.836  21.084 1.00 63.77  ? 62  LYS C NZ  1 
ATOM 5293 N N   . CYS F 1 63  ? 12.489 -63.373  26.370 1.00 52.75  ? 63  CYS C N   1 
ATOM 5294 C CA  . CYS F 1 63  ? 12.662 -63.115  27.796 1.00 54.59  ? 63  CYS C CA  1 
ATOM 5295 C C   . CYS F 1 63  ? 13.555 -61.895  28.025 1.00 55.92  ? 63  CYS C C   1 
ATOM 5296 O O   . CYS F 1 63  ? 13.177 -60.950  28.740 1.00 58.00  ? 63  CYS C O   1 
ATOM 5297 C CB  . CYS F 1 63  ? 13.239 -64.363  28.468 1.00 56.49  ? 63  CYS C CB  1 
ATOM 5298 S SG  . CYS F 1 63  ? 13.354 -64.310  30.260 1.00 57.64  ? 63  CYS C SG  1 
ATOM 5299 N N   . THR F 1 64  ? 14.743 -61.892  27.403 1.00 56.49  ? 64  THR C N   1 
ATOM 5300 C CA  . THR F 1 64  ? 15.603 -60.710  27.455 1.00 49.93  ? 64  THR C CA  1 
ATOM 5301 C C   . THR F 1 64  ? 14.871 -59.469  26.969 1.00 45.03  ? 64  THR C C   1 
ATOM 5302 O O   . THR F 1 64  ? 15.097 -58.370  27.479 1.00 44.67  ? 64  THR C O   1 
ATOM 5303 C CB  . THR F 1 64  ? 16.862 -60.910  26.609 1.00 51.06  ? 64  THR C CB  1 
ATOM 5304 O OG1 . THR F 1 64  ? 16.523 -61.595  25.399 1.00 61.30  ? 64  THR C OG1 1 
ATOM 5305 C CG2 . THR F 1 64  ? 17.909 -61.687  27.354 1.00 45.79  ? 64  THR C CG2 1 
ATOM 5306 N N   . GLU F 1 65  ? 14.008 -59.623  25.964 1.00 47.63  ? 65  GLU C N   1 
ATOM 5307 C CA  . GLU F 1 65  ? 13.241 -58.488  25.465 1.00 44.12  ? 65  GLU C CA  1 
ATOM 5308 C C   . GLU F 1 65  ? 12.254 -57.986  26.510 1.00 42.56  ? 65  GLU C C   1 
ATOM 5309 O O   . GLU F 1 65  ? 12.004 -56.779  26.604 1.00 49.37  ? 65  GLU C O   1 
ATOM 5310 C CB  . GLU F 1 65  ? 12.522 -58.869  24.172 1.00 44.13  ? 65  GLU C CB  1 
ATOM 5311 C CG  . GLU F 1 65  ? 13.458 -59.065  22.991 1.00 48.69  ? 65  GLU C CG  1 
ATOM 5312 C CD  . GLU F 1 65  ? 12.722 -59.410  21.714 1.00 65.35  ? 65  GLU C CD  1 
ATOM 5313 O OE1 . GLU F 1 65  ? 13.159 -60.343  21.005 1.00 73.49  ? 65  GLU C OE1 1 
ATOM 5314 O OE2 . GLU F 1 65  ? 11.697 -58.757  21.424 1.00 68.29  ? 65  GLU C OE2 1 
ATOM 5315 N N   . LYS F 1 66  ? 11.682 -58.893  27.302 1.00 38.51  ? 66  LYS C N   1 
ATOM 5316 C CA  . LYS F 1 66  ? 10.784 -58.483  28.377 1.00 40.50  ? 66  LYS C CA  1 
ATOM 5317 C C   . LYS F 1 66  ? 11.532 -57.660  29.422 1.00 43.46  ? 66  LYS C C   1 
ATOM 5318 O O   . LYS F 1 66  ? 11.185 -56.497  29.707 1.00 41.92  ? 66  LYS C O   1 
ATOM 5319 C CB  . LYS F 1 66  ? 10.157 -59.727  29.008 1.00 39.53  ? 66  LYS C CB  1 
ATOM 5320 C CG  . LYS F 1 66  ? 9.153  -59.460  30.107 1.00 42.53  ? 66  LYS C CG  1 
ATOM 5321 C CD  . LYS F 1 66  ? 7.861  -58.899  29.549 1.00 46.49  ? 66  LYS C CD  1 
ATOM 5322 C CE  . LYS F 1 66  ? 6.679  -59.329  30.399 1.00 51.31  ? 66  LYS C CE  1 
ATOM 5323 N NZ  . LYS F 1 66  ? 6.993  -59.239  31.855 1.00 53.92  ? 66  LYS C NZ  1 
ATOM 5324 N N   . PHE F 1 67  ? 12.589 -58.252  29.991 1.00 39.18  ? 67  PHE C N   1 
ATOM 5325 C CA  . PHE F 1 67  ? 13.377 -57.540  30.992 1.00 40.70  ? 67  PHE C CA  1 
ATOM 5326 C C   . PHE F 1 67  ? 13.944 -56.242  30.428 1.00 43.91  ? 67  PHE C C   1 
ATOM 5327 O O   . PHE F 1 67  ? 14.112 -55.258  31.161 1.00 44.90  ? 67  PHE C O   1 
ATOM 5328 C CB  . PHE F 1 67  ? 14.500 -58.442  31.503 1.00 39.66  ? 67  PHE C CB  1 
ATOM 5329 C CG  . PHE F 1 67  ? 15.224 -57.898  32.700 1.00 36.75  ? 67  PHE C CG  1 
ATOM 5330 C CD1 . PHE F 1 67  ? 14.555 -57.690  33.894 1.00 33.53  ? 67  PHE C CD1 1 
ATOM 5331 C CD2 . PHE F 1 67  ? 16.575 -57.601  32.633 1.00 39.70  ? 67  PHE C CD2 1 
ATOM 5332 C CE1 . PHE F 1 67  ? 15.220 -57.195  34.999 1.00 37.48  ? 67  PHE C CE1 1 
ATOM 5333 C CE2 . PHE F 1 67  ? 17.246 -57.103  33.735 1.00 40.29  ? 67  PHE C CE2 1 
ATOM 5334 C CZ  . PHE F 1 67  ? 16.568 -56.900  34.919 1.00 39.79  ? 67  PHE C CZ  1 
ATOM 5335 N N   . LEU F 1 68  ? 14.217 -56.215  29.124 1.00 45.08  ? 68  LEU C N   1 
ATOM 5336 C CA  . LEU F 1 68  ? 14.795 -55.042  28.483 1.00 38.35  ? 68  LEU C CA  1 
ATOM 5337 C C   . LEU F 1 68  ? 13.769 -53.936  28.284 1.00 39.17  ? 68  LEU C C   1 
ATOM 5338 O O   . LEU F 1 68  ? 14.111 -52.756  28.384 1.00 41.31  ? 68  LEU C O   1 
ATOM 5339 C CB  . LEU F 1 68  ? 15.413 -55.432  27.141 1.00 39.44  ? 68  LEU C CB  1 
ATOM 5340 C CG  . LEU F 1 68  ? 16.928 -55.276  27.072 1.00 30.93  ? 68  LEU C CG  1 
ATOM 5341 C CD1 . LEU F 1 68  ? 17.431 -55.401  25.646 1.00 31.91  ? 68  LEU C CD1 1 
ATOM 5342 C CD2 . LEU F 1 68  ? 17.299 -53.946  27.652 1.00 38.82  ? 68  LEU C CD2 1 
ATOM 5343 N N   . CYS F 1 69  ? 12.518 -54.283  27.976 1.00 36.98  ? 69  CYS C N   1 
ATOM 5344 C CA  . CYS F 1 69  ? 11.490 -53.252  27.880 1.00 39.64  ? 69  CYS C CA  1 
ATOM 5345 C C   . CYS F 1 69  ? 11.219 -52.628  29.240 1.00 46.24  ? 69  CYS C C   1 
ATOM 5346 O O   . CYS F 1 69  ? 11.075 -51.401  29.352 1.00 50.56  ? 69  CYS C O   1 
ATOM 5347 C CB  . CYS F 1 69  ? 10.208 -53.823  27.282 1.00 40.71  ? 69  CYS C CB  1 
ATOM 5348 S SG  . CYS F 1 69  ? 10.263 -53.968  25.488 1.00 67.65  ? 69  CYS C SG  1 
ATOM 5349 N N   . PHE F 1 70  ? 11.154 -53.455  30.288 1.00 49.30  ? 70  PHE C N   1 
ATOM 5350 C CA  . PHE F 1 70  ? 11.067 -52.900  31.638 1.00 48.43  ? 70  PHE C CA  1 
ATOM 5351 C C   . PHE F 1 70  ? 12.240 -51.956  31.911 1.00 43.72  ? 70  PHE C C   1 
ATOM 5352 O O   . PHE F 1 70  ? 12.056 -50.793  32.324 1.00 44.17  ? 70  PHE C O   1 
ATOM 5353 C CB  . PHE F 1 70  ? 11.026 -54.050  32.647 1.00 40.86  ? 70  PHE C CB  1 
ATOM 5354 C CG  . PHE F 1 70  ? 10.898 -53.610  34.070 1.00 38.31  ? 70  PHE C CG  1 
ATOM 5355 C CD1 . PHE F 1 70  ? 9.665  -53.257  34.589 1.00 41.34  ? 70  PHE C CD1 1 
ATOM 5356 C CD2 . PHE F 1 70  ? 12.007 -53.568  34.897 1.00 38.09  ? 70  PHE C CD2 1 
ATOM 5357 C CE1 . PHE F 1 70  ? 9.544  -52.857  35.905 1.00 51.97  ? 70  PHE C CE1 1 
ATOM 5358 C CE2 . PHE F 1 70  ? 11.895 -53.168  36.212 1.00 41.51  ? 70  PHE C CE2 1 
ATOM 5359 C CZ  . PHE F 1 70  ? 10.661 -52.813  36.719 1.00 49.41  ? 70  PHE C CZ  1 
ATOM 5360 N N   . MET F 1 71  ? 13.456 -52.436  31.630 1.00 38.15  ? 71  MET C N   1 
ATOM 5361 C CA  . MET F 1 71  ? 14.666 -51.651  31.845 1.00 41.09  ? 71  MET C CA  1 
ATOM 5362 C C   . MET F 1 71  ? 14.661 -50.347  31.058 1.00 47.54  ? 71  MET C C   1 
ATOM 5363 O O   . MET F 1 71  ? 15.229 -49.350  31.517 1.00 50.65  ? 71  MET C O   1 
ATOM 5364 C CB  . MET F 1 71  ? 15.889 -52.498  31.487 1.00 50.44  ? 71  MET C CB  1 
ATOM 5365 C CG  . MET F 1 71  ? 16.370 -53.423  32.609 1.00 43.19  ? 71  MET C CG  1 
ATOM 5366 S SD  . MET F 1 71  ? 16.834 -52.544  34.119 1.00 42.22  ? 71  MET C SD  1 
ATOM 5367 C CE  . MET F 1 71  ? 15.315 -52.556  35.056 1.00 38.85  ? 71  MET C CE  1 
ATOM 5368 N N   . LYS F 1 72  ? 14.041 -50.328  29.876 1.00 51.35  ? 72  LYS C N   1 
ATOM 5369 C CA  . LYS F 1 72  ? 13.987 -49.096  29.097 1.00 46.01  ? 72  LYS C CA  1 
ATOM 5370 C C   . LYS F 1 72  ? 12.943 -48.134  29.630 1.00 45.71  ? 72  LYS C C   1 
ATOM 5371 O O   . LYS F 1 72  ? 13.140 -46.915  29.558 1.00 50.57  ? 72  LYS C O   1 
ATOM 5372 C CB  . LYS F 1 72  ? 13.701 -49.391  27.626 1.00 45.16  ? 72  LYS C CB  1 
ATOM 5373 C CG  . LYS F 1 72  ? 14.911 -49.864  26.851 1.00 63.58  ? 72  LYS C CG  1 
ATOM 5374 C CD  . LYS F 1 72  ? 14.831 -49.432  25.398 1.00 65.96  ? 72  LYS C CD  1 
ATOM 5375 C CE  . LYS F 1 72  ? 14.488 -47.957  25.302 1.00 59.19  ? 72  LYS C CE  1 
ATOM 5376 N NZ  . LYS F 1 72  ? 15.363 -47.258  24.329 1.00 63.98  ? 72  LYS C NZ  1 
ATOM 5377 N N   . GLY F 1 73  ? 11.838 -48.648  30.164 1.00 41.97  ? 73  GLY C N   1 
ATOM 5378 C CA  . GLY F 1 73  ? 10.895 -47.765  30.813 1.00 43.79  ? 73  GLY C CA  1 
ATOM 5379 C C   . GLY F 1 73  ? 11.559 -47.005  31.942 1.00 40.79  ? 73  GLY C C   1 
ATOM 5380 O O   . GLY F 1 73  ? 11.669 -45.766  31.904 1.00 37.60  ? 73  GLY C O   1 
ATOM 5381 N N   . HIS F 1 74  ? 12.053 -47.745  32.939 1.00 41.88  ? 74  HIS C N   1 
ATOM 5382 C CA  . HIS F 1 74  ? 12.603 -47.061  34.107 1.00 36.76  ? 74  HIS C CA  1 
ATOM 5383 C C   . HIS F 1 74  ? 13.877 -46.299  33.762 1.00 36.54  ? 74  HIS C C   1 
ATOM 5384 O O   . HIS F 1 74  ? 14.095 -45.188  34.261 1.00 42.34  ? 74  HIS C O   1 
ATOM 5385 C CB  . HIS F 1 74  ? 12.838 -48.053  35.240 1.00 41.77  ? 74  HIS C CB  1 
ATOM 5386 C CG  . HIS F 1 74  ? 11.581 -48.464  35.939 1.00 45.21  ? 74  HIS C CG  1 
ATOM 5387 N ND1 . HIS F 1 74  ? 11.401 -48.316  37.297 1.00 52.27  ? 74  HIS C ND1 1 
ATOM 5388 C CD2 . HIS F 1 74  ? 10.431 -48.996  35.463 1.00 43.52  ? 74  HIS C CD2 1 
ATOM 5389 C CE1 . HIS F 1 74  ? 10.199 -48.752  37.630 1.00 48.90  ? 74  HIS C CE1 1 
ATOM 5390 N NE2 . HIS F 1 74  ? 9.590  -49.170  36.535 1.00 47.32  ? 74  HIS C NE2 1 
ATOM 5391 N N   . PHE F 1 75  ? 14.717 -46.864  32.894 1.00 34.27  ? 75  PHE C N   1 
ATOM 5392 C CA  . PHE F 1 75  ? 15.925 -46.160  32.476 1.00 35.25  ? 75  PHE C CA  1 
ATOM 5393 C C   . PHE F 1 75  ? 15.580 -44.827  31.834 1.00 41.19  ? 75  PHE C C   1 
ATOM 5394 O O   . PHE F 1 75  ? 16.199 -43.800  32.132 1.00 42.66  ? 75  PHE C O   1 
ATOM 5395 C CB  . PHE F 1 75  ? 16.729 -47.022  31.500 1.00 40.00  ? 75  PHE C CB  1 
ATOM 5396 C CG  . PHE F 1 75  ? 17.780 -46.258  30.728 1.00 39.66  ? 75  PHE C CG  1 
ATOM 5397 C CD1 . PHE F 1 75  ? 17.476 -45.661  29.510 1.00 42.21  ? 75  PHE C CD1 1 
ATOM 5398 C CD2 . PHE F 1 75  ? 19.076 -46.153  31.210 1.00 38.82  ? 75  PHE C CD2 1 
ATOM 5399 C CE1 . PHE F 1 75  ? 18.437 -44.963  28.800 1.00 42.09  ? 75  PHE C CE1 1 
ATOM 5400 C CE2 . PHE F 1 75  ? 20.045 -45.460  30.500 1.00 35.43  ? 75  PHE C CE2 1 
ATOM 5401 C CZ  . PHE F 1 75  ? 19.725 -44.865  29.294 1.00 40.45  ? 75  PHE C CZ  1 
ATOM 5402 N N   . ASP F 1 76  ? 14.592 -44.829  30.941 1.00 43.59  ? 76  ASP C N   1 
ATOM 5403 C CA  . ASP F 1 76  ? 14.263 -43.620  30.198 1.00 44.62  ? 76  ASP C CA  1 
ATOM 5404 C C   . ASP F 1 76  ? 13.697 -42.548  31.127 1.00 40.08  ? 76  ASP C C   1 
ATOM 5405 O O   . ASP F 1 76  ? 14.131 -41.387  31.091 1.00 36.82  ? 76  ASP C O   1 
ATOM 5406 C CB  . ASP F 1 76  ? 13.283 -43.964  29.079 1.00 40.83  ? 76  ASP C CB  1 
ATOM 5407 C CG  . ASP F 1 76  ? 13.644 -43.303  27.767 1.00 50.34  ? 76  ASP C CG  1 
ATOM 5408 O OD1 . ASP F 1 76  ? 14.059 -42.124  27.779 1.00 62.32  ? 76  ASP C OD1 1 
ATOM 5409 O OD2 . ASP F 1 76  ? 13.512 -43.971  26.719 1.00 42.04  ? 76  ASP C OD2 1 
ATOM 5410 N N   . ASN F 1 77  ? 12.743 -42.927  31.986 1.00 38.73  ? 77  ASN C N   1 
ATOM 5411 C CA  . ASN F 1 77  ? 12.177 -41.967  32.934 1.00 36.13  ? 77  ASN C CA  1 
ATOM 5412 C C   . ASN F 1 77  ? 13.264 -41.372  33.832 1.00 37.16  ? 77  ASN C C   1 
ATOM 5413 O O   . ASN F 1 77  ? 13.410 -40.140  33.938 1.00 44.32  ? 77  ASN C O   1 
ATOM 5414 C CB  . ASN F 1 77  ? 11.086 -42.661  33.756 1.00 35.31  ? 77  ASN C CB  1 
ATOM 5415 C CG  . ASN F 1 77  ? 10.677 -41.875  34.980 1.00 40.71  ? 77  ASN C CG  1 
ATOM 5416 O OD1 . ASN F 1 77  ? 11.071 -42.200  36.101 1.00 36.98  ? 77  ASN C OD1 1 
ATOM 5417 N ND2 . ASN F 1 77  ? 9.868  -40.843  34.777 1.00 55.95  ? 77  ASN C ND2 1 
ATOM 5418 N N   . LEU F 1 78  ? 14.066 -42.239  34.458 1.00 33.69  ? 78  LEU C N   1 
ATOM 5419 C CA  . LEU F 1 78  ? 15.108 -41.765  35.363 1.00 37.05  ? 78  LEU C CA  1 
ATOM 5420 C C   . LEU F 1 78  ? 16.138 -40.903  34.643 1.00 36.13  ? 78  LEU C C   1 
ATOM 5421 O O   . LEU F 1 78  ? 16.677 -39.959  35.235 1.00 33.60  ? 78  LEU C O   1 
ATOM 5422 C CB  . LEU F 1 78  ? 15.798 -42.950  36.049 1.00 42.88  ? 78  LEU C CB  1 
ATOM 5423 C CG  . LEU F 1 78  ? 15.166 -43.689  37.239 1.00 40.46  ? 78  LEU C CG  1 
ATOM 5424 C CD1 . LEU F 1 78  ? 13.672 -43.902  37.088 1.00 45.24  ? 78  LEU C CD1 1 
ATOM 5425 C CD2 . LEU F 1 78  ? 15.860 -45.032  37.434 1.00 37.18  ? 78  LEU C CD2 1 
ATOM 5426 N N   . PHE F 1 79  ? 16.423 -41.196  33.371 1.00 36.06  ? 79  PHE C N   1 
ATOM 5427 C CA  . PHE F 1 79  ? 17.369 -40.356  32.645 1.00 40.00  ? 79  PHE C CA  1 
ATOM 5428 C C   . PHE F 1 79  ? 16.778 -38.990  32.330 1.00 44.85  ? 79  PHE C C   1 
ATOM 5429 O O   . PHE F 1 79  ? 17.510 -37.993  32.318 1.00 40.95  ? 79  PHE C O   1 
ATOM 5430 C CB  . PHE F 1 79  ? 17.832 -41.030  31.354 1.00 38.25  ? 79  PHE C CB  1 
ATOM 5431 C CG  . PHE F 1 79  ? 18.895 -40.253  30.622 1.00 43.97  ? 79  PHE C CG  1 
ATOM 5432 C CD1 . PHE F 1 79  ? 18.554 -39.327  29.648 1.00 46.84  ? 79  PHE C CD1 1 
ATOM 5433 C CD2 . PHE F 1 79  ? 20.236 -40.431  30.928 1.00 45.44  ? 79  PHE C CD2 1 
ATOM 5434 C CE1 . PHE F 1 79  ? 19.529 -38.604  28.984 1.00 43.36  ? 79  PHE C CE1 1 
ATOM 5435 C CE2 . PHE F 1 79  ? 21.217 -39.712  30.264 1.00 41.00  ? 79  PHE C CE2 1 
ATOM 5436 C CZ  . PHE F 1 79  ? 20.862 -38.798  29.293 1.00 36.91  ? 79  PHE C CZ  1 
ATOM 5437 N N   . SER F 1 80  ? 15.471 -38.919  32.058 1.00 45.86  ? 80  SER C N   1 
ATOM 5438 C CA  . SER F 1 80  ? 14.837 -37.613  31.904 1.00 36.26  ? 80  SER C CA  1 
ATOM 5439 C C   . SER F 1 80  ? 15.000 -36.781  33.170 1.00 39.18  ? 80  SER C C   1 
ATOM 5440 O O   . SER F 1 80  ? 15.461 -35.631  33.117 1.00 44.23  ? 80  SER C O   1 
ATOM 5441 C CB  . SER F 1 80  ? 13.358 -37.769  31.546 1.00 30.82  ? 80  SER C CB  1 
ATOM 5442 O OG  . SER F 1 80  ? 13.197 -38.337  30.259 1.00 35.37  ? 80  SER C OG  1 
ATOM 5443 N N   . LYS F 1 81  ? 14.653 -37.355  34.327 1.00 33.79  ? 81  LYS C N   1 
ATOM 5444 C CA  . LYS F 1 81  ? 14.765 -36.586  35.567 1.00 36.03  ? 81  LYS C CA  1 
ATOM 5445 C C   . LYS F 1 81  ? 16.211 -36.170  35.834 1.00 31.69  ? 81  LYS C C   1 
ATOM 5446 O O   . LYS F 1 81  ? 16.491 -35.005  36.157 1.00 34.77  ? 81  LYS C O   1 
ATOM 5447 C CB  . LYS F 1 81  ? 14.195 -37.385  36.739 1.00 42.99  ? 81  LYS C CB  1 
ATOM 5448 C CG  . LYS F 1 81  ? 12.704 -37.675  36.606 1.00 46.09  ? 81  LYS C CG  1 
ATOM 5449 C CD  . LYS F 1 81  ? 12.134 -38.317  37.860 1.00 45.24  ? 81  LYS C CD  1 
ATOM 5450 C CE  . LYS F 1 81  ? 12.532 -39.772  37.979 1.00 46.60  ? 81  LYS C CE  1 
ATOM 5451 N NZ  . LYS F 1 81  ? 12.095 -40.341  39.281 1.00 58.20  ? 81  LYS C NZ  1 
ATOM 5452 N N   . MET F 1 82  ? 17.151 -37.107  35.680 1.00 37.22  ? 82  MET C N   1 
ATOM 5453 C CA  . MET F 1 82  ? 18.554 -36.767  35.887 1.00 39.91  ? 82  MET C CA  1 
ATOM 5454 C C   . MET F 1 82  ? 19.011 -35.686  34.921 1.00 36.56  ? 82  MET C C   1 
ATOM 5455 O O   . MET F 1 82  ? 19.888 -34.885  35.257 1.00 33.40  ? 82  MET C O   1 
ATOM 5456 C CB  . MET F 1 82  ? 19.440 -38.005  35.731 1.00 39.49  ? 82  MET C CB  1 
ATOM 5457 C CG  . MET F 1 82  ? 20.893 -37.747  36.115 1.00 40.51  ? 82  MET C CG  1 
ATOM 5458 S SD  . MET F 1 82  ? 22.056 -39.007  35.558 1.00 47.06  ? 82  MET C SD  1 
ATOM 5459 C CE  . MET F 1 82  ? 22.081 -38.693  33.794 1.00 34.80  ? 82  MET C CE  1 
ATOM 5460 N N   . GLU F 1 83  ? 18.427 -35.644  33.724 1.00 39.60  ? 83  GLU C N   1 
ATOM 5461 C CA  . GLU F 1 83  ? 18.823 -34.640  32.745 1.00 41.21  ? 83  GLU C CA  1 
ATOM 5462 C C   . GLU F 1 83  ? 18.276 -33.267  33.108 1.00 42.70  ? 83  GLU C C   1 
ATOM 5463 O O   . GLU F 1 83  ? 18.954 -32.253  32.889 1.00 41.90  ? 83  GLU C O   1 
ATOM 5464 C CB  . GLU F 1 83  ? 18.370 -35.077  31.348 1.00 45.81  ? 83  GLU C CB  1 
ATOM 5465 C CG  . GLU F 1 83  ? 18.496 -34.025  30.249 1.00 48.34  ? 83  GLU C CG  1 
ATOM 5466 C CD  . GLU F 1 83  ? 17.155 -33.449  29.827 1.00 54.28  ? 83  GLU C CD  1 
ATOM 5467 O OE1 . GLU F 1 83  ? 16.962 -32.223  29.954 1.00 58.44  ? 83  GLU C OE1 1 
ATOM 5468 O OE2 . GLU F 1 83  ? 16.293 -34.223  29.359 1.00 63.74  ? 83  GLU C OE2 1 
ATOM 5469 N N   . GLN F 1 84  ? 17.077 -33.209  33.698 1.00 45.49  ? 84  GLN C N   1 
ATOM 5470 C CA  . GLN F 1 84  ? 16.559 -31.916  34.142 1.00 46.40  ? 84  GLN C CA  1 
ATOM 5471 C C   . GLN F 1 84  ? 17.356 -31.378  35.327 1.00 41.48  ? 84  GLN C C   1 
ATOM 5472 O O   . GLN F 1 84  ? 17.648 -30.176  35.391 1.00 42.85  ? 84  GLN C O   1 
ATOM 5473 C CB  . GLN F 1 84  ? 15.077 -32.034  34.501 1.00 46.84  ? 84  GLN C CB  1 
ATOM 5474 C CG  . GLN F 1 84  ? 14.405 -30.702  34.810 1.00 55.31  ? 84  GLN C CG  1 
ATOM 5475 C CD  . GLN F 1 84  ? 12.923 -30.846  35.119 1.00 70.77  ? 84  GLN C CD  1 
ATOM 5476 O OE1 . GLN F 1 84  ? 12.544 -31.393  36.156 1.00 80.79  ? 84  GLN C OE1 1 
ATOM 5477 N NE2 . GLN F 1 84  ? 12.078 -30.354  34.218 1.00 71.04  ? 84  GLN C NE2 1 
ATOM 5478 N N   . LEU F 1 85  ? 17.743 -32.253  36.262 1.00 41.31  ? 85  LEU C N   1 
ATOM 5479 C CA  . LEU F 1 85  ? 18.667 -31.819  37.309 1.00 36.09  ? 85  LEU C CA  1 
ATOM 5480 C C   . LEU F 1 85  ? 20.005 -31.393  36.715 1.00 32.42  ? 85  LEU C C   1 
ATOM 5481 O O   . LEU F 1 85  ? 20.640 -30.443  37.194 1.00 33.71  ? 85  LEU C O   1 
ATOM 5482 C CB  . LEU F 1 85  ? 18.871 -32.935  38.334 1.00 35.25  ? 85  LEU C CB  1 
ATOM 5483 C CG  . LEU F 1 85  ? 17.932 -32.944  39.543 1.00 38.58  ? 85  LEU C CG  1 
ATOM 5484 C CD1 . LEU F 1 85  ? 16.584 -33.560  39.187 1.00 31.26  ? 85  LEU C CD1 1 
ATOM 5485 C CD2 . LEU F 1 85  ? 18.574 -33.668  40.719 1.00 35.34  ? 85  LEU C CD2 1 
ATOM 5486 N N   . PHE F 1 86  ? 20.442 -32.092  35.666 1.00 38.81  ? 86  PHE C N   1 
ATOM 5487 C CA  . PHE F 1 86  ? 21.685 -31.759  34.980 1.00 40.37  ? 86  PHE C CA  1 
ATOM 5488 C C   . PHE F 1 86  ? 21.667 -30.336  34.442 1.00 39.82  ? 86  PHE C C   1 
ATOM 5489 O O   . PHE F 1 86  ? 22.620 -29.579  34.640 1.00 34.96  ? 86  PHE C O   1 
ATOM 5490 C CB  . PHE F 1 86  ? 21.918 -32.750  33.844 1.00 41.79  ? 86  PHE C CB  1 
ATOM 5491 C CG  . PHE F 1 86  ? 23.049 -33.691  34.088 1.00 47.08  ? 86  PHE C CG  1 
ATOM 5492 C CD1 . PHE F 1 86  ? 24.333 -33.346  33.719 1.00 40.39  ? 86  PHE C CD1 1 
ATOM 5493 C CD2 . PHE F 1 86  ? 22.836 -34.908  34.711 1.00 44.78  ? 86  PHE C CD2 1 
ATOM 5494 C CE1 . PHE F 1 86  ? 25.373 -34.207  33.930 1.00 36.82  ? 86  PHE C CE1 1 
ATOM 5495 C CE2 . PHE F 1 86  ? 23.882 -35.770  34.941 1.00 45.86  ? 86  PHE C CE2 1 
ATOM 5496 C CZ  . PHE F 1 86  ? 25.155 -35.418  34.552 1.00 40.42  ? 86  PHE C CZ  1 
ATOM 5497 N N   . LEU F 1 87  ? 20.593 -29.959  33.744 1.00 42.46  ? 87  LEU C N   1 
ATOM 5498 C CA  . LEU F 1 87  ? 20.504 -28.608  33.197 1.00 40.95  ? 87  LEU C CA  1 
ATOM 5499 C C   . LEU F 1 87  ? 20.171 -27.565  34.254 1.00 41.18  ? 87  LEU C C   1 
ATOM 5500 O O   . LEU F 1 87  ? 20.410 -26.373  34.030 1.00 39.17  ? 87  LEU C O   1 
ATOM 5501 C CB  . LEU F 1 87  ? 19.470 -28.543  32.068 1.00 36.72  ? 87  LEU C CB  1 
ATOM 5502 C CG  . LEU F 1 87  ? 19.808 -29.080  30.673 1.00 34.01  ? 87  LEU C CG  1 
ATOM 5503 C CD1 . LEU F 1 87  ? 20.479 -30.440  30.691 1.00 49.11  ? 87  LEU C CD1 1 
ATOM 5504 C CD2 . LEU F 1 87  ? 18.543 -29.134  29.828 1.00 43.68  ? 87  LEU C CD2 1 
ATOM 5505 N N   . GLN F 1 88  ? 19.645 -27.982  35.403 1.00 41.34  ? 88  GLN C N   1 
ATOM 5506 C CA  . GLN F 1 88  ? 19.344 -27.020  36.454 1.00 35.60  ? 88  GLN C CA  1 
ATOM 5507 C C   . GLN F 1 88  ? 20.602 -26.635  37.227 1.00 34.73  ? 88  GLN C C   1 
ATOM 5508 O O   . GLN F 1 88  ? 20.994 -25.465  37.245 1.00 38.11  ? 88  GLN C O   1 
ATOM 5509 C CB  . GLN F 1 88  ? 18.281 -27.595  37.391 1.00 42.99  ? 88  GLN C CB  1 
ATOM 5510 C CG  . GLN F 1 88  ? 16.860 -27.316  36.941 1.00 48.33  ? 88  GLN C CG  1 
ATOM 5511 C CD  . GLN F 1 88  ? 15.834 -28.071  37.760 1.00 62.03  ? 88  GLN C CD  1 
ATOM 5512 O OE1 . GLN F 1 88  ? 16.163 -28.692  38.773 1.00 61.71  ? 88  GLN C OE1 1 
ATOM 5513 N NE2 . GLN F 1 88  ? 14.579 -28.023  37.325 1.00 60.26  ? 88  GLN C NE2 1 
ATOM 5514 N N   . LEU F 1 89  ? 21.259 -27.608  37.862 1.00 36.83  ? 89  LEU C N   1 
ATOM 5515 C CA  . LEU F 1 89  ? 22.353 -27.292  38.776 1.00 34.23  ? 89  LEU C CA  1 
ATOM 5516 C C   . LEU F 1 89  ? 23.737 -27.411  38.146 1.00 32.03  ? 89  LEU C C   1 
ATOM 5517 O O   . LEU F 1 89  ? 24.726 -27.041  38.788 1.00 26.73  ? 89  LEU C O   1 
ATOM 5518 C CB  . LEU F 1 89  ? 22.271 -28.179  40.023 1.00 37.38  ? 89  LEU C CB  1 
ATOM 5519 C CG  . LEU F 1 89  ? 20.869 -28.270  40.630 1.00 37.22  ? 89  LEU C CG  1 
ATOM 5520 C CD1 . LEU F 1 89  ? 20.822 -29.284  41.770 1.00 44.77  ? 89  LEU C CD1 1 
ATOM 5521 C CD2 . LEU F 1 89  ? 20.382 -26.901  41.087 1.00 32.21  ? 89  LEU C CD2 1 
ATOM 5522 N N   . ILE F 1 90  ? 23.832 -27.921  36.922 1.00 36.46  ? 90  ILE C N   1 
ATOM 5523 C CA  . ILE F 1 90  ? 25.070 -27.942  36.158 1.00 38.51  ? 90  ILE C CA  1 
ATOM 5524 C C   . ILE F 1 90  ? 24.734 -27.367  34.788 1.00 42.11  ? 90  ILE C C   1 
ATOM 5525 O O   . ILE F 1 90  ? 23.566 -27.201  34.435 1.00 44.49  ? 90  ILE C O   1 
ATOM 5526 C CB  . ILE F 1 90  ? 25.678 -29.364  36.034 1.00 34.56  ? 90  ILE C CB  1 
ATOM 5527 C CG1 . ILE F 1 90  ? 25.750 -30.058  37.393 1.00 31.53  ? 90  ILE C CG1 1 
ATOM 5528 C CG2 . ILE F 1 90  ? 27.097 -29.323  35.479 1.00 32.75  ? 90  ILE C CG2 1 
ATOM 5529 C CD1 . ILE F 1 90  ? 24.554 -30.918  37.698 1.00 31.01  ? 90  ILE C CD1 1 
ATOM 5530 N N   . LEU F 1 91  ? 25.772 -27.017  34.031 1.00 37.77  ? 91  LEU C N   1 
ATOM 5531 C CA  . LEU F 1 91  ? 25.612 -26.614  32.635 1.00 39.21  ? 91  LEU C CA  1 
ATOM 5532 C C   . LEU F 1 91  ? 24.633 -25.453  32.479 1.00 40.78  ? 91  LEU C C   1 
ATOM 5533 O O   . LEU F 1 91  ? 23.936 -25.349  31.467 1.00 39.40  ? 91  LEU C O   1 
ATOM 5534 C CB  . LEU F 1 91  ? 25.167 -27.796  31.770 1.00 32.89  ? 91  LEU C CB  1 
ATOM 5535 C CG  . LEU F 1 91  ? 26.021 -29.056  31.894 1.00 30.22  ? 91  LEU C CG  1 
ATOM 5536 C CD1 . LEU F 1 91  ? 25.440 -30.174  31.047 1.00 44.93  ? 91  LEU C CD1 1 
ATOM 5537 C CD2 . LEU F 1 91  ? 27.466 -28.780  31.527 1.00 27.55  ? 91  LEU C CD2 1 
ATOM 5538 N N   . ARG F 1 92  ? 24.543 -24.596  33.493 1.00 43.13  ? 92  ARG C N   1 
ATOM 5539 C CA  . ARG F 1 92  ? 23.656 -23.441  33.456 1.00 43.14  ? 92  ARG C CA  1 
ATOM 5540 C C   . ARG F 1 92  ? 24.366 -22.243  34.063 1.00 43.19  ? 92  ARG C C   1 
ATOM 5541 O O   . ARG F 1 92  ? 24.968 -22.351  35.136 1.00 40.65  ? 92  ARG C O   1 
ATOM 5542 C CB  . ARG F 1 92  ? 22.339 -23.713  34.197 1.00 42.87  ? 92  ARG C CB  1 
ATOM 5543 C CG  . ARG F 1 92  ? 21.725 -22.474  34.848 1.00 45.49  ? 92  ARG C CG  1 
ATOM 5544 C CD  . ARG F 1 92  ? 20.214 -22.407  34.664 1.00 51.64  ? 92  ARG C CD  1 
ATOM 5545 N NE  . ARG F 1 92  ? 19.839 -22.399  33.251 1.00 67.73  ? 92  ARG C NE  1 
ATOM 5546 C CZ  . ARG F 1 92  ? 18.592 -22.515  32.799 1.00 72.01  ? 92  ARG C CZ  1 
ATOM 5547 N NH1 . ARG F 1 92  ? 18.356 -22.492  31.493 1.00 56.75  ? 92  ARG C NH1 1 
ATOM 5548 N NH2 . ARG F 1 92  ? 17.581 -22.648  33.649 1.00 78.65  ? 92  ARG C NH2 1 
ATOM 5549 N N   . ILE F 1 93  ? 24.308 -21.113  33.364 1.00 41.92  ? 93  ILE C N   1 
ATOM 5550 C CA  . ILE F 1 93  ? 24.774 -19.842  33.908 1.00 44.57  ? 93  ILE C CA  1 
ATOM 5551 C C   . ILE F 1 93  ? 23.622 -19.271  34.729 1.00 43.39  ? 93  ILE C C   1 
ATOM 5552 O O   . ILE F 1 93  ? 22.517 -19.088  34.196 1.00 46.18  ? 93  ILE C O   1 
ATOM 5553 C CB  . ILE F 1 93  ? 25.223 -18.881  32.796 1.00 46.76  ? 93  ILE C CB  1 
ATOM 5554 C CG1 . ILE F 1 93  ? 25.967 -19.643  31.695 1.00 42.76  ? 93  ILE C CG1 1 
ATOM 5555 C CG2 . ILE F 1 93  ? 26.145 -17.815  33.366 1.00 44.48  ? 93  ILE C CG2 1 
ATOM 5556 C CD1 . ILE F 1 93  ? 27.265 -20.273  32.139 1.00 38.42  ? 93  ILE C CD1 1 
ATOM 5557 N N   . PRO F 1 94  ? 23.836 -18.964  36.018 1.00 39.87  ? 94  PRO C N   1 
ATOM 5558 C CA  . PRO F 1 94  ? 22.715 -18.698  36.938 1.00 44.26  ? 94  PRO C CA  1 
ATOM 5559 C C   . PRO F 1 94  ? 21.823 -17.516  36.576 1.00 54.81  ? 94  PRO C C   1 
ATOM 5560 O O   . PRO F 1 94  ? 20.847 -17.250  37.290 1.00 52.14  ? 94  PRO C O   1 
ATOM 5561 C CB  . PRO F 1 94  ? 23.427 -18.439  38.274 1.00 43.27  ? 94  PRO C CB  1 
ATOM 5562 C CG  . PRO F 1 94  ? 24.737 -19.134  38.151 1.00 37.71  ? 94  PRO C CG  1 
ATOM 5563 C CD  . PRO F 1 94  ? 25.133 -18.987  36.715 1.00 37.85  ? 94  PRO C CD  1 
ATOM 5564 N N   . SER F 1 95  ? 22.173 -16.784  35.511 1.00 56.23  ? 95  SER C N   1 
ATOM 5565 C CA  . SER F 1 95  ? 21.517 -15.549  35.078 1.00 53.44  ? 95  SER C CA  1 
ATOM 5566 C C   . SER F 1 95  ? 21.818 -14.419  36.055 1.00 47.10  ? 95  SER C C   1 
ATOM 5567 O O   . SER F 1 95  ? 21.709 -13.239  35.709 1.00 44.04  ? 95  SER C O   1 
ATOM 5568 C CB  . SER F 1 95  ? 20.006 -15.738  34.917 1.00 55.65  ? 95  SER C CB  1 
ATOM 5569 O OG  . SER F 1 95  ? 19.364 -15.785  36.179 1.00 53.05  ? 95  SER C OG  1 
ATOM 5570 N N   . ASN F 1 96  ? 22.207 -14.785  37.275 1.00 48.55  ? 96  ASN C N   1 
ATOM 5571 C CA  . ASN F 1 96  ? 22.786 -13.850  38.225 1.00 46.23  ? 96  ASN C CA  1 
ATOM 5572 C C   . ASN F 1 96  ? 24.251 -13.588  37.912 1.00 50.18  ? 96  ASN C C   1 
ATOM 5573 O O   . ASN F 1 96  ? 24.746 -12.476  38.126 1.00 46.46  ? 96  ASN C O   1 
ATOM 5574 C CB  . ASN F 1 96  ? 22.629 -14.419  39.638 1.00 46.18  ? 96  ASN C CB  1 
ATOM 5575 C CG  . ASN F 1 96  ? 23.416 -13.651  40.679 1.00 57.28  ? 96  ASN C CG  1 
ATOM 5576 O OD1 . ASN F 1 96  ? 23.654 -12.450  40.551 1.00 63.66  ? 96  ASN C OD1 1 
ATOM 5577 N ND2 . ASN F 1 96  ? 23.833 -14.354  41.723 1.00 54.81  ? 96  ASN C ND2 1 
ATOM 5578 N N   . ILE F 1 97  ? 24.941 -14.578  37.380 1.00 50.43  ? 97  ILE C N   1 
ATOM 5579 C CA  . ILE F 1 97  ? 26.371 -14.487  37.124 1.00 46.58  ? 97  ILE C CA  1 
ATOM 5580 C C   . ILE F 1 97  ? 26.594 -13.987  35.704 1.00 40.97  ? 97  ILE C C   1 
ATOM 5581 O O   . ILE F 1 97  ? 25.841 -14.316  34.781 1.00 39.54  ? 97  ILE C O   1 
ATOM 5582 C CB  . ILE F 1 97  ? 27.051 -15.849  37.375 1.00 40.90  ? 97  ILE C CB  1 
ATOM 5583 C CG1 . ILE F 1 97  ? 27.532 -15.944  38.826 1.00 40.25  ? 97  ILE C CG1 1 
ATOM 5584 C CG2 . ILE F 1 97  ? 28.212 -16.087  36.418 1.00 37.56  ? 97  ILE C CG2 1 
ATOM 5585 C CD1 . ILE F 1 97  ? 26.420 -16.053  39.856 1.00 46.35  ? 97  ILE C CD1 1 
ATOM 5586 N N   . LEU F 1 98  ? 27.624 -13.162  35.538 1.00 37.72  ? 98  LEU C N   1 
ATOM 5587 C CA  . LEU F 1 98  ? 28.064 -12.673  34.241 1.00 43.60  ? 98  LEU C CA  1 
ATOM 5588 C C   . LEU F 1 98  ? 29.456 -13.206  33.932 1.00 43.88  ? 98  LEU C C   1 
ATOM 5589 O O   . LEU F 1 98  ? 30.332 -13.226  34.804 1.00 43.23  ? 98  LEU C O   1 
ATOM 5590 C CB  . LEU F 1 98  ? 28.051 -11.144  34.206 1.00 56.80  ? 98  LEU C CB  1 
ATOM 5591 C CG  . LEU F 1 98  ? 28.655 -10.418  33.009 1.00 47.04  ? 98  LEU C CG  1 
ATOM 5592 C CD1 . LEU F 1 98  ? 27.753 -9.275   32.673 1.00 39.13  ? 98  LEU C CD1 1 
ATOM 5593 C CD2 . LEU F 1 98  ? 30.028 -9.884   33.382 1.00 40.07  ? 98  LEU C CD2 1 
ATOM 5594 N N   . LEU F 1 99  ? 29.646 -13.652  32.692 1.00 39.77  ? 99  LEU C N   1 
ATOM 5595 C CA  . LEU F 1 99  ? 30.894 -14.292  32.320 1.00 42.86  ? 99  LEU C CA  1 
ATOM 5596 C C   . LEU F 1 99  ? 32.035 -13.279  32.308 1.00 46.38  ? 99  LEU C C   1 
ATOM 5597 O O   . LEU F 1 99  ? 31.837 -12.110  31.965 1.00 51.49  ? 99  LEU C O   1 
ATOM 5598 C CB  . LEU F 1 99  ? 30.775 -14.944  30.945 1.00 42.53  ? 99  LEU C CB  1 
ATOM 5599 C CG  . LEU F 1 99  ? 29.928 -16.213  30.854 1.00 43.05  ? 99  LEU C CG  1 
ATOM 5600 C CD1 . LEU F 1 99  ? 29.861 -16.712  29.416 1.00 39.70  ? 99  LEU C CD1 1 
ATOM 5601 C CD2 . LEU F 1 99  ? 30.469 -17.289  31.786 1.00 40.66  ? 99  LEU C CD2 1 
ATOM 5602 N N   . PRO F 1 100 ? 33.249 -13.708  32.659 1.00 48.81  ? 100 PRO C N   1 
ATOM 5603 C CA  . PRO F 1 100 ? 34.397 -12.789  32.589 1.00 54.26  ? 100 PRO C CA  1 
ATOM 5604 C C   . PRO F 1 100 ? 34.701 -12.341  31.175 1.00 50.91  ? 100 PRO C C   1 
ATOM 5605 O O   . PRO F 1 100 ? 35.403 -11.339  30.989 1.00 50.11  ? 100 PRO C O   1 
ATOM 5606 C CB  . PRO F 1 100 ? 35.553 -13.609  33.184 1.00 49.79  ? 100 PRO C CB  1 
ATOM 5607 C CG  . PRO F 1 100 ? 34.919 -14.814  33.820 1.00 45.92  ? 100 PRO C CG  1 
ATOM 5608 C CD  . PRO F 1 100 ? 33.636 -15.056  33.104 1.00 44.45  ? 100 PRO C CD  1 
ATOM 5609 N N   . GLU F 1 101 ? 34.174 -13.051  30.177 1.00 52.81  ? 101 GLU C N   1 
ATOM 5610 C CA  . GLU F 1 101 ? 34.411 -12.696  28.784 1.00 52.39  ? 101 GLU C CA  1 
ATOM 5611 C C   . GLU F 1 101 ? 33.866 -11.309  28.468 1.00 48.19  ? 101 GLU C C   1 
ATOM 5612 O O   . GLU F 1 101 ? 34.533 -10.505  27.806 1.00 54.05  ? 101 GLU C O   1 
ATOM 5613 C CB  . GLU F 1 101 ? 33.768 -13.751  27.885 1.00 49.97  ? 101 GLU C CB  1 
ATOM 5614 C CG  . GLU F 1 101 ? 33.941 -15.169  28.419 1.00 52.87  ? 101 GLU C CG  1 
ATOM 5615 C CD  . GLU F 1 101 ? 32.996 -16.166  27.776 1.00 56.71  ? 101 GLU C CD  1 
ATOM 5616 O OE1 . GLU F 1 101 ? 32.084 -15.730  27.040 1.00 53.64  ? 101 GLU C OE1 1 
ATOM 5617 O OE2 . GLU F 1 101 ? 33.166 -17.384  28.009 1.00 54.47  ? 101 GLU C OE2 1 
ATOM 5618 N N   . ASP F 1 102 ? 32.653 -11.014  28.926 1.00 47.19  ? 102 ASP C N   1 
ATOM 5619 C CA  . ASP F 1 102 ? 31.999 -9.731   28.679 1.00 47.91  ? 102 ASP C CA  1 
ATOM 5620 C C   . ASP F 1 102 ? 31.614 -9.081   30.008 1.00 46.09  ? 102 ASP C C   1 
ATOM 5621 O O   . ASP F 1 102 ? 30.451 -9.118   30.413 1.00 38.96  ? 102 ASP C O   1 
ATOM 5622 C CB  . ASP F 1 102 ? 30.779 -9.924   27.768 1.00 49.27  ? 102 ASP C CB  1 
ATOM 5623 C CG  . ASP F 1 102 ? 30.046 -11.223  28.032 1.00 45.38  ? 102 ASP C CG  1 
ATOM 5624 O OD1 . ASP F 1 102 ? 29.434 -11.766  27.087 1.00 39.59  ? 102 ASP C OD1 1 
ATOM 5625 O OD2 . ASP F 1 102 ? 30.065 -11.692  29.187 1.00 50.76  ? 102 ASP C OD2 1 
ATOM 5626 N N   . LYS F 1 103 ? 32.598 -8.478   30.681 1.00 53.88  ? 103 LYS C N   1 
ATOM 5627 C CA  . LYS F 1 103 ? 32.320 -7.586   31.803 1.00 50.92  ? 103 LYS C CA  1 
ATOM 5628 C C   . LYS F 1 103 ? 32.116 -6.144   31.355 1.00 47.64  ? 103 LYS C C   1 
ATOM 5629 O O   . LYS F 1 103 ? 31.324 -5.415   31.963 1.00 45.51  ? 103 LYS C O   1 
ATOM 5630 C CB  . LYS F 1 103 ? 33.453 -7.643   32.836 1.00 41.89  ? 103 LYS C CB  1 
ATOM 5631 C CG  . LYS F 1 103 ? 33.366 -6.556   33.908 1.00 35.16  ? 103 LYS C CG  1 
ATOM 5632 C CD  . LYS F 1 103 ? 33.837 -7.026   35.279 1.00 32.95  ? 103 LYS C CD  1 
ATOM 5633 C CE  . LYS F 1 103 ? 35.355 -7.019   35.395 1.00 25.84  ? 103 LYS C CE  1 
ATOM 5634 N NZ  . LYS F 1 103 ? 35.796 -7.373   36.776 1.00 17.78  ? 103 LYS C NZ  1 
ATOM 5635 N N   . CYS F 1 104 ? 32.811 -5.720   30.298 1.00 45.01  ? 104 CYS C N   1 
ATOM 5636 C CA  . CYS F 1 104 ? 32.609 -4.379   29.765 1.00 46.80  ? 104 CYS C CA  1 
ATOM 5637 C C   . CYS F 1 104 ? 31.166 -4.160   29.335 1.00 47.57  ? 104 CYS C C   1 
ATOM 5638 O O   . CYS F 1 104 ? 30.675 -3.026   29.361 1.00 48.68  ? 104 CYS C O   1 
ATOM 5639 C CB  . CYS F 1 104 ? 33.549 -4.154   28.587 1.00 53.46  ? 104 CYS C CB  1 
ATOM 5640 S SG  . CYS F 1 104 ? 33.723 -5.628   27.557 1.00 67.52  ? 104 CYS C SG  1 
ATOM 5641 N N   . LYS F 1 105 ? 30.477 -5.224   28.930 1.00 50.36  ? 105 LYS C N   1 
ATOM 5642 C CA  . LYS F 1 105 ? 29.059 -5.136   28.618 1.00 52.25  ? 105 LYS C CA  1 
ATOM 5643 C C   . LYS F 1 105 ? 28.172 -5.161   29.859 1.00 48.49  ? 105 LYS C C   1 
ATOM 5644 O O   . LYS F 1 105 ? 26.946 -5.099   29.718 1.00 51.62  ? 105 LYS C O   1 
ATOM 5645 C CB  . LYS F 1 105 ? 28.642 -6.259   27.656 1.00 44.85  ? 105 LYS C CB  1 
ATOM 5646 C CG  . LYS F 1 105 ? 28.999 -6.006   26.190 1.00 47.54  ? 105 LYS C CG  1 
ATOM 5647 C CD  . LYS F 1 105 ? 30.366 -6.525   25.793 1.00 51.34  ? 105 LYS C CD  1 
ATOM 5648 C CE  . LYS F 1 105 ? 30.240 -7.892   25.150 1.00 48.32  ? 105 LYS C CE  1 
ATOM 5649 N NZ  . LYS F 1 105 ? 31.520 -8.350   24.547 1.00 47.76  ? 105 LYS C NZ  1 
ATOM 5650 N N   . GLU F 1 106 ? 28.748 -5.261   31.061 1.00 44.29  ? 106 GLU C N   1 
ATOM 5651 C CA  . GLU F 1 106 ? 27.925 -5.326   32.270 1.00 52.97  ? 106 GLU C CA  1 
ATOM 5652 C C   . GLU F 1 106 ? 27.320 -3.968   32.631 1.00 59.82  ? 106 GLU C C   1 
ATOM 5653 O O   . GLU F 1 106 ? 26.165 -3.907   33.070 1.00 66.13  ? 106 GLU C O   1 
ATOM 5654 C CB  . GLU F 1 106 ? 28.732 -5.919   33.428 1.00 57.86  ? 106 GLU C CB  1 
ATOM 5655 C CG  . GLU F 1 106 ? 28.177 -5.641   34.811 1.00 62.32  ? 106 GLU C CG  1 
ATOM 5656 C CD  . GLU F 1 106 ? 28.701 -4.353   35.391 1.00 60.33  ? 106 GLU C CD  1 
ATOM 5657 O OE1 . GLU F 1 106 ? 29.900 -4.069   35.189 1.00 59.91  ? 106 GLU C OE1 1 
ATOM 5658 O OE2 . GLU F 1 106 ? 27.916 -3.613   36.016 1.00 63.76  ? 106 GLU C OE2 1 
ATOM 5659 N N   . THR F 1 107 ? 28.081 -2.863   32.468 1.00 60.11  ? 107 THR C N   1 
ATOM 5660 C CA  . THR F 1 107 ? 27.503 -1.519   32.570 1.00 56.41  ? 107 THR C CA  1 
ATOM 5661 C C   . THR F 1 107 ? 27.249 -1.002   31.166 1.00 56.29  ? 107 THR C C   1 
ATOM 5662 O O   . THR F 1 107 ? 28.131 -0.366   30.577 1.00 60.09  ? 107 THR C O   1 
ATOM 5663 C CB  . THR F 1 107 ? 28.404 -0.491   33.274 1.00 55.10  ? 107 THR C CB  1 
ATOM 5664 O OG1 . THR F 1 107 ? 29.322 0.071    32.322 1.00 48.37  ? 107 THR C OG1 1 
ATOM 5665 C CG2 . THR F 1 107 ? 29.158 -1.073   34.458 1.00 57.74  ? 107 THR C CG2 1 
ATOM 5666 N N   . PRO F 1 108 ? 26.061 -1.216   30.612 1.00 56.20  ? 108 PRO C N   1 
ATOM 5667 C CA  . PRO F 1 108 ? 25.848 -0.891   29.199 1.00 61.90  ? 108 PRO C CA  1 
ATOM 5668 C C   . PRO F 1 108 ? 25.897 0.608    28.969 1.00 57.09  ? 108 PRO C C   1 
ATOM 5669 O O   . PRO F 1 108 ? 25.328 1.394    29.731 1.00 54.62  ? 108 PRO C O   1 
ATOM 5670 C CB  . PRO F 1 108 ? 24.449 -1.449   28.910 1.00 60.65  ? 108 PRO C CB  1 
ATOM 5671 C CG  . PRO F 1 108 ? 24.143 -2.368   30.057 1.00 59.07  ? 108 PRO C CG  1 
ATOM 5672 C CD  . PRO F 1 108 ? 24.852 -1.776   31.231 1.00 56.79  ? 108 PRO C CD  1 
ATOM 5673 N N   . TYR F 1 109 ? 26.588 0.998    27.905 1.00 46.50  ? 109 TYR C N   1 
ATOM 5674 C CA  . TYR F 1 109 ? 26.639 2.392    27.505 1.00 51.79  ? 109 TYR C CA  1 
ATOM 5675 C C   . TYR F 1 109 ? 25.456 2.664    26.585 1.00 56.29  ? 109 TYR C C   1 
ATOM 5676 O O   . TYR F 1 109 ? 25.334 2.043    25.520 1.00 50.29  ? 109 TYR C O   1 
ATOM 5677 C CB  . TYR F 1 109 ? 27.962 2.729    26.822 1.00 52.12  ? 109 TYR C CB  1 
ATOM 5678 C CG  . TYR F 1 109 ? 28.485 4.096    27.211 1.00 61.10  ? 109 TYR C CG  1 
ATOM 5679 C CD1 . TYR F 1 109 ? 28.872 4.354    28.520 1.00 54.87  ? 109 TYR C CD1 1 
ATOM 5680 C CD2 . TYR F 1 109 ? 28.566 5.133    26.286 1.00 62.85  ? 109 TYR C CD2 1 
ATOM 5681 C CE1 . TYR F 1 109 ? 29.348 5.595    28.897 1.00 63.53  ? 109 TYR C CE1 1 
ATOM 5682 C CE2 . TYR F 1 109 ? 29.040 6.387    26.657 1.00 60.22  ? 109 TYR C CE2 1 
ATOM 5683 C CZ  . TYR F 1 109 ? 29.429 6.610    27.966 1.00 64.22  ? 109 TYR C CZ  1 
ATOM 5684 O OH  . TYR F 1 109 ? 29.901 7.846    28.351 1.00 52.53  ? 109 TYR C OH  1 
ATOM 5685 N N   . SER F 1 110 ? 24.568 3.556    27.025 1.00 60.76  ? 110 SER C N   1 
ATOM 5686 C CA  . SER F 1 110 ? 23.362 3.875    26.269 1.00 61.09  ? 110 SER C CA  1 
ATOM 5687 C C   . SER F 1 110 ? 23.730 4.397    24.888 1.00 63.15  ? 110 SER C C   1 
ATOM 5688 O O   . SER F 1 110 ? 24.598 5.263    24.758 1.00 65.38  ? 110 SER C O   1 
ATOM 5689 C CB  . SER F 1 110 ? 22.531 4.921    27.015 1.00 63.00  ? 110 SER C CB  1 
ATOM 5690 O OG  . SER F 1 110 ? 22.525 4.669    28.404 1.00 60.13  ? 110 SER C OG  1 
ATOM 5691 N N   . GLU F 1 111 ? 23.064 3.872    23.854 1.00 55.61  ? 111 GLU C N   1 
ATOM 5692 C CA  . GLU F 1 111 ? 23.407 4.246    22.489 1.00 54.68  ? 111 GLU C CA  1 
ATOM 5693 C C   . GLU F 1 111 ? 23.296 5.741    22.280 1.00 60.05  ? 111 GLU C C   1 
ATOM 5694 O O   . GLU F 1 111 ? 23.975 6.291    21.409 1.00 62.28  ? 111 GLU C O   1 
ATOM 5695 C CB  . GLU F 1 111 ? 22.509 3.498    21.513 1.00 54.09  ? 111 GLU C CB  1 
ATOM 5696 C CG  . GLU F 1 111 ? 23.176 2.252    20.908 1.00 68.76  ? 111 GLU C CG  1 
ATOM 5697 C CD  . GLU F 1 111 ? 23.812 1.363    21.926 1.00 69.12  ? 111 GLU C CD  1 
ATOM 5698 O OE1 . GLU F 1 111 ? 23.280 1.144    22.964 1.00 72.28  ? 111 GLU C OE1 1 
ATOM 5699 O OE2 . GLU F 1 111 ? 24.877 0.875    21.701 1.00 49.09  ? 111 GLU C OE2 1 
ATOM 5700 N N   . GLU F 1 112 ? 22.453 6.417    23.061 1.00 59.38  ? 112 GLU C N   1 
ATOM 5701 C CA  . GLU F 1 112 ? 22.433 7.873    22.997 1.00 60.91  ? 112 GLU C CA  1 
ATOM 5702 C C   . GLU F 1 112 ? 23.708 8.463    23.596 1.00 57.80  ? 112 GLU C C   1 
ATOM 5703 O O   . GLU F 1 112 ? 24.289 9.400    23.033 1.00 68.88  ? 112 GLU C O   1 
ATOM 5704 C CB  . GLU F 1 112 ? 21.188 8.415    23.696 1.00 75.73  ? 112 GLU C CB  1 
ATOM 5705 C CG  . GLU F 1 112 ? 19.909 7.724    23.243 1.00 87.45  ? 112 GLU C CG  1 
ATOM 5706 C CD  . GLU F 1 112 ? 18.667 8.399    23.783 1.00 104.79 ? 112 GLU C CD  1 
ATOM 5707 O OE1 . GLU F 1 112 ? 18.741 8.994    24.881 1.00 107.86 ? 112 GLU C OE1 1 
ATOM 5708 O OE2 . GLU F 1 112 ? 17.617 8.340    23.109 1.00 103.66 ? 112 GLU C OE2 1 
ATOM 5709 N N   . ASP F 1 113 ? 24.168 7.923    24.728 1.00 47.37  ? 113 ASP C N   1 
ATOM 5710 C CA  . ASP F 1 113 ? 25.458 8.348    25.267 1.00 51.04  ? 113 ASP C CA  1 
ATOM 5711 C C   . ASP F 1 113 ? 26.594 8.010    24.310 1.00 52.07  ? 113 ASP C C   1 
ATOM 5712 O O   . ASP F 1 113 ? 27.560 8.774    24.180 1.00 49.72  ? 113 ASP C O   1 
ATOM 5713 C CB  . ASP F 1 113 ? 25.702 7.700    26.630 1.00 52.93  ? 113 ASP C CB  1 
ATOM 5714 C CG  . ASP F 1 113 ? 24.849 8.308    27.722 1.00 59.92  ? 113 ASP C CG  1 
ATOM 5715 O OD1 . ASP F 1 113 ? 24.614 9.533    27.681 1.00 63.59  ? 113 ASP C OD1 1 
ATOM 5716 O OD2 . ASP F 1 113 ? 24.421 7.563    28.628 1.00 64.46  ? 113 ASP C OD2 1 
ATOM 5717 N N   . PHE F 1 114 ? 26.489 6.873    23.619 1.00 55.98  ? 114 PHE C N   1 
ATOM 5718 C CA  . PHE F 1 114 ? 27.565 6.440    22.734 1.00 56.71  ? 114 PHE C CA  1 
ATOM 5719 C C   . PHE F 1 114 ? 27.670 7.333    21.503 1.00 56.88  ? 114 PHE C C   1 
ATOM 5720 O O   . PHE F 1 114 ? 28.759 7.814    21.168 1.00 54.51  ? 114 PHE C O   1 
ATOM 5721 C CB  . PHE F 1 114 ? 27.357 4.985    22.322 1.00 48.78  ? 114 PHE C CB  1 
ATOM 5722 C CG  . PHE F 1 114 ? 28.490 4.425    21.522 1.00 49.88  ? 114 PHE C CG  1 
ATOM 5723 C CD1 . PHE F 1 114 ? 28.432 4.402    20.139 1.00 52.17  ? 114 PHE C CD1 1 
ATOM 5724 C CD2 . PHE F 1 114 ? 29.620 3.931    22.151 1.00 46.94  ? 114 PHE C CD2 1 
ATOM 5725 C CE1 . PHE F 1 114 ? 29.478 3.895    19.397 1.00 53.30  ? 114 PHE C CE1 1 
ATOM 5726 C CE2 . PHE F 1 114 ? 30.670 3.420    21.414 1.00 48.77  ? 114 PHE C CE2 1 
ATOM 5727 C CZ  . PHE F 1 114 ? 30.598 3.401    20.034 1.00 51.64  ? 114 PHE C CZ  1 
ATOM 5728 N N   . GLN F 1 115 ? 26.552 7.551    20.803 1.00 55.52  ? 115 GLN C N   1 
ATOM 5729 C CA  . GLN F 1 115 ? 26.578 8.440    19.643 1.00 55.05  ? 115 GLN C CA  1 
ATOM 5730 C C   . GLN F 1 115 ? 26.893 9.869    20.064 1.00 54.08  ? 115 GLN C C   1 
ATOM 5731 O O   . GLN F 1 115 ? 27.580 10.602   19.341 1.00 49.44  ? 115 GLN C O   1 
ATOM 5732 C CB  . GLN F 1 115 ? 25.251 8.366    18.882 1.00 55.07  ? 115 GLN C CB  1 
ATOM 5733 C CG  . GLN F 1 115 ? 24.044 8.931    19.621 1.00 57.85  ? 115 GLN C CG  1 
ATOM 5734 C CD  . GLN F 1 115 ? 22.809 9.021    18.741 1.00 70.79  ? 115 GLN C CD  1 
ATOM 5735 O OE1 . GLN F 1 115 ? 22.771 8.458    17.647 1.00 81.54  ? 115 GLN C OE1 1 
ATOM 5736 N NE2 . GLN F 1 115 ? 21.788 9.726    19.220 1.00 68.82  ? 115 GLN C NE2 1 
ATOM 5737 N N   . HIS F 1 116 ? 26.381 10.282   21.226 1.00 52.27  ? 116 HIS C N   1 
ATOM 5738 C CA  . HIS F 1 116 ? 26.758 11.562   21.811 1.00 48.02  ? 116 HIS C CA  1 
ATOM 5739 C C   . HIS F 1 116 ? 28.275 11.685   21.893 1.00 45.31  ? 116 HIS C C   1 
ATOM 5740 O O   . HIS F 1 116 ? 28.857 12.705   21.501 1.00 50.94  ? 116 HIS C O   1 
ATOM 5741 C CB  . HIS F 1 116 ? 26.106 11.686   23.193 1.00 48.96  ? 116 HIS C CB  1 
ATOM 5742 C CG  . HIS F 1 116 ? 26.358 12.990   23.884 1.00 60.48  ? 116 HIS C CG  1 
ATOM 5743 N ND1 . HIS F 1 116 ? 27.619 13.425   24.231 1.00 61.48  ? 116 HIS C ND1 1 
ATOM 5744 C CD2 . HIS F 1 116 ? 25.500 13.950   24.304 1.00 64.36  ? 116 HIS C CD2 1 
ATOM 5745 C CE1 . HIS F 1 116 ? 27.529 14.600   24.828 1.00 57.54  ? 116 HIS C CE1 1 
ATOM 5746 N NE2 . HIS F 1 116 ? 26.254 14.942   24.885 1.00 67.27  ? 116 HIS C NE2 1 
ATOM 5747 N N   . LEU F 1 117 ? 28.938 10.627   22.360 1.00 42.66  ? 117 LEU C N   1 
ATOM 5748 C CA  . LEU F 1 117 ? 30.385 10.686   22.514 1.00 43.22  ? 117 LEU C CA  1 
ATOM 5749 C C   . LEU F 1 117 ? 31.108 10.588   21.173 1.00 40.58  ? 117 LEU C C   1 
ATOM 5750 O O   . LEU F 1 117 ? 32.187 11.169   21.011 1.00 38.80  ? 117 LEU C O   1 
ATOM 5751 C CB  . LEU F 1 117 ? 30.847 9.589    23.473 1.00 40.62  ? 117 LEU C CB  1 
ATOM 5752 C CG  . LEU F 1 117 ? 32.353 9.447    23.663 1.00 36.66  ? 117 LEU C CG  1 
ATOM 5753 C CD1 . LEU F 1 117 ? 32.669 9.182    25.118 1.00 41.28  ? 117 LEU C CD1 1 
ATOM 5754 C CD2 . LEU F 1 117 ? 32.865 8.323    22.806 1.00 40.85  ? 117 LEU C CD2 1 
ATOM 5755 N N   . GLN F 1 118 ? 30.541 9.861    20.209 1.00 46.53  ? 118 GLN C N   1 
ATOM 5756 C CA  . GLN F 1 118 ? 31.117 9.826    18.869 1.00 49.95  ? 118 GLN C CA  1 
ATOM 5757 C C   . GLN F 1 118 ? 31.121 11.214   18.245 1.00 44.78  ? 118 GLN C C   1 
ATOM 5758 O O   . GLN F 1 118 ? 32.156 11.694   17.759 1.00 46.40  ? 118 GLN C O   1 
ATOM 5759 C CB  . GLN F 1 118 ? 30.327 8.852    17.992 1.00 59.81  ? 118 GLN C CB  1 
ATOM 5760 C CG  . GLN F 1 118 ? 30.600 7.382    18.257 1.00 56.73  ? 118 GLN C CG  1 
ATOM 5761 C CD  . GLN F 1 118 ? 30.210 6.506    17.082 1.00 67.03  ? 118 GLN C CD  1 
ATOM 5762 O OE1 . GLN F 1 118 ? 29.242 6.793    16.373 1.00 66.34  ? 118 GLN C OE1 1 
ATOM 5763 N NE2 . GLN F 1 118 ? 30.959 5.430    16.869 1.00 70.67  ? 118 GLN C NE2 1 
ATOM 5764 N N   . LYS F 1 119 ? 29.958 11.874   18.255 1.00 48.56  ? 119 LYS C N   1 
ATOM 5765 C CA  . LYS F 1 119 ? 29.849 13.219   17.701 1.00 49.41  ? 119 LYS C CA  1 
ATOM 5766 C C   . LYS F 1 119 ? 30.775 14.181   18.436 1.00 35.25  ? 119 LYS C C   1 
ATOM 5767 O O   . LYS F 1 119 ? 31.469 14.990   17.810 1.00 31.27  ? 119 LYS C O   1 
ATOM 5768 C CB  . LYS F 1 119 ? 28.398 13.693   17.788 1.00 49.82  ? 119 LYS C CB  1 
ATOM 5769 C CG  . LYS F 1 119 ? 27.957 14.571   16.635 1.00 54.63  ? 119 LYS C CG  1 
ATOM 5770 C CD  . LYS F 1 119 ? 27.577 13.677   15.457 1.00 55.09  ? 119 LYS C CD  1 
ATOM 5771 C CE  . LYS F 1 119 ? 27.938 14.290   14.121 1.00 63.67  ? 119 LYS C CE  1 
ATOM 5772 N NZ  . LYS F 1 119 ? 27.724 13.315   13.013 1.00 53.76  ? 119 LYS C NZ  1 
ATOM 5773 N N   . GLU F 1 120 ? 30.820 14.077   19.769 1.00 34.85  ? 120 GLU C N   1 
ATOM 5774 C CA  . GLU F 1 120 ? 31.764 14.862   20.555 1.00 30.91  ? 120 GLU C CA  1 
ATOM 5775 C C   . GLU F 1 120 ? 33.196 14.664   20.072 1.00 31.54  ? 120 GLU C C   1 
ATOM 5776 O O   . GLU F 1 120 ? 33.954 15.631   19.938 1.00 35.26  ? 120 GLU C O   1 
ATOM 5777 C CB  . GLU F 1 120 ? 31.636 14.476   22.029 1.00 29.11  ? 120 GLU C CB  1 
ATOM 5778 C CG  . GLU F 1 120 ? 32.358 15.381   23.006 1.00 33.33  ? 120 GLU C CG  1 
ATOM 5779 C CD  . GLU F 1 120 ? 31.933 15.129   24.442 1.00 36.31  ? 120 GLU C CD  1 
ATOM 5780 O OE1 . GLU F 1 120 ? 31.156 14.179   24.672 1.00 39.63  ? 120 GLU C OE1 1 
ATOM 5781 O OE2 . GLU F 1 120 ? 32.391 15.861   25.343 1.00 33.78  ? 120 GLU C OE2 1 
ATOM 5782 N N   . ILE F 1 121 ? 33.576 13.421   19.771 1.00 38.07  ? 121 ILE C N   1 
ATOM 5783 C CA  . ILE F 1 121 ? 34.935 13.158   19.304 1.00 39.83  ? 121 ILE C CA  1 
ATOM 5784 C C   . ILE F 1 121 ? 35.176 13.846   17.967 1.00 39.91  ? 121 ILE C C   1 
ATOM 5785 O O   . ILE F 1 121 ? 36.188 14.531   17.773 1.00 38.63  ? 121 ILE C O   1 
ATOM 5786 C CB  . ILE F 1 121 ? 35.196 11.642   19.210 1.00 38.10  ? 121 ILE C CB  1 
ATOM 5787 C CG1 . ILE F 1 121 ? 35.377 11.025   20.600 1.00 39.05  ? 121 ILE C CG1 1 
ATOM 5788 C CG2 . ILE F 1 121 ? 36.412 11.361   18.342 1.00 34.51  ? 121 ILE C CG2 1 
ATOM 5789 C CD1 . ILE F 1 121 ? 35.446 9.514    20.588 1.00 31.48  ? 121 ILE C CD1 1 
ATOM 5790 N N   . GLU F 1 122 ? 34.239 13.684   17.029 1.00 45.77  ? 122 GLU C N   1 
ATOM 5791 C CA  . GLU F 1 122 ? 34.400 14.271   15.699 1.00 43.20  ? 122 GLU C CA  1 
ATOM 5792 C C   . GLU F 1 122 ? 34.536 15.790   15.772 1.00 45.14  ? 122 GLU C C   1 
ATOM 5793 O O   . GLU F 1 122 ? 35.471 16.379   15.205 1.00 43.58  ? 122 GLU C O   1 
ATOM 5794 C CB  . GLU F 1 122 ? 33.207 13.866   14.830 1.00 42.21  ? 122 GLU C CB  1 
ATOM 5795 C CG  . GLU F 1 122 ? 33.371 14.100   13.341 1.00 61.20  ? 122 GLU C CG  1 
ATOM 5796 C CD  . GLU F 1 122 ? 32.055 13.951   12.593 1.00 66.56  ? 122 GLU C CD  1 
ATOM 5797 O OE1 . GLU F 1 122 ? 32.082 13.757   11.357 1.00 59.85  ? 122 GLU C OE1 1 
ATOM 5798 O OE2 . GLU F 1 122 ? 30.993 14.020   13.248 1.00 58.20  ? 122 GLU C OE2 1 
ATOM 5799 N N   . GLN F 1 123 ? 33.618 16.441   16.489 1.00 47.48  ? 123 GLN C N   1 
ATOM 5800 C CA  . GLN F 1 123 ? 33.639 17.894   16.576 1.00 38.45  ? 123 GLN C CA  1 
ATOM 5801 C C   . GLN F 1 123 ? 34.836 18.395   17.376 1.00 37.76  ? 123 GLN C C   1 
ATOM 5802 O O   . GLN F 1 123 ? 35.286 19.524   17.159 1.00 41.34  ? 123 GLN C O   1 
ATOM 5803 C CB  . GLN F 1 123 ? 32.319 18.397   17.163 1.00 26.93  ? 123 GLN C CB  1 
ATOM 5804 C CG  . GLN F 1 123 ? 32.205 18.293   18.665 1.00 28.08  ? 123 GLN C CG  1 
ATOM 5805 C CD  . GLN F 1 123 ? 30.876 18.815   19.172 1.00 34.88  ? 123 GLN C CD  1 
ATOM 5806 O OE1 . GLN F 1 123 ? 29.878 18.812   18.445 1.00 25.08  ? 123 GLN C OE1 1 
ATOM 5807 N NE2 . GLN F 1 123 ? 30.853 19.264   20.423 1.00 58.92  ? 123 GLN C NE2 1 
ATOM 5808 N N   . LEU F 1 124 ? 35.372 17.585   18.295 1.00 37.56  ? 124 LEU C N   1 
ATOM 5809 C CA  . LEU F 1 124 ? 36.605 17.993   18.961 1.00 37.61  ? 124 LEU C CA  1 
ATOM 5810 C C   . LEU F 1 124 ? 37.813 17.838   18.054 1.00 34.66  ? 124 LEU C C   1 
ATOM 5811 O O   . LEU F 1 124 ? 38.774 18.604   18.175 1.00 40.35  ? 124 LEU C O   1 
ATOM 5812 C CB  . LEU F 1 124 ? 36.829 17.201   20.250 1.00 35.25  ? 124 LEU C CB  1 
ATOM 5813 C CG  . LEU F 1 124 ? 35.931 17.566   21.432 1.00 41.43  ? 124 LEU C CG  1 
ATOM 5814 C CD1 . LEU F 1 124 ? 35.992 16.489   22.508 1.00 40.70  ? 124 LEU C CD1 1 
ATOM 5815 C CD2 . LEU F 1 124 ? 36.309 18.929   21.994 1.00 34.83  ? 124 LEU C CD2 1 
ATOM 5816 N N   . GLN F 1 125 ? 37.790 16.865   17.146 1.00 38.99  ? 125 GLN C N   1 
ATOM 5817 C CA  . GLN F 1 125 ? 38.830 16.807   16.128 1.00 43.97  ? 125 GLN C CA  1 
ATOM 5818 C C   . GLN F 1 125 ? 38.796 18.054   15.261 1.00 37.07  ? 125 GLN C C   1 
ATOM 5819 O O   . GLN F 1 125 ? 39.841 18.657   14.975 1.00 35.39  ? 125 GLN C O   1 
ATOM 5820 C CB  . GLN F 1 125 ? 38.660 15.551   15.275 1.00 47.52  ? 125 GLN C CB  1 
ATOM 5821 C CG  . GLN F 1 125 ? 39.171 14.288   15.935 1.00 44.91  ? 125 GLN C CG  1 
ATOM 5822 C CD  . GLN F 1 125 ? 38.897 13.054   15.105 1.00 52.36  ? 125 GLN C CD  1 
ATOM 5823 O OE1 . GLN F 1 125 ? 37.756 12.790   14.724 1.00 51.34  ? 125 GLN C OE1 1 
ATOM 5824 N NE2 . GLN F 1 125 ? 39.946 12.296   14.809 1.00 53.89  ? 125 GLN C NE2 1 
ATOM 5825 N N   . GLU F 1 126 ? 37.595 18.467   14.849 1.00 38.78  ? 126 GLU C N   1 
ATOM 5826 C CA  . GLU F 1 126 ? 37.478 19.689   14.060 1.00 50.55  ? 126 GLU C CA  1 
ATOM 5827 C C   . GLU F 1 126 ? 37.914 20.910   14.867 1.00 52.91  ? 126 GLU C C   1 
ATOM 5828 O O   . GLU F 1 126 ? 38.550 21.828   14.331 1.00 46.31  ? 126 GLU C O   1 
ATOM 5829 C CB  . GLU F 1 126 ? 36.042 19.851   13.564 1.00 53.89  ? 126 GLU C CB  1 
ATOM 5830 C CG  . GLU F 1 126 ? 35.950 20.417   12.162 1.00 60.10  ? 126 GLU C CG  1 
ATOM 5831 C CD  . GLU F 1 126 ? 36.546 19.479   11.127 1.00 68.87  ? 126 GLU C CD  1 
ATOM 5832 O OE1 . GLU F 1 126 ? 36.477 18.246   11.328 1.00 64.75  ? 126 GLU C OE1 1 
ATOM 5833 O OE2 . GLU F 1 126 ? 37.096 19.972   10.119 1.00 74.34  ? 126 GLU C OE2 1 
ATOM 5834 N N   . LYS F 1 127 ? 37.584 20.933   16.161 1.00 53.49  ? 127 LYS C N   1 
ATOM 5835 C CA  . LYS F 1 127 ? 37.942 22.063   17.014 1.00 45.29  ? 127 LYS C CA  1 
ATOM 5836 C C   . LYS F 1 127 ? 39.455 22.184   17.155 1.00 40.47  ? 127 LYS C C   1 
ATOM 5837 O O   . LYS F 1 127 ? 40.016 23.275   17.023 1.00 48.28  ? 127 LYS C O   1 
ATOM 5838 C CB  . LYS F 1 127 ? 37.272 21.911   18.382 1.00 48.21  ? 127 LYS C CB  1 
ATOM 5839 C CG  . LYS F 1 127 ? 37.333 23.148   19.268 1.00 62.53  ? 127 LYS C CG  1 
ATOM 5840 C CD  . LYS F 1 127 ? 36.696 22.875   20.627 1.00 69.78  ? 127 LYS C CD  1 
ATOM 5841 C CE  . LYS F 1 127 ? 36.816 24.073   21.560 1.00 76.04  ? 127 LYS C CE  1 
ATOM 5842 N NZ  . LYS F 1 127 ? 36.317 23.761   22.932 1.00 68.25  ? 127 LYS C NZ  1 
ATOM 5843 N N   . TYR F 1 128 ? 40.133 21.065   17.422 1.00 39.55  ? 128 TYR C N   1 
ATOM 5844 C CA  . TYR F 1 128 ? 41.592 21.043   17.397 1.00 40.11  ? 128 TYR C CA  1 
ATOM 5845 C C   . TYR F 1 128 ? 42.118 21.571   16.068 1.00 40.67  ? 128 TYR C C   1 
ATOM 5846 O O   . TYR F 1 128 ? 43.047 22.394   16.029 1.00 35.52  ? 128 TYR C O   1 
ATOM 5847 C CB  . TYR F 1 128 ? 42.066 19.607   17.639 1.00 45.55  ? 128 TYR C CB  1 
ATOM 5848 C CG  . TYR F 1 128 ? 43.559 19.359   17.602 1.00 49.65  ? 128 TYR C CG  1 
ATOM 5849 C CD1 . TYR F 1 128 ? 44.182 18.939   16.434 1.00 46.76  ? 128 TYR C CD1 1 
ATOM 5850 C CD2 . TYR F 1 128 ? 44.337 19.501   18.746 1.00 52.21  ? 128 TYR C CD2 1 
ATOM 5851 C CE1 . TYR F 1 128 ? 45.544 18.692   16.397 1.00 48.83  ? 128 TYR C CE1 1 
ATOM 5852 C CE2 . TYR F 1 128 ? 45.701 19.251   18.720 1.00 50.68  ? 128 TYR C CE2 1 
ATOM 5853 C CZ  . TYR F 1 128 ? 46.299 18.849   17.541 1.00 47.31  ? 128 TYR C CZ  1 
ATOM 5854 O OH  . TYR F 1 128 ? 47.653 18.603   17.499 1.00 46.26  ? 128 TYR C OH  1 
ATOM 5855 N N   . LYS F 1 129 ? 41.499 21.135   14.967 1.00 50.51  ? 129 LYS C N   1 
ATOM 5856 C CA  . LYS F 1 129 ? 41.965 21.531   13.643 1.00 52.70  ? 129 LYS C CA  1 
ATOM 5857 C C   . LYS F 1 129 ? 41.835 23.034   13.412 1.00 44.01  ? 129 LYS C C   1 
ATOM 5858 O O   . LYS F 1 129 ? 42.677 23.621   12.723 1.00 46.51  ? 129 LYS C O   1 
ATOM 5859 C CB  . LYS F 1 129 ? 41.209 20.739   12.573 1.00 60.37  ? 129 LYS C CB  1 
ATOM 5860 C CG  . LYS F 1 129 ? 41.747 20.914   11.162 1.00 62.99  ? 129 LYS C CG  1 
ATOM 5861 C CD  . LYS F 1 129 ? 41.829 19.581   10.425 1.00 58.68  ? 129 LYS C CD  1 
ATOM 5862 C CE  . LYS F 1 129 ? 40.596 18.721   10.648 1.00 59.78  ? 129 LYS C CE  1 
ATOM 5863 N NZ  . LYS F 1 129 ? 39.401 19.289   9.970  1.00 62.99  ? 129 LYS C NZ  1 
ATOM 5864 N N   . THR F 1 130 ? 40.807 23.682   13.976 1.00 44.44  ? 130 THR C N   1 
ATOM 5865 C CA  . THR F 1 130 ? 40.729 25.137   13.838 1.00 42.68  ? 130 THR C CA  1 
ATOM 5866 C C   . THR F 1 130 ? 41.668 25.844   14.809 1.00 38.71  ? 130 THR C C   1 
ATOM 5867 O O   . THR F 1 130 ? 42.301 26.841   14.445 1.00 39.99  ? 130 THR C O   1 
ATOM 5868 C CB  . THR F 1 130 ? 39.299 25.650   14.050 1.00 38.32  ? 130 THR C CB  1 
ATOM 5869 O OG1 . THR F 1 130 ? 38.923 25.502   15.425 1.00 40.33  ? 130 THR C OG1 1 
ATOM 5870 C CG2 . THR F 1 130 ? 38.313 24.905   13.165 1.00 41.68  ? 130 THR C CG2 1 
ATOM 5871 N N   . GLU F 1 131 ? 41.769 25.344   16.044 1.00 38.45  ? 131 GLU C N   1 
ATOM 5872 C CA  . GLU F 1 131 ? 42.599 26.004   17.047 1.00 36.67  ? 131 GLU C CA  1 
ATOM 5873 C C   . GLU F 1 131 ? 44.060 26.052   16.619 1.00 38.06  ? 131 GLU C C   1 
ATOM 5874 O O   . GLU F 1 131 ? 44.756 27.039   16.882 1.00 43.47  ? 131 GLU C O   1 
ATOM 5875 C CB  . GLU F 1 131 ? 42.462 25.303   18.397 1.00 34.73  ? 131 GLU C CB  1 
ATOM 5876 C CG  . GLU F 1 131 ? 41.087 25.440   19.036 1.00 42.11  ? 131 GLU C CG  1 
ATOM 5877 C CD  . GLU F 1 131 ? 40.737 26.864   19.411 1.00 47.74  ? 131 GLU C CD  1 
ATOM 5878 O OE1 . GLU F 1 131 ? 41.660 27.666   19.659 1.00 49.81  ? 131 GLU C OE1 1 
ATOM 5879 O OE2 . GLU F 1 131 ? 39.530 27.178   19.460 1.00 54.28  ? 131 GLU C OE2 1 
ATOM 5880 N N   . LEU F 1 132 ? 44.549 25.003   15.952 1.00 46.33  ? 132 LEU C N   1 
ATOM 5881 C CA  . LEU F 1 132 ? 45.948 25.021   15.528 1.00 49.83  ? 132 LEU C CA  1 
ATOM 5882 C C   . LEU F 1 132 ? 46.189 26.074   14.449 1.00 46.06  ? 132 LEU C C   1 
ATOM 5883 O O   . LEU F 1 132 ? 47.153 26.849   14.525 1.00 50.37  ? 132 LEU C O   1 
ATOM 5884 C CB  . LEU F 1 132 ? 46.374 23.635   15.043 1.00 51.66  ? 132 LEU C CB  1 
ATOM 5885 C CG  . LEU F 1 132 ? 46.995 22.754   16.128 1.00 52.44  ? 132 LEU C CG  1 
ATOM 5886 C CD1 . LEU F 1 132 ? 45.946 22.300   17.118 1.00 42.74  ? 132 LEU C CD1 1 
ATOM 5887 C CD2 . LEU F 1 132 ? 47.701 21.558   15.517 1.00 72.08  ? 132 LEU C CD2 1 
ATOM 5888 N N   . CYS F 1 133 ? 45.309 26.142   13.449 1.00 44.63  ? 133 CYS C N   1 
ATOM 5889 C CA  . CYS F 1 133 ? 45.532 27.105   12.382 1.00 49.63  ? 133 CYS C CA  1 
ATOM 5890 C C   . CYS F 1 133 ? 45.250 28.531   12.833 1.00 46.52  ? 133 CYS C C   1 
ATOM 5891 O O   . CYS F 1 133 ? 45.790 29.468   12.236 1.00 50.83  ? 133 CYS C O   1 
ATOM 5892 C CB  . CYS F 1 133 ? 44.685 26.765   11.151 1.00 55.36  ? 133 CYS C CB  1 
ATOM 5893 S SG  . CYS F 1 133 ? 42.909 26.631   11.428 1.00 67.51  ? 133 CYS C SG  1 
ATOM 5894 N N   . THR F 1 134 ? 44.453 28.725   13.888 1.00 47.24  ? 134 THR C N   1 
ATOM 5895 C CA  . THR F 1 134 ? 44.325 30.072   14.432 1.00 43.44  ? 134 THR C CA  1 
ATOM 5896 C C   . THR F 1 134 ? 45.502 30.419   15.330 1.00 38.53  ? 134 THR C C   1 
ATOM 5897 O O   . THR F 1 134 ? 45.838 31.598   15.466 1.00 45.79  ? 134 THR C O   1 
ATOM 5898 C CB  . THR F 1 134 ? 43.012 30.245   15.199 1.00 35.44  ? 134 THR C CB  1 
ATOM 5899 O OG1 . THR F 1 134 ? 42.954 29.324   16.294 1.00 30.80  ? 134 THR C OG1 1 
ATOM 5900 C CG2 . THR F 1 134 ? 41.834 30.006   14.269 1.00 41.14  ? 134 THR C CG2 1 
ATOM 5901 N N   . LYS F 1 135 ? 46.134 29.421   15.949 1.00 37.40  ? 135 LYS C N   1 
ATOM 5902 C CA  . LYS F 1 135 ? 47.453 29.645   16.528 1.00 39.28  ? 135 LYS C CA  1 
ATOM 5903 C C   . LYS F 1 135 ? 48.404 30.190   15.476 1.00 41.04  ? 135 LYS C C   1 
ATOM 5904 O O   . LYS F 1 135 ? 49.070 31.213   15.685 1.00 44.92  ? 135 LYS C O   1 
ATOM 5905 C CB  . LYS F 1 135 ? 48.011 28.349   17.114 1.00 44.53  ? 135 LYS C CB  1 
ATOM 5906 C CG  . LYS F 1 135 ? 49.514 28.390   17.343 1.00 39.00  ? 135 LYS C CG  1 
ATOM 5907 C CD  . LYS F 1 135 ? 50.171 27.065   17.018 1.00 41.65  ? 135 LYS C CD  1 
ATOM 5908 C CE  . LYS F 1 135 ? 51.678 27.221   16.906 1.00 43.14  ? 135 LYS C CE  1 
ATOM 5909 N NZ  . LYS F 1 135 ? 52.322 27.363   18.242 1.00 40.11  ? 135 LYS C NZ  1 
ATOM 5910 N N   . GLN F 1 136 ? 48.473 29.518   14.323 1.00 43.01  ? 136 GLN C N   1 
ATOM 5911 C CA  . GLN F 1 136 ? 49.378 29.982   13.278 1.00 50.37  ? 136 GLN C CA  1 
ATOM 5912 C C   . GLN F 1 136 ? 48.955 31.335   12.720 1.00 52.61  ? 136 GLN C C   1 
ATOM 5913 O O   . GLN F 1 136 ? 49.806 32.110   12.270 1.00 53.50  ? 136 GLN C O   1 
ATOM 5914 C CB  . GLN F 1 136 ? 49.469 28.960   12.153 1.00 52.59  ? 136 GLN C CB  1 
ATOM 5915 C CG  . GLN F 1 136 ? 50.831 28.949   11.497 1.00 67.89  ? 136 GLN C CG  1 
ATOM 5916 C CD  . GLN F 1 136 ? 50.753 28.678   10.017 1.00 87.67  ? 136 GLN C CD  1 
ATOM 5917 O OE1 . GLN F 1 136 ? 49.885 27.938   9.554  1.00 90.08  ? 136 GLN C OE1 1 
ATOM 5918 N NE2 . GLN F 1 136 ? 51.656 29.290   9.258  1.00 90.10  ? 136 GLN C NE2 1 
ATOM 5919 N N   . ALA F 1 137 ? 47.652 31.631   12.724 1.00 51.76  ? 137 ALA C N   1 
ATOM 5920 C CA  . ALA F 1 137 ? 47.188 32.929   12.242 1.00 46.54  ? 137 ALA C CA  1 
ATOM 5921 C C   . ALA F 1 137 ? 47.582 34.042   13.201 1.00 43.57  ? 137 ALA C C   1 
ATOM 5922 O O   . ALA F 1 137 ? 47.988 35.124   12.767 1.00 42.82  ? 137 ALA C O   1 
ATOM 5923 C CB  . ALA F 1 137 ? 45.675 32.910   12.036 1.00 41.80  ? 137 ALA C CB  1 
ATOM 5924 N N   . LEU F 1 138 ? 47.452 33.800   14.507 1.00 41.10  ? 138 LEU C N   1 
ATOM 5925 C CA  . LEU F 1 138 ? 47.895 34.779   15.493 1.00 35.25  ? 138 LEU C CA  1 
ATOM 5926 C C   . LEU F 1 138 ? 49.395 35.009   15.384 1.00 40.85  ? 138 LEU C C   1 
ATOM 5927 O O   . LEU F 1 138 ? 49.857 36.154   15.287 1.00 49.66  ? 138 LEU C O   1 
ATOM 5928 C CB  . LEU F 1 138 ? 47.537 34.306   16.901 1.00 29.89  ? 138 LEU C CB  1 
ATOM 5929 C CG  . LEU F 1 138 ? 46.053 34.139   17.217 1.00 33.53  ? 138 LEU C CG  1 
ATOM 5930 C CD1 . LEU F 1 138 ? 45.867 33.654   18.646 1.00 33.27  ? 138 LEU C CD1 1 
ATOM 5931 C CD2 . LEU F 1 138 ? 45.283 35.424   16.961 1.00 41.82  ? 138 LEU C CD2 1 
ATOM 5932 N N   . LEU F 1 139 ? 50.170 33.922   15.393 1.00 44.47  ? 139 LEU C N   1 
ATOM 5933 C CA  . LEU F 1 139 ? 51.619 34.039   15.266 1.00 50.44  ? 139 LEU C CA  1 
ATOM 5934 C C   . LEU F 1 139 ? 51.994 34.789   13.994 1.00 51.69  ? 139 LEU C C   1 
ATOM 5935 O O   . LEU F 1 139 ? 52.898 35.637   14.000 1.00 50.08  ? 139 LEU C O   1 
ATOM 5936 C CB  . LEU F 1 139 ? 52.248 32.643   15.295 1.00 50.94  ? 139 LEU C CB  1 
ATOM 5937 C CG  . LEU F 1 139 ? 53.770 32.483   15.283 1.00 64.41  ? 139 LEU C CG  1 
ATOM 5938 C CD1 . LEU F 1 139 ? 54.159 31.219   16.035 1.00 50.51  ? 139 LEU C CD1 1 
ATOM 5939 C CD2 . LEU F 1 139 ? 54.314 32.432   13.856 1.00 63.31  ? 139 LEU C CD2 1 
ATOM 5940 N N   . ALA F 1 140 ? 51.293 34.501   12.896 1.00 53.50  ? 140 ALA C N   1 
ATOM 5941 C CA  . ALA F 1 140 ? 51.558 35.191   11.641 1.00 60.74  ? 140 ALA C CA  1 
ATOM 5942 C C   . ALA F 1 140 ? 51.198 36.670   11.733 1.00 57.91  ? 140 ALA C C   1 
ATOM 5943 O O   . ALA F 1 140 ? 51.886 37.517   11.152 1.00 60.17  ? 140 ALA C O   1 
ATOM 5944 C CB  . ALA F 1 140 ? 50.788 34.519   10.504 1.00 62.05  ? 140 ALA C CB  1 
ATOM 5945 N N   . GLU F 1 141 ? 50.124 37.003   12.456 1.00 57.57  ? 141 GLU C N   1 
ATOM 5946 C CA  . GLU F 1 141 ? 49.737 38.405   12.574 1.00 51.69  ? 141 GLU C CA  1 
ATOM 5947 C C   . GLU F 1 141 ? 50.728 39.196   13.415 1.00 47.63  ? 141 GLU C C   1 
ATOM 5948 O O   . GLU F 1 141 ? 51.005 40.359   13.112 1.00 53.78  ? 141 GLU C O   1 
ATOM 5949 C CB  . GLU F 1 141 ? 48.330 38.542   13.157 1.00 49.05  ? 141 GLU C CB  1 
ATOM 5950 C CG  . GLU F 1 141 ? 48.067 39.949   13.692 1.00 46.23  ? 141 GLU C CG  1 
ATOM 5951 C CD  . GLU F 1 141 ? 46.605 40.255   13.905 1.00 50.15  ? 141 GLU C CD  1 
ATOM 5952 O OE1 . GLU F 1 141 ? 46.306 41.268   14.571 1.00 36.62  ? 141 GLU C OE1 1 
ATOM 5953 O OE2 . GLU F 1 141 ? 45.755 39.495   13.397 1.00 67.88  ? 141 GLU C OE2 1 
ATOM 5954 N N   . LEU F 1 142 ? 51.266 38.603   14.482 1.00 45.34  ? 142 LEU C N   1 
ATOM 5955 C CA  . LEU F 1 142 ? 52.227 39.364   15.274 1.00 43.16  ? 142 LEU C CA  1 
ATOM 5956 C C   . LEU F 1 142 ? 53.576 39.453   14.568 1.00 41.69  ? 142 LEU C C   1 
ATOM 5957 O O   . LEU F 1 142 ? 54.254 40.485   14.649 1.00 42.73  ? 142 LEU C O   1 
ATOM 5958 C CB  . LEU F 1 142 ? 52.359 38.779   16.685 1.00 41.78  ? 142 LEU C CB  1 
ATOM 5959 C CG  . LEU F 1 142 ? 53.231 37.586   17.067 1.00 45.13  ? 142 LEU C CG  1 
ATOM 5960 C CD1 . LEU F 1 142 ? 54.668 38.015   17.337 1.00 44.74  ? 142 LEU C CD1 1 
ATOM 5961 C CD2 . LEU F 1 142 ? 52.638 36.922   18.295 1.00 43.01  ? 142 LEU C CD2 1 
ATOM 5962 N N   . GLU F 1 143 ? 53.989 38.384   13.880 1.00 53.29  ? 143 GLU C N   1 
ATOM 5963 C CA  . GLU F 1 143 ? 55.222 38.458   13.099 1.00 59.18  ? 143 GLU C CA  1 
ATOM 5964 C C   . GLU F 1 143 ? 55.105 39.493   11.985 1.00 55.16  ? 143 GLU C C   1 
ATOM 5965 O O   . GLU F 1 143 ? 56.065 40.216   11.693 1.00 55.68  ? 143 GLU C O   1 
ATOM 5966 C CB  . GLU F 1 143 ? 55.569 37.083   12.530 1.00 60.29  ? 143 GLU C CB  1 
ATOM 5967 C CG  . GLU F 1 143 ? 57.055 36.885   12.304 1.00 68.74  ? 143 GLU C CG  1 
ATOM 5968 C CD  . GLU F 1 143 ? 57.827 36.792   13.603 1.00 85.27  ? 143 GLU C CD  1 
ATOM 5969 O OE1 . GLU F 1 143 ? 57.474 35.941   14.448 1.00 93.97  ? 143 GLU C OE1 1 
ATOM 5970 O OE2 . GLU F 1 143 ? 58.785 37.576   13.782 1.00 75.52  ? 143 GLU C OE2 1 
ATOM 5971 N N   . GLU F 1 144 ? 53.936 39.563   11.345 1.00 55.75  ? 144 GLU C N   1 
ATOM 5972 C CA  . GLU F 1 144 ? 53.638 40.637   10.400 1.00 53.68  ? 144 GLU C CA  1 
ATOM 5973 C C   . GLU F 1 144 ? 53.597 41.995   11.092 1.00 49.33  ? 144 GLU C C   1 
ATOM 5974 O O   . GLU F 1 144 ? 53.940 43.019   10.493 1.00 43.74  ? 144 GLU C O   1 
ATOM 5975 C CB  . GLU F 1 144 ? 52.307 40.329   9.710  1.00 59.83  ? 144 GLU C CB  1 
ATOM 5976 C CG  . GLU F 1 144 ? 51.420 41.519   9.422  1.00 55.23  ? 144 GLU C CG  1 
ATOM 5977 C CD  . GLU F 1 144 ? 50.014 41.092   9.051  1.00 62.07  ? 144 GLU C CD  1 
ATOM 5978 O OE1 . GLU F 1 144 ? 49.857 40.287   8.109  1.00 70.89  ? 144 GLU C OE1 1 
ATOM 5979 O OE2 . GLU F 1 144 ? 49.065 41.544   9.722  1.00 63.06  ? 144 GLU C OE2 1 
ATOM 5980 N N   . GLN F 1 145 ? 53.169 42.013   12.348 1.00 51.58  ? 145 GLN C N   1 
ATOM 5981 C CA  . GLN F 1 145 ? 53.007 43.240   13.114 1.00 37.42  ? 145 GLN C CA  1 
ATOM 5982 C C   . GLN F 1 145 ? 54.354 43.839   13.499 1.00 38.67  ? 145 GLN C C   1 
ATOM 5983 O O   . GLN F 1 145 ? 54.469 45.058   13.679 1.00 45.03  ? 145 GLN C O   1 
ATOM 5984 C CB  . GLN F 1 145 ? 52.157 42.899   14.334 1.00 35.24  ? 145 GLN C CB  1 
ATOM 5985 C CG  . GLN F 1 145 ? 52.071 43.890   15.441 1.00 39.86  ? 145 GLN C CG  1 
ATOM 5986 C CD  . GLN F 1 145 ? 51.302 43.306   16.608 1.00 38.36  ? 145 GLN C CD  1 
ATOM 5987 O OE1 . GLN F 1 145 ? 51.883 42.703   17.510 1.00 33.45  ? 145 GLN C OE1 1 
ATOM 5988 N NE2 . GLN F 1 145 ? 49.987 43.440   16.572 1.00 36.90  ? 145 GLN C NE2 1 
ATOM 5989 N N   . LYS F 1 146 ? 55.384 42.997   13.611 1.00 45.47  ? 146 LYS C N   1 
ATOM 5990 C CA  . LYS F 1 146 ? 56.727 43.486   13.905 1.00 46.35  ? 146 LYS C CA  1 
ATOM 5991 C C   . LYS F 1 146 ? 57.212 44.470   12.844 1.00 44.01  ? 146 LYS C C   1 
ATOM 5992 O O   . LYS F 1 146 ? 57.907 45.442   13.164 1.00 43.53  ? 146 LYS C O   1 
ATOM 5993 C CB  . LYS F 1 146 ? 57.692 42.302   14.023 1.00 57.13  ? 146 LYS C CB  1 
ATOM 5994 C CG  . LYS F 1 146 ? 59.112 42.665   14.442 1.00 63.33  ? 146 LYS C CG  1 
ATOM 5995 C CD  . LYS F 1 146 ? 60.142 41.820   13.699 1.00 56.11  ? 146 LYS C CD  1 
ATOM 5996 C CE  . LYS F 1 146 ? 60.155 42.161   12.213 1.00 62.24  ? 146 LYS C CE  1 
ATOM 5997 N NZ  . LYS F 1 146 ? 61.066 41.285   11.423 1.00 62.20  ? 146 LYS C NZ  1 
ATOM 5998 N N   . ILE F 1 147 ? 56.853 44.242   11.576 1.00 43.86  ? 147 ILE C N   1 
ATOM 5999 C CA  . ILE F 1 147 ? 57.394 45.081   10.508 1.00 45.58  ? 147 ILE C CA  1 
ATOM 6000 C C   . ILE F 1 147 ? 56.800 46.486   10.575 1.00 48.00  ? 147 ILE C C   1 
ATOM 6001 O O   . ILE F 1 147 ? 57.522 47.480   10.434 1.00 53.10  ? 147 ILE C O   1 
ATOM 6002 C CB  . ILE F 1 147 ? 57.199 44.420   9.124  1.00 45.62  ? 147 ILE C CB  1 
ATOM 6003 C CG1 . ILE F 1 147 ? 58.086 45.095   8.074  1.00 50.72  ? 147 ILE C CG1 1 
ATOM 6004 C CG2 . ILE F 1 147 ? 55.764 44.480   8.643  1.00 40.71  ? 147 ILE C CG2 1 
ATOM 6005 C CD1 . ILE F 1 147 ? 59.537 44.665   8.118  1.00 52.68  ? 147 ILE C CD1 1 
ATOM 6006 N N   . VAL F 1 148 ? 55.486 46.603   10.794 1.00 45.11  ? 148 VAL C N   1 
ATOM 6007 C CA  . VAL F 1 148 ? 54.903 47.936   10.919 1.00 46.07  ? 148 VAL C CA  1 
ATOM 6008 C C   . VAL F 1 148 ? 55.352 48.583   12.219 1.00 43.70  ? 148 VAL C C   1 
ATOM 6009 O O   . VAL F 1 148 ? 55.559 49.803   12.277 1.00 43.82  ? 148 VAL C O   1 
ATOM 6010 C CB  . VAL F 1 148 ? 53.367 47.886   10.814 1.00 40.96  ? 148 VAL C CB  1 
ATOM 6011 C CG1 . VAL F 1 148 ? 52.949 47.221   9.516  1.00 42.67  ? 148 VAL C CG1 1 
ATOM 6012 C CG2 . VAL F 1 148 ? 52.758 47.180   12.012 1.00 38.92  ? 148 VAL C CG2 1 
ATOM 6013 N N   . GLN F 1 149 ? 55.536 47.781   13.272 1.00 40.30  ? 149 GLN C N   1 
ATOM 6014 C CA  . GLN F 1 149 ? 56.053 48.313   14.525 1.00 43.48  ? 149 GLN C CA  1 
ATOM 6015 C C   . GLN F 1 149 ? 57.414 48.965   14.319 1.00 47.08  ? 149 GLN C C   1 
ATOM 6016 O O   . GLN F 1 149 ? 57.678 50.054   14.842 1.00 48.77  ? 149 GLN C O   1 
ATOM 6017 C CB  . GLN F 1 149 ? 56.135 47.194   15.561 1.00 47.80  ? 149 GLN C CB  1 
ATOM 6018 C CG  . GLN F 1 149 ? 56.085 47.662   16.998 1.00 53.75  ? 149 GLN C CG  1 
ATOM 6019 C CD  . GLN F 1 149 ? 55.512 46.605   17.919 1.00 58.64  ? 149 GLN C CD  1 
ATOM 6020 O OE1 . GLN F 1 149 ? 54.643 45.825   17.525 1.00 48.29  ? 149 GLN C OE1 1 
ATOM 6021 N NE2 . GLN F 1 149 ? 56.005 46.565   19.151 1.00 63.81  ? 149 GLN C NE2 1 
ATOM 6022 N N   . ALA F 1 150 ? 58.297 48.308   13.564 1.00 50.26  ? 150 ALA C N   1 
ATOM 6023 C CA  . ALA F 1 150 ? 59.610 48.880   13.288 1.00 50.16  ? 150 ALA C CA  1 
ATOM 6024 C C   . ALA F 1 150 ? 59.532 50.026   12.286 1.00 44.58  ? 150 ALA C C   1 
ATOM 6025 O O   . ALA F 1 150 ? 60.377 50.927   12.312 1.00 46.11  ? 150 ALA C O   1 
ATOM 6026 C CB  . ALA F 1 150 ? 60.561 47.796   12.782 1.00 57.29  ? 150 ALA C CB  1 
ATOM 6027 N N   . LYS F 1 151 ? 58.544 50.000   11.391 1.00 42.30  ? 151 LYS C N   1 
ATOM 6028 C CA  . LYS F 1 151 ? 58.437 51.041   10.373 1.00 52.41  ? 151 LYS C CA  1 
ATOM 6029 C C   . LYS F 1 151 ? 57.967 52.367   10.968 1.00 53.17  ? 151 LYS C C   1 
ATOM 6030 O O   . LYS F 1 151 ? 58.446 53.435   10.568 1.00 45.23  ? 151 LYS C O   1 
ATOM 6031 C CB  . LYS F 1 151 ? 57.502 50.583   9.253  1.00 50.62  ? 151 LYS C CB  1 
ATOM 6032 C CG  . LYS F 1 151 ? 57.458 51.529   8.067  1.00 58.19  ? 151 LYS C CG  1 
ATOM 6033 C CD  . LYS F 1 151 ? 58.683 51.341   7.182  1.00 65.54  ? 151 LYS C CD  1 
ATOM 6034 C CE  . LYS F 1 151 ? 58.698 52.327   6.022  1.00 80.20  ? 151 LYS C CE  1 
ATOM 6035 N NZ  . LYS F 1 151 ? 57.423 52.313   5.253  1.00 87.16  ? 151 LYS C NZ  1 
ATOM 6036 N N   . LEU F 1 152 ? 57.018 52.328   11.908 1.00 52.32  ? 152 LEU C N   1 
ATOM 6037 C CA  . LEU F 1 152 ? 56.626 53.560   12.591 1.00 43.87  ? 152 LEU C CA  1 
ATOM 6038 C C   . LEU F 1 152 ? 57.789 54.152   13.376 1.00 42.27  ? 152 LEU C C   1 
ATOM 6039 O O   . LEU F 1 152 ? 57.932 55.377   13.456 1.00 42.54  ? 152 LEU C O   1 
ATOM 6040 C CB  . LEU F 1 152 ? 55.427 53.311   13.505 1.00 44.84  ? 152 LEU C CB  1 
ATOM 6041 C CG  . LEU F 1 152 ? 54.098 53.043   12.796 1.00 48.03  ? 152 LEU C CG  1 
ATOM 6042 C CD1 . LEU F 1 152 ? 52.947 53.112   13.781 1.00 46.70  ? 152 LEU C CD1 1 
ATOM 6043 C CD2 . LEU F 1 152 ? 53.889 54.040   11.667 1.00 38.94  ? 152 LEU C CD2 1 
ATOM 6044 N N   . LYS F 1 153 ? 58.630 53.299   13.965 1.00 47.20  ? 153 LYS C N   1 
ATOM 6045 C CA  . LYS F 1 153 ? 59.845 53.779   14.613 1.00 48.10  ? 153 LYS C CA  1 
ATOM 6046 C C   . LYS F 1 153 ? 60.755 54.525   13.645 1.00 48.32  ? 153 LYS C C   1 
ATOM 6047 O O   . LYS F 1 153 ? 61.558 55.356   14.083 1.00 47.09  ? 153 LYS C O   1 
ATOM 6048 C CB  . LYS F 1 153 ? 60.602 52.608   15.246 1.00 48.61  ? 153 LYS C CB  1 
ATOM 6049 C CG  . LYS F 1 153 ? 60.090 52.195   16.620 1.00 50.61  ? 153 LYS C CG  1 
ATOM 6050 C CD  . LYS F 1 153 ? 61.065 51.247   17.315 1.00 55.25  ? 153 LYS C CD  1 
ATOM 6051 C CE  . LYS F 1 153 ? 62.387 51.927   17.657 1.00 49.27  ? 153 LYS C CE  1 
ATOM 6052 N NZ  . LYS F 1 153 ? 62.508 52.243   19.108 1.00 39.07  ? 153 LYS C NZ  1 
ATOM 6053 N N   . GLN F 1 154 ? 60.641 54.253   12.341 1.00 48.19  ? 154 GLN C N   1 
ATOM 6054 C CA  . GLN F 1 154 ? 61.473 54.948   11.363 1.00 52.51  ? 154 GLN C CA  1 
ATOM 6055 C C   . GLN F 1 154 ? 61.046 56.403   11.205 1.00 51.12  ? 154 GLN C C   1 
ATOM 6056 O O   . GLN F 1 154 ? 61.897 57.300   11.154 1.00 50.46  ? 154 GLN C O   1 
ATOM 6057 C CB  . GLN F 1 154 ? 61.422 54.219   10.017 1.00 56.89  ? 154 GLN C CB  1 
ATOM 6058 C CG  . GLN F 1 154 ? 62.179 54.914   8.884  1.00 63.46  ? 154 GLN C CG  1 
ATOM 6059 C CD  . GLN F 1 154 ? 61.538 54.704   7.515  1.00 64.89  ? 154 GLN C CD  1 
ATOM 6060 O OE1 . GLN F 1 154 ? 60.340 54.926   7.334  1.00 60.74  ? 154 GLN C OE1 1 
ATOM 6061 N NE2 . GLN F 1 154 ? 62.341 54.278   6.544  1.00 65.61  ? 154 GLN C NE2 1 
ATOM 6062 N N   . THR F 1 155 ? 59.737 56.663   11.130 1.00 52.38  ? 155 THR C N   1 
ATOM 6063 C CA  . THR F 1 155 ? 59.279 58.046   11.025 1.00 44.30  ? 155 THR C CA  1 
ATOM 6064 C C   . THR F 1 155 ? 59.610 58.829   12.289 1.00 39.60  ? 155 THR C C   1 
ATOM 6065 O O   . THR F 1 155 ? 60.049 59.980   12.208 1.00 48.11  ? 155 THR C O   1 
ATOM 6066 C CB  . THR F 1 155 ? 57.777 58.104   10.738 1.00 43.02  ? 155 THR C CB  1 
ATOM 6067 O OG1 . THR F 1 155 ? 57.046 57.713   11.906 1.00 52.05  ? 155 THR C OG1 1 
ATOM 6068 C CG2 . THR F 1 155 ? 57.413 57.183   9.579  1.00 37.94  ? 155 THR C CG2 1 
ATOM 6069 N N   . LEU F 1 156 ? 59.407 58.224   13.464 1.00 36.86  ? 156 LEU C N   1 
ATOM 6070 C CA  . LEU F 1 156 ? 59.826 58.869   14.705 1.00 38.67  ? 156 LEU C CA  1 
ATOM 6071 C C   . LEU F 1 156 ? 61.325 59.136   14.712 1.00 44.46  ? 156 LEU C C   1 
ATOM 6072 O O   . LEU F 1 156 ? 61.777 60.166   15.226 1.00 48.85  ? 156 LEU C O   1 
ATOM 6073 C CB  . LEU F 1 156 ? 59.428 58.020   15.914 1.00 43.68  ? 156 LEU C CB  1 
ATOM 6074 C CG  . LEU F 1 156 ? 58.116 58.361   16.633 1.00 45.66  ? 156 LEU C CG  1 
ATOM 6075 C CD1 . LEU F 1 156 ? 57.019 58.712   15.652 1.00 45.40  ? 156 LEU C CD1 1 
ATOM 6076 C CD2 . LEU F 1 156 ? 57.674 57.226   17.552 1.00 35.09  ? 156 LEU C CD2 1 
ATOM 6077 N N   . THR F 1 157 ? 62.116 58.213   14.160 1.00 44.64  ? 157 THR C N   1 
ATOM 6078 C CA  . THR F 1 157 ? 63.548 58.461   14.029 1.00 45.26  ? 157 THR C CA  1 
ATOM 6079 C C   . THR F 1 157 ? 63.819 59.675   13.151 1.00 50.20  ? 157 THR C C   1 
ATOM 6080 O O   . THR F 1 157 ? 64.707 60.482   13.451 1.00 54.79  ? 157 THR C O   1 
ATOM 6081 C CB  . THR F 1 157 ? 64.251 57.229   13.463 1.00 40.93  ? 157 THR C CB  1 
ATOM 6082 O OG1 . THR F 1 157 ? 63.930 56.086   14.264 1.00 49.37  ? 157 THR C OG1 1 
ATOM 6083 C CG2 . THR F 1 157 ? 65.760 57.433   13.455 1.00 34.51  ? 157 THR C CG2 1 
ATOM 6084 N N   . PHE F 1 158 ? 63.058 59.828   12.063 1.00 48.57  ? 158 PHE C N   1 
ATOM 6085 C CA  . PHE F 1 158 ? 63.255 60.973   11.180 1.00 50.49  ? 158 PHE C CA  1 
ATOM 6086 C C   . PHE F 1 158 ? 62.866 62.274   11.871 1.00 54.39  ? 158 PHE C C   1 
ATOM 6087 O O   . PHE F 1 158 ? 63.529 63.301   11.693 1.00 56.05  ? 158 PHE C O   1 
ATOM 6088 C CB  . PHE F 1 158 ? 62.455 60.792   9.891  1.00 48.33  ? 158 PHE C CB  1 
ATOM 6089 C CG  . PHE F 1 158 ? 62.102 62.084   9.209  1.00 50.26  ? 158 PHE C CG  1 
ATOM 6090 C CD1 . PHE F 1 158 ? 63.090 62.895   8.672  1.00 53.57  ? 158 PHE C CD1 1 
ATOM 6091 C CD2 . PHE F 1 158 ? 60.784 62.489   9.108  1.00 52.69  ? 158 PHE C CD2 1 
ATOM 6092 C CE1 . PHE F 1 158 ? 62.765 64.080   8.042  1.00 61.93  ? 158 PHE C CE1 1 
ATOM 6093 C CE2 . PHE F 1 158 ? 60.454 63.675   8.483  1.00 51.32  ? 158 PHE C CE2 1 
ATOM 6094 C CZ  . PHE F 1 158 ? 61.444 64.471   7.949  1.00 56.23  ? 158 PHE C CZ  1 
ATOM 6095 N N   . PHE F 1 159 ? 61.783 62.254   12.649 1.00 49.30  ? 159 PHE C N   1 
ATOM 6096 C CA  . PHE F 1 159 ? 61.377 63.450   13.377 1.00 43.93  ? 159 PHE C CA  1 
ATOM 6097 C C   . PHE F 1 159 ? 62.412 63.823   14.428 1.00 54.41  ? 159 PHE C C   1 
ATOM 6098 O O   . PHE F 1 159 ? 62.744 65.004   14.595 1.00 58.18  ? 159 PHE C O   1 
ATOM 6099 C CB  . PHE F 1 159 ? 60.019 63.224   14.032 1.00 39.43  ? 159 PHE C CB  1 
ATOM 6100 C CG  . PHE F 1 159 ? 58.857 63.476   13.123 1.00 41.29  ? 159 PHE C CG  1 
ATOM 6101 C CD1 . PHE F 1 159 ? 59.017 63.471   11.751 1.00 44.32  ? 159 PHE C CD1 1 
ATOM 6102 C CD2 . PHE F 1 159 ? 57.601 63.707   13.642 1.00 43.97  ? 159 PHE C CD2 1 
ATOM 6103 C CE1 . PHE F 1 159 ? 57.940 63.693   10.916 1.00 48.76  ? 159 PHE C CE1 1 
ATOM 6104 C CE2 . PHE F 1 159 ? 56.522 63.936   12.818 1.00 50.01  ? 159 PHE C CE2 1 
ATOM 6105 C CZ  . PHE F 1 159 ? 56.689 63.928   11.452 1.00 53.37  ? 159 PHE C CZ  1 
ATOM 6106 N N   . ASP F 1 160 ? 62.928 62.826   15.151 1.00 58.45  ? 160 ASP C N   1 
ATOM 6107 C CA  . ASP F 1 160 ? 63.952 63.089   16.154 1.00 59.79  ? 160 ASP C CA  1 
ATOM 6108 C C   . ASP F 1 160 ? 65.224 63.620   15.509 1.00 59.10  ? 160 ASP C C   1 
ATOM 6109 O O   . ASP F 1 160 ? 65.882 64.509   16.059 1.00 62.47  ? 160 ASP C O   1 
ATOM 6110 C CB  . ASP F 1 160 ? 64.238 61.818   16.952 1.00 59.28  ? 160 ASP C CB  1 
ATOM 6111 C CG  . ASP F 1 160 ? 63.218 61.580   18.049 1.00 70.50  ? 160 ASP C CG  1 
ATOM 6112 O OD1 . ASP F 1 160 ? 62.423 62.501   18.337 1.00 73.22  ? 160 ASP C OD1 1 
ATOM 6113 O OD2 . ASP F 1 160 ? 63.208 60.472   18.623 1.00 80.17  ? 160 ASP C OD2 1 
ATOM 6114 N N   . GLU F 1 161 ? 65.585 63.091   14.338 1.00 55.62  ? 161 GLU C N   1 
ATOM 6115 C CA  . GLU F 1 161 ? 66.718 63.644   13.607 1.00 61.41  ? 161 GLU C CA  1 
ATOM 6116 C C   . GLU F 1 161 ? 66.422 65.048   13.106 1.00 67.22  ? 161 GLU C C   1 
ATOM 6117 O O   . GLU F 1 161 ? 67.346 65.846   12.919 1.00 70.52  ? 161 GLU C O   1 
ATOM 6118 C CB  . GLU F 1 161 ? 67.095 62.752   12.426 1.00 59.77  ? 161 GLU C CB  1 
ATOM 6119 C CG  . GLU F 1 161 ? 67.827 61.485   12.788 1.00 55.64  ? 161 GLU C CG  1 
ATOM 6120 C CD  . GLU F 1 161 ? 68.344 60.770   11.558 1.00 67.03  ? 161 GLU C CD  1 
ATOM 6121 O OE1 . GLU F 1 161 ? 69.580 60.702   11.384 1.00 66.59  ? 161 GLU C OE1 1 
ATOM 6122 O OE2 . GLU F 1 161 ? 67.516 60.288   10.758 1.00 73.50  ? 161 GLU C OE2 1 
ATOM 6123 N N   . LEU F 1 162 ? 65.152 65.358   12.857 1.00 61.21  ? 162 LEU C N   1 
ATOM 6124 C CA  . LEU F 1 162 ? 64.794 66.697   12.414 1.00 54.82  ? 162 LEU C CA  1 
ATOM 6125 C C   . LEU F 1 162 ? 64.959 67.699   13.549 1.00 59.77  ? 162 LEU C C   1 
ATOM 6126 O O   . LEU F 1 162 ? 65.540 68.774   13.363 1.00 64.18  ? 162 LEU C O   1 
ATOM 6127 C CB  . LEU F 1 162 ? 63.360 66.694   11.887 1.00 49.73  ? 162 LEU C CB  1 
ATOM 6128 C CG  . LEU F 1 162 ? 62.961 67.806   10.926 1.00 50.50  ? 162 LEU C CG  1 
ATOM 6129 C CD1 . LEU F 1 162 ? 63.742 67.660   9.635  1.00 52.78  ? 162 LEU C CD1 1 
ATOM 6130 C CD2 . LEU F 1 162 ? 61.469 67.754   10.657 1.00 46.25  ? 162 LEU C CD2 1 
ATOM 6131 N N   . HIS F 1 163 ? 64.465 67.354   14.740 1.00 64.42  ? 163 HIS C N   1 
ATOM 6132 C CA  . HIS F 1 163 ? 64.681 68.209   15.902 1.00 67.67  ? 163 HIS C CA  1 
ATOM 6133 C C   . HIS F 1 163 ? 66.153 68.256   16.303 1.00 67.73  ? 163 HIS C C   1 
ATOM 6134 O O   . HIS F 1 163 ? 66.598 69.243   16.897 1.00 64.91  ? 163 HIS C O   1 
ATOM 6135 C CB  . HIS F 1 163 ? 63.818 67.729   17.071 1.00 70.55  ? 163 HIS C CB  1 
ATOM 6136 C CG  . HIS F 1 163 ? 63.785 68.675   18.231 1.00 69.21  ? 163 HIS C CG  1 
ATOM 6137 N ND1 . HIS F 1 163 ? 64.859 68.859   19.076 1.00 67.27  ? 163 HIS C ND1 1 
ATOM 6138 C CD2 . HIS F 1 163 ? 62.801 69.483   18.693 1.00 68.16  ? 163 HIS C CD2 1 
ATOM 6139 C CE1 . HIS F 1 163 ? 64.540 69.743   20.004 1.00 68.39  ? 163 HIS C CE1 1 
ATOM 6140 N NE2 . HIS F 1 163 ? 63.297 70.137   19.795 1.00 70.17  ? 163 HIS C NE2 1 
ATOM 6141 N N   . ASN F 1 164 ? 66.917 67.201   16.000 1.00 70.46  ? 164 ASN C N   1 
ATOM 6142 C CA  . ASN F 1 164 ? 68.350 67.213   16.285 1.00 72.06  ? 164 ASN C CA  1 
ATOM 6143 C C   . ASN F 1 164 ? 69.090 68.142   15.333 1.00 71.61  ? 164 ASN C C   1 
ATOM 6144 O O   . ASN F 1 164 ? 69.936 68.939   15.754 1.00 75.39  ? 164 ASN C O   1 
ATOM 6145 C CB  . ASN F 1 164 ? 68.925 65.798   16.193 1.00 70.08  ? 164 ASN C CB  1 
ATOM 6146 C CG  . ASN F 1 164 ? 68.644 64.967   17.428 1.00 77.55  ? 164 ASN C CG  1 
ATOM 6147 O OD1 . ASN F 1 164 ? 69.283 65.144   18.465 1.00 86.63  ? 164 ASN C OD1 1 
ATOM 6148 N ND2 . ASN F 1 164 ? 67.702 64.039   17.316 1.00 76.81  ? 164 ASN C ND2 1 
ATOM 6149 N N   . VAL F 1 165 ? 68.780 68.049   14.038 1.00 66.20  ? 165 VAL C N   1 
ATOM 6150 C CA  . VAL F 1 165 ? 69.422 68.890   13.039 1.00 68.39  ? 165 VAL C CA  1 
ATOM 6151 C C   . VAL F 1 165 ? 68.953 70.333   13.174 1.00 73.92  ? 165 VAL C C   1 
ATOM 6152 O O   . VAL F 1 165 ? 69.657 71.261   12.754 1.00 69.66  ? 165 VAL C O   1 
ATOM 6153 C CB  . VAL F 1 165 ? 69.151 68.292   11.642 1.00 68.15  ? 165 VAL C CB  1 
ATOM 6154 C CG1 . VAL F 1 165 ? 69.306 69.323   10.539 1.00 75.35  ? 165 VAL C CG1 1 
ATOM 6155 C CG2 . VAL F 1 165 ? 70.067 67.102   11.391 1.00 74.08  ? 165 VAL C CG2 1 
ATOM 6156 N N   . GLY F 1 166 ? 67.794 70.547   13.792 1.00 74.31  ? 166 GLY C N   1 
ATOM 6157 C CA  . GLY F 1 166 ? 67.355 71.879   14.155 1.00 69.53  ? 166 GLY C CA  1 
ATOM 6158 C C   . GLY F 1 166 ? 68.058 72.408   15.389 1.00 68.93  ? 166 GLY C C   1 
ATOM 6159 O O   . GLY F 1 166 ? 68.420 73.586   15.439 1.00 66.41  ? 166 GLY C O   1 
ATOM 6160 N N   . ARG F 1 167 ? 68.257 71.549   16.393 1.00 72.16  ? 167 ARG C N   1 
ATOM 6161 C CA  . ARG F 1 167 ? 68.935 71.980   17.613 1.00 69.94  ? 167 ARG C CA  1 
ATOM 6162 C C   . ARG F 1 167 ? 70.338 72.478   17.303 1.00 70.74  ? 167 ARG C C   1 
ATOM 6163 O O   . ARG F 1 167 ? 70.737 73.563   17.742 1.00 79.38  ? 167 ARG C O   1 
ATOM 6164 C CB  . ARG F 1 167 ? 68.974 70.844   18.633 1.00 73.16  ? 167 ARG C CB  1 
ATOM 6165 C CG  . ARG F 1 167 ? 70.008 71.043   19.728 1.00 69.80  ? 167 ARG C CG  1 
ATOM 6166 C CD  . ARG F 1 167 ? 71.091 69.989   19.669 1.00 74.63  ? 167 ARG C CD  1 
ATOM 6167 N NE  . ARG F 1 167 ? 70.537 68.650   19.836 1.00 85.17  ? 167 ARG C NE  1 
ATOM 6168 C CZ  . ARG F 1 167 ? 70.306 68.080   21.013 1.00 92.30  ? 167 ARG C CZ  1 
ATOM 6169 N NH1 . ARG F 1 167 ? 70.575 68.739   22.133 1.00 88.30  ? 167 ARG C NH1 1 
ATOM 6170 N NH2 . ARG F 1 167 ? 69.800 66.855   21.071 1.00 96.00  ? 167 ARG C NH2 1 
ATOM 6171 N N   . ASP F 1 168 ? 71.103 71.698   16.546 1.00 68.94  ? 168 ASP C N   1 
ATOM 6172 C CA  . ASP F 1 168 ? 72.304 72.237   15.930 1.00 73.51  ? 168 ASP C CA  1 
ATOM 6173 C C   . ASP F 1 168 ? 71.904 73.245   14.863 1.00 77.92  ? 168 ASP C C   1 
ATOM 6174 O O   . ASP F 1 168 ? 70.822 73.158   14.278 1.00 76.09  ? 168 ASP C O   1 
ATOM 6175 C CB  . ASP F 1 168 ? 73.150 71.122   15.318 1.00 71.94  ? 168 ASP C CB  1 
ATOM 6176 C CG  . ASP F 1 168 ? 73.476 70.027   16.311 1.00 76.43  ? 168 ASP C CG  1 
ATOM 6177 O OD1 . ASP F 1 168 ? 72.658 69.097   16.464 1.00 75.04  ? 168 ASP C OD1 1 
ATOM 6178 O OD2 . ASP F 1 168 ? 74.553 70.098   16.940 1.00 82.54  ? 168 ASP C OD2 1 
ATOM 6179 N N   . HIS F 1 169 ? 72.782 74.219   14.629 1.00 81.46  ? 169 HIS C N   1 
ATOM 6180 C CA  . HIS F 1 169 ? 72.614 75.356   13.724 1.00 77.39  ? 169 HIS C CA  1 
ATOM 6181 C C   . HIS F 1 169 ? 71.770 76.462   14.360 1.00 81.54  ? 169 HIS C C   1 
ATOM 6182 O O   . HIS F 1 169 ? 71.465 77.450   13.679 1.00 90.32  ? 169 HIS C O   1 
ATOM 6183 C CB  . HIS F 1 169 ? 72.018 74.956   12.362 1.00 72.78  ? 169 HIS C CB  1 
ATOM 6184 C CG  . HIS F 1 169 ? 72.753 73.831   11.698 1.00 80.03  ? 169 HIS C CG  1 
ATOM 6185 N ND1 . HIS F 1 169 ? 73.899 74.023   10.957 1.00 85.90  ? 169 HIS C ND1 1 
ATOM 6186 C CD2 . HIS F 1 169 ? 72.522 72.496   11.693 1.00 72.87  ? 169 HIS C CD2 1 
ATOM 6187 C CE1 . HIS F 1 169 ? 74.332 72.858   10.508 1.00 81.14  ? 169 HIS C CE1 1 
ATOM 6188 N NE2 . HIS F 1 169 ? 73.516 71.915   10.943 1.00 68.17  ? 169 HIS C NE2 1 
ATOM 6189 N N   . GLY F 1 170 ? 71.369 76.329   15.630 1.00 79.13  ? 170 GLY C N   1 
ATOM 6190 C CA  . GLY F 1 170 ? 70.971 77.452   16.458 1.00 75.52  ? 170 GLY C CA  1 
ATOM 6191 C C   . GLY F 1 170 ? 69.514 77.499   16.881 1.00 73.73  ? 170 GLY C C   1 
ATOM 6192 O O   . GLY F 1 170 ? 69.209 78.138   17.897 1.00 79.70  ? 170 GLY C O   1 
ATOM 6193 N N   . THR F 1 171 ? 68.606 76.847   16.161 1.00 75.13  ? 171 THR C N   1 
ATOM 6194 C CA  . THR F 1 171 ? 67.174 76.943   16.456 1.00 72.14  ? 171 THR C CA  1 
ATOM 6195 C C   . THR F 1 171 ? 66.617 75.560   16.795 1.00 67.28  ? 171 THR C C   1 
ATOM 6196 O O   . THR F 1 171 ? 66.150 74.832   15.915 1.00 60.54  ? 171 THR C O   1 
ATOM 6197 C CB  . THR F 1 171 ? 66.434 77.578   15.280 1.00 63.12  ? 171 THR C CB  1 
ATOM 6198 O OG1 . THR F 1 171 ? 66.893 76.992   14.054 1.00 59.49  ? 171 THR C OG1 1 
ATOM 6199 C CG2 . THR F 1 171 ? 66.690 79.078   15.249 1.00 58.30  ? 171 THR C CG2 1 
ATOM 6200 N N   . SER F 1 172 ? 66.619 75.224   18.088 1.00 65.43  ? 172 SER C N   1 
ATOM 6201 C CA  . SER F 1 172 ? 66.160 73.906   18.518 1.00 70.14  ? 172 SER C CA  1 
ATOM 6202 C C   . SER F 1 172 ? 64.642 73.795   18.485 1.00 64.09  ? 172 SER C C   1 
ATOM 6203 O O   . SER F 1 172 ? 64.101 72.759   18.083 1.00 63.29  ? 172 SER C O   1 
ATOM 6204 C CB  . SER F 1 172 ? 66.685 73.602   19.922 1.00 74.64  ? 172 SER C CB  1 
ATOM 6205 O OG  . SER F 1 172 ? 66.222 74.557   20.860 1.00 80.94  ? 172 SER C OG  1 
ATOM 6206 N N   . ASP F 1 173 ? 63.942 74.840   18.914 1.00 56.37  ? 173 ASP C N   1 
ATOM 6207 C CA  . ASP F 1 173 ? 62.486 74.898   18.855 1.00 53.61  ? 173 ASP C CA  1 
ATOM 6208 C C   . ASP F 1 173 ? 62.135 76.025   17.893 1.00 50.06  ? 173 ASP C C   1 
ATOM 6209 O O   . ASP F 1 173 ? 62.383 77.198   18.192 1.00 52.57  ? 173 ASP C O   1 
ATOM 6210 C CB  . ASP F 1 173 ? 61.884 75.127   20.241 1.00 55.64  ? 173 ASP C CB  1 
ATOM 6211 C CG  . ASP F 1 173 ? 60.368 75.014   20.253 1.00 58.02  ? 173 ASP C CG  1 
ATOM 6212 O OD1 . ASP F 1 173 ? 59.743 75.034   19.169 1.00 56.80  ? 173 ASP C OD1 1 
ATOM 6213 O OD2 . ASP F 1 173 ? 59.798 74.903   21.359 1.00 54.70  ? 173 ASP C OD2 1 
ATOM 6214 N N   . PHE F 1 174 ? 61.568 75.673   16.738 1.00 48.27  ? 174 PHE C N   1 
ATOM 6215 C CA  . PHE F 1 174 ? 61.267 76.690   15.736 1.00 42.65  ? 174 PHE C CA  1 
ATOM 6216 C C   . PHE F 1 174 ? 60.219 77.669   16.243 1.00 46.31  ? 174 PHE C C   1 
ATOM 6217 O O   . PHE F 1 174 ? 60.394 78.890   16.134 1.00 56.33  ? 174 PHE C O   1 
ATOM 6218 C CB  . PHE F 1 174 ? 60.805 76.035   14.432 1.00 41.20  ? 174 PHE C CB  1 
ATOM 6219 C CG  . PHE F 1 174 ? 61.929 75.513   13.578 1.00 38.45  ? 174 PHE C CG  1 
ATOM 6220 C CD1 . PHE F 1 174 ? 61.747 75.327   12.218 1.00 29.24  ? 174 PHE C CD1 1 
ATOM 6221 C CD2 . PHE F 1 174 ? 63.166 75.217   14.131 1.00 40.29  ? 174 PHE C CD2 1 
ATOM 6222 C CE1 . PHE F 1 174 ? 62.774 74.858   11.425 1.00 30.37  ? 174 PHE C CE1 1 
ATOM 6223 C CE2 . PHE F 1 174 ? 64.196 74.742   13.343 1.00 39.91  ? 174 PHE C CE2 1 
ATOM 6224 C CZ  . PHE F 1 174 ? 64.000 74.564   11.988 1.00 37.55  ? 174 PHE C CZ  1 
ATOM 6225 N N   . ARG F 1 175 ? 59.143 77.153   16.846 1.00 45.39  ? 175 ARG C N   1 
ATOM 6226 C CA  . ARG F 1 175 ? 58.056 78.016   17.302 1.00 53.06  ? 175 ARG C CA  1 
ATOM 6227 C C   . ARG F 1 175 ? 58.576 79.151   18.172 1.00 50.04  ? 175 ARG C C   1 
ATOM 6228 O O   . ARG F 1 175 ? 58.293 80.328   17.914 1.00 44.50  ? 175 ARG C O   1 
ATOM 6229 C CB  . ARG F 1 175 ? 57.015 77.207   18.075 1.00 56.20  ? 175 ARG C CB  1 
ATOM 6230 C CG  . ARG F 1 175 ? 55.939 78.091   18.694 1.00 68.04  ? 175 ARG C CG  1 
ATOM 6231 C CD  . ARG F 1 175 ? 54.696 77.328   19.128 1.00 73.52  ? 175 ARG C CD  1 
ATOM 6232 N NE  . ARG F 1 175 ? 54.166 77.829   20.399 1.00 84.59  ? 175 ARG C NE  1 
ATOM 6233 C CZ  . ARG F 1 175 ? 53.634 79.037   20.585 1.00 91.36  ? 175 ARG C CZ  1 
ATOM 6234 N NH1 . ARG F 1 175 ? 53.187 79.383   21.786 1.00 87.54  ? 175 ARG C NH1 1 
ATOM 6235 N NH2 . ARG F 1 175 ? 53.539 79.900   19.581 1.00 89.49  ? 175 ARG C NH2 1 
ATOM 6236 N N   . GLU F 1 176 ? 59.378 78.814   19.183 1.00 48.71  ? 176 GLU C N   1 
ATOM 6237 C CA  . GLU F 1 176 ? 59.935 79.845   20.048 1.00 46.75  ? 176 GLU C CA  1 
ATOM 6238 C C   . GLU F 1 176 ? 60.700 80.869   19.227 1.00 46.90  ? 176 GLU C C   1 
ATOM 6239 O O   . GLU F 1 176 ? 60.429 82.073   19.312 1.00 50.39  ? 176 GLU C O   1 
ATOM 6240 C CB  . GLU F 1 176 ? 60.842 79.211   21.100 1.00 47.71  ? 176 GLU C CB  1 
ATOM 6241 C CG  . GLU F 1 176 ? 60.088 78.461   22.176 1.00 53.13  ? 176 GLU C CG  1 
ATOM 6242 C CD  . GLU F 1 176 ? 60.908 78.253   23.431 1.00 59.78  ? 176 GLU C CD  1 
ATOM 6243 O OE1 . GLU F 1 176 ? 60.364 78.484   24.532 1.00 60.32  ? 176 GLU C OE1 1 
ATOM 6244 O OE2 . GLU F 1 176 ? 62.095 77.877   23.318 1.00 59.79  ? 176 GLU C OE2 1 
ATOM 6245 N N   . SER F 1 177 ? 61.607 80.400   18.365 1.00 44.08  ? 177 SER C N   1 
ATOM 6246 C CA  . SER F 1 177 ? 62.313 81.321   17.485 1.00 44.97  ? 177 SER C CA  1 
ATOM 6247 C C   . SER F 1 177 ? 61.314 82.188   16.739 1.00 42.76  ? 177 SER C C   1 
ATOM 6248 O O   . SER F 1 177 ? 61.362 83.424   16.816 1.00 51.61  ? 177 SER C O   1 
ATOM 6249 C CB  . SER F 1 177 ? 63.196 80.545   16.505 1.00 44.75  ? 177 SER C CB  1 
ATOM 6250 O OG  . SER F 1 177 ? 64.058 79.651   17.186 1.00 46.52  ? 177 SER C OG  1 
ATOM 6251 N N   . LEU F 1 178 ? 60.307 81.549   16.144 1.00 37.35  ? 178 LEU C N   1 
ATOM 6252 C CA  . LEU F 1 178 ? 59.330 82.292   15.367 1.00 42.95  ? 178 LEU C CA  1 
ATOM 6253 C C   . LEU F 1 178 ? 58.616 83.316   16.237 1.00 47.72  ? 178 LEU C C   1 
ATOM 6254 O O   . LEU F 1 178 ? 58.475 84.482   15.845 1.00 44.18  ? 178 LEU C O   1 
ATOM 6255 C CB  . LEU F 1 178 ? 58.330 81.329   14.726 1.00 40.82  ? 178 LEU C CB  1 
ATOM 6256 C CG  . LEU F 1 178 ? 58.835 80.503   13.536 1.00 36.17  ? 178 LEU C CG  1 
ATOM 6257 C CD1 . LEU F 1 178 ? 57.694 80.150   12.589 1.00 38.08  ? 178 LEU C CD1 1 
ATOM 6258 C CD2 . LEU F 1 178 ? 59.970 81.195   12.796 1.00 39.85  ? 178 LEU C CD2 1 
ATOM 6259 N N   . VAL F 1 179 ? 58.230 82.927   17.458 1.00 51.92  ? 179 VAL C N   1 
ATOM 6260 C CA  . VAL F 1 179 ? 57.447 83.859   18.259 1.00 49.65  ? 179 VAL C CA  1 
ATOM 6261 C C   . VAL F 1 179 ? 58.311 85.045   18.660 1.00 48.95  ? 179 VAL C C   1 
ATOM 6262 O O   . VAL F 1 179 ? 57.811 86.169   18.785 1.00 55.81  ? 179 VAL C O   1 
ATOM 6263 C CB  . VAL F 1 179 ? 56.801 83.165   19.479 1.00 52.60  ? 179 VAL C CB  1 
ATOM 6264 C CG1 . VAL F 1 179 ? 57.809 82.902   20.587 1.00 46.61  ? 179 VAL C CG1 1 
ATOM 6265 C CG2 . VAL F 1 179 ? 55.630 83.988   19.999 1.00 56.97  ? 179 VAL C CG2 1 
ATOM 6266 N N   . SER F 1 180 ? 59.616 84.831   18.861 1.00 47.97  ? 180 SER C N   1 
ATOM 6267 C CA  . SER F 1 180 ? 60.475 85.980   19.113 1.00 45.97  ? 180 SER C CA  1 
ATOM 6268 C C   . SER F 1 180 ? 60.742 86.734   17.822 1.00 46.25  ? 180 SER C C   1 
ATOM 6269 O O   . SER F 1 180 ? 60.787 87.970   17.812 1.00 53.21  ? 180 SER C O   1 
ATOM 6270 C CB  . SER F 1 180 ? 61.790 85.546   19.756 1.00 48.26  ? 180 SER C CB  1 
ATOM 6271 O OG  . SER F 1 180 ? 62.702 85.090   18.774 1.00 49.41  ? 180 SER C OG  1 
ATOM 6272 N N   . LEU F 1 181 ? 60.860 86.001   16.714 1.00 43.93  ? 181 LEU C N   1 
ATOM 6273 C CA  . LEU F 1 181 ? 61.258 86.627   15.463 1.00 42.70  ? 181 LEU C CA  1 
ATOM 6274 C C   . LEU F 1 181 ? 60.156 87.518   14.915 1.00 46.27  ? 181 LEU C C   1 
ATOM 6275 O O   . LEU F 1 181 ? 60.447 88.524   14.258 1.00 48.24  ? 181 LEU C O   1 
ATOM 6276 C CB  . LEU F 1 181 ? 61.665 85.550   14.460 1.00 39.81  ? 181 LEU C CB  1 
ATOM 6277 C CG  . LEU F 1 181 ? 62.183 86.016   13.107 1.00 47.59  ? 181 LEU C CG  1 
ATOM 6278 C CD1 . LEU F 1 181 ? 63.605 85.545   12.928 1.00 48.66  ? 181 LEU C CD1 1 
ATOM 6279 C CD2 . LEU F 1 181 ? 61.311 85.446   12.015 1.00 47.10  ? 181 LEU C CD2 1 
ATOM 6280 N N   . VAL F 1 182 ? 58.892 87.180   15.175 1.00 46.31  ? 182 VAL C N   1 
ATOM 6281 C CA  . VAL F 1 182 ? 57.824 88.121   14.865 1.00 43.90  ? 182 VAL C CA  1 
ATOM 6282 C C   . VAL F 1 182 ? 57.822 89.257   15.878 1.00 47.25  ? 182 VAL C C   1 
ATOM 6283 O O   . VAL F 1 182 ? 57.667 90.431   15.516 1.00 55.56  ? 182 VAL C O   1 
ATOM 6284 C CB  . VAL F 1 182 ? 56.458 87.405   14.816 1.00 41.32  ? 182 VAL C CB  1 
ATOM 6285 C CG1 . VAL F 1 182 ? 56.513 86.236   13.877 1.00 48.85  ? 182 VAL C CG1 1 
ATOM 6286 C CG2 . VAL F 1 182 ? 56.009 86.945   16.196 1.00 48.91  ? 182 VAL C CG2 1 
ATOM 6287 N N   . GLN F 1 183 ? 58.095 88.936   17.146 1.00 43.64  ? 183 GLN C N   1 
ATOM 6288 C CA  . GLN F 1 183 ? 58.018 89.932   18.206 1.00 50.91  ? 183 GLN C CA  1 
ATOM 6289 C C   . GLN F 1 183 ? 58.980 91.078   17.932 1.00 57.61  ? 183 GLN C C   1 
ATOM 6290 O O   . GLN F 1 183 ? 58.565 92.225   17.716 1.00 56.37  ? 183 GLN C O   1 
ATOM 6291 C CB  . GLN F 1 183 ? 58.320 89.266   19.551 1.00 49.45  ? 183 GLN C CB  1 
ATOM 6292 C CG  . GLN F 1 183 ? 57.586 89.860   20.741 1.00 62.36  ? 183 GLN C CG  1 
ATOM 6293 C CD  . GLN F 1 183 ? 57.935 89.162   22.044 1.00 65.51  ? 183 GLN C CD  1 
ATOM 6294 O OE1 . GLN F 1 183 ? 57.149 88.371   22.569 1.00 60.29  ? 183 GLN C OE1 1 
ATOM 6295 N NE2 . GLN F 1 183 ? 59.119 89.452   22.572 1.00 67.42  ? 183 GLN C NE2 1 
ATOM 6296 N N   . ASN F 1 184 ? 60.271 90.764   17.854 1.00 51.66  ? 184 ASN C N   1 
ATOM 6297 C CA  . ASN F 1 184 ? 61.259 91.784   17.547 1.00 51.29  ? 184 ASN C CA  1 
ATOM 6298 C C   . ASN F 1 184 ? 61.076 92.350   16.147 1.00 51.25  ? 184 ASN C C   1 
ATOM 6299 O O   . ASN F 1 184 ? 61.569 93.448   15.871 1.00 63.88  ? 184 ASN C O   1 
ATOM 6300 C CB  . ASN F 1 184 ? 62.665 91.217   17.722 1.00 52.12  ? 184 ASN C CB  1 
ATOM 6301 C CG  . ASN F 1 184 ? 63.026 91.007   19.176 1.00 70.68  ? 184 ASN C CG  1 
ATOM 6302 O OD1 . ASN F 1 184 ? 62.592 90.041   19.805 1.00 75.23  ? 184 ASN C OD1 1 
ATOM 6303 N ND2 . ASN F 1 184 ? 63.821 91.921   19.724 1.00 73.11  ? 184 ASN C ND2 1 
ATOM 6304 N N   . SER F 1 185 ? 60.379 91.639   15.257 1.00 42.81  ? 185 SER C N   1 
ATOM 6305 C CA  . SER F 1 185 ? 60.060 92.247   13.972 1.00 42.64  ? 185 SER C CA  1 
ATOM 6306 C C   . SER F 1 185 ? 59.034 93.362   14.131 1.00 47.40  ? 185 SER C C   1 
ATOM 6307 O O   . SER F 1 185 ? 59.209 94.455   13.577 1.00 51.21  ? 185 SER C O   1 
ATOM 6308 C CB  . SER F 1 185 ? 59.550 91.188   13.000 1.00 43.73  ? 185 SER C CB  1 
ATOM 6309 O OG  . SER F 1 185 ? 59.696 91.617   11.660 1.00 43.68  ? 185 SER C OG  1 
ATOM 6310 N N   . ARG F 1 186 ? 58.007 93.137   14.957 1.00 48.84  ? 186 ARG C N   1 
ATOM 6311 C CA  . ARG F 1 186 ? 56.956 94.140   15.108 1.00 57.23  ? 186 ARG C CA  1 
ATOM 6312 C C   . ARG F 1 186 ? 57.505 95.435   15.686 1.00 59.74  ? 186 ARG C C   1 
ATOM 6313 O O   . ARG F 1 186 ? 57.133 96.528   15.242 1.00 59.34  ? 186 ARG C O   1 
ATOM 6314 C CB  . ARG F 1 186 ? 55.818 93.595   15.972 1.00 54.52  ? 186 ARG C CB  1 
ATOM 6315 C CG  . ARG F 1 186 ? 55.047 94.666   16.725 1.00 48.31  ? 186 ARG C CG  1 
ATOM 6316 C CD  . ARG F 1 186 ? 53.686 94.180   17.212 1.00 58.23  ? 186 ARG C CD  1 
ATOM 6317 N NE  . ARG F 1 186 ? 53.637 92.734   17.405 1.00 65.22  ? 186 ARG C NE  1 
ATOM 6318 C CZ  . ARG F 1 186 ? 52.885 91.911   16.684 1.00 51.75  ? 186 ARG C CZ  1 
ATOM 6319 N NH1 . ARG F 1 186 ? 52.901 90.611   16.928 1.00 46.39  ? 186 ARG C NH1 1 
ATOM 6320 N NH2 . ARG F 1 186 ? 52.103 92.393   15.735 1.00 46.43  ? 186 ARG C NH2 1 
ATOM 6321 N N   . LYS F 1 187 ? 58.385 95.333   16.685 1.00 64.52  ? 187 LYS C N   1 
ATOM 6322 C CA  . LYS F 1 187 ? 59.070 96.517   17.190 1.00 59.35  ? 187 LYS C CA  1 
ATOM 6323 C C   . LYS F 1 187 ? 59.818 97.231   16.073 1.00 61.95  ? 187 LYS C C   1 
ATOM 6324 O O   . LYS F 1 187 ? 59.704 98.454   15.920 1.00 63.76  ? 187 LYS C O   1 
ATOM 6325 C CB  . LYS F 1 187 ? 60.037 96.137   18.314 1.00 55.62  ? 187 LYS C CB  1 
ATOM 6326 C CG  . LYS F 1 187 ? 59.387 95.916   19.670 1.00 65.74  ? 187 LYS C CG  1 
ATOM 6327 C CD  . LYS F 1 187 ? 60.363 96.213   20.803 1.00 66.04  ? 187 LYS C CD  1 
ATOM 6328 C CE  . LYS F 1 187 ? 61.456 95.155   20.891 1.00 62.53  ? 187 LYS C CE  1 
ATOM 6329 N NZ  . LYS F 1 187 ? 62.457 95.455   21.954 1.00 50.61  ? 187 LYS C NZ  1 
ATOM 6330 N N   . LEU F 1 188 ? 60.573 96.479   15.263 1.00 58.26  ? 188 LEU C N   1 
ATOM 6331 C CA  . LEU F 1 188 ? 61.409 97.121   14.254 1.00 57.04  ? 188 LEU C CA  1 
ATOM 6332 C C   . LEU F 1 188 ? 60.557 97.895   13.260 1.00 56.32  ? 188 LEU C C   1 
ATOM 6333 O O   . LEU F 1 188 ? 60.774 99.094   13.041 1.00 58.05  ? 188 LEU C O   1 
ATOM 6334 C CB  . LEU F 1 188 ? 62.267 96.075   13.545 1.00 54.70  ? 188 LEU C CB  1 
ATOM 6335 C CG  . LEU F 1 188 ? 63.337 96.601   12.590 1.00 58.84  ? 188 LEU C CG  1 
ATOM 6336 C CD1 . LEU F 1 188 ? 64.548 95.695   12.644 1.00 67.23  ? 188 LEU C CD1 1 
ATOM 6337 C CD2 . LEU F 1 188 ? 62.819 96.697   11.166 1.00 64.78  ? 188 LEU C CD2 1 
ATOM 6338 N N   . GLN F 1 189 ? 59.524 97.243   12.721 1.00 58.67  ? 189 GLN C N   1 
ATOM 6339 C CA  . GLN F 1 189 ? 58.538 97.945   11.910 1.00 64.59  ? 189 GLN C CA  1 
ATOM 6340 C C   . GLN F 1 189 ? 58.115 99.233   12.598 1.00 61.77  ? 189 GLN C C   1 
ATOM 6341 O O   . GLN F 1 189 ? 58.233 100.328  12.034 1.00 58.30  ? 189 GLN C O   1 
ATOM 6342 C CB  . GLN F 1 189 ? 57.327 97.038   11.670 1.00 60.13  ? 189 GLN C CB  1 
ATOM 6343 C CG  . GLN F 1 189 ? 56.211 97.662   10.844 1.00 60.32  ? 189 GLN C CG  1 
ATOM 6344 C CD  . GLN F 1 189 ? 56.177 97.152   9.419  1.00 58.12  ? 189 GLN C CD  1 
ATOM 6345 O OE1 . GLN F 1 189 ? 57.192 96.714   8.881  1.00 56.57  ? 189 GLN C OE1 1 
ATOM 6346 N NE2 . GLN F 1 189 ? 55.001 97.199   8.802  1.00 50.40  ? 189 GLN C NE2 1 
ATOM 6347 N N   . ASN F 1 190 ? 57.718 99.120   13.866 1.00 62.86  ? 190 ASN C N   1 
ATOM 6348 C CA  . ASN F 1 190 ? 57.213 100.272  14.598 1.00 59.52  ? 190 ASN C CA  1 
ATOM 6349 C C   . ASN F 1 190 ? 58.249 101.387  14.630 1.00 65.15  ? 190 ASN C C   1 
ATOM 6350 O O   . ASN F 1 190 ? 57.928 102.553  14.372 1.00 70.49  ? 190 ASN C O   1 
ATOM 6351 C CB  . ASN F 1 190 ? 56.814 99.848   16.012 1.00 64.27  ? 190 ASN C CB  1 
ATOM 6352 C CG  . ASN F 1 190 ? 55.807 100.789  16.646 1.00 81.90  ? 190 ASN C CG  1 
ATOM 6353 O OD1 . ASN F 1 190 ? 55.825 101.998  16.405 1.00 98.60  ? 190 ASN C OD1 1 
ATOM 6354 N ND2 . ASN F 1 190 ? 54.912 100.233  17.457 1.00 79.36  ? 190 ASN C ND2 1 
ATOM 6355 N N   . ILE F 1 191 ? 59.503 101.053  14.948 1.00 60.06  ? 191 ILE C N   1 
ATOM 6356 C CA  . ILE F 1 191 ? 60.486 102.126  15.044 1.00 59.19  ? 191 ILE C CA  1 
ATOM 6357 C C   . ILE F 1 191 ? 60.887 102.626  13.661 1.00 59.27  ? 191 ILE C C   1 
ATOM 6358 O O   . ILE F 1 191 ? 61.262 103.796  13.509 1.00 60.37  ? 191 ILE C O   1 
ATOM 6359 C CB  . ILE F 1 191 ? 61.710 101.703  15.880 1.00 54.18  ? 191 ILE C CB  1 
ATOM 6360 C CG1 . ILE F 1 191 ? 62.255 100.348  15.443 1.00 58.46  ? 191 ILE C CG1 1 
ATOM 6361 C CG2 . ILE F 1 191 ? 61.359 101.675  17.360 1.00 54.70  ? 191 ILE C CG2 1 
ATOM 6362 C CD1 . ILE F 1 191 ? 63.350 100.439  14.403 1.00 67.12  ? 191 ILE C CD1 1 
ATOM 6363 N N   . ARG F 1 192 ? 60.782 101.783  12.624 1.00 63.12  ? 192 ARG C N   1 
ATOM 6364 C CA  . ARG F 1 192 ? 61.223 102.232  11.305 1.00 61.31  ? 192 ARG C CA  1 
ATOM 6365 C C   . ARG F 1 192 ? 60.374 103.399  10.819 1.00 60.90  ? 192 ARG C C   1 
ATOM 6366 O O   . ARG F 1 192 ? 60.901 104.359  10.245 1.00 64.04  ? 192 ARG C O   1 
ATOM 6367 C CB  . ARG F 1 192 ? 61.206 101.083  10.289 1.00 58.93  ? 192 ARG C CB  1 
ATOM 6368 C CG  . ARG F 1 192 ? 59.913 100.940  9.506  1.00 62.47  ? 192 ARG C CG  1 
ATOM 6369 C CD  . ARG F 1 192 ? 60.177 100.573  8.067  1.00 62.91  ? 192 ARG C CD  1 
ATOM 6370 N NE  . ARG F 1 192 ? 60.976 99.362   7.964  1.00 88.73  ? 192 ARG C NE  1 
ATOM 6371 C CZ  . ARG F 1 192 ? 61.456 98.885   6.822  1.00 86.16  ? 192 ARG C CZ  1 
ATOM 6372 N NH1 . ARG F 1 192 ? 61.225 99.527   5.683  1.00 80.30  ? 192 ARG C NH1 1 
ATOM 6373 N NH2 . ARG F 1 192 ? 62.163 97.766   6.814  1.00 74.73  ? 192 ARG C NH2 1 
ATOM 6374 N N   . ASP F 1 193 ? 59.062 103.353  11.071 1.00 57.80  ? 193 ASP C N   1 
ATOM 6375 C CA  . ASP F 1 193 ? 58.211 104.482  10.723 1.00 53.47  ? 193 ASP C CA  1 
ATOM 6376 C C   . ASP F 1 193 ? 58.628 105.712  11.518 1.00 66.27  ? 193 ASP C C   1 
ATOM 6377 O O   . ASP F 1 193 ? 58.680 106.824  10.977 1.00 70.74  ? 193 ASP C O   1 
ATOM 6378 C CB  . ASP F 1 193 ? 56.745 104.125  10.977 1.00 50.72  ? 193 ASP C CB  1 
ATOM 6379 C CG  . ASP F 1 193 ? 55.777 105.113  10.350 1.00 57.36  ? 193 ASP C CG  1 
ATOM 6380 O OD1 . ASP F 1 193 ? 55.881 106.326  10.623 1.00 68.32  ? 193 ASP C OD1 1 
ATOM 6381 O OD2 . ASP F 1 193 ? 54.896 104.665  9.586  1.00 52.39  ? 193 ASP C OD2 1 
ATOM 6382 N N   . ASN F 1 194 ? 58.979 105.518  12.796 1.00 64.58  ? 194 ASN C N   1 
ATOM 6383 C CA  . ASN F 1 194 ? 59.517 106.617  13.589 1.00 58.02  ? 194 ASN C CA  1 
ATOM 6384 C C   . ASN F 1 194 ? 60.776 107.176  12.944 1.00 60.95  ? 194 ASN C C   1 
ATOM 6385 O O   . ASN F 1 194 ? 61.022 108.385  13.002 1.00 68.39  ? 194 ASN C O   1 
ATOM 6386 C CB  . ASN F 1 194 ? 59.801 106.147  15.018 1.00 59.03  ? 194 ASN C CB  1 
ATOM 6387 C CG  . ASN F 1 194 ? 60.085 107.295  15.971 1.00 57.11  ? 194 ASN C CG  1 
ATOM 6388 O OD1 . ASN F 1 194 ? 61.242 107.631  16.231 1.00 58.86  ? 194 ASN C OD1 1 
ATOM 6389 N ND2 . ASN F 1 194 ? 59.028 107.900  16.500 1.00 54.34  ? 194 ASN C ND2 1 
ATOM 6390 N N   . VAL F 1 195 ? 61.576 106.311  12.316 1.00 62.10  ? 195 VAL C N   1 
ATOM 6391 C CA  . VAL F 1 195 ? 62.775 106.771  11.628 1.00 63.07  ? 195 VAL C CA  1 
ATOM 6392 C C   . VAL F 1 195 ? 62.399 107.481  10.329 1.00 64.13  ? 195 VAL C C   1 
ATOM 6393 O O   . VAL F 1 195 ? 63.075 108.431  9.914  1.00 67.31  ? 195 VAL C O   1 
ATOM 6394 C CB  . VAL F 1 195 ? 63.734 105.587  11.396 1.00 60.56  ? 195 VAL C CB  1 
ATOM 6395 C CG1 . VAL F 1 195 ? 64.721 105.880  10.274 1.00 66.30  ? 195 VAL C CG1 1 
ATOM 6396 C CG2 . VAL F 1 195 ? 64.474 105.246  12.681 1.00 63.14  ? 195 VAL C CG2 1 
ATOM 6397 N N   . GLU F 1 196 ? 61.310 107.059  9.679  1.00 63.90  ? 196 GLU C N   1 
ATOM 6398 C CA  . GLU F 1 196 ? 60.895 107.697  8.434  1.00 65.90  ? 196 GLU C CA  1 
ATOM 6399 C C   . GLU F 1 196 ? 60.218 109.045  8.644  1.00 70.11  ? 196 GLU C C   1 
ATOM 6400 O O   . GLU F 1 196 ? 60.237 109.878  7.732  1.00 71.42  ? 196 GLU C O   1 
ATOM 6401 C CB  . GLU F 1 196 ? 59.954 106.776  7.651  1.00 64.46  ? 196 GLU C CB  1 
ATOM 6402 C CG  . GLU F 1 196 ? 60.560 105.435  7.273  1.00 69.55  ? 196 GLU C CG  1 
ATOM 6403 C CD  . GLU F 1 196 ? 61.565 105.546  6.140  1.00 78.68  ? 196 GLU C CD  1 
ATOM 6404 O OE1 . GLU F 1 196 ? 61.228 105.149  5.005  1.00 83.34  ? 196 GLU C OE1 1 
ATOM 6405 O OE2 . GLU F 1 196 ? 62.694 106.024  6.386  1.00 77.78  ? 196 GLU C OE2 1 
ATOM 6406 N N   . LYS F 1 197 ? 59.626 109.284  9.814  1.00 68.68  ? 197 LYS C N   1 
ATOM 6407 C CA  . LYS F 1 197 ? 58.988 110.566  10.087 1.00 68.42  ? 197 LYS C CA  1 
ATOM 6408 C C   . LYS F 1 197 ? 59.917 111.571  10.754 1.00 72.24  ? 197 LYS C C   1 
ATOM 6409 O O   . LYS F 1 197 ? 59.680 112.779  10.640 1.00 77.89  ? 197 LYS C O   1 
ATOM 6410 C CB  . LYS F 1 197 ? 57.736 110.356  10.943 1.00 64.64  ? 197 LYS C CB  1 
ATOM 6411 C CG  . LYS F 1 197 ? 56.691 109.502  10.246 1.00 61.27  ? 197 LYS C CG  1 
ATOM 6412 C CD  . LYS F 1 197 ? 56.544 109.928  8.791  1.00 63.01  ? 197 LYS C CD  1 
ATOM 6413 C CE  . LYS F 1 197 ? 55.980 108.809  7.933  1.00 65.61  ? 197 LYS C CE  1 
ATOM 6414 N NZ  . LYS F 1 197 ? 56.114 109.108  6.480  1.00 70.40  ? 197 LYS C NZ  1 
ATOM 6415 N N   . GLU F 1 198 ? 60.963 111.111  11.443 1.00 69.37  ? 198 GLU C N   1 
ATOM 6416 C CA  . GLU F 1 198 ? 61.997 112.020  11.919 1.00 68.95  ? 198 GLU C CA  1 
ATOM 6417 C C   . GLU F 1 198 ? 62.936 112.439  10.794 1.00 75.27  ? 198 GLU C C   1 
ATOM 6418 O O   . GLU F 1 198 ? 63.662 113.430  10.938 1.00 77.81  ? 198 GLU C O   1 
ATOM 6419 C CB  . GLU F 1 198 ? 62.783 111.368  13.061 1.00 64.23  ? 198 GLU C CB  1 
ATOM 6420 C CG  . GLU F 1 198 ? 63.573 112.338  13.935 1.00 75.29  ? 198 GLU C CG  1 
ATOM 6421 C CD  . GLU F 1 198 ? 65.076 112.190  13.783 1.00 70.69  ? 198 GLU C CD  1 
ATOM 6422 O OE1 . GLU F 1 198 ? 65.809 112.613  14.703 1.00 65.02  ? 198 GLU C OE1 1 
ATOM 6423 O OE2 . GLU F 1 198 ? 65.523 111.659  12.745 1.00 67.32  ? 198 GLU C OE2 1 
ATOM 6424 N N   . SER F 1 199 ? 62.923 111.708  9.676  1.00 73.92  ? 199 SER C N   1 
ATOM 6425 C CA  . SER F 1 199 ? 63.656 112.031  8.457  1.00 75.18  ? 199 SER C CA  1 
ATOM 6426 C C   . SER F 1 199 ? 63.055 113.203  7.695  1.00 77.26  ? 199 SER C C   1 
ATOM 6427 O O   . SER F 1 199 ? 63.629 113.620  6.682  1.00 84.05  ? 199 SER C O   1 
ATOM 6428 C CB  . SER F 1 199 ? 63.717 110.805  7.543  1.00 71.38  ? 199 SER C CB  1 
ATOM 6429 O OG  . SER F 1 199 ? 64.341 111.115  6.309  1.00 66.93  ? 199 SER C OG  1 
ATOM 6430 N N   . LYS F 1 200 ? 61.925 113.736  8.143  1.00 75.69  ? 200 LYS C N   1 
ATOM 6431 C CA  . LYS F 1 200 ? 61.269 114.830  7.443  1.00 79.75  ? 200 LYS C CA  1 
ATOM 6432 C C   . LYS F 1 200 ? 61.159 116.063  8.332  1.00 75.06  ? 200 LYS C C   1 
ATOM 6433 O O   . LYS F 1 200 ? 62.057 116.905  8.351  1.00 79.74  ? 200 LYS C O   1 
ATOM 6434 C CB  . LYS F 1 200 ? 59.878 114.394  6.979  1.00 80.57  ? 200 LYS C CB  1 
ATOM 6435 C CG  . LYS F 1 200 ? 59.803 112.941  6.528  1.00 68.99  ? 200 LYS C CG  1 
ATOM 6436 C CD  . LYS F 1 200 ? 60.425 112.754  5.159  1.00 61.25  ? 200 LYS C CD  1 
ATOM 6437 C CE  . LYS F 1 200 ? 59.635 113.497  4.098  1.00 69.45  ? 200 LYS C CE  1 
ATOM 6438 N NZ  . LYS F 1 200 ? 60.385 113.578  2.816  1.00 84.41  ? 200 LYS C NZ  1 
ATOM 6439 N N   . THR G 2 2   ? 27.962 -25.334  48.088 1.00 56.65  ? 31  THR E N   1 
ATOM 6440 C CA  . THR G 2 2   ? 28.484 -25.203  46.732 1.00 68.70  ? 31  THR E CA  1 
ATOM 6441 C C   . THR G 2 2   ? 28.654 -26.568  46.054 1.00 65.75  ? 31  THR E C   1 
ATOM 6442 O O   . THR G 2 2   ? 28.177 -26.773  44.933 1.00 61.87  ? 31  THR E O   1 
ATOM 6443 C CB  . THR G 2 2   ? 29.826 -24.430  46.723 1.00 67.57  ? 31  THR E CB  1 
ATOM 6444 O OG1 . THR G 2 2   ? 30.434 -24.527  45.431 1.00 74.87  ? 31  THR E OG1 1 
ATOM 6445 C CG2 . THR G 2 2   ? 30.775 -24.951  47.796 1.00 64.40  ? 31  THR E CG2 1 
ATOM 6446 N N   . ILE G 2 3   ? 29.339 -27.492  46.732 1.00 56.51  ? 32  ILE E N   1 
ATOM 6447 C CA  . ILE G 2 3   ? 29.503 -28.879  46.297 1.00 54.65  ? 32  ILE E CA  1 
ATOM 6448 C C   . ILE G 2 3   ? 30.240 -28.932  44.959 1.00 55.01  ? 32  ILE E C   1 
ATOM 6449 O O   . ILE G 2 3   ? 30.234 -29.958  44.270 1.00 52.73  ? 32  ILE E O   1 
ATOM 6450 C CB  . ILE G 2 3   ? 28.141 -29.601  46.232 1.00 51.61  ? 32  ILE E CB  1 
ATOM 6451 C CG1 . ILE G 2 3   ? 27.297 -29.270  47.461 1.00 55.12  ? 32  ILE E CG1 1 
ATOM 6452 C CG2 . ILE G 2 3   ? 28.319 -31.108  46.231 1.00 59.75  ? 32  ILE E CG2 1 
ATOM 6453 C CD1 . ILE G 2 3   ? 26.079 -28.433  47.151 1.00 66.58  ? 32  ILE E CD1 1 
ATOM 6454 N N   . SER G 2 4   ? 30.883 -27.825  44.583 1.00 57.07  ? 33  SER E N   1 
ATOM 6455 C CA  . SER G 2 4   ? 31.830 -27.770  43.464 1.00 59.42  ? 33  SER E CA  1 
ATOM 6456 C C   . SER G 2 4   ? 31.258 -28.321  42.156 1.00 56.15  ? 33  SER E C   1 
ATOM 6457 O O   . SER G 2 4   ? 32.022 -28.722  41.271 1.00 60.79  ? 33  SER E O   1 
ATOM 6458 C CB  . SER G 2 4   ? 33.131 -28.507  43.807 1.00 53.28  ? 33  SER E CB  1 
ATOM 6459 O OG  . SER G 2 4   ? 32.915 -29.902  43.935 1.00 35.62  ? 33  SER E OG  1 
ATOM 6460 N N   . ARG G 2 5   ? 29.930 -28.388  42.019 1.00 50.52  ? 34  ARG E N   1 
ATOM 6461 C CA  . ARG G 2 5   ? 29.279 -28.776  40.766 1.00 51.34  ? 34  ARG E CA  1 
ATOM 6462 C C   . ARG G 2 5   ? 29.669 -30.160  40.248 1.00 46.20  ? 34  ARG E C   1 
ATOM 6463 O O   . ARG G 2 5   ? 28.852 -30.842  39.621 1.00 37.31  ? 34  ARG E O   1 
ATOM 6464 C CB  . ARG G 2 5   ? 29.566 -27.740  39.677 1.00 45.17  ? 34  ARG E CB  1 
ATOM 6465 C CG  . ARG G 2 5   ? 28.410 -26.809  39.415 1.00 47.27  ? 34  ARG E CG  1 
ATOM 6466 C CD  . ARG G 2 5   ? 28.709 -25.865  38.270 1.00 47.23  ? 34  ARG E CD  1 
ATOM 6467 N NE  . ARG G 2 5   ? 27.532 -25.071  37.945 1.00 47.57  ? 34  ARG E NE  1 
ATOM 6468 C CZ  . ARG G 2 5   ? 27.176 -23.976  38.605 1.00 39.91  ? 34  ARG E CZ  1 
ATOM 6469 N NH1 . ARG G 2 5   ? 27.912 -23.550  39.623 1.00 32.96  ? 34  ARG E NH1 1 
ATOM 6470 N NH2 . ARG G 2 5   ? 26.083 -23.312  38.251 1.00 39.93  ? 34  ARG E NH2 1 
ATOM 6471 N N   . VAL G 2 6   ? 30.910 -30.582  40.490 1.00 45.61  ? 35  VAL E N   1 
ATOM 6472 C CA  . VAL G 2 6   ? 31.347 -31.890  40.024 1.00 33.54  ? 35  VAL E CA  1 
ATOM 6473 C C   . VAL G 2 6   ? 30.919 -32.973  41.005 1.00 39.98  ? 35  VAL E C   1 
ATOM 6474 O O   . VAL G 2 6   ? 30.482 -34.055  40.595 1.00 43.85  ? 35  VAL E O   1 
ATOM 6475 C CB  . VAL G 2 6   ? 32.868 -31.886  39.767 1.00 29.66  ? 35  VAL E CB  1 
ATOM 6476 C CG1 . VAL G 2 6   ? 33.657 -31.797  41.067 1.00 33.30  ? 35  VAL E CG1 1 
ATOM 6477 C CG2 . VAL G 2 6   ? 33.274 -33.108  38.965 1.00 42.06  ? 35  VAL E CG2 1 
ATOM 6478 N N   . LYS G 2 7   ? 31.015 -32.705  42.312 1.00 40.98  ? 36  LYS E N   1 
ATOM 6479 C CA  . LYS G 2 7   ? 30.436 -33.623  43.286 1.00 45.42  ? 36  LYS E CA  1 
ATOM 6480 C C   . LYS G 2 7   ? 28.923 -33.691  43.146 1.00 40.78  ? 36  LYS E C   1 
ATOM 6481 O O   . LYS G 2 7   ? 28.317 -34.704  43.514 1.00 46.97  ? 36  LYS E O   1 
ATOM 6482 C CB  . LYS G 2 7   ? 30.830 -33.211  44.706 1.00 47.79  ? 36  LYS E CB  1 
ATOM 6483 C CG  . LYS G 2 7   ? 32.173 -33.765  45.157 1.00 54.88  ? 36  LYS E CG  1 
ATOM 6484 C CD  . LYS G 2 7   ? 32.100 -35.277  45.347 1.00 67.57  ? 36  LYS E CD  1 
ATOM 6485 C CE  . LYS G 2 7   ? 33.375 -35.966  44.880 1.00 65.00  ? 36  LYS E CE  1 
ATOM 6486 N NZ  . LYS G 2 7   ? 33.458 -36.027  43.393 1.00 50.42  ? 36  LYS E NZ  1 
ATOM 6487 N N   . LEU G 2 8   ? 28.309 -32.638  42.604 1.00 37.42  ? 37  LEU E N   1 
ATOM 6488 C CA  . LEU G 2 8   ? 26.898 -32.690  42.242 1.00 39.04  ? 37  LEU E CA  1 
ATOM 6489 C C   . LEU G 2 8   ? 26.681 -33.635  41.070 1.00 34.50  ? 37  LEU E C   1 
ATOM 6490 O O   . LEU G 2 8   ? 25.640 -34.296  40.984 1.00 36.37  ? 37  LEU E O   1 
ATOM 6491 C CB  . LEU G 2 8   ? 26.388 -31.290  41.899 1.00 48.08  ? 37  LEU E CB  1 
ATOM 6492 C CG  . LEU G 2 8   ? 26.191 -30.296  43.046 1.00 43.18  ? 37  LEU E CG  1 
ATOM 6493 C CD1 . LEU G 2 8   ? 25.588 -29.009  42.516 1.00 45.53  ? 37  LEU E CD1 1 
ATOM 6494 C CD2 . LEU G 2 8   ? 25.314 -30.889  44.138 1.00 43.81  ? 37  LEU E CD2 1 
ATOM 6495 N N   . LEU G 2 9   ? 27.652 -33.698  40.159 1.00 35.08  ? 38  LEU E N   1 
ATOM 6496 C CA  . LEU G 2 9   ? 27.536 -34.549  38.982 1.00 35.91  ? 38  LEU E CA  1 
ATOM 6497 C C   . LEU G 2 9   ? 27.688 -36.016  39.355 1.00 34.51  ? 38  LEU E C   1 
ATOM 6498 O O   . LEU G 2 9   ? 26.863 -36.860  38.978 1.00 31.88  ? 38  LEU E O   1 
ATOM 6499 C CB  . LEU G 2 9   ? 28.620 -34.148  37.986 1.00 34.99  ? 38  LEU E CB  1 
ATOM 6500 C CG  . LEU G 2 9   ? 28.748 -34.793  36.616 1.00 33.56  ? 38  LEU E CG  1 
ATOM 6501 C CD1 . LEU G 2 9   ? 28.125 -33.897  35.594 1.00 26.09  ? 38  LEU E CD1 1 
ATOM 6502 C CD2 . LEU G 2 9   ? 30.210 -35.030  36.303 1.00 43.95  ? 38  LEU E CD2 1 
ATOM 6503 N N   . ASP G 2 10  ? 28.730 -36.329  40.129 1.00 37.71  ? 39  ASP E N   1 
ATOM 6504 C CA  . ASP G 2 10  ? 28.897 -37.683  40.640 1.00 39.23  ? 39  ASP E CA  1 
ATOM 6505 C C   . ASP G 2 10  ? 27.734 -38.073  41.540 1.00 35.87  ? 39  ASP E C   1 
ATOM 6506 O O   . ASP G 2 10  ? 27.301 -39.231  41.540 1.00 42.39  ? 39  ASP E O   1 
ATOM 6507 C CB  . ASP G 2 10  ? 30.228 -37.796  41.379 1.00 42.31  ? 39  ASP E CB  1 
ATOM 6508 C CG  . ASP G 2 10  ? 31.414 -37.779  40.434 1.00 45.90  ? 39  ASP E CG  1 
ATOM 6509 O OD1 . ASP G 2 10  ? 31.212 -38.022  39.224 1.00 47.17  ? 39  ASP E OD1 1 
ATOM 6510 O OD2 . ASP G 2 10  ? 32.545 -37.518  40.896 1.00 46.61  ? 39  ASP E OD2 1 
ATOM 6511 N N   . THR G 2 11  ? 27.210 -37.118  42.308 1.00 30.33  ? 40  THR E N   1 
ATOM 6512 C CA  . THR G 2 11  ? 26.036 -37.392  43.127 1.00 30.72  ? 40  THR E CA  1 
ATOM 6513 C C   . THR G 2 11  ? 24.835 -37.753  42.260 1.00 30.19  ? 40  THR E C   1 
ATOM 6514 O O   . THR G 2 11  ? 24.090 -38.687  42.578 1.00 34.01  ? 40  THR E O   1 
ATOM 6515 C CB  . THR G 2 11  ? 25.721 -36.187  44.015 1.00 33.22  ? 40  THR E CB  1 
ATOM 6516 O OG1 . THR G 2 11  ? 26.697 -36.095  45.059 1.00 36.74  ? 40  THR E OG1 1 
ATOM 6517 C CG2 . THR G 2 11  ? 24.333 -36.312  44.629 1.00 29.23  ? 40  THR E CG2 1 
ATOM 6518 N N   . MET G 2 12  ? 24.635 -37.034  41.154 1.00 32.35  ? 41  MET E N   1 
ATOM 6519 C CA  . MET G 2 12  ? 23.451 -37.278  40.337 1.00 34.32  ? 41  MET E CA  1 
ATOM 6520 C C   . MET G 2 12  ? 23.556 -38.585  39.563 1.00 33.56  ? 41  MET E C   1 
ATOM 6521 O O   . MET G 2 12  ? 22.550 -39.283  39.382 1.00 36.40  ? 41  MET E O   1 
ATOM 6522 C CB  . MET G 2 12  ? 23.216 -36.113  39.378 1.00 38.75  ? 41  MET E CB  1 
ATOM 6523 C CG  . MET G 2 12  ? 22.687 -34.864  40.047 1.00 40.16  ? 41  MET E CG  1 
ATOM 6524 S SD  . MET G 2 12  ? 22.506 -33.503  38.886 1.00 66.69  ? 41  MET E SD  1 
ATOM 6525 C CE  . MET G 2 12  ? 22.030 -32.184  39.997 1.00 51.95  ? 41  MET E CE  1 
ATOM 6526 N N   . VAL G 2 13  ? 24.756 -38.945  39.099 1.00 33.16  ? 42  VAL E N   1 
ATOM 6527 C CA  . VAL G 2 13  ? 24.868 -40.247  38.446 1.00 30.58  ? 42  VAL E CA  1 
ATOM 6528 C C   . VAL G 2 13  ? 24.792 -41.372  39.471 1.00 30.01  ? 42  VAL E C   1 
ATOM 6529 O O   . VAL G 2 13  ? 24.241 -42.442  39.181 1.00 30.70  ? 42  VAL E O   1 
ATOM 6530 C CB  . VAL G 2 13  ? 26.147 -40.342  37.592 1.00 30.98  ? 42  VAL E CB  1 
ATOM 6531 C CG1 . VAL G 2 13  ? 26.062 -39.399  36.400 1.00 26.69  ? 42  VAL E CG1 1 
ATOM 6532 C CG2 . VAL G 2 13  ? 27.381 -40.059  38.428 1.00 36.80  ? 42  VAL E CG2 1 
ATOM 6533 N N   . ASP G 2 14  ? 25.319 -41.156  40.680 1.00 28.98  ? 43  ASP E N   1 
ATOM 6534 C CA  . ASP G 2 14  ? 25.170 -42.147  41.743 1.00 32.37  ? 43  ASP E CA  1 
ATOM 6535 C C   . ASP G 2 14  ? 23.700 -42.403  42.046 1.00 32.49  ? 43  ASP E C   1 
ATOM 6536 O O   . ASP G 2 14  ? 23.260 -43.557  42.114 1.00 37.36  ? 43  ASP E O   1 
ATOM 6537 C CB  . ASP G 2 14  ? 25.903 -41.691  43.006 1.00 35.81  ? 43  ASP E CB  1 
ATOM 6538 C CG  . ASP G 2 14  ? 27.401 -41.907  42.923 1.00 44.01  ? 43  ASP E CG  1 
ATOM 6539 O OD1 . ASP G 2 14  ? 28.156 -41.107  43.519 1.00 41.47  ? 43  ASP E OD1 1 
ATOM 6540 O OD2 . ASP G 2 14  ? 27.823 -42.878  42.262 1.00 49.99  ? 43  ASP E OD2 1 
ATOM 6541 N N   . THR G 2 15  ? 22.925 -41.333  42.240 1.00 32.57  ? 44  THR E N   1 
ATOM 6542 C CA  . THR G 2 15  ? 21.485 -41.485  42.420 1.00 33.62  ? 44  THR E CA  1 
ATOM 6543 C C   . THR G 2 15  ? 20.857 -42.190  41.227 1.00 27.08  ? 44  THR E C   1 
ATOM 6544 O O   . THR G 2 15  ? 19.959 -43.024  41.391 1.00 26.66  ? 44  THR E O   1 
ATOM 6545 C CB  . THR G 2 15  ? 20.829 -40.117  42.639 1.00 34.32  ? 44  THR E CB  1 
ATOM 6546 O OG1 . THR G 2 15  ? 21.575 -39.371  43.610 1.00 41.18  ? 44  THR E OG1 1 
ATOM 6547 C CG2 . THR G 2 15  ? 19.388 -40.272  43.119 1.00 25.78  ? 44  THR E CG2 1 
ATOM 6548 N N   . PHE G 2 16  ? 21.320 -41.871  40.017 1.00 23.53  ? 45  PHE E N   1 
ATOM 6549 C CA  . PHE G 2 16  ? 20.759 -42.496  38.824 1.00 26.17  ? 45  PHE E CA  1 
ATOM 6550 C C   . PHE G 2 16  ? 20.958 -44.007  38.836 1.00 32.54  ? 45  PHE E C   1 
ATOM 6551 O O   . PHE G 2 16  ? 20.040 -44.765  38.498 1.00 31.64  ? 45  PHE E O   1 
ATOM 6552 C CB  . PHE G 2 16  ? 21.382 -41.874  37.576 1.00 28.52  ? 45  PHE E CB  1 
ATOM 6553 C CG  . PHE G 2 16  ? 20.968 -42.534  36.293 1.00 31.88  ? 45  PHE E CG  1 
ATOM 6554 C CD1 . PHE G 2 16  ? 19.691 -42.350  35.787 1.00 33.46  ? 45  PHE E CD1 1 
ATOM 6555 C CD2 . PHE G 2 16  ? 21.866 -43.297  35.569 1.00 27.75  ? 45  PHE E CD2 1 
ATOM 6556 C CE1 . PHE G 2 16  ? 19.308 -42.942  34.601 1.00 26.94  ? 45  PHE E CE1 1 
ATOM 6557 C CE2 . PHE G 2 16  ? 21.489 -43.885  34.379 1.00 27.40  ? 45  PHE E CE2 1 
ATOM 6558 C CZ  . PHE G 2 16  ? 20.207 -43.705  33.895 1.00 26.92  ? 45  PHE E CZ  1 
ATOM 6559 N N   . LEU G 2 17  ? 22.148 -44.467  39.231 1.00 39.15  ? 46  LEU E N   1 
ATOM 6560 C CA  . LEU G 2 17  ? 22.387 -45.905  39.308 1.00 30.36  ? 46  LEU E CA  1 
ATOM 6561 C C   . LEU G 2 17  ? 21.600 -46.540  40.445 1.00 25.43  ? 46  LEU E C   1 
ATOM 6562 O O   . LEU G 2 17  ? 20.970 -47.585  40.256 1.00 26.92  ? 46  LEU E O   1 
ATOM 6563 C CB  . LEU G 2 17  ? 23.878 -46.181  39.470 1.00 27.09  ? 46  LEU E CB  1 
ATOM 6564 C CG  . LEU G 2 17  ? 24.675 -45.738  38.251 1.00 24.77  ? 46  LEU E CG  1 
ATOM 6565 C CD1 . LEU G 2 17  ? 26.132 -46.113  38.399 1.00 23.74  ? 46  LEU E CD1 1 
ATOM 6566 C CD2 . LEU G 2 17  ? 24.059 -46.362  37.013 1.00 26.22  ? 46  LEU E CD2 1 
ATOM 6567 N N   . GLN G 2 18  ? 21.605 -45.909  41.624 1.00 28.43  ? 47  GLN E N   1 
ATOM 6568 C CA  . GLN G 2 18  ? 20.815 -46.413  42.743 1.00 34.44  ? 47  GLN E CA  1 
ATOM 6569 C C   . GLN G 2 18  ? 19.361 -46.623  42.345 1.00 31.49  ? 47  GLN E C   1 
ATOM 6570 O O   . GLN G 2 18  ? 18.748 -47.635  42.705 1.00 29.82  ? 47  GLN E O   1 
ATOM 6571 C CB  . GLN G 2 18  ? 20.907 -45.442  43.925 1.00 38.83  ? 47  GLN E CB  1 
ATOM 6572 C CG  . GLN G 2 18  ? 22.303 -45.286  44.517 1.00 45.28  ? 47  GLN E CG  1 
ATOM 6573 C CD  . GLN G 2 18  ? 22.410 -44.092  45.455 1.00 52.66  ? 47  GLN E CD  1 
ATOM 6574 O OE1 . GLN G 2 18  ? 21.405 -43.480  45.814 1.00 52.80  ? 47  GLN E OE1 1 
ATOM 6575 N NE2 . GLN G 2 18  ? 23.634 -43.761  45.858 1.00 49.89  ? 47  GLN E NE2 1 
ATOM 6576 N N   . LYS G 2 19  ? 18.794 -45.681  41.591 1.00 33.01  ? 48  LYS E N   1 
ATOM 6577 C CA  . LYS G 2 19  ? 17.408 -45.817  41.164 1.00 32.37  ? 48  LYS E CA  1 
ATOM 6578 C C   . LYS G 2 19  ? 17.253 -46.845  40.051 1.00 28.93  ? 48  LYS E C   1 
ATOM 6579 O O   . LYS G 2 19  ? 16.235 -47.545  40.000 1.00 33.48  ? 48  LYS E O   1 
ATOM 6580 C CB  . LYS G 2 19  ? 16.857 -44.456  40.734 1.00 43.16  ? 48  LYS E CB  1 
ATOM 6581 C CG  . LYS G 2 19  ? 16.894 -43.395  41.829 1.00 40.65  ? 48  LYS E CG  1 
ATOM 6582 C CD  . LYS G 2 19  ? 15.911 -43.725  42.944 1.00 43.49  ? 48  LYS E CD  1 
ATOM 6583 C CE  . LYS G 2 19  ? 16.148 -42.868  44.177 1.00 44.65  ? 48  LYS E CE  1 
ATOM 6584 N NZ  . LYS G 2 19  ? 15.190 -43.190  45.277 1.00 41.80  ? 48  LYS E NZ  1 
ATOM 6585 N N   . LEU G 2 20  ? 18.232 -46.952  39.147 1.00 27.97  ? 49  LEU E N   1 
ATOM 6586 C CA  . LEU G 2 20  ? 18.145 -47.993  38.126 1.00 32.24  ? 49  LEU E CA  1 
ATOM 6587 C C   . LEU G 2 20  ? 18.318 -49.376  38.735 1.00 31.09  ? 49  LEU E C   1 
ATOM 6588 O O   . LEU G 2 20  ? 17.576 -50.300  38.395 1.00 27.19  ? 49  LEU E O   1 
ATOM 6589 C CB  . LEU G 2 20  ? 19.181 -47.780  37.021 1.00 29.73  ? 49  LEU E CB  1 
ATOM 6590 C CG  . LEU G 2 20  ? 18.628 -47.357  35.656 1.00 26.56  ? 49  LEU E CG  1 
ATOM 6591 C CD1 . LEU G 2 20  ? 19.703 -47.464  34.581 1.00 17.99  ? 49  LEU E CD1 1 
ATOM 6592 C CD2 . LEU G 2 20  ? 17.399 -48.169  35.282 1.00 28.30  ? 49  LEU E CD2 1 
ATOM 6593 N N   . VAL G 2 21  ? 19.291 -49.535  39.636 1.00 34.07  ? 50  VAL E N   1 
ATOM 6594 C CA  . VAL G 2 21  ? 19.482 -50.809  40.323 1.00 24.79  ? 50  VAL E CA  1 
ATOM 6595 C C   . VAL G 2 21  ? 18.294 -51.121  41.229 1.00 30.63  ? 50  VAL E C   1 
ATOM 6596 O O   . VAL G 2 21  ? 18.002 -52.293  41.499 1.00 31.16  ? 50  VAL E O   1 
ATOM 6597 C CB  . VAL G 2 21  ? 20.815 -50.783  41.098 1.00 25.03  ? 50  VAL E CB  1 
ATOM 6598 C CG1 . VAL G 2 21  ? 20.974 -52.017  41.964 1.00 34.31  ? 50  VAL E CG1 1 
ATOM 6599 C CG2 . VAL G 2 21  ? 21.983 -50.663  40.134 1.00 21.29  ? 50  VAL E CG2 1 
ATOM 6600 N N   . ALA G 2 22  ? 17.590 -50.092  41.712 1.00 35.84  ? 51  ALA E N   1 
ATOM 6601 C CA  . ALA G 2 22  ? 16.333 -50.324  42.418 1.00 34.11  ? 51  ALA E CA  1 
ATOM 6602 C C   . ALA G 2 22  ? 15.337 -51.029  41.508 1.00 37.39  ? 51  ALA E C   1 
ATOM 6603 O O   . ALA G 2 22  ? 14.692 -52.008  41.902 1.00 42.66  ? 51  ALA E O   1 
ATOM 6604 C CB  . ALA G 2 22  ? 15.759 -49.002  42.929 1.00 34.08  ? 51  ALA E CB  1 
ATOM 6605 N N   . ALA G 2 23  ? 15.204 -50.542  40.280 1.00 34.54  ? 52  ALA E N   1 
ATOM 6606 C CA  . ALA G 2 23  ? 14.544 -51.304  39.239 1.00 43.98  ? 52  ALA E CA  1 
ATOM 6607 C C   . ALA G 2 23  ? 15.425 -52.486  38.838 1.00 43.90  ? 52  ALA E C   1 
ATOM 6608 O O   . ALA G 2 23  ? 16.600 -52.575  39.201 1.00 46.64  ? 52  ALA E O   1 
ATOM 6609 C CB  . ALA G 2 23  ? 14.245 -50.416  38.032 1.00 47.96  ? 52  ALA E CB  1 
ATOM 6610 N N   . GLY G 2 24  ? 14.842 -53.417  38.094 1.00 38.25  ? 53  GLY E N   1 
ATOM 6611 C CA  . GLY G 2 24  ? 15.584 -54.625  37.761 1.00 39.36  ? 53  GLY E CA  1 
ATOM 6612 C C   . GLY G 2 24  ? 16.126 -55.341  38.973 1.00 49.05  ? 53  GLY E C   1 
ATOM 6613 O O   . GLY G 2 24  ? 17.278 -55.794  38.973 1.00 45.32  ? 53  GLY E O   1 
ATOM 6614 N N   . SER G 2 25  ? 15.325 -55.418  40.032 1.00 57.02  ? 54  SER E N   1 
ATOM 6615 C CA  . SER G 2 25  ? 15.725 -56.147  41.218 1.00 44.47  ? 54  SER E CA  1 
ATOM 6616 C C   . SER G 2 25  ? 15.873 -57.619  40.864 1.00 45.85  ? 54  SER E C   1 
ATOM 6617 O O   . SER G 2 25  ? 15.382 -58.084  39.832 1.00 42.78  ? 54  SER E O   1 
ATOM 6618 C CB  . SER G 2 25  ? 14.694 -55.973  42.332 1.00 47.42  ? 54  SER E CB  1 
ATOM 6619 O OG  . SER G 2 25  ? 13.399 -56.333  41.879 1.00 47.15  ? 54  SER E OG  1 
ATOM 6620 N N   . TYR G 2 26  ? 16.599 -58.349  41.713 1.00 54.19  ? 55  TYR E N   1 
ATOM 6621 C CA  . TYR G 2 26  ? 16.822 -59.764  41.441 1.00 49.55  ? 55  TYR E CA  1 
ATOM 6622 C C   . TYR G 2 26  ? 15.493 -60.478  41.219 1.00 45.84  ? 55  TYR E C   1 
ATOM 6623 O O   . TYR G 2 26  ? 15.364 -61.296  40.304 1.00 46.85  ? 55  TYR E O   1 
ATOM 6624 C CB  . TYR G 2 26  ? 17.605 -60.416  42.582 1.00 45.84  ? 55  TYR E CB  1 
ATOM 6625 C CG  . TYR G 2 26  ? 18.018 -61.839  42.276 1.00 49.18  ? 55  TYR E CG  1 
ATOM 6626 C CD1 . TYR G 2 26  ? 18.341 -62.220  40.979 1.00 47.73  ? 55  TYR E CD1 1 
ATOM 6627 C CD2 . TYR G 2 26  ? 18.057 -62.806  43.271 1.00 51.48  ? 55  TYR E CD2 1 
ATOM 6628 C CE1 . TYR G 2 26  ? 18.714 -63.517  40.684 1.00 47.96  ? 55  TYR E CE1 1 
ATOM 6629 C CE2 . TYR G 2 26  ? 18.422 -64.112  42.983 1.00 56.12  ? 55  TYR E CE2 1 
ATOM 6630 C CZ  . TYR G 2 26  ? 18.748 -64.461  41.687 1.00 54.53  ? 55  TYR E CZ  1 
ATOM 6631 O OH  . TYR G 2 26  ? 19.114 -65.756  41.393 1.00 54.05  ? 55  TYR E OH  1 
ATOM 6632 N N   . GLN G 2 27  ? 14.482 -60.155  42.034 1.00 43.82  ? 56  GLN E N   1 
ATOM 6633 C CA  . GLN G 2 27  ? 13.141 -60.681  41.793 1.00 48.53  ? 56  GLN E CA  1 
ATOM 6634 C C   . GLN G 2 27  ? 12.601 -60.233  40.440 1.00 49.81  ? 56  GLN E C   1 
ATOM 6635 O O   . GLN G 2 27  ? 12.002 -61.031  39.710 1.00 45.11  ? 56  GLN E O   1 
ATOM 6636 C CB  . GLN G 2 27  ? 12.191 -60.249  42.911 1.00 51.84  ? 56  GLN E CB  1 
ATOM 6637 C CG  . GLN G 2 27  ? 10.722 -60.452  42.559 1.00 63.66  ? 56  GLN E CG  1 
ATOM 6638 C CD  . GLN G 2 27  ? 9.783  -59.629  43.416 1.00 56.34  ? 56  GLN E CD  1 
ATOM 6639 O OE1 . GLN G 2 27  ? 10.010 -59.457  44.614 1.00 53.35  ? 56  GLN E OE1 1 
ATOM 6640 N NE2 . GLN G 2 27  ? 8.725  -59.108  42.804 1.00 50.08  ? 56  GLN E NE2 1 
ATOM 6641 N N   . ARG G 2 28  ? 12.796 -58.959  40.088 1.00 54.51  ? 57  ARG E N   1 
ATOM 6642 C CA  . ARG G 2 28  ? 12.355 -58.490  38.777 1.00 55.99  ? 57  ARG E CA  1 
ATOM 6643 C C   . ARG G 2 28  ? 13.145 -59.141  37.651 1.00 50.59  ? 57  ARG E C   1 
ATOM 6644 O O   . ARG G 2 28  ? 12.650 -59.239  36.523 1.00 48.94  ? 57  ARG E O   1 
ATOM 6645 C CB  . ARG G 2 28  ? 12.466 -56.970  38.685 1.00 44.16  ? 57  ARG E CB  1 
ATOM 6646 C CG  . ARG G 2 28  ? 11.486 -56.358  37.703 1.00 44.19  ? 57  ARG E CG  1 
ATOM 6647 C CD  . ARG G 2 28  ? 10.114 -56.178  38.320 1.00 52.86  ? 57  ARG E CD  1 
ATOM 6648 N NE  . ARG G 2 28  ? 10.191 -55.501  39.611 1.00 60.93  ? 57  ARG E NE  1 
ATOM 6649 C CZ  . ARG G 2 28  ? 9.146  -54.974  40.243 1.00 67.39  ? 57  ARG E CZ  1 
ATOM 6650 N NH1 . ARG G 2 28  ? 7.937  -55.038  39.699 1.00 65.87  ? 57  ARG E NH1 1 
ATOM 6651 N NH2 . ARG G 2 28  ? 9.311  -54.376  41.417 1.00 64.99  ? 57  ARG E NH2 1 
ATOM 6652 N N   . PHE G 2 29  ? 14.373 -59.576  37.932 1.00 48.25  ? 58  PHE E N   1 
ATOM 6653 C CA  . PHE G 2 29  ? 15.163 -60.272  36.925 1.00 45.20  ? 58  PHE E CA  1 
ATOM 6654 C C   . PHE G 2 29  ? 14.697 -61.711  36.752 1.00 46.15  ? 58  PHE E C   1 
ATOM 6655 O O   . PHE G 2 29  ? 14.681 -62.227  35.630 1.00 45.19  ? 58  PHE E O   1 
ATOM 6656 C CB  . PHE G 2 29  ? 16.645 -60.225  37.299 1.00 44.26  ? 58  PHE E CB  1 
ATOM 6657 C CG  . PHE G 2 29  ? 17.552 -60.838  36.270 1.00 47.02  ? 58  PHE E CG  1 
ATOM 6658 C CD1 . PHE G 2 29  ? 17.546 -60.388  34.962 1.00 55.41  ? 58  PHE E CD1 1 
ATOM 6659 C CD2 . PHE G 2 29  ? 18.430 -61.849  36.616 1.00 51.38  ? 58  PHE E CD2 1 
ATOM 6660 C CE1 . PHE G 2 29  ? 18.387 -60.949  34.015 1.00 56.92  ? 58  PHE E CE1 1 
ATOM 6661 C CE2 . PHE G 2 29  ? 19.275 -62.410  35.675 1.00 50.74  ? 58  PHE E CE2 1 
ATOM 6662 C CZ  . PHE G 2 29  ? 19.253 -61.959  34.373 1.00 47.78  ? 58  PHE E CZ  1 
ATOM 6663 N N   . THR G 2 30  ? 14.305 -62.365  37.849 1.00 52.38  ? 59  THR E N   1 
ATOM 6664 C CA  . THR G 2 30  ? 13.922 -63.773  37.808 1.00 47.07  ? 59  THR E CA  1 
ATOM 6665 C C   . THR G 2 30  ? 12.487 -63.972  37.335 1.00 46.98  ? 59  THR E C   1 
ATOM 6666 O O   . THR G 2 30  ? 12.221 -64.875  36.538 1.00 52.36  ? 59  THR E O   1 
ATOM 6667 C CB  . THR G 2 30  ? 14.109 -64.417  39.186 1.00 40.06  ? 59  THR E CB  1 
ATOM 6668 O OG1 . THR G 2 30  ? 13.279 -63.755  40.149 1.00 40.89  ? 59  THR E OG1 1 
ATOM 6669 C CG2 . THR G 2 30  ? 15.560 -64.354  39.627 1.00 33.03  ? 59  THR E CG2 1 
ATOM 6670 N N   . ASP G 2 31  ? 11.548 -63.153  37.813 1.00 50.41  ? 60  ASP E N   1 
ATOM 6671 C CA  . ASP G 2 31  ? 10.137 -63.432  37.565 1.00 53.38  ? 60  ASP E CA  1 
ATOM 6672 C C   . ASP G 2 31  ? 9.789  -63.399  36.081 1.00 50.77  ? 60  ASP E C   1 
ATOM 6673 O O   . ASP G 2 31  ? 8.766  -63.968  35.687 1.00 61.87  ? 60  ASP E O   1 
ATOM 6674 C CB  . ASP G 2 31  ? 9.252  -62.462  38.356 1.00 65.20  ? 60  ASP E CB  1 
ATOM 6675 C CG  . ASP G 2 31  ? 9.300  -61.048  37.820 1.00 75.95  ? 60  ASP E CG  1 
ATOM 6676 O OD1 . ASP G 2 31  ? 8.274  -60.341  37.920 1.00 85.04  ? 60  ASP E OD1 1 
ATOM 6677 O OD2 . ASP G 2 31  ? 10.360 -60.640  37.304 1.00 73.69  ? 60  ASP E OD2 1 
ATOM 6678 N N   . CYS G 2 32  ? 10.594 -62.730  35.253 1.00 47.56  ? 61  CYS E N   1 
ATOM 6679 C CA  . CYS G 2 32  ? 10.482 -62.901  33.808 1.00 61.87  ? 61  CYS E CA  1 
ATOM 6680 C C   . CYS G 2 32  ? 11.386 -64.011  33.289 1.00 59.69  ? 61  CYS E C   1 
ATOM 6681 O O   . CYS G 2 32  ? 11.084 -64.621  32.255 1.00 54.33  ? 61  CYS E O   1 
ATOM 6682 C CB  . CYS G 2 32  ? 10.808 -61.589  33.083 1.00 56.61  ? 61  CYS E CB  1 
ATOM 6683 S SG  . CYS G 2 32  ? 12.471 -60.943  33.370 1.00 50.06  ? 61  CYS E SG  1 
ATOM 6684 N N   . TYR G 2 33  ? 12.475 -64.296  34.008 1.00 54.73  ? 62  TYR E N   1 
ATOM 6685 C CA  . TYR G 2 33  ? 13.453 -65.317  33.651 1.00 52.40  ? 62  TYR E CA  1 
ATOM 6686 C C   . TYR G 2 33  ? 13.189 -66.657  34.319 1.00 56.32  ? 62  TYR E C   1 
ATOM 6687 O O   . TYR G 2 33  ? 14.145 -67.405  34.568 1.00 49.62  ? 62  TYR E O   1 
ATOM 6688 C CB  . TYR G 2 33  ? 14.857 -64.848  34.025 1.00 53.23  ? 62  TYR E CB  1 
ATOM 6689 C CG  . TYR G 2 33  ? 15.731 -64.439  32.877 1.00 54.75  ? 62  TYR E CG  1 
ATOM 6690 C CD1 . TYR G 2 33  ? 15.902 -63.101  32.544 1.00 58.69  ? 62  TYR E CD1 1 
ATOM 6691 C CD2 . TYR G 2 33  ? 16.421 -65.392  32.149 1.00 52.71  ? 62  TYR E CD2 1 
ATOM 6692 C CE1 . TYR G 2 33  ? 16.723 -62.730  31.501 1.00 54.03  ? 62  TYR E CE1 1 
ATOM 6693 C CE2 . TYR G 2 33  ? 17.235 -65.034  31.107 1.00 58.64  ? 62  TYR E CE2 1 
ATOM 6694 C CZ  . TYR G 2 33  ? 17.386 -63.705  30.788 1.00 60.06  ? 62  TYR E CZ  1 
ATOM 6695 O OH  . TYR G 2 33  ? 18.211 -63.364  29.751 1.00 57.48  ? 62  TYR E OH  1 
ATOM 6696 N N   . LYS G 2 34  ? 11.938 -66.960  34.675 1.00 55.69  ? 63  LYS E N   1 
ATOM 6697 C CA  . LYS G 2 34  ? 11.665 -68.193  35.409 1.00 47.34  ? 63  LYS E CA  1 
ATOM 6698 C C   . LYS G 2 34  ? 12.222 -69.398  34.666 1.00 47.85  ? 63  LYS E C   1 
ATOM 6699 O O   . LYS G 2 34  ? 12.903 -70.247  35.253 1.00 44.62  ? 63  LYS E O   1 
ATOM 6700 C CB  . LYS G 2 34  ? 10.165 -68.335  35.662 1.00 49.71  ? 63  LYS E CB  1 
ATOM 6701 C CG  . LYS G 2 34  ? 9.610  -67.159  36.427 1.00 49.27  ? 63  LYS E CG  1 
ATOM 6702 C CD  . LYS G 2 34  ? 10.222 -67.114  37.821 1.00 53.72  ? 63  LYS E CD  1 
ATOM 6703 C CE  . LYS G 2 34  ? 9.221  -66.702  38.878 1.00 57.66  ? 63  LYS E CE  1 
ATOM 6704 N NZ  . LYS G 2 34  ? 9.888  -66.327  40.161 1.00 47.47  ? 63  LYS E NZ  1 
ATOM 6705 N N   . CYS G 2 35  ? 11.969 -69.471  33.364 1.00 46.29  ? 64  CYS E N   1 
ATOM 6706 C CA  . CYS G 2 35  ? 12.695 -70.413  32.531 1.00 41.17  ? 64  CYS E CA  1 
ATOM 6707 C C   . CYS G 2 35  ? 14.181 -70.097  32.618 1.00 38.48  ? 64  CYS E C   1 
ATOM 6708 O O   . CYS G 2 35  ? 14.596 -68.975  32.316 1.00 45.25  ? 64  CYS E O   1 
ATOM 6709 C CB  . CYS G 2 35  ? 12.200 -70.335  31.087 1.00 47.09  ? 64  CYS E CB  1 
ATOM 6710 S SG  . CYS G 2 35  ? 12.099 -68.662  30.411 1.00 70.73  ? 64  CYS E SG  1 
ATOM 6711 N N   . PHE G 2 36  ? 14.960 -71.092  33.059 1.00 41.24  ? 65  PHE E N   1 
ATOM 6712 C CA  . PHE G 2 36  ? 16.384 -71.043  33.405 1.00 45.68  ? 65  PHE E CA  1 
ATOM 6713 C C   . PHE G 2 36  ? 16.575 -70.708  34.880 1.00 43.30  ? 65  PHE E C   1 
ATOM 6714 O O   . PHE G 2 36  ? 17.626 -71.007  35.454 1.00 42.02  ? 65  PHE E O   1 
ATOM 6715 C CB  . PHE G 2 36  ? 17.183 -70.046  32.548 1.00 40.27  ? 65  PHE E CB  1 
ATOM 6716 C CG  . PHE G 2 36  ? 18.634 -69.920  32.951 1.00 38.66  ? 65  PHE E CG  1 
ATOM 6717 C CD1 . PHE G 2 36  ? 19.054 -68.906  33.796 1.00 39.41  ? 65  PHE E CD1 1 
ATOM 6718 C CD2 . PHE G 2 36  ? 19.576 -70.823  32.486 1.00 49.02  ? 65  PHE E CD2 1 
ATOM 6719 C CE1 . PHE G 2 36  ? 20.384 -68.801  34.174 1.00 38.97  ? 65  PHE E CE1 1 
ATOM 6720 C CE2 . PHE G 2 36  ? 20.908 -70.717  32.856 1.00 49.12  ? 65  PHE E CE2 1 
ATOM 6721 C CZ  . PHE G 2 36  ? 21.311 -69.704  33.701 1.00 36.13  ? 65  PHE E CZ  1 
ATOM 6722 N N   . TYR G 2 37  ? 15.576 -70.104  35.521 1.00 48.68  ? 66  TYR E N   1 
ATOM 6723 C CA  . TYR G 2 37  ? 15.750 -69.812  36.939 1.00 49.06  ? 66  TYR E CA  1 
ATOM 6724 C C   . TYR G 2 37  ? 15.513 -71.036  37.817 1.00 48.23  ? 66  TYR E C   1 
ATOM 6725 O O   . TYR G 2 37  ? 16.180 -71.183  38.848 1.00 44.81  ? 66  TYR E O   1 
ATOM 6726 C CB  . TYR G 2 37  ? 14.840 -68.660  37.373 1.00 47.57  ? 66  TYR E CB  1 
ATOM 6727 C CG  . TYR G 2 37  ? 14.885 -68.401  38.864 1.00 43.84  ? 66  TYR E CG  1 
ATOM 6728 C CD1 . TYR G 2 37  ? 16.097 -68.193  39.514 1.00 41.32  ? 66  TYR E CD1 1 
ATOM 6729 C CD2 . TYR G 2 37  ? 13.719 -68.345  39.618 1.00 40.87  ? 66  TYR E CD2 1 
ATOM 6730 C CE1 . TYR G 2 37  ? 16.149 -67.961  40.874 1.00 37.03  ? 66  TYR E CE1 1 
ATOM 6731 C CE2 . TYR G 2 37  ? 13.761 -68.106  40.981 1.00 32.87  ? 66  TYR E CE2 1 
ATOM 6732 C CZ  . TYR G 2 37  ? 14.979 -67.916  41.602 1.00 31.93  ? 66  TYR E CZ  1 
ATOM 6733 O OH  . TYR G 2 37  ? 15.031 -67.679  42.957 1.00 29.25  ? 66  TYR E OH  1 
ATOM 6734 N N   . GLN G 2 38  ? 14.589 -71.926  37.430 1.00 50.04  ? 67  GLN E N   1 
ATOM 6735 C CA  . GLN G 2 38  ? 14.339 -73.119  38.237 1.00 50.88  ? 67  GLN E CA  1 
ATOM 6736 C C   . GLN G 2 38  ? 15.537 -74.063  38.269 1.00 44.37  ? 67  GLN E C   1 
ATOM 6737 O O   . GLN G 2 38  ? 15.694 -74.823  39.231 1.00 44.18  ? 67  GLN E O   1 
ATOM 6738 C CB  . GLN G 2 38  ? 13.104 -73.869  37.730 1.00 53.64  ? 67  GLN E CB  1 
ATOM 6739 C CG  . GLN G 2 38  ? 11.786 -73.111  37.855 1.00 46.24  ? 67  GLN E CG  1 
ATOM 6740 C CD  . GLN G 2 38  ? 11.321 -72.509  36.543 1.00 49.13  ? 67  GLN E CD  1 
ATOM 6741 O OE1 . GLN G 2 38  ? 11.835 -72.845  35.475 1.00 53.41  ? 67  GLN E OE1 1 
ATOM 6742 N NE2 . GLN G 2 38  ? 10.329 -71.627  36.616 1.00 49.17  ? 67  GLN E NE2 1 
ATOM 6743 N N   . LEU G 2 39  ? 16.379 -74.046  37.240 1.00 42.19  ? 68  LEU E N   1 
ATOM 6744 C CA  . LEU G 2 39  ? 17.579 -74.870  37.197 1.00 43.20  ? 68  LEU E CA  1 
ATOM 6745 C C   . LEU G 2 39  ? 18.798 -73.986  37.437 1.00 49.04  ? 68  LEU E C   1 
ATOM 6746 O O   . LEU G 2 39  ? 18.975 -72.964  36.765 1.00 48.36  ? 68  LEU E O   1 
ATOM 6747 C CB  . LEU G 2 39  ? 17.685 -75.652  35.877 1.00 44.71  ? 68  LEU E CB  1 
ATOM 6748 C CG  . LEU G 2 39  ? 17.325 -75.181  34.456 1.00 42.44  ? 68  LEU E CG  1 
ATOM 6749 C CD1 . LEU G 2 39  ? 15.845 -74.801  34.286 1.00 35.53  ? 68  LEU E CD1 1 
ATOM 6750 C CD2 . LEU G 2 39  ? 18.242 -74.071  33.967 1.00 47.72  ? 68  LEU E CD2 1 
ATOM 6751 N N   . GLN G 2 40  ? 19.627 -74.380  38.403 1.00 56.89  ? 69  GLN E N   1 
ATOM 6752 C CA  . GLN G 2 40  ? 20.793 -73.621  38.848 1.00 58.12  ? 69  GLN E CA  1 
ATOM 6753 C C   . GLN G 2 40  ? 20.406 -72.191  39.212 1.00 49.63  ? 69  GLN E C   1 
ATOM 6754 O O   . GLN G 2 40  ? 20.785 -71.245  38.510 1.00 47.45  ? 69  GLN E O   1 
ATOM 6755 C CB  . GLN G 2 40  ? 21.882 -73.616  37.773 1.00 47.93  ? 69  GLN E CB  1 
ATOM 6756 C CG  . GLN G 2 40  ? 22.419 -74.990  37.441 1.00 54.06  ? 69  GLN E CG  1 
ATOM 6757 C CD  . GLN G 2 40  ? 21.873 -75.508  36.131 1.00 68.83  ? 69  GLN E CD  1 
ATOM 6758 O OE1 . GLN G 2 40  ? 21.568 -74.730  35.228 1.00 59.10  ? 69  GLN E OE1 1 
ATOM 6759 N NE2 . GLN G 2 40  ? 21.736 -76.829  36.021 1.00 79.17  ? 69  GLN E NE2 1 
ATOM 6760 N N   . PRO G 2 41  ? 19.637 -71.987  40.287 1.00 43.42  ? 70  PRO E N   1 
ATOM 6761 C CA  . PRO G 2 41  ? 19.362 -70.618  40.744 1.00 53.80  ? 70  PRO E CA  1 
ATOM 6762 C C   . PRO G 2 41  ? 20.565 -69.931  41.370 1.00 56.79  ? 70  PRO E C   1 
ATOM 6763 O O   . PRO G 2 41  ? 20.463 -68.753  41.731 1.00 55.87  ? 70  PRO E O   1 
ATOM 6764 C CB  . PRO G 2 41  ? 18.238 -70.812  41.778 1.00 60.16  ? 70  PRO E CB  1 
ATOM 6765 C CG  . PRO G 2 41  ? 17.747 -72.222  41.587 1.00 44.67  ? 70  PRO E CG  1 
ATOM 6766 C CD  . PRO G 2 41  ? 18.932 -72.983  41.108 1.00 44.69  ? 70  PRO E CD  1 
ATOM 6767 N N   . ALA G 2 42  ? 21.696 -70.626  41.511 1.00 56.95  ? 71  ALA E N   1 
ATOM 6768 C CA  . ALA G 2 42  ? 22.921 -69.970  41.953 1.00 55.96  ? 71  ALA E CA  1 
ATOM 6769 C C   . ALA G 2 42  ? 23.604 -69.232  40.809 1.00 52.02  ? 71  ALA E C   1 
ATOM 6770 O O   . ALA G 2 42  ? 24.110 -68.120  41.000 1.00 54.19  ? 71  ALA E O   1 
ATOM 6771 C CB  . ALA G 2 42  ? 23.873 -70.993  42.573 1.00 57.73  ? 71  ALA E CB  1 
ATOM 6772 N N   . MET G 2 43  ? 23.637 -69.833  39.617 1.00 48.69  ? 72  MET E N   1 
ATOM 6773 C CA  . MET G 2 43  ? 24.231 -69.142  38.480 1.00 51.12  ? 72  MET E CA  1 
ATOM 6774 C C   . MET G 2 43  ? 23.392 -67.949  38.047 1.00 58.52  ? 72  MET E C   1 
ATOM 6775 O O   . MET G 2 43  ? 23.947 -66.946  37.587 1.00 63.95  ? 72  MET E O   1 
ATOM 6776 C CB  . MET G 2 43  ? 24.452 -70.093  37.305 1.00 47.86  ? 72  MET E CB  1 
ATOM 6777 C CG  . MET G 2 43  ? 25.520 -69.563  36.357 1.00 63.39  ? 72  MET E CG  1 
ATOM 6778 S SD  . MET G 2 43  ? 26.398 -70.786  35.371 1.00 95.75  ? 72  MET E SD  1 
ATOM 6779 C CE  . MET G 2 43  ? 27.787 -69.801  34.807 1.00 71.74  ? 72  MET E CE  1 
ATOM 6780 N N   . THR G 2 44  ? 22.064 -68.036  38.166 1.00 51.62  ? 73  THR E N   1 
ATOM 6781 C CA  . THR G 2 44  ? 21.221 -66.901  37.801 1.00 44.43  ? 73  THR E CA  1 
ATOM 6782 C C   . THR G 2 44  ? 21.617 -65.659  38.586 1.00 47.32  ? 73  THR E C   1 
ATOM 6783 O O   . THR G 2 44  ? 21.765 -64.570  38.016 1.00 53.07  ? 73  THR E O   1 
ATOM 6784 C CB  . THR G 2 44  ? 19.751 -67.238  38.045 1.00 46.45  ? 73  THR E CB  1 
ATOM 6785 O OG1 . THR G 2 44  ? 19.347 -68.293  37.164 1.00 53.77  ? 73  THR E OG1 1 
ATOM 6786 C CG2 . THR G 2 44  ? 18.876 -66.017  37.806 1.00 38.89  ? 73  THR E CG2 1 
ATOM 6787 N N   . GLN G 2 45  ? 21.831 -65.812  39.893 1.00 49.65  ? 74  GLN E N   1 
ATOM 6788 C CA  . GLN G 2 45  ? 22.237 -64.681  40.714 1.00 53.59  ? 74  GLN E CA  1 
ATOM 6789 C C   . GLN G 2 45  ? 23.657 -64.244  40.378 1.00 55.00  ? 74  GLN E C   1 
ATOM 6790 O O   . GLN G 2 45  ? 23.982 -63.058  40.489 1.00 58.25  ? 74  GLN E O   1 
ATOM 6791 C CB  . GLN G 2 45  ? 22.109 -65.047  42.195 1.00 56.79  ? 74  GLN E CB  1 
ATOM 6792 C CG  . GLN G 2 45  ? 21.878 -63.871  43.135 1.00 49.71  ? 74  GLN E CG  1 
ATOM 6793 C CD  . GLN G 2 45  ? 23.149 -63.144  43.514 1.00 58.70  ? 74  GLN E CD  1 
ATOM 6794 O OE1 . GLN G 2 45  ? 24.254 -63.606  43.232 1.00 68.03  ? 74  GLN E OE1 1 
ATOM 6795 N NE2 . GLN G 2 45  ? 22.997 -61.996  44.161 1.00 62.73  ? 74  GLN E NE2 1 
ATOM 6796 N N   . GLN G 2 46  ? 24.511 -65.182  39.963 1.00 50.79  ? 75  GLN E N   1 
ATOM 6797 C CA  . GLN G 2 46  ? 25.872 -64.832  39.567 1.00 55.17  ? 75  GLN E CA  1 
ATOM 6798 C C   . GLN G 2 46  ? 25.880 -63.953  38.320 1.00 52.58  ? 75  GLN E C   1 
ATOM 6799 O O   . GLN G 2 46  ? 26.553 -62.914  38.278 1.00 55.32  ? 75  GLN E O   1 
ATOM 6800 C CB  . GLN G 2 46  ? 26.679 -66.107  39.323 1.00 59.02  ? 75  GLN E CB  1 
ATOM 6801 C CG  . GLN G 2 46  ? 27.999 -65.882  38.609 1.00 68.46  ? 75  GLN E CG  1 
ATOM 6802 C CD  . GLN G 2 46  ? 28.793 -67.162  38.437 1.00 74.41  ? 75  GLN E CD  1 
ATOM 6803 O OE1 . GLN G 2 46  ? 28.310 -68.252  38.746 1.00 74.25  ? 75  GLN E OE1 1 
ATOM 6804 N NE2 . GLN G 2 46  ? 30.016 -67.037  37.932 1.00 79.65  ? 75  GLN E NE2 1 
ATOM 6805 N N   . ILE G 2 47  ? 25.126 -64.352  37.293 1.00 48.52  ? 76  ILE E N   1 
ATOM 6806 C CA  . ILE G 2 47  ? 25.095 -63.593  36.049 1.00 53.48  ? 76  ILE E CA  1 
ATOM 6807 C C   . ILE G 2 47  ? 24.344 -62.283  36.235 1.00 52.80  ? 76  ILE E C   1 
ATOM 6808 O O   . ILE G 2 47  ? 24.666 -61.277  35.589 1.00 53.71  ? 76  ILE E O   1 
ATOM 6809 C CB  . ILE G 2 47  ? 24.493 -64.453  34.922 1.00 51.50  ? 76  ILE E CB  1 
ATOM 6810 C CG1 . ILE G 2 47  ? 25.185 -65.815  34.880 1.00 58.58  ? 76  ILE E CG1 1 
ATOM 6811 C CG2 . ILE G 2 47  ? 24.675 -63.779  33.580 1.00 52.84  ? 76  ILE E CG2 1 
ATOM 6812 C CD1 . ILE G 2 47  ? 26.701 -65.733  34.777 1.00 60.04  ? 76  ILE E CD1 1 
ATOM 6813 N N   . TYR G 2 48  ? 23.340 -62.261  37.116 1.00 49.76  ? 77  TYR E N   1 
ATOM 6814 C CA  . TYR G 2 48  ? 22.690 -60.996  37.440 1.00 47.77  ? 77  TYR E CA  1 
ATOM 6815 C C   . TYR G 2 48  ? 23.657 -60.053  38.146 1.00 45.64  ? 77  TYR E C   1 
ATOM 6816 O O   . TYR G 2 48  ? 23.688 -58.852  37.855 1.00 46.59  ? 77  TYR E O   1 
ATOM 6817 C CB  . TYR G 2 48  ? 21.454 -61.245  38.303 1.00 50.23  ? 77  TYR E CB  1 
ATOM 6818 C CG  . TYR G 2 48  ? 20.873 -59.995  38.931 1.00 51.90  ? 77  TYR E CG  1 
ATOM 6819 C CD1 . TYR G 2 48  ? 19.979 -59.195  38.231 1.00 50.00  ? 77  TYR E CD1 1 
ATOM 6820 C CD2 . TYR G 2 48  ? 21.206 -59.624  40.230 1.00 49.61  ? 77  TYR E CD2 1 
ATOM 6821 C CE1 . TYR G 2 48  ? 19.441 -58.054  38.802 1.00 49.59  ? 77  TYR E CE1 1 
ATOM 6822 C CE2 . TYR G 2 48  ? 20.672 -58.485  40.808 1.00 48.11  ? 77  TYR E CE2 1 
ATOM 6823 C CZ  . TYR G 2 48  ? 19.790 -57.704  40.091 1.00 45.47  ? 77  TYR E CZ  1 
ATOM 6824 O OH  . TYR G 2 48  ? 19.257 -56.573  40.665 1.00 40.79  ? 77  TYR E OH  1 
ATOM 6825 N N   . ASP G 2 49  ? 24.461 -60.586  39.067 1.00 44.41  ? 78  ASP E N   1 
ATOM 6826 C CA  . ASP G 2 49  ? 25.433 -59.764  39.780 1.00 43.17  ? 78  ASP E CA  1 
ATOM 6827 C C   . ASP G 2 49  ? 26.472 -59.189  38.829 1.00 42.56  ? 78  ASP E C   1 
ATOM 6828 O O   . ASP G 2 49  ? 26.783 -57.991  38.881 1.00 47.66  ? 78  ASP E O   1 
ATOM 6829 C CB  . ASP G 2 49  ? 26.106 -60.595  40.872 1.00 47.96  ? 78  ASP E CB  1 
ATOM 6830 C CG  . ASP G 2 49  ? 25.216 -60.796  42.076 1.00 53.62  ? 78  ASP E CG  1 
ATOM 6831 O OD1 . ASP G 2 49  ? 25.750 -61.033  43.181 1.00 52.19  ? 78  ASP E OD1 1 
ATOM 6832 O OD2 . ASP G 2 49  ? 23.981 -60.706  41.917 1.00 56.15  ? 78  ASP E OD2 1 
ATOM 6833 N N   . LYS G 2 50  ? 27.017 -60.027  37.942 1.00 44.10  ? 79  LYS E N   1 
ATOM 6834 C CA  . LYS G 2 50  ? 27.956 -59.522  36.946 1.00 48.01  ? 79  LYS E CA  1 
ATOM 6835 C C   . LYS G 2 50  ? 27.295 -58.490  36.040 1.00 48.70  ? 79  LYS E C   1 
ATOM 6836 O O   . LYS G 2 50  ? 27.918 -57.486  35.672 1.00 49.05  ? 79  LYS E O   1 
ATOM 6837 C CB  . LYS G 2 50  ? 28.532 -60.672  36.120 1.00 50.51  ? 79  LYS E CB  1 
ATOM 6838 C CG  . LYS G 2 50  ? 29.709 -61.375  36.786 1.00 68.66  ? 79  LYS E CG  1 
ATOM 6839 C CD  . LYS G 2 50  ? 30.389 -62.365  35.847 1.00 74.56  ? 79  LYS E CD  1 
ATOM 6840 C CE  . LYS G 2 50  ? 31.223 -61.644  34.794 1.00 64.47  ? 79  LYS E CE  1 
ATOM 6841 N NZ  . LYS G 2 50  ? 31.960 -62.587  33.904 1.00 40.90  ? 79  LYS E NZ  1 
ATOM 6842 N N   . PHE G 2 51  ? 26.030 -58.718  35.679 1.00 45.34  ? 80  PHE E N   1 
ATOM 6843 C CA  . PHE G 2 51  ? 25.314 -57.767  34.836 1.00 42.46  ? 80  PHE E CA  1 
ATOM 6844 C C   . PHE G 2 51  ? 25.222 -56.404  35.505 1.00 39.32  ? 80  PHE E C   1 
ATOM 6845 O O   . PHE G 2 51  ? 25.591 -55.382  34.916 1.00 45.87  ? 80  PHE E O   1 
ATOM 6846 C CB  . PHE G 2 51  ? 23.917 -58.300  34.518 1.00 45.55  ? 80  PHE E CB  1 
ATOM 6847 C CG  . PHE G 2 51  ? 22.867 -57.226  34.388 1.00 41.31  ? 80  PHE E CG  1 
ATOM 6848 C CD1 . PHE G 2 51  ? 22.756 -56.477  33.232 1.00 40.02  ? 80  PHE E CD1 1 
ATOM 6849 C CD2 . PHE G 2 51  ? 21.986 -56.974  35.428 1.00 41.35  ? 80  PHE E CD2 1 
ATOM 6850 C CE1 . PHE G 2 51  ? 21.796 -55.494  33.116 1.00 44.04  ? 80  PHE E CE1 1 
ATOM 6851 C CE2 . PHE G 2 51  ? 21.022 -55.994  35.318 1.00 36.74  ? 80  PHE E CE2 1 
ATOM 6852 C CZ  . PHE G 2 51  ? 20.925 -55.255  34.160 1.00 43.72  ? 80  PHE E CZ  1 
ATOM 6853 N N   . ILE G 2 52  ? 24.743 -56.373  36.746 1.00 39.65  ? 81  ILE E N   1 
ATOM 6854 C CA  . ILE G 2 52  ? 24.493 -55.099  37.404 1.00 39.07  ? 81  ILE E CA  1 
ATOM 6855 C C   . ILE G 2 52  ? 25.813 -54.393  37.702 1.00 38.06  ? 81  ILE E C   1 
ATOM 6856 O O   . ILE G 2 52  ? 25.939 -53.171  37.522 1.00 38.31  ? 81  ILE E O   1 
ATOM 6857 C CB  . ILE G 2 52  ? 23.626 -55.330  38.660 1.00 32.39  ? 81  ILE E CB  1 
ATOM 6858 C CG1 . ILE G 2 52  ? 22.936 -54.047  39.090 1.00 28.62  ? 81  ILE E CG1 1 
ATOM 6859 C CG2 . ILE G 2 52  ? 24.440 -55.882  39.829 1.00 35.17  ? 81  ILE E CG2 1 
ATOM 6860 C CD1 . ILE G 2 52  ? 21.497 -54.288  39.471 1.00 33.91  ? 81  ILE E CD1 1 
ATOM 6861 N N   . ALA G 2 53  ? 26.836 -55.160  38.090 1.00 37.97  ? 82  ALA E N   1 
ATOM 6862 C CA  . ALA G 2 53  ? 28.124 -54.569  38.424 1.00 40.75  ? 82  ALA E CA  1 
ATOM 6863 C C   . ALA G 2 53  ? 28.794 -53.986  37.186 1.00 37.63  ? 82  ALA E C   1 
ATOM 6864 O O   . ALA G 2 53  ? 29.196 -52.816  37.179 1.00 43.62  ? 82  ALA E O   1 
ATOM 6865 C CB  . ALA G 2 53  ? 29.022 -55.614  39.087 1.00 45.98  ? 82  ALA E CB  1 
ATOM 6866 N N   . GLN G 2 54  ? 28.903 -54.781  36.119 1.00 35.27  ? 83  GLN E N   1 
ATOM 6867 C CA  . GLN G 2 54  ? 29.559 -54.281  34.916 1.00 45.08  ? 83  GLN E CA  1 
ATOM 6868 C C   . GLN G 2 54  ? 28.750 -53.167  34.265 1.00 44.15  ? 83  GLN E C   1 
ATOM 6869 O O   . GLN G 2 54  ? 29.321 -52.302  33.589 1.00 48.49  ? 83  GLN E O   1 
ATOM 6870 C CB  . GLN G 2 54  ? 29.809 -55.425  33.932 1.00 48.30  ? 83  GLN E CB  1 
ATOM 6871 C CG  . GLN G 2 54  ? 31.000 -55.183  33.011 1.00 50.24  ? 83  GLN E CG  1 
ATOM 6872 C CD  . GLN G 2 54  ? 31.137 -56.235  31.924 1.00 65.63  ? 83  GLN E CD  1 
ATOM 6873 O OE1 . GLN G 2 54  ? 31.184 -57.435  32.206 1.00 71.14  ? 83  GLN E OE1 1 
ATOM 6874 N NE2 . GLN G 2 54  ? 31.207 -55.789  30.673 1.00 53.50  ? 83  GLN E NE2 1 
ATOM 6875 N N   . LEU G 2 55  ? 27.432 -53.155  34.475 1.00 38.17  ? 84  LEU E N   1 
ATOM 6876 C CA  . LEU G 2 55  ? 26.617 -52.044  33.997 1.00 36.33  ? 84  LEU E CA  1 
ATOM 6877 C C   . LEU G 2 55  ? 26.980 -50.749  34.712 1.00 33.63  ? 84  LEU E C   1 
ATOM 6878 O O   . LEU G 2 55  ? 27.331 -49.747  34.073 1.00 32.59  ? 84  LEU E O   1 
ATOM 6879 C CB  . LEU G 2 55  ? 25.135 -52.361  34.192 1.00 32.56  ? 84  LEU E CB  1 
ATOM 6880 C CG  . LEU G 2 55  ? 24.184 -51.168  34.088 1.00 24.25  ? 84  LEU E CG  1 
ATOM 6881 C CD1 . LEU G 2 55  ? 24.117 -50.642  32.665 1.00 29.53  ? 84  LEU E CD1 1 
ATOM 6882 C CD2 . LEU G 2 55  ? 22.804 -51.563  34.576 1.00 21.28  ? 84  LEU E CD2 1 
ATOM 6883 N N   . GLN G 2 56  ? 26.918 -50.751  36.046 1.00 33.79  ? 85  GLN E N   1 
ATOM 6884 C CA  . GLN G 2 56  ? 27.132 -49.498  36.762 1.00 32.42  ? 85  GLN E CA  1 
ATOM 6885 C C   . GLN G 2 56  ? 28.578 -49.025  36.650 1.00 31.87  ? 85  GLN E C   1 
ATOM 6886 O O   . GLN G 2 56  ? 28.831 -47.820  36.549 1.00 37.98  ? 85  GLN E O   1 
ATOM 6887 C CB  . GLN G 2 56  ? 26.717 -49.638  38.225 1.00 31.26  ? 85  GLN E CB  1 
ATOM 6888 C CG  . GLN G 2 56  ? 27.485 -50.662  39.021 1.00 34.60  ? 85  GLN E CG  1 
ATOM 6889 C CD  . GLN G 2 56  ? 26.994 -50.743  40.447 1.00 45.13  ? 85  GLN E CD  1 
ATOM 6890 O OE1 . GLN G 2 56  ? 27.064 -49.765  41.192 1.00 51.95  ? 85  GLN E OE1 1 
ATOM 6891 N NE2 . GLN G 2 56  ? 26.488 -51.909  40.837 1.00 42.79  ? 85  GLN E NE2 1 
ATOM 6892 N N   . THR G 2 57  ? 29.543 -49.945  36.652 1.00 31.31  ? 86  THR E N   1 
ATOM 6893 C CA  . THR G 2 57  ? 30.927 -49.498  36.518 1.00 35.75  ? 86  THR E CA  1 
ATOM 6894 C C   . THR G 2 57  ? 31.271 -49.118  35.085 1.00 38.10  ? 86  THR E C   1 
ATOM 6895 O O   . THR G 2 57  ? 32.164 -48.291  34.869 1.00 45.12  ? 86  THR E O   1 
ATOM 6896 C CB  . THR G 2 57  ? 31.898 -50.562  37.020 1.00 35.98  ? 86  THR E CB  1 
ATOM 6897 O OG1 . THR G 2 57  ? 31.759 -51.747  36.229 1.00 53.93  ? 86  THR E OG1 1 
ATOM 6898 C CG2 . THR G 2 57  ? 31.632 -50.872  38.491 1.00 34.64  ? 86  THR E CG2 1 
ATOM 6899 N N   . SER G 2 58  ? 30.602 -49.714  34.098 1.00 37.17  ? 87  SER E N   1 
ATOM 6900 C CA  . SER G 2 58  ? 30.797 -49.254  32.727 1.00 45.45  ? 87  SER E CA  1 
ATOM 6901 C C   . SER G 2 58  ? 30.243 -47.844  32.545 1.00 41.81  ? 87  SER E C   1 
ATOM 6902 O O   . SER G 2 58  ? 30.854 -47.006  31.867 1.00 39.32  ? 87  SER E O   1 
ATOM 6903 C CB  . SER G 2 58  ? 30.138 -50.229  31.750 1.00 46.89  ? 87  SER E CB  1 
ATOM 6904 O OG  . SER G 2 58  ? 30.576 -50.000  30.421 1.00 58.35  ? 87  SER E OG  1 
ATOM 6905 N N   . ILE G 2 59  ? 29.100 -47.560  33.171 1.00 39.55  ? 88  ILE E N   1 
ATOM 6906 C CA  . ILE G 2 59  ? 28.452 -46.264  33.005 1.00 33.30  ? 88  ILE E CA  1 
ATOM 6907 C C   . ILE G 2 59  ? 29.210 -45.181  33.785 1.00 33.35  ? 88  ILE E C   1 
ATOM 6908 O O   . ILE G 2 59  ? 29.381 -44.047  33.305 1.00 33.72  ? 88  ILE E O   1 
ATOM 6909 C CB  . ILE G 2 59  ? 26.969 -46.404  33.411 1.00 28.03  ? 88  ILE E CB  1 
ATOM 6910 C CG1 . ILE G 2 59  ? 26.077 -45.424  32.668 1.00 30.53  ? 88  ILE E CG1 1 
ATOM 6911 C CG2 . ILE G 2 59  ? 26.773 -46.211  34.889 1.00 27.90  ? 88  ILE E CG2 1 
ATOM 6912 C CD1 . ILE G 2 59  ? 24.631 -45.894  32.588 1.00 26.61  ? 88  ILE E CD1 1 
ATOM 6913 N N   . ARG G 2 60  ? 29.722 -45.525  34.975 1.00 33.26  ? 89  ARG E N   1 
ATOM 6914 C CA  . ARG G 2 60  ? 30.566 -44.592  35.717 1.00 34.52  ? 89  ARG E CA  1 
ATOM 6915 C C   . ARG G 2 60  ? 31.885 -44.375  34.995 1.00 39.24  ? 89  ARG E C   1 
ATOM 6916 O O   . ARG G 2 60  ? 32.420 -43.257  34.971 1.00 41.85  ? 89  ARG E O   1 
ATOM 6917 C CB  . ARG G 2 60  ? 30.815 -45.104  37.135 1.00 32.55  ? 89  ARG E CB  1 
ATOM 6918 C CG  . ARG G 2 60  ? 29.605 -45.042  38.045 1.00 34.22  ? 89  ARG E CG  1 
ATOM 6919 C CD  . ARG G 2 60  ? 29.939 -45.578  39.425 1.00 38.54  ? 89  ARG E CD  1 
ATOM 6920 N NE  . ARG G 2 60  ? 28.765 -45.629  40.290 1.00 40.21  ? 89  ARG E NE  1 
ATOM 6921 C CZ  . ARG G 2 60  ? 28.817 -45.715  41.614 1.00 50.30  ? 89  ARG E CZ  1 
ATOM 6922 N NH1 . ARG G 2 60  ? 29.991 -45.759  42.232 1.00 55.35  ? 89  ARG E NH1 1 
ATOM 6923 N NH2 . ARG G 2 60  ? 27.697 -45.755  42.323 1.00 53.55  ? 89  ARG E NH2 1 
ATOM 6924 N N   . GLU G 2 61  ? 32.422 -45.435  34.393 1.00 40.65  ? 90  GLU E N   1 
ATOM 6925 C CA  . GLU G 2 61  ? 33.589 -45.270  33.543 1.00 47.39  ? 90  GLU E CA  1 
ATOM 6926 C C   . GLU G 2 61  ? 33.279 -44.347  32.375 1.00 46.72  ? 90  GLU E C   1 
ATOM 6927 O O   . GLU G 2 61  ? 34.174 -43.659  31.880 1.00 48.81  ? 90  GLU E O   1 
ATOM 6928 C CB  . GLU G 2 61  ? 34.062 -46.632  33.034 1.00 49.66  ? 90  GLU E CB  1 
ATOM 6929 C CG  . GLU G 2 61  ? 35.483 -46.642  32.500 1.00 61.64  ? 90  GLU E CG  1 
ATOM 6930 C CD  . GLU G 2 61  ? 36.517 -46.566  33.607 1.00 75.52  ? 90  GLU E CD  1 
ATOM 6931 O OE1 . GLU G 2 61  ? 36.174 -46.885  34.766 1.00 73.62  ? 90  GLU E OE1 1 
ATOM 6932 O OE2 . GLU G 2 61  ? 37.673 -46.190  33.316 1.00 79.66  ? 90  GLU E OE2 1 
ATOM 6933 N N   . GLU G 2 62  ? 32.015 -44.291  31.945 1.00 44.29  ? 91  GLU E N   1 
ATOM 6934 C CA  . GLU G 2 62  ? 31.646 -43.366  30.876 1.00 40.27  ? 91  GLU E CA  1 
ATOM 6935 C C   . GLU G 2 62  ? 31.670 -41.917  31.352 1.00 38.04  ? 91  GLU E C   1 
ATOM 6936 O O   . GLU G 2 62  ? 32.248 -41.051  30.682 1.00 39.30  ? 91  GLU E O   1 
ATOM 6937 C CB  . GLU G 2 62  ? 30.275 -43.721  30.303 1.00 42.31  ? 91  GLU E CB  1 
ATOM 6938 C CG  . GLU G 2 62  ? 29.814 -42.776  29.199 1.00 37.68  ? 91  GLU E CG  1 
ATOM 6939 C CD  . GLU G 2 62  ? 30.712 -42.813  27.973 1.00 40.65  ? 91  GLU E CD  1 
ATOM 6940 O OE1 . GLU G 2 62  ? 31.317 -43.870  27.699 1.00 43.27  ? 91  GLU E OE1 1 
ATOM 6941 O OE2 . GLU G 2 62  ? 30.815 -41.777  27.281 1.00 42.48  ? 91  GLU E OE2 1 
ATOM 6942 N N   . ILE G 2 63  ? 31.035 -41.619  32.494 1.00 41.87  ? 92  ILE E N   1 
ATOM 6943 C CA  . ILE G 2 63  ? 31.064 -40.223  32.945 1.00 35.21  ? 92  ILE E CA  1 
ATOM 6944 C C   . ILE G 2 63  ? 32.491 -39.789  33.257 1.00 35.91  ? 92  ILE E C   1 
ATOM 6945 O O   . ILE G 2 63  ? 32.868 -38.635  33.007 1.00 36.42  ? 92  ILE E O   1 
ATOM 6946 C CB  . ILE G 2 63  ? 30.125 -39.984  34.149 1.00 34.99  ? 92  ILE E CB  1 
ATOM 6947 C CG1 . ILE G 2 63  ? 30.440 -40.927  35.314 1.00 41.47  ? 92  ILE E CG1 1 
ATOM 6948 C CG2 . ILE G 2 63  ? 28.666 -40.074  33.720 1.00 35.80  ? 92  ILE E CG2 1 
ATOM 6949 C CD1 . ILE G 2 63  ? 31.317 -40.317  36.394 1.00 41.45  ? 92  ILE E CD1 1 
ATOM 6950 N N   . SER G 2 64  ? 33.316 -40.697  33.780 1.00 39.32  ? 93  SER E N   1 
ATOM 6951 C CA  . SER G 2 64  ? 34.730 -40.374  33.916 1.00 41.47  ? 93  SER E CA  1 
ATOM 6952 C C   . SER G 2 64  ? 35.416 -40.260  32.563 1.00 40.13  ? 93  SER E C   1 
ATOM 6953 O O   . SER G 2 64  ? 36.465 -39.616  32.466 1.00 38.37  ? 93  SER E O   1 
ATOM 6954 C CB  . SER G 2 64  ? 35.441 -41.420  34.775 1.00 52.06  ? 93  SER E CB  1 
ATOM 6955 O OG  . SER G 2 64  ? 35.025 -41.337  36.126 1.00 61.37  ? 93  SER E OG  1 
ATOM 6956 N N   . ASP G 2 65  ? 34.850 -40.875  31.521 1.00 42.68  ? 94  ASP E N   1 
ATOM 6957 C CA  . ASP G 2 65  ? 35.424 -40.756  30.186 1.00 44.04  ? 94  ASP E CA  1 
ATOM 6958 C C   . ASP G 2 65  ? 35.175 -39.377  29.592 1.00 45.15  ? 94  ASP E C   1 
ATOM 6959 O O   . ASP G 2 65  ? 36.073 -38.793  28.974 1.00 48.89  ? 94  ASP E O   1 
ATOM 6960 C CB  . ASP G 2 65  ? 34.843 -41.833  29.268 1.00 54.35  ? 94  ASP E CB  1 
ATOM 6961 C CG  . ASP G 2 65  ? 35.579 -43.151  29.365 1.00 63.64  ? 94  ASP E CG  1 
ATOM 6962 O OD1 . ASP G 2 65  ? 36.362 -43.330  30.323 1.00 66.29  ? 94  ASP E OD1 1 
ATOM 6963 O OD2 . ASP G 2 65  ? 35.362 -44.019  28.491 1.00 63.30  ? 94  ASP E OD2 1 
ATOM 6964 N N   . ILE G 2 66  ? 33.964 -38.834  29.762 1.00 46.33  ? 95  ILE E N   1 
ATOM 6965 C CA  . ILE G 2 66  ? 33.693 -37.499  29.236 1.00 38.60  ? 95  ILE E CA  1 
ATOM 6966 C C   . ILE G 2 66  ? 34.115 -36.394  30.195 1.00 38.49  ? 95  ILE E C   1 
ATOM 6967 O O   . ILE G 2 66  ? 34.080 -35.214  29.817 1.00 39.58  ? 95  ILE E O   1 
ATOM 6968 C CB  . ILE G 2 66  ? 32.211 -37.329  28.844 1.00 38.56  ? 95  ILE E CB  1 
ATOM 6969 C CG1 . ILE G 2 66  ? 31.275 -37.929  29.895 1.00 41.09  ? 95  ILE E CG1 1 
ATOM 6970 C CG2 . ILE G 2 66  ? 31.949 -37.950  27.478 1.00 45.86  ? 95  ILE E CG2 1 
ATOM 6971 C CD1 . ILE G 2 66  ? 31.037 -37.028  31.088 1.00 43.43  ? 95  ILE E CD1 1 
ATOM 6972 N N   . LYS G 2 67  ? 34.498 -36.725  31.430 1.00 40.33  ? 96  LYS E N   1 
ATOM 6973 C CA  . LYS G 2 67  ? 35.139 -35.707  32.255 1.00 35.87  ? 96  LYS E CA  1 
ATOM 6974 C C   . LYS G 2 67  ? 36.585 -35.461  31.839 1.00 39.40  ? 96  LYS E C   1 
ATOM 6975 O O   . LYS G 2 67  ? 37.078 -34.338  31.978 1.00 44.58  ? 96  LYS E O   1 
ATOM 6976 C CB  . LYS G 2 67  ? 35.075 -36.090  33.735 1.00 35.86  ? 96  LYS E CB  1 
ATOM 6977 C CG  . LYS G 2 67  ? 33.767 -35.699  34.405 1.00 38.55  ? 96  LYS E CG  1 
ATOM 6978 C CD  . LYS G 2 67  ? 33.498 -36.490  35.680 1.00 45.02  ? 96  LYS E CD  1 
ATOM 6979 C CE  . LYS G 2 67  ? 34.385 -36.039  36.830 1.00 44.23  ? 96  LYS E CE  1 
ATOM 6980 N NZ  . LYS G 2 67  ? 34.090 -36.802  38.078 1.00 45.71  ? 96  LYS E NZ  1 
ATOM 6981 N N   . GLU G 2 68  ? 37.270 -36.475  31.315 1.00 41.00  ? 97  GLU E N   1 
ATOM 6982 C CA  . GLU G 2 68  ? 38.656 -36.333  30.893 1.00 40.52  ? 97  GLU E CA  1 
ATOM 6983 C C   . GLU G 2 68  ? 38.818 -36.051  29.405 1.00 39.17  ? 97  GLU E C   1 
ATOM 6984 O O   . GLU G 2 68  ? 39.954 -36.002  28.928 1.00 45.87  ? 97  GLU E O   1 
ATOM 6985 C CB  . GLU G 2 68  ? 39.455 -37.591  31.255 1.00 45.72  ? 97  GLU E CB  1 
ATOM 6986 C CG  . GLU G 2 68  ? 39.800 -37.729  32.732 1.00 53.52  ? 97  GLU E CG  1 
ATOM 6987 C CD  . GLU G 2 68  ? 40.125 -39.167  33.128 1.00 73.84  ? 97  GLU E CD  1 
ATOM 6988 O OE1 . GLU G 2 68  ? 40.079 -40.056  32.249 1.00 82.33  ? 97  GLU E OE1 1 
ATOM 6989 O OE2 . GLU G 2 68  ? 40.421 -39.410  34.319 1.00 62.80  ? 97  GLU E OE2 1 
ATOM 6990 N N   . GLU G 2 69  ? 37.730 -35.890  28.650 1.00 39.20  ? 98  GLU E N   1 
ATOM 6991 C CA  . GLU G 2 69  ? 37.886 -35.628  27.221 1.00 45.50  ? 98  GLU E CA  1 
ATOM 6992 C C   . GLU G 2 69  ? 38.429 -34.219  26.986 1.00 54.85  ? 98  GLU E C   1 
ATOM 6993 O O   . GLU G 2 69  ? 39.437 -34.038  26.291 1.00 55.74  ? 98  GLU E O   1 
ATOM 6994 C CB  . GLU G 2 69  ? 36.566 -35.860  26.474 1.00 48.82  ? 98  GLU E CB  1 
ATOM 6995 C CG  . GLU G 2 69  ? 35.349 -35.123  27.000 1.00 58.27  ? 98  GLU E CG  1 
ATOM 6996 C CD  . GLU G 2 69  ? 35.166 -33.764  26.335 1.00 63.88  ? 98  GLU E CD  1 
ATOM 6997 O OE1 . GLU G 2 69  ? 35.014 -33.733  25.096 1.00 66.20  ? 98  GLU E OE1 1 
ATOM 6998 O OE2 . GLU G 2 69  ? 35.220 -32.730  27.038 1.00 53.40  ? 98  GLU E OE2 1 
ATOM 6999 N N   . GLY G 2 70  ? 37.777 -33.208  27.562 1.00 55.05  ? 99  GLY E N   1 
ATOM 7000 C CA  . GLY G 2 70  ? 38.151 -31.824  27.343 1.00 54.53  ? 99  GLY E CA  1 
ATOM 7001 C C   . GLY G 2 70  ? 38.319 -31.001  28.604 1.00 48.66  ? 99  GLY E C   1 
ATOM 7002 O O   . GLY G 2 70  ? 37.952 -29.822  28.628 1.00 47.39  ? 99  GLY E O   1 
ATOM 7003 N N   . ASN G 2 71  ? 38.837 -31.619  29.665 1.00 50.39  ? 100 ASN E N   1 
ATOM 7004 C CA  . ASN G 2 71  ? 39.026 -30.955  30.958 1.00 53.64  ? 100 ASN E CA  1 
ATOM 7005 C C   . ASN G 2 71  ? 37.713 -30.397  31.516 1.00 46.71  ? 100 ASN E C   1 
ATOM 7006 O O   . ASN G 2 71  ? 37.629 -29.236  31.921 1.00 49.39  ? 100 ASN E O   1 
ATOM 7007 C CB  . ASN G 2 71  ? 40.094 -29.857  30.870 1.00 50.78  ? 100 ASN E CB  1 
ATOM 7008 C CG  . ASN G 2 71  ? 41.504 -30.415  30.718 1.00 59.70  ? 100 ASN E CG  1 
ATOM 7009 O OD1 . ASN G 2 71  ? 41.977 -30.644  29.604 1.00 65.28  ? 100 ASN E OD1 1 
ATOM 7010 N ND2 . ASN G 2 71  ? 42.181 -30.633  31.842 1.00 54.13  ? 100 ASN E ND2 1 
ATOM 7011 N N   . LEU G 2 72  ? 36.677 -31.241  31.538 1.00 42.22  ? 101 LEU E N   1 
ATOM 7012 C CA  . LEU G 2 72  ? 35.399 -30.830  32.118 1.00 37.58  ? 101 LEU E CA  1 
ATOM 7013 C C   . LEU G 2 72  ? 35.509 -30.555  33.610 1.00 37.98  ? 101 LEU E C   1 
ATOM 7014 O O   . LEU G 2 72  ? 34.751 -29.738  34.143 1.00 39.84  ? 101 LEU E O   1 
ATOM 7015 C CB  . LEU G 2 72  ? 34.333 -31.887  31.835 1.00 32.97  ? 101 LEU E CB  1 
ATOM 7016 C CG  . LEU G 2 72  ? 33.326 -31.551  30.744 1.00 30.21  ? 101 LEU E CG  1 
ATOM 7017 C CD1 . LEU G 2 72  ? 32.494 -30.361  31.149 1.00 30.72  ? 101 LEU E CD1 1 
ATOM 7018 C CD2 . LEU G 2 72  ? 34.149 -31.142  29.546 1.00 35.97  ? 101 LEU E CD2 1 
ATOM 7019 N N   . GLU G 2 73  ? 36.449 -31.200  34.298 1.00 36.63  ? 102 GLU E N   1 
ATOM 7020 C CA  . GLU G 2 73  ? 36.678 -30.845  35.693 1.00 38.42  ? 102 GLU E CA  1 
ATOM 7021 C C   . GLU G 2 73  ? 37.219 -29.425  35.804 1.00 45.07  ? 102 GLU E C   1 
ATOM 7022 O O   . GLU G 2 73  ? 36.808 -28.665  36.687 1.00 47.52  ? 102 GLU E O   1 
ATOM 7023 C CB  . GLU G 2 73  ? 37.637 -31.841  36.350 1.00 47.79  ? 102 GLU E CB  1 
ATOM 7024 C CG  . GLU G 2 73  ? 39.060 -31.861  35.779 1.00 54.08  ? 102 GLU E CG  1 
ATOM 7025 C CD  . GLU G 2 73  ? 39.180 -32.627  34.470 1.00 61.35  ? 102 GLU E CD  1 
ATOM 7026 O OE1 . GLU G 2 73  ? 40.157 -33.391  34.314 1.00 65.97  ? 102 GLU E OE1 1 
ATOM 7027 O OE2 . GLU G 2 73  ? 38.301 -32.468  33.598 1.00 53.99  ? 102 GLU E OE2 1 
ATOM 7028 N N   . ALA G 2 74  ? 38.124 -29.042  34.900 1.00 47.50  ? 103 ALA E N   1 
ATOM 7029 C CA  . ALA G 2 74  ? 38.704 -27.705  34.956 1.00 45.49  ? 103 ALA E CA  1 
ATOM 7030 C C   . ALA G 2 74  ? 37.675 -26.641  34.601 1.00 40.41  ? 103 ALA E C   1 
ATOM 7031 O O   . ALA G 2 74  ? 37.670 -25.555  35.190 1.00 42.98  ? 103 ALA E O   1 
ATOM 7032 C CB  . ALA G 2 74  ? 39.912 -27.614  34.026 1.00 48.15  ? 103 ALA E CB  1 
ATOM 7033 N N   . VAL G 2 75  ? 36.799 -26.928  33.640 1.00 36.97  ? 104 VAL E N   1 
ATOM 7034 C CA  . VAL G 2 75  ? 35.842 -25.910  33.230 1.00 39.44  ? 104 VAL E CA  1 
ATOM 7035 C C   . VAL G 2 75  ? 34.665 -25.832  34.198 1.00 41.21  ? 104 VAL E C   1 
ATOM 7036 O O   . VAL G 2 75  ? 34.097 -24.752  34.396 1.00 41.75  ? 104 VAL E O   1 
ATOM 7037 C CB  . VAL G 2 75  ? 35.375 -26.157  31.785 1.00 36.89  ? 104 VAL E CB  1 
ATOM 7038 C CG1 . VAL G 2 75  ? 36.577 -26.266  30.855 1.00 38.51  ? 104 VAL E CG1 1 
ATOM 7039 C CG2 . VAL G 2 75  ? 34.499 -27.394  31.697 1.00 33.68  ? 104 VAL E CG2 1 
ATOM 7040 N N   . LEU G 2 76  ? 34.274 -26.948  34.820 1.00 41.19  ? 105 LEU E N   1 
ATOM 7041 C CA  . LEU G 2 76  ? 33.232 -26.869  35.839 1.00 40.71  ? 105 LEU E CA  1 
ATOM 7042 C C   . LEU G 2 76  ? 33.753 -26.284  37.141 1.00 36.07  ? 105 LEU E C   1 
ATOM 7043 O O   . LEU G 2 76  ? 33.006 -25.600  37.847 1.00 37.87  ? 105 LEU E O   1 
ATOM 7044 C CB  . LEU G 2 76  ? 32.612 -28.244  36.089 1.00 44.32  ? 105 LEU E CB  1 
ATOM 7045 C CG  . LEU G 2 76  ? 31.814 -28.817  34.920 1.00 42.81  ? 105 LEU E CG  1 
ATOM 7046 C CD1 . LEU G 2 76  ? 31.373 -30.238  35.220 1.00 45.61  ? 105 LEU E CD1 1 
ATOM 7047 C CD2 . LEU G 2 76  ? 30.616 -27.929  34.627 1.00 36.91  ? 105 LEU E CD2 1 
ATOM 7048 N N   . ASN G 2 77  ? 35.021 -26.534  37.469 1.00 35.51  ? 106 ASN E N   1 
ATOM 7049 C CA  . ASN G 2 77  ? 35.625 -25.867  38.616 1.00 40.61  ? 106 ASN E CA  1 
ATOM 7050 C C   . ASN G 2 77  ? 35.778 -24.375  38.355 1.00 40.47  ? 106 ASN E C   1 
ATOM 7051 O O   . ASN G 2 77  ? 35.522 -23.551  39.243 1.00 40.99  ? 106 ASN E O   1 
ATOM 7052 C CB  . ASN G 2 77  ? 36.976 -26.505  38.943 1.00 45.11  ? 106 ASN E CB  1 
ATOM 7053 C CG  . ASN G 2 77  ? 36.839 -27.807  39.719 1.00 39.90  ? 106 ASN E CG  1 
ATOM 7054 O OD1 . ASN G 2 77  ? 35.731 -28.274  39.996 1.00 33.32  ? 106 ASN E OD1 1 
ATOM 7055 N ND2 . ASN G 2 77  ? 37.973 -28.403  40.068 1.00 34.80  ? 106 ASN E ND2 1 
ATOM 7056 N N   . ALA G 2 78  ? 36.189 -24.012  37.137 1.00 44.41  ? 107 ALA E N   1 
ATOM 7057 C CA  . ALA G 2 78  ? 36.261 -22.604  36.767 1.00 40.24  ? 107 ALA E CA  1 
ATOM 7058 C C   . ALA G 2 78  ? 34.887 -21.951  36.820 1.00 36.79  ? 107 ALA E C   1 
ATOM 7059 O O   . ALA G 2 78  ? 34.759 -20.796  37.239 1.00 39.87  ? 107 ALA E O   1 
ATOM 7060 C CB  . ALA G 2 78  ? 36.871 -22.458  35.374 1.00 36.19  ? 107 ALA E CB  1 
ATOM 7061 N N   . LEU G 2 79  ? 33.844 -22.680  36.416 1.00 37.35  ? 108 LEU E N   1 
ATOM 7062 C CA  . LEU G 2 79  ? 32.490 -22.148  36.524 1.00 34.62  ? 108 LEU E CA  1 
ATOM 7063 C C   . LEU G 2 79  ? 32.078 -21.986  37.980 1.00 35.75  ? 108 LEU E C   1 
ATOM 7064 O O   . LEU G 2 79  ? 31.373 -21.033  38.324 1.00 38.05  ? 108 LEU E O   1 
ATOM 7065 C CB  . LEU G 2 79  ? 31.502 -23.052  35.789 1.00 43.99  ? 108 LEU E CB  1 
ATOM 7066 C CG  . LEU G 2 79  ? 30.027 -22.653  35.896 1.00 43.54  ? 108 LEU E CG  1 
ATOM 7067 C CD1 . LEU G 2 79  ? 29.827 -21.219  35.433 1.00 35.03  ? 108 LEU E CD1 1 
ATOM 7068 C CD2 . LEU G 2 79  ? 29.138 -23.604  35.111 1.00 46.49  ? 108 LEU E CD2 1 
ATOM 7069 N N   . ASP G 2 80  ? 32.492 -22.913  38.846 1.00 37.66  ? 109 ASP E N   1 
ATOM 7070 C CA  . ASP G 2 80  ? 32.273 -22.732  40.277 1.00 39.57  ? 109 ASP E CA  1 
ATOM 7071 C C   . ASP G 2 80  ? 32.914 -21.440  40.760 1.00 34.89  ? 109 ASP E C   1 
ATOM 7072 O O   . ASP G 2 80  ? 32.298 -20.664  41.502 1.00 37.48  ? 109 ASP E O   1 
ATOM 7073 C CB  . ASP G 2 80  ? 32.826 -23.927  41.053 1.00 47.83  ? 109 ASP E CB  1 
ATOM 7074 C CG  . ASP G 2 80  ? 32.021 -25.187  40.837 1.00 44.85  ? 109 ASP E CG  1 
ATOM 7075 O OD1 . ASP G 2 80  ? 32.631 -26.221  40.502 1.00 44.87  ? 109 ASP E OD1 1 
ATOM 7076 O OD2 . ASP G 2 80  ? 30.785 -25.145  41.012 1.00 46.82  ? 109 ASP E OD2 1 
ATOM 7077 N N   . LYS G 2 81  ? 34.160 -21.197  40.349 1.00 33.87  ? 110 LYS E N   1 
ATOM 7078 C CA  . LYS G 2 81  ? 34.842 -19.960  40.714 1.00 39.20  ? 110 LYS E CA  1 
ATOM 7079 C C   . LYS G 2 81  ? 34.068 -18.739  40.226 1.00 42.62  ? 110 LYS E C   1 
ATOM 7080 O O   . LYS G 2 81  ? 33.786 -17.817  41.000 1.00 42.73  ? 110 LYS E O   1 
ATOM 7081 C CB  . LYS G 2 81  ? 36.263 -19.970  40.144 1.00 36.70  ? 110 LYS E CB  1 
ATOM 7082 C CG  . LYS G 2 81  ? 37.087 -18.744  40.483 1.00 50.13  ? 110 LYS E CG  1 
ATOM 7083 C CD  . LYS G 2 81  ? 38.390 -18.715  39.700 1.00 53.44  ? 110 LYS E CD  1 
ATOM 7084 C CE  . LYS G 2 81  ? 39.448 -19.579  40.370 1.00 48.27  ? 110 LYS E CE  1 
ATOM 7085 N NZ  . LYS G 2 81  ? 40.828 -19.164  39.995 1.00 51.64  ? 110 LYS E NZ  1 
ATOM 7086 N N   . ILE G 2 82  ? 33.689 -18.734  38.946 1.00 38.78  ? 111 ILE E N   1 
ATOM 7087 C CA  . ILE G 2 82  ? 32.955 -17.612  38.370 1.00 32.48  ? 111 ILE E CA  1 
ATOM 7088 C C   . ILE G 2 82  ? 31.627 -17.401  39.085 1.00 35.76  ? 111 ILE E C   1 
ATOM 7089 O O   . ILE G 2 82  ? 31.150 -16.266  39.204 1.00 42.05  ? 111 ILE E O   1 
ATOM 7090 C CB  . ILE G 2 82  ? 32.766 -17.851  36.858 1.00 29.88  ? 111 ILE E CB  1 
ATOM 7091 C CG1 . ILE G 2 82  ? 34.119 -17.793  36.150 1.00 30.02  ? 111 ILE E CG1 1 
ATOM 7092 C CG2 . ILE G 2 82  ? 31.809 -16.840  36.249 1.00 33.08  ? 111 ILE E CG2 1 
ATOM 7093 C CD1 . ILE G 2 82  ? 34.065 -18.230  34.711 1.00 35.16  ? 111 ILE E CD1 1 
ATOM 7094 N N   . VAL G 2 83  ? 31.015 -18.473  39.587 1.00 36.61  ? 112 VAL E N   1 
ATOM 7095 C CA  . VAL G 2 83  ? 29.756 -18.325  40.310 1.00 39.44  ? 112 VAL E CA  1 
ATOM 7096 C C   . VAL G 2 83  ? 29.998 -17.749  41.700 1.00 42.30  ? 112 VAL E C   1 
ATOM 7097 O O   . VAL G 2 83  ? 29.206 -16.938  42.192 1.00 45.00  ? 112 VAL E O   1 
ATOM 7098 C CB  . VAL G 2 83  ? 29.002 -19.667  40.364 1.00 38.06  ? 112 VAL E CB  1 
ATOM 7099 C CG1 . VAL G 2 83  ? 27.826 -19.581  41.324 1.00 39.51  ? 112 VAL E CG1 1 
ATOM 7100 C CG2 . VAL G 2 83  ? 28.507 -20.043  38.976 1.00 33.29  ? 112 VAL E CG2 1 
ATOM 7101 N N   . GLU G 2 84  ? 31.090 -18.150  42.356 1.00 39.84  ? 113 GLU E N   1 
ATOM 7102 C CA  . GLU G 2 84  ? 31.371 -17.623  43.690 1.00 43.48  ? 113 GLU E CA  1 
ATOM 7103 C C   . GLU G 2 84  ? 31.733 -16.144  43.639 1.00 52.45  ? 113 GLU E C   1 
ATOM 7104 O O   . GLU G 2 84  ? 31.192 -15.333  44.402 1.00 53.75  ? 113 GLU E O   1 
ATOM 7105 C CB  . GLU G 2 84  ? 32.490 -18.424  44.353 1.00 42.05  ? 113 GLU E CB  1 
ATOM 7106 C CG  . GLU G 2 84  ? 32.003 -19.669  45.069 1.00 68.29  ? 113 GLU E CG  1 
ATOM 7107 C CD  . GLU G 2 84  ? 30.943 -19.361  46.110 1.00 68.79  ? 113 GLU E CD  1 
ATOM 7108 O OE1 . GLU G 2 84  ? 29.740 -19.490  45.794 1.00 68.75  ? 113 GLU E OE1 1 
ATOM 7109 O OE2 . GLU G 2 84  ? 31.314 -18.977  47.239 1.00 74.11  ? 113 GLU E OE2 1 
ATOM 7110 N N   . GLU G 2 85  ? 32.644 -15.773  42.738 1.00 50.39  ? 114 GLU E N   1 
ATOM 7111 C CA  . GLU G 2 85  ? 33.064 -14.380  42.625 1.00 46.94  ? 114 GLU E CA  1 
ATOM 7112 C C   . GLU G 2 85  ? 31.923 -13.484  42.155 1.00 47.63  ? 114 GLU E C   1 
ATOM 7113 O O   . GLU G 2 85  ? 31.845 -12.319  42.557 1.00 58.25  ? 114 GLU E O   1 
ATOM 7114 C CB  . GLU G 2 85  ? 34.253 -14.288  41.672 1.00 45.51  ? 114 GLU E CB  1 
ATOM 7115 C CG  . GLU G 2 85  ? 35.354 -15.290  41.990 1.00 42.63  ? 114 GLU E CG  1 
ATOM 7116 C CD  . GLU G 2 85  ? 36.595 -15.095  41.146 1.00 55.66  ? 114 GLU E CD  1 
ATOM 7117 O OE1 . GLU G 2 85  ? 36.453 -14.717  39.965 1.00 66.91  ? 114 GLU E OE1 1 
ATOM 7118 O OE2 . GLU G 2 85  ? 37.709 -15.350  41.652 1.00 61.86  ? 114 GLU E OE2 1 
ATOM 7119 N N   . GLY G 2 86  ? 31.034 -14.009  41.310 1.00 46.14  ? 115 GLY E N   1 
ATOM 7120 C CA  . GLY G 2 86  ? 29.910 -13.247  40.792 1.00 44.42  ? 115 GLY E CA  1 
ATOM 7121 C C   . GLY G 2 86  ? 28.812 -12.985  41.803 1.00 49.65  ? 115 GLY E C   1 
ATOM 7122 O O   . GLY G 2 86  ? 28.014 -12.062  41.606 1.00 48.53  ? 115 GLY E O   1 
ATOM 7123 N N   . LYS G 2 87  ? 28.717 -13.806  42.849 1.00 56.21  ? 116 LYS E N   1 
ATOM 7124 C CA  . LYS G 2 87  ? 27.725 -13.574  43.890 1.00 57.36  ? 116 LYS E CA  1 
ATOM 7125 C C   . LYS G 2 87  ? 27.997 -12.256  44.600 1.00 66.13  ? 116 LYS E C   1 
ATOM 7126 O O   . LYS G 2 87  ? 29.154 -11.899  44.842 1.00 69.66  ? 116 LYS E O   1 
ATOM 7127 C CB  . LYS G 2 87  ? 27.725 -14.719  44.902 1.00 47.30  ? 116 LYS E CB  1 
ATOM 7128 C CG  . LYS G 2 87  ? 27.112 -15.997  44.381 1.00 57.62  ? 116 LYS E CG  1 
ATOM 7129 C CD  . LYS G 2 87  ? 25.708 -15.729  43.866 1.00 58.98  ? 116 LYS E CD  1 
ATOM 7130 C CE  . LYS G 2 87  ? 24.979 -17.011  43.497 1.00 55.41  ? 116 LYS E CE  1 
ATOM 7131 N NZ  . LYS G 2 87  ? 24.564 -17.783  44.703 1.00 49.07  ? 116 LYS E NZ  1 
ATOM 7132 N N   . VAL G 2 88  ? 26.900 -11.571  44.960 1.00 66.65  ? 117 VAL E N   1 
ATOM 7133 C CA  . VAL G 2 88  ? 26.783 -10.248  45.588 1.00 68.76  ? 117 VAL E CA  1 
ATOM 7134 C C   . VAL G 2 88  ? 26.025 -9.342   44.626 1.00 61.13  ? 117 VAL E C   1 
ATOM 7135 O O   . VAL G 2 88  ? 25.606 -8.238   44.993 1.00 67.73  ? 117 VAL E O   1 
ATOM 7136 C CB  . VAL G 2 88  ? 28.125 -9.601   45.984 1.00 71.33  ? 117 VAL E CB  1 
ATOM 7137 C CG1 . VAL G 2 88  ? 28.733 -8.876   44.793 1.00 57.75  ? 117 VAL E CG1 1 
ATOM 7138 C CG2 . VAL G 2 88  ? 27.932 -8.650   47.160 1.00 72.88  ? 117 VAL E CG2 1 
ATOM 7139 N N   . ARG G 2 89  ? 25.826 -9.811   43.394 1.00 55.60  ? 118 ARG E N   1 
ATOM 7140 C CA  . ARG G 2 89  ? 25.055 -9.042   42.425 1.00 54.88  ? 118 ARG E CA  1 
ATOM 7141 C C   . ARG G 2 89  ? 23.561 -9.302   42.592 1.00 55.55  ? 118 ARG E C   1 
ATOM 7142 O O   . ARG G 2 89  ? 22.772 -8.362   42.737 1.00 60.70  ? 118 ARG E O   1 
ATOM 7143 C CB  . ARG G 2 89  ? 25.517 -9.373   41.003 1.00 56.65  ? 118 ARG E CB  1 
ATOM 7144 C CG  . ARG G 2 89  ? 26.898 -8.825   40.661 1.00 58.17  ? 118 ARG E CG  1 
ATOM 7145 C CD  . ARG G 2 89  ? 26.892 -7.303   40.658 1.00 71.80  ? 118 ARG E CD  1 
ATOM 7146 N NE  . ARG G 2 89  ? 28.176 -6.727   41.054 1.00 77.30  ? 118 ARG E NE  1 
ATOM 7147 C CZ  . ARG G 2 89  ? 29.113 -6.326   40.200 1.00 76.19  ? 118 ARG E CZ  1 
ATOM 7148 N NH1 . ARG G 2 89  ? 30.251 -5.812   40.650 1.00 67.31  ? 118 ARG E NH1 1 
ATOM 7149 N NH2 . ARG G 2 89  ? 28.912 -6.437   38.894 1.00 75.31  ? 118 ARG E NH2 1 
ATOM 7150 N N   . LYS G 2 90  ? 23.156 -10.574  42.539 1.00 51.38  ? 119 LYS E N   1 
ATOM 7151 C CA  . LYS G 2 90  ? 21.793 -11.013  42.837 1.00 49.34  ? 119 LYS E CA  1 
ATOM 7152 C C   . LYS G 2 90  ? 20.756 -10.478  41.855 1.00 45.40  ? 119 LYS E C   1 
ATOM 7153 O O   . LYS G 2 90  ? 19.598 -10.906  41.875 1.00 39.98  ? 119 LYS E O   1 
ATOM 7154 C CB  . LYS G 2 90  ? 21.406 -10.627  44.269 1.00 52.37  ? 119 LYS E CB  1 
ATOM 7155 C CG  . LYS G 2 90  ? 22.088 -11.463  45.345 1.00 60.80  ? 119 LYS E CG  1 
ATOM 7156 C CD  . LYS G 2 90  ? 21.585 -12.904  45.319 1.00 65.93  ? 119 LYS E CD  1 
ATOM 7157 C CE  . LYS G 2 90  ? 22.536 -13.851  46.040 1.00 62.70  ? 119 LYS E CE  1 
ATOM 7158 N NZ  . LYS G 2 90  ? 23.966 -13.504  45.806 1.00 60.17  ? 119 LYS E NZ  1 
ATOM 7159 N N   . GLU G 2 91  ? 21.143 -9.562   41.015 1.00 51.68  ? 120 GLU E N   1 
ATOM 7160 C CA  . GLU G 2 91  ? 20.264 -9.072   39.973 1.00 46.65  ? 120 GLU E CA  1 
ATOM 7161 C C   . GLU G 2 91  ? 20.532 -9.808   38.669 1.00 43.54  ? 120 GLU E C   1 
ATOM 7162 O O   . GLU G 2 91  ? 21.651 -10.280  38.439 1.00 45.01  ? 120 GLU E O   1 
ATOM 7163 C CB  . GLU G 2 91  ? 20.475 -7.571   39.760 1.00 45.96  ? 120 GLU E CB  1 
ATOM 7164 C CG  . GLU G 2 91  ? 20.124 -6.728   40.968 1.00 48.61  ? 120 GLU E CG  1 
ATOM 7165 C CD  . GLU G 2 91  ? 20.616 -5.302   40.838 1.00 71.14  ? 120 GLU E CD  1 
ATOM 7166 O OE1 . GLU G 2 91  ? 21.735 -5.105   40.316 1.00 73.01  ? 120 GLU E OE1 1 
ATOM 7167 O OE2 . GLU G 2 91  ? 19.886 -4.378   41.257 1.00 76.76  ? 120 GLU E OE2 1 
ATOM 7168 N N   . PRO G 2 92  ? 19.526 -9.930   37.803 1.00 37.24  ? 121 PRO E N   1 
ATOM 7169 C CA  . PRO G 2 92  ? 19.752 -10.565  36.496 1.00 30.90  ? 121 PRO E CA  1 
ATOM 7170 C C   . PRO G 2 92  ? 20.881 -9.862   35.762 1.00 40.67  ? 121 PRO E C   1 
ATOM 7171 O O   . PRO G 2 92  ? 20.829 -8.655   35.514 1.00 55.52  ? 121 PRO E O   1 
ATOM 7172 C CB  . PRO G 2 92  ? 18.407 -10.392  35.783 1.00 22.42  ? 121 PRO E CB  1 
ATOM 7173 C CG  . PRO G 2 92  ? 17.414 -10.304  36.889 1.00 26.79  ? 121 PRO E CG  1 
ATOM 7174 C CD  . PRO G 2 92  ? 18.109 -9.582   38.010 1.00 34.64  ? 121 PRO E CD  1 
ATOM 7175 N N   . ALA G 2 93  ? 21.916 -10.625  35.429 1.00 41.31  ? 122 ALA E N   1 
ATOM 7176 C CA  . ALA G 2 93  ? 23.071 -10.034  34.776 1.00 42.34  ? 122 ALA E CA  1 
ATOM 7177 C C   . ALA G 2 93  ? 22.743 -9.677   33.331 1.00 38.57  ? 122 ALA E C   1 
ATOM 7178 O O   . ALA G 2 93  ? 21.742 -10.120  32.760 1.00 36.22  ? 122 ALA E O   1 
ATOM 7179 C CB  . ALA G 2 93  ? 24.264 -10.987  34.828 1.00 47.33  ? 122 ALA E CB  1 
ATOM 7180 N N   . TRP G 2 94  ? 23.595 -8.840   32.747 1.00 42.05  ? 123 TRP E N   1 
ATOM 7181 C CA  . TRP G 2 94  ? 23.436 -8.481   31.346 1.00 50.42  ? 123 TRP E CA  1 
ATOM 7182 C C   . TRP G 2 94  ? 23.560 -9.716   30.468 1.00 48.94  ? 123 TRP E C   1 
ATOM 7183 O O   . TRP G 2 94  ? 24.487 -10.516  30.627 1.00 53.42  ? 123 TRP E O   1 
ATOM 7184 C CB  . TRP G 2 94  ? 24.483 -7.442   30.947 1.00 58.44  ? 123 TRP E CB  1 
ATOM 7185 C CG  . TRP G 2 94  ? 24.622 -7.280   29.464 1.00 56.65  ? 123 TRP E CG  1 
ATOM 7186 C CD1 . TRP G 2 94  ? 23.935 -6.420   28.656 1.00 51.91  ? 123 TRP E CD1 1 
ATOM 7187 C CD2 . TRP G 2 94  ? 25.511 -8.009   28.613 1.00 53.77  ? 123 TRP E CD2 1 
ATOM 7188 N NE1 . TRP G 2 94  ? 24.345 -6.572   27.352 1.00 49.69  ? 123 TRP E NE1 1 
ATOM 7189 C CE2 . TRP G 2 94  ? 25.312 -7.542   27.302 1.00 51.39  ? 123 TRP E CE2 1 
ATOM 7190 C CE3 . TRP G 2 94  ? 26.458 -9.013   28.834 1.00 50.08  ? 123 TRP E CE3 1 
ATOM 7191 C CZ2 . TRP G 2 94  ? 26.027 -8.044   26.220 1.00 48.26  ? 123 TRP E CZ2 1 
ATOM 7192 C CZ3 . TRP G 2 94  ? 27.163 -9.510   27.756 1.00 52.58  ? 123 TRP E CZ3 1 
ATOM 7193 C CH2 . TRP G 2 94  ? 26.943 -9.026   26.466 1.00 51.07  ? 123 TRP E CH2 1 
ATOM 7194 N N   . ARG G 2 95  ? 22.616 -9.875   29.543 1.00 52.01  ? 124 ARG E N   1 
ATOM 7195 C CA  . ARG G 2 95  ? 22.700 -10.952  28.575 1.00 50.91  ? 124 ARG E CA  1 
ATOM 7196 C C   . ARG G 2 95  ? 22.650 -10.393  27.158 1.00 51.16  ? 124 ARG E C   1 
ATOM 7197 O O   . ARG G 2 95  ? 22.108 -9.304   26.937 1.00 56.15  ? 124 ARG E O   1 
ATOM 7198 C CB  . ARG G 2 95  ? 21.576 -11.975  28.773 1.00 49.61  ? 124 ARG E CB  1 
ATOM 7199 C CG  . ARG G 2 95  ? 22.045 -13.177  29.572 1.00 47.74  ? 124 ARG E CG  1 
ATOM 7200 C CD  . ARG G 2 95  ? 22.214 -12.765  31.024 1.00 49.42  ? 124 ARG E CD  1 
ATOM 7201 N NE  . ARG G 2 95  ? 23.247 -13.505  31.740 1.00 49.62  ? 124 ARG E NE  1 
ATOM 7202 C CZ  . ARG G 2 95  ? 23.135 -14.767  32.133 1.00 55.61  ? 124 ARG E CZ  1 
ATOM 7203 N NH1 . ARG G 2 95  ? 22.033 -15.457  31.869 1.00 61.27  ? 124 ARG E NH1 1 
ATOM 7204 N NH2 . ARG G 2 95  ? 24.132 -15.339  32.791 1.00 55.02  ? 124 ARG E NH2 1 
ATOM 7205 N N   . PRO G 2 96  ? 23.224 -11.106  26.181 1.00 46.55  ? 125 PRO E N   1 
ATOM 7206 C CA  . PRO G 2 96  ? 23.191 -10.626  24.793 1.00 44.08  ? 125 PRO E CA  1 
ATOM 7207 C C   . PRO G 2 96  ? 21.783 -10.354  24.295 1.00 51.56  ? 125 PRO E C   1 
ATOM 7208 O O   . PRO G 2 96  ? 20.980 -11.275  24.119 1.00 51.25  ? 125 PRO E O   1 
ATOM 7209 C CB  . PRO G 2 96  ? 23.847 -11.769  24.013 1.00 35.66  ? 125 PRO E CB  1 
ATOM 7210 C CG  . PRO G 2 96  ? 24.741 -12.423  25.001 1.00 42.79  ? 125 PRO E CG  1 
ATOM 7211 C CD  . PRO G 2 96  ? 24.032 -12.330  26.320 1.00 47.62  ? 125 PRO E CD  1 
ATOM 7212 N N   . SER G 2 97  ? 21.477 -9.072   24.086 1.00 57.46  ? 126 SER E N   1 
ATOM 7213 C CA  . SER G 2 97  ? 20.155 -8.648   23.648 1.00 58.58  ? 126 SER E CA  1 
ATOM 7214 C C   . SER G 2 97  ? 19.845 -9.053   22.213 1.00 60.84  ? 126 SER E C   1 
ATOM 7215 O O   . SER G 2 97  ? 18.712 -8.853   21.762 1.00 66.88  ? 126 SER E O   1 
ATOM 7216 C CB  . SER G 2 97  ? 20.041 -7.132   23.791 1.00 56.22  ? 126 SER E CB  1 
ATOM 7217 O OG  . SER G 2 97  ? 21.227 -6.511   23.325 1.00 51.71  ? 126 SER E OG  1 
ATOM 7218 N N   . GLY G 2 98  ? 20.811 -9.613   21.492 1.00 56.09  ? 127 GLY E N   1 
ATOM 7219 C CA  . GLY G 2 98  ? 20.612 -10.031  20.123 1.00 53.38  ? 127 GLY E CA  1 
ATOM 7220 C C   . GLY G 2 98  ? 20.895 -8.969   19.084 1.00 62.28  ? 127 GLY E C   1 
ATOM 7221 O O   . GLY G 2 98  ? 20.802 -9.261   17.885 1.00 58.90  ? 127 GLY E O   1 
ATOM 7222 N N   . ILE G 2 99  ? 21.242 -7.754   19.500 1.00 63.01  ? 128 ILE E N   1 
ATOM 7223 C CA  . ILE G 2 99  ? 21.619 -6.686   18.578 1.00 57.09  ? 128 ILE E CA  1 
ATOM 7224 C C   . ILE G 2 99  ? 23.110 -6.424   18.751 1.00 52.42  ? 128 ILE E C   1 
ATOM 7225 O O   . ILE G 2 99  ? 23.502 -5.723   19.693 1.00 52.53  ? 128 ILE E O   1 
ATOM 7226 C CB  . ILE G 2 99  ? 20.796 -5.411   18.824 1.00 55.39  ? 128 ILE E CB  1 
ATOM 7227 C CG1 . ILE G 2 99  ? 19.295 -5.708   18.749 1.00 51.08  ? 128 ILE E CG1 1 
ATOM 7228 C CG2 . ILE G 2 99  ? 21.190 -4.322   17.834 1.00 55.12  ? 128 ILE E CG2 1 
ATOM 7229 C CD1 . ILE G 2 99  ? 18.881 -6.506   17.529 1.00 55.82  ? 128 ILE E CD1 1 
ATOM 7230 N N   . PRO G 2 100 ? 23.964 -6.910   17.846 1.00 47.69  ? 129 PRO E N   1 
ATOM 7231 C CA  . PRO G 2 100 ? 25.416 -6.811   18.079 1.00 44.35  ? 129 PRO E CA  1 
ATOM 7232 C C   . PRO G 2 100 ? 25.928 -5.387   18.209 1.00 56.81  ? 129 PRO E C   1 
ATOM 7233 O O   . PRO G 2 100 ? 26.963 -5.174   18.855 1.00 58.81  ? 129 PRO E O   1 
ATOM 7234 C CB  . PRO G 2 100 ? 26.017 -7.522   16.857 1.00 38.21  ? 129 PRO E CB  1 
ATOM 7235 C CG  . PRO G 2 100 ? 24.949 -7.476   15.823 1.00 42.97  ? 129 PRO E CG  1 
ATOM 7236 C CD  . PRO G 2 100 ? 23.648 -7.548   16.558 1.00 45.03  ? 129 PRO E CD  1 
ATOM 7237 N N   . GLU G 2 101 ? 25.235 -4.404   17.628 1.00 61.09  ? 130 GLU E N   1 
ATOM 7238 C CA  . GLU G 2 101 ? 25.705 -3.024   17.717 1.00 57.64  ? 130 GLU E CA  1 
ATOM 7239 C C   . GLU G 2 101 ? 25.704 -2.519   19.154 1.00 53.99  ? 130 GLU E C   1 
ATOM 7240 O O   . GLU G 2 101 ? 26.657 -1.860   19.581 1.00 57.51  ? 130 GLU E O   1 
ATOM 7241 C CB  . GLU G 2 101 ? 24.858 -2.111   16.827 1.00 62.09  ? 130 GLU E CB  1 
ATOM 7242 C CG  . GLU G 2 101 ? 25.193 -2.162   15.338 1.00 64.57  ? 130 GLU E CG  1 
ATOM 7243 C CD  . GLU G 2 101 ? 26.409 -1.304   14.978 1.00 73.48  ? 130 GLU E CD  1 
ATOM 7244 O OE1 . GLU G 2 101 ? 27.393 -1.280   15.749 1.00 64.70  ? 130 GLU E OE1 1 
ATOM 7245 O OE2 . GLU G 2 101 ? 26.375 -0.641   13.917 1.00 71.36  ? 130 GLU E OE2 1 
ATOM 7246 N N   . LYS G 2 102 ? 24.659 -2.832   19.924 1.00 52.34  ? 131 LYS E N   1 
ATOM 7247 C CA  . LYS G 2 102 ? 24.590 -2.342   21.299 1.00 61.25  ? 131 LYS E CA  1 
ATOM 7248 C C   . LYS G 2 102 ? 25.723 -2.914   22.145 1.00 61.08  ? 131 LYS E C   1 
ATOM 7249 O O   . LYS G 2 102 ? 26.436 -2.176   22.841 1.00 67.63  ? 131 LYS E O   1 
ATOM 7250 C CB  . LYS G 2 102 ? 23.230 -2.684   21.912 1.00 58.72  ? 131 LYS E CB  1 
ATOM 7251 C CG  . LYS G 2 102 ? 23.069 -2.216   23.355 1.00 66.35  ? 131 LYS E CG  1 
ATOM 7252 C CD  . LYS G 2 102 ? 23.346 -3.343   24.345 1.00 67.87  ? 131 LYS E CD  1 
ATOM 7253 C CE  . LYS G 2 102 ? 23.593 -2.799   25.740 1.00 71.31  ? 131 LYS E CE  1 
ATOM 7254 N NZ  . LYS G 2 102 ? 22.469 -1.949   26.223 1.00 75.24  ? 131 LYS E NZ  1 
ATOM 7255 N N   . ASP G 2 103 ? 25.892 -4.236   22.109 1.00 54.41  ? 132 ASP E N   1 
ATOM 7256 C CA  . ASP G 2 103 ? 26.923 -4.876   22.916 1.00 57.10  ? 132 ASP E CA  1 
ATOM 7257 C C   . ASP G 2 103 ? 28.313 -4.426   22.477 1.00 50.23  ? 132 ASP E C   1 
ATOM 7258 O O   . ASP G 2 103 ? 29.199 -4.186   23.312 1.00 51.08  ? 132 ASP E O   1 
ATOM 7259 C CB  . ASP G 2 103 ? 26.779 -6.395   22.807 1.00 62.09  ? 132 ASP E CB  1 
ATOM 7260 C CG  . ASP G 2 103 ? 25.318 -6.844   22.791 1.00 60.00  ? 132 ASP E CG  1 
ATOM 7261 O OD1 . ASP G 2 103 ? 24.692 -6.764   21.720 1.00 56.60  ? 132 ASP E OD1 1 
ATOM 7262 O OD2 . ASP G 2 103 ? 24.774 -7.251   23.834 1.00 58.05  ? 132 ASP E OD2 1 
ATOM 7263 N N   . LEU G 2 104 ? 28.514 -4.285   21.162 1.00 47.34  ? 133 LEU E N   1 
ATOM 7264 C CA  . LEU G 2 104 ? 29.805 -3.835   20.654 1.00 49.08  ? 133 LEU E CA  1 
ATOM 7265 C C   . LEU G 2 104 ? 30.102 -2.404   21.087 1.00 50.89  ? 133 LEU E C   1 
ATOM 7266 O O   . LEU G 2 104 ? 31.258 -2.059   21.363 1.00 48.47  ? 133 LEU E O   1 
ATOM 7267 C CB  . LEU G 2 104 ? 29.839 -3.961   19.133 1.00 46.57  ? 133 LEU E CB  1 
ATOM 7268 C CG  . LEU G 2 104 ? 31.228 -4.163   18.529 1.00 42.48  ? 133 LEU E CG  1 
ATOM 7269 C CD1 . LEU G 2 104 ? 31.884 -5.394   19.133 1.00 41.00  ? 133 LEU E CD1 1 
ATOM 7270 C CD2 . LEU G 2 104 ? 31.145 -4.289   17.021 1.00 48.94  ? 133 LEU E CD2 1 
ATOM 7271 N N   . HIS G 2 105 ? 29.076 -1.552   21.144 1.00 57.66  ? 134 HIS E N   1 
ATOM 7272 C CA  . HIS G 2 105 ? 29.256 -0.223   21.718 1.00 51.37  ? 134 HIS E CA  1 
ATOM 7273 C C   . HIS G 2 105 ? 29.650 -0.317   23.183 1.00 44.26  ? 134 HIS E C   1 
ATOM 7274 O O   . HIS G 2 105 ? 30.529 0.419    23.647 1.00 50.15  ? 134 HIS E O   1 
ATOM 7275 C CB  . HIS G 2 105 ? 27.986 0.610    21.555 1.00 47.27  ? 134 HIS E CB  1 
ATOM 7276 C CG  . HIS G 2 105 ? 27.618 0.879    20.129 1.00 56.19  ? 134 HIS E CG  1 
ATOM 7277 N ND1 . HIS G 2 105 ? 26.351 1.266    19.747 1.00 56.53  ? 134 HIS E ND1 1 
ATOM 7278 C CD2 . HIS G 2 105 ? 28.351 0.816    18.991 1.00 63.21  ? 134 HIS E CD2 1 
ATOM 7279 C CE1 . HIS G 2 105 ? 26.320 1.428    18.436 1.00 64.83  ? 134 HIS E CE1 1 
ATOM 7280 N NE2 . HIS G 2 105 ? 27.521 1.163    17.953 1.00 69.70  ? 134 HIS E NE2 1 
ATOM 7281 N N   . SER G 2 106 ? 29.006 -1.216   23.931 1.00 41.88  ? 135 SER E N   1 
ATOM 7282 C CA  . SER G 2 106 ? 29.313 -1.332   25.352 1.00 41.84  ? 135 SER E CA  1 
ATOM 7283 C C   . SER G 2 106 ? 30.768 -1.732   25.573 1.00 43.42  ? 135 SER E C   1 
ATOM 7284 O O   . SER G 2 106 ? 31.404 -1.275   26.532 1.00 36.98  ? 135 SER E O   1 
ATOM 7285 C CB  . SER G 2 106 ? 28.370 -2.330   26.018 1.00 37.62  ? 135 SER E CB  1 
ATOM 7286 O OG  . SER G 2 106 ? 28.526 -2.287   27.423 1.00 32.22  ? 135 SER E OG  1 
ATOM 7287 N N   . VAL G 2 107 ? 31.315 -2.592   24.707 1.00 49.48  ? 136 VAL E N   1 
ATOM 7288 C CA  . VAL G 2 107 ? 32.713 -2.986   24.884 1.00 48.76  ? 136 VAL E CA  1 
ATOM 7289 C C   . VAL G 2 107 ? 33.663 -1.906   24.363 1.00 42.45  ? 136 VAL E C   1 
ATOM 7290 O O   . VAL G 2 107 ? 34.720 -1.658   24.956 1.00 34.10  ? 136 VAL E O   1 
ATOM 7291 C CB  . VAL G 2 107 ? 32.991 -4.357   24.230 1.00 43.82  ? 136 VAL E CB  1 
ATOM 7292 C CG1 . VAL G 2 107 ? 32.508 -4.394   22.808 1.00 38.33  ? 136 VAL E CG1 1 
ATOM 7293 C CG2 . VAL G 2 107 ? 34.481 -4.678   24.274 1.00 43.26  ? 136 VAL E CG2 1 
ATOM 7294 N N   . MET G 2 108 ? 33.313 -1.240   23.259 1.00 42.59  ? 137 MET E N   1 
ATOM 7295 C CA  . MET G 2 108 ? 34.200 -0.221   22.701 1.00 41.13  ? 137 MET E CA  1 
ATOM 7296 C C   . MET G 2 108 ? 34.139 1.112    23.437 1.00 39.52  ? 137 MET E C   1 
ATOM 7297 O O   . MET G 2 108 ? 34.960 1.989    23.149 1.00 36.55  ? 137 MET E O   1 
ATOM 7298 C CB  . MET G 2 108 ? 33.898 0.020    21.217 1.00 37.95  ? 137 MET E CB  1 
ATOM 7299 C CG  . MET G 2 108 ? 34.158 -1.170   20.306 1.00 43.01  ? 137 MET E CG  1 
ATOM 7300 S SD  . MET G 2 108 ? 33.723 -0.829   18.586 1.00 38.88  ? 137 MET E SD  1 
ATOM 7301 C CE  . MET G 2 108 ? 32.088 -0.119   18.780 1.00 40.23  ? 137 MET E CE  1 
ATOM 7302 N N   . ALA G 2 109 ? 33.201 1.286    24.369 1.00 41.44  ? 138 ALA E N   1 
ATOM 7303 C CA  . ALA G 2 109 ? 33.036 2.566    25.058 1.00 32.88  ? 138 ALA E CA  1 
ATOM 7304 C C   . ALA G 2 109 ? 34.310 3.091    25.716 1.00 31.56  ? 138 ALA E C   1 
ATOM 7305 O O   . ALA G 2 109 ? 34.682 4.243    25.440 1.00 37.77  ? 138 ALA E O   1 
ATOM 7306 C CB  . ALA G 2 109 ? 31.896 2.445    26.079 1.00 34.68  ? 138 ALA E CB  1 
ATOM 7307 N N   . PRO G 2 110 ? 35.022 2.335    26.564 1.00 27.75  ? 139 PRO E N   1 
ATOM 7308 C CA  . PRO G 2 110 ? 36.137 2.950    27.309 1.00 28.62  ? 139 PRO E CA  1 
ATOM 7309 C C   . PRO G 2 110 ? 37.226 3.525    26.422 1.00 30.07  ? 139 PRO E C   1 
ATOM 7310 O O   . PRO G 2 110 ? 37.782 4.588    26.732 1.00 31.92  ? 139 PRO E O   1 
ATOM 7311 C CB  . PRO G 2 110 ? 36.668 1.788    28.162 1.00 39.96  ? 139 PRO E CB  1 
ATOM 7312 C CG  . PRO G 2 110 ? 35.549 0.811    28.226 1.00 48.73  ? 139 PRO E CG  1 
ATOM 7313 C CD  . PRO G 2 110 ? 34.876 0.908    26.901 1.00 40.30  ? 139 PRO E CD  1 
ATOM 7314 N N   . TYR G 2 111 ? 37.545 2.850    25.319 1.00 32.14  ? 140 TYR E N   1 
ATOM 7315 C CA  . TYR G 2 111 ? 38.600 3.331    24.436 1.00 35.84  ? 140 TYR E CA  1 
ATOM 7316 C C   . TYR G 2 111 ? 38.182 4.601    23.705 1.00 36.10  ? 140 TYR E C   1 
ATOM 7317 O O   . TYR G 2 111 ? 39.016 5.481    23.449 1.00 32.82  ? 140 TYR E O   1 
ATOM 7318 C CB  . TYR G 2 111 ? 38.975 2.221    23.457 1.00 38.74  ? 140 TYR E CB  1 
ATOM 7319 C CG  . TYR G 2 111 ? 39.525 0.994    24.156 1.00 46.07  ? 140 TYR E CG  1 
ATOM 7320 C CD1 . TYR G 2 111 ? 40.482 1.113    25.158 1.00 49.66  ? 140 TYR E CD1 1 
ATOM 7321 C CD2 . TYR G 2 111 ? 39.061 -0.276   23.845 1.00 43.43  ? 140 TYR E CD2 1 
ATOM 7322 C CE1 . TYR G 2 111 ? 40.982 -0.001   25.809 1.00 50.81  ? 140 TYR E CE1 1 
ATOM 7323 C CE2 . TYR G 2 111 ? 39.554 -1.394   24.492 1.00 44.40  ? 140 TYR E CE2 1 
ATOM 7324 C CZ  . TYR G 2 111 ? 40.513 -1.254   25.472 1.00 54.22  ? 140 TYR E CZ  1 
ATOM 7325 O OH  . TYR G 2 111 ? 41.003 -2.370   26.115 1.00 59.19  ? 140 TYR E OH  1 
ATOM 7326 N N   . PHE G 2 112 ? 36.895 4.723    23.381 1.00 34.89  ? 141 PHE E N   1 
ATOM 7327 C CA  . PHE G 2 112 ? 36.398 5.957    22.789 1.00 28.57  ? 141 PHE E CA  1 
ATOM 7328 C C   . PHE G 2 112 ? 36.359 7.089    23.811 1.00 32.12  ? 141 PHE E C   1 
ATOM 7329 O O   . PHE G 2 112 ? 36.560 8.256    23.451 1.00 33.94  ? 141 PHE E O   1 
ATOM 7330 C CB  . PHE G 2 112 ? 35.016 5.712    22.189 1.00 23.56  ? 141 PHE E CB  1 
ATOM 7331 C CG  . PHE G 2 112 ? 35.043 4.986    20.875 1.00 22.90  ? 141 PHE E CG  1 
ATOM 7332 C CD1 . PHE G 2 112 ? 36.244 4.623    20.291 1.00 23.27  ? 141 PHE E CD1 1 
ATOM 7333 C CD2 . PHE G 2 112 ? 33.863 4.660    20.226 1.00 26.66  ? 141 PHE E CD2 1 
ATOM 7334 C CE1 . PHE G 2 112 ? 36.268 3.952    19.082 1.00 22.94  ? 141 PHE E CE1 1 
ATOM 7335 C CE2 . PHE G 2 112 ? 33.880 3.988    19.016 1.00 24.12  ? 141 PHE E CE2 1 
ATOM 7336 C CZ  . PHE G 2 112 ? 35.083 3.634    18.443 1.00 18.59  ? 141 PHE E CZ  1 
ATOM 7337 N N   . LEU G 2 113 ? 36.118 6.765    25.087 1.00 35.88  ? 142 LEU E N   1 
ATOM 7338 C CA  . LEU G 2 113 ? 36.192 7.778    26.138 1.00 31.54  ? 142 LEU E CA  1 
ATOM 7339 C C   . LEU G 2 113 ? 37.616 8.292    26.310 1.00 26.32  ? 142 LEU E C   1 
ATOM 7340 O O   . LEU G 2 113 ? 37.837 9.503    26.411 1.00 34.61  ? 142 LEU E O   1 
ATOM 7341 C CB  . LEU G 2 113 ? 35.665 7.219    27.463 1.00 38.74  ? 142 LEU E CB  1 
ATOM 7342 C CG  . LEU G 2 113 ? 34.161 6.988    27.651 1.00 41.23  ? 142 LEU E CG  1 
ATOM 7343 C CD1 . LEU G 2 113 ? 33.890 5.646    28.321 1.00 42.96  ? 142 LEU E CD1 1 
ATOM 7344 C CD2 . LEU G 2 113 ? 33.545 8.117    28.463 1.00 42.20  ? 142 LEU E CD2 1 
ATOM 7345 N N   . GLN G 2 114 ? 38.598 7.386    26.369 1.00 31.86  ? 143 GLN E N   1 
ATOM 7346 C CA  . GLN G 2 114 ? 39.985 7.830    26.493 1.00 33.16  ? 143 GLN E CA  1 
ATOM 7347 C C   . GLN G 2 114 ? 40.435 8.593    25.252 1.00 30.96  ? 143 GLN E C   1 
ATOM 7348 O O   . GLN G 2 114 ? 41.259 9.510    25.356 1.00 32.35  ? 143 GLN E O   1 
ATOM 7349 C CB  . GLN G 2 114 ? 40.913 6.640    26.784 1.00 45.05  ? 143 GLN E CB  1 
ATOM 7350 C CG  . GLN G 2 114 ? 41.119 5.652    25.636 1.00 46.98  ? 143 GLN E CG  1 
ATOM 7351 C CD  . GLN G 2 114 ? 42.113 4.544    25.966 1.00 48.27  ? 143 GLN E CD  1 
ATOM 7352 O OE1 . GLN G 2 114 ? 42.170 4.059    27.097 1.00 51.41  ? 143 GLN E OE1 1 
ATOM 7353 N NE2 . GLN G 2 114 ? 42.894 4.133    24.970 1.00 47.57  ? 143 GLN E NE2 1 
ATOM 7354 N N   . GLN G 2 115 ? 39.905 8.239    24.077 1.00 35.54  ? 144 GLN E N   1 
ATOM 7355 C CA  . GLN G 2 115 ? 40.159 9.045    22.886 1.00 34.92  ? 144 GLN E CA  1 
ATOM 7356 C C   . GLN G 2 115 ? 39.613 10.457   23.069 1.00 33.91  ? 144 GLN E C   1 
ATOM 7357 O O   . GLN G 2 115 ? 40.306 11.448   22.797 1.00 34.08  ? 144 GLN E O   1 
ATOM 7358 C CB  . GLN G 2 115 ? 39.539 8.379    21.655 1.00 36.67  ? 144 GLN E CB  1 
ATOM 7359 C CG  . GLN G 2 115 ? 39.981 8.980    20.330 1.00 29.70  ? 144 GLN E CG  1 
ATOM 7360 C CD  . GLN G 2 115 ? 39.152 8.487    19.159 1.00 31.41  ? 144 GLN E CD  1 
ATOM 7361 O OE1 . GLN G 2 115 ? 38.140 7.809    19.338 1.00 31.63  ? 144 GLN E OE1 1 
ATOM 7362 N NE2 . GLN G 2 115 ? 39.585 8.819    17.948 1.00 31.25  ? 144 GLN E NE2 1 
ATOM 7363 N N   . ARG G 2 116 ? 38.362 10.563   23.535 1.00 36.00  ? 145 ARG E N   1 
ATOM 7364 C CA  . ARG G 2 116 ? 37.769 11.869   23.811 1.00 28.11  ? 145 ARG E CA  1 
ATOM 7365 C C   . ARG G 2 116 ? 38.622 12.681   24.774 1.00 29.53  ? 145 ARG E C   1 
ATOM 7366 O O   . ARG G 2 116 ? 38.861 13.869   24.550 1.00 45.92  ? 145 ARG E O   1 
ATOM 7367 C CB  . ARG G 2 116 ? 36.363 11.718   24.387 1.00 27.35  ? 145 ARG E CB  1 
ATOM 7368 C CG  . ARG G 2 116 ? 35.893 13.013   25.034 1.00 25.55  ? 145 ARG E CG  1 
ATOM 7369 C CD  . ARG G 2 116 ? 34.466 12.983   25.527 1.00 29.95  ? 145 ARG E CD  1 
ATOM 7370 N NE  . ARG G 2 116 ? 34.312 12.144   26.710 1.00 35.97  ? 145 ARG E NE  1 
ATOM 7371 C CZ  . ARG G 2 116 ? 34.546 12.555   27.951 1.00 37.05  ? 145 ARG E CZ  1 
ATOM 7372 N NH1 . ARG G 2 116 ? 34.974 13.790   28.170 1.00 40.64  ? 145 ARG E NH1 1 
ATOM 7373 N NH2 . ARG G 2 116 ? 34.372 11.727   28.972 1.00 37.34  ? 145 ARG E NH2 1 
ATOM 7374 N N   . ASP G 2 117 ? 39.067 12.066   25.868 1.00 23.00  ? 146 ASP E N   1 
ATOM 7375 C CA  . ASP G 2 117 ? 39.779 12.828   26.887 1.00 27.53  ? 146 ASP E CA  1 
ATOM 7376 C C   . ASP G 2 117 ? 41.170 13.234   26.410 1.00 33.99  ? 146 ASP E C   1 
ATOM 7377 O O   . ASP G 2 117 ? 41.643 14.331   26.731 1.00 42.11  ? 146 ASP E O   1 
ATOM 7378 C CB  . ASP G 2 117 ? 39.859 12.026   28.185 1.00 34.88  ? 146 ASP E CB  1 
ATOM 7379 C CG  . ASP G 2 117 ? 38.530 11.975   28.923 1.00 41.36  ? 146 ASP E CG  1 
ATOM 7380 O OD1 . ASP G 2 117 ? 38.130 13.004   29.511 1.00 49.94  ? 146 ASP E OD1 1 
ATOM 7381 O OD2 . ASP G 2 117 ? 37.896 10.897   28.935 1.00 32.20  ? 146 ASP E OD2 1 
ATOM 7382 N N   . THR G 2 118 ? 41.838 12.373   25.636 1.00 32.91  ? 147 THR E N   1 
ATOM 7383 C CA  . THR G 2 118 ? 43.129 12.750   25.062 1.00 41.38  ? 147 THR E CA  1 
ATOM 7384 C C   . THR G 2 118 ? 42.977 13.923   24.097 1.00 45.64  ? 147 THR E C   1 
ATOM 7385 O O   . THR G 2 118 ? 43.676 14.943   24.216 1.00 45.87  ? 147 THR E O   1 
ATOM 7386 C CB  . THR G 2 118 ? 43.763 11.550   24.356 1.00 37.48  ? 147 THR E CB  1 
ATOM 7387 O OG1 . THR G 2 118 ? 43.994 10.504   25.307 1.00 49.24  ? 147 THR E OG1 1 
ATOM 7388 C CG2 . THR G 2 118 ? 45.086 11.941   23.715 1.00 43.08  ? 147 THR E CG2 1 
ATOM 7389 N N   . LEU G 2 119 ? 42.052 13.798   23.138 1.00 40.33  ? 148 LEU E N   1 
ATOM 7390 C CA  . LEU G 2 119 ? 41.790 14.902   22.221 1.00 39.97  ? 148 LEU E CA  1 
ATOM 7391 C C   . LEU G 2 119 ? 41.385 16.159   22.976 1.00 45.75  ? 148 LEU E C   1 
ATOM 7392 O O   . LEU G 2 119 ? 41.730 17.271   22.565 1.00 51.69  ? 148 LEU E O   1 
ATOM 7393 C CB  . LEU G 2 119 ? 40.704 14.516   21.221 1.00 36.01  ? 148 LEU E CB  1 
ATOM 7394 C CG  . LEU G 2 119 ? 41.112 13.486   20.170 1.00 41.38  ? 148 LEU E CG  1 
ATOM 7395 C CD1 . LEU G 2 119 ? 39.912 13.080   19.329 1.00 41.69  ? 148 LEU E CD1 1 
ATOM 7396 C CD2 . LEU G 2 119 ? 42.235 14.025   19.304 1.00 45.25  ? 148 LEU E CD2 1 
ATOM 7397 N N   . ARG G 2 120 ? 40.666 15.996   24.084 1.00 36.03  ? 149 ARG E N   1 
ATOM 7398 C CA  . ARG G 2 120 ? 40.202 17.134   24.865 1.00 38.50  ? 149 ARG E CA  1 
ATOM 7399 C C   . ARG G 2 120 ? 41.370 17.866   25.516 1.00 43.12  ? 149 ARG E C   1 
ATOM 7400 O O   . ARG G 2 120 ? 41.433 19.102   25.483 1.00 46.67  ? 149 ARG E O   1 
ATOM 7401 C CB  . ARG G 2 120 ? 39.202 16.643   25.911 1.00 31.23  ? 149 ARG E CB  1 
ATOM 7402 C CG  . ARG G 2 120 ? 38.742 17.672   26.913 1.00 37.11  ? 149 ARG E CG  1 
ATOM 7403 C CD  . ARG G 2 120 ? 37.374 17.294   27.445 1.00 32.83  ? 149 ARG E CD  1 
ATOM 7404 N NE  . ARG G 2 120 ? 36.394 17.258   26.364 1.00 33.09  ? 149 ARG E NE  1 
ATOM 7405 C CZ  . ARG G 2 120 ? 35.094 17.025   26.525 1.00 41.09  ? 149 ARG E CZ  1 
ATOM 7406 N NH1 . ARG G 2 120 ? 34.592 16.807   27.734 1.00 36.91  ? 149 ARG E NH1 1 
ATOM 7407 N NH2 . ARG G 2 120 ? 34.293 17.017   25.468 1.00 40.96  ? 149 ARG E NH2 1 
ATOM 7408 N N   . ARG G 2 121 ? 42.313 17.121   26.098 1.00 41.04  ? 150 ARG E N   1 
ATOM 7409 C CA  . ARG G 2 121 ? 43.494 17.760   26.672 1.00 42.50  ? 150 ARG E CA  1 
ATOM 7410 C C   . ARG G 2 121 ? 44.331 18.439   25.597 1.00 43.59  ? 150 ARG E C   1 
ATOM 7411 O O   . ARG G 2 121 ? 44.923 19.498   25.842 1.00 50.76  ? 150 ARG E O   1 
ATOM 7412 C CB  . ARG G 2 121 ? 44.333 16.739   27.439 1.00 52.19  ? 150 ARG E CB  1 
ATOM 7413 C CG  . ARG G 2 121 ? 43.600 16.056   28.586 1.00 59.87  ? 150 ARG E CG  1 
ATOM 7414 C CD  . ARG G 2 121 ? 44.544 15.175   29.394 1.00 67.52  ? 150 ARG E CD  1 
ATOM 7415 N NE  . ARG G 2 121 ? 45.421 14.381   28.535 1.00 66.31  ? 150 ARG E NE  1 
ATOM 7416 C CZ  . ARG G 2 121 ? 45.156 13.140   28.138 1.00 60.73  ? 150 ARG E CZ  1 
ATOM 7417 N NH1 . ARG G 2 121 ? 46.011 12.495   27.353 1.00 59.43  ? 150 ARG E NH1 1 
ATOM 7418 N NH2 . ARG G 2 121 ? 44.037 12.540   28.525 1.00 54.38  ? 150 ARG E NH2 1 
ATOM 7419 N N   . HIS G 2 122 ? 44.389 17.854   24.396 1.00 43.74  ? 151 HIS E N   1 
ATOM 7420 C CA  . HIS G 2 122 ? 45.105 18.510   23.303 1.00 47.17  ? 151 HIS E CA  1 
ATOM 7421 C C   . HIS G 2 122 ? 44.439 19.829   22.918 1.00 53.71  ? 151 HIS E C   1 
ATOM 7422 O O   . HIS G 2 122 ? 45.094 20.883   22.851 1.00 53.20  ? 151 HIS E O   1 
ATOM 7423 C CB  . HIS G 2 122 ? 45.181 17.579   22.093 1.00 48.59  ? 151 HIS E CB  1 
ATOM 7424 C CG  . HIS G 2 122 ? 46.157 16.454   22.249 1.00 53.59  ? 151 HIS E CG  1 
ATOM 7425 N ND1 . HIS G 2 122 ? 47.041 16.375   23.304 1.00 58.91  ? 151 HIS E ND1 1 
ATOM 7426 C CD2 . HIS G 2 122 ? 46.398 15.369   21.474 1.00 55.78  ? 151 HIS E CD2 1 
ATOM 7427 C CE1 . HIS G 2 122 ? 47.778 15.286   23.177 1.00 68.19  ? 151 HIS E CE1 1 
ATOM 7428 N NE2 . HIS G 2 122 ? 47.409 14.659   22.074 1.00 64.70  ? 151 HIS E NE2 1 
ATOM 7429 N N   . VAL G 2 123 ? 43.126 19.787   22.673 1.00 50.74  ? 152 VAL E N   1 
ATOM 7430 C CA  . VAL G 2 123 ? 42.388 20.982   22.274 1.00 47.56  ? 152 VAL E CA  1 
ATOM 7431 C C   . VAL G 2 123 ? 42.541 22.083   23.312 1.00 44.60  ? 152 VAL E C   1 
ATOM 7432 O O   . VAL G 2 123 ? 42.780 23.243   22.969 1.00 52.50  ? 152 VAL E O   1 
ATOM 7433 C CB  . VAL G 2 123 ? 40.905 20.650   22.030 1.00 49.47  ? 152 VAL E CB  1 
ATOM 7434 C CG1 . VAL G 2 123 ? 40.124 21.922   21.740 1.00 48.91  ? 152 VAL E CG1 1 
ATOM 7435 C CG2 . VAL G 2 123 ? 40.763 19.678   20.883 1.00 49.63  ? 152 VAL E CG2 1 
ATOM 7436 N N   . GLN G 2 124 ? 42.397 21.745   24.595 1.00 46.17  ? 153 GLN E N   1 
ATOM 7437 C CA  . GLN G 2 124 ? 42.455 22.800   25.603 1.00 47.22  ? 153 GLN E CA  1 
ATOM 7438 C C   . GLN G 2 124 ? 43.878 23.294   25.829 1.00 45.34  ? 153 GLN E C   1 
ATOM 7439 O O   . GLN G 2 124 ? 44.075 24.471   26.153 1.00 56.78  ? 153 GLN E O   1 
ATOM 7440 C CB  . GLN G 2 124 ? 41.824 22.327   26.912 1.00 50.25  ? 153 GLN E CB  1 
ATOM 7441 C CG  . GLN G 2 124 ? 40.310 22.534   26.939 1.00 58.94  ? 153 GLN E CG  1 
ATOM 7442 C CD  . GLN G 2 124 ? 39.633 21.865   28.120 1.00 69.78  ? 153 GLN E CD  1 
ATOM 7443 O OE1 . GLN G 2 124 ? 40.272 21.165   28.902 1.00 72.78  ? 153 GLN E OE1 1 
ATOM 7444 N NE2 . GLN G 2 124 ? 38.327 22.076   28.250 1.00 69.71  ? 153 GLN E NE2 1 
ATOM 7445 N N   . LYS G 2 125 ? 44.876 22.427   25.655 1.00 40.04  ? 154 LYS E N   1 
ATOM 7446 C CA  . LYS G 2 125 ? 46.261 22.888   25.665 1.00 46.76  ? 154 LYS E CA  1 
ATOM 7447 C C   . LYS G 2 125 ? 46.476 23.966   24.606 1.00 53.06  ? 154 LYS E C   1 
ATOM 7448 O O   . LYS G 2 125 ? 46.860 25.108   24.913 1.00 48.38  ? 154 LYS E O   1 
ATOM 7449 C CB  . LYS G 2 125 ? 47.196 21.698   25.431 1.00 50.54  ? 154 LYS E CB  1 
ATOM 7450 C CG  . LYS G 2 125 ? 48.677 22.013   25.539 1.00 48.13  ? 154 LYS E CG  1 
ATOM 7451 C CD  . LYS G 2 125 ? 49.520 20.889   24.951 1.00 35.90  ? 154 LYS E CD  1 
ATOM 7452 C CE  . LYS G 2 125 ? 51.004 21.140   25.173 1.00 41.28  ? 154 LYS E CE  1 
ATOM 7453 N NZ  . LYS G 2 125 ? 51.860 20.144   24.469 1.00 44.19  ? 154 LYS E NZ  1 
ATOM 7454 N N   . GLN G 2 126 ? 46.187 23.626   23.344 1.00 54.78  ? 155 GLN E N   1 
ATOM 7455 C CA  . GLN G 2 126 ? 46.350 24.598   22.268 1.00 52.73  ? 155 GLN E CA  1 
ATOM 7456 C C   . GLN G 2 126 ? 45.448 25.808   22.460 1.00 52.32  ? 155 GLN E C   1 
ATOM 7457 O O   . GLN G 2 126 ? 45.779 26.907   22.003 1.00 61.12  ? 155 GLN E O   1 
ATOM 7458 C CB  . GLN G 2 126 ? 46.078 23.941   20.917 1.00 51.96  ? 155 GLN E CB  1 
ATOM 7459 C CG  . GLN G 2 126 ? 47.338 23.504   20.199 1.00 67.80  ? 155 GLN E CG  1 
ATOM 7460 C CD  . GLN G 2 126 ? 48.205 24.682   19.794 1.00 58.70  ? 155 GLN E CD  1 
ATOM 7461 O OE1 . GLN G 2 126 ? 47.696 25.725   19.381 1.00 47.06  ? 155 GLN E OE1 1 
ATOM 7462 N NE2 . GLN G 2 126 ? 49.519 24.524   19.914 1.00 63.63  ? 155 GLN E NE2 1 
ATOM 7463 N N   . GLU G 2 127 ? 44.314 25.628   23.135 1.00 48.44  ? 156 GLU E N   1 
ATOM 7464 C CA  . GLU G 2 127 ? 43.385 26.729   23.359 1.00 46.21  ? 156 GLU E CA  1 
ATOM 7465 C C   . GLU G 2 127 ? 43.969 27.744   24.332 1.00 48.35  ? 156 GLU E C   1 
ATOM 7466 O O   . GLU G 2 127 ? 43.898 28.957   24.097 1.00 52.81  ? 156 GLU E O   1 
ATOM 7467 C CB  . GLU G 2 127 ? 42.052 26.184   23.869 1.00 47.11  ? 156 GLU E CB  1 
ATOM 7468 C CG  . GLU G 2 127 ? 40.843 26.970   23.404 1.00 50.45  ? 156 GLU E CG  1 
ATOM 7469 C CD  . GLU G 2 127 ? 39.568 26.147   23.412 1.00 61.62  ? 156 GLU E CD  1 
ATOM 7470 O OE1 . GLU G 2 127 ? 39.598 25.004   23.918 1.00 71.53  ? 156 GLU E OE1 1 
ATOM 7471 O OE2 . GLU G 2 127 ? 38.534 26.644   22.913 1.00 56.87  ? 156 GLU E OE2 1 
ATOM 7472 N N   . ALA G 2 128 ? 44.540 27.267   25.440 1.00 42.70  ? 157 ALA E N   1 
ATOM 7473 C CA  . ALA G 2 128 ? 45.199 28.172   26.376 1.00 46.14  ? 157 ALA E CA  1 
ATOM 7474 C C   . ALA G 2 128 ? 46.368 28.884   25.707 1.00 46.48  ? 157 ALA E C   1 
ATOM 7475 O O   . ALA G 2 128 ? 46.528 30.109   25.835 1.00 49.60  ? 157 ALA E O   1 
ATOM 7476 C CB  . ALA G 2 128 ? 45.666 27.402   27.611 1.00 53.03  ? 157 ALA E CB  1 
ATOM 7477 N N   . GLU G 2 129 ? 47.193 28.130   24.969 1.00 47.80  ? 158 GLU E N   1 
ATOM 7478 C CA  . GLU G 2 129 ? 48.312 28.759   24.270 1.00 47.87  ? 158 GLU E CA  1 
ATOM 7479 C C   . GLU G 2 129 ? 47.826 29.818   23.284 1.00 43.77  ? 158 GLU E C   1 
ATOM 7480 O O   . GLU G 2 129 ? 48.479 30.854   23.101 1.00 39.11  ? 158 GLU E O   1 
ATOM 7481 C CB  . GLU G 2 129 ? 49.147 27.703   23.546 1.00 52.53  ? 158 GLU E CB  1 
ATOM 7482 C CG  . GLU G 2 129 ? 50.382 28.266   22.853 1.00 55.79  ? 158 GLU E CG  1 
ATOM 7483 C CD  . GLU G 2 129 ? 50.822 27.437   21.660 1.00 57.24  ? 158 GLU E CD  1 
ATOM 7484 O OE1 . GLU G 2 129 ? 52.044 27.228   21.496 1.00 58.26  ? 158 GLU E OE1 1 
ATOM 7485 O OE2 . GLU G 2 129 ? 49.947 26.990   20.890 1.00 56.64  ? 158 GLU E OE2 1 
ATOM 7486 N N   . ASN G 2 130 ? 46.675 29.583   22.648 1.00 41.71  ? 159 ASN E N   1 
ATOM 7487 C CA  . ASN G 2 130 ? 46.136 30.571   21.720 1.00 40.13  ? 159 ASN E CA  1 
ATOM 7488 C C   . ASN G 2 130 ? 45.592 31.794   22.438 1.00 43.68  ? 159 ASN E C   1 
ATOM 7489 O O   . ASN G 2 130 ? 45.703 32.913   21.925 1.00 45.34  ? 159 ASN E O   1 
ATOM 7490 C CB  . ASN G 2 130 ? 45.046 29.956   20.849 1.00 33.09  ? 159 ASN E CB  1 
ATOM 7491 C CG  . ASN G 2 130 ? 45.608 29.070   19.784 1.00 36.73  ? 159 ASN E CG  1 
ATOM 7492 O OD1 . ASN G 2 130 ? 46.748 28.625   19.882 1.00 42.13  ? 159 ASN E OD1 1 
ATOM 7493 N ND2 . ASN G 2 130 ? 44.832 28.839   18.734 1.00 42.32  ? 159 ASN E ND2 1 
ATOM 7494 N N   . GLN G 2 131 ? 44.979 31.613   23.606 1.00 41.06  ? 160 GLN E N   1 
ATOM 7495 C CA  . GLN G 2 131 ? 44.493 32.783   24.326 1.00 43.45  ? 160 GLN E CA  1 
ATOM 7496 C C   . GLN G 2 131 ? 45.656 33.668   24.760 1.00 42.29  ? 160 GLN E C   1 
ATOM 7497 O O   . GLN G 2 131 ? 45.599 34.897   24.610 1.00 45.45  ? 160 GLN E O   1 
ATOM 7498 C CB  . GLN G 2 131 ? 43.639 32.362   25.519 1.00 42.35  ? 160 GLN E CB  1 
ATOM 7499 C CG  . GLN G 2 131 ? 42.927 33.522   26.196 1.00 38.07  ? 160 GLN E CG  1 
ATOM 7500 C CD  . GLN G 2 131 ? 43.583 33.939   27.489 1.00 51.11  ? 160 GLN E CD  1 
ATOM 7501 O OE1 . GLN G 2 131 ? 44.728 33.577   27.764 1.00 50.86  ? 160 GLN E OE1 1 
ATOM 7502 N NE2 . GLN G 2 131 ? 42.859 34.701   28.299 1.00 64.49  ? 160 GLN E NE2 1 
ATOM 7503 N N   . GLN G 2 132 ? 46.732 33.064   25.279 1.00 40.82  ? 161 GLN E N   1 
ATOM 7504 C CA  . GLN G 2 132 ? 47.908 33.861   25.626 1.00 43.00  ? 161 GLN E CA  1 
ATOM 7505 C C   . GLN G 2 132 ? 48.519 34.518   24.392 1.00 43.02  ? 161 GLN E C   1 
ATOM 7506 O O   . GLN G 2 132 ? 48.889 35.702   24.421 1.00 44.35  ? 161 GLN E O   1 
ATOM 7507 C CB  . GLN G 2 132 ? 48.942 32.999   26.346 1.00 45.71  ? 161 GLN E CB  1 
ATOM 7508 C CG  . GLN G 2 132 ? 48.982 33.258   27.836 1.00 56.51  ? 161 GLN E CG  1 
ATOM 7509 C CD  . GLN G 2 132 ? 49.675 34.567   28.165 1.00 74.62  ? 161 GLN E CD  1 
ATOM 7510 O OE1 . GLN G 2 132 ? 50.856 34.750   27.869 1.00 82.04  ? 161 GLN E OE1 1 
ATOM 7511 N NE2 . GLN G 2 132 ? 48.935 35.494   28.766 1.00 73.50  ? 161 GLN E NE2 1 
ATOM 7512 N N   . LEU G 2 133 ? 48.641 33.760   23.301 1.00 41.04  ? 162 LEU E N   1 
ATOM 7513 C CA  . LEU G 2 133 ? 49.234 34.298   22.082 1.00 42.81  ? 162 LEU E CA  1 
ATOM 7514 C C   . LEU G 2 133 ? 48.438 35.500   21.585 1.00 38.25  ? 162 LEU E C   1 
ATOM 7515 O O   . LEU G 2 133 ? 49.011 36.526   21.189 1.00 36.82  ? 162 LEU E O   1 
ATOM 7516 C CB  . LEU G 2 133 ? 49.291 33.194   21.024 1.00 48.16  ? 162 LEU E CB  1 
ATOM 7517 C CG  . LEU G 2 133 ? 50.477 33.117   20.065 1.00 48.63  ? 162 LEU E CG  1 
ATOM 7518 C CD1 . LEU G 2 133 ? 51.744 32.792   20.839 1.00 43.38  ? 162 LEU E CD1 1 
ATOM 7519 C CD2 . LEU G 2 133 ? 50.222 32.066   18.999 1.00 44.42  ? 162 LEU E CD2 1 
ATOM 7520 N N   . ALA G 2 134 ? 47.109 35.395   21.624 1.00 39.65  ? 163 ALA E N   1 
ATOM 7521 C CA  . ALA G 2 134 ? 46.253 36.510   21.238 1.00 39.56  ? 163 ALA E CA  1 
ATOM 7522 C C   . ALA G 2 134 ? 46.435 37.693   22.177 1.00 38.87  ? 163 ALA E C   1 
ATOM 7523 O O   . ALA G 2 134 ? 46.388 38.847   21.741 1.00 41.52  ? 163 ALA E O   1 
ATOM 7524 C CB  . ALA G 2 134 ? 44.791 36.066   21.216 1.00 39.26  ? 163 ALA E CB  1 
ATOM 7525 N N   . ASP G 2 135 ? 46.605 37.432   23.477 1.00 35.80  ? 164 ASP E N   1 
ATOM 7526 C CA  . ASP G 2 135 ? 46.923 38.518   24.400 1.00 33.03  ? 164 ASP E CA  1 
ATOM 7527 C C   . ASP G 2 135 ? 48.170 39.269   23.952 1.00 37.93  ? 164 ASP E C   1 
ATOM 7528 O O   . ASP G 2 135 ? 48.192 40.510   23.937 1.00 39.55  ? 164 ASP E O   1 
ATOM 7529 C CB  . ASP G 2 135 ? 47.115 37.972   25.813 1.00 38.15  ? 164 ASP E CB  1 
ATOM 7530 C CG  . ASP G 2 135 ? 45.817 37.516   26.443 1.00 49.62  ? 164 ASP E CG  1 
ATOM 7531 O OD1 . ASP G 2 135 ? 44.740 37.845   25.899 1.00 51.93  ? 164 ASP E OD1 1 
ATOM 7532 O OD2 . ASP G 2 135 ? 45.874 36.832   27.486 1.00 52.62  ? 164 ASP E OD2 1 
ATOM 7533 N N   . ALA G 2 136 ? 49.214 38.533   23.561 1.00 37.83  ? 165 ALA E N   1 
ATOM 7534 C CA  . ALA G 2 136 ? 50.404 39.185   23.023 1.00 39.27  ? 165 ALA E CA  1 
ATOM 7535 C C   . ALA G 2 136 ? 50.067 40.005   21.784 1.00 33.61  ? 165 ALA E C   1 
ATOM 7536 O O   . ALA G 2 136 ? 50.572 41.123   21.612 1.00 31.47  ? 165 ALA E O   1 
ATOM 7537 C CB  . ALA G 2 136 ? 51.478 38.146   22.704 1.00 41.86  ? 165 ALA E CB  1 
ATOM 7538 N N   . VAL G 2 137 ? 49.200 39.476   20.918 1.00 38.07  ? 166 VAL E N   1 
ATOM 7539 C CA  . VAL G 2 137 ? 48.832 40.212   19.711 1.00 38.86  ? 166 VAL E CA  1 
ATOM 7540 C C   . VAL G 2 137 ? 48.141 41.521   20.072 1.00 37.27  ? 166 VAL E C   1 
ATOM 7541 O O   . VAL G 2 137 ? 48.433 42.573   19.491 1.00 41.28  ? 166 VAL E O   1 
ATOM 7542 C CB  . VAL G 2 137 ? 47.958 39.339   18.792 1.00 36.37  ? 166 VAL E CB  1 
ATOM 7543 C CG1 . VAL G 2 137 ? 47.428 40.162   17.625 1.00 34.75  ? 166 VAL E CG1 1 
ATOM 7544 C CG2 . VAL G 2 137 ? 48.760 38.156   18.285 1.00 35.92  ? 166 VAL E CG2 1 
ATOM 7545 N N   . LEU G 2 138 ? 47.220 41.482   21.039 1.00 31.94  ? 167 LEU E N   1 
ATOM 7546 C CA  . LEU G 2 138 ? 46.552 42.704   21.474 1.00 33.31  ? 167 LEU E CA  1 
ATOM 7547 C C   . LEU G 2 138 ? 47.548 43.711   22.026 1.00 35.71  ? 167 LEU E C   1 
ATOM 7548 O O   . LEU G 2 138 ? 47.472 44.906   21.712 1.00 34.60  ? 167 LEU E O   1 
ATOM 7549 C CB  . LEU G 2 138 ? 45.495 42.383   22.527 1.00 29.98  ? 167 LEU E CB  1 
ATOM 7550 C CG  . LEU G 2 138 ? 44.155 41.874   22.008 1.00 33.20  ? 167 LEU E CG  1 
ATOM 7551 C CD1 . LEU G 2 138 ? 43.181 41.691   23.159 1.00 35.17  ? 167 LEU E CD1 1 
ATOM 7552 C CD2 . LEU G 2 138 ? 43.594 42.830   20.970 1.00 32.85  ? 167 LEU E CD2 1 
ATOM 7553 N N   . ALA G 2 139 ? 48.497 43.248   22.842 1.00 38.11  ? 168 ALA E N   1 
ATOM 7554 C CA  . ALA G 2 139 ? 49.545 44.140   23.329 1.00 36.05  ? 168 ALA E CA  1 
ATOM 7555 C C   . ALA G 2 139 ? 50.270 44.815   22.173 1.00 32.43  ? 168 ALA E C   1 
ATOM 7556 O O   . ALA G 2 139 ? 50.475 46.036   22.176 1.00 43.05  ? 168 ALA E O   1 
ATOM 7557 C CB  . ALA G 2 139 ? 50.528 43.367   24.207 1.00 43.20  ? 168 ALA E CB  1 
ATOM 7558 N N   . GLY G 2 140 ? 50.655 44.032   21.164 1.00 31.06  ? 169 GLY E N   1 
ATOM 7559 C CA  . GLY G 2 140 ? 51.338 44.606   20.020 1.00 33.98  ? 169 GLY E CA  1 
ATOM 7560 C C   . GLY G 2 140 ? 50.473 45.575   19.241 1.00 38.33  ? 169 GLY E C   1 
ATOM 7561 O O   . GLY G 2 140 ? 50.982 46.533   18.651 1.00 39.66  ? 169 GLY E O   1 
ATOM 7562 N N   . ARG G 2 141 ? 49.160 45.347   19.228 1.00 36.09  ? 170 ARG E N   1 
ATOM 7563 C CA  . ARG G 2 141 ? 48.277 46.223   18.469 1.00 40.50  ? 170 ARG E CA  1 
ATOM 7564 C C   . ARG G 2 141 ? 48.038 47.547   19.183 1.00 38.30  ? 170 ARG E C   1 
ATOM 7565 O O   . ARG G 2 141 ? 47.945 48.593   18.531 1.00 37.24  ? 170 ARG E O   1 
ATOM 7566 C CB  . ARG G 2 141 ? 46.951 45.517   18.197 1.00 39.32  ? 170 ARG E CB  1 
ATOM 7567 C CG  . ARG G 2 141 ? 47.067 44.376   17.211 1.00 37.18  ? 170 ARG E CG  1 
ATOM 7568 C CD  . ARG G 2 141 ? 45.811 44.237   16.389 1.00 46.42  ? 170 ARG E CD  1 
ATOM 7569 N NE  . ARG G 2 141 ? 44.688 43.718   17.162 1.00 52.65  ? 170 ARG E NE  1 
ATOM 7570 C CZ  . ARG G 2 141 ? 44.172 42.504   17.011 1.00 47.42  ? 170 ARG E CZ  1 
ATOM 7571 N NH1 . ARG G 2 141 ? 43.145 42.127   17.757 1.00 45.09  ? 170 ARG E NH1 1 
ATOM 7572 N NH2 . ARG G 2 141 ? 44.669 41.674   16.103 1.00 42.16  ? 170 ARG E NH2 1 
ATOM 7573 N N   . ARG G 2 142 ? 47.944 47.534   20.516 1.00 38.86  ? 171 ARG E N   1 
ATOM 7574 C CA  . ARG G 2 142 ? 47.907 48.802   21.233 1.00 35.38  ? 171 ARG E CA  1 
ATOM 7575 C C   . ARG G 2 142 ? 49.248 49.514   21.139 1.00 36.78  ? 171 ARG E C   1 
ATOM 7576 O O   . ARG G 2 142 ? 49.298 50.751   21.159 1.00 49.21  ? 171 ARG E O   1 
ATOM 7577 C CB  . ARG G 2 142 ? 47.504 48.586   22.691 1.00 37.32  ? 171 ARG E CB  1 
ATOM 7578 C CG  . ARG G 2 142 ? 48.653 48.608   23.686 1.00 42.16  ? 171 ARG E CG  1 
ATOM 7579 C CD  . ARG G 2 142 ? 48.116 48.615   25.101 1.00 41.84  ? 171 ARG E CD  1 
ATOM 7580 N NE  . ARG G 2 142 ? 47.055 47.625   25.253 1.00 47.42  ? 171 ARG E NE  1 
ATOM 7581 C CZ  . ARG G 2 142 ? 47.269 46.344   25.532 1.00 47.80  ? 171 ARG E CZ  1 
ATOM 7582 N NH1 . ARG G 2 142 ? 48.506 45.903   25.706 1.00 43.34  ? 171 ARG E NH1 1 
ATOM 7583 N NH2 . ARG G 2 142 ? 46.248 45.506   25.650 1.00 38.52  ? 171 ARG E NH2 1 
ATOM 7584 N N   . GLN G 2 143 ? 50.339 48.753   21.019 1.00 31.98  ? 172 GLN E N   1 
ATOM 7585 C CA  . GLN G 2 143 ? 51.634 49.367   20.755 1.00 38.40  ? 172 GLN E CA  1 
ATOM 7586 C C   . GLN G 2 143 ? 51.639 50.078   19.405 1.00 42.93  ? 172 GLN E C   1 
ATOM 7587 O O   . GLN G 2 143 ? 52.115 51.214   19.295 1.00 47.72  ? 172 GLN E O   1 
ATOM 7588 C CB  . GLN G 2 143 ? 52.738 48.312   20.817 1.00 42.38  ? 172 GLN E CB  1 
ATOM 7589 C CG  . GLN G 2 143 ? 54.109 48.833   20.434 1.00 50.71  ? 172 GLN E CG  1 
ATOM 7590 C CD  . GLN G 2 143 ? 54.626 49.890   21.391 1.00 66.49  ? 172 GLN E CD  1 
ATOM 7591 O OE1 . GLN G 2 143 ? 54.178 49.986   22.536 1.00 71.35  ? 172 GLN E OE1 1 
ATOM 7592 N NE2 . GLN G 2 143 ? 55.575 50.693   20.924 1.00 67.34  ? 172 GLN E NE2 1 
ATOM 7593 N N   . VAL G 2 144 ? 51.098 49.431   18.370 1.00 44.49  ? 173 VAL E N   1 
ATOM 7594 C CA  . VAL G 2 144 ? 51.032 50.059   17.051 1.00 46.16  ? 173 VAL E CA  1 
ATOM 7595 C C   . VAL G 2 144 ? 50.125 51.286   17.087 1.00 42.25  ? 173 VAL E C   1 
ATOM 7596 O O   . VAL G 2 144 ? 50.422 52.318   16.467 1.00 44.86  ? 173 VAL E O   1 
ATOM 7597 C CB  . VAL G 2 144 ? 50.559 49.030   16.002 1.00 45.93  ? 173 VAL E CB  1 
ATOM 7598 C CG1 . VAL G 2 144 ? 50.206 49.713   14.688 1.00 49.15  ? 173 VAL E CG1 1 
ATOM 7599 C CG2 . VAL G 2 144 ? 51.622 47.958   15.779 1.00 36.40  ? 173 VAL E CG2 1 
ATOM 7600 N N   . GLU G 2 145 ? 49.032 51.208   17.853 1.00 42.35  ? 174 GLU E N   1 
ATOM 7601 C CA  . GLU G 2 145 ? 48.100 52.328   17.954 1.00 41.87  ? 174 GLU E CA  1 
ATOM 7602 C C   . GLU G 2 145 ? 48.761 53.539   18.599 1.00 46.64  ? 174 GLU E C   1 
ATOM 7603 O O   . GLU G 2 145 ? 48.712 54.651   18.057 1.00 46.48  ? 174 GLU E O   1 
ATOM 7604 C CB  . GLU G 2 145 ? 46.861 51.905   18.744 1.00 41.74  ? 174 GLU E CB  1 
ATOM 7605 C CG  . GLU G 2 145 ? 45.905 53.044   19.077 1.00 54.44  ? 174 GLU E CG  1 
ATOM 7606 C CD  . GLU G 2 145 ? 44.573 52.554   19.626 1.00 63.89  ? 174 GLU E CD  1 
ATOM 7607 O OE1 . GLU G 2 145 ? 44.568 51.551   20.371 1.00 52.68  ? 174 GLU E OE1 1 
ATOM 7608 O OE2 . GLU G 2 145 ? 43.532 53.169   19.312 1.00 78.73  ? 174 GLU E OE2 1 
ATOM 7609 N N   . GLU G 2 146 ? 49.382 53.348   19.766 1.00 46.00  ? 175 GLU E N   1 
ATOM 7610 C CA  . GLU G 2 146 ? 50.025 54.484   20.417 1.00 49.80  ? 175 GLU E CA  1 
ATOM 7611 C C   . GLU G 2 146 ? 51.223 54.977   19.617 1.00 46.81  ? 175 GLU E C   1 
ATOM 7612 O O   . GLU G 2 146 ? 51.569 56.162   19.692 1.00 50.68  ? 175 GLU E O   1 
ATOM 7613 C CB  . GLU G 2 146 ? 50.428 54.131   21.850 1.00 52.77  ? 175 GLU E CB  1 
ATOM 7614 C CG  . GLU G 2 146 ? 51.639 53.231   21.984 1.00 60.99  ? 175 GLU E CG  1 
ATOM 7615 C CD  . GLU G 2 146 ? 52.132 53.147   23.418 1.00 74.71  ? 175 GLU E CD  1 
ATOM 7616 O OE1 . GLU G 2 146 ? 53.260 53.612   23.693 1.00 85.15  ? 175 GLU E OE1 1 
ATOM 7617 O OE2 . GLU G 2 146 ? 51.386 52.618   24.271 1.00 73.01  ? 175 GLU E OE2 1 
ATOM 7618 N N   . LEU G 2 147 ? 51.861 54.096   18.841 1.00 43.53  ? 176 LEU E N   1 
ATOM 7619 C CA  . LEU G 2 147 ? 52.945 54.542   17.971 1.00 44.10  ? 176 LEU E CA  1 
ATOM 7620 C C   . LEU G 2 147 ? 52.434 55.501   16.903 1.00 46.60  ? 176 LEU E C   1 
ATOM 7621 O O   . LEU G 2 147 ? 52.982 56.595   16.730 1.00 47.84  ? 176 LEU E O   1 
ATOM 7622 C CB  . LEU G 2 147 ? 53.644 53.346   17.323 1.00 46.59  ? 176 LEU E CB  1 
ATOM 7623 C CG  . LEU G 2 147 ? 54.723 52.631   18.136 1.00 51.45  ? 176 LEU E CG  1 
ATOM 7624 C CD1 . LEU G 2 147 ? 55.337 51.493   17.333 1.00 52.32  ? 176 LEU E CD1 1 
ATOM 7625 C CD2 . LEU G 2 147 ? 55.791 53.613   18.582 1.00 45.02  ? 176 LEU E CD2 1 
ATOM 7626 N N   . GLN G 2 148 ? 51.375 55.119   16.177 1.00 44.63  ? 177 GLN E N   1 
ATOM 7627 C CA  . GLN G 2 148 ? 50.856 56.046   15.173 1.00 43.69  ? 177 GLN E CA  1 
ATOM 7628 C C   . GLN G 2 148 ? 50.273 57.295   15.824 1.00 48.40  ? 177 GLN E C   1 
ATOM 7629 O O   . GLN G 2 148 ? 50.274 58.371   15.211 1.00 54.62  ? 177 GLN E O   1 
ATOM 7630 C CB  . GLN G 2 148 ? 49.825 55.368   14.265 1.00 40.78  ? 177 GLN E CB  1 
ATOM 7631 C CG  . GLN G 2 148 ? 48.577 54.846   14.944 1.00 46.86  ? 177 GLN E CG  1 
ATOM 7632 C CD  . GLN G 2 148 ? 47.794 53.893   14.055 1.00 46.98  ? 177 GLN E CD  1 
ATOM 7633 O OE1 . GLN G 2 148 ? 48.237 52.778   13.778 1.00 46.27  ? 177 GLN E OE1 1 
ATOM 7634 N NE2 . GLN G 2 148 ? 46.625 54.332   13.601 1.00 43.94  ? 177 GLN E NE2 1 
ATOM 7635 N N   . LEU G 2 149 ? 49.794 57.178   17.066 1.00 47.93  ? 178 LEU E N   1 
ATOM 7636 C CA  . LEU G 2 149 ? 49.359 58.362   17.800 1.00 52.31  ? 178 LEU E CA  1 
ATOM 7637 C C   . LEU G 2 149 ? 50.532 59.304   18.045 1.00 53.43  ? 178 LEU E C   1 
ATOM 7638 O O   . LEU G 2 149 ? 50.380 60.529   17.972 1.00 50.98  ? 178 LEU E O   1 
ATOM 7639 C CB  . LEU G 2 149 ? 48.698 57.953   19.118 1.00 54.81  ? 178 LEU E CB  1 
ATOM 7640 C CG  . LEU G 2 149 ? 47.820 58.984   19.838 1.00 63.41  ? 178 LEU E CG  1 
ATOM 7641 C CD1 . LEU G 2 149 ? 46.769 58.286   20.686 1.00 61.70  ? 178 LEU E CD1 1 
ATOM 7642 C CD2 . LEU G 2 149 ? 48.651 59.928   20.710 1.00 65.26  ? 178 LEU E CD2 1 
ATOM 7643 N N   . GLN G 2 150 ? 51.707 58.749   18.352 1.00 48.22  ? 179 GLN E N   1 
ATOM 7644 C CA  . GLN G 2 150 ? 52.902 59.575   18.489 1.00 49.51  ? 179 GLN E CA  1 
ATOM 7645 C C   . GLN G 2 150 ? 53.305 60.179   17.148 1.00 53.07  ? 179 GLN E C   1 
ATOM 7646 O O   . GLN G 2 150 ? 53.737 61.339   17.084 1.00 49.40  ? 179 GLN E O   1 
ATOM 7647 C CB  . GLN G 2 150 ? 54.044 58.742   19.066 1.00 46.87  ? 179 GLN E CB  1 
ATOM 7648 C CG  . GLN G 2 150 ? 53.806 58.275   20.490 1.00 52.64  ? 179 GLN E CG  1 
ATOM 7649 C CD  . GLN G 2 150 ? 55.002 57.549   21.071 1.00 53.73  ? 179 GLN E CD  1 
ATOM 7650 O OE1 . GLN G 2 150 ? 55.907 57.137   20.344 1.00 48.94  ? 179 GLN E OE1 1 
ATOM 7651 N NE2 . GLN G 2 150 ? 55.012 57.385   22.390 1.00 51.09  ? 179 GLN E NE2 1 
ATOM 7652 N N   . VAL G 2 151 ? 53.180 59.400   16.070 1.00 54.73  ? 180 VAL E N   1 
ATOM 7653 C CA  . VAL G 2 151 ? 53.475 59.902   14.730 1.00 55.30  ? 180 VAL E CA  1 
ATOM 7654 C C   . VAL G 2 151 ? 52.652 61.150   14.440 1.00 53.80  ? 180 VAL E C   1 
ATOM 7655 O O   . VAL G 2 151 ? 53.193 62.210   14.099 1.00 49.87  ? 180 VAL E O   1 
ATOM 7656 C CB  . VAL G 2 151 ? 53.213 58.808   13.679 1.00 47.06  ? 180 VAL E CB  1 
ATOM 7657 C CG1 . VAL G 2 151 ? 53.166 59.409   12.282 1.00 46.81  ? 180 VAL E CG1 1 
ATOM 7658 C CG2 . VAL G 2 151 ? 54.264 57.720   13.762 1.00 47.95  ? 180 VAL E CG2 1 
ATOM 7659 N N   . GLN G 2 152 ? 51.329 61.044   14.580 1.00 52.03  ? 181 GLN E N   1 
ATOM 7660 C CA  . GLN G 2 152 ? 50.482 62.204   14.332 1.00 52.61  ? 181 GLN E CA  1 
ATOM 7661 C C   . GLN G 2 152 ? 50.728 63.302   15.358 1.00 60.15  ? 181 GLN E C   1 
ATOM 7662 O O   . GLN G 2 152 ? 50.562 64.488   15.048 1.00 61.75  ? 181 GLN E O   1 
ATOM 7663 C CB  . GLN G 2 152 ? 49.011 61.792   14.337 1.00 58.00  ? 181 GLN E CB  1 
ATOM 7664 C CG  . GLN G 2 152 ? 48.057 62.922   14.001 1.00 67.59  ? 181 GLN E CG  1 
ATOM 7665 C CD  . GLN G 2 152 ? 46.628 62.610   14.385 1.00 86.48  ? 181 GLN E CD  1 
ATOM 7666 O OE1 . GLN G 2 152 ? 46.373 61.752   15.231 1.00 92.86  ? 181 GLN E OE1 1 
ATOM 7667 N NE2 . GLN G 2 152 ? 45.683 63.310   13.767 1.00 98.39  ? 181 GLN E NE2 1 
ATOM 7668 N N   . ALA G 2 153 ? 51.137 62.930   16.573 1.00 56.87  ? 182 ALA E N   1 
ATOM 7669 C CA  . ALA G 2 153 ? 51.402 63.919   17.612 1.00 56.25  ? 182 ALA E CA  1 
ATOM 7670 C C   . ALA G 2 153 ? 52.543 64.845   17.209 1.00 51.32  ? 182 ALA E C   1 
ATOM 7671 O O   . ALA G 2 153 ? 52.376 66.069   17.137 1.00 56.86  ? 182 ALA E O   1 
ATOM 7672 C CB  . ALA G 2 153 ? 51.711 63.215   18.934 1.00 52.76  ? 182 ALA E CB  1 
ATOM 7673 N N   . GLN G 2 154 ? 53.716 64.276   16.930 1.00 46.54  ? 183 GLN E N   1 
ATOM 7674 C CA  . GLN G 2 154 ? 54.831 65.109   16.494 1.00 43.35  ? 183 GLN E CA  1 
ATOM 7675 C C   . GLN G 2 154 ? 54.572 65.726   15.124 1.00 45.02  ? 183 GLN E C   1 
ATOM 7676 O O   . GLN G 2 154 ? 55.083 66.814   14.828 1.00 46.14  ? 183 GLN E O   1 
ATOM 7677 C CB  . GLN G 2 154 ? 56.117 64.291   16.476 1.00 38.05  ? 183 GLN E CB  1 
ATOM 7678 C CG  . GLN G 2 154 ? 56.819 64.174   17.810 1.00 42.30  ? 183 GLN E CG  1 
ATOM 7679 C CD  . GLN G 2 154 ? 58.267 63.752   17.653 1.00 50.14  ? 183 GLN E CD  1 
ATOM 7680 O OE1 . GLN G 2 154 ? 59.003 64.311   16.842 1.00 49.20  ? 183 GLN E OE1 1 
ATOM 7681 N NE2 . GLN G 2 154 ? 58.681 62.754   18.427 1.00 57.30  ? 183 GLN E NE2 1 
ATOM 7682 N N   . GLN G 2 155 ? 53.774 65.063   14.285 1.00 47.65  ? 184 GLN E N   1 
ATOM 7683 C CA  . GLN G 2 155 ? 53.426 65.634   12.989 1.00 46.23  ? 184 GLN E CA  1 
ATOM 7684 C C   . GLN G 2 155 ? 52.696 66.961   13.155 1.00 48.02  ? 184 GLN E C   1 
ATOM 7685 O O   . GLN G 2 155 ? 53.132 67.996   12.635 1.00 54.57  ? 184 GLN E O   1 
ATOM 7686 C CB  . GLN G 2 155 ? 52.576 64.642   12.190 1.00 48.41  ? 184 GLN E CB  1 
ATOM 7687 C CG  . GLN G 2 155 ? 52.437 64.997   10.717 1.00 48.96  ? 184 GLN E CG  1 
ATOM 7688 C CD  . GLN G 2 155 ? 51.161 64.462   10.093 1.00 51.87  ? 184 GLN E CD  1 
ATOM 7689 O OE1 . GLN G 2 155 ? 50.206 64.124   10.792 1.00 56.81  ? 184 GLN E OE1 1 
ATOM 7690 N NE2 . GLN G 2 155 ? 51.133 64.399   8.766  1.00 52.75  ? 184 GLN E NE2 1 
ATOM 7691 N N   . GLN G 2 156 ? 51.588 66.959   13.903 1.00 47.86  ? 185 GLN E N   1 
ATOM 7692 C CA  . GLN G 2 156 ? 50.891 68.216   14.151 1.00 47.92  ? 185 GLN E CA  1 
ATOM 7693 C C   . GLN G 2 156 ? 51.747 69.171   14.972 1.00 48.73  ? 185 GLN E C   1 
ATOM 7694 O O   . GLN G 2 156 ? 51.578 70.392   14.870 1.00 50.33  ? 185 GLN E O   1 
ATOM 7695 C CB  . GLN G 2 156 ? 49.547 67.969   14.835 1.00 45.82  ? 185 GLN E CB  1 
ATOM 7696 C CG  . GLN G 2 156 ? 49.635 67.333   16.205 1.00 52.77  ? 185 GLN E CG  1 
ATOM 7697 C CD  . GLN G 2 156 ? 48.275 66.943   16.744 1.00 58.24  ? 185 GLN E CD  1 
ATOM 7698 O OE1 . GLN G 2 156 ? 47.261 67.082   16.060 1.00 60.53  ? 185 GLN E OE1 1 
ATOM 7699 N NE2 . GLN G 2 156 ? 48.246 66.457   17.980 1.00 60.30  ? 185 GLN E NE2 1 
ATOM 7700 N N   . ALA G 2 157 ? 52.667 68.639   15.784 1.00 46.47  ? 186 ALA E N   1 
ATOM 7701 C CA  . ALA G 2 157 ? 53.606 69.502   16.495 1.00 46.13  ? 186 ALA E CA  1 
ATOM 7702 C C   . ALA G 2 157 ? 54.443 70.321   15.518 1.00 52.23  ? 186 ALA E C   1 
ATOM 7703 O O   . ALA G 2 157 ? 54.737 71.496   15.771 1.00 55.70  ? 186 ALA E O   1 
ATOM 7704 C CB  . ALA G 2 157 ? 54.500 68.669   17.413 1.00 40.00  ? 186 ALA E CB  1 
ATOM 7705 N N   . TRP G 2 158 ? 54.830 69.722   14.391 1.00 49.50  ? 187 TRP E N   1 
ATOM 7706 C CA  . TRP G 2 158 ? 55.493 70.493   13.348 1.00 41.08  ? 187 TRP E CA  1 
ATOM 7707 C C   . TRP G 2 158 ? 54.517 71.299   12.505 1.00 42.08  ? 187 TRP E C   1 
ATOM 7708 O O   . TRP G 2 158 ? 54.936 72.265   11.859 1.00 49.90  ? 187 TRP E O   1 
ATOM 7709 C CB  . TRP G 2 158 ? 56.310 69.572   12.442 1.00 44.92  ? 187 TRP E CB  1 
ATOM 7710 C CG  . TRP G 2 158 ? 57.669 69.279   12.970 1.00 46.77  ? 187 TRP E CG  1 
ATOM 7711 C CD1 . TRP G 2 158 ? 58.042 68.221   13.749 1.00 52.02  ? 187 TRP E CD1 1 
ATOM 7712 C CD2 . TRP G 2 158 ? 58.852 70.045   12.739 1.00 41.88  ? 187 TRP E CD2 1 
ATOM 7713 N NE1 . TRP G 2 158 ? 59.385 68.290   14.028 1.00 53.32  ? 187 TRP E NE1 1 
ATOM 7714 C CE2 . TRP G 2 158 ? 59.906 69.401   13.417 1.00 54.62  ? 187 TRP E CE2 1 
ATOM 7715 C CE3 . TRP G 2 158 ? 59.123 71.215   12.028 1.00 38.48  ? 187 TRP E CE3 1 
ATOM 7716 C CZ2 . TRP G 2 158 ? 61.208 69.893   13.405 1.00 56.23  ? 187 TRP E CZ2 1 
ATOM 7717 C CZ3 . TRP G 2 158 ? 60.414 71.698   12.016 1.00 38.62  ? 187 TRP E CZ3 1 
ATOM 7718 C CH2 . TRP G 2 158 ? 61.441 71.040   12.700 1.00 40.41  ? 187 TRP E CH2 1 
ATOM 7719 N N   . GLN G 2 159 ? 53.232 70.935   12.496 1.00 43.06  ? 188 GLN E N   1 
ATOM 7720 C CA  . GLN G 2 159 ? 52.233 71.735   11.793 1.00 52.94  ? 188 GLN E CA  1 
ATOM 7721 C C   . GLN G 2 159 ? 51.806 72.976   12.568 1.00 51.65  ? 188 GLN E C   1 
ATOM 7722 O O   . GLN G 2 159 ? 51.178 73.866   11.981 1.00 41.79  ? 188 GLN E O   1 
ATOM 7723 C CB  . GLN G 2 159 ? 50.995 70.892   11.458 1.00 50.07  ? 188 GLN E CB  1 
ATOM 7724 C CG  . GLN G 2 159 ? 51.280 69.644   10.635 1.00 46.73  ? 188 GLN E CG  1 
ATOM 7725 C CD  . GLN G 2 159 ? 50.055 68.762   10.454 1.00 52.39  ? 188 GLN E CD  1 
ATOM 7726 O OE1 . GLN G 2 159 ? 49.990 67.653   10.984 1.00 57.55  ? 188 GLN E OE1 1 
ATOM 7727 N NE2 . GLN G 2 159 ? 49.078 69.252   9.698  1.00 45.36  ? 188 GLN E NE2 1 
ATOM 7728 N N   . ALA G 2 160 ? 52.129 73.060   13.861 1.00 49.25  ? 189 ALA E N   1 
ATOM 7729 C CA  . ALA G 2 160 ? 51.721 74.213   14.654 1.00 51.10  ? 189 ALA E CA  1 
ATOM 7730 C C   . ALA G 2 160 ? 52.453 75.483   14.240 1.00 51.99  ? 189 ALA E C   1 
ATOM 7731 O O   . ALA G 2 160 ? 51.980 76.583   14.546 1.00 50.16  ? 189 ALA E O   1 
ATOM 7732 C CB  . ALA G 2 160 ? 51.955 73.938   16.141 1.00 43.85  ? 189 ALA E CB  1 
ATOM 7733 N N   . LEU G 2 161 ? 53.583 75.355   13.541 1.00 47.43  ? 190 LEU E N   1 
ATOM 7734 C CA  . LEU G 2 161 ? 54.343 76.519   13.103 1.00 41.68  ? 190 LEU E CA  1 
ATOM 7735 C C   . LEU G 2 161 ? 53.562 77.375   12.114 1.00 47.68  ? 190 LEU E C   1 
ATOM 7736 O O   . LEU G 2 161 ? 53.909 78.546   11.907 1.00 56.02  ? 190 LEU E O   1 
ATOM 7737 C CB  . LEU G 2 161 ? 55.664 76.067   12.475 1.00 44.07  ? 190 LEU E CB  1 
ATOM 7738 C CG  . LEU G 2 161 ? 56.553 75.143   13.314 1.00 39.75  ? 190 LEU E CG  1 
ATOM 7739 C CD1 . LEU G 2 161 ? 57.664 74.537   12.466 1.00 34.81  ? 190 LEU E CD1 1 
ATOM 7740 C CD2 . LEU G 2 161 ? 57.132 75.884   14.504 1.00 39.72  ? 190 LEU E CD2 1 
ATOM 7741 N N   . HIS G 2 162 ? 52.518 76.813   11.502 1.00 52.75  ? 191 HIS E N   1 
ATOM 7742 C CA  . HIS G 2 162 ? 51.809 77.511   10.435 1.00 50.23  ? 191 HIS E CA  1 
ATOM 7743 C C   . HIS G 2 162 ? 51.183 78.811   10.920 1.00 52.42  ? 191 HIS E C   1 
ATOM 7744 O O   . HIS G 2 162 ? 51.208 79.816   10.202 1.00 60.90  ? 191 HIS E O   1 
ATOM 7745 C CB  . HIS G 2 162 ? 50.735 76.607   9.838  1.00 58.67  ? 191 HIS E CB  1 
ATOM 7746 C CG  . HIS G 2 162 ? 49.710 77.349   9.041  1.00 55.11  ? 191 HIS E CG  1 
ATOM 7747 N ND1 . HIS G 2 162 ? 49.995 77.936   7.827  1.00 59.64  ? 191 HIS E ND1 1 
ATOM 7748 C CD2 . HIS G 2 162 ? 48.407 77.618   9.292  1.00 58.90  ? 191 HIS E CD2 1 
ATOM 7749 C CE1 . HIS G 2 162 ? 48.909 78.525   7.360  1.00 63.96  ? 191 HIS E CE1 1 
ATOM 7750 N NE2 . HIS G 2 162 ? 47.931 78.348   8.230  1.00 58.33  ? 191 HIS E NE2 1 
ATOM 7751 N N   . ARG G 2 163 ? 50.587 78.812   12.116 1.00 53.96  ? 192 ARG E N   1 
ATOM 7752 C CA  . ARG G 2 163 ? 49.995 80.047   12.626 1.00 50.76  ? 192 ARG E CA  1 
ATOM 7753 C C   . ARG G 2 163 ? 51.063 81.113   12.865 1.00 57.16  ? 192 ARG E C   1 
ATOM 7754 O O   . ARG G 2 163 ? 50.884 82.279   12.484 1.00 64.55  ? 192 ARG E O   1 
ATOM 7755 C CB  . ARG G 2 163 ? 49.178 79.781   13.894 1.00 46.66  ? 192 ARG E CB  1 
ATOM 7756 C CG  . ARG G 2 163 ? 49.935 79.206   15.073 1.00 61.36  ? 192 ARG E CG  1 
ATOM 7757 C CD  . ARG G 2 163 ? 49.027 79.094   16.291 1.00 69.81  ? 192 ARG E CD  1 
ATOM 7758 N NE  . ARG G 2 163 ? 49.739 78.628   17.478 1.00 82.96  ? 192 ARG E NE  1 
ATOM 7759 C CZ  . ARG G 2 163 ? 49.167 78.428   18.662 1.00 92.07  ? 192 ARG E CZ  1 
ATOM 7760 N NH1 . ARG G 2 163 ? 49.890 78.004   19.690 1.00 97.79  ? 192 ARG E NH1 1 
ATOM 7761 N NH2 . ARG G 2 163 ? 47.871 78.661   18.819 1.00 93.62  ? 192 ARG E NH2 1 
ATOM 7762 N N   . GLU G 2 164 ? 52.193 80.726   13.477 1.00 51.90  ? 193 GLU E N   1 
ATOM 7763 C CA  . GLU G 2 164 ? 53.275 81.684   13.701 1.00 55.19  ? 193 GLU E CA  1 
ATOM 7764 C C   . GLU G 2 164 ? 53.747 82.291   12.388 1.00 53.26  ? 193 GLU E C   1 
ATOM 7765 O O   . GLU G 2 164 ? 53.992 83.504   12.303 1.00 55.56  ? 193 GLU E O   1 
ATOM 7766 C CB  . GLU G 2 164 ? 54.441 81.036   14.450 1.00 52.09  ? 193 GLU E CB  1 
ATOM 7767 C CG  . GLU G 2 164 ? 54.254 80.952   15.965 1.00 61.15  ? 193 GLU E CG  1 
ATOM 7768 C CD  . GLU G 2 164 ? 53.125 80.037   16.389 1.00 73.75  ? 193 GLU E CD  1 
ATOM 7769 O OE1 . GLU G 2 164 ? 52.987 78.944   15.801 1.00 73.21  ? 193 GLU E OE1 1 
ATOM 7770 O OE2 . GLU G 2 164 ? 52.375 80.415   17.316 1.00 77.77  ? 193 GLU E OE2 1 
ATOM 7771 N N   . GLN G 2 165 ? 53.856 81.471   11.345 1.00 49.81  ? 194 GLN E N   1 
ATOM 7772 C CA  . GLN G 2 165 ? 54.160 82.033   10.037 1.00 46.80  ? 194 GLN E CA  1 
ATOM 7773 C C   . GLN G 2 165 ? 53.038 82.933   9.537  1.00 48.38  ? 194 GLN E C   1 
ATOM 7774 O O   . GLN G 2 165 ? 53.304 83.923   8.848  1.00 55.67  ? 194 GLN E O   1 
ATOM 7775 C CB  . GLN G 2 165 ? 54.426 80.919   9.032  1.00 50.82  ? 194 GLN E CB  1 
ATOM 7776 C CG  . GLN G 2 165 ? 55.408 79.875   9.509  1.00 51.75  ? 194 GLN E CG  1 
ATOM 7777 C CD  . GLN G 2 165 ? 55.730 78.888   8.422  1.00 55.47  ? 194 GLN E CD  1 
ATOM 7778 O OE1 . GLN G 2 165 ? 56.151 79.275   7.336  1.00 60.03  ? 194 GLN E OE1 1 
ATOM 7779 N NE2 . GLN G 2 165 ? 55.541 77.604   8.705  1.00 52.12  ? 194 GLN E NE2 1 
ATOM 7780 N N   . ARG G 2 166 ? 51.783 82.623   9.873  1.00 46.85  ? 195 ARG E N   1 
ATOM 7781 C CA  . ARG G 2 166 ? 50.690 83.401   9.301  1.00 48.21  ? 195 ARG E CA  1 
ATOM 7782 C C   . ARG G 2 166 ? 50.620 84.809   9.891  1.00 49.43  ? 195 ARG E C   1 
ATOM 7783 O O   . ARG G 2 166 ? 50.473 85.782   9.140  1.00 50.10  ? 195 ARG E O   1 
ATOM 7784 C CB  . ARG G 2 166 ? 49.362 82.651   9.456  1.00 49.68  ? 195 ARG E CB  1 
ATOM 7785 C CG  . ARG G 2 166 ? 48.458 83.113   10.584 1.00 51.13  ? 195 ARG E CG  1 
ATOM 7786 C CD  . ARG G 2 166 ? 47.026 82.663   10.369 1.00 52.83  ? 195 ARG E CD  1 
ATOM 7787 N NE  . ARG G 2 166 ? 46.498 83.121   9.090  1.00 54.99  ? 195 ARG E NE  1 
ATOM 7788 C CZ  . ARG G 2 166 ? 45.236 82.954   8.711  1.00 53.41  ? 195 ARG E CZ  1 
ATOM 7789 N NH1 . ARG G 2 166 ? 44.379 82.340   9.516  1.00 55.57  ? 195 ARG E NH1 1 
ATOM 7790 N NH2 . ARG G 2 166 ? 44.827 83.400   7.530  1.00 49.62  ? 195 ARG E NH2 1 
ATOM 7791 N N   . GLU G 2 167 ? 50.757 84.969   11.218 1.00 50.87  ? 196 GLU E N   1 
ATOM 7792 C CA  . GLU G 2 167 ? 50.776 86.356   11.680 1.00 56.42  ? 196 GLU E CA  1 
ATOM 7793 C C   . GLU G 2 167 ? 52.151 86.979   11.501 1.00 52.84  ? 196 GLU E C   1 
ATOM 7794 O O   . GLU G 2 167 ? 52.272 88.203   11.603 1.00 55.57  ? 196 GLU E O   1 
ATOM 7795 C CB  . GLU G 2 167 ? 50.274 86.547   13.124 1.00 63.16  ? 196 GLU E CB  1 
ATOM 7796 C CG  . GLU G 2 167 ? 51.259 86.418   14.265 1.00 64.17  ? 196 GLU E CG  1 
ATOM 7797 C CD  . GLU G 2 167 ? 51.279 85.046   14.842 1.00 81.43  ? 196 GLU E CD  1 
ATOM 7798 O OE1 . GLU G 2 167 ? 51.374 84.116   14.040 1.00 73.26  ? 196 GLU E OE1 1 
ATOM 7799 O OE2 . GLU G 2 167 ? 51.185 84.897   16.080 1.00 96.95  ? 196 GLU E OE2 1 
ATOM 7800 N N   . LEU G 2 168 ? 53.194 86.174   11.276 1.00 48.46  ? 197 LEU E N   1 
ATOM 7801 C CA  . LEU G 2 168 ? 54.442 86.757   10.794 1.00 44.07  ? 197 LEU E CA  1 
ATOM 7802 C C   . LEU G 2 168 ? 54.211 87.484   9.479  1.00 40.68  ? 197 LEU E C   1 
ATOM 7803 O O   . LEU G 2 168 ? 54.655 88.622   9.297  1.00 41.11  ? 197 LEU E O   1 
ATOM 7804 C CB  . LEU G 2 168 ? 55.512 85.685   10.615 1.00 43.77  ? 197 LEU E CB  1 
ATOM 7805 C CG  . LEU G 2 168 ? 56.767 86.253   9.946  1.00 40.48  ? 197 LEU E CG  1 
ATOM 7806 C CD1 . LEU G 2 168 ? 58.002 85.919   10.743 1.00 40.77  ? 197 LEU E CD1 1 
ATOM 7807 C CD2 . LEU G 2 168 ? 56.910 85.733   8.524  1.00 50.27  ? 197 LEU E CD2 1 
ATOM 7808 N N   . VAL G 2 169 ? 53.528 86.829   8.537  1.00 43.78  ? 198 VAL E N   1 
ATOM 7809 C CA  . VAL G 2 169 ? 53.200 87.484   7.277  1.00 46.94  ? 198 VAL E CA  1 
ATOM 7810 C C   . VAL G 2 169 ? 52.240 88.641   7.514  1.00 52.23  ? 198 VAL E C   1 
ATOM 7811 O O   . VAL G 2 169 ? 52.276 89.647   6.793  1.00 56.22  ? 198 VAL E O   1 
ATOM 7812 C CB  . VAL G 2 169 ? 52.628 86.464   6.275  1.00 45.64  ? 198 VAL E CB  1 
ATOM 7813 C CG1 . VAL G 2 169 ? 52.261 87.141   4.967  1.00 54.58  ? 198 VAL E CG1 1 
ATOM 7814 C CG2 . VAL G 2 169 ? 53.638 85.362   6.016  1.00 53.39  ? 198 VAL E CG2 1 
ATOM 7815 N N   . ALA G 2 170 ? 51.382 88.536   8.532  1.00 49.61  ? 199 ALA E N   1 
ATOM 7816 C CA  . ALA G 2 170 ? 50.475 89.640   8.836  1.00 53.18  ? 199 ALA E CA  1 
ATOM 7817 C C   . ALA G 2 170 ? 51.234 90.872   9.322  1.00 55.05  ? 199 ALA E C   1 
ATOM 7818 O O   . ALA G 2 170 ? 50.872 92.004   8.983  1.00 57.20  ? 199 ALA E O   1 
ATOM 7819 C CB  . ALA G 2 170 ? 49.442 89.201   9.873  1.00 53.98  ? 199 ALA E CB  1 
ATOM 7820 N N   . VAL G 2 171 ? 52.283 90.672   10.124 1.00 53.21  ? 200 VAL E N   1 
ATOM 7821 C CA  . VAL G 2 171 ? 53.078 91.792   10.621 1.00 48.35  ? 200 VAL E CA  1 
ATOM 7822 C C   . VAL G 2 171 ? 53.822 92.480   9.481  1.00 45.41  ? 200 VAL E C   1 
ATOM 7823 O O   . VAL G 2 171 ? 53.944 93.710   9.453  1.00 52.92  ? 200 VAL E O   1 
ATOM 7824 C CB  . VAL G 2 171 ? 54.046 91.302   11.715 1.00 44.31  ? 200 VAL E CB  1 
ATOM 7825 C CG1 . VAL G 2 171 ? 55.189 92.293   11.927 1.00 37.29  ? 200 VAL E CG1 1 
ATOM 7826 C CG2 . VAL G 2 171 ? 53.296 91.042   13.010 1.00 45.51  ? 200 VAL E CG2 1 
ATOM 7827 N N   . LEU G 2 172 ? 54.309 91.708   8.514  1.00 44.67  ? 201 LEU E N   1 
ATOM 7828 C CA  . LEU G 2 172 ? 55.178 92.231   7.470  1.00 49.98  ? 201 LEU E CA  1 
ATOM 7829 C C   . LEU G 2 172 ? 54.417 92.784   6.271  1.00 62.28  ? 201 LEU E C   1 
ATOM 7830 O O   . LEU G 2 172 ? 55.042 93.106   5.255  1.00 67.21  ? 201 LEU E O   1 
ATOM 7831 C CB  . LEU G 2 172 ? 56.154 91.146   7.004  1.00 48.14  ? 201 LEU E CB  1 
ATOM 7832 C CG  . LEU G 2 172 ? 57.100 90.588   8.066  1.00 42.56  ? 201 LEU E CG  1 
ATOM 7833 C CD1 . LEU G 2 172 ? 58.199 89.757   7.423  1.00 50.63  ? 201 LEU E CD1 1 
ATOM 7834 C CD2 . LEU G 2 172 ? 57.686 91.712   8.900  1.00 48.31  ? 201 LEU E CD2 1 
ATOM 7835 N N   . ARG G 2 173 ? 53.098 92.912   6.359  1.00 62.60  ? 202 ARG E N   1 
ATOM 7836 C CA  . ARG G 2 173 ? 52.298 93.422   5.256  1.00 69.46  ? 202 ARG E CA  1 
ATOM 7837 C C   . ARG G 2 173 ? 51.668 94.761   5.622  1.00 69.67  ? 202 ARG E C   1 
ATOM 7838 O O   . ARG G 2 173 ? 51.312 95.008   6.778  1.00 72.02  ? 202 ARG E O   1 
ATOM 7839 C CB  . ARG G 2 173 ? 51.210 92.421   4.857  1.00 73.67  ? 202 ARG E CB  1 
ATOM 7840 C CG  . ARG G 2 173 ? 51.725 91.264   4.015  1.00 72.98  ? 202 ARG E CG  1 
ATOM 7841 C CD  . ARG G 2 173 ? 50.587 90.439   3.439  1.00 72.49  ? 202 ARG E CD  1 
ATOM 7842 N NE  . ARG G 2 173 ? 51.067 89.472   2.457  1.00 77.90  ? 202 ARG E NE  1 
ATOM 7843 C CZ  . ARG G 2 173 ? 51.180 89.721   1.157  1.00 80.01  ? 202 ARG E CZ  1 
ATOM 7844 N NH1 . ARG G 2 173 ? 51.629 88.780   0.335  1.00 76.20  ? 202 ARG E NH1 1 
ATOM 7845 N NH2 . ARG G 2 173 ? 50.841 90.911   0.677  1.00 80.68  ? 202 ARG E NH2 1 
ATOM 7846 N N   . GLU G 2 174 ? 51.537 95.625   4.619  1.00 69.87  ? 203 GLU E N   1 
ATOM 7847 C CA  . GLU G 2 174 ? 50.948 96.945   4.812  1.00 72.68  ? 203 GLU E CA  1 
ATOM 7848 C C   . GLU G 2 174 ? 50.394 97.487   3.499  1.00 67.52  ? 203 GLU E C   1 
ATOM 7849 O O   . GLU G 2 174 ? 51.152 97.866   2.607  1.00 67.82  ? 203 GLU E O   1 
ATOM 7850 C CB  . GLU G 2 174 ? 51.974 97.910   5.392  1.00 62.25  ? 203 GLU E CB  1 
ATOM 7851 N N   . SER H 3 19  ? 3.357  -29.279  23.056 1.00 52.71  ? 203 SER F N   1 
ATOM 7852 C CA  . SER H 3 19  ? 3.084  -29.197  21.625 1.00 60.47  ? 203 SER F CA  1 
ATOM 7853 C C   . SER H 3 19  ? 4.374  -29.169  20.810 1.00 66.79  ? 203 SER F C   1 
ATOM 7854 O O   . SER H 3 19  ? 5.071  -28.155  20.764 1.00 64.86  ? 203 SER F O   1 
ATOM 7855 C CB  . SER H 3 19  ? 2.238  -27.961  21.308 1.00 56.75  ? 203 SER F CB  1 
ATOM 7856 O OG  . SER H 3 19  ? 2.146  -27.753  19.909 1.00 59.68  ? 203 SER F OG  1 
ATOM 7857 N N   . LEU H 3 20  ? 4.680  -30.298  20.166 1.00 74.60  ? 204 LEU F N   1 
ATOM 7858 C CA  . LEU H 3 20  ? 5.903  -30.404  19.374 1.00 75.83  ? 204 LEU F CA  1 
ATOM 7859 C C   . LEU H 3 20  ? 5.898  -29.412  18.216 1.00 76.92  ? 204 LEU F C   1 
ATOM 7860 O O   . LEU H 3 20  ? 6.948  -28.868  17.847 1.00 76.94  ? 204 LEU F O   1 
ATOM 7861 C CB  . LEU H 3 20  ? 6.066  -31.840  18.869 1.00 67.88  ? 204 LEU F CB  1 
ATOM 7862 C CG  . LEU H 3 20  ? 7.347  -32.265  18.144 1.00 71.93  ? 204 LEU F CG  1 
ATOM 7863 C CD1 . LEU H 3 20  ? 7.256  -32.000  16.648 1.00 69.13  ? 204 LEU F CD1 1 
ATOM 7864 C CD2 . LEU H 3 20  ? 8.561  -31.566  18.742 1.00 76.60  ? 204 LEU F CD2 1 
ATOM 7865 N N   . GLU H 3 21  ? 4.723  -29.167  17.631 1.00 69.11  ? 205 GLU F N   1 
ATOM 7866 C CA  . GLU H 3 21  ? 4.625  -28.247  16.503 1.00 68.66  ? 205 GLU F CA  1 
ATOM 7867 C C   . GLU H 3 21  ? 5.123  -26.859  16.886 1.00 72.33  ? 205 GLU F C   1 
ATOM 7868 O O   . GLU H 3 21  ? 5.895  -26.237  16.147 1.00 68.26  ? 205 GLU F O   1 
ATOM 7869 C CB  . GLU H 3 21  ? 3.179  -28.185  16.012 1.00 71.53  ? 205 GLU F CB  1 
ATOM 7870 C CG  . GLU H 3 21  ? 2.510  -29.542  15.878 1.00 74.90  ? 205 GLU F CG  1 
ATOM 7871 C CD  . GLU H 3 21  ? 1.000  -29.437  15.770 1.00 80.33  ? 205 GLU F CD  1 
ATOM 7872 O OE1 . GLU H 3 21  ? 0.379  -28.826  16.667 1.00 86.05  ? 205 GLU F OE1 1 
ATOM 7873 O OE2 . GLU H 3 21  ? 0.435  -29.964  14.786 1.00 64.52  ? 205 GLU F OE2 1 
ATOM 7874 N N   . ALA H 3 22  ? 4.696  -26.361  18.051 1.00 78.72  ? 206 ALA F N   1 
ATOM 7875 C CA  . ALA H 3 22  ? 5.125  -25.039  18.496 1.00 75.32  ? 206 ALA F CA  1 
ATOM 7876 C C   . ALA H 3 22  ? 6.627  -25.004  18.744 1.00 70.28  ? 206 ALA F C   1 
ATOM 7877 O O   . ALA H 3 22  ? 7.289  -24.006  18.440 1.00 65.10  ? 206 ALA F O   1 
ATOM 7878 C CB  . ALA H 3 22  ? 4.364  -24.631  19.757 1.00 70.80  ? 206 ALA F CB  1 
ATOM 7879 N N   . SER H 3 23  ? 7.182  -26.084  19.300 1.00 71.16  ? 207 SER F N   1 
ATOM 7880 C CA  . SER H 3 23  ? 8.617  -26.128  19.561 1.00 72.31  ? 207 SER F CA  1 
ATOM 7881 C C   . SER H 3 23  ? 9.407  -26.063  18.259 1.00 72.56  ? 207 SER F C   1 
ATOM 7882 O O   . SER H 3 23  ? 10.370 -25.296  18.138 1.00 71.75  ? 207 SER F O   1 
ATOM 7883 C CB  . SER H 3 23  ? 8.968  -27.393  20.348 1.00 74.82  ? 207 SER F CB  1 
ATOM 7884 O OG  . SER H 3 23  ? 10.367 -27.503  20.559 1.00 71.94  ? 207 SER F OG  1 
ATOM 7885 N N   . VAL H 3 24  ? 9.009  -26.862  17.266 1.00 72.20  ? 208 VAL F N   1 
ATOM 7886 C CA  . VAL H 3 24  ? 9.699  -26.816  15.982 1.00 70.04  ? 208 VAL F CA  1 
ATOM 7887 C C   . VAL H 3 24  ? 9.489  -25.467  15.302 1.00 66.56  ? 208 VAL F C   1 
ATOM 7888 O O   . VAL H 3 24  ? 10.364 -24.990  14.569 1.00 64.17  ? 208 VAL F O   1 
ATOM 7889 C CB  . VAL H 3 24  ? 9.235  -27.984  15.092 1.00 68.26  ? 208 VAL F CB  1 
ATOM 7890 C CG1 . VAL H 3 24  ? 9.941  -27.951  13.744 1.00 60.15  ? 208 VAL F CG1 1 
ATOM 7891 C CG2 . VAL H 3 24  ? 9.489  -29.306  15.793 1.00 70.88  ? 208 VAL F CG2 1 
ATOM 7892 N N   . ALA H 3 25  ? 8.348  -24.819  15.544 1.00 65.29  ? 209 ALA F N   1 
ATOM 7893 C CA  . ALA H 3 25  ? 8.113  -23.502  14.962 1.00 62.05  ? 209 ALA F CA  1 
ATOM 7894 C C   . ALA H 3 25  ? 9.048  -22.459  15.562 1.00 63.56  ? 209 ALA F C   1 
ATOM 7895 O O   . ALA H 3 25  ? 9.770  -21.767  14.832 1.00 61.61  ? 209 ALA F O   1 
ATOM 7896 C CB  . ALA H 3 25  ? 6.653  -23.096  15.159 1.00 62.31  ? 209 ALA F CB  1 
ATOM 7897 N N   . GLU H 3 26  ? 9.054  -22.340  16.894 1.00 65.27  ? 210 GLU F N   1 
ATOM 7898 C CA  . GLU H 3 26  ? 9.940  -21.390  17.562 1.00 60.97  ? 210 GLU F CA  1 
ATOM 7899 C C   . GLU H 3 26  ? 11.396 -21.666  17.216 1.00 56.56  ? 210 GLU F C   1 
ATOM 7900 O O   . GLU H 3 26  ? 12.196 -20.736  17.059 1.00 60.81  ? 210 GLU F O   1 
ATOM 7901 C CB  . GLU H 3 26  ? 9.739  -21.449  19.075 1.00 52.77  ? 210 GLU F CB  1 
ATOM 7902 C CG  . GLU H 3 26  ? 8.332  -21.144  19.556 1.00 65.33  ? 210 GLU F CG  1 
ATOM 7903 C CD  . GLU H 3 26  ? 8.165  -21.401  21.046 1.00 73.52  ? 210 GLU F CD  1 
ATOM 7904 O OE1 . GLU H 3 26  ? 7.505  -22.398  21.412 1.00 75.58  ? 210 GLU F OE1 1 
ATOM 7905 O OE2 . GLU H 3 26  ? 8.706  -20.614  21.851 1.00 70.73  ? 210 GLU F OE2 1 
ATOM 7906 N N   . MET H 3 27  ? 11.759 -22.942  17.106 1.00 59.74  ? 211 MET F N   1 
ATOM 7907 C CA  . MET H 3 27  ? 13.119 -23.291  16.718 1.00 62.39  ? 211 MET F CA  1 
ATOM 7908 C C   . MET H 3 27  ? 13.401 -22.869  15.280 1.00 60.40  ? 211 MET F C   1 
ATOM 7909 O O   . MET H 3 27  ? 14.521 -22.443  14.961 1.00 60.53  ? 211 MET F O   1 
ATOM 7910 C CB  . MET H 3 27  ? 13.324 -24.793  16.916 1.00 62.96  ? 211 MET F CB  1 
ATOM 7911 C CG  . MET H 3 27  ? 14.627 -25.354  16.403 1.00 60.05  ? 211 MET F CG  1 
ATOM 7912 S SD  . MET H 3 27  ? 14.651 -27.137  16.660 1.00 66.97  ? 211 MET F SD  1 
ATOM 7913 C CE  . MET H 3 27  ? 14.907 -27.205  18.431 1.00 62.38  ? 211 MET F CE  1 
ATOM 7914 N N   . LYS H 3 28  ? 12.389 -22.946  14.410 1.00 55.21  ? 212 LYS F N   1 
ATOM 7915 C CA  . LYS H 3 28  ? 12.546 -22.493  13.034 1.00 57.88  ? 212 LYS F CA  1 
ATOM 7916 C C   . LYS H 3 28  ? 12.559 -20.974  12.928 1.00 70.33  ? 212 LYS F C   1 
ATOM 7917 O O   . LYS H 3 28  ? 12.959 -20.438  11.889 1.00 73.49  ? 212 LYS F O   1 
ATOM 7918 C CB  . LYS H 3 28  ? 11.437 -23.067  12.153 1.00 63.34  ? 212 LYS F CB  1 
ATOM 7919 C CG  . LYS H 3 28  ? 11.952 -24.040  11.107 1.00 72.54  ? 212 LYS F CG  1 
ATOM 7920 C CD  . LYS H 3 28  ? 13.018 -23.392  10.239 1.00 62.19  ? 212 LYS F CD  1 
ATOM 7921 C CE  . LYS H 3 28  ? 13.650 -24.393  9.286  1.00 61.95  ? 212 LYS F CE  1 
ATOM 7922 N NZ  . LYS H 3 28  ? 14.771 -23.785  8.516  1.00 74.70  ? 212 LYS F NZ  1 
ATOM 7923 N N   . GLU H 3 29  ? 12.112 -20.270  13.968 1.00 70.21  ? 213 GLU F N   1 
ATOM 7924 C CA  . GLU H 3 29  ? 12.330 -18.830  14.031 1.00 62.08  ? 213 GLU F CA  1 
ATOM 7925 C C   . GLU H 3 29  ? 13.745 -18.526  14.507 1.00 57.19  ? 213 GLU F C   1 
ATOM 7926 O O   . GLU H 3 29  ? 14.452 -17.705  13.908 1.00 61.34  ? 213 GLU F O   1 
ATOM 7927 C CB  . GLU H 3 29  ? 11.297 -18.181  14.957 1.00 61.16  ? 213 GLU F CB  1 
ATOM 7928 C CG  . GLU H 3 29  ? 9.922  -17.991  14.331 1.00 69.44  ? 213 GLU F CG  1 
ATOM 7929 C CD  . GLU H 3 29  ? 9.869  -16.816  13.371 1.00 77.88  ? 213 GLU F CD  1 
ATOM 7930 O OE1 . GLU H 3 29  ? 10.711 -15.902  13.495 1.00 74.35  ? 213 GLU F OE1 1 
ATOM 7931 O OE2 . GLU H 3 29  ? 8.981  -16.808  12.491 1.00 81.33  ? 213 GLU F OE2 1 
ATOM 7932 N N   . TYR H 3 30  ? 14.178 -19.207  15.571 1.00 54.71  ? 214 TYR F N   1 
ATOM 7933 C CA  . TYR H 3 30  ? 15.501 -18.955  16.133 1.00 52.48  ? 214 TYR F CA  1 
ATOM 7934 C C   . TYR H 3 30  ? 16.603 -19.237  15.119 1.00 56.21  ? 214 TYR F C   1 
ATOM 7935 O O   . TYR H 3 30  ? 17.603 -18.512  15.072 1.00 58.05  ? 214 TYR F O   1 
ATOM 7936 C CB  . TYR H 3 30  ? 15.710 -19.801  17.389 1.00 53.78  ? 214 TYR F CB  1 
ATOM 7937 C CG  . TYR H 3 30  ? 15.128 -19.217  18.657 1.00 54.67  ? 214 TYR F CG  1 
ATOM 7938 C CD1 . TYR H 3 30  ? 13.983 -18.429  18.627 1.00 55.93  ? 214 TYR F CD1 1 
ATOM 7939 C CD2 . TYR H 3 30  ? 15.722 -19.463  19.890 1.00 50.32  ? 214 TYR F CD2 1 
ATOM 7940 C CE1 . TYR H 3 30  ? 13.448 -17.900  19.789 1.00 55.14  ? 214 TYR F CE1 1 
ATOM 7941 C CE2 . TYR H 3 30  ? 15.196 -18.939  21.055 1.00 47.37  ? 214 TYR F CE2 1 
ATOM 7942 C CZ  . TYR H 3 30  ? 14.060 -18.159  21.000 1.00 54.64  ? 214 TYR F CZ  1 
ATOM 7943 O OH  . TYR H 3 30  ? 13.535 -17.638  22.161 1.00 57.69  ? 214 TYR F OH  1 
ATOM 7944 N N   . ILE H 3 31  ? 16.449 -20.290  14.306 1.00 58.01  ? 215 ILE F N   1 
ATOM 7945 C CA  . ILE H 3 31  ? 17.482 -20.617  13.320 1.00 58.58  ? 215 ILE F CA  1 
ATOM 7946 C C   . ILE H 3 31  ? 17.746 -19.427  12.400 1.00 58.36  ? 215 ILE F C   1 
ATOM 7947 O O   . ILE H 3 31  ? 18.902 -19.075  12.124 1.00 58.06  ? 215 ILE F O   1 
ATOM 7948 C CB  . ILE H 3 31  ? 17.096 -21.888  12.529 1.00 60.56  ? 215 ILE F CB  1 
ATOM 7949 C CG1 . ILE H 3 31  ? 18.210 -22.306  11.565 1.00 57.79  ? 215 ILE F CG1 1 
ATOM 7950 C CG2 . ILE H 3 31  ? 15.801 -21.706  11.768 1.00 64.17  ? 215 ILE F CG2 1 
ATOM 7951 C CD1 . ILE H 3 31  ? 19.478 -22.754  12.228 1.00 54.10  ? 215 ILE F CD1 1 
ATOM 7952 N N   . THR H 3 32  ? 16.684 -18.759  11.954 1.00 54.87  ? 216 THR F N   1 
ATOM 7953 C CA  . THR H 3 32  ? 16.842 -17.641  11.034 1.00 61.91  ? 216 THR F CA  1 
ATOM 7954 C C   . THR H 3 32  ? 17.279 -16.370  11.757 1.00 57.07  ? 216 THR F C   1 
ATOM 7955 O O   . THR H 3 32  ? 18.084 -15.595  11.223 1.00 51.40  ? 216 THR F O   1 
ATOM 7956 C CB  . THR H 3 32  ? 15.537 -17.425  10.271 1.00 71.68  ? 216 THR F CB  1 
ATOM 7957 O OG1 . THR H 3 32  ? 14.433 -17.541  11.178 1.00 70.74  ? 216 THR F OG1 1 
ATOM 7958 C CG2 . THR H 3 32  ? 15.389 -18.478  9.181  1.00 68.22  ? 216 THR F CG2 1 
ATOM 7959 N N   . LYS H 3 33  ? 16.769 -16.145  12.973 1.00 53.98  ? 217 LYS F N   1 
ATOM 7960 C CA  . LYS H 3 33  ? 17.219 -15.008  13.774 1.00 51.26  ? 217 LYS F CA  1 
ATOM 7961 C C   . LYS H 3 33  ? 18.727 -15.057  13.996 1.00 56.07  ? 217 LYS F C   1 
ATOM 7962 O O   . LYS H 3 33  ? 19.447 -14.088  13.719 1.00 59.68  ? 217 LYS F O   1 
ATOM 7963 C CB  . LYS H 3 33  ? 16.484 -14.997  15.115 1.00 49.42  ? 217 LYS F CB  1 
ATOM 7964 C CG  . LYS H 3 33  ? 16.820 -13.817  16.012 1.00 45.50  ? 217 LYS F CG  1 
ATOM 7965 C CD  . LYS H 3 33  ? 15.564 -13.203  16.609 1.00 46.20  ? 217 LYS F CD  1 
ATOM 7966 C CE  . LYS H 3 33  ? 14.831 -14.198  17.496 1.00 38.03  ? 217 LYS F CE  1 
ATOM 7967 N NZ  . LYS H 3 33  ? 15.540 -14.427  18.785 1.00 37.98  ? 217 LYS F NZ  1 
ATOM 7968 N N   . PHE H 3 34  ? 19.223 -16.184  14.505 1.00 54.53  ? 218 PHE F N   1 
ATOM 7969 C CA  . PHE H 3 34  ? 20.658 -16.340  14.692 1.00 56.75  ? 218 PHE F CA  1 
ATOM 7970 C C   . PHE H 3 34  ? 21.406 -16.372  13.366 1.00 58.06  ? 218 PHE F C   1 
ATOM 7971 O O   . PHE H 3 34  ? 22.592 -16.025  13.333 1.00 54.70  ? 218 PHE F O   1 
ATOM 7972 C CB  . PHE H 3 34  ? 20.936 -17.596  15.521 1.00 56.27  ? 218 PHE F CB  1 
ATOM 7973 C CG  . PHE H 3 34  ? 20.436 -17.503  16.940 1.00 59.52  ? 218 PHE F CG  1 
ATOM 7974 C CD1 . PHE H 3 34  ? 20.516 -16.306  17.637 1.00 64.49  ? 218 PHE F CD1 1 
ATOM 7975 C CD2 . PHE H 3 34  ? 19.851 -18.593  17.563 1.00 57.39  ? 218 PHE F CD2 1 
ATOM 7976 C CE1 . PHE H 3 34  ? 20.051 -16.208  18.939 1.00 63.05  ? 218 PHE F CE1 1 
ATOM 7977 C CE2 . PHE H 3 34  ? 19.379 -18.500  18.864 1.00 53.00  ? 218 PHE F CE2 1 
ATOM 7978 C CZ  . PHE H 3 34  ? 19.481 -17.307  19.552 1.00 56.76  ? 218 PHE F CZ  1 
ATOM 7979 N N   . SER H 3 35  ? 20.742 -16.765  12.274 1.00 56.57  ? 219 SER F N   1 
ATOM 7980 C CA  . SER H 3 35  ? 21.364 -16.637  10.960 1.00 55.01  ? 219 SER F CA  1 
ATOM 7981 C C   . SER H 3 35  ? 21.686 -15.179  10.652 1.00 57.06  ? 219 SER F C   1 
ATOM 7982 O O   . SER H 3 35  ? 22.831 -14.839  10.320 1.00 57.05  ? 219 SER F O   1 
ATOM 7983 C CB  . SER H 3 35  ? 20.445 -17.218  9.886  1.00 55.98  ? 219 SER F CB  1 
ATOM 7984 O OG  . SER H 3 35  ? 20.417 -18.631  9.946  1.00 61.05  ? 219 SER F OG  1 
ATOM 7985 N N   . LEU H 3 36  ? 20.686 -14.296  10.777 1.00 61.20  ? 220 LEU F N   1 
ATOM 7986 C CA  . LEU H 3 36  ? 20.927 -12.880  10.510 1.00 58.27  ? 220 LEU F CA  1 
ATOM 7987 C C   . LEU H 3 36  ? 21.909 -12.277  11.508 1.00 53.71  ? 220 LEU F C   1 
ATOM 7988 O O   . LEU H 3 36  ? 22.680 -11.381  11.145 1.00 51.91  ? 220 LEU F O   1 
ATOM 7989 C CB  . LEU H 3 36  ? 19.610 -12.089  10.488 1.00 50.85  ? 220 LEU F CB  1 
ATOM 7990 C CG  . LEU H 3 36  ? 18.674 -11.906  11.691 1.00 53.48  ? 220 LEU F CG  1 
ATOM 7991 C CD1 . LEU H 3 36  ? 19.176 -10.865  12.691 1.00 47.47  ? 220 LEU F CD1 1 
ATOM 7992 C CD2 . LEU H 3 36  ? 17.272 -11.550  11.214 1.00 48.42  ? 220 LEU F CD2 1 
ATOM 7993 N N   . GLU H 3 37  ? 21.899 -12.741  12.764 1.00 49.30  ? 221 GLU F N   1 
ATOM 7994 C CA  . GLU H 3 37  ? 22.862 -12.199  13.721 1.00 46.84  ? 221 GLU F CA  1 
ATOM 7995 C C   . GLU H 3 37  ? 24.288 -12.609  13.366 1.00 47.23  ? 221 GLU F C   1 
ATOM 7996 O O   . GLU H 3 37  ? 25.203 -11.781  13.420 1.00 44.39  ? 221 GLU F O   1 
ATOM 7997 C CB  . GLU H 3 37  ? 22.515 -12.615  15.150 1.00 50.70  ? 221 GLU F CB  1 
ATOM 7998 C CG  . GLU H 3 37  ? 23.178 -11.705  16.189 1.00 49.29  ? 221 GLU F CG  1 
ATOM 7999 C CD  . GLU H 3 37  ? 22.950 -12.140  17.625 1.00 51.84  ? 221 GLU F CD  1 
ATOM 8000 O OE1 . GLU H 3 37  ? 23.907 -12.052  18.426 1.00 39.28  ? 221 GLU F OE1 1 
ATOM 8001 O OE2 . GLU H 3 37  ? 21.816 -12.552  17.956 1.00 56.83  ? 221 GLU F OE2 1 
ATOM 8002 N N   . ARG H 3 38  ? 24.503 -13.878  13.007 1.00 54.22  ? 222 ARG F N   1 
ATOM 8003 C CA  . ARG H 3 38  ? 25.821 -14.289  12.528 1.00 54.75  ? 222 ARG F CA  1 
ATOM 8004 C C   . ARG H 3 38  ? 26.246 -13.450  11.330 1.00 51.73  ? 222 ARG F C   1 
ATOM 8005 O O   . ARG H 3 38  ? 27.401 -13.003  11.247 1.00 50.69  ? 222 ARG F O   1 
ATOM 8006 C CB  . ARG H 3 38  ? 25.824 -15.783  12.187 1.00 59.84  ? 222 ARG F CB  1 
ATOM 8007 C CG  . ARG H 3 38  ? 27.077 -16.258  11.454 1.00 62.48  ? 222 ARG F CG  1 
ATOM 8008 C CD  . ARG H 3 38  ? 27.234 -17.781  11.497 1.00 72.33  ? 222 ARG F CD  1 
ATOM 8009 N NE  . ARG H 3 38  ? 26.207 -18.516  10.760 1.00 85.05  ? 222 ARG F NE  1 
ATOM 8010 C CZ  . ARG H 3 38  ? 26.161 -19.845  10.673 1.00 74.74  ? 222 ARG F CZ  1 
ATOM 8011 N NH1 . ARG H 3 38  ? 25.195 -20.438  9.984  1.00 71.09  ? 222 ARG F NH1 1 
ATOM 8012 N NH2 . ARG H 3 38  ? 27.083 -20.586  11.277 1.00 59.94  ? 222 ARG F NH2 1 
ATOM 8013 N N   . GLN H 3 39  ? 25.319 -13.222  10.396 1.00 52.31  ? 223 GLN F N   1 
ATOM 8014 C CA  . GLN H 3 39  ? 25.598 -12.353  9.257  1.00 53.36  ? 223 GLN F CA  1 
ATOM 8015 C C   . GLN H 3 39  ? 26.075 -10.976  9.712  1.00 56.41  ? 223 GLN F C   1 
ATOM 8016 O O   . GLN H 3 39  ? 27.099 -10.469  9.237  1.00 60.64  ? 223 GLN F O   1 
ATOM 8017 C CB  . GLN H 3 39  ? 24.338 -12.227  8.398  1.00 62.12  ? 223 GLN F CB  1 
ATOM 8018 C CG  . GLN H 3 39  ? 24.500 -11.386  7.143  1.00 75.00  ? 223 GLN F CG  1 
ATOM 8019 C CD  . GLN H 3 39  ? 23.276 -11.436  6.247  1.00 70.95  ? 223 GLN F CD  1 
ATOM 8020 O OE1 . GLN H 3 39  ? 23.079 -12.394  5.500  1.00 77.95  ? 223 GLN F OE1 1 
ATOM 8021 N NE2 . GLN H 3 39  ? 22.444 -10.403  6.322  1.00 76.44  ? 223 GLN F NE2 1 
ATOM 8022 N N   . THR H 3 40  ? 25.355 -10.368  10.661 1.00 52.03  ? 224 THR F N   1 
ATOM 8023 C CA  . THR H 3 40  ? 25.734 -9.044   11.145 1.00 46.06  ? 224 THR F CA  1 
ATOM 8024 C C   . THR H 3 40  ? 27.096 -9.065   11.825 1.00 39.25  ? 224 THR F C   1 
ATOM 8025 O O   . THR H 3 40  ? 27.851 -8.095   11.725 1.00 37.66  ? 224 THR F O   1 
ATOM 8026 C CB  . THR H 3 40  ? 24.670 -8.506   12.103 1.00 39.74  ? 224 THR F CB  1 
ATOM 8027 O OG1 . THR H 3 40  ? 23.370 -8.743   11.553 1.00 46.56  ? 224 THR F OG1 1 
ATOM 8028 C CG2 . THR H 3 40  ? 24.845 -7.017   12.298 1.00 42.24  ? 224 THR F CG2 1 
ATOM 8029 N N   . TRP H 3 41  ? 27.424 -10.154  12.523 1.00 48.23  ? 225 TRP F N   1 
ATOM 8030 C CA  . TRP H 3 41  ? 28.719 -10.252  13.190 1.00 45.88  ? 225 TRP F CA  1 
ATOM 8031 C C   . TRP H 3 41  ? 29.857 -10.306  12.178 1.00 42.17  ? 225 TRP F C   1 
ATOM 8032 O O   . TRP H 3 41  ? 30.857 -9.589   12.312 1.00 40.19  ? 225 TRP F O   1 
ATOM 8033 C CB  . TRP H 3 41  ? 28.750 -11.483  14.098 1.00 41.86  ? 225 TRP F CB  1 
ATOM 8034 C CG  . TRP H 3 41  ? 28.106 -11.275  15.439 1.00 39.39  ? 225 TRP F CG  1 
ATOM 8035 C CD1 . TRP H 3 41  ? 26.842 -11.635  15.810 1.00 40.56  ? 225 TRP F CD1 1 
ATOM 8036 C CD2 . TRP H 3 41  ? 28.703 -10.670  16.592 1.00 35.47  ? 225 TRP F CD2 1 
ATOM 8037 N NE1 . TRP H 3 41  ? 26.613 -11.285  17.119 1.00 38.63  ? 225 TRP F NE1 1 
ATOM 8038 C CE2 . TRP H 3 41  ? 27.741 -10.691  17.621 1.00 35.17  ? 225 TRP F CE2 1 
ATOM 8039 C CE3 . TRP H 3 41  ? 29.956 -10.111  16.852 1.00 31.06  ? 225 TRP F CE3 1 
ATOM 8040 C CZ2 . TRP H 3 41  ? 27.995 -10.175  18.889 1.00 29.29  ? 225 TRP F CZ2 1 
ATOM 8041 C CZ3 . TRP H 3 41  ? 30.204 -9.602   18.111 1.00 30.32  ? 225 TRP F CZ3 1 
ATOM 8042 C CH2 . TRP H 3 41  ? 29.230 -9.637   19.113 1.00 27.49  ? 225 TRP F CH2 1 
ATOM 8043 N N   . ASP H 3 42  ? 29.728 -11.154  11.155 1.00 46.68  ? 226 ASP F N   1 
ATOM 8044 C CA  . ASP H 3 42  ? 30.785 -11.247  10.152 1.00 50.68  ? 226 ASP F CA  1 
ATOM 8045 C C   . ASP H 3 42  ? 30.930 -9.930   9.396  1.00 48.43  ? 226 ASP F C   1 
ATOM 8046 O O   . ASP H 3 42  ? 32.043 -9.409   9.224  1.00 47.10  ? 226 ASP F O   1 
ATOM 8047 C CB  . ASP H 3 42  ? 30.486 -12.399  9.192  1.00 57.83  ? 226 ASP F CB  1 
ATOM 8048 C CG  . ASP H 3 42  ? 30.512 -13.755  9.879  1.00 61.45  ? 226 ASP F CG  1 
ATOM 8049 O OD1 . ASP H 3 42  ? 31.260 -13.915  10.868 1.00 60.25  ? 226 ASP F OD1 1 
ATOM 8050 O OD2 . ASP H 3 42  ? 29.782 -14.664  9.429  1.00 69.22  ? 226 ASP F OD2 1 
ATOM 8051 N N   . GLN H 3 43  ? 29.799 -9.374   8.951  1.00 50.61  ? 227 GLN F N   1 
ATOM 8052 C CA  . GLN H 3 43  ? 29.791 -8.092   8.254  1.00 50.03  ? 227 GLN F CA  1 
ATOM 8053 C C   . GLN H 3 43  ? 30.460 -7.002   9.084  1.00 48.18  ? 227 GLN F C   1 
ATOM 8054 O O   . GLN H 3 43  ? 31.321 -6.264   8.589  1.00 45.97  ? 227 GLN F O   1 
ATOM 8055 C CB  . GLN H 3 43  ? 28.347 -7.712   7.928  1.00 46.04  ? 227 GLN F CB  1 
ATOM 8056 C CG  . GLN H 3 43  ? 28.186 -6.498   7.049  1.00 66.28  ? 227 GLN F CG  1 
ATOM 8057 C CD  . GLN H 3 43  ? 26.768 -6.359   6.540  1.00 89.54  ? 227 GLN F CD  1 
ATOM 8058 O OE1 . GLN H 3 43  ? 25.819 -6.800   7.192  1.00 83.85  ? 227 GLN F OE1 1 
ATOM 8059 N NE2 . GLN H 3 43  ? 26.612 -5.737   5.377  1.00 101.39 ? 227 GLN F NE2 1 
ATOM 8060 N N   . LEU H 3 44  ? 30.069 -6.889   10.353 1.00 45.92  ? 228 LEU F N   1 
ATOM 8061 C CA  . LEU H 3 44  ? 30.615 -5.855   11.225 1.00 38.35  ? 228 LEU F CA  1 
ATOM 8062 C C   . LEU H 3 44  ? 32.114 -6.044   11.428 1.00 37.49  ? 228 LEU F C   1 
ATOM 8063 O O   . LEU H 3 44  ? 32.891 -5.081   11.349 1.00 45.56  ? 228 LEU F O   1 
ATOM 8064 C CB  . LEU H 3 44  ? 29.878 -5.888   12.562 1.00 33.59  ? 228 LEU F CB  1 
ATOM 8065 C CG  . LEU H 3 44  ? 29.464 -4.565   13.196 1.00 38.61  ? 228 LEU F CG  1 
ATOM 8066 C CD1 . LEU H 3 44  ? 28.712 -3.724   12.174 1.00 45.28  ? 228 LEU F CD1 1 
ATOM 8067 C CD2 . LEU H 3 44  ? 28.607 -4.817   14.426 1.00 36.65  ? 228 LEU F CD2 1 
ATOM 8068 N N   . LEU H 3 45  ? 32.541 -7.284   11.673 1.00 37.80  ? 229 LEU F N   1 
ATOM 8069 C CA  . LEU H 3 45  ? 33.954 -7.545   11.919 1.00 40.06  ? 229 LEU F CA  1 
ATOM 8070 C C   . LEU H 3 45  ? 34.800 -7.170   10.711 1.00 42.56  ? 229 LEU F C   1 
ATOM 8071 O O   . LEU H 3 45  ? 35.821 -6.485   10.845 1.00 46.13  ? 229 LEU F O   1 
ATOM 8072 C CB  . LEU H 3 45  ? 34.162 -9.013   12.293 1.00 42.68  ? 229 LEU F CB  1 
ATOM 8073 C CG  . LEU H 3 45  ? 35.619 -9.469   12.359 1.00 38.42  ? 229 LEU F CG  1 
ATOM 8074 C CD1 . LEU H 3 45  ? 35.877 -10.236  13.637 1.00 38.19  ? 229 LEU F CD1 1 
ATOM 8075 C CD2 . LEU H 3 45  ? 35.933 -10.337  11.153 1.00 46.40  ? 229 LEU F CD2 1 
ATOM 8076 N N   . LEU H 3 46  ? 34.393 -7.605   9.515  1.00 46.14  ? 230 LEU F N   1 
ATOM 8077 C CA  . LEU H 3 46  ? 35.164 -7.221   8.337  1.00 51.72  ? 230 LEU F CA  1 
ATOM 8078 C C   . LEU H 3 46  ? 35.084 -5.717   8.082  1.00 55.48  ? 230 LEU F C   1 
ATOM 8079 O O   . LEU H 3 46  ? 36.033 -5.130   7.546  1.00 56.14  ? 230 LEU F O   1 
ATOM 8080 C CB  . LEU H 3 46  ? 34.706 -8.022   7.113  1.00 58.11  ? 230 LEU F CB  1 
ATOM 8081 C CG  . LEU H 3 46  ? 33.282 -7.955   6.549  1.00 57.08  ? 230 LEU F CG  1 
ATOM 8082 C CD1 . LEU H 3 46  ? 33.046 -6.701   5.709  1.00 55.23  ? 230 LEU F CD1 1 
ATOM 8083 C CD2 . LEU H 3 46  ? 32.985 -9.212   5.740  1.00 56.13  ? 230 LEU F CD2 1 
ATOM 8084 N N   . HIS H 3 47  ? 33.975 -5.080   8.472  1.00 55.35  ? 231 HIS F N   1 
ATOM 8085 C CA  . HIS H 3 47  ? 33.868 -3.625   8.395  1.00 52.36  ? 231 HIS F CA  1 
ATOM 8086 C C   . HIS H 3 47  ? 34.990 -2.950   9.177  1.00 46.77  ? 231 HIS F C   1 
ATOM 8087 O O   . HIS H 3 47  ? 35.799 -2.203   8.612  1.00 52.55  ? 231 HIS F O   1 
ATOM 8088 C CB  . HIS H 3 47  ? 32.493 -3.177   8.905  1.00 50.90  ? 231 HIS F CB  1 
ATOM 8089 C CG  . HIS H 3 47  ? 32.321 -1.691   8.989  1.00 49.99  ? 231 HIS F CG  1 
ATOM 8090 N ND1 . HIS H 3 47  ? 32.934 -0.921   9.955  1.00 44.44  ? 231 HIS F ND1 1 
ATOM 8091 C CD2 . HIS H 3 47  ? 31.592 -0.834   8.235  1.00 50.59  ? 231 HIS F CD2 1 
ATOM 8092 C CE1 . HIS H 3 47  ? 32.596 0.344    9.788  1.00 44.25  ? 231 HIS F CE1 1 
ATOM 8093 N NE2 . HIS H 3 47  ? 31.782 0.424    8.751  1.00 50.97  ? 231 HIS F NE2 1 
ATOM 8094 N N   . TYR H 3 48  ? 35.054 -3.202   10.489 1.00 39.92  ? 232 TYR F N   1 
ATOM 8095 C CA  . TYR H 3 48  ? 36.108 -2.581   11.285 1.00 40.51  ? 232 TYR F CA  1 
ATOM 8096 C C   . TYR H 3 48  ? 37.492 -3.017   10.817 1.00 42.07  ? 232 TYR F C   1 
ATOM 8097 O O   . TYR H 3 48  ? 38.464 -2.262   10.958 1.00 50.48  ? 232 TYR F O   1 
ATOM 8098 C CB  . TYR H 3 48  ? 35.915 -2.903   12.767 1.00 37.60  ? 232 TYR F CB  1 
ATOM 8099 C CG  . TYR H 3 48  ? 34.700 -2.244   13.393 1.00 42.01  ? 232 TYR F CG  1 
ATOM 8100 C CD1 . TYR H 3 48  ? 34.796 -1.004   14.014 1.00 42.32  ? 232 TYR F CD1 1 
ATOM 8101 C CD2 . TYR H 3 48  ? 33.459 -2.863   13.366 1.00 39.18  ? 232 TYR F CD2 1 
ATOM 8102 C CE1 . TYR H 3 48  ? 33.686 -0.401   14.593 1.00 37.83  ? 232 TYR F CE1 1 
ATOM 8103 C CE2 . TYR H 3 48  ? 32.346 -2.270   13.939 1.00 39.10  ? 232 TYR F CE2 1 
ATOM 8104 C CZ  . TYR H 3 48  ? 32.463 -1.040   14.551 1.00 39.80  ? 232 TYR F CZ  1 
ATOM 8105 O OH  . TYR H 3 48  ? 31.349 -0.457   15.119 1.00 36.60  ? 232 TYR F OH  1 
ATOM 8106 N N   . GLN H 3 49  ? 37.597 -4.212   10.233 1.00 45.27  ? 233 GLN F N   1 
ATOM 8107 C CA  . GLN H 3 49  ? 38.881 -4.689   9.728  1.00 52.37  ? 233 GLN F CA  1 
ATOM 8108 C C   . GLN H 3 49  ? 39.381 -3.824   8.575  1.00 56.68  ? 233 GLN F C   1 
ATOM 8109 O O   . GLN H 3 49  ? 40.494 -3.284   8.622  1.00 62.52  ? 233 GLN F O   1 
ATOM 8110 C CB  . GLN H 3 49  ? 38.762 -6.154   9.302  1.00 55.91  ? 233 GLN F CB  1 
ATOM 8111 C CG  . GLN H 3 49  ? 38.858 -7.146   10.453 1.00 50.78  ? 233 GLN F CG  1 
ATOM 8112 C CD  . GLN H 3 49  ? 38.698 -8.584   10.002 1.00 53.06  ? 233 GLN F CD  1 
ATOM 8113 O OE1 . GLN H 3 49  ? 38.127 -8.857   8.944  1.00 50.41  ? 233 GLN F OE1 1 
ATOM 8114 N NE2 . GLN H 3 49  ? 39.200 -9.513   10.806 1.00 55.52  ? 233 GLN F NE2 1 
ATOM 8115 N N   . GLN H 3 50  ? 38.572 -3.686   7.518  1.00 56.52  ? 234 GLN F N   1 
ATOM 8116 C CA  . GLN H 3 50  ? 39.007 -2.895   6.368  1.00 59.87  ? 234 GLN F CA  1 
ATOM 8117 C C   . GLN H 3 50  ? 39.072 -1.407   6.696  1.00 60.29  ? 234 GLN F C   1 
ATOM 8118 O O   . GLN H 3 50  ? 39.837 -0.667   6.062  1.00 57.25  ? 234 GLN F O   1 
ATOM 8119 C CB  . GLN H 3 50  ? 38.088 -3.152   5.173  1.00 52.94  ? 234 GLN F CB  1 
ATOM 8120 C CG  . GLN H 3 50  ? 36.629 -2.804   5.409  1.00 59.73  ? 234 GLN F CG  1 
ATOM 8121 C CD  . GLN H 3 50  ? 35.707 -3.421   4.371  1.00 64.79  ? 234 GLN F CD  1 
ATOM 8122 O OE1 . GLN H 3 50  ? 36.072 -4.378   3.687  1.00 62.99  ? 234 GLN F OE1 1 
ATOM 8123 N NE2 . GLN H 3 50  ? 34.502 -2.878   4.253  1.00 72.24  ? 234 GLN F NE2 1 
ATOM 8124 N N   . GLU H 3 51  ? 38.294 -0.949   7.679  1.00 56.55  ? 235 GLU F N   1 
ATOM 8125 C CA  . GLU H 3 51  ? 38.472 0.412    8.173  1.00 53.44  ? 235 GLU F CA  1 
ATOM 8126 C C   . GLU H 3 51  ? 39.865 0.598    8.761  1.00 57.03  ? 235 GLU F C   1 
ATOM 8127 O O   . GLU H 3 51  ? 40.580 1.544    8.410  1.00 63.73  ? 235 GLU F O   1 
ATOM 8128 C CB  . GLU H 3 51  ? 37.406 0.742    9.216  1.00 50.27  ? 235 GLU F CB  1 
ATOM 8129 C CG  . GLU H 3 51  ? 37.531 2.145    9.787  1.00 56.82  ? 235 GLU F CG  1 
ATOM 8130 C CD  . GLU H 3 51  ? 36.978 2.251    11.192 1.00 56.24  ? 235 GLU F CD  1 
ATOM 8131 O OE1 . GLU H 3 51  ? 37.304 1.371    12.019 1.00 51.65  ? 235 GLU F OE1 1 
ATOM 8132 O OE2 . GLU H 3 51  ? 36.223 3.210    11.468 1.00 48.28  ? 235 GLU F OE2 1 
ATOM 8133 N N   . ALA H 3 52  ? 40.274 -0.309   9.654  1.00 55.62  ? 236 ALA F N   1 
ATOM 8134 C CA  . ALA H 3 52  ? 41.611 -0.215   10.234 1.00 58.70  ? 236 ALA F CA  1 
ATOM 8135 C C   . ALA H 3 52  ? 42.687 -0.296   9.161  1.00 61.76  ? 236 ALA F C   1 
ATOM 8136 O O   . ALA H 3 52  ? 43.663 0.466    9.188  1.00 65.94  ? 236 ALA F O   1 
ATOM 8137 C CB  . ALA H 3 52  ? 41.814 -1.318   11.272 1.00 57.30  ? 236 ALA F CB  1 
ATOM 8138 N N   . LYS H 3 53  ? 42.520 -1.209   8.204  1.00 63.14  ? 237 LYS F N   1 
ATOM 8139 C CA  . LYS H 3 53  ? 43.508 -1.365   7.143  1.00 71.51  ? 237 LYS F CA  1 
ATOM 8140 C C   . LYS H 3 53  ? 43.639 -0.085   6.327  1.00 68.56  ? 237 LYS F C   1 
ATOM 8141 O O   . LYS H 3 53  ? 44.751 0.390    6.062  1.00 74.79  ? 237 LYS F O   1 
ATOM 8142 C CB  . LYS H 3 53  ? 43.126 -2.553   6.255  1.00 76.13  ? 237 LYS F CB  1 
ATOM 8143 C CG  . LYS H 3 53  ? 44.197 -2.983   5.266  1.00 79.87  ? 237 LYS F CG  1 
ATOM 8144 C CD  . LYS H 3 53  ? 43.667 -4.027   4.289  1.00 80.49  ? 237 LYS F CD  1 
ATOM 8145 C CE  . LYS H 3 53  ? 43.397 -5.352   4.997  1.00 86.55  ? 237 LYS F CE  1 
ATOM 8146 N NZ  . LYS H 3 53  ? 42.417 -6.208   4.270  1.00 84.47  ? 237 LYS F NZ  1 
ATOM 8147 N N   . GLU H 3 54  ? 42.506 0.511    5.955  1.00 65.31  ? 238 GLU F N   1 
ATOM 8148 C CA  . GLU H 3 54  ? 42.550 1.688    5.097  1.00 71.83  ? 238 GLU F CA  1 
ATOM 8149 C C   . GLU H 3 54  ? 43.090 2.904    5.841  1.00 74.83  ? 238 GLU F C   1 
ATOM 8150 O O   . GLU H 3 54  ? 43.838 3.704    5.267  1.00 70.70  ? 238 GLU F O   1 
ATOM 8151 C CB  . GLU H 3 54  ? 41.156 1.966    4.532  1.00 72.23  ? 238 GLU F CB  1 
ATOM 8152 C CG  . GLU H 3 54  ? 40.986 3.345    3.916  1.00 79.79  ? 238 GLU F CG  1 
ATOM 8153 C CD  . GLU H 3 54  ? 40.431 4.355    4.902  1.00 80.64  ? 238 GLU F CD  1 
ATOM 8154 O OE1 . GLU H 3 54  ? 39.743 3.936    5.858  1.00 73.76  ? 238 GLU F OE1 1 
ATOM 8155 O OE2 . GLU H 3 54  ? 40.690 5.563    4.722  1.00 82.16  ? 238 GLU F OE2 1 
ATOM 8156 N N   . ILE H 3 55  ? 42.743 3.054    7.124  1.00 81.76  ? 239 ILE F N   1 
ATOM 8157 C CA  . ILE H 3 55  ? 43.227 4.213    7.871  1.00 76.10  ? 239 ILE F CA  1 
ATOM 8158 C C   . ILE H 3 55  ? 44.708 4.070    8.208  1.00 72.43  ? 239 ILE F C   1 
ATOM 8159 O O   . ILE H 3 55  ? 45.432 5.071    8.286  1.00 69.13  ? 239 ILE F O   1 
ATOM 8160 C CB  . ILE H 3 55  ? 42.375 4.437    9.136  1.00 74.36  ? 239 ILE F CB  1 
ATOM 8161 C CG1 . ILE H 3 55  ? 40.922 4.722    8.755  1.00 72.26  ? 239 ILE F CG1 1 
ATOM 8162 C CG2 . ILE H 3 55  ? 42.919 5.597    9.963  1.00 49.28  ? 239 ILE F CG2 1 
ATOM 8163 C CD1 . ILE H 3 55  ? 40.724 6.045    8.057  1.00 67.13  ? 239 ILE F CD1 1 
ATOM 8164 N N   . LEU H 3 56  ? 45.195 2.840    8.399  1.00 74.13  ? 240 LEU F N   1 
ATOM 8165 C CA  . LEU H 3 56  ? 46.617 2.668    8.676  1.00 73.64  ? 240 LEU F CA  1 
ATOM 8166 C C   . LEU H 3 56  ? 47.460 2.722    7.407  1.00 72.16  ? 240 LEU F C   1 
ATOM 8167 O O   . LEU H 3 56  ? 48.645 3.066    7.479  1.00 70.62  ? 240 LEU F O   1 
ATOM 8168 C CB  . LEU H 3 56  ? 46.852 1.356    9.432  1.00 62.33  ? 240 LEU F CB  1 
ATOM 8169 C CG  . LEU H 3 56  ? 48.048 1.294    10.393 1.00 58.61  ? 240 LEU F CG  1 
ATOM 8170 C CD1 . LEU H 3 56  ? 47.838 0.166    11.382 1.00 63.13  ? 240 LEU F CD1 1 
ATOM 8171 C CD2 . LEU H 3 56  ? 49.384 1.109    9.685  1.00 59.73  ? 240 LEU F CD2 1 
ATOM 8172 N N   . SER H 3 57  ? 46.878 2.409    6.249  1.00 73.33  ? 241 SER F N   1 
ATOM 8173 C CA  . SER H 3 57  ? 47.576 2.572    4.980  1.00 84.89  ? 241 SER F CA  1 
ATOM 8174 C C   . SER H 3 57  ? 47.364 3.943    4.344  1.00 89.45  ? 241 SER F C   1 
ATOM 8175 O O   . SER H 3 57  ? 47.990 4.232    3.317  1.00 88.04  ? 241 SER F O   1 
ATOM 8176 C CB  . SER H 3 57  ? 47.143 1.487    3.989  1.00 88.19  ? 241 SER F CB  1 
ATOM 8177 O OG  . SER H 3 57  ? 48.131 1.288    2.991  1.00 87.18  ? 241 SER F OG  1 
ATOM 8178 N N   . ARG H 3 58  ? 46.504 4.790    4.921  1.00 96.53  ? 242 ARG F N   1 
ATOM 8179 C CA  . ARG H 3 58  ? 46.170 6.070    4.299  1.00 101.64 ? 242 ARG F CA  1 
ATOM 8180 C C   . ARG H 3 58  ? 47.196 7.161    4.591  1.00 107.18 ? 242 ARG F C   1 
ATOM 8181 O O   . ARG H 3 58  ? 47.404 8.044    3.750  1.00 116.10 ? 242 ARG F O   1 
ATOM 8182 C CB  . ARG H 3 58  ? 44.779 6.525    4.757  1.00 99.61  ? 242 ARG F CB  1 
ATOM 8183 C CG  . ARG H 3 58  ? 44.316 7.863    4.181  1.00 83.47  ? 242 ARG F CG  1 
ATOM 8184 C CD  . ARG H 3 58  ? 42.844 8.129    4.482  1.00 75.54  ? 242 ARG F CD  1 
ATOM 8185 N NE  . ARG H 3 58  ? 42.642 8.722    5.802  1.00 74.10  ? 242 ARG F NE  1 
ATOM 8186 C CZ  . ARG H 3 58  ? 41.449 8.988    6.328  1.00 75.04  ? 242 ARG F CZ  1 
ATOM 8187 N NH1 . ARG H 3 58  ? 40.344 8.708    5.651  1.00 75.99  ? 242 ARG F NH1 1 
ATOM 8188 N NH2 . ARG H 3 58  ? 41.359 9.530    7.536  1.00 68.43  ? 242 ARG F NH2 1 
ATOM 8189 N N   . GLY H 3 59  ? 47.848 7.129    5.756  1.00 100.81 ? 243 GLY F N   1 
ATOM 8190 C CA  . GLY H 3 59  ? 48.766 8.204    6.094  1.00 109.76 ? 243 GLY F CA  1 
ATOM 8191 C C   . GLY H 3 59  ? 50.068 8.153    5.319  1.00 123.05 ? 243 GLY F C   1 
ATOM 8192 O O   . GLY H 3 59  ? 50.643 9.198    4.997  1.00 120.47 ? 243 GLY F O   1 
ATOM 8193 N N   . SER H 3 60  ? 50.554 6.949    5.013  1.00 125.96 ? 244 SER F N   1 
ATOM 8194 C CA  . SER H 3 60  ? 51.808 6.804    4.279  1.00 125.49 ? 244 SER F CA  1 
ATOM 8195 C C   . SER H 3 60  ? 51.610 7.038    2.784  1.00 127.11 ? 244 SER F C   1 
ATOM 8196 O O   . SER H 3 60  ? 52.154 7.990    2.213  1.00 121.21 ? 244 SER F O   1 
ATOM 8197 C CB  . SER H 3 60  ? 52.408 5.418    4.530  1.00 127.27 ? 244 SER F CB  1 
ATOM 8198 O OG  . SER H 3 60  ? 53.707 5.320    3.973  1.00 126.00 ? 244 SER F OG  1 
ATOM 8199 N N   . THR H 3 61  ? 50.829 6.175    2.139  1.00 132.08 ? 245 THR F N   1 
ATOM 8200 C CA  . THR H 3 61  ? 50.587 6.258    0.701  1.00 134.36 ? 245 THR F CA  1 
ATOM 8201 C C   . THR H 3 61  ? 49.678 7.434    0.358  1.00 138.04 ? 245 THR F C   1 
ATOM 8202 O O   . THR H 3 61  ? 49.977 8.221    -0.542 1.00 146.16 ? 245 THR F O   1 
ATOM 8203 C CB  . THR H 3 61  ? 49.954 4.956    0.161  1.00 121.75 ? 245 THR F CB  1 
ATOM 8204 O OG1 . THR H 3 61  ? 50.709 3.826    0.616  1.00 109.83 ? 245 THR F OG1 1 
ATOM 8205 C CG2 . THR H 3 61  ? 49.927 4.964    -1.361 1.00 117.76 ? 245 THR F CG2 1 
ATOM 8206 N N   . LEU H 3 76  ? 37.485 29.259   10.989 1.00 73.67  ? 260 LEU F N   1 
ATOM 8207 C CA  . LEU H 3 76  ? 37.967 30.104   12.075 1.00 65.51  ? 260 LEU F CA  1 
ATOM 8208 C C   . LEU H 3 76  ? 36.882 30.365   13.114 1.00 70.17  ? 260 LEU F C   1 
ATOM 8209 O O   . LEU H 3 76  ? 36.496 31.513   13.340 1.00 77.16  ? 260 LEU F O   1 
ATOM 8210 C CB  . LEU H 3 76  ? 38.489 31.438   11.532 1.00 60.50  ? 260 LEU F CB  1 
ATOM 8211 C CG  . LEU H 3 76  ? 39.608 31.423   10.487 1.00 66.93  ? 260 LEU F CG  1 
ATOM 8212 C CD1 . LEU H 3 76  ? 40.158 32.828   10.275 1.00 64.24  ? 260 LEU F CD1 1 
ATOM 8213 C CD2 . LEU H 3 76  ? 40.723 30.469   10.886 1.00 64.04  ? 260 LEU F CD2 1 
ATOM 8214 N N   . GLY H 3 77  ? 36.393 29.302   13.749 1.00 62.62  ? 261 GLY F N   1 
ATOM 8215 C CA  . GLY H 3 77  ? 35.446 29.460   14.836 1.00 57.26  ? 261 GLY F CA  1 
ATOM 8216 C C   . GLY H 3 77  ? 36.130 29.234   16.166 1.00 52.41  ? 261 GLY F C   1 
ATOM 8217 O O   . GLY H 3 77  ? 35.508 28.799   17.139 1.00 49.07  ? 261 GLY F O   1 
ATOM 8218 N N   . SER H 3 78  ? 37.423 29.549   16.208 1.00 52.35  ? 262 SER F N   1 
ATOM 8219 C CA  . SER H 3 78  ? 38.285 29.212   17.331 1.00 50.14  ? 262 SER F CA  1 
ATOM 8220 C C   . SER H 3 78  ? 37.901 29.992   18.587 1.00 43.02  ? 262 SER F C   1 
ATOM 8221 O O   . SER H 3 78  ? 37.006 30.840   18.585 1.00 42.97  ? 262 SER F O   1 
ATOM 8222 C CB  . SER H 3 78  ? 39.746 29.481   16.983 1.00 43.46  ? 262 SER F CB  1 
ATOM 8223 O OG  . SER H 3 78  ? 40.006 30.870   16.905 1.00 39.22  ? 262 SER F OG  1 
ATOM 8224 N N   . SER H 3 79  ? 38.574 29.641   19.687 1.00 38.98  ? 263 SER F N   1 
ATOM 8225 C CA  . SER H 3 79  ? 38.441 30.394   20.930 1.00 39.81  ? 263 SER F CA  1 
ATOM 8226 C C   . SER H 3 79  ? 38.683 31.883   20.714 1.00 46.64  ? 263 SER F C   1 
ATOM 8227 O O   . SER H 3 79  ? 37.943 32.723   21.238 1.00 45.92  ? 263 SER F O   1 
ATOM 8228 C CB  . SER H 3 79  ? 39.420 29.855   21.972 1.00 39.17  ? 263 SER F CB  1 
ATOM 8229 O OG  . SER H 3 79  ? 40.741 29.826   21.456 1.00 35.86  ? 263 SER F OG  1 
ATOM 8230 N N   . GLN H 3 80  ? 39.722 32.230   19.957 1.00 43.88  ? 264 GLN F N   1 
ATOM 8231 C CA  . GLN H 3 80  ? 40.065 33.627   19.721 1.00 35.75  ? 264 GLN F CA  1 
ATOM 8232 C C   . GLN H 3 80  ? 39.438 34.086   18.408 1.00 36.54  ? 264 GLN F C   1 
ATOM 8233 O O   . GLN H 3 80  ? 40.097 34.308   17.394 1.00 35.47  ? 264 GLN F O   1 
ATOM 8234 C CB  . GLN H 3 80  ? 41.576 33.813   19.737 1.00 29.30  ? 264 GLN F CB  1 
ATOM 8235 C CG  . GLN H 3 80  ? 42.205 33.412   21.055 1.00 27.75  ? 264 GLN F CG  1 
ATOM 8236 C CD  . GLN H 3 80  ? 41.570 34.120   22.239 1.00 34.60  ? 264 GLN F CD  1 
ATOM 8237 O OE1 . GLN H 3 80  ? 41.917 35.255   22.555 1.00 39.00  ? 264 GLN F OE1 1 
ATOM 8238 N NE2 . GLN H 3 80  ? 40.657 33.433   22.922 1.00 39.08  ? 264 GLN F NE2 1 
ATOM 8239 N N   . ASN H 3 81  ? 38.119 34.235   18.458 1.00 37.14  ? 265 ASN F N   1 
ATOM 8240 C CA  . ASN H 3 81  ? 37.377 34.709   17.297 1.00 38.95  ? 265 ASN F CA  1 
ATOM 8241 C C   . ASN H 3 81  ? 37.407 36.227   17.212 1.00 45.31  ? 265 ASN F C   1 
ATOM 8242 O O   . ASN H 3 81  ? 37.699 36.790   16.153 1.00 45.96  ? 265 ASN F O   1 
ATOM 8243 C CB  . ASN H 3 81  ? 35.937 34.204   17.369 1.00 43.72  ? 265 ASN F CB  1 
ATOM 8244 C CG  . ASN H 3 81  ? 35.361 34.299   18.769 1.00 50.17  ? 265 ASN F CG  1 
ATOM 8245 O OD1 . ASN H 3 81  ? 35.908 34.986   19.631 1.00 49.46  ? 265 ASN F OD1 1 
ATOM 8246 N ND2 . ASN H 3 81  ? 34.255 33.603   19.004 1.00 58.03  ? 265 ASN F ND2 1 
ATOM 8247 N N   . GLU H 3 82  ? 37.120 36.903   18.328 1.00 45.88  ? 266 GLU F N   1 
ATOM 8248 C CA  . GLU H 3 82  ? 37.080 38.361   18.328 1.00 43.73  ? 266 GLU F CA  1 
ATOM 8249 C C   . GLU H 3 82  ? 38.452 38.944   18.016 1.00 44.43  ? 266 GLU F C   1 
ATOM 8250 O O   . GLU H 3 82  ? 38.577 39.863   17.197 1.00 49.18  ? 266 GLU F O   1 
ATOM 8251 C CB  . GLU H 3 82  ? 36.569 38.871   19.676 1.00 47.30  ? 266 GLU F CB  1 
ATOM 8252 C CG  . GLU H 3 82  ? 36.463 40.390   19.770 1.00 58.19  ? 266 GLU F CG  1 
ATOM 8253 C CD  . GLU H 3 82  ? 35.927 40.864   21.111 1.00 62.49  ? 266 GLU F CD  1 
ATOM 8254 O OE1 . GLU H 3 82  ? 35.669 40.014   21.988 1.00 66.88  ? 266 GLU F OE1 1 
ATOM 8255 O OE2 . GLU H 3 82  ? 35.759 42.089   21.286 1.00 70.41  ? 266 GLU F OE2 1 
ATOM 8256 N N   . VAL H 3 83  ? 39.496 38.412   18.656 1.00 34.02  ? 267 VAL F N   1 
ATOM 8257 C CA  . VAL H 3 83  ? 40.851 38.893   18.402 1.00 35.71  ? 267 VAL F CA  1 
ATOM 8258 C C   . VAL H 3 83  ? 41.203 38.745   16.927 1.00 36.73  ? 267 VAL F C   1 
ATOM 8259 O O   . VAL H 3 83  ? 41.831 39.628   16.329 1.00 34.49  ? 267 VAL F O   1 
ATOM 8260 C CB  . VAL H 3 83  ? 41.853 38.155   19.309 1.00 32.52  ? 267 VAL F CB  1 
ATOM 8261 C CG1 . VAL H 3 83  ? 43.271 38.644   19.061 1.00 32.14  ? 267 VAL F CG1 1 
ATOM 8262 C CG2 . VAL H 3 83  ? 41.471 38.342   20.767 1.00 32.97  ? 267 VAL F CG2 1 
ATOM 8263 N N   . LEU H 3 84  ? 40.784 37.641   16.310 1.00 45.75  ? 268 LEU F N   1 
ATOM 8264 C CA  . LEU H 3 84  ? 41.082 37.428   14.897 1.00 48.58  ? 268 LEU F CA  1 
ATOM 8265 C C   . LEU H 3 84  ? 40.299 38.389   14.013 1.00 38.95  ? 268 LEU F C   1 
ATOM 8266 O O   . LEU H 3 84  ? 40.820 38.877   13.002 1.00 36.55  ? 268 LEU F O   1 
ATOM 8267 C CB  . LEU H 3 84  ? 40.779 35.981   14.510 1.00 45.05  ? 268 LEU F CB  1 
ATOM 8268 C CG  . LEU H 3 84  ? 41.919 34.984   14.696 1.00 34.82  ? 268 LEU F CG  1 
ATOM 8269 C CD1 . LEU H 3 84  ? 41.398 33.573   14.538 1.00 46.38  ? 268 LEU F CD1 1 
ATOM 8270 C CD2 . LEU H 3 84  ? 43.044 35.262   13.713 1.00 41.29  ? 268 LEU F CD2 1 
ATOM 8271 N N   . ASN H 3 85  ? 39.051 38.674   14.374 1.00 34.62  ? 269 ASN F N   1 
ATOM 8272 C CA  . ASN H 3 85  ? 38.221 39.552   13.562 1.00 47.36  ? 269 ASN F CA  1 
ATOM 8273 C C   . ASN H 3 85  ? 38.554 41.023   13.770 1.00 54.79  ? 269 ASN F C   1 
ATOM 8274 O O   . ASN H 3 85  ? 38.270 41.844   12.890 1.00 44.39  ? 269 ASN F O   1 
ATOM 8275 C CB  . ASN H 3 85  ? 36.750 39.283   13.865 1.00 50.55  ? 269 ASN F CB  1 
ATOM 8276 C CG  . ASN H 3 85  ? 36.298 37.933   13.354 1.00 44.72  ? 269 ASN F CG  1 
ATOM 8277 O OD1 . ASN H 3 85  ? 36.864 37.398   12.400 1.00 37.77  ? 269 ASN F OD1 1 
ATOM 8278 N ND2 . ASN H 3 85  ? 35.291 37.361   14.002 1.00 50.25  ? 269 ASN F ND2 1 
ATOM 8279 N N   . THR H 3 86  ? 39.159 41.369   14.902 1.00 54.19  ? 270 THR F N   1 
ATOM 8280 C CA  . THR H 3 86  ? 39.696 42.708   15.118 1.00 45.08  ? 270 THR F CA  1 
ATOM 8281 C C   . THR H 3 86  ? 41.096 42.684   14.519 1.00 47.08  ? 270 THR F C   1 
ATOM 8282 O O   . THR H 3 86  ? 42.038 42.190   15.139 1.00 43.80  ? 270 THR F O   1 
ATOM 8283 C CB  . THR H 3 86  ? 39.716 43.050   16.603 1.00 43.72  ? 270 THR F CB  1 
ATOM 8284 O OG1 . THR H 3 86  ? 38.373 43.117   17.095 1.00 50.48  ? 270 THR F OG1 1 
ATOM 8285 C CG2 . THR H 3 86  ? 40.399 44.393   16.833 1.00 49.99  ? 270 THR F CG2 1 
ATOM 8286 N N   . LYS H 3 87  ? 41.234 43.193   13.296 1.00 43.87  ? 271 LYS F N   1 
ATOM 8287 C CA  . LYS H 3 87  ? 42.481 43.061   12.544 1.00 47.14  ? 271 LYS F CA  1 
ATOM 8288 C C   . LYS H 3 87  ? 42.701 44.341   11.752 1.00 54.58  ? 271 LYS F C   1 
ATOM 8289 O O   . LYS H 3 87  ? 42.303 44.447   10.585 1.00 59.63  ? 271 LYS F O   1 
ATOM 8290 C CB  . LYS H 3 87  ? 42.434 41.835   11.631 1.00 51.58  ? 271 LYS F CB  1 
ATOM 8291 C CG  . LYS H 3 87  ? 43.740 41.068   11.493 1.00 56.40  ? 271 LYS F CG  1 
ATOM 8292 C CD  . LYS H 3 87  ? 44.721 41.725   10.543 1.00 55.84  ? 271 LYS F CD  1 
ATOM 8293 C CE  . LYS H 3 87  ? 45.912 40.808   10.305 1.00 58.04  ? 271 LYS F CE  1 
ATOM 8294 N NZ  . LYS H 3 87  ? 46.843 41.344   9.279  1.00 66.14  ? 271 LYS F NZ  1 
ATOM 8295 N N   . PRO H 3 88  ? 43.332 45.343   12.364 1.00 52.39  ? 272 PRO F N   1 
ATOM 8296 C CA  . PRO H 3 88  ? 43.502 46.638   11.693 1.00 52.18  ? 272 PRO F CA  1 
ATOM 8297 C C   . PRO H 3 88  ? 44.356 46.554   10.435 1.00 48.50  ? 272 PRO F C   1 
ATOM 8298 O O   . PRO H 3 88  ? 45.303 45.770   10.343 1.00 47.43  ? 272 PRO F O   1 
ATOM 8299 C CB  . PRO H 3 88  ? 44.173 47.504   12.767 1.00 56.30  ? 272 PRO F CB  1 
ATOM 8300 C CG  . PRO H 3 88  ? 44.800 46.526   13.711 1.00 44.26  ? 272 PRO F CG  1 
ATOM 8301 C CD  . PRO H 3 88  ? 43.879 45.350   13.729 1.00 45.85  ? 272 PRO F CD  1 
ATOM 8302 N N   . ASP H 3 89  ? 44.015 47.402   9.466  1.00 49.40  ? 273 ASP F N   1 
ATOM 8303 C CA  . ASP H 3 89  ? 44.706 47.454   8.181  1.00 52.03  ? 273 ASP F CA  1 
ATOM 8304 C C   . ASP H 3 89  ? 46.053 48.140   8.371  1.00 49.39  ? 273 ASP F C   1 
ATOM 8305 O O   . ASP H 3 89  ? 46.111 49.344   8.641  1.00 57.39  ? 273 ASP F O   1 
ATOM 8306 C CB  . ASP H 3 89  ? 43.851 48.196   7.155  1.00 51.65  ? 273 ASP F CB  1 
ATOM 8307 C CG  . ASP H 3 89  ? 44.371 48.051   5.731  1.00 54.32  ? 273 ASP F CG  1 
ATOM 8308 O OD1 . ASP H 3 89  ? 43.540 47.882   4.813  1.00 52.84  ? 273 ASP F OD1 1 
ATOM 8309 O OD2 . ASP H 3 89  ? 45.602 48.116   5.522  1.00 51.82  ? 273 ASP F OD2 1 
ATOM 8310 N N   . TYR H 3 90  ? 47.139 47.383   8.217  1.00 42.27  ? 274 TYR F N   1 
ATOM 8311 C CA  . TYR H 3 90  ? 48.464 47.970   8.376  1.00 46.84  ? 274 TYR F CA  1 
ATOM 8312 C C   . TYR H 3 90  ? 48.924 48.651   7.094  1.00 49.90  ? 274 TYR F C   1 
ATOM 8313 O O   . TYR H 3 90  ? 49.609 49.681   7.140  1.00 59.21  ? 274 TYR F O   1 
ATOM 8314 C CB  . TYR H 3 90  ? 49.464 46.901   8.807  1.00 42.91  ? 274 TYR F CB  1 
ATOM 8315 C CG  . TYR H 3 90  ? 49.128 46.246   10.127 1.00 45.97  ? 274 TYR F CG  1 
ATOM 8316 C CD1 . TYR H 3 90  ? 48.498 45.011   10.174 1.00 47.91  ? 274 TYR F CD1 1 
ATOM 8317 C CD2 . TYR H 3 90  ? 49.442 46.866   11.328 1.00 50.94  ? 274 TYR F CD2 1 
ATOM 8318 C CE1 . TYR H 3 90  ? 48.193 44.408   11.385 1.00 51.10  ? 274 TYR F CE1 1 
ATOM 8319 C CE2 . TYR H 3 90  ? 49.143 46.272   12.542 1.00 53.26  ? 274 TYR F CE2 1 
ATOM 8320 C CZ  . TYR H 3 90  ? 48.517 45.043   12.566 1.00 47.88  ? 274 TYR F CZ  1 
ATOM 8321 O OH  . TYR H 3 90  ? 48.216 44.452   13.773 1.00 38.24  ? 274 TYR F OH  1 
ATOM 8322 N N   . GLN H 3 91  ? 48.555 48.084   5.945  1.00 47.57  ? 275 GLN F N   1 
ATOM 8323 C CA  . GLN H 3 91  ? 48.875 48.697   4.661  1.00 58.71  ? 275 GLN F CA  1 
ATOM 8324 C C   . GLN H 3 91  ? 48.396 50.145   4.612  1.00 65.76  ? 275 GLN F C   1 
ATOM 8325 O O   . GLN H 3 91  ? 49.141 51.053   4.214  1.00 66.95  ? 275 GLN F O   1 
ATOM 8326 C CB  . GLN H 3 91  ? 48.247 47.868   3.540  1.00 66.77  ? 275 GLN F CB  1 
ATOM 8327 C CG  . GLN H 3 91  ? 48.745 48.199   2.157  1.00 80.42  ? 275 GLN F CG  1 
ATOM 8328 C CD  . GLN H 3 91  ? 48.924 46.962   1.297  1.00 88.88  ? 275 GLN F CD  1 
ATOM 8329 O OE1 . GLN H 3 91  ? 49.965 46.777   0.665  1.00 86.54  ? 275 GLN F OE1 1 
ATOM 8330 N NE2 . GLN H 3 91  ? 47.907 46.108   1.268  1.00 94.08  ? 275 GLN F NE2 1 
ATOM 8331 N N   . LYS H 3 92  ? 47.150 50.378   5.034  1.00 63.81  ? 276 LYS F N   1 
ATOM 8332 C CA  . LYS H 3 92  ? 46.630 51.738   5.104  1.00 52.52  ? 276 LYS F CA  1 
ATOM 8333 C C   . LYS H 3 92  ? 47.460 52.595   6.050  1.00 50.27  ? 276 LYS F C   1 
ATOM 8334 O O   . LYS H 3 92  ? 47.598 53.803   5.831  1.00 61.27  ? 276 LYS F O   1 
ATOM 8335 C CB  . LYS H 3 92  ? 45.162 51.706   5.540  1.00 43.25  ? 276 LYS F CB  1 
ATOM 8336 C CG  . LYS H 3 92  ? 44.492 53.065   5.657  1.00 55.14  ? 276 LYS F CG  1 
ATOM 8337 C CD  . LYS H 3 92  ? 43.091 52.950   6.251  1.00 59.36  ? 276 LYS F CD  1 
ATOM 8338 C CE  . LYS H 3 92  ? 42.491 54.323   6.544  1.00 64.87  ? 276 LYS F CE  1 
ATOM 8339 N NZ  . LYS H 3 92  ? 41.180 54.239   7.252  1.00 57.00  ? 276 LYS F NZ  1 
ATOM 8340 N N   . ILE H 3 93  ? 48.058 51.983   7.074  1.00 44.36  ? 277 ILE F N   1 
ATOM 8341 C CA  . ILE H 3 93  ? 48.917 52.732   7.986  1.00 47.26  ? 277 ILE F CA  1 
ATOM 8342 C C   . ILE H 3 93  ? 50.172 53.208   7.265  1.00 53.82  ? 277 ILE F C   1 
ATOM 8343 O O   . ILE H 3 93  ? 50.551 54.384   7.356  1.00 68.49  ? 277 ILE F O   1 
ATOM 8344 C CB  . ILE H 3 93  ? 49.260 51.887   9.226  1.00 35.48  ? 277 ILE F CB  1 
ATOM 8345 C CG1 . ILE H 3 93  ? 48.000 51.607   10.046 1.00 33.62  ? 277 ILE F CG1 1 
ATOM 8346 C CG2 . ILE H 3 93  ? 50.317 52.571   10.075 1.00 40.94  ? 277 ILE F CG2 1 
ATOM 8347 C CD1 . ILE H 3 93  ? 48.232 50.686   11.212 1.00 36.59  ? 277 ILE F CD1 1 
ATOM 8348 N N   . LEU H 3 94  ? 50.826 52.315   6.519  1.00 45.40  ? 278 LEU F N   1 
ATOM 8349 C CA  . LEU H 3 94  ? 52.021 52.742   5.795  1.00 57.29  ? 278 LEU F CA  1 
ATOM 8350 C C   . LEU H 3 94  ? 51.686 53.781   4.728  1.00 69.21  ? 278 LEU F C   1 
ATOM 8351 O O   . LEU H 3 94  ? 52.474 54.707   4.485  1.00 74.93  ? 278 LEU F O   1 
ATOM 8352 C CB  . LEU H 3 94  ? 52.743 51.542   5.184  1.00 65.14  ? 278 LEU F CB  1 
ATOM 8353 C CG  . LEU H 3 94  ? 53.321 50.519   6.166  1.00 67.56  ? 278 LEU F CG  1 
ATOM 8354 C CD1 . LEU H 3 94  ? 52.503 49.240   6.192  1.00 63.57  ? 278 LEU F CD1 1 
ATOM 8355 C CD2 . LEU H 3 94  ? 54.779 50.224   5.843  1.00 72.30  ? 278 LEU F CD2 1 
ATOM 8356 N N   . GLN H 3 95  ? 50.521 53.655   4.081  1.00 67.88  ? 279 GLN F N   1 
ATOM 8357 C CA  . GLN H 3 95  ? 50.080 54.707   3.166  1.00 70.20  ? 279 GLN F CA  1 
ATOM 8358 C C   . GLN H 3 95  ? 49.949 56.042   3.891  1.00 63.41  ? 279 GLN F C   1 
ATOM 8359 O O   . GLN H 3 95  ? 50.415 57.084   3.405  1.00 71.93  ? 279 GLN F O   1 
ATOM 8360 C CB  . GLN H 3 95  ? 48.748 54.326   2.517  1.00 70.61  ? 279 GLN F CB  1 
ATOM 8361 C CG  . GLN H 3 95  ? 48.789 53.082   1.650  1.00 74.58  ? 279 GLN F CG  1 
ATOM 8362 C CD  . GLN H 3 95  ? 47.503 52.888   0.866  1.00 78.66  ? 279 GLN F CD  1 
ATOM 8363 O OE1 . GLN H 3 95  ? 47.529 52.533   -0.313 1.00 88.32  ? 279 GLN F OE1 1 
ATOM 8364 N NE2 . GLN H 3 95  ? 46.370 53.126   1.518  1.00 66.39  ? 279 GLN F NE2 1 
ATOM 8365 N N   . ASN H 3 96  ? 49.322 56.023   5.070  1.00 59.94  ? 280 ASN F N   1 
ATOM 8366 C CA  . ASN H 3 96  ? 49.152 57.249   5.841  1.00 65.27  ? 280 ASN F CA  1 
ATOM 8367 C C   . ASN H 3 96  ? 50.494 57.860   6.226  1.00 62.19  ? 280 ASN F C   1 
ATOM 8368 O O   . ASN H 3 96  ? 50.611 59.088   6.312  1.00 58.18  ? 280 ASN F O   1 
ATOM 8369 C CB  . ASN H 3 96  ? 48.297 56.967   7.076  1.00 61.28  ? 280 ASN F CB  1 
ATOM 8370 C CG  . ASN H 3 96  ? 46.852 56.651   6.721  1.00 59.40  ? 280 ASN F CG  1 
ATOM 8371 O OD1 . ASN H 3 96  ? 46.503 56.521   5.544  1.00 48.77  ? 280 ASN F OD1 1 
ATOM 8372 N ND2 . ASN H 3 96  ? 46.007 56.517   7.736  1.00 62.32  ? 280 ASN F ND2 1 
ATOM 8373 N N   . GLN H 3 97  ? 51.518 57.030   6.449  1.00 60.09  ? 281 GLN F N   1 
ATOM 8374 C CA  . GLN H 3 97  ? 52.872 57.563   6.598  1.00 60.38  ? 281 GLN F CA  1 
ATOM 8375 C C   . GLN H 3 97  ? 53.329 58.246   5.315  1.00 60.59  ? 281 GLN F C   1 
ATOM 8376 O O   . GLN H 3 97  ? 53.861 59.367   5.341  1.00 53.53  ? 281 GLN F O   1 
ATOM 8377 C CB  . GLN H 3 97  ? 53.845 56.448   6.981  1.00 51.73  ? 281 GLN F CB  1 
ATOM 8378 C CG  . GLN H 3 97  ? 53.442 55.669   8.211  1.00 59.12  ? 281 GLN F CG  1 
ATOM 8379 C CD  . GLN H 3 97  ? 53.156 56.572   9.389  1.00 59.12  ? 281 GLN F CD  1 
ATOM 8380 O OE1 . GLN H 3 97  ? 54.047 57.266   9.883  1.00 50.72  ? 281 GLN F OE1 1 
ATOM 8381 N NE2 . GLN H 3 97  ? 51.908 56.572   9.847  1.00 56.94  ? 281 GLN F NE2 1 
ATOM 8382 N N   . SER H 3 98  ? 53.120 57.576   4.177  1.00 66.06  ? 282 SER F N   1 
ATOM 8383 C CA  . SER H 3 98  ? 53.561 58.127   2.901  1.00 68.42  ? 282 SER F CA  1 
ATOM 8384 C C   . SER H 3 98  ? 52.968 59.503   2.646  1.00 58.75  ? 282 SER F C   1 
ATOM 8385 O O   . SER H 3 98  ? 53.620 60.348   2.023  1.00 58.92  ? 282 SER F O   1 
ATOM 8386 C CB  . SER H 3 98  ? 53.196 57.180   1.757  1.00 79.19  ? 282 SER F CB  1 
ATOM 8387 O OG  . SER H 3 98  ? 53.373 57.816   0.502  1.00 79.06  ? 282 SER F OG  1 
ATOM 8388 N N   . LYS H 3 99  ? 51.742 59.755   3.111  1.00 55.86  ? 283 LYS F N   1 
ATOM 8389 C CA  . LYS H 3 99  ? 51.199 61.101   2.968  1.00 61.13  ? 283 LYS F CA  1 
ATOM 8390 C C   . LYS H 3 99  ? 51.592 62.030   4.114  1.00 60.70  ? 283 LYS F C   1 
ATOM 8391 O O   . LYS H 3 99  ? 51.613 63.255   3.921  1.00 59.68  ? 283 LYS F O   1 
ATOM 8392 C CB  . LYS H 3 99  ? 49.673 61.064   2.827  1.00 56.28  ? 283 LYS F CB  1 
ATOM 8393 C CG  . LYS H 3 99  ? 48.910 60.461   3.984  1.00 45.48  ? 283 LYS F CG  1 
ATOM 8394 C CD  . LYS H 3 99  ? 47.426 60.452   3.657  1.00 47.19  ? 283 LYS F CD  1 
ATOM 8395 C CE  . LYS H 3 99  ? 46.583 59.990   4.828  1.00 61.83  ? 283 LYS F CE  1 
ATOM 8396 N NZ  . LYS H 3 99  ? 45.134 60.000   4.481  1.00 70.78  ? 283 LYS F NZ  1 
ATOM 8397 N N   . VAL H 3 100 ? 51.913 61.484   5.290  1.00 57.49  ? 284 VAL F N   1 
ATOM 8398 C CA  . VAL H 3 100 ? 52.469 62.308   6.362  1.00 52.28  ? 284 VAL F CA  1 
ATOM 8399 C C   . VAL H 3 100 ? 53.728 63.011   5.878  1.00 50.63  ? 284 VAL F C   1 
ATOM 8400 O O   . VAL H 3 100 ? 53.896 64.226   6.058  1.00 49.96  ? 284 VAL F O   1 
ATOM 8401 C CB  . VAL H 3 100 ? 52.755 61.451   7.610  1.00 53.97  ? 284 VAL F CB  1 
ATOM 8402 C CG1 . VAL H 3 100 ? 53.854 62.085   8.457  1.00 42.55  ? 284 VAL F CG1 1 
ATOM 8403 C CG2 . VAL H 3 100 ? 51.489 61.249   8.428  1.00 61.15  ? 284 VAL F CG2 1 
ATOM 8404 N N   . PHE H 3 101 ? 54.620 62.259   5.224  1.00 57.49  ? 285 PHE F N   1 
ATOM 8405 C CA  . PHE H 3 101 ? 55.849 62.862   4.716  1.00 56.54  ? 285 PHE F CA  1 
ATOM 8406 C C   . PHE H 3 101 ? 55.555 63.994   3.739  1.00 49.55  ? 285 PHE F C   1 
ATOM 8407 O O   . PHE H 3 101 ? 56.285 64.992   3.703  1.00 55.13  ? 285 PHE F O   1 
ATOM 8408 C CB  . PHE H 3 101 ? 56.719 61.796   4.048  1.00 61.00  ? 285 PHE F CB  1 
ATOM 8409 C CG  . PHE H 3 101 ? 57.551 60.997   5.013  1.00 62.34  ? 285 PHE F CG  1 
ATOM 8410 C CD1 . PHE H 3 101 ? 56.954 60.258   6.019  1.00 63.61  ? 285 PHE F CD1 1 
ATOM 8411 C CD2 . PHE H 3 101 ? 58.933 60.988   4.913  1.00 70.66  ? 285 PHE F CD2 1 
ATOM 8412 C CE1 . PHE H 3 101 ? 57.720 59.522   6.907  1.00 68.61  ? 285 PHE F CE1 1 
ATOM 8413 C CE2 . PHE H 3 101 ? 59.705 60.255   5.797  1.00 66.41  ? 285 PHE F CE2 1 
ATOM 8414 C CZ  . PHE H 3 101 ? 59.098 59.521   6.795  1.00 62.46  ? 285 PHE F CZ  1 
ATOM 8415 N N   . ASP H 3 102 ? 54.481 63.870   2.959  1.00 48.01  ? 286 ASP F N   1 
ATOM 8416 C CA  . ASP H 3 102 ? 54.094 64.948   2.057  1.00 56.19  ? 286 ASP F CA  1 
ATOM 8417 C C   . ASP H 3 102 ? 53.644 66.173   2.843  1.00 55.07  ? 286 ASP F C   1 
ATOM 8418 O O   . ASP H 3 102 ? 54.089 67.301   2.574  1.00 53.58  ? 286 ASP F O   1 
ATOM 8419 C CB  . ASP H 3 102 ? 52.984 64.468   1.122  1.00 59.85  ? 286 ASP F CB  1 
ATOM 8420 C CG  . ASP H 3 102 ? 53.468 63.437   0.119  1.00 62.28  ? 286 ASP F CG  1 
ATOM 8421 O OD1 . ASP H 3 102 ? 54.698 63.312   -0.069 1.00 60.73  ? 286 ASP F OD1 1 
ATOM 8422 O OD2 . ASP H 3 102 ? 52.615 62.745   -0.476 1.00 60.70  ? 286 ASP F OD2 1 
ATOM 8423 N N   . CYS H 3 103 ? 52.760 65.960   3.826  1.00 54.11  ? 287 CYS F N   1 
ATOM 8424 C CA  . CYS H 3 103 ? 52.305 67.045   4.690  1.00 49.84  ? 287 CYS F CA  1 
ATOM 8425 C C   . CYS H 3 103 ? 53.476 67.829   5.273  1.00 42.82  ? 287 CYS F C   1 
ATOM 8426 O O   . CYS H 3 103 ? 53.519 69.063   5.183  1.00 44.92  ? 287 CYS F O   1 
ATOM 8427 C CB  . CYS H 3 103 ? 51.426 66.479   5.805  1.00 50.27  ? 287 CYS F CB  1 
ATOM 8428 S SG  . CYS H 3 103 ? 50.980 67.666   7.086  1.00 50.95  ? 287 CYS F SG  1 
ATOM 8429 N N   . MET H 3 104 ? 54.455 67.128   5.850  1.00 37.70  ? 288 MET F N   1 
ATOM 8430 C CA  . MET H 3 104 ? 55.623 67.838   6.364  1.00 39.04  ? 288 MET F CA  1 
ATOM 8431 C C   . MET H 3 104 ? 56.412 68.510   5.248  1.00 44.99  ? 288 MET F C   1 
ATOM 8432 O O   . MET H 3 104 ? 57.001 69.577   5.467  1.00 49.38  ? 288 MET F O   1 
ATOM 8433 C CB  . MET H 3 104 ? 56.528 66.913   7.172  1.00 35.48  ? 288 MET F CB  1 
ATOM 8434 C CG  . MET H 3 104 ? 56.080 66.743   8.613  1.00 42.15  ? 288 MET F CG  1 
ATOM 8435 S SD  . MET H 3 104 ? 57.468 66.801   9.765  1.00 51.14  ? 288 MET F SD  1 
ATOM 8436 C CE  . MET H 3 104 ? 58.139 68.415   9.390  1.00 48.02  ? 288 MET F CE  1 
ATOM 8437 N N   . GLU H 3 105 ? 56.457 67.904   4.058  1.00 47.39  ? 289 GLU F N   1 
ATOM 8438 C CA  . GLU H 3 105 ? 57.221 68.511   2.971  1.00 51.97  ? 289 GLU F CA  1 
ATOM 8439 C C   . GLU H 3 105 ? 56.680 69.890   2.616  1.00 54.59  ? 289 GLU F C   1 
ATOM 8440 O O   . GLU H 3 105 ? 57.433 70.873   2.583  1.00 53.37  ? 289 GLU F O   1 
ATOM 8441 C CB  . GLU H 3 105 ? 57.214 67.609   1.739  1.00 54.80  ? 289 GLU F CB  1 
ATOM 8442 C CG  . GLU H 3 105 ? 57.836 68.282   0.523  1.00 65.34  ? 289 GLU F CG  1 
ATOM 8443 C CD  . GLU H 3 105 ? 59.058 67.551   0.008  1.00 89.74  ? 289 GLU F CD  1 
ATOM 8444 O OE1 . GLU H 3 105 ? 59.638 66.753   0.776  1.00 89.09  ? 289 GLU F OE1 1 
ATOM 8445 O OE2 . GLU H 3 105 ? 59.448 67.790   -1.155 1.00 99.87  ? 289 GLU F OE2 1 
ATOM 8446 N N   . LEU H 3 106 ? 55.369 69.997   2.372  1.00 50.42  ? 290 LEU F N   1 
ATOM 8447 C CA  . LEU H 3 106 ? 54.846 71.324   2.060  1.00 45.57  ? 290 LEU F CA  1 
ATOM 8448 C C   . LEU H 3 106 ? 54.821 72.230   3.289  1.00 46.59  ? 290 LEU F C   1 
ATOM 8449 O O   . LEU H 3 106 ? 54.844 73.458   3.136  1.00 49.76  ? 290 LEU F O   1 
ATOM 8450 C CB  . LEU H 3 106 ? 53.463 71.243   1.405  1.00 34.16  ? 290 LEU F CB  1 
ATOM 8451 C CG  . LEU H 3 106 ? 52.179 71.047   2.203  1.00 40.08  ? 290 LEU F CG  1 
ATOM 8452 C CD1 . LEU H 3 106 ? 51.016 71.664   1.458  1.00 46.52  ? 290 LEU F CD1 1 
ATOM 8453 C CD2 . LEU H 3 106 ? 51.921 69.584   2.376  1.00 48.12  ? 290 LEU F CD2 1 
ATOM 8454 N N   . VAL H 3 107 ? 54.779 71.657   4.497  1.00 46.87  ? 291 VAL F N   1 
ATOM 8455 C CA  . VAL H 3 107 ? 54.987 72.459   5.703  1.00 46.84  ? 291 VAL F CA  1 
ATOM 8456 C C   . VAL H 3 107 ? 56.313 73.207   5.617  1.00 45.01  ? 291 VAL F C   1 
ATOM 8457 O O   . VAL H 3 107 ? 56.370 74.436   5.768  1.00 45.66  ? 291 VAL F O   1 
ATOM 8458 C CB  . VAL H 3 107 ? 54.922 71.567   6.959  1.00 38.37  ? 291 VAL F CB  1 
ATOM 8459 C CG1 . VAL H 3 107 ? 55.718 72.179   8.105  1.00 31.40  ? 291 VAL F CG1 1 
ATOM 8460 C CG2 . VAL H 3 107 ? 53.477 71.353   7.380  1.00 42.94  ? 291 VAL F CG2 1 
ATOM 8461 N N   . MET H 3 108 ? 57.396 72.480   5.342  1.00 44.70  ? 292 MET F N   1 
ATOM 8462 C CA  . MET H 3 108 ? 58.699 73.123   5.248  1.00 47.64  ? 292 MET F CA  1 
ATOM 8463 C C   . MET H 3 108 ? 58.826 73.999   4.012  1.00 52.36  ? 292 MET F C   1 
ATOM 8464 O O   . MET H 3 108 ? 59.648 74.923   4.006  1.00 56.71  ? 292 MET F O   1 
ATOM 8465 C CB  . MET H 3 108 ? 59.809 72.081   5.249  1.00 52.21  ? 292 MET F CB  1 
ATOM 8466 C CG  . MET H 3 108 ? 60.205 71.621   6.629  1.00 53.30  ? 292 MET F CG  1 
ATOM 8467 S SD  . MET H 3 108 ? 61.967 71.287   6.663  1.00 79.15  ? 292 MET F SD  1 
ATOM 8468 C CE  . MET H 3 108 ? 62.579 72.820   5.971  1.00 65.34  ? 292 MET F CE  1 
ATOM 8469 N N   . ASP H 3 109 ? 58.042 73.730   2.967  1.00 51.80  ? 293 ASP F N   1 
ATOM 8470 C CA  . ASP H 3 109 ? 58.020 74.638   1.825  1.00 53.98  ? 293 ASP F CA  1 
ATOM 8471 C C   . ASP H 3 109 ? 57.455 75.996   2.225  1.00 47.90  ? 293 ASP F C   1 
ATOM 8472 O O   . ASP H 3 109 ? 58.046 77.043   1.923  1.00 49.50  ? 293 ASP F O   1 
ATOM 8473 C CB  . ASP H 3 109 ? 57.208 74.024   0.685  1.00 50.38  ? 293 ASP F CB  1 
ATOM 8474 C CG  . ASP H 3 109 ? 57.977 72.954   -0.064 1.00 52.21  ? 293 ASP F CG  1 
ATOM 8475 O OD1 . ASP H 3 109 ? 59.187 72.789   0.205  1.00 57.00  ? 293 ASP F OD1 1 
ATOM 8476 O OD2 . ASP H 3 109 ? 57.370 72.280   -0.921 1.00 54.02  ? 293 ASP F OD2 1 
ATOM 8477 N N   . GLU H 3 110 ? 56.313 75.997   2.918  1.00 47.81  ? 294 GLU F N   1 
ATOM 8478 C CA  . GLU H 3 110 ? 55.759 77.250   3.424  1.00 52.14  ? 294 GLU F CA  1 
ATOM 8479 C C   . GLU H 3 110 ? 56.731 77.934   4.378  1.00 51.01  ? 294 GLU F C   1 
ATOM 8480 O O   . GLU H 3 110 ? 56.862 79.164   4.365  1.00 49.82  ? 294 GLU F O   1 
ATOM 8481 C CB  . GLU H 3 110 ? 54.425 76.995   4.123  1.00 56.76  ? 294 GLU F CB  1 
ATOM 8482 C CG  . GLU H 3 110 ? 54.000 78.118   5.058  1.00 53.30  ? 294 GLU F CG  1 
ATOM 8483 C CD  . GLU H 3 110 ? 53.182 77.622   6.232  1.00 60.26  ? 294 GLU F CD  1 
ATOM 8484 O OE1 . GLU H 3 110 ? 53.130 76.390   6.441  1.00 64.60  ? 294 GLU F OE1 1 
ATOM 8485 O OE2 . GLU H 3 110 ? 52.601 78.464   6.951  1.00 57.22  ? 294 GLU F OE2 1 
ATOM 8486 N N   . LEU H 3 111 ? 57.421 77.152   5.214  1.00 51.89  ? 295 LEU F N   1 
ATOM 8487 C CA  . LEU H 3 111 ? 58.403 77.731   6.128  1.00 50.48  ? 295 LEU F CA  1 
ATOM 8488 C C   . LEU H 3 111 ? 59.502 78.460   5.363  1.00 51.11  ? 295 LEU F C   1 
ATOM 8489 O O   . LEU H 3 111 ? 59.785 79.640   5.622  1.00 54.31  ? 295 LEU F O   1 
ATOM 8490 C CB  . LEU H 3 111 ? 58.987 76.635   7.018  1.00 53.15  ? 295 LEU F CB  1 
ATOM 8491 C CG  . LEU H 3 111 ? 59.798 77.077   8.234  1.00 51.01  ? 295 LEU F CG  1 
ATOM 8492 C CD1 . LEU H 3 111 ? 58.949 77.950   9.140  1.00 54.75  ? 295 LEU F CD1 1 
ATOM 8493 C CD2 . LEU H 3 111 ? 60.316 75.866   8.993  1.00 43.56  ? 295 LEU F CD2 1 
ATOM 8494 N N   . GLN H 3 112 ? 60.120 77.779   4.396  1.00 54.54  ? 296 GLN F N   1 
ATOM 8495 C CA  . GLN H 3 112 ? 61.164 78.406   3.596  1.00 57.65  ? 296 GLN F CA  1 
ATOM 8496 C C   . GLN H 3 112 ? 60.623 79.496   2.679  1.00 51.95  ? 296 GLN F C   1 
ATOM 8497 O O   . GLN H 3 112 ? 61.417 80.204   2.053  1.00 54.17  ? 296 GLN F O   1 
ATOM 8498 C CB  . GLN H 3 112 ? 61.931 77.352   2.793  1.00 66.38  ? 296 GLN F CB  1 
ATOM 8499 C CG  . GLN H 3 112 ? 61.410 77.062   1.401  1.00 67.05  ? 296 GLN F CG  1 
ATOM 8500 C CD  . GLN H 3 112 ? 62.375 76.192   0.618  1.00 69.60  ? 296 GLN F CD  1 
ATOM 8501 O OE1 . GLN H 3 112 ? 63.480 75.902   1.083  1.00 57.72  ? 296 GLN F OE1 1 
ATOM 8502 N NE2 . GLN H 3 112 ? 61.965 75.770   -0.572 1.00 78.59  ? 296 GLN F NE2 1 
ATOM 8503 N N   . GLY H 3 113 ? 59.304 79.632   2.561  1.00 48.16  ? 297 GLY F N   1 
ATOM 8504 C CA  . GLY H 3 113 ? 58.749 80.814   1.932  1.00 53.44  ? 297 GLY F CA  1 
ATOM 8505 C C   . GLY H 3 113 ? 58.709 81.975   2.909  1.00 56.21  ? 297 GLY F C   1 
ATOM 8506 O O   . GLY H 3 113 ? 59.079 83.110   2.576  1.00 58.73  ? 297 GLY F O   1 
ATOM 8507 N N   . SER H 3 114 ? 58.262 81.689   4.135  1.00 50.43  ? 298 SER F N   1 
ATOM 8508 C CA  . SER H 3 114 ? 58.210 82.721   5.163  1.00 45.71  ? 298 SER F CA  1 
ATOM 8509 C C   . SER H 3 114 ? 59.588 83.304   5.441  1.00 46.38  ? 298 SER F C   1 
ATOM 8510 O O   . SER H 3 114 ? 59.702 84.496   5.754  1.00 49.76  ? 298 SER F O   1 
ATOM 8511 C CB  . SER H 3 114 ? 57.600 82.156   6.445  1.00 47.35  ? 298 SER F CB  1 
ATOM 8512 O OG  . SER H 3 114 ? 56.186 82.104   6.354  1.00 45.52  ? 298 SER F OG  1 
ATOM 8513 N N   . VAL H 3 115 ? 60.645 82.492   5.338  1.00 48.86  ? 299 VAL F N   1 
ATOM 8514 C CA  . VAL H 3 115 ? 61.992 83.029   5.532  1.00 52.34  ? 299 VAL F CA  1 
ATOM 8515 C C   . VAL H 3 115 ? 62.299 84.094   4.479  1.00 61.02  ? 299 VAL F C   1 
ATOM 8516 O O   . VAL H 3 115 ? 62.871 85.146   4.789  1.00 58.27  ? 299 VAL F O   1 
ATOM 8517 C CB  . VAL H 3 115 ? 63.048 81.902   5.558  1.00 52.57  ? 299 VAL F CB  1 
ATOM 8518 C CG1 . VAL H 3 115 ? 62.644 80.823   6.551  1.00 59.25  ? 299 VAL F CG1 1 
ATOM 8519 C CG2 . VAL H 3 115 ? 63.304 81.303   4.185  1.00 52.57  ? 299 VAL F CG2 1 
ATOM 8520 N N   . LYS H 3 116 ? 61.953 83.829   3.216  1.00 58.35  ? 300 LYS F N   1 
ATOM 8521 C CA  . LYS H 3 116 ? 62.191 84.812   2.162  1.00 59.12  ? 300 LYS F CA  1 
ATOM 8522 C C   . LYS H 3 116 ? 61.363 86.073   2.389  1.00 60.05  ? 300 LYS F C   1 
ATOM 8523 O O   . LYS H 3 116 ? 61.876 87.197   2.276  1.00 61.25  ? 300 LYS F O   1 
ATOM 8524 C CB  . LYS H 3 116 ? 61.889 84.197   0.796  1.00 57.68  ? 300 LYS F CB  1 
ATOM 8525 C CG  . LYS H 3 116 ? 63.004 83.312   0.267  1.00 52.86  ? 300 LYS F CG  1 
ATOM 8526 C CD  . LYS H 3 116 ? 62.776 82.945   -1.191 1.00 68.05  ? 300 LYS F CD  1 
ATOM 8527 C CE  . LYS H 3 116 ? 62.977 84.143   -2.107 1.00 73.32  ? 300 LYS F CE  1 
ATOM 8528 N NZ  . LYS H 3 116 ? 62.914 83.765   -3.548 1.00 72.54  ? 300 LYS F NZ  1 
ATOM 8529 N N   . GLN H 3 117 ? 60.075 85.902   2.720  1.00 61.69  ? 301 GLN F N   1 
ATOM 8530 C CA  . GLN H 3 117 ? 59.231 87.045   3.067  1.00 66.41  ? 301 GLN F CA  1 
ATOM 8531 C C   . GLN H 3 117 ? 59.843 87.875   4.188  1.00 62.51  ? 301 GLN F C   1 
ATOM 8532 O O   . GLN H 3 117 ? 59.656 89.096   4.234  1.00 58.37  ? 301 GLN F O   1 
ATOM 8533 C CB  . GLN H 3 117 ? 57.831 86.564   3.468  1.00 72.79  ? 301 GLN F CB  1 
ATOM 8534 C CG  . GLN H 3 117 ? 56.863 87.672   3.902  1.00 78.52  ? 301 GLN F CG  1 
ATOM 8535 C CD  . GLN H 3 117 ? 56.186 88.384   2.742  1.00 85.72  ? 301 GLN F CD  1 
ATOM 8536 O OE1 . GLN H 3 117 ? 56.162 87.886   1.616  1.00 88.48  ? 301 GLN F OE1 1 
ATOM 8537 N NE2 . GLN H 3 117 ? 55.623 89.555   3.019  1.00 73.48  ? 301 GLN F NE2 1 
ATOM 8538 N N   . LEU H 3 118 ? 60.585 87.232   5.091  1.00 64.35  ? 302 LEU F N   1 
ATOM 8539 C CA  . LEU H 3 118 ? 61.273 87.969   6.145  1.00 62.15  ? 302 LEU F CA  1 
ATOM 8540 C C   . LEU H 3 118 ? 62.493 88.696   5.591  1.00 65.82  ? 302 LEU F C   1 
ATOM 8541 O O   . LEU H 3 118 ? 62.669 89.898   5.819  1.00 66.62  ? 302 LEU F O   1 
ATOM 8542 C CB  . LEU H 3 118 ? 61.674 87.031   7.280  1.00 59.36  ? 302 LEU F CB  1 
ATOM 8543 C CG  . LEU H 3 118 ? 62.667 87.651   8.262  1.00 60.40  ? 302 LEU F CG  1 
ATOM 8544 C CD1 . LEU H 3 118 ? 61.944 88.623   9.180  1.00 67.56  ? 302 LEU F CD1 1 
ATOM 8545 C CD2 . LEU H 3 118 ? 63.372 86.584   9.065  1.00 51.32  ? 302 LEU F CD2 1 
ATOM 8546 N N   . GLN H 3 119 ? 63.354 87.975   4.866  1.00 71.04  ? 303 GLN F N   1 
ATOM 8547 C CA  . GLN H 3 119 ? 64.652 88.515   4.482  1.00 76.28  ? 303 GLN F CA  1 
ATOM 8548 C C   . GLN H 3 119 ? 64.539 89.618   3.437  1.00 70.96  ? 303 GLN F C   1 
ATOM 8549 O O   . GLN H 3 119 ? 65.449 90.453   3.332  1.00 66.62  ? 303 GLN F O   1 
ATOM 8550 C CB  . GLN H 3 119 ? 65.524 87.376   3.940  1.00 69.62  ? 303 GLN F CB  1 
ATOM 8551 C CG  . GLN H 3 119 ? 66.954 87.755   3.595  1.00 80.07  ? 303 GLN F CG  1 
ATOM 8552 C CD  . GLN H 3 119 ? 67.855 87.777   4.809  1.00 88.56  ? 303 GLN F CD  1 
ATOM 8553 O OE1 . GLN H 3 119 ? 67.571 87.128   5.815  1.00 94.09  ? 303 GLN F OE1 1 
ATOM 8554 N NE2 . GLN H 3 119 ? 68.952 88.522   4.722  1.00 73.25  ? 303 GLN F NE2 1 
ATOM 8555 N N   . ALA H 3 120 ? 63.417 89.689   2.715  1.00 67.72  ? 304 ALA F N   1 
ATOM 8556 C CA  . ALA H 3 120 ? 63.119 90.894   1.948  1.00 68.76  ? 304 ALA F CA  1 
ATOM 8557 C C   . ALA H 3 120 ? 62.965 92.099   2.870  1.00 71.95  ? 304 ALA F C   1 
ATOM 8558 O O   . ALA H 3 120 ? 63.558 93.162   2.637  1.00 77.80  ? 304 ALA F O   1 
ATOM 8559 C CB  . ALA H 3 120 ? 61.856 90.685   1.112  1.00 65.64  ? 304 ALA F CB  1 
ATOM 8560 N N   . PHE H 3 121 ? 62.180 91.939   3.938  1.00 68.12  ? 305 PHE F N   1 
ATOM 8561 C CA  . PHE H 3 121 ? 61.992 93.014   4.905  1.00 61.15  ? 305 PHE F CA  1 
ATOM 8562 C C   . PHE H 3 121 ? 63.298 93.388   5.599  1.00 67.85  ? 305 PHE F C   1 
ATOM 8563 O O   . PHE H 3 121 ? 63.548 94.568   5.862  1.00 73.50  ? 305 PHE F O   1 
ATOM 8564 C CB  . PHE H 3 121 ? 60.934 92.601   5.930  1.00 57.70  ? 305 PHE F CB  1 
ATOM 8565 C CG  . PHE H 3 121 ? 60.726 93.601   7.032  1.00 67.95  ? 305 PHE F CG  1 
ATOM 8566 C CD1 . PHE H 3 121 ? 61.202 93.355   8.310  1.00 68.58  ? 305 PHE F CD1 1 
ATOM 8567 C CD2 . PHE H 3 121 ? 60.053 94.787   6.791  1.00 76.37  ? 305 PHE F CD2 1 
ATOM 8568 C CE1 . PHE H 3 121 ? 61.009 94.275   9.329  1.00 62.06  ? 305 PHE F CE1 1 
ATOM 8569 C CE2 . PHE H 3 121 ? 59.857 95.710   7.805  1.00 69.04  ? 305 PHE F CE2 1 
ATOM 8570 C CZ  . PHE H 3 121 ? 60.334 95.453   9.075  1.00 58.97  ? 305 PHE F CZ  1 
ATOM 8571 N N   . MET H 3 122 ? 64.138 92.400   5.921  1.00 70.16  ? 306 MET F N   1 
ATOM 8572 C CA  . MET H 3 122 ? 65.410 92.709   6.570  1.00 66.73  ? 306 MET F CA  1 
ATOM 8573 C C   . MET H 3 122 ? 66.357 93.459   5.637  1.00 70.72  ? 306 MET F C   1 
ATOM 8574 O O   . MET H 3 122 ? 67.005 94.430   6.054  1.00 75.76  ? 306 MET F O   1 
ATOM 8575 C CB  . MET H 3 122 ? 66.061 91.430   7.096  1.00 73.65  ? 306 MET F CB  1 
ATOM 8576 C CG  . MET H 3 122 ? 65.483 90.959   8.426  1.00 72.73  ? 306 MET F CG  1 
ATOM 8577 S SD  . MET H 3 122 ? 66.712 90.197   9.506  1.00 79.99  ? 306 MET F SD  1 
ATOM 8578 C CE  . MET H 3 122 ? 67.305 88.885   8.444  1.00 77.82  ? 306 MET F CE  1 
ATOM 8579 N N   . ASP H 3 123 ? 66.451 93.035   4.373  1.00 74.46  ? 307 ASP F N   1 
ATOM 8580 C CA  . ASP H 3 123 ? 67.340 93.724   3.440  1.00 75.85  ? 307 ASP F CA  1 
ATOM 8581 C C   . ASP H 3 123 ? 66.858 95.148   3.177  1.00 76.25  ? 307 ASP F C   1 
ATOM 8582 O O   . ASP H 3 123 ? 67.646 96.105   3.223  1.00 78.73  ? 307 ASP F O   1 
ATOM 8583 C CB  . ASP H 3 123 ? 67.452 92.934   2.136  1.00 74.63  ? 307 ASP F CB  1 
ATOM 8584 C CG  . ASP H 3 123 ? 68.274 91.667   2.291  1.00 75.98  ? 307 ASP F CG  1 
ATOM 8585 O OD1 . ASP H 3 123 ? 69.276 91.695   3.037  1.00 79.92  ? 307 ASP F OD1 1 
ATOM 8586 O OD2 . ASP H 3 123 ? 67.919 90.643   1.670  1.00 73.29  ? 307 ASP F OD2 1 
ATOM 8587 N N   . GLU H 3 124 ? 65.555 95.310   2.924  1.00 69.26  ? 308 GLU F N   1 
ATOM 8588 C CA  . GLU H 3 124 ? 65.019 96.652   2.735  1.00 64.74  ? 308 GLU F CA  1 
ATOM 8589 C C   . GLU H 3 124 ? 65.163 97.482   4.007  1.00 72.24  ? 308 GLU F C   1 
ATOM 8590 O O   . GLU H 3 124 ? 65.264 98.713   3.940  1.00 79.67  ? 308 GLU F O   1 
ATOM 8591 C CB  . GLU H 3 124 ? 63.561 96.585   2.271  1.00 57.52  ? 308 GLU F CB  1 
ATOM 8592 C CG  . GLU H 3 124 ? 62.521 96.589   3.377  1.00 68.52  ? 308 GLU F CG  1 
ATOM 8593 C CD  . GLU H 3 124 ? 61.131 96.929   2.863  1.00 70.43  ? 308 GLU F CD  1 
ATOM 8594 O OE1 . GLU H 3 124 ? 60.963 97.047   1.630  1.00 66.03  ? 308 GLU F OE1 1 
ATOM 8595 O OE2 . GLU H 3 124 ? 60.209 97.087   3.691  1.00 71.09  ? 308 GLU F OE2 1 
ATOM 8596 N N   . SER H 3 125 ? 65.190 96.828   5.169  1.00 72.32  ? 309 SER F N   1 
ATOM 8597 C CA  . SER H 3 125 ? 65.364 97.550   6.424  1.00 71.27  ? 309 SER F CA  1 
ATOM 8598 C C   . SER H 3 125 ? 66.779 98.096   6.549  1.00 75.03  ? 309 SER F C   1 
ATOM 8599 O O   . SER H 3 125 ? 66.970 99.270   6.888  1.00 84.15  ? 309 SER F O   1 
ATOM 8600 C CB  . SER H 3 125 ? 65.037 96.643   7.610  1.00 74.41  ? 309 SER F CB  1 
ATOM 8601 O OG  . SER H 3 125 ? 63.686 96.218   7.572  1.00 73.53  ? 309 SER F OG  1 
ATOM 8602 N N   . THR H 3 126 ? 67.788 97.264   6.274  1.00 73.38  ? 310 THR F N   1 
ATOM 8603 C CA  . THR H 3 126 ? 69.156 97.759   6.398  1.00 83.51  ? 310 THR F CA  1 
ATOM 8604 C C   . THR H 3 126 ? 69.483 98.798   5.328  1.00 91.58  ? 310 THR F C   1 
ATOM 8605 O O   . THR H 3 126 ? 70.205 99.765   5.612  1.00 94.28  ? 310 THR F O   1 
ATOM 8606 C CB  . THR H 3 126 ? 70.156 96.594   6.369  1.00 87.04  ? 310 THR F CB  1 
ATOM 8607 O OG1 . THR H 3 126 ? 71.451 97.064   6.768  1.00 84.08  ? 310 THR F OG1 1 
ATOM 8608 C CG2 . THR H 3 126 ? 70.246 95.952   4.987  1.00 87.48  ? 310 THR F CG2 1 
ATOM 8609 N N   . GLN H 3 127 ? 68.940 98.655   4.112  1.00 89.38  ? 311 GLN F N   1 
ATOM 8610 C CA  . GLN H 3 127 ? 69.202 99.678   3.101  1.00 91.05  ? 311 GLN F CA  1 
ATOM 8611 C C   . GLN H 3 127 ? 68.476 100.978  3.437  1.00 92.64  ? 311 GLN F C   1 
ATOM 8612 O O   . GLN H 3 127 ? 69.062 102.066  3.351  1.00 96.40  ? 311 GLN F O   1 
ATOM 8613 C CB  . GLN H 3 127 ? 68.844 99.171   1.699  1.00 87.65  ? 311 GLN F CB  1 
ATOM 8614 C CG  . GLN H 3 127 ? 67.401 98.781   1.474  1.00 90.42  ? 311 GLN F CG  1 
ATOM 8615 C CD  . GLN H 3 127 ? 66.581 99.884   0.830  1.00 99.12  ? 311 GLN F CD  1 
ATOM 8616 O OE1 . GLN H 3 127 ? 66.952 101.057  0.869  1.00 109.62 ? 311 GLN F OE1 1 
ATOM 8617 N NE2 . GLN H 3 127 ? 65.456 99.509   0.232  1.00 103.22 ? 311 GLN F NE2 1 
ATOM 8618 N N   . CYS H 3 128 ? 67.203 100.893  3.834  1.00 92.83  ? 312 CYS F N   1 
ATOM 8619 C CA  . CYS H 3 128 ? 66.471 102.104  4.186  1.00 94.97  ? 312 CYS F CA  1 
ATOM 8620 C C   . CYS H 3 128 ? 67.023 102.763  5.445  1.00 89.10  ? 312 CYS F C   1 
ATOM 8621 O O   . CYS H 3 128 ? 66.800 103.962  5.647  1.00 89.84  ? 312 CYS F O   1 
ATOM 8622 C CB  . CYS H 3 128 ? 64.984 101.787  4.368  1.00 96.41  ? 312 CYS F CB  1 
ATOM 8623 S SG  . CYS H 3 128 ? 63.897 103.235  4.446  1.00 85.13  ? 312 CYS F SG  1 
ATOM 8624 N N   . PHE H 3 129 ? 67.735 102.017  6.292  1.00 87.30  ? 313 PHE F N   1 
ATOM 8625 C CA  . PHE H 3 129 ? 68.403 102.619  7.438  1.00 86.10  ? 313 PHE F CA  1 
ATOM 8626 C C   . PHE H 3 129 ? 69.794 103.146  7.114  1.00 90.20  ? 313 PHE F C   1 
ATOM 8627 O O   . PHE H 3 129 ? 70.307 103.983  7.865  1.00 87.83  ? 313 PHE F O   1 
ATOM 8628 C CB  . PHE H 3 129 ? 68.481 101.628  8.601  1.00 80.15  ? 313 PHE F CB  1 
ATOM 8629 C CG  . PHE H 3 129 ? 67.225 101.570  9.420  1.00 76.16  ? 313 PHE F CG  1 
ATOM 8630 C CD1 . PHE H 3 129 ? 66.055 102.149  8.954  1.00 76.91  ? 313 PHE F CD1 1 
ATOM 8631 C CD2 . PHE H 3 129 ? 67.215 100.958  10.660 1.00 67.85  ? 313 PHE F CD2 1 
ATOM 8632 C CE1 . PHE H 3 129 ? 64.894 102.104  9.701  1.00 81.00  ? 313 PHE F CE1 1 
ATOM 8633 C CE2 . PHE H 3 129 ? 66.056 100.910  11.411 1.00 67.34  ? 313 PHE F CE2 1 
ATOM 8634 C CZ  . PHE H 3 129 ? 64.895 101.484  10.934 1.00 72.33  ? 313 PHE F CZ  1 
ATOM 8635 N N   . GLN H 3 130 ? 70.424 102.682  6.033  1.00 95.13  ? 314 GLN F N   1 
ATOM 8636 C CA  . GLN H 3 130 ? 71.638 103.344  5.569  1.00 100.39 ? 314 GLN F CA  1 
ATOM 8637 C C   . GLN H 3 130 ? 71.341 104.542  4.674  1.00 102.82 ? 314 GLN F C   1 
ATOM 8638 O O   . GLN H 3 130 ? 72.247 105.345  4.421  1.00 104.25 ? 314 GLN F O   1 
ATOM 8639 C CB  . GLN H 3 130 ? 72.561 102.358  4.834  1.00 102.19 ? 314 GLN F CB  1 
ATOM 8640 C CG  . GLN H 3 130 ? 72.073 101.882  3.474  1.00 106.87 ? 314 GLN F CG  1 
ATOM 8641 C CD  . GLN H 3 130 ? 72.717 102.633  2.320  1.00 106.15 ? 314 GLN F CD  1 
ATOM 8642 O OE1 . GLN H 3 130 ? 73.375 103.653  2.519  1.00 96.71  ? 314 GLN F OE1 1 
ATOM 8643 N NE2 . GLN H 3 130 ? 72.526 102.130  1.104  1.00 110.69 ? 314 GLN F NE2 1 
ATOM 8644 N N   . LYS H 3 131 ? 70.097 104.693  4.203  1.00 103.37 ? 315 LYS F N   1 
ATOM 8645 C CA  . LYS H 3 131 ? 69.684 105.901  3.487  1.00 97.12  ? 315 LYS F CA  1 
ATOM 8646 C C   . LYS H 3 131 ? 69.693 107.154  4.357  1.00 95.40  ? 315 LYS F C   1 
ATOM 8647 O O   . LYS H 3 131 ? 69.315 108.221  3.862  1.00 92.74  ? 315 LYS F O   1 
ATOM 8648 C CB  . LYS H 3 131 ? 68.281 105.723  2.897  1.00 94.93  ? 315 LYS F CB  1 
ATOM 8649 C CG  . LYS H 3 131 ? 68.230 105.495  1.394  1.00 90.67  ? 315 LYS F CG  1 
ATOM 8650 C CD  . LYS H 3 131 ? 68.825 104.162  0.994  1.00 89.86  ? 315 LYS F CD  1 
ATOM 8651 C CE  . LYS H 3 131 ? 68.442 103.807  -0.432 1.00 88.13  ? 315 LYS F CE  1 
ATOM 8652 N NZ  . LYS H 3 131 ? 68.821 104.879  -1.391 1.00 103.28 ? 315 LYS F NZ  1 
ATOM 8653 N N   . VAL H 3 132 ? 70.094 107.058  5.629  1.00 96.44  ? 316 VAL F N   1 
ATOM 8654 C CA  . VAL H 3 132 ? 70.066 108.212  6.528  1.00 98.45  ? 316 VAL F CA  1 
ATOM 8655 C C   . VAL H 3 132 ? 71.193 109.199  6.279  1.00 105.05 ? 316 VAL F C   1 
ATOM 8656 O O   . VAL H 3 132 ? 71.202 110.278  6.887  1.00 106.85 ? 316 VAL F O   1 
ATOM 8657 C CB  . VAL H 3 132 ? 70.121 107.766  8.000  1.00 93.14  ? 316 VAL F CB  1 
ATOM 8658 C CG1 . VAL H 3 132 ? 68.960 106.834  8.311  1.00 84.58  ? 316 VAL F CG1 1 
ATOM 8659 C CG2 . VAL H 3 132 ? 71.456 107.099  8.296  1.00 93.91  ? 316 VAL F CG2 1 
ATOM 8660 N N   . SER H 3 133 ? 72.150 108.865  5.421  1.00 103.71 ? 317 SER F N   1 
ATOM 8661 C CA  . SER H 3 133 ? 73.255 109.771  5.131  1.00 104.96 ? 317 SER F CA  1 
ATOM 8662 C C   . SER H 3 133 ? 72.821 110.882  4.177  1.00 99.21  ? 317 SER F C   1 
ATOM 8663 O O   . SER H 3 133 ? 72.364 111.942  4.610  1.00 97.45  ? 317 SER F O   1 
ATOM 8664 C CB  . SER H 3 133 ? 74.437 108.998  4.547  1.00 97.03  ? 317 SER F CB  1 
ATOM 8665 O OG  . SER H 3 133 ? 74.810 107.932  5.403  1.00 83.17  ? 317 SER F OG  1 
ATOM 8666 N N   . PHE I 4 13  ? 5.143  -35.784  12.850 1.00 74.37  ? 103 PHE G N   1 
ATOM 8667 C CA  . PHE I 4 13  ? 6.481  -35.222  12.701 1.00 90.57  ? 103 PHE G CA  1 
ATOM 8668 C C   . PHE I 4 13  ? 7.551  -36.305  12.782 1.00 98.52  ? 103 PHE G C   1 
ATOM 8669 O O   . PHE I 4 13  ? 7.951  -36.706  13.876 1.00 97.89  ? 103 PHE G O   1 
ATOM 8670 C CB  . PHE I 4 13  ? 6.740  -34.160  13.769 1.00 94.15  ? 103 PHE G CB  1 
ATOM 8671 C CG  . PHE I 4 13  ? 6.608  -32.750  13.270 1.00 88.65  ? 103 PHE G CG  1 
ATOM 8672 C CD1 . PHE I 4 13  ? 7.658  -32.136  12.608 1.00 87.35  ? 103 PHE G CD1 1 
ATOM 8673 C CD2 . PHE I 4 13  ? 5.440  -32.034  13.477 1.00 85.00  ? 103 PHE G CD2 1 
ATOM 8674 C CE1 . PHE I 4 13  ? 7.543  -30.838  12.151 1.00 93.42  ? 103 PHE G CE1 1 
ATOM 8675 C CE2 . PHE I 4 13  ? 5.318  -30.734  13.024 1.00 90.03  ? 103 PHE G CE2 1 
ATOM 8676 C CZ  . PHE I 4 13  ? 6.370  -30.135  12.360 1.00 97.17  ? 103 PHE G CZ  1 
ATOM 8677 N N   . MET I 4 14  ? 8.013  -36.772  11.623 1.00 110.12 ? 104 MET G N   1 
ATOM 8678 C CA  . MET I 4 14  ? 9.033  -37.812  11.589 1.00 112.17 ? 104 MET G CA  1 
ATOM 8679 C C   . MET I 4 14  ? 10.340 -37.288  12.175 1.00 107.33 ? 104 MET G C   1 
ATOM 8680 O O   . MET I 4 14  ? 10.688 -36.114  12.027 1.00 102.33 ? 104 MET G O   1 
ATOM 8681 C CB  . MET I 4 14  ? 9.249  -38.303  10.155 1.00 113.12 ? 104 MET G CB  1 
ATOM 8682 C CG  . MET I 4 14  ? 10.123 -39.553  10.024 1.00 112.08 ? 104 MET G CG  1 
ATOM 8683 S SD  . MET I 4 14  ? 9.243  -41.113  10.286 1.00 137.78 ? 104 MET G SD  1 
ATOM 8684 C CE  . MET I 4 14  ? 9.493  -41.393  12.037 1.00 109.44 ? 104 MET G CE  1 
ATOM 8685 N N   . ASP I 4 15  ? 11.068 -38.180  12.851 1.00 112.96 ? 105 ASP G N   1 
ATOM 8686 C CA  . ASP I 4 15  ? 12.266 -37.783  13.579 1.00 104.64 ? 105 ASP G CA  1 
ATOM 8687 C C   . ASP I 4 15  ? 13.476 -37.575  12.677 1.00 101.93 ? 105 ASP G C   1 
ATOM 8688 O O   . ASP I 4 15  ? 14.410 -36.874  13.080 1.00 98.47  ? 105 ASP G O   1 
ATOM 8689 C CB  . ASP I 4 15  ? 12.602 -38.823  14.651 1.00 102.73 ? 105 ASP G CB  1 
ATOM 8690 C CG  . ASP I 4 15  ? 12.549 -40.244  14.122 1.00 108.99 ? 105 ASP G CG  1 
ATOM 8691 O OD1 . ASP I 4 15  ? 11.584 -40.968  14.447 1.00 111.52 ? 105 ASP G OD1 1 
ATOM 8692 O OD2 . ASP I 4 15  ? 13.475 -40.633  13.379 1.00 105.45 ? 105 ASP G OD2 1 
ATOM 8693 N N   . SER I 4 16  ? 13.495 -38.177  11.483 1.00 102.98 ? 106 SER G N   1 
ATOM 8694 C CA  . SER I 4 16  ? 14.635 -37.994  10.587 1.00 98.92  ? 106 SER G CA  1 
ATOM 8695 C C   . SER I 4 16  ? 14.836 -36.522  10.245 1.00 96.28  ? 106 SER G C   1 
ATOM 8696 O O   . SER I 4 16  ? 15.975 -36.047  10.156 1.00 90.66  ? 106 SER G O   1 
ATOM 8697 C CB  . SER I 4 16  ? 14.443 -38.818  9.314  1.00 94.80  ? 106 SER G CB  1 
ATOM 8698 O OG  . SER I 4 16  ? 14.172 -40.175  9.620  1.00 106.81 ? 106 SER G OG  1 
ATOM 8699 N N   . ASP I 4 17  ? 13.739 -35.789  10.038 1.00 99.13  ? 107 ASP G N   1 
ATOM 8700 C CA  . ASP I 4 17  ? 13.829 -34.353  9.796  1.00 92.75  ? 107 ASP G CA  1 
ATOM 8701 C C   . ASP I 4 17  ? 14.237 -33.597  11.057 1.00 83.93  ? 107 ASP G C   1 
ATOM 8702 O O   . ASP I 4 17  ? 15.004 -32.628  10.989 1.00 82.90  ? 107 ASP G O   1 
ATOM 8703 C CB  . ASP I 4 17  ? 12.492 -33.828  9.269  1.00 95.55  ? 107 ASP G CB  1 
ATOM 8704 C CG  . ASP I 4 17  ? 11.906 -34.709  8.180  1.00 99.33  ? 107 ASP G CG  1 
ATOM 8705 O OD1 . ASP I 4 17  ? 10.663 -34.781  8.082  1.00 107.71 ? 107 ASP G OD1 1 
ATOM 8706 O OD2 . ASP I 4 17  ? 12.684 -35.335  7.429  1.00 94.57  ? 107 ASP G OD2 1 
ATOM 8707 N N   . ILE I 4 18  ? 13.732 -34.029  12.216 1.00 81.87  ? 108 ILE G N   1 
ATOM 8708 C CA  . ILE I 4 18  ? 13.994 -33.325  13.468 1.00 78.70  ? 108 ILE G CA  1 
ATOM 8709 C C   . ILE I 4 18  ? 15.454 -33.452  13.895 1.00 70.44  ? 108 ILE G C   1 
ATOM 8710 O O   . ILE I 4 18  ? 16.007 -32.532  14.508 1.00 63.61  ? 108 ILE G O   1 
ATOM 8711 C CB  . ILE I 4 18  ? 13.022 -33.833  14.553 1.00 77.35  ? 108 ILE G CB  1 
ATOM 8712 C CG1 . ILE I 4 18  ? 11.639 -33.210  14.349 1.00 72.80  ? 108 ILE G CG1 1 
ATOM 8713 C CG2 . ILE I 4 18  ? 13.537 -33.526  15.955 1.00 64.35  ? 108 ILE G CG2 1 
ATOM 8714 C CD1 . ILE I 4 18  ? 10.609 -33.652  15.361 1.00 78.95  ? 108 ILE G CD1 1 
ATOM 8715 N N   . LYS I 4 19  ? 16.116 -34.563  13.566 1.00 74.44  ? 109 LYS G N   1 
ATOM 8716 C CA  . LYS I 4 19  ? 17.534 -34.680  13.900 1.00 70.44  ? 109 LYS G CA  1 
ATOM 8717 C C   . LYS I 4 19  ? 18.387 -33.762  13.034 1.00 66.57  ? 109 LYS G C   1 
ATOM 8718 O O   . LYS I 4 19  ? 19.371 -33.187  13.514 1.00 58.65  ? 109 LYS G O   1 
ATOM 8719 C CB  . LYS I 4 19  ? 17.997 -36.133  13.778 1.00 57.55  ? 109 LYS G CB  1 
ATOM 8720 C CG  . LYS I 4 19  ? 17.917 -36.895  15.090 1.00 51.20  ? 109 LYS G CG  1 
ATOM 8721 C CD  . LYS I 4 19  ? 18.830 -36.256  16.131 1.00 48.83  ? 109 LYS G CD  1 
ATOM 8722 C CE  . LYS I 4 19  ? 18.316 -36.471  17.540 1.00 38.52  ? 109 LYS G CE  1 
ATOM 8723 N NZ  . LYS I 4 19  ? 17.128 -35.626  17.824 1.00 40.21  ? 109 LYS G NZ  1 
ATOM 8724 N N   . VAL I 4 20  ? 18.036 -33.615  11.756 1.00 72.39  ? 110 VAL G N   1 
ATOM 8725 C CA  . VAL I 4 20  ? 18.760 -32.683  10.898 1.00 71.55  ? 110 VAL G CA  1 
ATOM 8726 C C   . VAL I 4 20  ? 18.520 -31.248  11.352 1.00 64.71  ? 110 VAL G C   1 
ATOM 8727 O O   . VAL I 4 20  ? 19.456 -30.440  11.430 1.00 62.96  ? 110 VAL G O   1 
ATOM 8728 C CB  . VAL I 4 20  ? 18.358 -32.893  9.426  1.00 71.63  ? 110 VAL G CB  1 
ATOM 8729 C CG1 . VAL I 4 20  ? 19.024 -31.853  8.538  1.00 78.52  ? 110 VAL G CG1 1 
ATOM 8730 C CG2 . VAL I 4 20  ? 18.724 -34.299  8.974  1.00 73.25  ? 110 VAL G CG2 1 
ATOM 8731 N N   . LEU I 4 21  ? 17.266 -30.911  11.667 1.00 60.92  ? 111 LEU G N   1 
ATOM 8732 C CA  . LEU I 4 21  ? 16.951 -29.550  12.090 1.00 62.63  ? 111 LEU G CA  1 
ATOM 8733 C C   . LEU I 4 21  ? 17.622 -29.210  13.415 1.00 57.14  ? 111 LEU G C   1 
ATOM 8734 O O   . LEU I 4 21  ? 18.161 -28.110  13.580 1.00 54.72  ? 111 LEU G O   1 
ATOM 8735 C CB  . LEU I 4 21  ? 15.438 -29.369  12.198 1.00 57.49  ? 111 LEU G CB  1 
ATOM 8736 C CG  . LEU I 4 21  ? 14.969 -27.924  12.360 1.00 48.15  ? 111 LEU G CG  1 
ATOM 8737 C CD1 . LEU I 4 21  ? 15.357 -27.117  11.131 1.00 55.22  ? 111 LEU G CD1 1 
ATOM 8738 C CD2 . LEU I 4 21  ? 13.471 -27.849  12.606 1.00 41.80  ? 111 LEU G CD2 1 
ATOM 8739 N N   . GLU I 4 22  ? 17.600 -30.141  14.372 1.00 56.49  ? 112 GLU G N   1 
ATOM 8740 C CA  . GLU I 4 22  ? 18.274 -29.911  15.645 1.00 48.87  ? 112 GLU G CA  1 
ATOM 8741 C C   . GLU I 4 22  ? 19.788 -29.906  15.486 1.00 50.18  ? 112 GLU G C   1 
ATOM 8742 O O   . GLU I 4 22  ? 20.487 -29.250  16.265 1.00 52.61  ? 112 GLU G O   1 
ATOM 8743 C CB  . GLU I 4 22  ? 17.861 -30.970  16.667 1.00 52.19  ? 112 GLU G CB  1 
ATOM 8744 C CG  . GLU I 4 22  ? 16.618 -30.626  17.473 1.00 56.78  ? 112 GLU G CG  1 
ATOM 8745 C CD  . GLU I 4 22  ? 16.462 -31.505  18.704 1.00 60.64  ? 112 GLU G CD  1 
ATOM 8746 O OE1 . GLU I 4 22  ? 17.047 -32.610  18.720 1.00 59.26  ? 112 GLU G OE1 1 
ATOM 8747 O OE2 . GLU I 4 22  ? 15.756 -31.092  19.652 1.00 59.14  ? 112 GLU G OE2 1 
ATOM 8748 N N   . ASP I 4 23  ? 20.313 -30.648  14.509 1.00 55.02  ? 113 ASP G N   1 
ATOM 8749 C CA  . ASP I 4 23  ? 21.750 -30.634  14.256 1.00 58.46  ? 113 ASP G CA  1 
ATOM 8750 C C   . ASP I 4 23  ? 22.196 -29.276  13.726 1.00 58.44  ? 113 ASP G C   1 
ATOM 8751 O O   . ASP I 4 23  ? 23.107 -28.646  14.282 1.00 62.88  ? 113 ASP G O   1 
ATOM 8752 C CB  . ASP I 4 23  ? 22.120 -31.751  13.278 1.00 62.66  ? 113 ASP G CB  1 
ATOM 8753 C CG  . ASP I 4 23  ? 22.751 -32.951  13.968 1.00 62.09  ? 113 ASP G CG  1 
ATOM 8754 O OD1 . ASP I 4 23  ? 22.547 -33.112  15.191 1.00 61.14  ? 113 ASP G OD1 1 
ATOM 8755 O OD2 . ASP I 4 23  ? 23.449 -33.732  13.288 1.00 62.93  ? 113 ASP G OD2 1 
ATOM 8756 N N   . GLN I 4 24  ? 21.557 -28.805  12.651 1.00 55.61  ? 114 GLN G N   1 
ATOM 8757 C CA  . GLN I 4 24  ? 21.876 -27.482  12.124 1.00 54.38  ? 114 GLN G CA  1 
ATOM 8758 C C   . GLN I 4 24  ? 21.629 -26.406  13.172 1.00 52.74  ? 114 GLN G C   1 
ATOM 8759 O O   . GLN I 4 24  ? 22.397 -25.439  13.281 1.00 60.50  ? 114 GLN G O   1 
ATOM 8760 C CB  . GLN I 4 24  ? 21.040 -27.212  10.873 1.00 56.70  ? 114 GLN G CB  1 
ATOM 8761 C CG  . GLN I 4 24  ? 21.264 -25.850  10.242 1.00 61.33  ? 114 GLN G CG  1 
ATOM 8762 C CD  . GLN I 4 24  ? 20.134 -25.454  9.311  1.00 65.55  ? 114 GLN G CD  1 
ATOM 8763 O OE1 . GLN I 4 24  ? 19.017 -25.964  9.420  1.00 61.39  ? 114 GLN G OE1 1 
ATOM 8764 N NE2 . GLN I 4 24  ? 20.415 -24.535  8.393  1.00 68.35  ? 114 GLN G NE2 1 
ATOM 8765 N N   . PHE I 4 25  ? 20.581 -26.581  13.979 1.00 47.52  ? 115 PHE G N   1 
ATOM 8766 C CA  . PHE I 4 25  ? 20.271 -25.617  15.028 1.00 50.23  ? 115 PHE G CA  1 
ATOM 8767 C C   . PHE I 4 25  ? 21.391 -25.552  16.057 1.00 45.82  ? 115 PHE G C   1 
ATOM 8768 O O   . PHE I 4 25  ? 21.847 -24.467  16.426 1.00 50.18  ? 115 PHE G O   1 
ATOM 8769 C CB  . PHE I 4 25  ? 18.947 -25.987  15.695 1.00 52.14  ? 115 PHE G CB  1 
ATOM 8770 C CG  . PHE I 4 25  ? 18.426 -24.940  16.631 1.00 53.47  ? 115 PHE G CG  1 
ATOM 8771 C CD1 . PHE I 4 25  ? 17.954 -23.733  16.146 1.00 54.98  ? 115 PHE G CD1 1 
ATOM 8772 C CD2 . PHE I 4 25  ? 18.416 -25.159  17.999 1.00 51.50  ? 115 PHE G CD2 1 
ATOM 8773 C CE1 . PHE I 4 25  ? 17.474 -22.768  17.007 1.00 55.12  ? 115 PHE G CE1 1 
ATOM 8774 C CE2 . PHE I 4 25  ? 17.940 -24.195  18.866 1.00 51.59  ? 115 PHE G CE2 1 
ATOM 8775 C CZ  . PHE I 4 25  ? 17.467 -22.998  18.369 1.00 54.90  ? 115 PHE G CZ  1 
ATOM 8776 N N   . ASP I 4 26  ? 21.854 -26.712  16.526 1.00 43.63  ? 116 ASP G N   1 
ATOM 8777 C CA  . ASP I 4 26  ? 22.993 -26.735  17.436 1.00 42.61  ? 116 ASP G CA  1 
ATOM 8778 C C   . ASP I 4 26  ? 24.206 -26.066  16.807 1.00 43.19  ? 116 ASP G C   1 
ATOM 8779 O O   . ASP I 4 26  ? 24.916 -25.294  17.468 1.00 45.20  ? 116 ASP G O   1 
ATOM 8780 C CB  . ASP I 4 26  ? 23.312 -28.174  17.837 1.00 44.48  ? 116 ASP G CB  1 
ATOM 8781 C CG  . ASP I 4 26  ? 24.492 -28.268  18.781 1.00 45.23  ? 116 ASP G CG  1 
ATOM 8782 O OD1 . ASP I 4 26  ? 24.300 -28.056  19.999 1.00 42.06  ? 116 ASP G OD1 1 
ATOM 8783 O OD2 . ASP I 4 26  ? 25.609 -28.564  18.303 1.00 41.32  ? 116 ASP G OD2 1 
ATOM 8784 N N   . GLU I 4 27  ? 24.449 -26.338  15.521 1.00 45.39  ? 117 GLU G N   1 
ATOM 8785 C CA  . GLU I 4 27  ? 25.572 -25.715  14.828 1.00 51.81  ? 117 GLU G CA  1 
ATOM 8786 C C   . GLU I 4 27  ? 25.490 -24.196  14.891 1.00 47.18  ? 117 GLU G C   1 
ATOM 8787 O O   . GLU I 4 27  ? 26.479 -23.519  15.202 1.00 45.20  ? 117 GLU G O   1 
ATOM 8788 C CB  . GLU I 4 27  ? 25.616 -26.192  13.377 1.00 58.22  ? 117 GLU G CB  1 
ATOM 8789 C CG  . GLU I 4 27  ? 26.543 -25.377  12.488 1.00 71.41  ? 117 GLU G CG  1 
ATOM 8790 C CD  . GLU I 4 27  ? 28.001 -25.498  12.888 1.00 78.44  ? 117 GLU G CD  1 
ATOM 8791 O OE1 . GLU I 4 27  ? 28.412 -26.589  13.338 1.00 80.16  ? 117 GLU G OE1 1 
ATOM 8792 O OE2 . GLU I 4 27  ? 28.738 -24.497  12.750 1.00 77.64  ? 117 GLU G OE2 1 
ATOM 8793 N N   . ILE I 4 28  ? 24.308 -23.638  14.620 1.00 45.47  ? 118 ILE G N   1 
ATOM 8794 C CA  . ILE I 4 28  ? 24.197 -22.185  14.619 1.00 51.16  ? 118 ILE G CA  1 
ATOM 8795 C C   . ILE I 4 28  ? 24.233 -21.634  16.041 1.00 48.81  ? 118 ILE G C   1 
ATOM 8796 O O   . ILE I 4 28  ? 24.618 -20.477  16.251 1.00 47.36  ? 118 ILE G O   1 
ATOM 8797 C CB  . ILE I 4 28  ? 22.934 -21.731  13.866 1.00 54.09  ? 118 ILE G CB  1 
ATOM 8798 C CG1 . ILE I 4 28  ? 23.092 -20.281  13.410 1.00 55.60  ? 118 ILE G CG1 1 
ATOM 8799 C CG2 . ILE I 4 28  ? 21.714 -21.834  14.756 1.00 53.09  ? 118 ILE G CG2 1 
ATOM 8800 C CD1 . ILE I 4 28  ? 22.291 -19.948  12.182 1.00 58.39  ? 118 ILE G CD1 1 
ATOM 8801 N N   . ILE I 4 29  ? 23.833 -22.431  17.036 1.00 43.29  ? 119 ILE G N   1 
ATOM 8802 C CA  . ILE I 4 29  ? 23.905 -21.962  18.417 1.00 36.10  ? 119 ILE G CA  1 
ATOM 8803 C C   . ILE I 4 29  ? 25.355 -21.828  18.853 1.00 34.48  ? 119 ILE G C   1 
ATOM 8804 O O   . ILE I 4 29  ? 25.779 -20.772  19.339 1.00 40.93  ? 119 ILE G O   1 
ATOM 8805 C CB  . ILE I 4 29  ? 23.128 -22.898  19.359 1.00 38.82  ? 119 ILE G CB  1 
ATOM 8806 C CG1 . ILE I 4 29  ? 21.646 -22.928  18.998 1.00 44.97  ? 119 ILE G CG1 1 
ATOM 8807 C CG2 . ILE I 4 29  ? 23.285 -22.436  20.793 1.00 35.86  ? 119 ILE G CG2 1 
ATOM 8808 C CD1 . ILE I 4 29  ? 21.035 -21.569  18.870 1.00 48.29  ? 119 ILE G CD1 1 
ATOM 8809 N N   . VAL I 4 30  ? 26.146 -22.887  18.672 1.00 38.12  ? 120 VAL G N   1 
ATOM 8810 C CA  . VAL I 4 30  ? 27.541 -22.799  19.087 1.00 42.06  ? 120 VAL G CA  1 
ATOM 8811 C C   . VAL I 4 30  ? 28.295 -21.797  18.226 1.00 39.49  ? 120 VAL G C   1 
ATOM 8812 O O   . VAL I 4 30  ? 29.251 -21.160  18.693 1.00 36.80  ? 120 VAL G O   1 
ATOM 8813 C CB  . VAL I 4 30  ? 28.205 -24.187  19.056 1.00 39.91  ? 120 VAL G CB  1 
ATOM 8814 C CG1 . VAL I 4 30  ? 27.575 -25.092  20.104 1.00 37.71  ? 120 VAL G CG1 1 
ATOM 8815 C CG2 . VAL I 4 30  ? 28.093 -24.801  17.671 1.00 43.98  ? 120 VAL G CG2 1 
ATOM 8816 N N   . ASP I 4 31  ? 27.871 -21.616  16.973 1.00 42.71  ? 121 ASP G N   1 
ATOM 8817 C CA  . ASP I 4 31  ? 28.546 -20.654  16.110 1.00 46.61  ? 121 ASP G CA  1 
ATOM 8818 C C   . ASP I 4 31  ? 28.258 -19.226  16.558 1.00 41.94  ? 121 ASP G C   1 
ATOM 8819 O O   . ASP I 4 31  ? 29.180 -18.418  16.723 1.00 43.58  ? 121 ASP G O   1 
ATOM 8820 C CB  . ASP I 4 31  ? 28.125 -20.863  14.656 1.00 58.52  ? 121 ASP G CB  1 
ATOM 8821 C CG  . ASP I 4 31  ? 29.126 -20.287  13.672 1.00 61.70  ? 121 ASP G CG  1 
ATOM 8822 O OD1 . ASP I 4 31  ? 29.263 -19.047  13.616 1.00 66.67  ? 121 ASP G OD1 1 
ATOM 8823 O OD2 . ASP I 4 31  ? 29.779 -21.073  12.954 1.00 67.21  ? 121 ASP G OD2 1 
ATOM 8824 N N   . ILE I 4 32  ? 26.980 -18.902  16.779 1.00 40.11  ? 122 ILE G N   1 
ATOM 8825 C CA  . ILE I 4 32  ? 26.632 -17.549  17.200 1.00 40.86  ? 122 ILE G CA  1 
ATOM 8826 C C   . ILE I 4 32  ? 27.187 -17.258  18.587 1.00 31.22  ? 122 ILE G C   1 
ATOM 8827 O O   . ILE I 4 32  ? 27.530 -16.111  18.898 1.00 31.55  ? 122 ILE G O   1 
ATOM 8828 C CB  . ILE I 4 32  ? 25.104 -17.339  17.138 1.00 41.37  ? 122 ILE G CB  1 
ATOM 8829 C CG1 . ILE I 4 32  ? 24.765 -15.850  17.189 1.00 43.49  ? 122 ILE G CG1 1 
ATOM 8830 C CG2 . ILE I 4 32  ? 24.399 -18.056  18.275 1.00 34.83  ? 122 ILE G CG2 1 
ATOM 8831 C CD1 . ILE I 4 32  ? 25.359 -15.054  16.053 1.00 44.49  ? 122 ILE G CD1 1 
ATOM 8832 N N   . ALA I 4 33  ? 27.318 -18.283  19.430 1.00 32.96  ? 123 ALA G N   1 
ATOM 8833 C CA  . ALA I 4 33  ? 27.943 -18.086  20.733 1.00 31.82  ? 123 ALA G CA  1 
ATOM 8834 C C   . ALA I 4 33  ? 29.434 -17.801  20.594 1.00 31.49  ? 123 ALA G C   1 
ATOM 8835 O O   . ALA I 4 33  ? 29.975 -16.931  21.291 1.00 32.50  ? 123 ALA G O   1 
ATOM 8836 C CB  . ALA I 4 33  ? 27.700 -19.311  21.611 1.00 33.78  ? 123 ALA G CB  1 
ATOM 8837 N N   . THR I 4 34  ? 30.117 -18.527  19.705 1.00 36.85  ? 124 THR G N   1 
ATOM 8838 C CA  . THR I 4 34  ? 31.530 -18.252  19.458 1.00 37.42  ? 124 THR G CA  1 
ATOM 8839 C C   . THR I 4 34  ? 31.731 -16.834  18.933 1.00 35.70  ? 124 THR G C   1 
ATOM 8840 O O   . THR I 4 34  ? 32.634 -16.116  19.388 1.00 36.09  ? 124 THR G O   1 
ATOM 8841 C CB  . THR I 4 34  ? 32.099 -19.281  18.479 1.00 39.64  ? 124 THR G CB  1 
ATOM 8842 O OG1 . THR I 4 34  ? 31.761 -20.603  18.924 1.00 29.92  ? 124 THR G OG1 1 
ATOM 8843 C CG2 . THR I 4 34  ? 33.613 -19.154  18.384 1.00 44.17  ? 124 THR G CG2 1 
ATOM 8844 N N   . LYS I 4 35  ? 30.890 -16.411  17.984 1.00 35.29  ? 125 LYS G N   1 
ATOM 8845 C CA  . LYS I 4 35  ? 30.929 -15.032  17.507 1.00 33.92  ? 125 LYS G CA  1 
ATOM 8846 C C   . LYS I 4 35  ? 30.765 -14.061  18.670 1.00 31.79  ? 125 LYS G C   1 
ATOM 8847 O O   . LYS I 4 35  ? 31.638 -13.219  18.926 1.00 33.32  ? 125 LYS G O   1 
ATOM 8848 C CB  . LYS I 4 35  ? 29.830 -14.806  16.465 1.00 35.84  ? 125 LYS G CB  1 
ATOM 8849 C CG  . LYS I 4 35  ? 29.904 -15.695  15.231 1.00 42.60  ? 125 LYS G CG  1 
ATOM 8850 C CD  . LYS I 4 35  ? 31.103 -15.353  14.369 1.00 50.02  ? 125 LYS G CD  1 
ATOM 8851 C CE  . LYS I 4 35  ? 31.319 -16.369  13.253 1.00 53.14  ? 125 LYS G CE  1 
ATOM 8852 N NZ  . LYS I 4 35  ? 30.326 -16.220  12.153 1.00 50.23  ? 125 LYS G NZ  1 
ATOM 8853 N N   . ARG I 4 36  ? 29.657 -14.202  19.409 1.00 29.96  ? 126 ARG G N   1 
ATOM 8854 C CA  . ARG I 4 36  ? 29.364 -13.339  20.550 1.00 26.94  ? 126 ARG G CA  1 
ATOM 8855 C C   . ARG I 4 36  ? 30.556 -13.232  21.488 1.00 27.04  ? 126 ARG G C   1 
ATOM 8856 O O   . ARG I 4 36  ? 30.796 -12.176  22.084 1.00 28.79  ? 126 ARG G O   1 
ATOM 8857 C CB  . ARG I 4 36  ? 28.160 -13.886  21.318 1.00 24.91  ? 126 ARG G CB  1 
ATOM 8858 C CG  . ARG I 4 36  ? 26.803 -13.530  20.755 1.00 24.10  ? 126 ARG G CG  1 
ATOM 8859 C CD  . ARG I 4 36  ? 25.809 -14.614  21.129 1.00 25.28  ? 126 ARG G CD  1 
ATOM 8860 N NE  . ARG I 4 36  ? 24.428 -14.274  20.805 1.00 32.71  ? 126 ARG G NE  1 
ATOM 8861 C CZ  . ARG I 4 36  ? 23.416 -14.373  21.661 1.00 34.59  ? 126 ARG G CZ  1 
ATOM 8862 N NH1 . ARG I 4 36  ? 23.632 -14.812  22.893 1.00 36.66  ? 126 ARG G NH1 1 
ATOM 8863 N NH2 . ARG I 4 36  ? 22.187 -14.049  21.281 1.00 34.58  ? 126 ARG G NH2 1 
ATOM 8864 N N   . LYS I 4 37  ? 31.311 -14.319  21.640 1.00 32.58  ? 127 LYS G N   1 
ATOM 8865 C CA  . LYS I 4 37  ? 32.447 -14.290  22.560 1.00 37.85  ? 127 LYS G CA  1 
ATOM 8866 C C   . LYS I 4 37  ? 33.648 -13.574  21.948 1.00 31.66  ? 127 LYS G C   1 
ATOM 8867 O O   . LYS I 4 37  ? 34.028 -12.488  22.396 1.00 35.03  ? 127 LYS G O   1 
ATOM 8868 C CB  . LYS I 4 37  ? 32.826 -15.711  22.993 1.00 38.49  ? 127 LYS G CB  1 
ATOM 8869 C CG  . LYS I 4 37  ? 34.057 -15.747  23.897 1.00 37.94  ? 127 LYS G CG  1 
ATOM 8870 C CD  . LYS I 4 37  ? 34.251 -17.083  24.590 1.00 32.76  ? 127 LYS G CD  1 
ATOM 8871 C CE  . LYS I 4 37  ? 35.628 -17.160  25.242 1.00 35.64  ? 127 LYS G CE  1 
ATOM 8872 N NZ  . LYS I 4 37  ? 35.661 -18.102  26.397 1.00 40.85  ? 127 LYS G NZ  1 
ATOM 8873 N N   . GLN I 4 38  ? 34.257 -14.163  20.916 1.00 35.03  ? 128 GLN G N   1 
ATOM 8874 C CA  . GLN I 4 38  ? 35.596 -13.739  20.515 1.00 41.41  ? 128 GLN G CA  1 
ATOM 8875 C C   . GLN I 4 38  ? 35.619 -12.705  19.391 1.00 41.80  ? 128 GLN G C   1 
ATOM 8876 O O   . GLN I 4 38  ? 36.700 -12.199  19.067 1.00 38.32  ? 128 GLN G O   1 
ATOM 8877 C CB  . GLN I 4 38  ? 36.451 -14.955  20.127 1.00 44.92  ? 128 GLN G CB  1 
ATOM 8878 C CG  . GLN I 4 38  ? 36.179 -15.549  18.761 1.00 51.63  ? 128 GLN G CG  1 
ATOM 8879 C CD  . GLN I 4 38  ? 37.180 -16.638  18.408 1.00 73.25  ? 128 GLN G CD  1 
ATOM 8880 O OE1 . GLN I 4 38  ? 37.674 -17.351  19.285 1.00 80.93  ? 128 GLN G OE1 1 
ATOM 8881 N NE2 . GLN I 4 38  ? 37.495 -16.762  17.121 1.00 71.39  ? 128 GLN G NE2 1 
ATOM 8882 N N   . TYR I 4 39  ? 34.468 -12.375  18.790 1.00 39.99  ? 129 TYR G N   1 
ATOM 8883 C CA  . TYR I 4 39  ? 34.463 -11.321  17.774 1.00 35.25  ? 129 TYR G CA  1 
ATOM 8884 C C   . TYR I 4 39  ? 34.682 -9.932   18.367 1.00 35.92  ? 129 TYR G C   1 
ATOM 8885 O O   . TYR I 4 39  ? 35.495 -9.168   17.810 1.00 37.09  ? 129 TYR G O   1 
ATOM 8886 C CB  . TYR I 4 39  ? 33.166 -11.391  16.963 1.00 36.50  ? 129 TYR G CB  1 
ATOM 8887 C CG  . TYR I 4 39  ? 33.310 -12.109  15.645 1.00 38.57  ? 129 TYR G CG  1 
ATOM 8888 C CD1 . TYR I 4 39  ? 34.099 -13.244  15.539 1.00 39.39  ? 129 TYR G CD1 1 
ATOM 8889 C CD2 . TYR I 4 39  ? 32.642 -11.663  14.512 1.00 38.50  ? 129 TYR G CD2 1 
ATOM 8890 C CE1 . TYR I 4 39  ? 34.237 -13.905  14.339 1.00 46.63  ? 129 TYR G CE1 1 
ATOM 8891 C CE2 . TYR I 4 39  ? 32.771 -12.321  13.305 1.00 44.46  ? 129 TYR G CE2 1 
ATOM 8892 C CZ  . TYR I 4 39  ? 33.571 -13.441  13.224 1.00 46.80  ? 129 TYR G CZ  1 
ATOM 8893 O OH  . TYR I 4 39  ? 33.707 -14.112  12.031 1.00 54.24  ? 129 TYR G OH  1 
ATOM 8894 N N   . PRO I 4 40  ? 34.012 -9.529   19.458 1.00 32.71  ? 130 PRO G N   1 
ATOM 8895 C CA  . PRO I 4 40  ? 34.264 -8.186   20.004 1.00 31.28  ? 130 PRO G CA  1 
ATOM 8896 C C   . PRO I 4 40  ? 35.715 -7.925   20.353 1.00 34.05  ? 130 PRO G C   1 
ATOM 8897 O O   . PRO I 4 40  ? 36.149 -6.769   20.313 1.00 39.58  ? 130 PRO G O   1 
ATOM 8898 C CB  . PRO I 4 40  ? 33.379 -8.147   21.256 1.00 30.25  ? 130 PRO G CB  1 
ATOM 8899 C CG  . PRO I 4 40  ? 32.298 -9.105   20.978 1.00 31.37  ? 130 PRO G CG  1 
ATOM 8900 C CD  . PRO I 4 40  ? 32.927 -10.208  20.192 1.00 32.35  ? 130 PRO G CD  1 
ATOM 8901 N N   . ARG I 4 41  ? 36.485 -8.962   20.682 1.00 33.37  ? 131 ARG G N   1 
ATOM 8902 C CA  . ARG I 4 41  ? 37.882 -8.746   21.041 1.00 37.68  ? 131 ARG G CA  1 
ATOM 8903 C C   . ARG I 4 41  ? 38.727 -8.426   19.811 1.00 36.09  ? 131 ARG G C   1 
ATOM 8904 O O   . ARG I 4 41  ? 39.594 -7.545   19.857 1.00 37.68  ? 131 ARG G O   1 
ATOM 8905 C CB  . ARG I 4 41  ? 38.425 -9.972   21.776 1.00 49.09  ? 131 ARG G CB  1 
ATOM 8906 C CG  . ARG I 4 41  ? 37.814 -10.184  23.161 1.00 58.20  ? 131 ARG G CG  1 
ATOM 8907 C CD  . ARG I 4 41  ? 37.926 -11.637  23.624 1.00 58.28  ? 131 ARG G CD  1 
ATOM 8908 N NE  . ARG I 4 41  ? 39.300 -12.012  23.956 1.00 65.05  ? 131 ARG G NE  1 
ATOM 8909 C CZ  . ARG I 4 41  ? 40.020 -12.897  23.272 1.00 60.39  ? 131 ARG G CZ  1 
ATOM 8910 N NH1 . ARG I 4 41  ? 39.497 -13.503  22.215 1.00 59.02  ? 131 ARG G NH1 1 
ATOM 8911 N NH2 . ARG I 4 41  ? 41.263 -13.176  23.644 1.00 47.43  ? 131 ARG G NH2 1 
ATOM 8912 N N   . LYS I 4 42  ? 38.490 -9.130   18.703 1.00 35.76  ? 132 LYS G N   1 
ATOM 8913 C CA  . LYS I 4 42  ? 39.243 -8.858   17.482 1.00 37.13  ? 132 LYS G CA  1 
ATOM 8914 C C   . LYS I 4 42  ? 38.835 -7.523   16.873 1.00 35.60  ? 132 LYS G C   1 
ATOM 8915 O O   . LYS I 4 42  ? 39.693 -6.727   16.461 1.00 42.89  ? 132 LYS G O   1 
ATOM 8916 C CB  . LYS I 4 42  ? 39.057 -10.003  16.486 1.00 49.27  ? 132 LYS G CB  1 
ATOM 8917 C CG  . LYS I 4 42  ? 39.661 -11.324  16.967 1.00 48.53  ? 132 LYS G CG  1 
ATOM 8918 C CD  . LYS I 4 42  ? 39.749 -12.354  15.852 1.00 43.02  ? 132 LYS G CD  1 
ATOM 8919 C CE  . LYS I 4 42  ? 38.384 -12.640  15.252 1.00 47.11  ? 132 LYS G CE  1 
ATOM 8920 N NZ  . LYS I 4 42  ? 37.445 -13.220  16.250 1.00 49.61  ? 132 LYS G NZ  1 
ATOM 8921 N N   . ILE I 4 43  ? 37.526 -7.264   16.797 1.00 35.29  ? 133 ILE G N   1 
ATOM 8922 C CA  . ILE I 4 43  ? 37.064 -5.947   16.360 1.00 38.23  ? 133 ILE G CA  1 
ATOM 8923 C C   . ILE I 4 43  ? 37.678 -4.861   17.235 1.00 31.93  ? 133 ILE G C   1 
ATOM 8924 O O   . ILE I 4 43  ? 38.124 -3.816   16.743 1.00 25.09  ? 133 ILE G O   1 
ATOM 8925 C CB  . ILE I 4 43  ? 35.526 -5.883   16.379 1.00 35.40  ? 133 ILE G CB  1 
ATOM 8926 C CG1 . ILE I 4 43  ? 34.931 -6.865   15.370 1.00 30.06  ? 133 ILE G CG1 1 
ATOM 8927 C CG2 . ILE I 4 43  ? 35.052 -4.467   16.096 1.00 36.81  ? 133 ILE G CG2 1 
ATOM 8928 C CD1 . ILE I 4 43  ? 33.437 -7.035   15.511 1.00 29.03  ? 133 ILE G CD1 1 
ATOM 8929 N N   . LEU I 4 44  ? 37.721 -5.104   18.546 1.00 33.34  ? 134 LEU G N   1 
ATOM 8930 C CA  . LEU I 4 44  ? 38.344 -4.168   19.472 1.00 31.85  ? 134 LEU G CA  1 
ATOM 8931 C C   . LEU I 4 44  ? 39.799 -3.920   19.098 1.00 33.48  ? 134 LEU G C   1 
ATOM 8932 O O   . LEU I 4 44  ? 40.260 -2.776   19.086 1.00 40.82  ? 134 LEU G O   1 
ATOM 8933 C CB  . LEU I 4 44  ? 38.236 -4.708   20.896 1.00 30.88  ? 134 LEU G CB  1 
ATOM 8934 C CG  . LEU I 4 44  ? 38.459 -3.734   22.047 1.00 32.13  ? 134 LEU G CG  1 
ATOM 8935 C CD1 . LEU I 4 44  ? 37.221 -2.879   22.251 1.00 37.36  ? 134 LEU G CD1 1 
ATOM 8936 C CD2 . LEU I 4 44  ? 38.805 -4.504   23.310 1.00 40.18  ? 134 LEU G CD2 1 
ATOM 8937 N N   . GLU I 4 45  ? 40.542 -4.988   18.797 1.00 33.62  ? 135 GLU G N   1 
ATOM 8938 C CA  . GLU I 4 45  ? 41.913 -4.831   18.315 1.00 34.00  ? 135 GLU G CA  1 
ATOM 8939 C C   . GLU I 4 45  ? 41.963 -3.901   17.108 1.00 30.13  ? 135 GLU G C   1 
ATOM 8940 O O   . GLU I 4 45  ? 42.821 -3.006   17.026 1.00 39.32  ? 135 GLU G O   1 
ATOM 8941 C CB  . GLU I 4 45  ? 42.494 -6.204   17.975 1.00 50.11  ? 135 GLU G CB  1 
ATOM 8942 C CG  . GLU I 4 45  ? 43.944 -6.206   17.535 1.00 57.24  ? 135 GLU G CG  1 
ATOM 8943 C CD  . GLU I 4 45  ? 44.470 -7.618   17.339 1.00 56.84  ? 135 GLU G CD  1 
ATOM 8944 O OE1 . GLU I 4 45  ? 44.052 -8.518   18.101 1.00 41.34  ? 135 GLU G OE1 1 
ATOM 8945 O OE2 . GLU I 4 45  ? 45.294 -7.831   16.425 1.00 65.02  ? 135 GLU G OE2 1 
ATOM 8946 N N   . CYS I 4 46  ? 41.034 -4.089   16.167 1.00 27.88  ? 136 CYS G N   1 
ATOM 8947 C CA  . CYS I 4 46  ? 40.982 -3.217   14.998 1.00 36.84  ? 136 CYS G CA  1 
ATOM 8948 C C   . CYS I 4 46  ? 40.783 -1.756   15.396 1.00 44.88  ? 136 CYS G C   1 
ATOM 8949 O O   . CYS I 4 46  ? 41.526 -0.874   14.946 1.00 45.72  ? 136 CYS G O   1 
ATOM 8950 C CB  . CYS I 4 46  ? 39.875 -3.674   14.049 1.00 35.72  ? 136 CYS G CB  1 
ATOM 8951 S SG  . CYS I 4 46  ? 40.363 -5.041   12.984 1.00 49.52  ? 136 CYS G SG  1 
ATOM 8952 N N   . VAL I 4 47  ? 39.792 -1.475   16.249 1.00 42.19  ? 137 VAL G N   1 
ATOM 8953 C CA  . VAL I 4 47  ? 39.518 -0.078   16.580 1.00 32.37  ? 137 VAL G CA  1 
ATOM 8954 C C   . VAL I 4 47  ? 40.665 0.520    17.386 1.00 31.10  ? 137 VAL G C   1 
ATOM 8955 O O   . VAL I 4 47  ? 40.913 1.730    17.319 1.00 39.95  ? 137 VAL G O   1 
ATOM 8956 C CB  . VAL I 4 47  ? 38.168 0.073    17.312 1.00 29.71  ? 137 VAL G CB  1 
ATOM 8957 C CG1 . VAL I 4 47  ? 37.076 -0.677   16.572 1.00 34.39  ? 137 VAL G CG1 1 
ATOM 8958 C CG2 . VAL I 4 47  ? 38.260 -0.384   18.758 1.00 33.85  ? 137 VAL G CG2 1 
ATOM 8959 N N   . ILE I 4 48  ? 41.391 -0.306   18.142 1.00 27.19  ? 138 ILE G N   1 
ATOM 8960 C CA  . ILE I 4 48  ? 42.587 0.177    18.823 1.00 31.07  ? 138 ILE G CA  1 
ATOM 8961 C C   . ILE I 4 48  ? 43.612 0.642    17.802 1.00 29.50  ? 138 ILE G C   1 
ATOM 8962 O O   . ILE I 4 48  ? 44.265 1.677    17.983 1.00 31.89  ? 138 ILE G O   1 
ATOM 8963 C CB  . ILE I 4 48  ? 43.163 -0.909   19.751 1.00 32.68  ? 138 ILE G CB  1 
ATOM 8964 C CG1 . ILE I 4 48  ? 42.184 -1.226   20.882 1.00 28.79  ? 138 ILE G CG1 1 
ATOM 8965 C CG2 . ILE I 4 48  ? 44.507 -0.476   20.318 1.00 34.65  ? 138 ILE G CG2 1 
ATOM 8966 C CD1 . ILE I 4 48  ? 41.812 -0.027   21.707 1.00 43.36  ? 138 ILE G CD1 1 
ATOM 8967 N N   . LYS I 4 49  ? 43.775 -0.116   16.715 1.00 29.91  ? 139 LYS G N   1 
ATOM 8968 C CA  . LYS I 4 49  ? 44.623 0.370    15.629 1.00 34.10  ? 139 LYS G CA  1 
ATOM 8969 C C   . LYS I 4 49  ? 44.089 1.681    15.051 1.00 35.72  ? 139 LYS G C   1 
ATOM 8970 O O   . LYS I 4 49  ? 44.858 2.625    14.808 1.00 32.20  ? 139 LYS G O   1 
ATOM 8971 C CB  . LYS I 4 49  ? 44.749 -0.694   14.537 1.00 32.35  ? 139 LYS G CB  1 
ATOM 8972 C CG  . LYS I 4 49  ? 45.929 -1.634   14.730 1.00 33.09  ? 139 LYS G CG  1 
ATOM 8973 C CD  . LYS I 4 49  ? 46.207 -2.451   13.479 1.00 47.94  ? 139 LYS G CD  1 
ATOM 8974 C CE  . LYS I 4 49  ? 47.507 -3.240   13.604 1.00 46.52  ? 139 LYS G CE  1 
ATOM 8975 N NZ  . LYS I 4 49  ? 47.892 -3.906   12.323 1.00 36.76  ? 139 LYS G NZ  1 
ATOM 8976 N N   . THR I 4 50  ? 42.768 1.769    14.852 1.00 33.91  ? 140 THR G N   1 
ATOM 8977 C CA  . THR I 4 50  ? 42.197 2.911    14.141 1.00 36.34  ? 140 THR G CA  1 
ATOM 8978 C C   . THR I 4 50  ? 42.360 4.206    14.926 1.00 37.47  ? 140 THR G C   1 
ATOM 8979 O O   . THR I 4 50  ? 42.767 5.226    14.365 1.00 37.49  ? 140 THR G O   1 
ATOM 8980 C CB  . THR I 4 50  ? 40.712 2.686    13.849 1.00 41.67  ? 140 THR G CB  1 
ATOM 8981 O OG1 . THR I 4 50  ? 39.985 2.655    15.083 1.00 54.37  ? 140 THR G OG1 1 
ATOM 8982 C CG2 . THR I 4 50  ? 40.487 1.397    13.104 1.00 37.03  ? 140 THR G CG2 1 
ATOM 8983 N N   . ILE I 4 51  ? 42.020 4.198    16.218 1.00 35.86  ? 141 ILE G N   1 
ATOM 8984 C CA  . ILE I 4 51  ? 42.066 5.443    16.981 1.00 32.49  ? 141 ILE G CA  1 
ATOM 8985 C C   . ILE I 4 51  ? 43.492 5.969    17.075 1.00 33.87  ? 141 ILE G C   1 
ATOM 8986 O O   . ILE I 4 51  ? 43.714 7.189    17.080 1.00 38.86  ? 141 ILE G O   1 
ATOM 8987 C CB  . ILE I 4 51  ? 41.427 5.254    18.374 1.00 33.42  ? 141 ILE G CB  1 
ATOM 8988 C CG1 . ILE I 4 51  ? 42.237 4.283    19.234 1.00 37.00  ? 141 ILE G CG1 1 
ATOM 8989 C CG2 . ILE I 4 51  ? 39.988 4.776    18.244 1.00 30.61  ? 141 ILE G CG2 1 
ATOM 8990 C CD1 . ILE I 4 51  ? 41.823 4.280    20.695 1.00 40.27  ? 141 ILE G CD1 1 
ATOM 8991 N N   . LYS I 4 52  ? 44.483 5.074    17.122 1.00 36.06  ? 142 LYS G N   1 
ATOM 8992 C CA  . LYS I 4 52  ? 45.869 5.530    17.136 1.00 42.52  ? 142 LYS G CA  1 
ATOM 8993 C C   . LYS I 4 52  ? 46.274 6.088    15.778 1.00 44.32  ? 142 LYS G C   1 
ATOM 8994 O O   . LYS I 4 52  ? 46.942 7.129    15.700 1.00 44.81  ? 142 LYS G O   1 
ATOM 8995 C CB  . LYS I 4 52  ? 46.806 4.395    17.553 1.00 36.55  ? 142 LYS G CB  1 
ATOM 8996 C CG  . LYS I 4 52  ? 48.257 4.645    17.160 1.00 39.67  ? 142 LYS G CG  1 
ATOM 8997 C CD  . LYS I 4 52  ? 49.215 3.637    17.776 1.00 51.91  ? 142 LYS G CD  1 
ATOM 8998 C CE  . LYS I 4 52  ? 50.659 4.123    17.656 1.00 52.29  ? 142 LYS G CE  1 
ATOM 8999 N NZ  . LYS I 4 52  ? 51.639 3.208    18.307 1.00 37.57  ? 142 LYS G NZ  1 
ATOM 9000 N N   . ALA I 4 53  ? 45.856 5.428    14.693 1.00 46.60  ? 143 ALA G N   1 
ATOM 9001 C CA  . ALA I 4 53  ? 46.159 5.959    13.368 1.00 47.18  ? 143 ALA G CA  1 
ATOM 9002 C C   . ALA I 4 53  ? 45.539 7.339    13.179 1.00 41.28  ? 143 ALA G C   1 
ATOM 9003 O O   . ALA I 4 53  ? 46.192 8.258    12.672 1.00 38.70  ? 143 ALA G O   1 
ATOM 9004 C CB  . ALA I 4 53  ? 45.671 4.990    12.291 1.00 46.96  ? 143 ALA G CB  1 
ATOM 9005 N N   . LYS I 4 54  ? 44.286 7.506    13.610 1.00 42.36  ? 144 LYS G N   1 
ATOM 9006 C CA  . LYS I 4 54  ? 43.599 8.785    13.468 1.00 40.21  ? 144 LYS G CA  1 
ATOM 9007 C C   . LYS I 4 54  ? 44.263 9.866    14.308 1.00 42.40  ? 144 LYS G C   1 
ATOM 9008 O O   . LYS I 4 54  ? 44.425 11.003   13.849 1.00 48.30  ? 144 LYS G O   1 
ATOM 9009 C CB  . LYS I 4 54  ? 42.127 8.643    13.861 1.00 36.99  ? 144 LYS G CB  1 
ATOM 9010 C CG  . LYS I 4 54  ? 41.235 8.074    12.771 1.00 41.81  ? 144 LYS G CG  1 
ATOM 9011 C CD  . LYS I 4 54  ? 39.763 8.319    13.078 1.00 44.93  ? 144 LYS G CD  1 
ATOM 9012 C CE  . LYS I 4 54  ? 39.179 7.243    13.979 1.00 51.62  ? 144 LYS G CE  1 
ATOM 9013 N NZ  . LYS I 4 54  ? 37.778 7.567    14.377 1.00 49.16  ? 144 LYS G NZ  1 
ATOM 9014 N N   . GLN I 4 55  ? 44.641 9.540    15.546 1.00 41.05  ? 145 GLN G N   1 
ATOM 9015 C CA  . GLN I 4 55  ? 45.294 10.538   16.384 1.00 46.95  ? 145 GLN G CA  1 
ATOM 9016 C C   . GLN I 4 55  ? 46.629 10.965   15.786 1.00 53.69  ? 145 GLN G C   1 
ATOM 9017 O O   . GLN I 4 55  ? 46.962 12.158   15.768 1.00 62.67  ? 145 GLN G O   1 
ATOM 9018 C CB  . GLN I 4 55  ? 45.492 9.997    17.798 1.00 52.80  ? 145 GLN G CB  1 
ATOM 9019 C CG  . GLN I 4 55  ? 45.537 11.077   18.868 1.00 61.48  ? 145 GLN G CG  1 
ATOM 9020 C CD  . GLN I 4 55  ? 46.933 11.292   19.424 1.00 64.26  ? 145 GLN G CD  1 
ATOM 9021 O OE1 . GLN I 4 55  ? 47.864 10.557   19.097 1.00 54.92  ? 145 GLN G OE1 1 
ATOM 9022 N NE2 . GLN I 4 55  ? 47.081 12.302   20.275 1.00 70.51  ? 145 GLN G NE2 1 
ATOM 9023 N N   . GLU I 4 56  ? 47.403 10.005   15.273 1.00 53.19  ? 146 GLU G N   1 
ATOM 9024 C CA  . GLU I 4 56  ? 48.710 10.354   14.729 1.00 56.18  ? 146 GLU G CA  1 
ATOM 9025 C C   . GLU I 4 56  ? 48.578 11.165   13.445 1.00 55.29  ? 146 GLU G C   1 
ATOM 9026 O O   . GLU I 4 56  ? 49.302 12.150   13.256 1.00 56.04  ? 146 GLU G O   1 
ATOM 9027 C CB  . GLU I 4 56  ? 49.547 9.099    14.495 1.00 63.28  ? 146 GLU G CB  1 
ATOM 9028 C CG  . GLU I 4 56  ? 51.036 9.340    14.705 1.00 71.29  ? 146 GLU G CG  1 
ATOM 9029 C CD  . GLU I 4 56  ? 51.744 9.791    13.442 1.00 82.90  ? 146 GLU G CD  1 
ATOM 9030 O OE1 . GLU I 4 56  ? 51.234 9.509    12.337 1.00 83.86  ? 146 GLU G OE1 1 
ATOM 9031 O OE2 . GLU I 4 56  ? 52.804 10.443   13.557 1.00 87.35  ? 146 GLU G OE2 1 
ATOM 9032 N N   . ILE I 4 57  ? 47.662 10.779   12.549 1.00 57.02  ? 147 ILE G N   1 
ATOM 9033 C CA  . ILE I 4 57  ? 47.488 11.569   11.334 1.00 56.62  ? 147 ILE G CA  1 
ATOM 9034 C C   . ILE I 4 57  ? 46.902 12.935   11.661 1.00 53.29  ? 147 ILE G C   1 
ATOM 9035 O O   . ILE I 4 57  ? 47.087 13.885   10.892 1.00 58.11  ? 147 ILE G O   1 
ATOM 9036 C CB  . ILE I 4 57  ? 46.622 10.834   10.286 1.00 54.79  ? 147 ILE G CB  1 
ATOM 9037 C CG1 . ILE I 4 57  ? 45.182 10.639   10.778 1.00 54.57  ? 147 ILE G CG1 1 
ATOM 9038 C CG2 . ILE I 4 57  ? 47.256 9.498    9.900  1.00 47.40  ? 147 ILE G CG2 1 
ATOM 9039 C CD1 . ILE I 4 57  ? 44.189 11.686   10.281 1.00 44.62  ? 147 ILE G CD1 1 
ATOM 9040 N N   . LEU I 4 58  ? 46.197 13.060   12.788 1.00 53.40  ? 148 LEU G N   1 
ATOM 9041 C CA  . LEU I 4 58  ? 45.784 14.380   13.250 1.00 60.71  ? 148 LEU G CA  1 
ATOM 9042 C C   . LEU I 4 58  ? 46.994 15.213   13.649 1.00 56.90  ? 148 LEU G C   1 
ATOM 9043 O O   . LEU I 4 58  ? 47.130 16.370   13.238 1.00 55.10  ? 148 LEU G O   1 
ATOM 9044 C CB  . LEU I 4 58  ? 44.812 14.257   14.422 1.00 57.94  ? 148 LEU G CB  1 
ATOM 9045 C CG  . LEU I 4 58  ? 44.341 15.590   15.008 1.00 49.37  ? 148 LEU G CG  1 
ATOM 9046 C CD1 . LEU I 4 58  ? 43.152 16.160   14.243 1.00 47.89  ? 148 LEU G CD1 1 
ATOM 9047 C CD2 . LEU I 4 58  ? 44.014 15.427   16.481 1.00 52.36  ? 148 LEU G CD2 1 
ATOM 9048 N N   . LYS I 4 59  ? 47.892 14.634   14.450 1.00 58.20  ? 149 LYS G N   1 
ATOM 9049 C CA  . LYS I 4 59  ? 49.068 15.373   14.891 1.00 57.73  ? 149 LYS G CA  1 
ATOM 9050 C C   . LYS I 4 59  ? 50.024 15.689   13.745 1.00 59.32  ? 149 LYS G C   1 
ATOM 9051 O O   . LYS I 4 59  ? 50.807 16.638   13.856 1.00 65.08  ? 149 LYS G O   1 
ATOM 9052 C CB  . LYS I 4 59  ? 49.801 14.592   15.981 1.00 62.29  ? 149 LYS G CB  1 
ATOM 9053 C CG  . LYS I 4 59  ? 48.939 14.274   17.191 1.00 61.14  ? 149 LYS G CG  1 
ATOM 9054 C CD  . LYS I 4 59  ? 49.749 14.343   18.472 1.00 59.75  ? 149 LYS G CD  1 
ATOM 9055 C CE  . LYS I 4 59  ? 50.237 15.755   18.744 1.00 61.40  ? 149 LYS G CE  1 
ATOM 9056 N NZ  . LYS I 4 59  ? 50.981 15.834   20.031 1.00 64.80  ? 149 LYS G NZ  1 
ATOM 9057 N N   . GLN I 4 60  ? 50.002 14.907   12.660 1.00 63.86  ? 150 GLN G N   1 
ATOM 9058 C CA  . GLN I 4 60  ? 50.834 15.234   11.505 1.00 67.43  ? 150 GLN G CA  1 
ATOM 9059 C C   . GLN I 4 60  ? 50.332 16.469   10.772 1.00 72.51  ? 150 GLN G C   1 
ATOM 9060 O O   . GLN I 4 60  ? 51.085 17.067   9.997  1.00 76.69  ? 150 GLN G O   1 
ATOM 9061 C CB  . GLN I 4 60  ? 50.911 14.053   10.533 1.00 71.21  ? 150 GLN G CB  1 
ATOM 9062 C CG  . GLN I 4 60  ? 52.103 14.133   9.578  1.00 79.34  ? 150 GLN G CG  1 
ATOM 9063 C CD  . GLN I 4 60  ? 52.016 13.153   8.420  1.00 83.97  ? 150 GLN G CD  1 
ATOM 9064 O OE1 . GLN I 4 60  ? 51.441 12.072   8.544  1.00 83.76  ? 150 GLN G OE1 1 
ATOM 9065 N NE2 . GLN I 4 60  ? 52.592 13.534   7.281  1.00 67.92  ? 150 GLN G NE2 1 
ATOM 9066 N N   . TYR I 4 61  ? 49.080 16.862   11.001 1.00 71.15  ? 151 TYR G N   1 
ATOM 9067 C CA  . TYR I 4 61  ? 48.552 18.091   10.427 1.00 73.57  ? 151 TYR G CA  1 
ATOM 9068 C C   . TYR I 4 61  ? 49.000 19.322   11.200 1.00 86.03  ? 151 TYR G C   1 
ATOM 9069 O O   . TYR I 4 61  ? 48.783 20.443   10.724 1.00 91.06  ? 151 TYR G O   1 
ATOM 9070 C CB  . TYR I 4 61  ? 47.020 18.024   10.369 1.00 67.25  ? 151 TYR G CB  1 
ATOM 9071 C CG  . TYR I 4 61  ? 46.347 19.287   9.875  1.00 68.15  ? 151 TYR G CG  1 
ATOM 9072 C CD1 . TYR I 4 61  ? 45.646 20.108   10.750 1.00 77.53  ? 151 TYR G CD1 1 
ATOM 9073 C CD2 . TYR I 4 61  ? 46.428 19.668   8.543  1.00 76.52  ? 151 TYR G CD2 1 
ATOM 9074 C CE1 . TYR I 4 61  ? 45.034 21.269   10.310 1.00 78.67  ? 151 TYR G CE1 1 
ATOM 9075 C CE2 . TYR I 4 61  ? 45.816 20.830   8.092  1.00 90.21  ? 151 TYR G CE2 1 
ATOM 9076 C CZ  . TYR I 4 61  ? 45.120 21.626   8.981  1.00 86.06  ? 151 TYR G CZ  1 
ATOM 9077 O OH  . TYR I 4 61  ? 44.510 22.780   8.544  1.00 80.98  ? 151 TYR G OH  1 
ATOM 9078 N N   . HIS I 4 62  ? 49.635 19.133   12.359 1.00 87.93  ? 152 HIS G N   1 
ATOM 9079 C CA  . HIS I 4 62  ? 50.137 20.255   13.150 1.00 91.78  ? 152 HIS G CA  1 
ATOM 9080 C C   . HIS I 4 62  ? 50.891 21.279   12.309 1.00 99.05  ? 152 HIS G C   1 
ATOM 9081 O O   . HIS I 4 62  ? 50.741 22.484   12.576 1.00 109.45 ? 152 HIS G O   1 
ATOM 9082 C CB  . HIS I 4 62  ? 51.011 19.723   14.299 1.00 92.75  ? 152 HIS G CB  1 
ATOM 9083 C CG  . HIS I 4 62  ? 51.218 20.700   15.418 1.00 108.28 ? 152 HIS G CG  1 
ATOM 9084 N ND1 . HIS I 4 62  ? 50.794 20.452   16.707 1.00 105.24 ? 152 HIS G ND1 1 
ATOM 9085 C CD2 . HIS I 4 62  ? 51.807 21.920   15.446 1.00 110.36 ? 152 HIS G CD2 1 
ATOM 9086 C CE1 . HIS I 4 62  ? 51.110 21.477   17.479 1.00 100.12 ? 152 HIS G CE1 1 
ATOM 9087 N NE2 . HIS I 4 62  ? 51.725 22.382   16.738 1.00 101.85 ? 152 HIS G NE2 1 
ATOM 9088 N N   . PRO I 4 63  ? 51.701 20.896   11.302 1.00 91.36  ? 153 PRO G N   1 
ATOM 9089 C CA  . PRO I 4 63  ? 52.188 21.900   10.346 1.00 96.87  ? 153 PRO G CA  1 
ATOM 9090 C C   . PRO I 4 63  ? 51.107 22.331   9.362  1.00 96.86  ? 153 PRO G C   1 
ATOM 9091 O O   . PRO I 4 63  ? 51.023 21.802   8.249  1.00 91.46  ? 153 PRO G O   1 
ATOM 9092 C CB  . PRO I 4 63  ? 53.343 21.183   9.633  1.00 96.95  ? 153 PRO G CB  1 
ATOM 9093 C CG  . PRO I 4 63  ? 53.721 20.058   10.537 1.00 91.39  ? 153 PRO G CG  1 
ATOM 9094 C CD  . PRO I 4 63  ? 52.444 19.630   11.175 1.00 83.57  ? 153 PRO G CD  1 
ATOM 9095 N N   . VAL I 4 64  ? 50.265 23.282   9.773  1.00 98.38  ? 154 VAL G N   1 
ATOM 9096 C CA  . VAL I 4 64  ? 49.276 23.849   8.860  1.00 91.85  ? 154 VAL G CA  1 
ATOM 9097 C C   . VAL I 4 64  ? 49.957 24.756   7.842  1.00 103.13 ? 154 VAL G C   1 
ATOM 9098 O O   . VAL I 4 64  ? 49.622 24.734   6.651  1.00 104.24 ? 154 VAL G O   1 
ATOM 9099 C CB  . VAL I 4 64  ? 48.186 24.600   9.645  1.00 77.17  ? 154 VAL G CB  1 
ATOM 9100 C CG1 . VAL I 4 64  ? 47.066 25.038   8.712  1.00 72.98  ? 154 VAL G CG1 1 
ATOM 9101 C CG2 . VAL I 4 64  ? 47.645 23.731   10.765 1.00 72.59  ? 154 VAL G CG2 1 
ATOM 9102 N N   . VAL I 4 65  ? 50.912 25.572   8.304  1.00 102.70 ? 155 VAL G N   1 
ATOM 9103 C CA  . VAL I 4 65  ? 51.775 26.464   7.522  1.00 106.99 ? 155 VAL G CA  1 
ATOM 9104 C C   . VAL I 4 65  ? 51.011 27.211   6.428  1.00 101.48 ? 155 VAL G C   1 
ATOM 9105 O O   . VAL I 4 65  ? 50.930 26.768   5.276  1.00 99.77  ? 155 VAL G O   1 
ATOM 9106 C CB  . VAL I 4 65  ? 53.015 25.718   6.964  1.00 112.56 ? 155 VAL G CB  1 
ATOM 9107 C CG1 . VAL I 4 65  ? 52.667 24.496   6.094  1.00 105.76 ? 155 VAL G CG1 1 
ATOM 9108 C CG2 . VAL I 4 65  ? 53.933 26.687   6.214  1.00 103.41 ? 155 VAL G CG2 1 
ATOM 9109 N N   . HIS I 4 66  ? 50.447 28.361   6.792  1.00 100.17 ? 156 HIS G N   1 
ATOM 9110 C CA  . HIS I 4 66  ? 49.864 29.296   5.834  1.00 102.97 ? 156 HIS G CA  1 
ATOM 9111 C C   . HIS I 4 66  ? 50.433 30.674   6.149  1.00 104.20 ? 156 HIS G C   1 
ATOM 9112 O O   . HIS I 4 66  ? 50.317 31.143   7.302  1.00 87.77  ? 156 HIS G O   1 
ATOM 9113 C CB  . HIS I 4 66  ? 48.334 29.282   5.890  1.00 99.05  ? 156 HIS G CB  1 
ATOM 9114 C CG  . HIS I 4 66  ? 47.715 28.135   5.150  1.00 100.75 ? 156 HIS G CG  1 
ATOM 9115 N ND1 . HIS I 4 66  ? 48.091 26.825   5.359  1.00 102.22 ? 156 HIS G ND1 1 
ATOM 9116 C CD2 . HIS I 4 66  ? 46.757 28.101   4.194  1.00 104.51 ? 156 HIS G CD2 1 
ATOM 9117 C CE1 . HIS I 4 66  ? 47.385 26.033   4.571  1.00 98.15  ? 156 HIS G CE1 1 
ATOM 9118 N NE2 . HIS I 4 66  ? 46.569 26.783   3.853  1.00 100.28 ? 156 HIS G NE2 1 
ATOM 9119 N N   . PRO I 4 67  ? 51.047 31.356   5.176  1.00 104.80 ? 157 PRO G N   1 
ATOM 9120 C CA  . PRO I 4 67  ? 51.898 32.511   5.514  1.00 97.11  ? 157 PRO G CA  1 
ATOM 9121 C C   . PRO I 4 67  ? 51.137 33.755   5.948  1.00 102.27 ? 157 PRO G C   1 
ATOM 9122 O O   . PRO I 4 67  ? 51.546 34.398   6.924  1.00 103.10 ? 157 PRO G O   1 
ATOM 9123 C CB  . PRO I 4 67  ? 52.685 32.754   4.215  1.00 88.14  ? 157 PRO G CB  1 
ATOM 9124 C CG  . PRO I 4 67  ? 52.541 31.486   3.419  1.00 82.42  ? 157 PRO G CG  1 
ATOM 9125 C CD  . PRO I 4 67  ? 51.181 30.972   3.762  1.00 98.49  ? 157 PRO G CD  1 
ATOM 9126 N N   . LEU I 4 68  ? 50.059 34.120   5.243  1.00 104.74 ? 158 LEU G N   1 
ATOM 9127 C CA  . LEU I 4 68  ? 49.358 35.395   5.414  1.00 98.69  ? 158 LEU G CA  1 
ATOM 9128 C C   . LEU I 4 68  ? 50.264 36.543   4.976  1.00 97.33  ? 158 LEU G C   1 
ATOM 9129 O O   . LEU I 4 68  ? 50.540 36.681   3.778  1.00 99.16  ? 158 LEU G O   1 
ATOM 9130 C CB  . LEU I 4 68  ? 48.872 35.591   6.857  1.00 91.67  ? 158 LEU G CB  1 
ATOM 9131 C CG  . LEU I 4 68  ? 47.800 36.661   7.094  1.00 83.94  ? 158 LEU G CG  1 
ATOM 9132 C CD1 . LEU I 4 68  ? 46.639 36.496   6.121  1.00 70.95  ? 158 LEU G CD1 1 
ATOM 9133 C CD2 . LEU I 4 68  ? 47.312 36.634   8.535  1.00 79.57  ? 158 LEU G CD2 1 
ATOM 9134 N N   . ASP I 4 69  ? 50.695 37.390   5.917  1.00 94.57  ? 159 ASP G N   1 
ATOM 9135 C CA  . ASP I 4 69  ? 51.646 38.464   5.627  1.00 92.82  ? 159 ASP G CA  1 
ATOM 9136 C C   . ASP I 4 69  ? 51.037 39.522   4.712  1.00 87.54  ? 159 ASP G C   1 
ATOM 9137 O O   . ASP I 4 69  ? 50.068 40.188   5.097  1.00 77.11  ? 159 ASP G O   1 
ATOM 9138 C CB  . ASP I 4 69  ? 52.934 37.900   5.018  1.00 90.99  ? 159 ASP G CB  1 
ATOM 9139 C CG  . ASP I 4 69  ? 53.429 36.669   5.748  1.00 92.09  ? 159 ASP G CG  1 
ATOM 9140 O OD1 . ASP I 4 69  ? 53.928 35.743   5.077  1.00 98.81  ? 159 ASP G OD1 1 
ATOM 9141 O OD2 . ASP I 4 69  ? 53.314 36.627   6.991  1.00 82.52  ? 159 ASP G OD2 1 
ATOM 9142 N N   . LEU I 4 70  ? 51.602 39.669   3.506  1.00 89.02  ? 160 LEU G N   1 
ATOM 9143 C CA  . LEU I 4 70  ? 51.384 40.794   2.594  1.00 94.42  ? 160 LEU G CA  1 
ATOM 9144 C C   . LEU I 4 70  ? 51.999 42.083   3.130  1.00 88.72  ? 160 LEU G C   1 
ATOM 9145 O O   . LEU I 4 70  ? 51.382 42.793   3.931  1.00 81.44  ? 160 LEU G O   1 
ATOM 9146 C CB  . LEU I 4 70  ? 49.888 41.006   2.316  1.00 91.27  ? 160 LEU G CB  1 
ATOM 9147 C CG  . LEU I 4 70  ? 48.995 39.806   1.999  1.00 89.43  ? 160 LEU G CG  1 
ATOM 9148 C CD1 . LEU I 4 70  ? 47.581 40.042   2.515  1.00 79.51  ? 160 LEU G CD1 1 
ATOM 9149 C CD2 . LEU I 4 70  ? 48.978 39.513   0.507  1.00 92.87  ? 160 LEU G CD2 1 
ATOM 9150 N N   . LYS I 4 71  ? 53.210 42.396   2.686  1.00 83.76  ? 161 LYS G N   1 
ATOM 9151 C CA  . LYS I 4 71  ? 53.887 43.616   3.090  1.00 74.57  ? 161 LYS G CA  1 
ATOM 9152 C C   . LYS I 4 71  ? 53.572 44.749   2.118  1.00 86.92  ? 161 LYS G C   1 
ATOM 9153 O O   . LYS I 4 71  ? 53.161 44.529   0.975  1.00 90.05  ? 161 LYS G O   1 
ATOM 9154 C CB  . LYS I 4 71  ? 55.401 43.388   3.155  1.00 76.82  ? 161 LYS G CB  1 
ATOM 9155 C CG  . LYS I 4 71  ? 56.180 44.440   3.934  1.00 75.47  ? 161 LYS G CG  1 
ATOM 9156 C CD  . LYS I 4 71  ? 57.610 44.561   3.425  1.00 76.18  ? 161 LYS G CD  1 
ATOM 9157 C CE  . LYS I 4 71  ? 58.335 43.226   3.454  1.00 61.33  ? 161 LYS G CE  1 
ATOM 9158 N NZ  . LYS I 4 71  ? 59.606 43.273   2.678  1.00 39.85  ? 161 LYS G NZ  1 
ATOM 9159 N N   . TYR I 4 72  ? 53.772 45.975   2.593  1.00 95.20  ? 162 TYR G N   1 
ATOM 9160 C CA  . TYR I 4 72  ? 53.626 47.168   1.776  1.00 94.36  ? 162 TYR G CA  1 
ATOM 9161 C C   . TYR I 4 72  ? 54.937 47.521   1.089  1.00 100.10 ? 162 TYR G C   1 
ATOM 9162 O O   . TYR I 4 72  ? 56.025 47.165   1.555  1.00 94.43  ? 162 TYR G O   1 
ATOM 9163 C CB  . TYR I 4 72  ? 53.151 48.352   2.622  1.00 88.57  ? 162 TYR G CB  1 
ATOM 9164 C CG  . TYR I 4 72  ? 52.687 49.550   1.815  1.00 100.79 ? 162 TYR G CG  1 
ATOM 9165 C CD1 . TYR I 4 72  ? 53.345 50.769   1.912  1.00 105.17 ? 162 TYR G CD1 1 
ATOM 9166 C CD2 . TYR I 4 72  ? 51.590 49.467   0.970  1.00 99.93  ? 162 TYR G CD2 1 
ATOM 9167 C CE1 . TYR I 4 72  ? 52.930 51.871   1.184  1.00 101.61 ? 162 TYR G CE1 1 
ATOM 9168 C CE2 . TYR I 4 72  ? 51.164 50.565   0.238  1.00 95.66  ? 162 TYR G CE2 1 
ATOM 9169 C CZ  . TYR I 4 72  ? 51.839 51.764   0.349  1.00 98.65  ? 162 TYR G CZ  1 
ATOM 9170 O OH  . TYR I 4 72  ? 51.423 52.858   -0.375 1.00 103.71 ? 162 TYR G OH  1 
ATOM 9171 N N   . ASP I 4 73  ? 54.814 48.223   -0.040 1.00 112.22 ? 163 ASP G N   1 
ATOM 9172 C CA  . ASP I 4 73  ? 55.925 48.830   -0.759 1.00 120.41 ? 163 ASP G CA  1 
ATOM 9173 C C   . ASP I 4 73  ? 56.591 49.867   0.135  1.00 120.38 ? 163 ASP G C   1 
ATOM 9174 O O   . ASP I 4 73  ? 55.980 50.896   0.456  1.00 114.05 ? 163 ASP G O   1 
ATOM 9175 C CB  . ASP I 4 73  ? 55.430 49.472   -2.061 1.00 124.78 ? 163 ASP G CB  1 
ATOM 9176 C CG  . ASP I 4 73  ? 56.369 50.554   -2.587 1.00 128.75 ? 163 ASP G CG  1 
ATOM 9177 O OD1 . ASP I 4 73  ? 57.339 50.218   -3.300 1.00 134.10 ? 163 ASP G OD1 1 
ATOM 9178 O OD2 . ASP I 4 73  ? 56.120 51.747   -2.303 1.00 120.21 ? 163 ASP G OD2 1 
ATOM 9179 N N   . PRO I 4 74  ? 57.831 49.639   0.554  1.00 126.23 ? 164 PRO G N   1 
ATOM 9180 C CA  . PRO I 4 74  ? 58.476 50.595   1.455  1.00 118.70 ? 164 PRO G CA  1 
ATOM 9181 C C   . PRO I 4 74  ? 58.852 51.867   0.712  1.00 126.43 ? 164 PRO G C   1 
ATOM 9182 O O   . PRO I 4 74  ? 59.258 51.839   -0.453 1.00 130.94 ? 164 PRO G O   1 
ATOM 9183 C CB  . PRO I 4 74  ? 59.708 49.836   1.958  1.00 115.89 ? 164 PRO G CB  1 
ATOM 9184 C CG  . PRO I 4 74  ? 59.978 48.775   0.911  1.00 123.77 ? 164 PRO G CG  1 
ATOM 9185 C CD  . PRO I 4 74  ? 58.783 48.663   -0.000 1.00 123.37 ? 164 PRO G CD  1 
ATOM 9186 N N   . ASP I 4 75  ? 58.707 52.993   1.406  1.00 125.78 ? 165 ASP G N   1 
ATOM 9187 C CA  . ASP I 4 75  ? 59.166 54.298   0.941  1.00 110.85 ? 165 ASP G CA  1 
ATOM 9188 C C   . ASP I 4 75  ? 60.375 54.730   1.759  1.00 105.97 ? 165 ASP G C   1 
ATOM 9189 O O   . ASP I 4 75  ? 60.223 55.335   2.831  1.00 102.95 ? 165 ASP G O   1 
ATOM 9190 C CB  . ASP I 4 75  ? 58.038 55.327   1.045  1.00 115.77 ? 165 ASP G CB  1 
ATOM 9191 C CG  . ASP I 4 75  ? 57.190 55.137   2.292  1.00 120.75 ? 165 ASP G CG  1 
ATOM 9192 O OD1 . ASP I 4 75  ? 56.095 55.734   2.367  1.00 118.93 ? 165 ASP G OD1 1 
ATOM 9193 O OD2 . ASP I 4 75  ? 57.610 54.378   3.190  1.00 122.13 ? 165 ASP G OD2 1 
ATOM 9194 N N   . PRO I 4 76  ? 61.597 54.403   1.325  1.00 104.62 ? 166 PRO G N   1 
ATOM 9195 C CA  . PRO I 4 76  ? 62.768 54.621   2.186  1.00 102.62 ? 166 PRO G CA  1 
ATOM 9196 C C   . PRO I 4 76  ? 63.112 56.095   2.340  1.00 99.55  ? 166 PRO G C   1 
ATOM 9197 O O   . PRO I 4 76  ? 62.226 56.956   2.345  1.00 99.21  ? 166 PRO G O   1 
ATOM 9198 C CB  . PRO I 4 76  ? 63.884 53.855   1.460  1.00 108.08 ? 166 PRO G CB  1 
ATOM 9199 C CG  . PRO I 4 76  ? 63.166 52.866   0.586  1.00 107.25 ? 166 PRO G CG  1 
ATOM 9200 C CD  . PRO I 4 76  ? 61.928 53.587   0.146  1.00 105.62 ? 166 PRO G CD  1 
ATOM 9201 N N   . ALA I 4 77  ? 64.401 56.410   2.455  1.00 99.22  ? 167 ALA G N   1 
ATOM 9202 C CA  . ALA I 4 77  ? 64.855 57.763   2.775  1.00 92.38  ? 167 ALA G CA  1 
ATOM 9203 C C   . ALA I 4 77  ? 65.693 58.399   1.667  1.00 93.95  ? 167 ALA G C   1 
ATOM 9204 O O   . ALA I 4 77  ? 66.852 58.766   1.898  1.00 92.48  ? 167 ALA G O   1 
ATOM 9205 C CB  . ALA I 4 77  ? 65.643 57.744   4.081  1.00 87.85  ? 167 ALA G CB  1 
ATOM 9206 N N   . PRO I 4 78  ? 65.143 58.565   0.442  1.00 99.87  ? 168 PRO G N   1 
ATOM 9207 C CA  . PRO I 4 78  ? 65.830 59.433   -0.524 1.00 99.24  ? 168 PRO G CA  1 
ATOM 9208 C C   . PRO I 4 78  ? 65.505 60.892   -0.257 1.00 95.14  ? 168 PRO G C   1 
ATOM 9209 O O   . PRO I 4 78  ? 66.382 61.761   -0.262 1.00 98.99  ? 168 PRO G O   1 
ATOM 9210 C CB  . PRO I 4 78  ? 65.284 58.962   -1.877 1.00 95.65  ? 168 PRO G CB  1 
ATOM 9211 C CG  . PRO I 4 78  ? 63.924 58.457   -1.569 1.00 96.26  ? 168 PRO G CG  1 
ATOM 9212 C CD  . PRO I 4 78  ? 63.956 57.925   -0.158 1.00 97.77  ? 168 PRO G CD  1 
ATOM 9213 N N   . HIS I 4 79  ? 64.226 61.154   -0.007 1.00 88.20  ? 169 HIS G N   1 
ATOM 9214 C CA  . HIS I 4 79  ? 63.738 62.489   0.294  1.00 91.60  ? 169 HIS G CA  1 
ATOM 9215 C C   . HIS I 4 79  ? 63.693 62.775   1.786  1.00 86.30  ? 169 HIS G C   1 
ATOM 9216 O O   . HIS I 4 79  ? 63.617 63.943   2.180  1.00 87.46  ? 169 HIS G O   1 
ATOM 9217 C CB  . HIS I 4 79  ? 62.353 62.683   -0.328 1.00 95.22  ? 169 HIS G CB  1 
ATOM 9218 C CG  . HIS I 4 79  ? 61.238 62.109   0.486  1.00 88.80  ? 169 HIS G CG  1 
ATOM 9219 N ND1 . HIS I 4 79  ? 61.052 60.750   0.630  1.00 91.40  ? 169 HIS G ND1 1 
ATOM 9220 C CD2 . HIS I 4 79  ? 60.249 62.702   1.195  1.00 81.67  ? 169 HIS G CD2 1 
ATOM 9221 C CE1 . HIS I 4 79  ? 59.996 60.531   1.393  1.00 91.17  ? 169 HIS G CE1 1 
ATOM 9222 N NE2 . HIS I 4 79  ? 59.491 61.698   1.749  1.00 85.69  ? 169 HIS G NE2 1 
ATOM 9223 N N   . MET I 4 80  ? 63.727 61.739   2.618  1.00 83.24  ? 170 MET G N   1 
ATOM 9224 C CA  . MET I 4 80  ? 63.707 61.942   4.060  1.00 79.27  ? 170 MET G CA  1 
ATOM 9225 C C   . MET I 4 80  ? 64.935 62.728   4.518  1.00 70.65  ? 170 MET G C   1 
ATOM 9226 O O   . MET I 4 80  ? 64.818 63.743   5.220  1.00 68.17  ? 170 MET G O   1 
ATOM 9227 C CB  . MET I 4 80  ? 63.623 60.577   4.742  1.00 81.72  ? 170 MET G CB  1 
ATOM 9228 C CG  . MET I 4 80  ? 63.256 60.577   6.202  1.00 74.78  ? 170 MET G CG  1 
ATOM 9229 S SD  . MET I 4 80  ? 63.127 58.887   6.830  1.00 68.29  ? 170 MET G SD  1 
ATOM 9230 C CE  . MET I 4 80  ? 64.806 58.581   7.379  1.00 65.79  ? 170 MET G CE  1 
ATOM 9231 N N   . GLU I 4 81  ? 66.126 62.294   4.090  1.00 72.66  ? 171 GLU G N   1 
ATOM 9232 C CA  . GLU I 4 81  ? 67.346 62.999   4.467  1.00 76.54  ? 171 GLU G CA  1 
ATOM 9233 C C   . GLU I 4 81  ? 67.502 64.328   3.733  1.00 86.20  ? 171 GLU G C   1 
ATOM 9234 O O   . GLU I 4 81  ? 68.150 65.244   4.255  1.00 88.09  ? 171 GLU G O   1 
ATOM 9235 C CB  . GLU I 4 81  ? 68.567 62.111   4.224  1.00 73.22  ? 171 GLU G CB  1 
ATOM 9236 C CG  . GLU I 4 81  ? 69.820 62.606   4.928  1.00 74.29  ? 171 GLU G CG  1 
ATOM 9237 C CD  . GLU I 4 81  ? 71.025 61.718   4.699  1.00 86.34  ? 171 GLU G CD  1 
ATOM 9238 O OE1 . GLU I 4 81  ? 71.560 61.716   3.570  1.00 84.67  ? 171 GLU G OE1 1 
ATOM 9239 O OE2 . GLU I 4 81  ? 71.443 61.026   5.654  1.00 91.92  ? 171 GLU G OE2 1 
ATOM 9240 N N   . ASN I 4 82  ? 66.926 64.471   2.535  1.00 82.63  ? 172 ASN G N   1 
ATOM 9241 C CA  . ASN I 4 82  ? 66.979 65.780   1.890  1.00 84.71  ? 172 ASN G CA  1 
ATOM 9242 C C   . ASN I 4 82  ? 66.018 66.744   2.571  1.00 85.32  ? 172 ASN G C   1 
ATOM 9243 O O   . ASN I 4 82  ? 66.279 67.950   2.633  1.00 86.55  ? 172 ASN G O   1 
ATOM 9244 C CB  . ASN I 4 82  ? 66.752 65.675   0.367  1.00 85.97  ? 172 ASN G CB  1 
ATOM 9245 C CG  . ASN I 4 82  ? 65.283 65.541   -0.052 1.00 89.01  ? 172 ASN G CG  1 
ATOM 9246 O OD1 . ASN I 4 82  ? 64.356 65.985   0.624  1.00 84.53  ? 172 ASN G OD1 1 
ATOM 9247 N ND2 . ASN I 4 82  ? 65.082 64.947   -1.223 1.00 84.50  ? 172 ASN G ND2 1 
ATOM 9248 N N   . LEU I 4 83  ? 64.891 66.232   3.065  1.00 82.09  ? 173 LEU G N   1 
ATOM 9249 C CA  . LEU I 4 83  ? 63.988 67.078   3.828  1.00 73.48  ? 173 LEU G CA  1 
ATOM 9250 C C   . LEU I 4 83  ? 64.613 67.486   5.156  1.00 68.91  ? 173 LEU G C   1 
ATOM 9251 O O   . LEU I 4 83  ? 64.405 68.618   5.614  1.00 68.27  ? 173 LEU G O   1 
ATOM 9252 C CB  . LEU I 4 83  ? 62.672 66.330   4.059  1.00 69.11  ? 173 LEU G CB  1 
ATOM 9253 C CG  . LEU I 4 83  ? 61.363 67.048   4.397  1.00 67.25  ? 173 LEU G CG  1 
ATOM 9254 C CD1 . LEU I 4 83  ? 61.343 67.591   5.823  1.00 73.60  ? 173 LEU G CD1 1 
ATOM 9255 C CD2 . LEU I 4 83  ? 61.070 68.141   3.381  1.00 71.43  ? 173 LEU G CD2 1 
ATOM 9256 N N   . LYS I 4 84  ? 65.431 66.617   5.759  1.00 70.57  ? 174 LYS G N   1 
ATOM 9257 C CA  . LYS I 4 84  ? 66.124 67.048   6.969  1.00 75.37  ? 174 LYS G CA  1 
ATOM 9258 C C   . LYS I 4 84  ? 67.291 67.987   6.663  1.00 79.70  ? 174 LYS G C   1 
ATOM 9259 O O   . LYS I 4 84  ? 67.631 68.834   7.501  1.00 83.16  ? 174 LYS G O   1 
ATOM 9260 C CB  . LYS I 4 84  ? 66.583 65.838   7.791  1.00 72.37  ? 174 LYS G CB  1 
ATOM 9261 C CG  . LYS I 4 84  ? 67.865 65.157   7.357  1.00 82.38  ? 174 LYS G CG  1 
ATOM 9262 C CD  . LYS I 4 84  ? 68.131 63.944   8.245  1.00 83.78  ? 174 LYS G CD  1 
ATOM 9263 C CE  . LYS I 4 84  ? 69.604 63.573   8.287  1.00 85.67  ? 174 LYS G CE  1 
ATOM 9264 N NZ  . LYS I 4 84  ? 69.855 62.389   9.158  1.00 76.66  ? 174 LYS G NZ  1 
ATOM 9265 N N   . CYS I 4 85  ? 67.899 67.883   5.476  1.00 76.65  ? 175 CYS G N   1 
ATOM 9266 C CA  . CYS I 4 85  ? 68.961 68.827   5.130  1.00 82.28  ? 175 CYS G CA  1 
ATOM 9267 C C   . CYS I 4 85  ? 68.384 70.205   4.824  1.00 75.66  ? 175 CYS G C   1 
ATOM 9268 O O   . CYS I 4 85  ? 68.944 71.228   5.241  1.00 74.81  ? 175 CYS G O   1 
ATOM 9269 C CB  . CYS I 4 85  ? 69.788 68.310   3.952  1.00 89.79  ? 175 CYS G CB  1 
ATOM 9270 S SG  . CYS I 4 85  ? 69.119 68.673   2.317  1.00 108.21 ? 175 CYS G SG  1 
ATOM 9271 N N   . ARG I 4 86  ? 67.267 70.253   4.089  1.00 74.24  ? 176 ARG G N   1 
ATOM 9272 C CA  . ARG I 4 86  ? 66.555 71.516   3.928  1.00 71.88  ? 176 ARG G CA  1 
ATOM 9273 C C   . ARG I 4 86  ? 66.095 72.051   5.277  1.00 65.96  ? 176 ARG G C   1 
ATOM 9274 O O   . ARG I 4 86  ? 66.042 73.273   5.484  1.00 59.83  ? 176 ARG G O   1 
ATOM 9275 C CB  . ARG I 4 86  ? 65.368 71.331   2.979  1.00 61.79  ? 176 ARG G CB  1 
ATOM 9276 C CG  . ARG I 4 86  ? 64.400 72.501   2.963  1.00 66.04  ? 176 ARG G CG  1 
ATOM 9277 C CD  . ARG I 4 86  ? 63.392 72.402   1.833  1.00 65.10  ? 176 ARG G CD  1 
ATOM 9278 N NE  . ARG I 4 86  ? 63.115 71.028   1.435  1.00 59.75  ? 176 ARG G NE  1 
ATOM 9279 C CZ  . ARG I 4 86  ? 62.098 70.674   0.657  1.00 63.99  ? 176 ARG G CZ  1 
ATOM 9280 N NH1 . ARG I 4 86  ? 61.262 71.596   0.201  1.00 60.97  ? 176 ARG G NH1 1 
ATOM 9281 N NH2 . ARG I 4 86  ? 61.915 69.402   0.333  1.00 67.24  ? 176 ARG G NH2 1 
ATOM 9282 N N   . GLY I 4 87  ? 65.808 71.151   6.219  1.00 70.57  ? 177 GLY G N   1 
ATOM 9283 C CA  . GLY I 4 87  ? 65.568 71.584   7.584  1.00 66.34  ? 177 GLY G CA  1 
ATOM 9284 C C   . GLY I 4 87  ? 66.788 72.239   8.203  1.00 71.28  ? 177 GLY G C   1 
ATOM 9285 O O   . GLY I 4 87  ? 66.667 73.191   8.978  1.00 76.40  ? 177 GLY G O   1 
ATOM 9286 N N   . GLU I 4 88  ? 67.981 71.735   7.876  1.00 73.56  ? 178 GLU G N   1 
ATOM 9287 C CA  . GLU I 4 88  ? 69.203 72.386   8.341  1.00 73.62  ? 178 GLU G CA  1 
ATOM 9288 C C   . GLU I 4 88  ? 69.354 73.782   7.744  1.00 68.04  ? 178 GLU G C   1 
ATOM 9289 O O   . GLU I 4 88  ? 69.674 74.744   8.459  1.00 62.99  ? 178 GLU G O   1 
ATOM 9290 C CB  . GLU I 4 88  ? 70.414 71.517   7.998  1.00 78.54  ? 178 GLU G CB  1 
ATOM 9291 C CG  . GLU I 4 88  ? 71.751 72.168   8.276  1.00 74.99  ? 178 GLU G CG  1 
ATOM 9292 C CD  . GLU I 4 88  ? 72.627 72.277   7.045  1.00 70.43  ? 178 GLU G CD  1 
ATOM 9293 O OE1 . GLU I 4 88  ? 73.853 72.425   7.209  1.00 65.93  ? 178 GLU G OE1 1 
ATOM 9294 O OE2 . GLU I 4 88  ? 72.094 72.219   5.915  1.00 71.00  ? 178 GLU G OE2 1 
ATOM 9295 N N   . THR I 4 89  ? 69.102 73.915   6.437  1.00 71.42  ? 179 THR G N   1 
ATOM 9296 C CA  . THR I 4 89  ? 69.233 75.213   5.780  1.00 66.70  ? 179 THR G CA  1 
ATOM 9297 C C   . THR I 4 89  ? 68.288 76.235   6.399  1.00 61.19  ? 179 THR G C   1 
ATOM 9298 O O   . THR I 4 89  ? 68.708 77.331   6.791  1.00 58.62  ? 179 THR G O   1 
ATOM 9299 C CB  . THR I 4 89  ? 68.972 75.079   4.277  1.00 62.39  ? 179 THR G CB  1 
ATOM 9300 O OG1 . THR I 4 89  ? 67.607 74.702   4.052  1.00 60.01  ? 179 THR G OG1 1 
ATOM 9301 C CG2 . THR I 4 89  ? 69.894 74.035   3.662  1.00 60.29  ? 179 THR G CG2 1 
ATOM 9302 N N   . VAL I 4 90  ? 67.004 75.891   6.499  1.00 60.58  ? 180 VAL G N   1 
ATOM 9303 C CA  . VAL I 4 90  ? 66.047 76.831   7.070  1.00 55.01  ? 180 VAL G CA  1 
ATOM 9304 C C   . VAL I 4 90  ? 66.342 77.080   8.546  1.00 58.43  ? 180 VAL G C   1 
ATOM 9305 O O   . VAL I 4 90  ? 66.159 78.199   9.041  1.00 59.27  ? 180 VAL G O   1 
ATOM 9306 C CB  . VAL I 4 90  ? 64.617 76.310   6.844  1.00 59.46  ? 180 VAL G CB  1 
ATOM 9307 C CG1 . VAL I 4 90  ? 63.625 77.025   7.742  1.00 62.38  ? 180 VAL G CG1 1 
ATOM 9308 C CG2 . VAL I 4 90  ? 64.231 76.475   5.384  1.00 62.53  ? 180 VAL G CG2 1 
ATOM 9309 N N   . ALA I 4 91  ? 66.835 76.067   9.262  1.00 60.37  ? 181 ALA G N   1 
ATOM 9310 C CA  . ALA I 4 91  ? 67.144 76.232   10.680 1.00 59.95  ? 181 ALA G CA  1 
ATOM 9311 C C   . ALA I 4 91  ? 68.239 77.272   10.890 1.00 65.24  ? 181 ALA G C   1 
ATOM 9312 O O   . ALA I 4 91  ? 68.048 78.262   11.612 1.00 68.81  ? 181 ALA G O   1 
ATOM 9313 C CB  . ALA I 4 91  ? 67.550 74.888   11.286 1.00 59.96  ? 181 ALA G CB  1 
ATOM 9314 N N   . LYS I 4 92  ? 69.398 77.072   10.254 1.00 67.55  ? 182 LYS G N   1 
ATOM 9315 C CA  . LYS I 4 92  ? 70.466 78.057   10.397 1.00 72.27  ? 182 LYS G CA  1 
ATOM 9316 C C   . LYS I 4 92  ? 70.058 79.405   9.820  1.00 63.44  ? 182 LYS G C   1 
ATOM 9317 O O   . LYS I 4 92  ? 70.487 80.449   10.324 1.00 65.60  ? 182 LYS G O   1 
ATOM 9318 C CB  . LYS I 4 92  ? 71.758 77.567   9.741  1.00 80.08  ? 182 LYS G CB  1 
ATOM 9319 C CG  . LYS I 4 92  ? 72.980 78.382   10.163 1.00 77.79  ? 182 LYS G CG  1 
ATOM 9320 C CD  . LYS I 4 92  ? 74.288 77.633   9.957  1.00 85.76  ? 182 LYS G CD  1 
ATOM 9321 C CE  . LYS I 4 92  ? 75.430 78.337   10.681 1.00 85.84  ? 182 LYS G CE  1 
ATOM 9322 N NZ  . LYS I 4 92  ? 76.743 77.671   10.460 1.00 80.78  ? 182 LYS G NZ  1 
ATOM 9323 N N   . GLU I 4 93  ? 69.227 79.405   8.775  1.00 63.23  ? 183 GLU G N   1 
ATOM 9324 C CA  . GLU I 4 93  ? 68.805 80.660   8.164  1.00 65.73  ? 183 GLU G CA  1 
ATOM 9325 C C   . GLU I 4 93  ? 67.981 81.500   9.137  1.00 60.96  ? 183 GLU G C   1 
ATOM 9326 O O   . GLU I 4 93  ? 68.242 82.696   9.318  1.00 55.67  ? 183 GLU G O   1 
ATOM 9327 C CB  . GLU I 4 93  ? 68.022 80.376   6.882  1.00 64.30  ? 183 GLU G CB  1 
ATOM 9328 C CG  . GLU I 4 93  ? 67.681 81.616   6.073  1.00 71.89  ? 183 GLU G CG  1 
ATOM 9329 C CD  . GLU I 4 93  ? 67.118 81.278   4.708  1.00 74.68  ? 183 GLU G CD  1 
ATOM 9330 O OE1 . GLU I 4 93  ? 67.277 80.117   4.275  1.00 73.10  ? 183 GLU G OE1 1 
ATOM 9331 O OE2 . GLU I 4 93  ? 66.521 82.171   4.069  1.00 75.04  ? 183 GLU G OE2 1 
ATOM 9332 N N   . ILE I 4 94  ? 66.984 80.891   9.787  1.00 60.97  ? 184 ILE G N   1 
ATOM 9333 C CA  . ILE I 4 94  ? 66.205 81.656   10.753 1.00 54.28  ? 184 ILE G CA  1 
ATOM 9334 C C   . ILE I 4 94  ? 67.030 81.948   11.995 1.00 54.28  ? 184 ILE G C   1 
ATOM 9335 O O   . ILE I 4 94  ? 66.718 82.889   12.735 1.00 65.43  ? 184 ILE G O   1 
ATOM 9336 C CB  . ILE I 4 94  ? 64.885 80.953   11.133 1.00 53.89  ? 184 ILE G CB  1 
ATOM 9337 C CG1 . ILE I 4 94  ? 65.130 79.766   12.062 1.00 53.04  ? 184 ILE G CG1 1 
ATOM 9338 C CG2 . ILE I 4 94  ? 64.133 80.509   9.891  1.00 56.22  ? 184 ILE G CG2 1 
ATOM 9339 C CD1 . ILE I 4 94  ? 63.924 79.423   12.917 1.00 45.56  ? 184 ILE G CD1 1 
ATOM 9340 N N   . SER I 4 95  ? 68.079 81.163   12.251 1.00 55.47  ? 185 SER G N   1 
ATOM 9341 C CA  . SER I 4 95  ? 68.996 81.505   13.333 1.00 64.06  ? 185 SER G CA  1 
ATOM 9342 C C   . SER I 4 95  ? 69.724 82.814   13.035 1.00 64.65  ? 185 SER G C   1 
ATOM 9343 O O   . SER I 4 95  ? 69.728 83.745   13.855 1.00 58.98  ? 185 SER G O   1 
ATOM 9344 C CB  . SER I 4 95  ? 69.988 80.363   13.554 1.00 63.62  ? 185 SER G CB  1 
ATOM 9345 O OG  . SER I 4 95  ? 70.829 80.622   14.664 1.00 68.27  ? 185 SER G OG  1 
ATOM 9346 N N   . GLU I 4 96  ? 70.337 82.909   11.850 1.00 64.66  ? 186 GLU G N   1 
ATOM 9347 C CA  . GLU I 4 96  ? 71.056 84.122   11.480 1.00 63.24  ? 186 GLU G CA  1 
ATOM 9348 C C   . GLU I 4 96  ? 70.117 85.305   11.278 1.00 66.19  ? 186 GLU G C   1 
ATOM 9349 O O   . GLU I 4 96  ? 70.548 86.456   11.422 1.00 70.46  ? 186 GLU G O   1 
ATOM 9350 C CB  . GLU I 4 96  ? 71.900 83.881   10.226 1.00 58.13  ? 186 GLU G CB  1 
ATOM 9351 C CG  . GLU I 4 96  ? 71.106 83.732   8.947  1.00 61.95  ? 186 GLU G CG  1 
ATOM 9352 C CD  . GLU I 4 96  ? 71.951 83.239   7.792  1.00 72.50  ? 186 GLU G CD  1 
ATOM 9353 O OE1 . GLU I 4 96  ? 73.158 82.990   8.002  1.00 75.86  ? 186 GLU G OE1 1 
ATOM 9354 O OE2 . GLU I 4 96  ? 71.407 83.098   6.676  1.00 74.75  ? 186 GLU G OE2 1 
ATOM 9355 N N   . ALA I 4 97  ? 68.846 85.053   10.958 1.00 64.44  ? 187 ALA G N   1 
ATOM 9356 C CA  . ALA I 4 97  ? 67.863 86.131   10.984 1.00 59.24  ? 187 ALA G CA  1 
ATOM 9357 C C   . ALA I 4 97  ? 67.596 86.593   12.410 1.00 59.18  ? 187 ALA G C   1 
ATOM 9358 O O   . ALA I 4 97  ? 67.497 87.798   12.671 1.00 68.58  ? 187 ALA G O   1 
ATOM 9359 C CB  . ALA I 4 97  ? 66.567 85.681   10.315 1.00 58.39  ? 187 ALA G CB  1 
ATOM 9360 N N   . MET I 4 98  ? 67.479 85.646   13.346 1.00 54.40  ? 188 MET G N   1 
ATOM 9361 C CA  . MET I 4 98  ? 67.290 86.007   14.747 1.00 57.22  ? 188 MET G CA  1 
ATOM 9362 C C   . MET I 4 98  ? 68.477 86.771   15.320 1.00 63.73  ? 188 MET G C   1 
ATOM 9363 O O   . MET I 4 98  ? 68.309 87.534   16.278 1.00 57.84  ? 188 MET G O   1 
ATOM 9364 C CB  . MET I 4 98  ? 67.028 84.763   15.591 1.00 53.91  ? 188 MET G CB  1 
ATOM 9365 C CG  . MET I 4 98  ? 65.568 84.413   15.740 1.00 47.94  ? 188 MET G CG  1 
ATOM 9366 S SD  . MET I 4 98  ? 65.353 83.315   17.145 1.00 71.05  ? 188 MET G SD  1 
ATOM 9367 C CE  . MET I 4 98  ? 65.825 84.405   18.487 1.00 46.92  ? 188 MET G CE  1 
ATOM 9368 N N   . LYS I 4 99  ? 69.682 86.570   14.785 1.00 70.54  ? 189 LYS G N   1 
ATOM 9369 C CA  . LYS I 4 99  ? 70.805 87.358   15.286 1.00 69.29  ? 189 LYS G CA  1 
ATOM 9370 C C   . LYS I 4 99  ? 70.986 88.676   14.542 1.00 63.46  ? 189 LYS G C   1 
ATOM 9371 O O   . LYS I 4 99  ? 71.452 89.652   15.142 1.00 61.33  ? 189 LYS G O   1 
ATOM 9372 C CB  . LYS I 4 99  ? 72.110 86.547   15.240 1.00 79.04  ? 189 LYS G CB  1 
ATOM 9373 C CG  . LYS I 4 99  ? 72.558 86.077   13.863 1.00 75.78  ? 189 LYS G CG  1 
ATOM 9374 C CD  . LYS I 4 99  ? 73.470 87.078   13.159 1.00 75.44  ? 189 LYS G CD  1 
ATOM 9375 C CE  . LYS I 4 99  ? 73.774 86.634   11.735 1.00 77.92  ? 189 LYS G CE  1 
ATOM 9376 N NZ  . LYS I 4 99  ? 74.389 87.722   10.925 1.00 90.23  ? 189 LYS G NZ  1 
ATOM 9377 N N   . SER I 4 100 ? 70.623 88.735   13.257 1.00 65.03  ? 190 SER G N   1 
ATOM 9378 C CA  . SER I 4 100 ? 70.814 89.948   12.470 1.00 69.45  ? 190 SER G CA  1 
ATOM 9379 C C   . SER I 4 100 ? 69.682 90.952   12.626 1.00 64.40  ? 190 SER G C   1 
ATOM 9380 O O   . SER I 4 100 ? 69.879 92.134   12.326 1.00 70.31  ? 190 SER G O   1 
ATOM 9381 C CB  . SER I 4 100 ? 70.962 89.613   10.982 1.00 70.84  ? 190 SER G CB  1 
ATOM 9382 O OG  . SER I 4 100 ? 69.745 89.117   10.452 1.00 65.34  ? 190 SER G OG  1 
ATOM 9383 N N   . LEU I 4 101 ? 68.501 90.514   13.071 1.00 55.98  ? 191 LEU G N   1 
ATOM 9384 C CA  . LEU I 4 101 ? 67.390 91.456   13.203 1.00 59.37  ? 191 LEU G CA  1 
ATOM 9385 C C   . LEU I 4 101 ? 67.598 92.421   14.367 1.00 65.95  ? 191 LEU G C   1 
ATOM 9386 O O   . LEU I 4 101 ? 67.428 93.639   14.170 1.00 64.77  ? 191 LEU G O   1 
ATOM 9387 C CB  . LEU I 4 101 ? 66.070 90.685   13.299 1.00 54.13  ? 191 LEU G CB  1 
ATOM 9388 C CG  . LEU I 4 101 ? 64.758 91.466   13.360 1.00 51.76  ? 191 LEU G CG  1 
ATOM 9389 C CD1 . LEU I 4 101 ? 63.649 90.683   12.678 1.00 51.07  ? 191 LEU G CD1 1 
ATOM 9390 C CD2 . LEU I 4 101 ? 64.379 91.758   14.788 1.00 56.92  ? 191 LEU G CD2 1 
ATOM 9391 N N   . PRO I 4 102 ? 67.947 91.978   15.582 1.00 70.60  ? 192 PRO G N   1 
ATOM 9392 C CA  . PRO I 4 102 ? 68.194 92.949   16.661 1.00 70.56  ? 192 PRO G CA  1 
ATOM 9393 C C   . PRO I 4 102 ? 69.327 93.915   16.363 1.00 71.76  ? 192 PRO G C   1 
ATOM 9394 O O   . PRO I 4 102 ? 69.357 95.005   16.948 1.00 75.07  ? 192 PRO G O   1 
ATOM 9395 C CB  . PRO I 4 102 ? 68.518 92.059   17.870 1.00 71.20  ? 192 PRO G CB  1 
ATOM 9396 C CG  . PRO I 4 102 ? 67.850 90.771   17.573 1.00 71.95  ? 192 PRO G CG  1 
ATOM 9397 C CD  . PRO I 4 102 ? 67.993 90.595   16.091 1.00 72.33  ? 192 PRO G CD  1 
ATOM 9398 N N   . ALA I 4 103 ? 70.273 93.549   15.494 1.00 71.69  ? 193 ALA G N   1 
ATOM 9399 C CA  . ALA I 4 103 ? 71.271 94.515   15.045 1.00 72.31  ? 193 ALA G CA  1 
ATOM 9400 C C   . ALA I 4 103 ? 70.615 95.651   14.273 1.00 72.63  ? 193 ALA G C   1 
ATOM 9401 O O   . ALA I 4 103 ? 70.973 96.824   14.444 1.00 78.34  ? 193 ALA G O   1 
ATOM 9402 C CB  . ALA I 4 103 ? 72.328 93.820   14.187 1.00 74.95  ? 193 ALA G CB  1 
ATOM 9403 N N   . LEU I 4 104 ? 69.639 95.321   13.425 1.00 68.00  ? 194 LEU G N   1 
ATOM 9404 C CA  . LEU I 4 104 ? 68.854 96.352   12.763 1.00 72.34  ? 194 LEU G CA  1 
ATOM 9405 C C   . LEU I 4 104 ? 67.966 97.104   13.746 1.00 70.85  ? 194 LEU G C   1 
ATOM 9406 O O   . LEU I 4 104 ? 67.599 98.252   13.477 1.00 73.48  ? 194 LEU G O   1 
ATOM 9407 C CB  . LEU I 4 104 ? 68.016 95.741   11.638 1.00 69.36  ? 194 LEU G CB  1 
ATOM 9408 C CG  . LEU I 4 104 ? 68.669 95.613   10.256 1.00 74.34  ? 194 LEU G CG  1 
ATOM 9409 C CD1 . LEU I 4 104 ? 70.019 94.905   10.313 1.00 73.36  ? 194 LEU G CD1 1 
ATOM 9410 C CD2 . LEU I 4 104 ? 67.735 94.899   9.292  1.00 77.77  ? 194 LEU G CD2 1 
ATOM 9411 N N   . ILE I 4 105 ? 67.618 96.488   14.879 1.00 71.04  ? 195 ILE G N   1 
ATOM 9412 C CA  . ILE I 4 105 ? 66.958 97.238   15.944 1.00 75.14  ? 195 ILE G CA  1 
ATOM 9413 C C   . ILE I 4 105 ? 67.924 98.249   16.557 1.00 77.70  ? 195 ILE G C   1 
ATOM 9414 O O   . ILE I 4 105 ? 67.528 99.360   16.932 1.00 77.81  ? 195 ILE G O   1 
ATOM 9415 C CB  . ILE I 4 105 ? 66.383 96.282   17.005 1.00 78.67  ? 195 ILE G CB  1 
ATOM 9416 C CG1 . ILE I 4 105 ? 65.348 95.344   16.378 1.00 76.16  ? 195 ILE G CG1 1 
ATOM 9417 C CG2 . ILE I 4 105 ? 65.765 97.061   18.161 1.00 76.29  ? 195 ILE G CG2 1 
ATOM 9418 C CD1 . ILE I 4 105 ? 64.778 94.331   17.347 1.00 75.25  ? 195 ILE G CD1 1 
ATOM 9419 N N   . GLU I 4 106 ? 69.204 97.882   16.668 1.00 74.48  ? 196 GLU G N   1 
ATOM 9420 C CA  . GLU I 4 106 ? 70.200 98.822   17.174 1.00 69.04  ? 196 GLU G CA  1 
ATOM 9421 C C   . GLU I 4 106 ? 70.400 99.978   16.205 1.00 70.14  ? 196 GLU G C   1 
ATOM 9422 O O   . GLU I 4 106 ? 70.505 101.136  16.628 1.00 72.55  ? 196 GLU G O   1 
ATOM 9423 C CB  . GLU I 4 106 ? 71.522 98.102   17.437 1.00 64.28  ? 196 GLU G CB  1 
ATOM 9424 C CG  . GLU I 4 106 ? 72.444 98.812   18.424 1.00 68.44  ? 196 GLU G CG  1 
ATOM 9425 C CD  . GLU I 4 106 ? 72.049 98.599   19.878 1.00 70.98  ? 196 GLU G CD  1 
ATOM 9426 O OE1 . GLU I 4 106 ? 70.962 98.038   20.133 1.00 69.90  ? 196 GLU G OE1 1 
ATOM 9427 O OE2 . GLU I 4 106 ? 72.835 98.990   20.768 1.00 66.48  ? 196 GLU G OE2 1 
ATOM 9428 N N   . GLN I 4 107 ? 70.454 99.689   14.900 1.00 69.44  ? 197 GLN G N   1 
ATOM 9429 C CA  . GLN I 4 107 ? 70.407 100.767  13.916 1.00 71.28  ? 197 GLN G CA  1 
ATOM 9430 C C   . GLN I 4 107 ? 69.124 101.579  14.042 1.00 77.87  ? 197 GLN G C   1 
ATOM 9431 O O   . GLN I 4 107 ? 69.117 102.779  13.746 1.00 82.79  ? 197 GLN G O   1 
ATOM 9432 C CB  . GLN I 4 107 ? 70.529 100.211  12.497 1.00 69.17  ? 197 GLN G CB  1 
ATOM 9433 C CG  . GLN I 4 107 ? 71.807 99.446   12.213 1.00 77.13  ? 197 GLN G CG  1 
ATOM 9434 C CD  . GLN I 4 107 ? 71.837 98.888   10.801 1.00 86.83  ? 197 GLN G CD  1 
ATOM 9435 O OE1 . GLN I 4 107 ? 70.846 98.961   10.073 1.00 87.30  ? 197 GLN G OE1 1 
ATOM 9436 N NE2 . GLN I 4 107 ? 72.977 98.332   10.406 1.00 86.90  ? 197 GLN G NE2 1 
ATOM 9437 N N   . GLY I 4 108 ? 68.035 100.946  14.474 1.00 77.40  ? 198 GLY G N   1 
ATOM 9438 C CA  . GLY I 4 108 ? 66.762 101.622  14.620 1.00 73.46  ? 198 GLY G CA  1 
ATOM 9439 C C   . GLY I 4 108 ? 66.727 102.643  15.735 1.00 71.85  ? 198 GLY G C   1 
ATOM 9440 O O   . GLY I 4 108 ? 66.409 103.812  15.499 1.00 76.40  ? 198 GLY G O   1 
ATOM 9441 N N   . GLU I 4 109 ? 67.045 102.220  16.956 1.00 72.17  ? 199 GLU G N   1 
ATOM 9442 C CA  . GLU I 4 109 ? 67.036 103.143  18.081 1.00 80.32  ? 199 GLU G CA  1 
ATOM 9443 C C   . GLU I 4 109 ? 68.324 103.952  18.178 1.00 81.68  ? 199 GLU G C   1 
ATOM 9444 O O   . GLU I 4 109 ? 68.428 104.826  19.045 1.00 76.86  ? 199 GLU G O   1 
ATOM 9445 C CB  . GLU I 4 109 ? 66.780 102.381  19.387 1.00 88.08  ? 199 GLU G CB  1 
ATOM 9446 C CG  . GLU I 4 109 ? 66.284 103.258  20.535 1.00 87.63  ? 199 GLU G CG  1 
ATOM 9447 C CD  . GLU I 4 109 ? 65.180 102.608  21.344 1.00 80.29  ? 199 GLU G CD  1 
ATOM 9448 O OE1 . GLU I 4 109 ? 64.095 102.362  20.775 1.00 67.81  ? 199 GLU G OE1 1 
ATOM 9449 O OE2 . GLU I 4 109 ? 65.394 102.348  22.547 1.00 82.92  ? 199 GLU G OE2 1 
ATOM 9450 N N   . GLY I 4 110 ? 69.299 103.692  17.304 1.00 82.64  ? 200 GLY G N   1 
ATOM 9451 C CA  . GLY I 4 110 ? 70.433 104.590  17.188 1.00 77.14  ? 200 GLY G CA  1 
ATOM 9452 C C   . GLY I 4 110 ? 70.107 105.866  16.446 1.00 76.95  ? 200 GLY G C   1 
ATOM 9453 O O   . GLY I 4 110 ? 70.749 106.896  16.673 1.00 80.07  ? 200 GLY G O   1 
ATOM 9454 N N   . PHE I 4 111 ? 69.115 105.824  15.557 1.00 77.75  ? 201 PHE G N   1 
ATOM 9455 C CA  . PHE I 4 111 ? 68.713 106.978  14.764 1.00 78.04  ? 201 PHE G CA  1 
ATOM 9456 C C   . PHE I 4 111 ? 67.500 107.710  15.324 1.00 75.22  ? 201 PHE G C   1 
ATOM 9457 O O   . PHE I 4 111 ? 67.097 108.729  14.756 1.00 79.70  ? 201 PHE G O   1 
ATOM 9458 C CB  . PHE I 4 111 ? 68.420 106.550  13.321 1.00 74.53  ? 201 PHE G CB  1 
ATOM 9459 C CG  . PHE I 4 111 ? 69.622 106.038  12.580 1.00 78.55  ? 201 PHE G CG  1 
ATOM 9460 C CD1 . PHE I 4 111 ? 69.470 105.286  11.430 1.00 81.57  ? 201 PHE G CD1 1 
ATOM 9461 C CD2 . PHE I 4 111 ? 70.903 106.304  13.036 1.00 82.46  ? 201 PHE G CD2 1 
ATOM 9462 C CE1 . PHE I 4 111 ? 70.572 104.812  10.747 1.00 83.14  ? 201 PHE G CE1 1 
ATOM 9463 C CE2 . PHE I 4 111 ? 72.009 105.833  12.355 1.00 80.10  ? 201 PHE G CE2 1 
ATOM 9464 C CZ  . PHE I 4 111 ? 71.842 105.087  11.208 1.00 80.35  ? 201 PHE G CZ  1 
ATOM 9465 N N   . SER I 4 112 ? 66.909 107.228  16.414 1.00 72.00  ? 202 SER G N   1 
ATOM 9466 C CA  . SER I 4 112 ? 65.658 107.797  16.897 1.00 78.90  ? 202 SER G CA  1 
ATOM 9467 C C   . SER I 4 112 ? 65.848 108.987  17.829 1.00 87.09  ? 202 SER G C   1 
ATOM 9468 O O   . SER I 4 112 ? 64.861 109.650  18.163 1.00 93.91  ? 202 SER G O   1 
ATOM 9469 C CB  . SER I 4 112 ? 64.832 106.725  17.617 1.00 85.35  ? 202 SER G CB  1 
ATOM 9470 O OG  . SER I 4 112 ? 65.599 106.072  18.614 1.00 87.54  ? 202 SER G OG  1 
ATOM 9471 N N   . GLN I 4 113 ? 67.078 109.282  18.250 1.00 85.49  ? 203 GLN G N   1 
ATOM 9472 C CA  . GLN I 4 113 ? 67.344 110.417  19.126 1.00 88.22  ? 203 GLN G CA  1 
ATOM 9473 C C   . GLN I 4 113 ? 68.173 111.488  18.427 1.00 84.36  ? 203 GLN G C   1 
ATOM 9474 O O   . GLN I 4 113 ? 67.700 112.616  18.250 1.00 79.59  ? 203 GLN G O   1 
ATOM 9475 C CB  . GLN I 4 113 ? 67.998 109.948  20.449 1.00 81.09  ? 203 GLN G CB  1 
ATOM 9476 C CG  . GLN I 4 113 ? 69.446 109.440  20.412 1.00 82.73  ? 203 GLN G CG  1 
ATOM 9477 C CD  . GLN I 4 113 ? 69.625 108.154  19.628 1.00 84.23  ? 203 GLN G CD  1 
ATOM 9478 O OE1 . GLN I 4 113 ? 68.672 107.608  19.073 1.00 85.61  ? 203 GLN G OE1 1 
ATOM 9479 N NE2 . GLN I 4 113 ? 70.859 107.665  19.576 1.00 81.36  ? 203 GLN G NE2 1 
ATOM 9480 N N   . VAL I 4 114 ? 69.395 111.167  18.013 1.00 79.51  ? 204 VAL G N   1 
ATOM 9481 C CA  . VAL I 4 114 ? 70.278 112.123  17.365 1.00 80.67  ? 204 VAL G CA  1 
ATOM 9482 C C   . VAL I 4 114 ? 70.747 111.557  16.033 1.00 76.85  ? 204 VAL G C   1 
ATOM 9483 O O   . VAL I 4 114 ? 69.940 111.070  15.241 1.00 76.25  ? 204 VAL G O   1 
ATOM 9484 C CB  . VAL I 4 114 ? 71.481 112.470  18.263 1.00 85.89  ? 204 VAL G CB  1 
ATOM 9485 C CG1 . VAL I 4 114 ? 71.010 112.974  19.623 1.00 88.90  ? 204 VAL G CG1 1 
ATOM 9486 C CG2 . VAL I 4 114 ? 72.391 111.260  18.419 1.00 68.67  ? 204 VAL G CG2 1 
ATOM 9487 N N   . LEU J 5 11  ? 20.017 -58.053  18.191 1.00 46.88  ? 6   LEU Q N   1 
ATOM 9488 C CA  . LEU J 5 11  ? 19.117 -57.402  19.136 1.00 56.80  ? 6   LEU Q CA  1 
ATOM 9489 C C   . LEU J 5 11  ? 19.027 -55.902  18.886 1.00 71.22  ? 6   LEU Q C   1 
ATOM 9490 O O   . LEU J 5 11  ? 18.329 -55.464  17.970 1.00 79.36  ? 6   LEU Q O   1 
ATOM 9491 C CB  . LEU J 5 11  ? 19.570 -57.659  20.579 1.00 59.92  ? 6   LEU Q CB  1 
ATOM 9492 C CG  . LEU J 5 11  ? 18.662 -57.202  21.732 1.00 51.19  ? 6   LEU Q CG  1 
ATOM 9493 C CD1 . LEU J 5 11  ? 17.191 -57.370  21.383 1.00 51.83  ? 6   LEU Q CD1 1 
ATOM 9494 C CD2 . LEU J 5 11  ? 19.005 -57.924  23.032 1.00 47.13  ? 6   LEU Q CD2 1 
ATOM 9495 N N   . ASP J 5 12  ? 19.778 -55.151  19.700 1.00 70.74  ? 7   ASP Q N   1 
ATOM 9496 C CA  . ASP J 5 12  ? 19.714 -53.699  19.869 1.00 68.44  ? 7   ASP Q CA  1 
ATOM 9497 C C   . ASP J 5 12  ? 18.642 -52.989  19.040 1.00 64.71  ? 7   ASP Q C   1 
ATOM 9498 O O   . ASP J 5 12  ? 18.936 -52.341  18.030 1.00 60.56  ? 7   ASP Q O   1 
ATOM 9499 C CB  . ASP J 5 12  ? 21.111 -53.097  19.625 1.00 65.33  ? 7   ASP Q CB  1 
ATOM 9500 C CG  . ASP J 5 12  ? 21.583 -53.228  18.188 1.00 68.08  ? 7   ASP Q CG  1 
ATOM 9501 O OD1 . ASP J 5 12  ? 22.436 -52.417  17.768 1.00 59.49  ? 7   ASP Q OD1 1 
ATOM 9502 O OD2 . ASP J 5 12  ? 21.113 -54.147  17.486 1.00 83.92  ? 7   ASP Q OD2 1 
ATOM 9503 N N   . HIS J 5 13  ? 17.386 -53.113  19.467 1.00 63.25  ? 8   HIS Q N   1 
ATOM 9504 C CA  . HIS J 5 13  ? 16.298 -52.275  18.965 1.00 62.86  ? 8   HIS Q CA  1 
ATOM 9505 C C   . HIS J 5 13  ? 16.095 -51.165  19.991 1.00 69.67  ? 8   HIS Q C   1 
ATOM 9506 O O   . HIS J 5 13  ? 15.323 -51.301  20.942 1.00 65.59  ? 8   HIS Q O   1 
ATOM 9507 C CB  . HIS J 5 13  ? 15.021 -53.071  18.741 1.00 67.21  ? 8   HIS Q CB  1 
ATOM 9508 C CG  . HIS J 5 13  ? 13.814 -52.209  18.543 1.00 69.01  ? 8   HIS Q CG  1 
ATOM 9509 N ND1 . HIS J 5 13  ? 13.700 -51.321  17.495 1.00 67.88  ? 8   HIS Q ND1 1 
ATOM 9510 C CD2 . HIS J 5 13  ? 12.682 -52.076  19.274 1.00 73.89  ? 8   HIS Q CD2 1 
ATOM 9511 C CE1 . HIS J 5 13  ? 12.543 -50.690  17.579 1.00 72.73  ? 8   HIS Q CE1 1 
ATOM 9512 N NE2 . HIS J 5 13  ? 11.906 -51.129  18.650 1.00 73.79  ? 8   HIS Q NE2 1 
ATOM 9513 N N   . LEU J 5 14  ? 16.800 -50.058  19.792 1.00 71.27  ? 9   LEU Q N   1 
ATOM 9514 C CA  . LEU J 5 14  ? 16.842 -48.970  20.755 1.00 56.83  ? 9   LEU Q CA  1 
ATOM 9515 C C   . LEU J 5 14  ? 15.945 -47.831  20.293 1.00 66.46  ? 9   LEU Q C   1 
ATOM 9516 O O   . LEU J 5 14  ? 15.923 -47.487  19.107 1.00 62.58  ? 9   LEU Q O   1 
ATOM 9517 C CB  . LEU J 5 14  ? 18.274 -48.454  20.938 1.00 54.07  ? 9   LEU Q CB  1 
ATOM 9518 C CG  . LEU J 5 14  ? 19.445 -49.442  21.029 1.00 50.12  ? 9   LEU Q CG  1 
ATOM 9519 C CD1 . LEU J 5 14  ? 20.001 -49.746  19.647 1.00 57.88  ? 9   LEU Q CD1 1 
ATOM 9520 C CD2 . LEU J 5 14  ? 20.552 -48.922  21.929 1.00 46.95  ? 9   LEU Q CD2 1 
ATOM 9521 N N   . LYS J 5 15  ? 15.198 -47.255  21.235 1.00 79.56  ? 10  LYS Q N   1 
ATOM 9522 C CA  . LYS J 5 15  ? 14.504 -45.996  20.991 1.00 75.20  ? 10  LYS Q CA  1 
ATOM 9523 C C   . LYS J 5 15  ? 15.534 -44.907  20.730 1.00 65.67  ? 10  LYS Q C   1 
ATOM 9524 O O   . LYS J 5 15  ? 16.175 -44.415  21.664 1.00 54.21  ? 10  LYS Q O   1 
ATOM 9525 C CB  . LYS J 5 15  ? 13.610 -45.624  22.177 1.00 66.96  ? 10  LYS Q CB  1 
ATOM 9526 C CG  . LYS J 5 15  ? 13.072 -44.200  22.142 1.00 73.10  ? 10  LYS Q CG  1 
ATOM 9527 C CD  . LYS J 5 15  ? 11.579 -44.162  22.421 1.00 80.61  ? 10  LYS Q CD  1 
ATOM 9528 C CE  . LYS J 5 15  ? 11.081 -42.734  22.593 1.00 65.33  ? 10  LYS Q CE  1 
ATOM 9529 N NZ  . LYS J 5 15  ? 11.272 -41.924  21.359 1.00 60.98  ? 10  LYS Q NZ  1 
ATOM 9530 N N   . ASN J 5 16  ? 15.710 -44.537  19.466 1.00 71.24  ? 11  ASN Q N   1 
ATOM 9531 C CA  . ASN J 5 16  ? 16.766 -43.624  19.070 1.00 75.28  ? 11  ASN Q CA  1 
ATOM 9532 C C   . ASN J 5 16  ? 16.208 -42.217  18.881 1.00 78.83  ? 11  ASN Q C   1 
ATOM 9533 O O   . ASN J 5 16  ? 15.000 -41.977  18.964 1.00 78.96  ? 11  ASN Q O   1 
ATOM 9534 C CB  . ASN J 5 16  ? 17.454 -44.125  17.800 1.00 74.87  ? 11  ASN Q CB  1 
ATOM 9535 C CG  . ASN J 5 16  ? 18.811 -44.737  18.080 1.00 78.64  ? 11  ASN Q CG  1 
ATOM 9536 O OD1 . ASN J 5 16  ? 19.420 -44.477  19.119 1.00 76.36  ? 11  ASN Q OD1 1 
ATOM 9537 N ND2 . ASN J 5 16  ? 19.294 -45.555  17.152 1.00 77.02  ? 11  ASN Q ND2 1 
ATOM 9538 N N   . GLY J 5 17  ? 17.110 -41.273  18.623 1.00 71.76  ? 12  GLY Q N   1 
ATOM 9539 C CA  . GLY J 5 17  ? 16.731 -39.882  18.499 1.00 62.71  ? 12  GLY Q CA  1 
ATOM 9540 C C   . GLY J 5 17  ? 16.886 -39.120  19.799 1.00 68.48  ? 12  GLY Q C   1 
ATOM 9541 O O   . GLY J 5 17  ? 17.907 -38.461  20.016 1.00 74.63  ? 12  GLY Q O   1 
ATOM 9542 N N   . TYR J 5 18  ? 15.887 -39.229  20.678 1.00 71.28  ? 13  TYR Q N   1 
ATOM 9543 C CA  . TYR J 5 18  ? 15.812 -38.450  21.912 1.00 68.03  ? 13  TYR Q CA  1 
ATOM 9544 C C   . TYR J 5 18  ? 15.975 -36.966  21.613 1.00 63.55  ? 13  TYR Q C   1 
ATOM 9545 O O   . TYR J 5 18  ? 17.093 -36.440  21.631 1.00 59.57  ? 13  TYR Q O   1 
ATOM 9546 C CB  . TYR J 5 18  ? 16.862 -38.912  22.928 1.00 58.36  ? 13  TYR Q CB  1 
ATOM 9547 C CG  . TYR J 5 18  ? 16.632 -38.378  24.330 1.00 60.37  ? 13  TYR Q CG  1 
ATOM 9548 C CD1 . TYR J 5 18  ? 15.511 -38.752  25.062 1.00 64.41  ? 13  TYR Q CD1 1 
ATOM 9549 C CD2 . TYR J 5 18  ? 17.539 -37.505  24.922 1.00 59.82  ? 13  TYR Q CD2 1 
ATOM 9550 C CE1 . TYR J 5 18  ? 15.296 -38.268  26.343 1.00 70.61  ? 13  TYR Q CE1 1 
ATOM 9551 C CE2 . TYR J 5 18  ? 17.332 -37.017  26.204 1.00 59.87  ? 13  TYR Q CE2 1 
ATOM 9552 C CZ  . TYR J 5 18  ? 16.209 -37.402  26.909 1.00 61.74  ? 13  TYR Q CZ  1 
ATOM 9553 O OH  . TYR J 5 18  ? 15.997 -36.922  28.182 1.00 47.56  ? 13  TYR Q OH  1 
ATOM 9554 N N   . ARG J 5 19  ? 14.860 -36.292  21.330 1.00 62.04  ? 14  ARG Q N   1 
ATOM 9555 C CA  . ARG J 5 19  ? 14.895 -34.881  20.975 1.00 68.85  ? 14  ARG Q CA  1 
ATOM 9556 C C   . ARG J 5 19  ? 15.590 -34.075  22.066 1.00 72.33  ? 14  ARG Q C   1 
ATOM 9557 O O   . ARG J 5 19  ? 15.497 -34.393  23.255 1.00 72.36  ? 14  ARG Q O   1 
ATOM 9558 C CB  . ARG J 5 19  ? 13.474 -34.365  20.750 1.00 77.23  ? 14  ARG Q CB  1 
ATOM 9559 C CG  . ARG J 5 19  ? 12.718 -35.099  19.655 1.00 78.02  ? 14  ARG Q CG  1 
ATOM 9560 C CD  . ARG J 5 19  ? 11.464 -35.771  20.192 1.00 82.81  ? 14  ARG Q CD  1 
ATOM 9561 N NE  . ARG J 5 19  ? 10.925 -36.733  19.235 1.00 95.96  ? 14  ARG Q NE  1 
ATOM 9562 C CZ  . ARG J 5 19  ? 10.063 -36.421  18.273 1.00 97.49  ? 14  ARG Q CZ  1 
ATOM 9563 N NH1 . ARG J 5 19  ? 9.635  -35.172  18.144 1.00 82.47  ? 14  ARG Q NH1 1 
ATOM 9564 N NH2 . ARG J 5 19  ? 9.626  -37.357  17.440 1.00 103.90 ? 14  ARG Q NH2 1 
ATOM 9565 N N   . ARG J 5 20  ? 16.309 -33.032  21.652 1.00 66.71  ? 15  ARG Q N   1 
ATOM 9566 C CA  . ARG J 5 20  ? 17.127 -32.285  22.599 1.00 61.79  ? 15  ARG Q CA  1 
ATOM 9567 C C   . ARG J 5 20  ? 16.320 -31.192  23.292 1.00 72.00  ? 15  ARG Q C   1 
ATOM 9568 O O   . ARG J 5 20  ? 16.275 -31.128  24.525 1.00 76.39  ? 15  ARG Q O   1 
ATOM 9569 C CB  . ARG J 5 20  ? 18.352 -31.712  21.885 1.00 51.04  ? 15  ARG Q CB  1 
ATOM 9570 C CG  . ARG J 5 20  ? 19.521 -32.687  21.833 1.00 47.03  ? 15  ARG Q CG  1 
ATOM 9571 C CD  . ARG J 5 20  ? 20.567 -32.281  20.808 1.00 39.86  ? 15  ARG Q CD  1 
ATOM 9572 N NE  . ARG J 5 20  ? 20.186 -32.673  19.455 1.00 47.61  ? 15  ARG Q NE  1 
ATOM 9573 C CZ  . ARG J 5 20  ? 21.008 -32.657  18.411 1.00 49.25  ? 15  ARG Q CZ  1 
ATOM 9574 N NH1 . ARG J 5 20  ? 22.268 -32.269  18.561 1.00 49.39  ? 15  ARG Q NH1 1 
ATOM 9575 N NH2 . ARG J 5 20  ? 20.572 -33.031  17.217 1.00 54.09  ? 15  ARG Q NH2 1 
ATOM 9576 N N   . ARG J 5 21  ? 15.666 -30.333  22.517 1.00 72.03  ? 16  ARG Q N   1 
ATOM 9577 C CA  . ARG J 5 21  ? 14.814 -29.272  23.054 1.00 84.13  ? 16  ARG Q CA  1 
ATOM 9578 C C   . ARG J 5 21  ? 13.367 -29.645  22.744 1.00 89.29  ? 16  ARG Q C   1 
ATOM 9579 O O   . ARG J 5 21  ? 12.793 -29.211  21.743 1.00 84.08  ? 16  ARG Q O   1 
ATOM 9580 C CB  . ARG J 5 21  ? 15.195 -27.920  22.473 1.00 69.00  ? 16  ARG Q CB  1 
ATOM 9581 C CG  . ARG J 5 21  ? 16.646 -27.574  22.720 1.00 58.91  ? 16  ARG Q CG  1 
ATOM 9582 C CD  . ARG J 5 21  ? 17.238 -26.812  21.560 1.00 55.70  ? 16  ARG Q CD  1 
ATOM 9583 N NE  . ARG J 5 21  ? 18.633 -27.182  21.351 1.00 49.91  ? 16  ARG Q NE  1 
ATOM 9584 C CZ  . ARG J 5 21  ? 19.058 -27.937  20.346 1.00 43.49  ? 16  ARG Q CZ  1 
ATOM 9585 N NH1 . ARG J 5 21  ? 18.194 -28.389  19.449 1.00 51.11  ? 16  ARG Q NH1 1 
ATOM 9586 N NH2 . ARG J 5 21  ? 20.347 -28.231  20.230 1.00 33.59  ? 16  ARG Q NH2 1 
ATOM 9587 N N   . PHE J 5 22  ? 12.780 -30.455  23.623 1.00 89.60  ? 17  PHE Q N   1 
ATOM 9588 C CA  . PHE J 5 22  ? 11.455 -31.026  23.413 1.00 87.17  ? 17  PHE Q CA  1 
ATOM 9589 C C   . PHE J 5 22  ? 10.600 -30.809  24.652 1.00 84.42  ? 17  PHE Q C   1 
ATOM 9590 O O   . PHE J 5 22  ? 10.986 -31.211  25.755 1.00 80.39  ? 17  PHE Q O   1 
ATOM 9591 C CB  . PHE J 5 22  ? 11.546 -32.519  23.053 1.00 89.91  ? 17  PHE Q CB  1 
ATOM 9592 C CG  . PHE J 5 22  ? 12.022 -33.415  24.180 1.00 91.19  ? 17  PHE Q CG  1 
ATOM 9593 C CD1 . PHE J 5 22  ? 11.282 -34.528  24.551 1.00 91.77  ? 17  PHE Q CD1 1 
ATOM 9594 C CD2 . PHE J 5 22  ? 13.216 -33.166  24.844 1.00 84.05  ? 17  PHE Q CD2 1 
ATOM 9595 C CE1 . PHE J 5 22  ? 11.712 -35.363  25.572 1.00 90.21  ? 17  PHE Q CE1 1 
ATOM 9596 C CE2 . PHE J 5 22  ? 13.651 -33.996  25.866 1.00 79.99  ? 17  PHE Q CE2 1 
ATOM 9597 C CZ  . PHE J 5 22  ? 12.898 -35.096  26.229 1.00 81.17  ? 17  PHE Q CZ  1 
ATOM 9598 N N   . CYS J 5 23  ? 9.458  -30.140  24.456 1.00 83.75  ? 18  CYS Q N   1 
ATOM 9599 C CA  . CYS J 5 23  ? 8.375  -29.943  25.420 1.00 95.92  ? 18  CYS Q CA  1 
ATOM 9600 C C   . CYS J 5 23  ? 8.758  -30.150  26.884 1.00 101.02 ? 18  CYS Q C   1 
ATOM 9601 O O   . CYS J 5 23  ? 8.483  -31.208  27.458 1.00 103.97 ? 18  CYS Q O   1 
ATOM 9602 C CB  . CYS J 5 23  ? 7.209  -30.867  25.056 1.00 81.78  ? 18  CYS Q CB  1 
ATOM 9603 S SG  . CYS J 5 23  ? 6.581  -30.630  23.367 1.00 55.73  ? 18  CYS Q SG  1 
ATOM 9604 N N   . ARG J 5 24  ? 9.387  -29.140  27.495 1.00 103.12 ? 19  ARG Q N   1 
ATOM 9605 C CA  . ARG J 5 24  ? 9.751  -29.137  28.909 1.00 96.72  ? 19  ARG Q CA  1 
ATOM 9606 C C   . ARG J 5 24  ? 9.900  -27.693  29.364 1.00 102.18 ? 19  ARG Q C   1 
ATOM 9607 O O   . ARG J 5 24  ? 10.418 -26.864  28.600 1.00 99.00  ? 19  ARG Q O   1 
ATOM 9608 C CB  . ARG J 5 24  ? 11.050 -29.908  29.178 1.00 93.22  ? 19  ARG Q CB  1 
ATOM 9609 C CG  . ARG J 5 24  ? 10.842 -31.364  29.576 1.00 95.74  ? 19  ARG Q CG  1 
ATOM 9610 C CD  . ARG J 5 24  ? 9.949  -31.471  30.805 1.00 92.22  ? 19  ARG Q CD  1 
ATOM 9611 N NE  . ARG J 5 24  ? 9.436  -32.821  31.014 1.00 98.81  ? 19  ARG Q NE  1 
ATOM 9612 C CZ  . ARG J 5 24  ? 8.341  -33.100  31.715 1.00 97.74  ? 19  ARG Q CZ  1 
ATOM 9613 N NH1 . ARG J 5 24  ? 7.648  -32.119  32.280 1.00 100.93 ? 19  ARG Q NH1 1 
ATOM 9614 N NH2 . ARG J 5 24  ? 7.938  -34.356  31.855 1.00 81.47  ? 19  ARG Q NH2 1 
ATOM 9615 N N   . PRO J 5 25  ? 9.456  -27.356  30.587 1.00 102.26 ? 20  PRO Q N   1 
ATOM 9616 C CA  . PRO J 5 25  ? 9.549  -25.987  31.108 1.00 108.59 ? 20  PRO Q CA  1 
ATOM 9617 C C   . PRO J 5 25  ? 10.988 -25.527  31.325 1.00 106.20 ? 20  PRO Q C   1 
ATOM 9618 O O   . PRO J 5 25  ? 11.261 -24.336  31.166 1.00 99.46  ? 20  PRO Q O   1 
ATOM 9619 C CB  . PRO J 5 25  ? 8.797  -26.068  32.442 1.00 103.32 ? 20  PRO Q CB  1 
ATOM 9620 C CG  . PRO J 5 25  ? 8.877  -27.502  32.833 1.00 96.57  ? 20  PRO Q CG  1 
ATOM 9621 C CD  . PRO J 5 25  ? 8.805  -28.264  31.547 1.00 93.10  ? 20  PRO Q CD  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   MET 6   6   6   MET MET A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  GLN 18  18  18  GLN GLN A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  CYS 20  20  20  CYS CYS A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  TYR 31  31  31  TYR TYR A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  GLN 59  59  59  GLN GLN A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 CYS 104 104 104 CYS CYS A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 HIS 116 116 116 HIS HIS A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 CYS 133 133 133 CYS CYS A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 GLN 136 136 136 GLN GLN A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 PHE 159 159 159 PHE PHE A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 HIS 169 169 169 HIS HIS A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 PHE 174 174 174 PHE PHE A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 GLN 189 189 189 GLN GLN A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ARG 201 201 ?   ?   ?   A . n 
A 1 202 LEU 202 202 ?   ?   ?   A . n 
A 1 203 LYS 203 203 ?   ?   ?   A . n 
A 1 204 ILE 204 204 ?   ?   ?   A . n 
A 1 205 SER 205 205 ?   ?   ?   A . n 
B 2 1   MET 1   30  ?   ?   ?   B . n 
B 2 2   THR 2   31  31  THR THR B . n 
B 2 3   ILE 3   32  32  ILE ILE B . n 
B 2 4   SER 4   33  33  SER SER B . n 
B 2 5   ARG 5   34  34  ARG ARG B . n 
B 2 6   VAL 6   35  35  VAL VAL B . n 
B 2 7   LYS 7   36  36  LYS LYS B . n 
B 2 8   LEU 8   37  37  LEU LEU B . n 
B 2 9   LEU 9   38  38  LEU LEU B . n 
B 2 10  ASP 10  39  39  ASP ASP B . n 
B 2 11  THR 11  40  40  THR THR B . n 
B 2 12  MET 12  41  41  MET MET B . n 
B 2 13  VAL 13  42  42  VAL VAL B . n 
B 2 14  ASP 14  43  43  ASP ASP B . n 
B 2 15  THR 15  44  44  THR THR B . n 
B 2 16  PHE 16  45  45  PHE PHE B . n 
B 2 17  LEU 17  46  46  LEU LEU B . n 
B 2 18  GLN 18  47  47  GLN GLN B . n 
B 2 19  LYS 19  48  48  LYS LYS B . n 
B 2 20  LEU 20  49  49  LEU LEU B . n 
B 2 21  VAL 21  50  50  VAL VAL B . n 
B 2 22  ALA 22  51  51  ALA ALA B . n 
B 2 23  ALA 23  52  52  ALA ALA B . n 
B 2 24  GLY 24  53  53  GLY GLY B . n 
B 2 25  SER 25  54  54  SER SER B . n 
B 2 26  TYR 26  55  55  TYR TYR B . n 
B 2 27  GLN 27  56  56  GLN GLN B . n 
B 2 28  ARG 28  57  57  ARG ARG B . n 
B 2 29  PHE 29  58  58  PHE PHE B . n 
B 2 30  THR 30  59  59  THR THR B . n 
B 2 31  ASP 31  60  60  ASP ASP B . n 
B 2 32  CYS 32  61  61  CYS CYS B . n 
B 2 33  TYR 33  62  62  TYR TYR B . n 
B 2 34  LYS 34  63  63  LYS LYS B . n 
B 2 35  CYS 35  64  64  CYS CYS B . n 
B 2 36  PHE 36  65  65  PHE PHE B . n 
B 2 37  TYR 37  66  66  TYR TYR B . n 
B 2 38  GLN 38  67  67  GLN GLN B . n 
B 2 39  LEU 39  68  68  LEU LEU B . n 
B 2 40  GLN 40  69  69  GLN GLN B . n 
B 2 41  PRO 41  70  70  PRO PRO B . n 
B 2 42  ALA 42  71  71  ALA ALA B . n 
B 2 43  MET 43  72  72  MET MET B . n 
B 2 44  THR 44  73  73  THR THR B . n 
B 2 45  GLN 45  74  74  GLN GLN B . n 
B 2 46  GLN 46  75  75  GLN GLN B . n 
B 2 47  ILE 47  76  76  ILE ILE B . n 
B 2 48  TYR 48  77  77  TYR TYR B . n 
B 2 49  ASP 49  78  78  ASP ASP B . n 
B 2 50  LYS 50  79  79  LYS LYS B . n 
B 2 51  PHE 51  80  80  PHE PHE B . n 
B 2 52  ILE 52  81  81  ILE ILE B . n 
B 2 53  ALA 53  82  82  ALA ALA B . n 
B 2 54  GLN 54  83  83  GLN GLN B . n 
B 2 55  LEU 55  84  84  LEU LEU B . n 
B 2 56  GLN 56  85  85  GLN GLN B . n 
B 2 57  THR 57  86  86  THR THR B . n 
B 2 58  SER 58  87  87  SER SER B . n 
B 2 59  ILE 59  88  88  ILE ILE B . n 
B 2 60  ARG 60  89  89  ARG ARG B . n 
B 2 61  GLU 61  90  90  GLU GLU B . n 
B 2 62  GLU 62  91  91  GLU GLU B . n 
B 2 63  ILE 63  92  92  ILE ILE B . n 
B 2 64  SER 64  93  93  SER SER B . n 
B 2 65  ASP 65  94  94  ASP ASP B . n 
B 2 66  ILE 66  95  95  ILE ILE B . n 
B 2 67  LYS 67  96  96  LYS LYS B . n 
B 2 68  GLU 68  97  97  GLU GLU B . n 
B 2 69  GLU 69  98  98  GLU GLU B . n 
B 2 70  GLY 70  99  99  GLY GLY B . n 
B 2 71  ASN 71  100 100 ASN ASN B . n 
B 2 72  LEU 72  101 101 LEU LEU B . n 
B 2 73  GLU 73  102 102 GLU GLU B . n 
B 2 74  ALA 74  103 103 ALA ALA B . n 
B 2 75  VAL 75  104 104 VAL VAL B . n 
B 2 76  LEU 76  105 105 LEU LEU B . n 
B 2 77  ASN 77  106 106 ASN ASN B . n 
B 2 78  ALA 78  107 107 ALA ALA B . n 
B 2 79  LEU 79  108 108 LEU LEU B . n 
B 2 80  ASP 80  109 109 ASP ASP B . n 
B 2 81  LYS 81  110 110 LYS LYS B . n 
B 2 82  ILE 82  111 111 ILE ILE B . n 
B 2 83  VAL 83  112 112 VAL VAL B . n 
B 2 84  GLU 84  113 113 GLU GLU B . n 
B 2 85  GLU 85  114 114 GLU GLU B . n 
B 2 86  GLY 86  115 115 GLY GLY B . n 
B 2 87  LYS 87  116 116 LYS LYS B . n 
B 2 88  VAL 88  117 117 VAL VAL B . n 
B 2 89  ARG 89  118 118 ARG ARG B . n 
B 2 90  LYS 90  119 119 LYS LYS B . n 
B 2 91  GLU 91  120 120 GLU GLU B . n 
B 2 92  PRO 92  121 121 PRO PRO B . n 
B 2 93  ALA 93  122 122 ALA ALA B . n 
B 2 94  TRP 94  123 123 TRP TRP B . n 
B 2 95  ARG 95  124 124 ARG ARG B . n 
B 2 96  PRO 96  125 125 PRO PRO B . n 
B 2 97  SER 97  126 126 SER SER B . n 
B 2 98  GLY 98  127 127 GLY GLY B . n 
B 2 99  ILE 99  128 128 ILE ILE B . n 
B 2 100 PRO 100 129 129 PRO PRO B . n 
B 2 101 GLU 101 130 130 GLU GLU B . n 
B 2 102 LYS 102 131 131 LYS LYS B . n 
B 2 103 ASP 103 132 132 ASP ASP B . n 
B 2 104 LEU 104 133 133 LEU LEU B . n 
B 2 105 HIS 105 134 134 HIS HIS B . n 
B 2 106 SER 106 135 135 SER SER B . n 
B 2 107 VAL 107 136 136 VAL VAL B . n 
B 2 108 MET 108 137 137 MET MET B . n 
B 2 109 ALA 109 138 138 ALA ALA B . n 
B 2 110 PRO 110 139 139 PRO PRO B . n 
B 2 111 TYR 111 140 140 TYR TYR B . n 
B 2 112 PHE 112 141 141 PHE PHE B . n 
B 2 113 LEU 113 142 142 LEU LEU B . n 
B 2 114 GLN 114 143 143 GLN GLN B . n 
B 2 115 GLN 115 144 144 GLN GLN B . n 
B 2 116 ARG 116 145 145 ARG ARG B . n 
B 2 117 ASP 117 146 146 ASP ASP B . n 
B 2 118 THR 118 147 147 THR THR B . n 
B 2 119 LEU 119 148 148 LEU LEU B . n 
B 2 120 ARG 120 149 149 ARG ARG B . n 
B 2 121 ARG 121 150 150 ARG ARG B . n 
B 2 122 HIS 122 151 151 HIS HIS B . n 
B 2 123 VAL 123 152 152 VAL VAL B . n 
B 2 124 GLN 124 153 153 GLN GLN B . n 
B 2 125 LYS 125 154 154 LYS LYS B . n 
B 2 126 GLN 126 155 155 GLN GLN B . n 
B 2 127 GLU 127 156 156 GLU GLU B . n 
B 2 128 ALA 128 157 157 ALA ALA B . n 
B 2 129 GLU 129 158 158 GLU GLU B . n 
B 2 130 ASN 130 159 159 ASN ASN B . n 
B 2 131 GLN 131 160 160 GLN GLN B . n 
B 2 132 GLN 132 161 161 GLN GLN B . n 
B 2 133 LEU 133 162 162 LEU LEU B . n 
B 2 134 ALA 134 163 163 ALA ALA B . n 
B 2 135 ASP 135 164 164 ASP ASP B . n 
B 2 136 ALA 136 165 165 ALA ALA B . n 
B 2 137 VAL 137 166 166 VAL VAL B . n 
B 2 138 LEU 138 167 167 LEU LEU B . n 
B 2 139 ALA 139 168 168 ALA ALA B . n 
B 2 140 GLY 140 169 169 GLY GLY B . n 
B 2 141 ARG 141 170 170 ARG ARG B . n 
B 2 142 ARG 142 171 171 ARG ARG B . n 
B 2 143 GLN 143 172 172 GLN GLN B . n 
B 2 144 VAL 144 173 173 VAL VAL B . n 
B 2 145 GLU 145 174 174 GLU GLU B . n 
B 2 146 GLU 146 175 175 GLU GLU B . n 
B 2 147 LEU 147 176 176 LEU LEU B . n 
B 2 148 GLN 148 177 177 GLN GLN B . n 
B 2 149 LEU 149 178 178 LEU LEU B . n 
B 2 150 GLN 150 179 179 GLN GLN B . n 
B 2 151 VAL 151 180 180 VAL VAL B . n 
B 2 152 GLN 152 181 181 GLN GLN B . n 
B 2 153 ALA 153 182 182 ALA ALA B . n 
B 2 154 GLN 154 183 183 GLN GLN B . n 
B 2 155 GLN 155 184 184 GLN GLN B . n 
B 2 156 GLN 156 185 185 GLN GLN B . n 
B 2 157 ALA 157 186 186 ALA ALA B . n 
B 2 158 TRP 158 187 187 TRP TRP B . n 
B 2 159 GLN 159 188 188 GLN GLN B . n 
B 2 160 ALA 160 189 189 ALA ALA B . n 
B 2 161 LEU 161 190 190 LEU LEU B . n 
B 2 162 HIS 162 191 191 HIS HIS B . n 
B 2 163 ARG 163 192 192 ARG ARG B . n 
B 2 164 GLU 164 193 193 GLU GLU B . n 
B 2 165 GLN 165 194 194 GLN GLN B . n 
B 2 166 ARG 166 195 195 ARG ARG B . n 
B 2 167 GLU 167 196 196 GLU GLU B . n 
B 2 168 LEU 168 197 197 LEU LEU B . n 
B 2 169 VAL 169 198 198 VAL VAL B . n 
B 2 170 ALA 170 199 199 ALA ALA B . n 
B 2 171 VAL 171 200 200 VAL VAL B . n 
B 2 172 LEU 172 201 201 LEU LEU B . n 
B 2 173 ARG 173 202 202 ARG ARG B . n 
B 2 174 GLU 174 203 203 GLU ALA B . n 
B 2 175 PRO 175 204 ?   ?   ?   B . n 
B 2 176 GLU 176 205 ?   ?   ?   B . n 
C 3 1   MET 1   185 ?   ?   ?   D . n 
C 3 2   GLY 2   186 ?   ?   ?   D . n 
C 3 3   THR 3   187 ?   ?   ?   D . n 
C 3 4   LEU 4   188 ?   ?   ?   D . n 
C 3 5   GLN 5   189 ?   ?   ?   D . n 
C 3 6   LYS 6   190 ?   ?   ?   D . n 
C 3 7   CYS 7   191 ?   ?   ?   D . n 
C 3 8   PHE 8   192 ?   ?   ?   D . n 
C 3 9   GLU 9   193 ?   ?   ?   D . n 
C 3 10  ASP 10  194 ?   ?   ?   D . n 
C 3 11  SER 11  195 ?   ?   ?   D . n 
C 3 12  ASN 12  196 ?   ?   ?   D . n 
C 3 13  GLY 13  197 ?   ?   ?   D . n 
C 3 14  LYS 14  198 ?   ?   ?   D . n 
C 3 15  ALA 15  199 ?   ?   ?   D . n 
C 3 16  SER 16  200 ?   ?   ?   D . n 
C 3 17  ASP 17  201 ?   ?   ?   D . n 
C 3 18  PHE 18  202 ?   ?   ?   D . n 
C 3 19  SER 19  203 203 SER SER D . n 
C 3 20  LEU 20  204 204 LEU LEU D . n 
C 3 21  GLU 21  205 205 GLU GLU D . n 
C 3 22  ALA 22  206 206 ALA ALA D . n 
C 3 23  SER 23  207 207 SER SER D . n 
C 3 24  VAL 24  208 208 VAL VAL D . n 
C 3 25  ALA 25  209 209 ALA ALA D . n 
C 3 26  GLU 26  210 210 GLU GLU D . n 
C 3 27  MET 27  211 211 MET MET D . n 
C 3 28  LYS 28  212 212 LYS LYS D . n 
C 3 29  GLU 29  213 213 GLU GLU D . n 
C 3 30  TYR 30  214 214 TYR TYR D . n 
C 3 31  ILE 31  215 215 ILE ILE D . n 
C 3 32  THR 32  216 216 THR THR D . n 
C 3 33  LYS 33  217 217 LYS LYS D . n 
C 3 34  PHE 34  218 218 PHE PHE D . n 
C 3 35  SER 35  219 219 SER SER D . n 
C 3 36  LEU 36  220 220 LEU LEU D . n 
C 3 37  GLU 37  221 221 GLU GLU D . n 
C 3 38  ARG 38  222 222 ARG ARG D . n 
C 3 39  GLN 39  223 223 GLN GLN D . n 
C 3 40  THR 40  224 224 THR THR D . n 
C 3 41  TRP 41  225 225 TRP TRP D . n 
C 3 42  ASP 42  226 226 ASP ASP D . n 
C 3 43  GLN 43  227 227 GLN GLN D . n 
C 3 44  LEU 44  228 228 LEU LEU D . n 
C 3 45  LEU 45  229 229 LEU LEU D . n 
C 3 46  LEU 46  230 230 LEU LEU D . n 
C 3 47  HIS 47  231 231 HIS HIS D . n 
C 3 48  TYR 48  232 232 TYR TYR D . n 
C 3 49  GLN 49  233 233 GLN GLN D . n 
C 3 50  GLN 50  234 234 GLN GLN D . n 
C 3 51  GLU 51  235 235 GLU GLU D . n 
C 3 52  ALA 52  236 236 ALA ALA D . n 
C 3 53  LYS 53  237 237 LYS LYS D . n 
C 3 54  GLU 54  238 238 GLU GLU D . n 
C 3 55  ILE 55  239 239 ILE ILE D . n 
C 3 56  LEU 56  240 240 LEU LEU D . n 
C 3 57  SER 57  241 241 SER SER D . n 
C 3 58  ARG 58  242 242 ARG ARG D . n 
C 3 59  GLY 59  243 243 GLY GLY D . n 
C 3 60  SER 60  244 244 SER SER D . n 
C 3 61  THR 61  245 245 THR THR D . n 
C 3 62  GLU 62  246 ?   ?   ?   D . n 
C 3 63  ALA 63  247 ?   ?   ?   D . n 
C 3 64  LYS 64  248 ?   ?   ?   D . n 
C 3 65  ILE 65  249 ?   ?   ?   D . n 
C 3 66  THR 66  250 ?   ?   ?   D . n 
C 3 67  GLU 67  251 ?   ?   ?   D . n 
C 3 68  VAL 68  252 ?   ?   ?   D . n 
C 3 69  LYS 69  253 ?   ?   ?   D . n 
C 3 70  VAL 70  254 ?   ?   ?   D . n 
C 3 71  GLU 71  255 ?   ?   ?   D . n 
C 3 72  PRO 72  256 ?   ?   ?   D . n 
C 3 73  MET 73  257 ?   ?   ?   D . n 
C 3 74  THR 74  258 ?   ?   ?   D . n 
C 3 75  TYR 75  259 ?   ?   ?   D . n 
C 3 76  LEU 76  260 260 LEU LEU D . n 
C 3 77  GLY 77  261 261 GLY GLY D . n 
C 3 78  SER 78  262 262 SER SER D . n 
C 3 79  SER 79  263 263 SER SER D . n 
C 3 80  GLN 80  264 264 GLN GLN D . n 
C 3 81  ASN 81  265 265 ASN ASN D . n 
C 3 82  GLU 82  266 266 GLU GLU D . n 
C 3 83  VAL 83  267 267 VAL VAL D . n 
C 3 84  LEU 84  268 268 LEU LEU D . n 
C 3 85  ASN 85  269 269 ASN ASN D . n 
C 3 86  THR 86  270 270 THR THR D . n 
C 3 87  LYS 87  271 271 LYS LYS D . n 
C 3 88  PRO 88  272 272 PRO PRO D . n 
C 3 89  ASP 89  273 273 ASP ASP D . n 
C 3 90  TYR 90  274 274 TYR TYR D . n 
C 3 91  GLN 91  275 275 GLN GLN D . n 
C 3 92  LYS 92  276 276 LYS LYS D . n 
C 3 93  ILE 93  277 277 ILE ILE D . n 
C 3 94  LEU 94  278 278 LEU LEU D . n 
C 3 95  GLN 95  279 279 GLN GLN D . n 
C 3 96  ASN 96  280 280 ASN ASN D . n 
C 3 97  GLN 97  281 281 GLN GLN D . n 
C 3 98  SER 98  282 282 SER SER D . n 
C 3 99  LYS 99  283 283 LYS LYS D . n 
C 3 100 VAL 100 284 284 VAL VAL D . n 
C 3 101 PHE 101 285 285 PHE PHE D . n 
C 3 102 ASP 102 286 286 ASP ASP D . n 
C 3 103 CYS 103 287 287 CYS CYS D . n 
C 3 104 MET 104 288 288 MET MET D . n 
C 3 105 GLU 105 289 289 GLU GLU D . n 
C 3 106 LEU 106 290 290 LEU LEU D . n 
C 3 107 VAL 107 291 291 VAL VAL D . n 
C 3 108 MET 108 292 292 MET MET D . n 
C 3 109 ASP 109 293 293 ASP ASP D . n 
C 3 110 GLU 110 294 294 GLU GLU D . n 
C 3 111 LEU 111 295 295 LEU LEU D . n 
C 3 112 GLN 112 296 296 GLN GLN D . n 
C 3 113 GLY 113 297 297 GLY GLY D . n 
C 3 114 SER 114 298 298 SER SER D . n 
C 3 115 VAL 115 299 299 VAL VAL D . n 
C 3 116 LYS 116 300 300 LYS LYS D . n 
C 3 117 GLN 117 301 301 GLN GLN D . n 
C 3 118 LEU 118 302 302 LEU LEU D . n 
C 3 119 GLN 119 303 303 GLN GLN D . n 
C 3 120 ALA 120 304 304 ALA ALA D . n 
C 3 121 PHE 121 305 305 PHE PHE D . n 
C 3 122 MET 122 306 306 MET MET D . n 
C 3 123 ASP 123 307 307 ASP ASP D . n 
C 3 124 GLU 124 308 308 GLU GLU D . n 
C 3 125 SER 125 309 309 SER SER D . n 
C 3 126 THR 126 310 310 THR THR D . n 
C 3 127 GLN 127 311 311 GLN GLN D . n 
C 3 128 CYS 128 312 312 CYS CYS D . n 
C 3 129 PHE 129 313 313 PHE PHE D . n 
C 3 130 GLN 130 314 314 GLN GLN D . n 
C 3 131 LYS 131 315 315 LYS LYS D . n 
C 3 132 VAL 132 316 316 VAL VAL D . n 
C 3 133 SER 133 317 317 SER SER D . n 
C 3 134 VAL 134 318 ?   ?   ?   D . n 
C 3 135 GLN 135 319 ?   ?   ?   D . n 
C 3 136 LEU 136 320 ?   ?   ?   D . n 
C 3 137 GLY 137 321 ?   ?   ?   D . n 
C 3 138 LYS 138 322 ?   ?   ?   D . n 
C 3 139 ARG 139 323 ?   ?   ?   D . n 
C 3 140 SER 140 324 ?   ?   ?   D . n 
C 3 141 MET 141 325 ?   ?   ?   D . n 
C 3 142 GLN 142 326 ?   ?   ?   D . n 
C 3 143 GLN 143 327 ?   ?   ?   D . n 
C 3 144 LEU 144 328 ?   ?   ?   D . n 
C 3 145 ASP 145 329 ?   ?   ?   D . n 
C 3 146 PRO 146 330 ?   ?   ?   D . n 
C 3 147 SER 147 331 ?   ?   ?   D . n 
C 3 148 PRO 148 332 ?   ?   ?   D . n 
C 3 149 ALA 149 333 ?   ?   ?   D . n 
C 3 150 ARG 150 334 ?   ?   ?   D . n 
C 3 151 LYS 151 335 ?   ?   ?   D . n 
C 3 152 LEU 152 336 ?   ?   ?   D . n 
C 3 153 LEU 153 337 ?   ?   ?   D . n 
C 3 154 LYS 154 338 ?   ?   ?   D . n 
C 3 155 LEU 155 339 ?   ?   ?   D . n 
C 3 156 GLN 156 340 ?   ?   ?   D . n 
C 3 157 LEU 157 341 ?   ?   ?   D . n 
C 3 158 GLN 158 342 ?   ?   ?   D . n 
C 3 159 ASN 159 343 ?   ?   ?   D . n 
C 3 160 PRO 160 344 ?   ?   ?   D . n 
C 3 161 PRO 161 345 ?   ?   ?   D . n 
C 3 162 ALA 162 346 ?   ?   ?   D . n 
C 3 163 ILE 163 347 ?   ?   ?   D . n 
C 3 164 HIS 164 348 ?   ?   ?   D . n 
C 3 165 GLY 165 349 ?   ?   ?   D . n 
C 3 166 SER 166 350 ?   ?   ?   D . n 
C 3 167 GLY 167 351 ?   ?   ?   D . n 
C 3 168 SER 168 352 ?   ?   ?   D . n 
C 3 169 GLY 169 353 ?   ?   ?   D . n 
C 3 170 SER 170 354 ?   ?   ?   D . n 
C 3 171 CYS 171 355 ?   ?   ?   D . n 
C 3 172 GLN 172 356 ?   ?   ?   D . n 
C 3 173 HIS 173 357 ?   ?   ?   D . n 
C 3 174 HIS 174 358 ?   ?   ?   D . n 
C 3 175 HIS 175 359 ?   ?   ?   D . n 
C 3 176 HIS 176 360 ?   ?   ?   D . n 
C 3 177 HIS 177 361 ?   ?   ?   D . n 
C 3 178 HIS 178 362 ?   ?   ?   D . n 
D 4 1   MET 1   91  ?   ?   ?   N . n 
D 4 2   GLY 2   92  ?   ?   ?   N . n 
D 4 3   GLN 3   93  ?   ?   ?   N . n 
D 4 4   ALA 4   94  ?   ?   ?   N . n 
D 4 5   TRP 5   95  ?   ?   ?   N . n 
D 4 6   GLN 6   96  ?   ?   ?   N . n 
D 4 7   GLU 7   97  ?   ?   ?   N . n 
D 4 8   ALA 8   98  ?   ?   ?   N . n 
D 4 9   SER 9   99  ?   ?   ?   N . n 
D 4 10  ASP 10  100 ?   ?   ?   N . n 
D 4 11  ASN 11  101 ?   ?   ?   N . n 
D 4 12  CYS 12  102 ?   ?   ?   N . n 
D 4 13  PHE 13  103 ?   ?   ?   N . n 
D 4 14  MET 14  104 104 MET MET N . n 
D 4 15  ASP 15  105 105 ASP ASP N . n 
D 4 16  SER 16  106 106 SER SER N . n 
D 4 17  ASP 17  107 107 ASP ASP N . n 
D 4 18  ILE 18  108 108 ILE ILE N . n 
D 4 19  LYS 19  109 109 LYS LYS N . n 
D 4 20  VAL 20  110 110 VAL VAL N . n 
D 4 21  LEU 21  111 111 LEU LEU N . n 
D 4 22  GLU 22  112 112 GLU GLU N . n 
D 4 23  ASP 23  113 113 ASP ASP N . n 
D 4 24  GLN 24  114 114 GLN GLN N . n 
D 4 25  PHE 25  115 115 PHE PHE N . n 
D 4 26  ASP 26  116 116 ASP ASP N . n 
D 4 27  GLU 27  117 117 GLU GLU N . n 
D 4 28  ILE 28  118 118 ILE ILE N . n 
D 4 29  ILE 29  119 119 ILE ILE N . n 
D 4 30  VAL 30  120 120 VAL VAL N . n 
D 4 31  ASP 31  121 121 ASP ASP N . n 
D 4 32  ILE 32  122 122 ILE ILE N . n 
D 4 33  ALA 33  123 123 ALA ALA N . n 
D 4 34  THR 34  124 124 THR THR N . n 
D 4 35  LYS 35  125 125 LYS LYS N . n 
D 4 36  ARG 36  126 126 ARG ARG N . n 
D 4 37  LYS 37  127 127 LYS LYS N . n 
D 4 38  GLN 38  128 128 GLN GLN N . n 
D 4 39  TYR 39  129 129 TYR TYR N . n 
D 4 40  PRO 40  130 130 PRO PRO N . n 
D 4 41  ARG 41  131 131 ARG ARG N . n 
D 4 42  LYS 42  132 132 LYS LYS N . n 
D 4 43  ILE 43  133 133 ILE ILE N . n 
D 4 44  LEU 44  134 134 LEU LEU N . n 
D 4 45  GLU 45  135 135 GLU GLU N . n 
D 4 46  CYS 46  136 136 CYS CYS N . n 
D 4 47  VAL 47  137 137 VAL VAL N . n 
D 4 48  ILE 48  138 138 ILE ILE N . n 
D 4 49  LYS 49  139 139 LYS LYS N . n 
D 4 50  THR 50  140 140 THR THR N . n 
D 4 51  ILE 51  141 141 ILE ILE N . n 
D 4 52  LYS 52  142 142 LYS LYS N . n 
D 4 53  ALA 53  143 143 ALA ALA N . n 
D 4 54  LYS 54  144 144 LYS LYS N . n 
D 4 55  GLN 55  145 145 GLN GLN N . n 
D 4 56  GLU 56  146 146 GLU GLU N . n 
D 4 57  ILE 57  147 147 ILE ILE N . n 
D 4 58  LEU 58  148 148 LEU LEU N . n 
D 4 59  LYS 59  149 149 LYS LYS N . n 
D 4 60  GLN 60  150 150 GLN GLN N . n 
D 4 61  TYR 61  151 151 TYR TYR N . n 
D 4 62  HIS 62  152 152 HIS HIS N . n 
D 4 63  PRO 63  153 153 PRO PRO N . n 
D 4 64  VAL 64  154 154 VAL VAL N . n 
D 4 65  VAL 65  155 155 VAL VAL N . n 
D 4 66  HIS 66  156 156 HIS HIS N . n 
D 4 67  PRO 67  157 157 PRO PRO N . n 
D 4 68  LEU 68  158 158 LEU LEU N . n 
D 4 69  ASP 69  159 159 ASP ASP N . n 
D 4 70  LEU 70  160 160 LEU LEU N . n 
D 4 71  LYS 71  161 161 LYS LYS N . n 
D 4 72  TYR 72  162 162 TYR TYR N . n 
D 4 73  ASP 73  163 163 ASP ASP N . n 
D 4 74  PRO 74  164 164 PRO PRO N . n 
D 4 75  ASP 75  165 165 ASP ASP N . n 
D 4 76  PRO 76  166 166 PRO PRO N . n 
D 4 77  ALA 77  167 167 ALA ALA N . n 
D 4 78  PRO 78  168 168 PRO PRO N . n 
D 4 79  HIS 79  169 169 HIS HIS N . n 
D 4 80  MET 80  170 170 MET MET N . n 
D 4 81  GLU 81  171 171 GLU GLU N . n 
D 4 82  ASN 82  172 172 ASN ASN N . n 
D 4 83  LEU 83  173 173 LEU LEU N . n 
D 4 84  LYS 84  174 174 LYS LYS N . n 
D 4 85  CYS 85  175 175 CYS CYS N . n 
D 4 86  ARG 86  176 176 ARG ARG N . n 
D 4 87  GLY 87  177 177 GLY GLY N . n 
D 4 88  GLU 88  178 178 GLU GLU N . n 
D 4 89  THR 89  179 179 THR THR N . n 
D 4 90  VAL 90  180 180 VAL VAL N . n 
D 4 91  ALA 91  181 181 ALA ALA N . n 
D 4 92  LYS 92  182 182 LYS LYS N . n 
D 4 93  GLU 93  183 183 GLU GLU N . n 
D 4 94  ILE 94  184 184 ILE ILE N . n 
D 4 95  SER 95  185 185 SER SER N . n 
D 4 96  GLU 96  186 186 GLU GLU N . n 
D 4 97  ALA 97  187 187 ALA ALA N . n 
D 4 98  MET 98  188 188 MET MET N . n 
D 4 99  LYS 99  189 189 LYS LYS N . n 
D 4 100 SER 100 190 190 SER SER N . n 
D 4 101 LEU 101 191 191 LEU LEU N . n 
D 4 102 PRO 102 192 192 PRO PRO N . n 
D 4 103 ALA 103 193 193 ALA ALA N . n 
D 4 104 LEU 104 194 194 LEU LEU N . n 
D 4 105 ILE 105 195 195 ILE ILE N . n 
D 4 106 GLU 106 196 196 GLU GLU N . n 
D 4 107 GLN 107 197 197 GLN GLN N . n 
D 4 108 GLY 108 198 198 GLY GLY N . n 
D 4 109 GLU 109 199 199 GLU GLU N . n 
D 4 110 GLY 110 200 200 GLY GLY N . n 
D 4 111 PHE 111 201 201 PHE PHE N . n 
D 4 112 SER 112 202 202 SER SER N . n 
D 4 113 GLN 113 203 203 GLN GLN N . n 
D 4 114 VAL 114 204 204 VAL VAL N . n 
D 4 115 LEU 115 205 ?   ?   ?   N . n 
D 4 116 ARG 116 206 ?   ?   ?   N . n 
E 5 1   GLY 1   -4  ?   ?   ?   P . n 
E 5 2   PRO 2   -3  ?   ?   ?   P . n 
E 5 3   LEU 3   -2  ?   ?   ?   P . n 
E 5 4   GLY 4   -1  ?   ?   ?   P . n 
E 5 5   SER 5   0   ?   ?   ?   P . n 
E 5 6   MET 6   1   ?   ?   ?   P . n 
E 5 7   ALA 7   2   ?   ?   ?   P . n 
E 5 8   ALA 8   3   ?   ?   ?   P . n 
E 5 9   SER 9   4   ?   ?   ?   P . n 
E 5 10  GLY 10  5   ?   ?   ?   P . n 
E 5 11  LEU 11  6   6   LEU LEU P . n 
E 5 12  ASP 12  7   7   ASP ASP P . n 
E 5 13  HIS 13  8   8   HIS HIS P . n 
E 5 14  LEU 14  9   9   LEU LEU P . n 
E 5 15  LYS 15  10  10  LYS LYS P . n 
E 5 16  ASN 16  11  11  ASN ASN P . n 
E 5 17  GLY 17  12  12  GLY GLY P . n 
E 5 18  TYR 18  13  13  TYR TYR P . n 
E 5 19  ARG 19  14  14  ARG ARG P . n 
E 5 20  ARG 20  15  15  ARG ARG P . n 
E 5 21  ARG 21  16  16  ARG ARG P . n 
E 5 22  PHE 22  17  17  PHE PHE P . n 
E 5 23  CYS 23  18  18  CYS CYS P . n 
E 5 24  ARG 24  19  ?   ?   ?   P . n 
E 5 25  PRO 25  20  ?   ?   ?   P . n 
E 5 26  SER 26  21  ?   ?   ?   P . n 
E 5 27  ARG 27  22  ?   ?   ?   P . n 
E 5 28  ALA 28  23  ?   ?   ?   P . n 
E 5 29  ARG 29  24  ?   ?   ?   P . n 
E 5 30  ASP 30  25  ?   ?   ?   P . n 
E 5 31  ILE 31  26  ?   ?   ?   P . n 
E 5 32  ASN 32  27  ?   ?   ?   P . n 
E 5 33  THR 33  28  ?   ?   ?   P . n 
E 5 34  GLU 34  29  ?   ?   ?   P . n 
E 5 35  GLN 35  30  ?   ?   ?   P . n 
E 5 36  GLY 36  31  ?   ?   ?   P . n 
E 5 37  GLN 37  32  ?   ?   ?   P . n 
E 5 38  ASN 38  33  ?   ?   ?   P . n 
E 5 39  VAL 39  34  ?   ?   ?   P . n 
E 5 40  LEU 40  35  ?   ?   ?   P . n 
E 5 41  GLU 41  36  ?   ?   ?   P . n 
E 5 42  ILE 42  37  ?   ?   ?   P . n 
E 5 43  LEU 43  38  ?   ?   ?   P . n 
E 5 44  GLN 44  39  ?   ?   ?   P . n 
E 5 45  ASP 45  40  ?   ?   ?   P . n 
E 5 46  CYS 46  41  ?   ?   ?   P . n 
E 5 47  PHE 47  42  ?   ?   ?   P . n 
E 5 48  GLU 48  43  ?   ?   ?   P . n 
E 5 49  GLU 49  44  ?   ?   ?   P . n 
E 5 50  LYS 50  45  ?   ?   ?   P . n 
E 5 51  SER 51  46  ?   ?   ?   P . n 
E 5 52  LEU 52  47  ?   ?   ?   P . n 
E 5 53  ALA 53  48  ?   ?   ?   P . n 
E 5 54  ASN 54  49  ?   ?   ?   P . n 
E 5 55  ASP 55  50  ?   ?   ?   P . n 
E 5 56  PHE 56  51  ?   ?   ?   P . n 
E 5 57  SER 57  52  ?   ?   ?   P . n 
E 5 58  THR 58  53  ?   ?   ?   P . n 
E 5 59  ASN 59  54  ?   ?   ?   P . n 
E 5 60  SER 60  55  ?   ?   ?   P . n 
E 5 61  THR 61  56  ?   ?   ?   P . n 
E 5 62  LYS 62  57  ?   ?   ?   P . n 
E 5 63  SER 63  58  ?   ?   ?   P . n 
E 5 64  VAL 64  59  ?   ?   ?   P . n 
E 5 65  PRO 65  60  ?   ?   ?   P . n 
E 5 66  ASN 66  61  ?   ?   ?   P . n 
E 5 67  SER 67  62  ?   ?   ?   P . n 
E 5 68  THR 68  63  ?   ?   ?   P . n 
E 5 69  ARG 69  64  ?   ?   ?   P . n 
E 5 70  LYS 70  65  ?   ?   ?   P . n 
E 5 71  ILE 71  66  ?   ?   ?   P . n 
E 5 72  LYS 72  67  ?   ?   ?   P . n 
E 5 73  ASP 73  68  ?   ?   ?   P . n 
E 5 74  THR 74  69  ?   ?   ?   P . n 
E 5 75  CYS 75  70  ?   ?   ?   P . n 
E 5 76  ILE 76  71  ?   ?   ?   P . n 
F 1 1   MET 1   1   ?   ?   ?   C . n 
F 1 2   SER 2   2   2   SER SER C . n 
F 1 3   VAL 3   3   3   VAL VAL C . n 
F 1 4   ASP 4   4   4   ASP ASP C . n 
F 1 5   PRO 5   5   5   PRO PRO C . n 
F 1 6   MET 6   6   6   MET MET C . n 
F 1 7   THR 7   7   7   THR THR C . n 
F 1 8   TYR 8   8   8   TYR TYR C . n 
F 1 9   GLU 9   9   9   GLU GLU C . n 
F 1 10  ALA 10  10  10  ALA ALA C . n 
F 1 11  GLN 11  11  11  GLN GLN C . n 
F 1 12  PHE 12  12  12  PHE PHE C . n 
F 1 13  PHE 13  13  13  PHE PHE C . n 
F 1 14  GLY 14  14  14  GLY GLY C . n 
F 1 15  PHE 15  15  15  PHE PHE C . n 
F 1 16  THR 16  16  16  THR THR C . n 
F 1 17  PRO 17  17  17  PRO PRO C . n 
F 1 18  GLN 18  18  18  GLN GLN C . n 
F 1 19  THR 19  19  19  THR THR C . n 
F 1 20  CYS 20  20  20  CYS CYS C . n 
F 1 21  MET 21  21  21  MET MET C . n 
F 1 22  LEU 22  22  22  LEU LEU C . n 
F 1 23  ARG 23  23  23  ARG ARG C . n 
F 1 24  ILE 24  24  24  ILE ILE C . n 
F 1 25  TYR 25  25  25  TYR TYR C . n 
F 1 26  ILE 26  26  26  ILE ILE C . n 
F 1 27  ALA 27  27  27  ALA ALA C . n 
F 1 28  PHE 28  28  28  PHE PHE C . n 
F 1 29  GLN 29  29  29  GLN GLN C . n 
F 1 30  ASP 30  30  30  ASP ASP C . n 
F 1 31  TYR 31  31  31  TYR TYR C . n 
F 1 32  LEU 32  32  32  LEU LEU C . n 
F 1 33  PHE 33  33  33  PHE PHE C . n 
F 1 34  GLU 34  34  34  GLU GLU C . n 
F 1 35  VAL 35  35  35  VAL VAL C . n 
F 1 36  MET 36  36  36  MET MET C . n 
F 1 37  GLN 37  37  37  GLN GLN C . n 
F 1 38  ALA 38  38  38  ALA ALA C . n 
F 1 39  VAL 39  39  39  VAL VAL C . n 
F 1 40  GLU 40  40  40  GLU GLU C . n 
F 1 41  GLN 41  41  41  GLN GLN C . n 
F 1 42  VAL 42  42  42  VAL VAL C . n 
F 1 43  ILE 43  43  43  ILE ILE C . n 
F 1 44  LEU 44  44  44  LEU LEU C . n 
F 1 45  LYS 45  45  45  LYS LYS C . n 
F 1 46  LYS 46  46  46  LYS LYS C . n 
F 1 47  LEU 47  47  47  LEU LEU C . n 
F 1 48  ASP 48  48  48  ASP ASP C . n 
F 1 49  GLY 49  49  49  GLY GLY C . n 
F 1 50  ILE 50  50  50  ILE ILE C . n 
F 1 51  PRO 51  51  51  PRO PRO C . n 
F 1 52  ASP 52  52  52  ASP ASP C . n 
F 1 53  CYS 53  53  53  CYS CYS C . n 
F 1 54  ASP 54  54  54  ASP ASP C . n 
F 1 55  ILE 55  55  55  ILE ILE C . n 
F 1 56  SER 56  56  56  SER SER C . n 
F 1 57  PRO 57  57  57  PRO PRO C . n 
F 1 58  VAL 58  58  58  VAL VAL C . n 
F 1 59  GLN 59  59  59  GLN GLN C . n 
F 1 60  ILE 60  60  60  ILE ILE C . n 
F 1 61  ARG 61  61  61  ARG ARG C . n 
F 1 62  LYS 62  62  62  LYS LYS C . n 
F 1 63  CYS 63  63  63  CYS CYS C . n 
F 1 64  THR 64  64  64  THR THR C . n 
F 1 65  GLU 65  65  65  GLU GLU C . n 
F 1 66  LYS 66  66  66  LYS LYS C . n 
F 1 67  PHE 67  67  67  PHE PHE C . n 
F 1 68  LEU 68  68  68  LEU LEU C . n 
F 1 69  CYS 69  69  69  CYS CYS C . n 
F 1 70  PHE 70  70  70  PHE PHE C . n 
F 1 71  MET 71  71  71  MET MET C . n 
F 1 72  LYS 72  72  72  LYS LYS C . n 
F 1 73  GLY 73  73  73  GLY GLY C . n 
F 1 74  HIS 74  74  74  HIS HIS C . n 
F 1 75  PHE 75  75  75  PHE PHE C . n 
F 1 76  ASP 76  76  76  ASP ASP C . n 
F 1 77  ASN 77  77  77  ASN ASN C . n 
F 1 78  LEU 78  78  78  LEU LEU C . n 
F 1 79  PHE 79  79  79  PHE PHE C . n 
F 1 80  SER 80  80  80  SER SER C . n 
F 1 81  LYS 81  81  81  LYS LYS C . n 
F 1 82  MET 82  82  82  MET MET C . n 
F 1 83  GLU 83  83  83  GLU GLU C . n 
F 1 84  GLN 84  84  84  GLN GLN C . n 
F 1 85  LEU 85  85  85  LEU LEU C . n 
F 1 86  PHE 86  86  86  PHE PHE C . n 
F 1 87  LEU 87  87  87  LEU LEU C . n 
F 1 88  GLN 88  88  88  GLN GLN C . n 
F 1 89  LEU 89  89  89  LEU LEU C . n 
F 1 90  ILE 90  90  90  ILE ILE C . n 
F 1 91  LEU 91  91  91  LEU LEU C . n 
F 1 92  ARG 92  92  92  ARG ARG C . n 
F 1 93  ILE 93  93  93  ILE ILE C . n 
F 1 94  PRO 94  94  94  PRO PRO C . n 
F 1 95  SER 95  95  95  SER SER C . n 
F 1 96  ASN 96  96  96  ASN ASN C . n 
F 1 97  ILE 97  97  97  ILE ILE C . n 
F 1 98  LEU 98  98  98  LEU LEU C . n 
F 1 99  LEU 99  99  99  LEU LEU C . n 
F 1 100 PRO 100 100 100 PRO PRO C . n 
F 1 101 GLU 101 101 101 GLU GLU C . n 
F 1 102 ASP 102 102 102 ASP ASP C . n 
F 1 103 LYS 103 103 103 LYS LYS C . n 
F 1 104 CYS 104 104 104 CYS CYS C . n 
F 1 105 LYS 105 105 105 LYS LYS C . n 
F 1 106 GLU 106 106 106 GLU GLU C . n 
F 1 107 THR 107 107 107 THR THR C . n 
F 1 108 PRO 108 108 108 PRO PRO C . n 
F 1 109 TYR 109 109 109 TYR TYR C . n 
F 1 110 SER 110 110 110 SER SER C . n 
F 1 111 GLU 111 111 111 GLU GLU C . n 
F 1 112 GLU 112 112 112 GLU GLU C . n 
F 1 113 ASP 113 113 113 ASP ASP C . n 
F 1 114 PHE 114 114 114 PHE PHE C . n 
F 1 115 GLN 115 115 115 GLN GLN C . n 
F 1 116 HIS 116 116 116 HIS HIS C . n 
F 1 117 LEU 117 117 117 LEU LEU C . n 
F 1 118 GLN 118 118 118 GLN GLN C . n 
F 1 119 LYS 119 119 119 LYS LYS C . n 
F 1 120 GLU 120 120 120 GLU GLU C . n 
F 1 121 ILE 121 121 121 ILE ILE C . n 
F 1 122 GLU 122 122 122 GLU GLU C . n 
F 1 123 GLN 123 123 123 GLN GLN C . n 
F 1 124 LEU 124 124 124 LEU LEU C . n 
F 1 125 GLN 125 125 125 GLN GLN C . n 
F 1 126 GLU 126 126 126 GLU GLU C . n 
F 1 127 LYS 127 127 127 LYS LYS C . n 
F 1 128 TYR 128 128 128 TYR TYR C . n 
F 1 129 LYS 129 129 129 LYS LYS C . n 
F 1 130 THR 130 130 130 THR THR C . n 
F 1 131 GLU 131 131 131 GLU GLU C . n 
F 1 132 LEU 132 132 132 LEU LEU C . n 
F 1 133 CYS 133 133 133 CYS CYS C . n 
F 1 134 THR 134 134 134 THR THR C . n 
F 1 135 LYS 135 135 135 LYS LYS C . n 
F 1 136 GLN 136 136 136 GLN GLN C . n 
F 1 137 ALA 137 137 137 ALA ALA C . n 
F 1 138 LEU 138 138 138 LEU LEU C . n 
F 1 139 LEU 139 139 139 LEU LEU C . n 
F 1 140 ALA 140 140 140 ALA ALA C . n 
F 1 141 GLU 141 141 141 GLU GLU C . n 
F 1 142 LEU 142 142 142 LEU LEU C . n 
F 1 143 GLU 143 143 143 GLU GLU C . n 
F 1 144 GLU 144 144 144 GLU GLU C . n 
F 1 145 GLN 145 145 145 GLN GLN C . n 
F 1 146 LYS 146 146 146 LYS LYS C . n 
F 1 147 ILE 147 147 147 ILE ILE C . n 
F 1 148 VAL 148 148 148 VAL VAL C . n 
F 1 149 GLN 149 149 149 GLN GLN C . n 
F 1 150 ALA 150 150 150 ALA ALA C . n 
F 1 151 LYS 151 151 151 LYS LYS C . n 
F 1 152 LEU 152 152 152 LEU LEU C . n 
F 1 153 LYS 153 153 153 LYS LYS C . n 
F 1 154 GLN 154 154 154 GLN GLN C . n 
F 1 155 THR 155 155 155 THR THR C . n 
F 1 156 LEU 156 156 156 LEU LEU C . n 
F 1 157 THR 157 157 157 THR THR C . n 
F 1 158 PHE 158 158 158 PHE PHE C . n 
F 1 159 PHE 159 159 159 PHE PHE C . n 
F 1 160 ASP 160 160 160 ASP ASP C . n 
F 1 161 GLU 161 161 161 GLU GLU C . n 
F 1 162 LEU 162 162 162 LEU LEU C . n 
F 1 163 HIS 163 163 163 HIS HIS C . n 
F 1 164 ASN 164 164 164 ASN ASN C . n 
F 1 165 VAL 165 165 165 VAL VAL C . n 
F 1 166 GLY 166 166 166 GLY GLY C . n 
F 1 167 ARG 167 167 167 ARG ARG C . n 
F 1 168 ASP 168 168 168 ASP ASP C . n 
F 1 169 HIS 169 169 169 HIS HIS C . n 
F 1 170 GLY 170 170 170 GLY GLY C . n 
F 1 171 THR 171 171 171 THR THR C . n 
F 1 172 SER 172 172 172 SER SER C . n 
F 1 173 ASP 173 173 173 ASP ASP C . n 
F 1 174 PHE 174 174 174 PHE PHE C . n 
F 1 175 ARG 175 175 175 ARG ARG C . n 
F 1 176 GLU 176 176 176 GLU GLU C . n 
F 1 177 SER 177 177 177 SER SER C . n 
F 1 178 LEU 178 178 178 LEU LEU C . n 
F 1 179 VAL 179 179 179 VAL VAL C . n 
F 1 180 SER 180 180 180 SER SER C . n 
F 1 181 LEU 181 181 181 LEU LEU C . n 
F 1 182 VAL 182 182 182 VAL VAL C . n 
F 1 183 GLN 183 183 183 GLN GLN C . n 
F 1 184 ASN 184 184 184 ASN ASN C . n 
F 1 185 SER 185 185 185 SER SER C . n 
F 1 186 ARG 186 186 186 ARG ARG C . n 
F 1 187 LYS 187 187 187 LYS LYS C . n 
F 1 188 LEU 188 188 188 LEU LEU C . n 
F 1 189 GLN 189 189 189 GLN GLN C . n 
F 1 190 ASN 190 190 190 ASN ASN C . n 
F 1 191 ILE 191 191 191 ILE ILE C . n 
F 1 192 ARG 192 192 192 ARG ARG C . n 
F 1 193 ASP 193 193 193 ASP ASP C . n 
F 1 194 ASN 194 194 194 ASN ASN C . n 
F 1 195 VAL 195 195 195 VAL VAL C . n 
F 1 196 GLU 196 196 196 GLU GLU C . n 
F 1 197 LYS 197 197 197 LYS LYS C . n 
F 1 198 GLU 198 198 198 GLU GLU C . n 
F 1 199 SER 199 199 199 SER SER C . n 
F 1 200 LYS 200 200 200 LYS LYS C . n 
F 1 201 ARG 201 201 ?   ?   ?   C . n 
F 1 202 LEU 202 202 ?   ?   ?   C . n 
F 1 203 LYS 203 203 ?   ?   ?   C . n 
F 1 204 ILE 204 204 ?   ?   ?   C . n 
F 1 205 SER 205 205 ?   ?   ?   C . n 
G 2 1   MET 1   30  ?   ?   ?   E . n 
G 2 2   THR 2   31  31  THR THR E . n 
G 2 3   ILE 3   32  32  ILE ILE E . n 
G 2 4   SER 4   33  33  SER SER E . n 
G 2 5   ARG 5   34  34  ARG ARG E . n 
G 2 6   VAL 6   35  35  VAL VAL E . n 
G 2 7   LYS 7   36  36  LYS LYS E . n 
G 2 8   LEU 8   37  37  LEU LEU E . n 
G 2 9   LEU 9   38  38  LEU LEU E . n 
G 2 10  ASP 10  39  39  ASP ASP E . n 
G 2 11  THR 11  40  40  THR THR E . n 
G 2 12  MET 12  41  41  MET MET E . n 
G 2 13  VAL 13  42  42  VAL VAL E . n 
G 2 14  ASP 14  43  43  ASP ASP E . n 
G 2 15  THR 15  44  44  THR THR E . n 
G 2 16  PHE 16  45  45  PHE PHE E . n 
G 2 17  LEU 17  46  46  LEU LEU E . n 
G 2 18  GLN 18  47  47  GLN GLN E . n 
G 2 19  LYS 19  48  48  LYS LYS E . n 
G 2 20  LEU 20  49  49  LEU LEU E . n 
G 2 21  VAL 21  50  50  VAL VAL E . n 
G 2 22  ALA 22  51  51  ALA ALA E . n 
G 2 23  ALA 23  52  52  ALA ALA E . n 
G 2 24  GLY 24  53  53  GLY GLY E . n 
G 2 25  SER 25  54  54  SER SER E . n 
G 2 26  TYR 26  55  55  TYR TYR E . n 
G 2 27  GLN 27  56  56  GLN GLN E . n 
G 2 28  ARG 28  57  57  ARG ARG E . n 
G 2 29  PHE 29  58  58  PHE PHE E . n 
G 2 30  THR 30  59  59  THR THR E . n 
G 2 31  ASP 31  60  60  ASP ASP E . n 
G 2 32  CYS 32  61  61  CYS CYS E . n 
G 2 33  TYR 33  62  62  TYR TYR E . n 
G 2 34  LYS 34  63  63  LYS LYS E . n 
G 2 35  CYS 35  64  64  CYS CYS E . n 
G 2 36  PHE 36  65  65  PHE PHE E . n 
G 2 37  TYR 37  66  66  TYR TYR E . n 
G 2 38  GLN 38  67  67  GLN GLN E . n 
G 2 39  LEU 39  68  68  LEU LEU E . n 
G 2 40  GLN 40  69  69  GLN GLN E . n 
G 2 41  PRO 41  70  70  PRO PRO E . n 
G 2 42  ALA 42  71  71  ALA ALA E . n 
G 2 43  MET 43  72  72  MET MET E . n 
G 2 44  THR 44  73  73  THR THR E . n 
G 2 45  GLN 45  74  74  GLN GLN E . n 
G 2 46  GLN 46  75  75  GLN GLN E . n 
G 2 47  ILE 47  76  76  ILE ILE E . n 
G 2 48  TYR 48  77  77  TYR TYR E . n 
G 2 49  ASP 49  78  78  ASP ASP E . n 
G 2 50  LYS 50  79  79  LYS LYS E . n 
G 2 51  PHE 51  80  80  PHE PHE E . n 
G 2 52  ILE 52  81  81  ILE ILE E . n 
G 2 53  ALA 53  82  82  ALA ALA E . n 
G 2 54  GLN 54  83  83  GLN GLN E . n 
G 2 55  LEU 55  84  84  LEU LEU E . n 
G 2 56  GLN 56  85  85  GLN GLN E . n 
G 2 57  THR 57  86  86  THR THR E . n 
G 2 58  SER 58  87  87  SER SER E . n 
G 2 59  ILE 59  88  88  ILE ILE E . n 
G 2 60  ARG 60  89  89  ARG ARG E . n 
G 2 61  GLU 61  90  90  GLU GLU E . n 
G 2 62  GLU 62  91  91  GLU GLU E . n 
G 2 63  ILE 63  92  92  ILE ILE E . n 
G 2 64  SER 64  93  93  SER SER E . n 
G 2 65  ASP 65  94  94  ASP ASP E . n 
G 2 66  ILE 66  95  95  ILE ILE E . n 
G 2 67  LYS 67  96  96  LYS LYS E . n 
G 2 68  GLU 68  97  97  GLU GLU E . n 
G 2 69  GLU 69  98  98  GLU GLU E . n 
G 2 70  GLY 70  99  99  GLY GLY E . n 
G 2 71  ASN 71  100 100 ASN ASN E . n 
G 2 72  LEU 72  101 101 LEU LEU E . n 
G 2 73  GLU 73  102 102 GLU GLU E . n 
G 2 74  ALA 74  103 103 ALA ALA E . n 
G 2 75  VAL 75  104 104 VAL VAL E . n 
G 2 76  LEU 76  105 105 LEU LEU E . n 
G 2 77  ASN 77  106 106 ASN ASN E . n 
G 2 78  ALA 78  107 107 ALA ALA E . n 
G 2 79  LEU 79  108 108 LEU LEU E . n 
G 2 80  ASP 80  109 109 ASP ASP E . n 
G 2 81  LYS 81  110 110 LYS LYS E . n 
G 2 82  ILE 82  111 111 ILE ILE E . n 
G 2 83  VAL 83  112 112 VAL VAL E . n 
G 2 84  GLU 84  113 113 GLU GLU E . n 
G 2 85  GLU 85  114 114 GLU GLU E . n 
G 2 86  GLY 86  115 115 GLY GLY E . n 
G 2 87  LYS 87  116 116 LYS LYS E . n 
G 2 88  VAL 88  117 117 VAL VAL E . n 
G 2 89  ARG 89  118 118 ARG ARG E . n 
G 2 90  LYS 90  119 119 LYS LYS E . n 
G 2 91  GLU 91  120 120 GLU GLU E . n 
G 2 92  PRO 92  121 121 PRO PRO E . n 
G 2 93  ALA 93  122 122 ALA ALA E . n 
G 2 94  TRP 94  123 123 TRP TRP E . n 
G 2 95  ARG 95  124 124 ARG ARG E . n 
G 2 96  PRO 96  125 125 PRO PRO E . n 
G 2 97  SER 97  126 126 SER SER E . n 
G 2 98  GLY 98  127 127 GLY GLY E . n 
G 2 99  ILE 99  128 128 ILE ILE E . n 
G 2 100 PRO 100 129 129 PRO PRO E . n 
G 2 101 GLU 101 130 130 GLU GLU E . n 
G 2 102 LYS 102 131 131 LYS LYS E . n 
G 2 103 ASP 103 132 132 ASP ASP E . n 
G 2 104 LEU 104 133 133 LEU LEU E . n 
G 2 105 HIS 105 134 134 HIS HIS E . n 
G 2 106 SER 106 135 135 SER SER E . n 
G 2 107 VAL 107 136 136 VAL VAL E . n 
G 2 108 MET 108 137 137 MET MET E . n 
G 2 109 ALA 109 138 138 ALA ALA E . n 
G 2 110 PRO 110 139 139 PRO PRO E . n 
G 2 111 TYR 111 140 140 TYR TYR E . n 
G 2 112 PHE 112 141 141 PHE PHE E . n 
G 2 113 LEU 113 142 142 LEU LEU E . n 
G 2 114 GLN 114 143 143 GLN GLN E . n 
G 2 115 GLN 115 144 144 GLN GLN E . n 
G 2 116 ARG 116 145 145 ARG ARG E . n 
G 2 117 ASP 117 146 146 ASP ASP E . n 
G 2 118 THR 118 147 147 THR THR E . n 
G 2 119 LEU 119 148 148 LEU LEU E . n 
G 2 120 ARG 120 149 149 ARG ARG E . n 
G 2 121 ARG 121 150 150 ARG ARG E . n 
G 2 122 HIS 122 151 151 HIS HIS E . n 
G 2 123 VAL 123 152 152 VAL VAL E . n 
G 2 124 GLN 124 153 153 GLN GLN E . n 
G 2 125 LYS 125 154 154 LYS LYS E . n 
G 2 126 GLN 126 155 155 GLN GLN E . n 
G 2 127 GLU 127 156 156 GLU GLU E . n 
G 2 128 ALA 128 157 157 ALA ALA E . n 
G 2 129 GLU 129 158 158 GLU GLU E . n 
G 2 130 ASN 130 159 159 ASN ASN E . n 
G 2 131 GLN 131 160 160 GLN GLN E . n 
G 2 132 GLN 132 161 161 GLN GLN E . n 
G 2 133 LEU 133 162 162 LEU LEU E . n 
G 2 134 ALA 134 163 163 ALA ALA E . n 
G 2 135 ASP 135 164 164 ASP ASP E . n 
G 2 136 ALA 136 165 165 ALA ALA E . n 
G 2 137 VAL 137 166 166 VAL VAL E . n 
G 2 138 LEU 138 167 167 LEU LEU E . n 
G 2 139 ALA 139 168 168 ALA ALA E . n 
G 2 140 GLY 140 169 169 GLY GLY E . n 
G 2 141 ARG 141 170 170 ARG ARG E . n 
G 2 142 ARG 142 171 171 ARG ARG E . n 
G 2 143 GLN 143 172 172 GLN GLN E . n 
G 2 144 VAL 144 173 173 VAL VAL E . n 
G 2 145 GLU 145 174 174 GLU GLU E . n 
G 2 146 GLU 146 175 175 GLU GLU E . n 
G 2 147 LEU 147 176 176 LEU LEU E . n 
G 2 148 GLN 148 177 177 GLN GLN E . n 
G 2 149 LEU 149 178 178 LEU LEU E . n 
G 2 150 GLN 150 179 179 GLN GLN E . n 
G 2 151 VAL 151 180 180 VAL VAL E . n 
G 2 152 GLN 152 181 181 GLN GLN E . n 
G 2 153 ALA 153 182 182 ALA ALA E . n 
G 2 154 GLN 154 183 183 GLN GLN E . n 
G 2 155 GLN 155 184 184 GLN GLN E . n 
G 2 156 GLN 156 185 185 GLN GLN E . n 
G 2 157 ALA 157 186 186 ALA ALA E . n 
G 2 158 TRP 158 187 187 TRP TRP E . n 
G 2 159 GLN 159 188 188 GLN GLN E . n 
G 2 160 ALA 160 189 189 ALA ALA E . n 
G 2 161 LEU 161 190 190 LEU LEU E . n 
G 2 162 HIS 162 191 191 HIS HIS E . n 
G 2 163 ARG 163 192 192 ARG ARG E . n 
G 2 164 GLU 164 193 193 GLU GLU E . n 
G 2 165 GLN 165 194 194 GLN GLN E . n 
G 2 166 ARG 166 195 195 ARG ARG E . n 
G 2 167 GLU 167 196 196 GLU GLU E . n 
G 2 168 LEU 168 197 197 LEU LEU E . n 
G 2 169 VAL 169 198 198 VAL VAL E . n 
G 2 170 ALA 170 199 199 ALA ALA E . n 
G 2 171 VAL 171 200 200 VAL VAL E . n 
G 2 172 LEU 172 201 201 LEU LEU E . n 
G 2 173 ARG 173 202 202 ARG ARG E . n 
G 2 174 GLU 174 203 203 GLU ALA E . n 
G 2 175 PRO 175 204 ?   ?   ?   E . n 
G 2 176 GLU 176 205 ?   ?   ?   E . n 
H 3 1   MET 1   185 ?   ?   ?   F . n 
H 3 2   GLY 2   186 ?   ?   ?   F . n 
H 3 3   THR 3   187 ?   ?   ?   F . n 
H 3 4   LEU 4   188 ?   ?   ?   F . n 
H 3 5   GLN 5   189 ?   ?   ?   F . n 
H 3 6   LYS 6   190 ?   ?   ?   F . n 
H 3 7   CYS 7   191 ?   ?   ?   F . n 
H 3 8   PHE 8   192 ?   ?   ?   F . n 
H 3 9   GLU 9   193 ?   ?   ?   F . n 
H 3 10  ASP 10  194 ?   ?   ?   F . n 
H 3 11  SER 11  195 ?   ?   ?   F . n 
H 3 12  ASN 12  196 ?   ?   ?   F . n 
H 3 13  GLY 13  197 ?   ?   ?   F . n 
H 3 14  LYS 14  198 ?   ?   ?   F . n 
H 3 15  ALA 15  199 ?   ?   ?   F . n 
H 3 16  SER 16  200 ?   ?   ?   F . n 
H 3 17  ASP 17  201 ?   ?   ?   F . n 
H 3 18  PHE 18  202 ?   ?   ?   F . n 
H 3 19  SER 19  203 203 SER SER F . n 
H 3 20  LEU 20  204 204 LEU LEU F . n 
H 3 21  GLU 21  205 205 GLU GLU F . n 
H 3 22  ALA 22  206 206 ALA ALA F . n 
H 3 23  SER 23  207 207 SER SER F . n 
H 3 24  VAL 24  208 208 VAL VAL F . n 
H 3 25  ALA 25  209 209 ALA ALA F . n 
H 3 26  GLU 26  210 210 GLU GLU F . n 
H 3 27  MET 27  211 211 MET MET F . n 
H 3 28  LYS 28  212 212 LYS LYS F . n 
H 3 29  GLU 29  213 213 GLU GLU F . n 
H 3 30  TYR 30  214 214 TYR TYR F . n 
H 3 31  ILE 31  215 215 ILE ILE F . n 
H 3 32  THR 32  216 216 THR THR F . n 
H 3 33  LYS 33  217 217 LYS LYS F . n 
H 3 34  PHE 34  218 218 PHE PHE F . n 
H 3 35  SER 35  219 219 SER SER F . n 
H 3 36  LEU 36  220 220 LEU LEU F . n 
H 3 37  GLU 37  221 221 GLU GLU F . n 
H 3 38  ARG 38  222 222 ARG ARG F . n 
H 3 39  GLN 39  223 223 GLN GLN F . n 
H 3 40  THR 40  224 224 THR THR F . n 
H 3 41  TRP 41  225 225 TRP TRP F . n 
H 3 42  ASP 42  226 226 ASP ASP F . n 
H 3 43  GLN 43  227 227 GLN GLN F . n 
H 3 44  LEU 44  228 228 LEU LEU F . n 
H 3 45  LEU 45  229 229 LEU LEU F . n 
H 3 46  LEU 46  230 230 LEU LEU F . n 
H 3 47  HIS 47  231 231 HIS HIS F . n 
H 3 48  TYR 48  232 232 TYR TYR F . n 
H 3 49  GLN 49  233 233 GLN GLN F . n 
H 3 50  GLN 50  234 234 GLN GLN F . n 
H 3 51  GLU 51  235 235 GLU GLU F . n 
H 3 52  ALA 52  236 236 ALA ALA F . n 
H 3 53  LYS 53  237 237 LYS LYS F . n 
H 3 54  GLU 54  238 238 GLU GLU F . n 
H 3 55  ILE 55  239 239 ILE ILE F . n 
H 3 56  LEU 56  240 240 LEU LEU F . n 
H 3 57  SER 57  241 241 SER SER F . n 
H 3 58  ARG 58  242 242 ARG ARG F . n 
H 3 59  GLY 59  243 243 GLY GLY F . n 
H 3 60  SER 60  244 244 SER SER F . n 
H 3 61  THR 61  245 245 THR THR F . n 
H 3 62  GLU 62  246 ?   ?   ?   F . n 
H 3 63  ALA 63  247 ?   ?   ?   F . n 
H 3 64  LYS 64  248 ?   ?   ?   F . n 
H 3 65  ILE 65  249 ?   ?   ?   F . n 
H 3 66  THR 66  250 ?   ?   ?   F . n 
H 3 67  GLU 67  251 ?   ?   ?   F . n 
H 3 68  VAL 68  252 ?   ?   ?   F . n 
H 3 69  LYS 69  253 ?   ?   ?   F . n 
H 3 70  VAL 70  254 ?   ?   ?   F . n 
H 3 71  GLU 71  255 ?   ?   ?   F . n 
H 3 72  PRO 72  256 ?   ?   ?   F . n 
H 3 73  MET 73  257 ?   ?   ?   F . n 
H 3 74  THR 74  258 ?   ?   ?   F . n 
H 3 75  TYR 75  259 ?   ?   ?   F . n 
H 3 76  LEU 76  260 260 LEU LEU F . n 
H 3 77  GLY 77  261 261 GLY GLY F . n 
H 3 78  SER 78  262 262 SER SER F . n 
H 3 79  SER 79  263 263 SER SER F . n 
H 3 80  GLN 80  264 264 GLN GLN F . n 
H 3 81  ASN 81  265 265 ASN ASN F . n 
H 3 82  GLU 82  266 266 GLU GLU F . n 
H 3 83  VAL 83  267 267 VAL VAL F . n 
H 3 84  LEU 84  268 268 LEU LEU F . n 
H 3 85  ASN 85  269 269 ASN ASN F . n 
H 3 86  THR 86  270 270 THR THR F . n 
H 3 87  LYS 87  271 271 LYS LYS F . n 
H 3 88  PRO 88  272 272 PRO PRO F . n 
H 3 89  ASP 89  273 273 ASP ASP F . n 
H 3 90  TYR 90  274 274 TYR TYR F . n 
H 3 91  GLN 91  275 275 GLN GLN F . n 
H 3 92  LYS 92  276 276 LYS LYS F . n 
H 3 93  ILE 93  277 277 ILE ILE F . n 
H 3 94  LEU 94  278 278 LEU LEU F . n 
H 3 95  GLN 95  279 279 GLN GLN F . n 
H 3 96  ASN 96  280 280 ASN ASN F . n 
H 3 97  GLN 97  281 281 GLN GLN F . n 
H 3 98  SER 98  282 282 SER SER F . n 
H 3 99  LYS 99  283 283 LYS LYS F . n 
H 3 100 VAL 100 284 284 VAL VAL F . n 
H 3 101 PHE 101 285 285 PHE PHE F . n 
H 3 102 ASP 102 286 286 ASP ASP F . n 
H 3 103 CYS 103 287 287 CYS CYS F . n 
H 3 104 MET 104 288 288 MET MET F . n 
H 3 105 GLU 105 289 289 GLU GLU F . n 
H 3 106 LEU 106 290 290 LEU LEU F . n 
H 3 107 VAL 107 291 291 VAL VAL F . n 
H 3 108 MET 108 292 292 MET MET F . n 
H 3 109 ASP 109 293 293 ASP ASP F . n 
H 3 110 GLU 110 294 294 GLU GLU F . n 
H 3 111 LEU 111 295 295 LEU LEU F . n 
H 3 112 GLN 112 296 296 GLN GLN F . n 
H 3 113 GLY 113 297 297 GLY GLY F . n 
H 3 114 SER 114 298 298 SER SER F . n 
H 3 115 VAL 115 299 299 VAL VAL F . n 
H 3 116 LYS 116 300 300 LYS LYS F . n 
H 3 117 GLN 117 301 301 GLN GLN F . n 
H 3 118 LEU 118 302 302 LEU LEU F . n 
H 3 119 GLN 119 303 303 GLN GLN F . n 
H 3 120 ALA 120 304 304 ALA ALA F . n 
H 3 121 PHE 121 305 305 PHE PHE F . n 
H 3 122 MET 122 306 306 MET MET F . n 
H 3 123 ASP 123 307 307 ASP ASP F . n 
H 3 124 GLU 124 308 308 GLU GLU F . n 
H 3 125 SER 125 309 309 SER SER F . n 
H 3 126 THR 126 310 310 THR THR F . n 
H 3 127 GLN 127 311 311 GLN GLN F . n 
H 3 128 CYS 128 312 312 CYS CYS F . n 
H 3 129 PHE 129 313 313 PHE PHE F . n 
H 3 130 GLN 130 314 314 GLN GLN F . n 
H 3 131 LYS 131 315 315 LYS LYS F . n 
H 3 132 VAL 132 316 316 VAL VAL F . n 
H 3 133 SER 133 317 317 SER SER F . n 
H 3 134 VAL 134 318 ?   ?   ?   F . n 
H 3 135 GLN 135 319 ?   ?   ?   F . n 
H 3 136 LEU 136 320 ?   ?   ?   F . n 
H 3 137 GLY 137 321 ?   ?   ?   F . n 
H 3 138 LYS 138 322 ?   ?   ?   F . n 
H 3 139 ARG 139 323 ?   ?   ?   F . n 
H 3 140 SER 140 324 ?   ?   ?   F . n 
H 3 141 MET 141 325 ?   ?   ?   F . n 
H 3 142 GLN 142 326 ?   ?   ?   F . n 
H 3 143 GLN 143 327 ?   ?   ?   F . n 
H 3 144 LEU 144 328 ?   ?   ?   F . n 
H 3 145 ASP 145 329 ?   ?   ?   F . n 
H 3 146 PRO 146 330 ?   ?   ?   F . n 
H 3 147 SER 147 331 ?   ?   ?   F . n 
H 3 148 PRO 148 332 ?   ?   ?   F . n 
H 3 149 ALA 149 333 ?   ?   ?   F . n 
H 3 150 ARG 150 334 ?   ?   ?   F . n 
H 3 151 LYS 151 335 ?   ?   ?   F . n 
H 3 152 LEU 152 336 ?   ?   ?   F . n 
H 3 153 LEU 153 337 ?   ?   ?   F . n 
H 3 154 LYS 154 338 ?   ?   ?   F . n 
H 3 155 LEU 155 339 ?   ?   ?   F . n 
H 3 156 GLN 156 340 ?   ?   ?   F . n 
H 3 157 LEU 157 341 ?   ?   ?   F . n 
H 3 158 GLN 158 342 ?   ?   ?   F . n 
H 3 159 ASN 159 343 ?   ?   ?   F . n 
H 3 160 PRO 160 344 ?   ?   ?   F . n 
H 3 161 PRO 161 345 ?   ?   ?   F . n 
H 3 162 ALA 162 346 ?   ?   ?   F . n 
H 3 163 ILE 163 347 ?   ?   ?   F . n 
H 3 164 HIS 164 348 ?   ?   ?   F . n 
H 3 165 GLY 165 349 ?   ?   ?   F . n 
H 3 166 SER 166 350 ?   ?   ?   F . n 
H 3 167 GLY 167 351 ?   ?   ?   F . n 
H 3 168 SER 168 352 ?   ?   ?   F . n 
H 3 169 GLY 169 353 ?   ?   ?   F . n 
H 3 170 SER 170 354 ?   ?   ?   F . n 
H 3 171 CYS 171 355 ?   ?   ?   F . n 
H 3 172 GLN 172 356 ?   ?   ?   F . n 
H 3 173 HIS 173 357 ?   ?   ?   F . n 
H 3 174 HIS 174 358 ?   ?   ?   F . n 
H 3 175 HIS 175 359 ?   ?   ?   F . n 
H 3 176 HIS 176 360 ?   ?   ?   F . n 
H 3 177 HIS 177 361 ?   ?   ?   F . n 
H 3 178 HIS 178 362 ?   ?   ?   F . n 
I 4 1   MET 1   91  ?   ?   ?   G . n 
I 4 2   GLY 2   92  ?   ?   ?   G . n 
I 4 3   GLN 3   93  ?   ?   ?   G . n 
I 4 4   ALA 4   94  ?   ?   ?   G . n 
I 4 5   TRP 5   95  ?   ?   ?   G . n 
I 4 6   GLN 6   96  ?   ?   ?   G . n 
I 4 7   GLU 7   97  ?   ?   ?   G . n 
I 4 8   ALA 8   98  ?   ?   ?   G . n 
I 4 9   SER 9   99  ?   ?   ?   G . n 
I 4 10  ASP 10  100 ?   ?   ?   G . n 
I 4 11  ASN 11  101 ?   ?   ?   G . n 
I 4 12  CYS 12  102 ?   ?   ?   G . n 
I 4 13  PHE 13  103 103 PHE PHE G . n 
I 4 14  MET 14  104 104 MET MET G . n 
I 4 15  ASP 15  105 105 ASP ASP G . n 
I 4 16  SER 16  106 106 SER SER G . n 
I 4 17  ASP 17  107 107 ASP ASP G . n 
I 4 18  ILE 18  108 108 ILE ILE G . n 
I 4 19  LYS 19  109 109 LYS LYS G . n 
I 4 20  VAL 20  110 110 VAL VAL G . n 
I 4 21  LEU 21  111 111 LEU LEU G . n 
I 4 22  GLU 22  112 112 GLU GLU G . n 
I 4 23  ASP 23  113 113 ASP ASP G . n 
I 4 24  GLN 24  114 114 GLN GLN G . n 
I 4 25  PHE 25  115 115 PHE PHE G . n 
I 4 26  ASP 26  116 116 ASP ASP G . n 
I 4 27  GLU 27  117 117 GLU GLU G . n 
I 4 28  ILE 28  118 118 ILE ILE G . n 
I 4 29  ILE 29  119 119 ILE ILE G . n 
I 4 30  VAL 30  120 120 VAL VAL G . n 
I 4 31  ASP 31  121 121 ASP ASP G . n 
I 4 32  ILE 32  122 122 ILE ILE G . n 
I 4 33  ALA 33  123 123 ALA ALA G . n 
I 4 34  THR 34  124 124 THR THR G . n 
I 4 35  LYS 35  125 125 LYS LYS G . n 
I 4 36  ARG 36  126 126 ARG ARG G . n 
I 4 37  LYS 37  127 127 LYS LYS G . n 
I 4 38  GLN 38  128 128 GLN GLN G . n 
I 4 39  TYR 39  129 129 TYR TYR G . n 
I 4 40  PRO 40  130 130 PRO PRO G . n 
I 4 41  ARG 41  131 131 ARG ARG G . n 
I 4 42  LYS 42  132 132 LYS LYS G . n 
I 4 43  ILE 43  133 133 ILE ILE G . n 
I 4 44  LEU 44  134 134 LEU LEU G . n 
I 4 45  GLU 45  135 135 GLU GLU G . n 
I 4 46  CYS 46  136 136 CYS CYS G . n 
I 4 47  VAL 47  137 137 VAL VAL G . n 
I 4 48  ILE 48  138 138 ILE ILE G . n 
I 4 49  LYS 49  139 139 LYS LYS G . n 
I 4 50  THR 50  140 140 THR THR G . n 
I 4 51  ILE 51  141 141 ILE ILE G . n 
I 4 52  LYS 52  142 142 LYS LYS G . n 
I 4 53  ALA 53  143 143 ALA ALA G . n 
I 4 54  LYS 54  144 144 LYS LYS G . n 
I 4 55  GLN 55  145 145 GLN GLN G . n 
I 4 56  GLU 56  146 146 GLU GLU G . n 
I 4 57  ILE 57  147 147 ILE ILE G . n 
I 4 58  LEU 58  148 148 LEU LEU G . n 
I 4 59  LYS 59  149 149 LYS LYS G . n 
I 4 60  GLN 60  150 150 GLN GLN G . n 
I 4 61  TYR 61  151 151 TYR TYR G . n 
I 4 62  HIS 62  152 152 HIS HIS G . n 
I 4 63  PRO 63  153 153 PRO PRO G . n 
I 4 64  VAL 64  154 154 VAL VAL G . n 
I 4 65  VAL 65  155 155 VAL VAL G . n 
I 4 66  HIS 66  156 156 HIS HIS G . n 
I 4 67  PRO 67  157 157 PRO PRO G . n 
I 4 68  LEU 68  158 158 LEU LEU G . n 
I 4 69  ASP 69  159 159 ASP ASP G . n 
I 4 70  LEU 70  160 160 LEU LEU G . n 
I 4 71  LYS 71  161 161 LYS LYS G . n 
I 4 72  TYR 72  162 162 TYR TYR G . n 
I 4 73  ASP 73  163 163 ASP ASP G . n 
I 4 74  PRO 74  164 164 PRO PRO G . n 
I 4 75  ASP 75  165 165 ASP ASP G . n 
I 4 76  PRO 76  166 166 PRO PRO G . n 
I 4 77  ALA 77  167 167 ALA ALA G . n 
I 4 78  PRO 78  168 168 PRO PRO G . n 
I 4 79  HIS 79  169 169 HIS HIS G . n 
I 4 80  MET 80  170 170 MET MET G . n 
I 4 81  GLU 81  171 171 GLU GLU G . n 
I 4 82  ASN 82  172 172 ASN ASN G . n 
I 4 83  LEU 83  173 173 LEU LEU G . n 
I 4 84  LYS 84  174 174 LYS LYS G . n 
I 4 85  CYS 85  175 175 CYS CYS G . n 
I 4 86  ARG 86  176 176 ARG ARG G . n 
I 4 87  GLY 87  177 177 GLY GLY G . n 
I 4 88  GLU 88  178 178 GLU GLU G . n 
I 4 89  THR 89  179 179 THR THR G . n 
I 4 90  VAL 90  180 180 VAL VAL G . n 
I 4 91  ALA 91  181 181 ALA ALA G . n 
I 4 92  LYS 92  182 182 LYS LYS G . n 
I 4 93  GLU 93  183 183 GLU GLU G . n 
I 4 94  ILE 94  184 184 ILE ILE G . n 
I 4 95  SER 95  185 185 SER SER G . n 
I 4 96  GLU 96  186 186 GLU GLU G . n 
I 4 97  ALA 97  187 187 ALA ALA G . n 
I 4 98  MET 98  188 188 MET MET G . n 
I 4 99  LYS 99  189 189 LYS LYS G . n 
I 4 100 SER 100 190 190 SER SER G . n 
I 4 101 LEU 101 191 191 LEU LEU G . n 
I 4 102 PRO 102 192 192 PRO PRO G . n 
I 4 103 ALA 103 193 193 ALA ALA G . n 
I 4 104 LEU 104 194 194 LEU LEU G . n 
I 4 105 ILE 105 195 195 ILE ILE G . n 
I 4 106 GLU 106 196 196 GLU GLU G . n 
I 4 107 GLN 107 197 197 GLN GLN G . n 
I 4 108 GLY 108 198 198 GLY GLY G . n 
I 4 109 GLU 109 199 199 GLU GLU G . n 
I 4 110 GLY 110 200 200 GLY GLY G . n 
I 4 111 PHE 111 201 201 PHE PHE G . n 
I 4 112 SER 112 202 202 SER SER G . n 
I 4 113 GLN 113 203 203 GLN GLN G . n 
I 4 114 VAL 114 204 204 VAL VAL G . n 
I 4 115 LEU 115 205 ?   ?   ?   G . n 
I 4 116 ARG 116 206 ?   ?   ?   G . n 
J 5 1   GLY 1   -4  ?   ?   ?   Q . n 
J 5 2   PRO 2   -3  ?   ?   ?   Q . n 
J 5 3   LEU 3   -2  ?   ?   ?   Q . n 
J 5 4   GLY 4   -1  ?   ?   ?   Q . n 
J 5 5   SER 5   0   ?   ?   ?   Q . n 
J 5 6   MET 6   1   ?   ?   ?   Q . n 
J 5 7   ALA 7   2   ?   ?   ?   Q . n 
J 5 8   ALA 8   3   ?   ?   ?   Q . n 
J 5 9   SER 9   4   ?   ?   ?   Q . n 
J 5 10  GLY 10  5   ?   ?   ?   Q . n 
J 5 11  LEU 11  6   6   LEU LEU Q . n 
J 5 12  ASP 12  7   7   ASP ASP Q . n 
J 5 13  HIS 13  8   8   HIS HIS Q . n 
J 5 14  LEU 14  9   9   LEU LEU Q . n 
J 5 15  LYS 15  10  10  LYS LYS Q . n 
J 5 16  ASN 16  11  11  ASN ASN Q . n 
J 5 17  GLY 17  12  12  GLY GLY Q . n 
J 5 18  TYR 18  13  13  TYR TYR Q . n 
J 5 19  ARG 19  14  14  ARG ARG Q . n 
J 5 20  ARG 20  15  15  ARG ARG Q . n 
J 5 21  ARG 21  16  16  ARG ARG Q . n 
J 5 22  PHE 22  17  17  PHE PHE Q . n 
J 5 23  CYS 23  18  18  CYS CYS Q . n 
J 5 24  ARG 24  19  19  ARG ARG Q . n 
J 5 25  PRO 25  20  20  PRO PRO Q . n 
J 5 26  SER 26  21  ?   ?   ?   Q . n 
J 5 27  ARG 27  22  ?   ?   ?   Q . n 
J 5 28  ALA 28  23  ?   ?   ?   Q . n 
J 5 29  ARG 29  24  ?   ?   ?   Q . n 
J 5 30  ASP 30  25  ?   ?   ?   Q . n 
J 5 31  ILE 31  26  ?   ?   ?   Q . n 
J 5 32  ASN 32  27  ?   ?   ?   Q . n 
J 5 33  THR 33  28  ?   ?   ?   Q . n 
J 5 34  GLU 34  29  ?   ?   ?   Q . n 
J 5 35  GLN 35  30  ?   ?   ?   Q . n 
J 5 36  GLY 36  31  ?   ?   ?   Q . n 
J 5 37  GLN 37  32  ?   ?   ?   Q . n 
J 5 38  ASN 38  33  ?   ?   ?   Q . n 
J 5 39  VAL 39  34  ?   ?   ?   Q . n 
J 5 40  LEU 40  35  ?   ?   ?   Q . n 
J 5 41  GLU 41  36  ?   ?   ?   Q . n 
J 5 42  ILE 42  37  ?   ?   ?   Q . n 
J 5 43  LEU 43  38  ?   ?   ?   Q . n 
J 5 44  GLN 44  39  ?   ?   ?   Q . n 
J 5 45  ASP 45  40  ?   ?   ?   Q . n 
J 5 46  CYS 46  41  ?   ?   ?   Q . n 
J 5 47  PHE 47  42  ?   ?   ?   Q . n 
J 5 48  GLU 48  43  ?   ?   ?   Q . n 
J 5 49  GLU 49  44  ?   ?   ?   Q . n 
J 5 50  LYS 50  45  ?   ?   ?   Q . n 
J 5 51  SER 51  46  ?   ?   ?   Q . n 
J 5 52  LEU 52  47  ?   ?   ?   Q . n 
J 5 53  ALA 53  48  ?   ?   ?   Q . n 
J 5 54  ASN 54  49  ?   ?   ?   Q . n 
J 5 55  ASP 55  50  ?   ?   ?   Q . n 
J 5 56  PHE 56  51  ?   ?   ?   Q . n 
J 5 57  SER 57  52  ?   ?   ?   Q . n 
J 5 58  THR 58  53  ?   ?   ?   Q . n 
J 5 59  ASN 59  54  ?   ?   ?   Q . n 
J 5 60  SER 60  55  ?   ?   ?   Q . n 
J 5 61  THR 61  56  ?   ?   ?   Q . n 
J 5 62  LYS 62  57  ?   ?   ?   Q . n 
J 5 63  SER 63  58  ?   ?   ?   Q . n 
J 5 64  VAL 64  59  ?   ?   ?   Q . n 
J 5 65  PRO 65  60  ?   ?   ?   Q . n 
J 5 66  ASN 66  61  ?   ?   ?   Q . n 
J 5 67  SER 67  62  ?   ?   ?   Q . n 
J 5 68  THR 68  63  ?   ?   ?   Q . n 
J 5 69  ARG 69  64  ?   ?   ?   Q . n 
J 5 70  LYS 70  65  ?   ?   ?   Q . n 
J 5 71  ILE 71  66  ?   ?   ?   Q . n 
J 5 72  LYS 72  67  ?   ?   ?   Q . n 
J 5 73  ASP 73  68  ?   ?   ?   Q . n 
J 5 74  THR 74  69  ?   ?   ?   Q . n 
J 5 75  CYS 75  70  ?   ?   ?   Q . n 
J 5 76  ILE 76  71  ?   ?   ?   Q . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA pentameric 5 
2 author_and_software_defined_assembly PISA pentameric 5 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E 
2 1 F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 24050 ? 
1 MORE         -225  ? 
1 'SSA (A^2)'  31550 ? 
2 'ABSA (A^2)' 24260 ? 
2 MORE         -223  ? 
2 'SSA (A^2)'  31860 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-11-16 
2 'Structure model' 1 1 2016-12-07 
3 'Structure model' 1 2 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            reflns_shell 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_reflns_shell.percent_possible_all' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.10_2155 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.11      2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .         3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .         4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .         5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            N 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             152 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            N 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             153 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.496 
_pdbx_validate_rmsd_bond.bond_target_value         1.338 
_pdbx_validate_rmsd_bond.bond_deviation            0.158 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA N LEU 160 ? ? CB N LEU 160 ? ? CG N LEU 160 ? ? 130.16 115.30 14.86 2.30 N 
2 1 CA N LEU 173 ? ? CB N LEU 173 ? ? CG N LEU 173 ? ? 131.28 115.30 15.98 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 10  ? ? -69.73  -174.00 
2  1 GLN A 11  ? ? 70.28   -27.30  
3  1 THR A 16  ? ? 78.23   143.59  
4  1 ASP A 52  ? ? 59.92   -64.37  
5  1 SER A 95  ? ? 71.45   -19.31  
6  1 SER B 33  ? ? 52.21   19.85   
7  1 ARG B 34  ? ? 60.24   -25.69  
8  1 SER B 54  ? ? -64.73  45.34   
9  1 TYR B 55  ? ? 59.07   -45.54  
10 1 PHE B 65  ? ? 90.11   -21.36  
11 1 GLN B 69  ? ? 51.40   71.03   
12 1 VAL B 117 ? ? 119.04  -13.88  
13 1 LYS B 119 ? ? 65.61   -9.18   
14 1 PRO B 125 ? ? -55.87  109.21  
15 1 ASP N 105 ? ? 55.58   -96.75  
16 1 VAL N 155 ? ? 41.49   80.31   
17 1 LEU N 158 ? ? 62.05   -117.31 
18 1 ASP N 159 ? ? 64.34   -128.26 
19 1 LEU N 160 ? ? 61.36   157.98  
20 1 ASP N 163 ? ? 61.69   171.71  
21 1 PRO N 166 ? ? -61.55  -143.61 
22 1 ALA N 167 ? ? -116.13 60.44   
23 1 ASP P 7   ? ? 45.27   -116.74 
24 1 TYR P 13  ? ? 51.55   76.69   
25 1 VAL C 3   ? ? 46.02   70.05   
26 1 ALA C 10  ? ? -68.94  -175.01 
27 1 GLN C 11  ? ? 70.04   -26.98  
28 1 PHE C 12  ? ? -98.42  -60.45  
29 1 THR C 16  ? ? 71.95   140.57  
30 1 ASP C 52  ? ? 63.02   67.65   
31 1 CYS C 53  ? ? 75.85   173.24  
32 1 SER C 56  ? ? -179.54 -175.52 
33 1 SER C 95  ? ? 70.57   -20.73  
34 1 ARG E 34  ? ? 58.47   -32.72  
35 1 PHE E 65  ? ? 90.58   -21.16  
36 1 VAL E 117 ? ? 118.16  -10.49  
37 1 LYS E 119 ? ? 64.71   -9.96   
38 1 LYS F 315 ? ? -65.53  1.80    
39 1 VAL G 155 ? ? 42.77   87.37   
40 1 LEU G 158 ? ? 66.49   -112.75 
41 1 ASP G 159 ? ? 66.88   -116.27 
42 1 LEU G 160 ? ? 69.13   96.03   
43 1 PRO G 166 ? ? -71.36  -146.06 
44 1 ALA G 167 ? ? -117.16 59.87   
45 1 ASP Q 7   ? ? 1.59    75.39   
46 1 TYR Q 13  ? ? 52.08   88.51   
47 1 CYS Q 18  ? ? 19.53   80.04   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B GLU 203 ? CG  ? B GLU 174 CG  
2 1 Y 1 B GLU 203 ? CD  ? B GLU 174 CD  
3 1 Y 1 B GLU 203 ? OE1 ? B GLU 174 OE1 
4 1 Y 1 B GLU 203 ? OE2 ? B GLU 174 OE2 
5 1 Y 1 E GLU 203 ? CG  ? G GLU 174 CG  
6 1 Y 1 E GLU 203 ? CD  ? G GLU 174 CD  
7 1 Y 1 E GLU 203 ? OE1 ? G GLU 174 OE1 
8 1 Y 1 E GLU 203 ? OE2 ? G GLU 174 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ARG 201 ? A ARG 201 
3   1 Y 1 A LEU 202 ? A LEU 202 
4   1 Y 1 A LYS 203 ? A LYS 203 
5   1 Y 1 A ILE 204 ? A ILE 204 
6   1 Y 1 A SER 205 ? A SER 205 
7   1 Y 1 B MET 30  ? B MET 1   
8   1 Y 1 B PRO 204 ? B PRO 175 
9   1 Y 1 B GLU 205 ? B GLU 176 
10  1 Y 1 D MET 185 ? C MET 1   
11  1 Y 1 D GLY 186 ? C GLY 2   
12  1 Y 1 D THR 187 ? C THR 3   
13  1 Y 1 D LEU 188 ? C LEU 4   
14  1 Y 1 D GLN 189 ? C GLN 5   
15  1 Y 1 D LYS 190 ? C LYS 6   
16  1 Y 1 D CYS 191 ? C CYS 7   
17  1 Y 1 D PHE 192 ? C PHE 8   
18  1 Y 1 D GLU 193 ? C GLU 9   
19  1 Y 1 D ASP 194 ? C ASP 10  
20  1 Y 1 D SER 195 ? C SER 11  
21  1 Y 1 D ASN 196 ? C ASN 12  
22  1 Y 1 D GLY 197 ? C GLY 13  
23  1 Y 1 D LYS 198 ? C LYS 14  
24  1 Y 1 D ALA 199 ? C ALA 15  
25  1 Y 1 D SER 200 ? C SER 16  
26  1 Y 1 D ASP 201 ? C ASP 17  
27  1 Y 1 D PHE 202 ? C PHE 18  
28  1 Y 1 D GLU 246 ? C GLU 62  
29  1 Y 1 D ALA 247 ? C ALA 63  
30  1 Y 1 D LYS 248 ? C LYS 64  
31  1 Y 1 D ILE 249 ? C ILE 65  
32  1 Y 1 D THR 250 ? C THR 66  
33  1 Y 1 D GLU 251 ? C GLU 67  
34  1 Y 1 D VAL 252 ? C VAL 68  
35  1 Y 1 D LYS 253 ? C LYS 69  
36  1 Y 1 D VAL 254 ? C VAL 70  
37  1 Y 1 D GLU 255 ? C GLU 71  
38  1 Y 1 D PRO 256 ? C PRO 72  
39  1 Y 1 D MET 257 ? C MET 73  
40  1 Y 1 D THR 258 ? C THR 74  
41  1 Y 1 D TYR 259 ? C TYR 75  
42  1 Y 1 D VAL 318 ? C VAL 134 
43  1 Y 1 D GLN 319 ? C GLN 135 
44  1 Y 1 D LEU 320 ? C LEU 136 
45  1 Y 1 D GLY 321 ? C GLY 137 
46  1 Y 1 D LYS 322 ? C LYS 138 
47  1 Y 1 D ARG 323 ? C ARG 139 
48  1 Y 1 D SER 324 ? C SER 140 
49  1 Y 1 D MET 325 ? C MET 141 
50  1 Y 1 D GLN 326 ? C GLN 142 
51  1 Y 1 D GLN 327 ? C GLN 143 
52  1 Y 1 D LEU 328 ? C LEU 144 
53  1 Y 1 D ASP 329 ? C ASP 145 
54  1 Y 1 D PRO 330 ? C PRO 146 
55  1 Y 1 D SER 331 ? C SER 147 
56  1 Y 1 D PRO 332 ? C PRO 148 
57  1 Y 1 D ALA 333 ? C ALA 149 
58  1 Y 1 D ARG 334 ? C ARG 150 
59  1 Y 1 D LYS 335 ? C LYS 151 
60  1 Y 1 D LEU 336 ? C LEU 152 
61  1 Y 1 D LEU 337 ? C LEU 153 
62  1 Y 1 D LYS 338 ? C LYS 154 
63  1 Y 1 D LEU 339 ? C LEU 155 
64  1 Y 1 D GLN 340 ? C GLN 156 
65  1 Y 1 D LEU 341 ? C LEU 157 
66  1 Y 1 D GLN 342 ? C GLN 158 
67  1 Y 1 D ASN 343 ? C ASN 159 
68  1 Y 1 D PRO 344 ? C PRO 160 
69  1 Y 1 D PRO 345 ? C PRO 161 
70  1 Y 1 D ALA 346 ? C ALA 162 
71  1 Y 1 D ILE 347 ? C ILE 163 
72  1 Y 1 D HIS 348 ? C HIS 164 
73  1 Y 1 D GLY 349 ? C GLY 165 
74  1 Y 1 D SER 350 ? C SER 166 
75  1 Y 1 D GLY 351 ? C GLY 167 
76  1 Y 1 D SER 352 ? C SER 168 
77  1 Y 1 D GLY 353 ? C GLY 169 
78  1 Y 1 D SER 354 ? C SER 170 
79  1 Y 1 D CYS 355 ? C CYS 171 
80  1 Y 1 D GLN 356 ? C GLN 172 
81  1 Y 1 D HIS 357 ? C HIS 173 
82  1 Y 1 D HIS 358 ? C HIS 174 
83  1 Y 1 D HIS 359 ? C HIS 175 
84  1 Y 1 D HIS 360 ? C HIS 176 
85  1 Y 1 D HIS 361 ? C HIS 177 
86  1 Y 1 D HIS 362 ? C HIS 178 
87  1 Y 1 N MET 91  ? D MET 1   
88  1 Y 1 N GLY 92  ? D GLY 2   
89  1 Y 1 N GLN 93  ? D GLN 3   
90  1 Y 1 N ALA 94  ? D ALA 4   
91  1 Y 1 N TRP 95  ? D TRP 5   
92  1 Y 1 N GLN 96  ? D GLN 6   
93  1 Y 1 N GLU 97  ? D GLU 7   
94  1 Y 1 N ALA 98  ? D ALA 8   
95  1 Y 1 N SER 99  ? D SER 9   
96  1 Y 1 N ASP 100 ? D ASP 10  
97  1 Y 1 N ASN 101 ? D ASN 11  
98  1 Y 1 N CYS 102 ? D CYS 12  
99  1 Y 1 N PHE 103 ? D PHE 13  
100 1 Y 1 N LEU 205 ? D LEU 115 
101 1 Y 1 N ARG 206 ? D ARG 116 
102 1 Y 1 P GLY -4  ? E GLY 1   
103 1 Y 1 P PRO -3  ? E PRO 2   
104 1 Y 1 P LEU -2  ? E LEU 3   
105 1 Y 1 P GLY -1  ? E GLY 4   
106 1 Y 1 P SER 0   ? E SER 5   
107 1 Y 1 P MET 1   ? E MET 6   
108 1 Y 1 P ALA 2   ? E ALA 7   
109 1 Y 1 P ALA 3   ? E ALA 8   
110 1 Y 1 P SER 4   ? E SER 9   
111 1 Y 1 P GLY 5   ? E GLY 10  
112 1 Y 1 P ARG 19  ? E ARG 24  
113 1 Y 1 P PRO 20  ? E PRO 25  
114 1 Y 1 P SER 21  ? E SER 26  
115 1 Y 1 P ARG 22  ? E ARG 27  
116 1 Y 1 P ALA 23  ? E ALA 28  
117 1 Y 1 P ARG 24  ? E ARG 29  
118 1 Y 1 P ASP 25  ? E ASP 30  
119 1 Y 1 P ILE 26  ? E ILE 31  
120 1 Y 1 P ASN 27  ? E ASN 32  
121 1 Y 1 P THR 28  ? E THR 33  
122 1 Y 1 P GLU 29  ? E GLU 34  
123 1 Y 1 P GLN 30  ? E GLN 35  
124 1 Y 1 P GLY 31  ? E GLY 36  
125 1 Y 1 P GLN 32  ? E GLN 37  
126 1 Y 1 P ASN 33  ? E ASN 38  
127 1 Y 1 P VAL 34  ? E VAL 39  
128 1 Y 1 P LEU 35  ? E LEU 40  
129 1 Y 1 P GLU 36  ? E GLU 41  
130 1 Y 1 P ILE 37  ? E ILE 42  
131 1 Y 1 P LEU 38  ? E LEU 43  
132 1 Y 1 P GLN 39  ? E GLN 44  
133 1 Y 1 P ASP 40  ? E ASP 45  
134 1 Y 1 P CYS 41  ? E CYS 46  
135 1 Y 1 P PHE 42  ? E PHE 47  
136 1 Y 1 P GLU 43  ? E GLU 48  
137 1 Y 1 P GLU 44  ? E GLU 49  
138 1 Y 1 P LYS 45  ? E LYS 50  
139 1 Y 1 P SER 46  ? E SER 51  
140 1 Y 1 P LEU 47  ? E LEU 52  
141 1 Y 1 P ALA 48  ? E ALA 53  
142 1 Y 1 P ASN 49  ? E ASN 54  
143 1 Y 1 P ASP 50  ? E ASP 55  
144 1 Y 1 P PHE 51  ? E PHE 56  
145 1 Y 1 P SER 52  ? E SER 57  
146 1 Y 1 P THR 53  ? E THR 58  
147 1 Y 1 P ASN 54  ? E ASN 59  
148 1 Y 1 P SER 55  ? E SER 60  
149 1 Y 1 P THR 56  ? E THR 61  
150 1 Y 1 P LYS 57  ? E LYS 62  
151 1 Y 1 P SER 58  ? E SER 63  
152 1 Y 1 P VAL 59  ? E VAL 64  
153 1 Y 1 P PRO 60  ? E PRO 65  
154 1 Y 1 P ASN 61  ? E ASN 66  
155 1 Y 1 P SER 62  ? E SER 67  
156 1 Y 1 P THR 63  ? E THR 68  
157 1 Y 1 P ARG 64  ? E ARG 69  
158 1 Y 1 P LYS 65  ? E LYS 70  
159 1 Y 1 P ILE 66  ? E ILE 71  
160 1 Y 1 P LYS 67  ? E LYS 72  
161 1 Y 1 P ASP 68  ? E ASP 73  
162 1 Y 1 P THR 69  ? E THR 74  
163 1 Y 1 P CYS 70  ? E CYS 75  
164 1 Y 1 P ILE 71  ? E ILE 76  
165 1 Y 1 C MET 1   ? F MET 1   
166 1 Y 1 C ARG 201 ? F ARG 201 
167 1 Y 1 C LEU 202 ? F LEU 202 
168 1 Y 1 C LYS 203 ? F LYS 203 
169 1 Y 1 C ILE 204 ? F ILE 204 
170 1 Y 1 C SER 205 ? F SER 205 
171 1 Y 1 E MET 30  ? G MET 1   
172 1 Y 1 E PRO 204 ? G PRO 175 
173 1 Y 1 E GLU 205 ? G GLU 176 
174 1 Y 1 F MET 185 ? H MET 1   
175 1 Y 1 F GLY 186 ? H GLY 2   
176 1 Y 1 F THR 187 ? H THR 3   
177 1 Y 1 F LEU 188 ? H LEU 4   
178 1 Y 1 F GLN 189 ? H GLN 5   
179 1 Y 1 F LYS 190 ? H LYS 6   
180 1 Y 1 F CYS 191 ? H CYS 7   
181 1 Y 1 F PHE 192 ? H PHE 8   
182 1 Y 1 F GLU 193 ? H GLU 9   
183 1 Y 1 F ASP 194 ? H ASP 10  
184 1 Y 1 F SER 195 ? H SER 11  
185 1 Y 1 F ASN 196 ? H ASN 12  
186 1 Y 1 F GLY 197 ? H GLY 13  
187 1 Y 1 F LYS 198 ? H LYS 14  
188 1 Y 1 F ALA 199 ? H ALA 15  
189 1 Y 1 F SER 200 ? H SER 16  
190 1 Y 1 F ASP 201 ? H ASP 17  
191 1 Y 1 F PHE 202 ? H PHE 18  
192 1 Y 1 F GLU 246 ? H GLU 62  
193 1 Y 1 F ALA 247 ? H ALA 63  
194 1 Y 1 F LYS 248 ? H LYS 64  
195 1 Y 1 F ILE 249 ? H ILE 65  
196 1 Y 1 F THR 250 ? H THR 66  
197 1 Y 1 F GLU 251 ? H GLU 67  
198 1 Y 1 F VAL 252 ? H VAL 68  
199 1 Y 1 F LYS 253 ? H LYS 69  
200 1 Y 1 F VAL 254 ? H VAL 70  
201 1 Y 1 F GLU 255 ? H GLU 71  
202 1 Y 1 F PRO 256 ? H PRO 72  
203 1 Y 1 F MET 257 ? H MET 73  
204 1 Y 1 F THR 258 ? H THR 74  
205 1 Y 1 F TYR 259 ? H TYR 75  
206 1 Y 1 F VAL 318 ? H VAL 134 
207 1 Y 1 F GLN 319 ? H GLN 135 
208 1 Y 1 F LEU 320 ? H LEU 136 
209 1 Y 1 F GLY 321 ? H GLY 137 
210 1 Y 1 F LYS 322 ? H LYS 138 
211 1 Y 1 F ARG 323 ? H ARG 139 
212 1 Y 1 F SER 324 ? H SER 140 
213 1 Y 1 F MET 325 ? H MET 141 
214 1 Y 1 F GLN 326 ? H GLN 142 
215 1 Y 1 F GLN 327 ? H GLN 143 
216 1 Y 1 F LEU 328 ? H LEU 144 
217 1 Y 1 F ASP 329 ? H ASP 145 
218 1 Y 1 F PRO 330 ? H PRO 146 
219 1 Y 1 F SER 331 ? H SER 147 
220 1 Y 1 F PRO 332 ? H PRO 148 
221 1 Y 1 F ALA 333 ? H ALA 149 
222 1 Y 1 F ARG 334 ? H ARG 150 
223 1 Y 1 F LYS 335 ? H LYS 151 
224 1 Y 1 F LEU 336 ? H LEU 152 
225 1 Y 1 F LEU 337 ? H LEU 153 
226 1 Y 1 F LYS 338 ? H LYS 154 
227 1 Y 1 F LEU 339 ? H LEU 155 
228 1 Y 1 F GLN 340 ? H GLN 156 
229 1 Y 1 F LEU 341 ? H LEU 157 
230 1 Y 1 F GLN 342 ? H GLN 158 
231 1 Y 1 F ASN 343 ? H ASN 159 
232 1 Y 1 F PRO 344 ? H PRO 160 
233 1 Y 1 F PRO 345 ? H PRO 161 
234 1 Y 1 F ALA 346 ? H ALA 162 
235 1 Y 1 F ILE 347 ? H ILE 163 
236 1 Y 1 F HIS 348 ? H HIS 164 
237 1 Y 1 F GLY 349 ? H GLY 165 
238 1 Y 1 F SER 350 ? H SER 166 
239 1 Y 1 F GLY 351 ? H GLY 167 
240 1 Y 1 F SER 352 ? H SER 168 
241 1 Y 1 F GLY 353 ? H GLY 169 
242 1 Y 1 F SER 354 ? H SER 170 
243 1 Y 1 F CYS 355 ? H CYS 171 
244 1 Y 1 F GLN 356 ? H GLN 172 
245 1 Y 1 F HIS 357 ? H HIS 173 
246 1 Y 1 F HIS 358 ? H HIS 174 
247 1 Y 1 F HIS 359 ? H HIS 175 
248 1 Y 1 F HIS 360 ? H HIS 176 
249 1 Y 1 F HIS 361 ? H HIS 177 
250 1 Y 1 F HIS 362 ? H HIS 178 
251 1 Y 1 G MET 91  ? I MET 1   
252 1 Y 1 G GLY 92  ? I GLY 2   
253 1 Y 1 G GLN 93  ? I GLN 3   
254 1 Y 1 G ALA 94  ? I ALA 4   
255 1 Y 1 G TRP 95  ? I TRP 5   
256 1 Y 1 G GLN 96  ? I GLN 6   
257 1 Y 1 G GLU 97  ? I GLU 7   
258 1 Y 1 G ALA 98  ? I ALA 8   
259 1 Y 1 G SER 99  ? I SER 9   
260 1 Y 1 G ASP 100 ? I ASP 10  
261 1 Y 1 G ASN 101 ? I ASN 11  
262 1 Y 1 G CYS 102 ? I CYS 12  
263 1 Y 1 G LEU 205 ? I LEU 115 
264 1 Y 1 G ARG 206 ? I ARG 116 
265 1 Y 1 Q GLY -4  ? J GLY 1   
266 1 Y 1 Q PRO -3  ? J PRO 2   
267 1 Y 1 Q LEU -2  ? J LEU 3   
268 1 Y 1 Q GLY -1  ? J GLY 4   
269 1 Y 1 Q SER 0   ? J SER 5   
270 1 Y 1 Q MET 1   ? J MET 6   
271 1 Y 1 Q ALA 2   ? J ALA 7   
272 1 Y 1 Q ALA 3   ? J ALA 8   
273 1 Y 1 Q SER 4   ? J SER 9   
274 1 Y 1 Q GLY 5   ? J GLY 10  
275 1 Y 1 Q SER 21  ? J SER 26  
276 1 Y 1 Q ARG 22  ? J ARG 27  
277 1 Y 1 Q ALA 23  ? J ALA 28  
278 1 Y 1 Q ARG 24  ? J ARG 29  
279 1 Y 1 Q ASP 25  ? J ASP 30  
280 1 Y 1 Q ILE 26  ? J ILE 31  
281 1 Y 1 Q ASN 27  ? J ASN 32  
282 1 Y 1 Q THR 28  ? J THR 33  
283 1 Y 1 Q GLU 29  ? J GLU 34  
284 1 Y 1 Q GLN 30  ? J GLN 35  
285 1 Y 1 Q GLY 31  ? J GLY 36  
286 1 Y 1 Q GLN 32  ? J GLN 37  
287 1 Y 1 Q ASN 33  ? J ASN 38  
288 1 Y 1 Q VAL 34  ? J VAL 39  
289 1 Y 1 Q LEU 35  ? J LEU 40  
290 1 Y 1 Q GLU 36  ? J GLU 41  
291 1 Y 1 Q ILE 37  ? J ILE 42  
292 1 Y 1 Q LEU 38  ? J LEU 43  
293 1 Y 1 Q GLN 39  ? J GLN 44  
294 1 Y 1 Q ASP 40  ? J ASP 45  
295 1 Y 1 Q CYS 41  ? J CYS 46  
296 1 Y 1 Q PHE 42  ? J PHE 47  
297 1 Y 1 Q GLU 43  ? J GLU 48  
298 1 Y 1 Q GLU 44  ? J GLU 49  
299 1 Y 1 Q LYS 45  ? J LYS 50  
300 1 Y 1 Q SER 46  ? J SER 51  
301 1 Y 1 Q LEU 47  ? J LEU 52  
302 1 Y 1 Q ALA 48  ? J ALA 53  
303 1 Y 1 Q ASN 49  ? J ASN 54  
304 1 Y 1 Q ASP 50  ? J ASP 55  
305 1 Y 1 Q PHE 51  ? J PHE 56  
306 1 Y 1 Q SER 52  ? J SER 57  
307 1 Y 1 Q THR 53  ? J THR 58  
308 1 Y 1 Q ASN 54  ? J ASN 59  
309 1 Y 1 Q SER 55  ? J SER 60  
310 1 Y 1 Q THR 56  ? J THR 61  
311 1 Y 1 Q LYS 57  ? J LYS 62  
312 1 Y 1 Q SER 58  ? J SER 63  
313 1 Y 1 Q VAL 59  ? J VAL 64  
314 1 Y 1 Q PRO 60  ? J PRO 65  
315 1 Y 1 Q ASN 61  ? J ASN 66  
316 1 Y 1 Q SER 62  ? J SER 67  
317 1 Y 1 Q THR 63  ? J THR 68  
318 1 Y 1 Q ARG 64  ? J ARG 69  
319 1 Y 1 Q LYS 65  ? J LYS 70  
320 1 Y 1 Q ILE 66  ? J ILE 71  
321 1 Y 1 Q LYS 67  ? J LYS 72  
322 1 Y 1 Q ASP 68  ? J ASP 73  
323 1 Y 1 Q THR 69  ? J THR 74  
324 1 Y 1 Q CYS 70  ? J CYS 75  
325 1 Y 1 Q ILE 71  ? J ILE 76  
#