data_5LXG
# 
_entry.id   5LXG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LXG         
WWPDB D_1200001532 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2017-03-22 
_pdbx_database_PDB_obs_spr.pdb_id           5LXG 
_pdbx_database_PDB_obs_spr.replace_pdb_id   3WXV 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        
;3WXV contains the same protein with a large error in the position of transmembrane helix 5 (TM5) and the loop connecting TM4 and TM5. The error appears to arise from incorrect model building and refinement.
;
_pdbx_database_related.db_id          3WXV 
_pdbx_database_related.content_type   re-refinement 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LXG 
_pdbx_database_status.recvd_initial_deposition_date   2016-09-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leyrat, C.'                1 
'Vasiliauskaite-Brooks, I.' 2 
'Granier, S.'               3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                120 
_citation.page_last                 123 
_citation.title                     'Structural insights into adiponectin receptors suggest ceramidase activity.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature21714 
_citation.pdbx_database_id_PubMed   28329765 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vasiliauskaite-Brooks, I.' 1  ? 
primary 'Sounier, R.'               2  ? 
primary 'Rochaix, P.'               3  ? 
primary 'Bellot, G.'                4  ? 
primary 'Fortier, M.'               5  ? 
primary 'Hoh, F.'                   6  ? 
primary 'De Colibus, L.'            7  ? 
primary 'Bechara, C.'               8  ? 
primary 'Saied, E.M.'               9  ? 
primary 'Arenz, C.'                 10 ? 
primary 'Leyrat, C.'                11 ? 
primary 'Granier, S.'               12 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LXG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     92.310 
_cell.length_a_esd                 ? 
_cell.length_b                     194.110 
_cell.length_b_esd                 ? 
_cell.length_c                     74.330 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LXG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adiponectin receptor protein 1' 35040.801 1   ? ? ? ? 
2 polymer     man 'V REGION HEAVY CHAIN'           13160.635 1   ? ? ? ? 
3 polymer     man 'V REGION LIGHT CHAIN'           11647.850 1   ? ? ? ? 
4 non-polymer syn 'ZINC ION'                       65.409    1   ? ? ? ? 
5 non-polymer syn 'SULFATE ION'                    96.063    2   ? ? ? ? 
6 water       nat water                            18.015    169 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Progestin and adipoQ receptor family member I' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDYKDDDDKENLYFQGGSEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF
LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYC
SPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMY
ITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
;
;MDYKDDDDKENLYFQGGSEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF
LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYC
SPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMY
ITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
;
A ? 
2 'polypeptide(L)' no no 
;EVLLQQSGPELVKPGASVRITCKASGYTFTDFNMDWVKQSPGKSLEWIGDFNPNSGGSIYNQKFKDKATFTVDKSSSTAY
MELRSLTFEDTAVYYCARETGTAWFAYWGQGTLVTVSAA
;
;EVLLQQSGPELVKPGASVRITCKASGYTFTDFNMDWVKQSPGKSLEWIGDFNPNSGGSIYNQKFKDKATFTVDKSSSTAY
MELRSLTFEDTAVYYCARETGTAWFAYWGQGTLVTVSAA
;
H ? 
3 'polypeptide(L)' no no 
;DIQMTQSPASLSASVGETVTITCRASGNIHNFLAWYQQKQGKSPQVLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQP
EDFGSYYCQQFWSTPYTFGGGTKLEIN
;
;DIQMTQSPASLSASVGETVTITCRASGNIHNFLAWYQQKQGKSPQVLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQP
EDFGSYYCQQFWSTPYTFGGGTKLEIN
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   TYR n 
1 4   LYS n 
1 5   ASP n 
1 6   ASP n 
1 7   ASP n 
1 8   ASP n 
1 9   LYS n 
1 10  GLU n 
1 11  ASN n 
1 12  LEU n 
1 13  TYR n 
1 14  PHE n 
1 15  GLN n 
1 16  GLY n 
1 17  GLY n 
1 18  SER n 
1 19  GLU n 
1 20  GLY n 
1 21  ARG n 
1 22  TRP n 
1 23  ARG n 
1 24  VAL n 
1 25  ILE n 
1 26  PRO n 
1 27  TYR n 
1 28  ASP n 
1 29  VAL n 
1 30  LEU n 
1 31  PRO n 
1 32  ASP n 
1 33  TRP n 
1 34  LEU n 
1 35  LYS n 
1 36  ASP n 
1 37  ASN n 
1 38  ASP n 
1 39  TYR n 
1 40  LEU n 
1 41  LEU n 
1 42  HIS n 
1 43  GLY n 
1 44  HIS n 
1 45  ARG n 
1 46  PRO n 
1 47  PRO n 
1 48  MET n 
1 49  PRO n 
1 50  SER n 
1 51  PHE n 
1 52  ARG n 
1 53  ALA n 
1 54  CYS n 
1 55  PHE n 
1 56  LYS n 
1 57  SER n 
1 58  ILE n 
1 59  PHE n 
1 60  ARG n 
1 61  ILE n 
1 62  HIS n 
1 63  THR n 
1 64  GLU n 
1 65  THR n 
1 66  GLY n 
1 67  ASN n 
1 68  ILE n 
1 69  TRP n 
1 70  THR n 
1 71  HIS n 
1 72  LEU n 
1 73  LEU n 
1 74  GLY n 
1 75  PHE n 
1 76  VAL n 
1 77  LEU n 
1 78  PHE n 
1 79  LEU n 
1 80  PHE n 
1 81  LEU n 
1 82  GLY n 
1 83  ILE n 
1 84  LEU n 
1 85  THR n 
1 86  MET n 
1 87  LEU n 
1 88  ARG n 
1 89  PRO n 
1 90  ASN n 
1 91  MET n 
1 92  TYR n 
1 93  PHE n 
1 94  MET n 
1 95  ALA n 
1 96  PRO n 
1 97  LEU n 
1 98  GLN n 
1 99  GLU n 
1 100 LYS n 
1 101 VAL n 
1 102 VAL n 
1 103 PHE n 
1 104 GLY n 
1 105 MET n 
1 106 PHE n 
1 107 PHE n 
1 108 LEU n 
1 109 GLY n 
1 110 ALA n 
1 111 VAL n 
1 112 LEU n 
1 113 CYS n 
1 114 LEU n 
1 115 SER n 
1 116 PHE n 
1 117 SER n 
1 118 TRP n 
1 119 LEU n 
1 120 PHE n 
1 121 HIS n 
1 122 THR n 
1 123 VAL n 
1 124 TYR n 
1 125 CYS n 
1 126 HIS n 
1 127 SER n 
1 128 GLU n 
1 129 LYS n 
1 130 VAL n 
1 131 SER n 
1 132 ARG n 
1 133 THR n 
1 134 PHE n 
1 135 SER n 
1 136 LYS n 
1 137 LEU n 
1 138 ASP n 
1 139 TYR n 
1 140 SER n 
1 141 GLY n 
1 142 ILE n 
1 143 ALA n 
1 144 LEU n 
1 145 LEU n 
1 146 ILE n 
1 147 MET n 
1 148 GLY n 
1 149 SER n 
1 150 PHE n 
1 151 VAL n 
1 152 PRO n 
1 153 TRP n 
1 154 LEU n 
1 155 TYR n 
1 156 TYR n 
1 157 SER n 
1 158 PHE n 
1 159 TYR n 
1 160 CYS n 
1 161 SER n 
1 162 PRO n 
1 163 GLN n 
1 164 PRO n 
1 165 ARG n 
1 166 LEU n 
1 167 ILE n 
1 168 TYR n 
1 169 LEU n 
1 170 SER n 
1 171 ILE n 
1 172 VAL n 
1 173 CYS n 
1 174 VAL n 
1 175 LEU n 
1 176 GLY n 
1 177 ILE n 
1 178 SER n 
1 179 ALA n 
1 180 ILE n 
1 181 ILE n 
1 182 VAL n 
1 183 ALA n 
1 184 GLN n 
1 185 TRP n 
1 186 ASP n 
1 187 ARG n 
1 188 PHE n 
1 189 ALA n 
1 190 THR n 
1 191 PRO n 
1 192 LYS n 
1 193 HIS n 
1 194 ARG n 
1 195 GLN n 
1 196 THR n 
1 197 ARG n 
1 198 ALA n 
1 199 GLY n 
1 200 VAL n 
1 201 PHE n 
1 202 LEU n 
1 203 GLY n 
1 204 LEU n 
1 205 GLY n 
1 206 LEU n 
1 207 SER n 
1 208 GLY n 
1 209 VAL n 
1 210 VAL n 
1 211 PRO n 
1 212 THR n 
1 213 MET n 
1 214 HIS n 
1 215 PHE n 
1 216 THR n 
1 217 ILE n 
1 218 ALA n 
1 219 GLU n 
1 220 GLY n 
1 221 PHE n 
1 222 VAL n 
1 223 LYS n 
1 224 ALA n 
1 225 THR n 
1 226 THR n 
1 227 VAL n 
1 228 GLY n 
1 229 GLN n 
1 230 MET n 
1 231 GLY n 
1 232 TRP n 
1 233 PHE n 
1 234 PHE n 
1 235 LEU n 
1 236 MET n 
1 237 ALA n 
1 238 VAL n 
1 239 MET n 
1 240 TYR n 
1 241 ILE n 
1 242 THR n 
1 243 GLY n 
1 244 ALA n 
1 245 GLY n 
1 246 LEU n 
1 247 TYR n 
1 248 ALA n 
1 249 ALA n 
1 250 ARG n 
1 251 ILE n 
1 252 PRO n 
1 253 GLU n 
1 254 ARG n 
1 255 PHE n 
1 256 PHE n 
1 257 PRO n 
1 258 GLY n 
1 259 LYS n 
1 260 PHE n 
1 261 ASP n 
1 262 ILE n 
1 263 TRP n 
1 264 PHE n 
1 265 GLN n 
1 266 SER n 
1 267 HIS n 
1 268 GLN n 
1 269 ILE n 
1 270 PHE n 
1 271 HIS n 
1 272 VAL n 
1 273 LEU n 
1 274 VAL n 
1 275 VAL n 
1 276 ALA n 
1 277 ALA n 
1 278 ALA n 
1 279 PHE n 
1 280 VAL n 
1 281 HIS n 
1 282 PHE n 
1 283 TYR n 
1 284 GLY n 
1 285 VAL n 
1 286 SER n 
1 287 ASN n 
1 288 LEU n 
1 289 GLN n 
1 290 GLU n 
1 291 PHE n 
1 292 ARG n 
1 293 TYR n 
1 294 GLY n 
1 295 LEU n 
1 296 GLU n 
1 297 GLY n 
1 298 GLY n 
1 299 CYS n 
1 300 THR n 
1 301 ASP n 
1 302 ASP n 
1 303 THR n 
1 304 LEU n 
1 305 LEU n 
2 1   GLU n 
2 2   VAL n 
2 3   LEU n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  ARG n 
2 20  ILE n 
2 21  THR n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  PHE n 
2 33  ASN n 
2 34  MET n 
2 35  ASP n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  SER n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  SER n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  ASP n 
2 51  PHE n 
2 52  ASN n 
2 53  PRO n 
2 54  ASN n 
2 55  SER n 
2 56  GLY n 
2 57  GLY n 
2 58  SER n 
2 59  ILE n 
2 60  TYR n 
2 61  ASN n 
2 62  GLN n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  ASP n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  PHE n 
2 71  THR n 
2 72  VAL n 
2 73  ASP n 
2 74  LYS n 
2 75  SER n 
2 76  SER n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLU n 
2 83  LEU n 
2 84  ARG n 
2 85  SER n 
2 86  LEU n 
2 87  THR n 
2 88  PHE n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  ARG n 
2 99  GLU n 
2 100 THR n 
2 101 GLY n 
2 102 THR n 
2 103 ALA n 
2 104 TRP n 
2 105 PHE n 
2 106 ALA n 
2 107 TYR n 
2 108 TRP n 
2 109 GLY n 
2 110 GLN n 
2 111 GLY n 
2 112 THR n 
2 113 LEU n 
2 114 VAL n 
2 115 THR n 
2 116 VAL n 
2 117 SER n 
2 118 ALA n 
2 119 ALA n 
3 1   ASP n 
3 2   ILE n 
3 3   GLN n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   PRO n 
3 9   ALA n 
3 10  SER n 
3 11  LEU n 
3 12  SER n 
3 13  ALA n 
3 14  SER n 
3 15  VAL n 
3 16  GLY n 
3 17  GLU n 
3 18  THR n 
3 19  VAL n 
3 20  THR n 
3 21  ILE n 
3 22  THR n 
3 23  CYS n 
3 24  ARG n 
3 25  ALA n 
3 26  SER n 
3 27  GLY n 
3 28  ASN n 
3 29  ILE n 
3 30  HIS n 
3 31  ASN n 
3 32  PHE n 
3 33  LEU n 
3 34  ALA n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  LYS n 
3 40  GLN n 
3 41  GLY n 
3 42  LYS n 
3 43  SER n 
3 44  PRO n 
3 45  GLN n 
3 46  VAL n 
3 47  LEU n 
3 48  VAL n 
3 49  TYR n 
3 50  ASN n 
3 51  ALA n 
3 52  LYS n 
3 53  THR n 
3 54  LEU n 
3 55  ALA n 
3 56  ASP n 
3 57  GLY n 
3 58  VAL n 
3 59  PRO n 
3 60  SER n 
3 61  ARG n 
3 62  PHE n 
3 63  SER n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  GLN n 
3 71  TYR n 
3 72  SER n 
3 73  LEU n 
3 74  LYS n 
3 75  ILE n 
3 76  ASN n 
3 77  SER n 
3 78  LEU n 
3 79  GLN n 
3 80  PRO n 
3 81  GLU n 
3 82  ASP n 
3 83  PHE n 
3 84  GLY n 
3 85  SER n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  GLN n 
3 91  PHE n 
3 92  TRP n 
3 93  SER n 
3 94  THR n 
3 95  PRO n 
3 96  TYR n 
3 97  THR n 
3 98  PHE n 
3 99  GLY n 
3 100 GLY n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 LEU n 
3 105 GLU n 
3 106 ILE n 
3 107 ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 305 Human         ? 'ADIPOR1, PAQR1, TESBP1A, CGI-45' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? 
? ? ? 'Cabbage looper' 'Trichoplusia ni'  7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                    
2 1 sample ?                     ? ?   'House mouse' ? ?                                 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? 
? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'E.COLI CELL-FREE PROTEIN SYNTHESIS' 
3 1 sample ?                     ? ?   'House mouse' ? ?                                 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? 
? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'E.COLI CELL-FREE PROTEIN SYNTHESIS' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ADR1_HUMAN Q96A54 ? 1 
;EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQ
EKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGIS
AIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPG
KFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
;
89 
2 PDB 5LXG       5LXG   ? 2 ? 1  
3 PDB 5LXG       5LXG   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5LXG A 19 ? 305 ? Q96A54 89 ? 375 ? 89 375 
2 2 5LXG H 1  ? 119 ? 5LXG   1  ? 119 ? 1  119 
3 3 5LXG L 1  ? 107 ? 5LXG   1  ? 107 ? 1  107 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5LXG MET A 1  ? UNP Q96A54 ? ? 'initiating methionine' -17 1  
1 5LXG ASP A 2  ? UNP Q96A54 ? ? 'expression tag'        -16 2  
1 5LXG TYR A 3  ? UNP Q96A54 ? ? 'expression tag'        -15 3  
1 5LXG LYS A 4  ? UNP Q96A54 ? ? 'expression tag'        -14 4  
1 5LXG ASP A 5  ? UNP Q96A54 ? ? 'expression tag'        -13 5  
1 5LXG ASP A 6  ? UNP Q96A54 ? ? 'expression tag'        -12 6  
1 5LXG ASP A 7  ? UNP Q96A54 ? ? 'expression tag'        -11 7  
1 5LXG ASP A 8  ? UNP Q96A54 ? ? 'expression tag'        -10 8  
1 5LXG LYS A 9  ? UNP Q96A54 ? ? 'expression tag'        -9  9  
1 5LXG GLU A 10 ? UNP Q96A54 ? ? 'expression tag'        -8  10 
1 5LXG ASN A 11 ? UNP Q96A54 ? ? 'expression tag'        -7  11 
1 5LXG LEU A 12 ? UNP Q96A54 ? ? 'expression tag'        -6  12 
1 5LXG TYR A 13 ? UNP Q96A54 ? ? 'expression tag'        -5  13 
1 5LXG PHE A 14 ? UNP Q96A54 ? ? 'expression tag'        -4  14 
1 5LXG GLN A 15 ? UNP Q96A54 ? ? 'expression tag'        -3  15 
1 5LXG GLY A 16 ? UNP Q96A54 ? ? 'expression tag'        -2  16 
1 5LXG GLY A 17 ? UNP Q96A54 ? ? 'expression tag'        -1  17 
1 5LXG SER A 18 ? UNP Q96A54 ? ? 'expression tag'        0   18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LXG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.78 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.78 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100mM Bicine, 100mM MgCl2, 30% PEG400, pH 8.0, Lipidic mesophase method, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX225HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-06-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'DOUBLE-CRYSTAL MONOCHROMATOR' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL32XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL32XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            52.37 
_reflns.entry_id                         5LXG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.73 
_reflns.d_resolution_low                 97.06 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17815 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.4 
_reflns.pdbx_Rmerge_I_obs                0.171 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.934 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            -17.60390 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][2]                            13.10540 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            4.49850 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               74.57 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.906 
_refine.correlation_coeff_Fo_to_Fc_free          0.913 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5LXG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.73 
_refine.ls_d_res_low                             26.66 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     17798 
_refine.ls_number_reflns_R_free                  890 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.1 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.225 
_refine.ls_R_factor_R_free                       0.234 
_refine.ls_R_factor_R_free_error                 0.000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3WXV 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.312 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.312 
_refine.pdbx_overall_SU_R_Blow_DPI               2.115 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             1.301 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5LXG 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.44 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3985 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             169 
_refine_hist.number_atoms_total               4165 
_refine_hist.d_res_high                       2.73 
_refine_hist.d_res_low                        26.66 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008 ? 4167 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 0.97  ? 5660 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1347 ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 69   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 616  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 4167 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 0    ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 2.08  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 16.65 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 521  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 5171 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.73 
_refine_ls_shell.d_res_low                        2.90 
_refine_ls_shell.number_reflns_all                2583 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             129 
_refine_ls_shell.number_reflns_R_work             2454 
_refine_ls_shell.percent_reflns_obs               89.45 
_refine_ls_shell.percent_reflns_R_free            4.99 
_refine_ls_shell.R_factor_all                     0.251 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.265 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.R_factor_R_work                  0.250 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5LXG 
_struct.title                        'Revised crystal structure of the human adiponectin receptor 1 in an open conformation' 
_struct.pdbx_descriptor              'Adiponectin receptor protein 2, V REGION HEAVY CHAIN, V REGION LIGHT CHAIN' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LXG 
_struct_keywords.text            
'PROGESTIN AND ADIPOQ RECEPTOR FAMILY, INTEGRAL MEMBRANE PROTEIN, 7TM, CERAMIDASE, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 26  ? LEU A 30  ? PRO A 96  LEU A 100 5 ? 5  
HELX_P HELX_P2  AA2 PRO A 31  ? LYS A 35  ? PRO A 101 LYS A 105 5 ? 5  
HELX_P HELX_P3  AA3 SER A 50  ? SER A 57  ? SER A 120 SER A 127 1 ? 8  
HELX_P HELX_P4  AA4 ILE A 58  ? ARG A 60  ? ILE A 128 ARG A 130 5 ? 3  
HELX_P HELX_P5  AA5 GLU A 64  ? LEU A 87  ? GLU A 134 LEU A 157 1 ? 24 
HELX_P HELX_P6  AA6 GLN A 98  ? VAL A 123 ? GLN A 168 VAL A 193 1 ? 26 
HELX_P HELX_P7  AA7 SER A 127 ? PHE A 158 ? SER A 197 PHE A 228 1 ? 32 
HELX_P HELX_P8  AA8 SER A 161 ? TRP A 185 ? SER A 231 TRP A 255 1 ? 25 
HELX_P HELX_P9  AA9 GLN A 195 ? GLY A 208 ? GLN A 265 GLY A 278 1 ? 14 
HELX_P HELX_P10 AB1 GLY A 208 ? GLY A 220 ? GLY A 278 GLY A 290 1 ? 13 
HELX_P HELX_P11 AB2 GLY A 220 ? VAL A 227 ? GLY A 290 VAL A 297 1 ? 8  
HELX_P HELX_P12 AB3 PHE A 233 ? ARG A 250 ? PHE A 303 ARG A 320 1 ? 18 
HELX_P HELX_P13 AB4 GLN A 265 ? LEU A 295 ? GLN A 335 LEU A 365 1 ? 31 
HELX_P HELX_P14 AB5 THR B 28  ? PHE B 32  ? THR H 28  PHE H 32  5 ? 5  
HELX_P HELX_P15 AB6 GLN B 62  ? LYS B 65  ? GLN H 62  LYS H 65  5 ? 4  
HELX_P HELX_P16 AB7 THR B 87  ? THR B 91  ? THR H 87  THR H 91  5 ? 5  
HELX_P HELX_P17 AB8 GLN C 79  ? PHE C 83  ? GLN L 79  PHE L 83  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 22  SG  ? ? ? 1_555 B CYS 96 SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.095 ? 
disulf2 disulf ? ? C CYS 23  SG  ? ? ? 1_555 C CYS 88 SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc1 metalc ? ? A HIS 121 NE2 ? ? ? 1_555 D ZN  .  ZN ? ? A HIS 191 A ZN  401 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc2 metalc ? ? A HIS 267 NE2 ? ? ? 1_555 D ZN  .  ZN ? ? A HIS 337 A ZN  401 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc3 metalc ? ? A HIS 271 NE2 ? ? ? 1_555 D ZN  .  ZN ? ? A HIS 341 A ZN  401 1_555 ? ? ? ? ? ? ? 2.081 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 95  A . ? ALA 165 A PRO 96  A ? PRO 166 A 1 11.70 
2 THR 190 A . ? THR 260 A PRO 191 A ? PRO 261 A 1 -1.26 
3 ILE 251 A . ? ILE 321 A PRO 252 A ? PRO 322 A 1 3.46  
4 SER 7   C . ? SER 7   L PRO 8   C ? PRO 8   L 1 0.33  
5 THR 94  C . ? THR 94  L PRO 95  C ? PRO 95  L 1 -3.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 6 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU B 3   ? GLN B 6   ? LEU H 3   GLN H 6   
AA1 2 VAL B 18  ? SER B 25  ? VAL H 18  SER H 25  
AA1 3 THR B 78  ? LEU B 83  ? THR H 78  LEU H 83  
AA1 4 ALA B 68  ? ASP B 73  ? ALA H 68  ASP H 73  
AA2 1 GLU B 10  ? VAL B 12  ? GLU H 10  VAL H 12  
AA2 2 THR B 112 ? VAL B 116 ? THR H 112 VAL H 116 
AA2 3 ALA B 92  ? GLU B 99  ? ALA H 92  GLU H 99  
AA2 4 MET B 34  ? GLN B 39  ? MET H 34  GLN H 39  
AA2 5 LEU B 45  ? ASN B 52  ? LEU H 45  ASN H 52  
AA2 6 GLY B 57  ? TYR B 60  ? GLY H 57  TYR H 60  
AA3 1 GLU B 10  ? VAL B 12  ? GLU H 10  VAL H 12  
AA3 2 THR B 112 ? VAL B 116 ? THR H 112 VAL H 116 
AA3 3 ALA B 92  ? GLU B 99  ? ALA H 92  GLU H 99  
AA3 4 PHE B 105 ? TRP B 108 ? PHE H 105 TRP H 108 
AA4 1 MET C 4   ? SER C 7   ? MET L 4   SER L 7   
AA4 2 VAL C 19  ? ALA C 25  ? VAL L 19  ALA L 25  
AA4 3 GLN C 70  ? ILE C 75  ? GLN L 70  ILE L 75  
AA4 4 PHE C 62  ? SER C 67  ? PHE L 62  SER L 67  
AA5 1 SER C 10  ? SER C 14  ? SER L 10  SER L 14  
AA5 2 THR C 102 ? ASN C 107 ? THR L 102 ASN L 107 
AA5 3 GLY C 84  ? GLN C 90  ? GLY L 84  GLN L 90  
AA5 4 LEU C 33  ? GLN C 38  ? LEU L 33  GLN L 38  
AA5 5 GLN C 45  ? TYR C 49  ? GLN L 45  TYR L 49  
AA5 6 THR C 53  ? LEU C 54  ? THR L 53  LEU L 54  
AA6 1 SER C 10  ? SER C 14  ? SER L 10  SER L 14  
AA6 2 THR C 102 ? ASN C 107 ? THR L 102 ASN L 107 
AA6 3 GLY C 84  ? GLN C 90  ? GLY L 84  GLN L 90  
AA6 4 THR C 97  ? PHE C 98  ? THR L 97  PHE L 98  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN B 5   ? N GLN H 5   O LYS B 23  ? O LYS H 23  
AA1 2 3 N CYS B 22  ? N CYS H 22  O ALA B 79  ? O ALA H 79  
AA1 3 4 O THR B 78  ? O THR H 78  N ASP B 73  ? N ASP H 73  
AA2 1 2 N GLU B 10  ? N GLU H 10  O THR B 115 ? O THR H 115 
AA2 2 3 O THR B 112 ? O THR H 112 N TYR B 94  ? N TYR H 94  
AA2 3 4 O ALA B 97  ? O ALA H 97  N ASP B 35  ? N ASP H 35  
AA2 4 5 N MET B 34  ? N MET H 34  O PHE B 51  ? O PHE H 51  
AA2 5 6 N ASP B 50  ? N ASP H 50  O ILE B 59  ? O ILE H 59  
AA3 1 2 N GLU B 10  ? N GLU H 10  O THR B 115 ? O THR H 115 
AA3 2 3 O THR B 112 ? O THR H 112 N TYR B 94  ? N TYR H 94  
AA3 3 4 N ARG B 98  ? N ARG H 98  O TYR B 107 ? O TYR H 107 
AA4 1 2 N THR C 5   ? N THR L 5   O ARG C 24  ? O ARG L 24  
AA4 2 3 N CYS C 23  ? N CYS L 23  O TYR C 71  ? O TYR L 71  
AA4 3 4 O SER C 72  ? O SER L 72  N SER C 65  ? N SER L 65  
AA5 1 2 N LEU C 11  ? N LEU L 11  O LYS C 103 ? O LYS L 103 
AA5 2 3 O THR C 102 ? O THR L 102 N TYR C 86  ? N TYR L 86  
AA5 3 4 O SER C 85  ? O SER L 85  N GLN C 38  ? N GLN L 38  
AA5 4 5 N TRP C 35  ? N TRP L 35  O LEU C 47  ? O LEU L 47  
AA5 5 6 N TYR C 49  ? N TYR L 49  O THR C 53  ? O THR L 53  
AA6 1 2 N LEU C 11  ? N LEU L 11  O LYS C 103 ? O LYS L 103 
AA6 2 3 O THR C 102 ? O THR L 102 N TYR C 86  ? N TYR L 86  
AA6 3 4 N GLN C 90  ? N GLN L 90  O THR C 97  ? O THR L 97  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  401 ? 5 'binding site for residue ZN A 401'  
AC2 Software A SO4 402 ? 4 'binding site for residue SO4 A 402' 
AC3 Software L SO4 201 ? 3 'binding site for residue SO4 L 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 SER A 117 ? SER A 187 . ? 1_555 ? 
2  AC1 5 HIS A 121 ? HIS A 191 . ? 1_555 ? 
3  AC1 5 ASP A 138 ? ASP A 208 . ? 1_555 ? 
4  AC1 5 HIS A 267 ? HIS A 337 . ? 1_555 ? 
5  AC1 5 HIS A 271 ? HIS A 341 . ? 1_555 ? 
6  AC2 4 SER A 50  ? SER A 120 . ? 1_555 ? 
7  AC2 4 PHE A 51  ? PHE A 121 . ? 1_555 ? 
8  AC2 4 ARG A 52  ? ARG A 122 . ? 1_555 ? 
9  AC2 4 HIS C 30  ? HIS L 30  . ? 1_555 ? 
10 AC3 3 ARG A 52  ? ARG A 122 . ? 1_555 ? 
11 AC3 3 ASN C 28  ? ASN L 28  . ? 1_555 ? 
12 AC3 3 HIS C 30  ? HIS L 30  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5LXG 
_atom_sites.fract_transf_matrix[1][1]   0.010833 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005152 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013454 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 17  ? 18.196 19.047  -30.567 1.00 79.92  ? -1  GLY A N   1 
ATOM   2    C  CA  . GLY A 1 17  ? 17.266 19.046  -29.442 1.00 78.12  ? -1  GLY A CA  1 
ATOM   3    C  C   . GLY A 1 17  ? 17.203 17.737  -28.675 1.00 79.78  ? -1  GLY A C   1 
ATOM   4    O  O   . GLY A 1 17  ? 16.545 17.663  -27.633 1.00 78.15  ? -1  GLY A O   1 
ATOM   5    N  N   . SER A 1 18  ? 17.872 16.689  -29.198 1.00 75.89  ? 0   SER A N   1 
ATOM   6    C  CA  . SER A 1 18  ? 17.955 15.362  -28.576 1.00 73.92  ? 0   SER A CA  1 
ATOM   7    C  C   . SER A 1 18  ? 19.244 15.243  -27.738 1.00 74.37  ? 0   SER A C   1 
ATOM   8    O  O   . SER A 1 18  ? 19.554 14.171  -27.198 1.00 72.67  ? 0   SER A O   1 
ATOM   9    C  CB  . SER A 1 18  ? 17.884 14.266  -29.636 1.00 79.39  ? 0   SER A CB  1 
ATOM   10   O  OG  . SER A 1 18  ? 19.032 14.253  -30.470 1.00 89.09  ? 0   SER A OG  1 
ATOM   11   N  N   . GLU A 1 19  ? 19.978 16.370  -27.634 1.00 69.72  ? 89  GLU A N   1 
ATOM   12   C  CA  . GLU A 1 19  ? 21.217 16.531  -26.871 1.00 67.34  ? 89  GLU A CA  1 
ATOM   13   C  C   . GLU A 1 19  ? 20.883 17.152  -25.520 1.00 68.15  ? 89  GLU A C   1 
ATOM   14   O  O   . GLU A 1 19  ? 20.014 18.025  -25.450 1.00 68.07  ? 89  GLU A O   1 
ATOM   15   C  CB  . GLU A 1 19  ? 22.195 17.477  -27.591 1.00 69.78  ? 89  GLU A CB  1 
ATOM   16   C  CG  . GLU A 1 19  ? 22.749 16.988  -28.916 1.00 82.54  ? 89  GLU A CG  1 
ATOM   17   C  CD  . GLU A 1 19  ? 23.611 18.017  -29.623 1.00 106.58 ? 89  GLU A CD  1 
ATOM   18   O  OE1 . GLU A 1 19  ? 24.715 17.648  -30.081 1.00 101.63 ? 89  GLU A OE1 1 
ATOM   19   O  OE2 . GLU A 1 19  ? 23.195 19.196  -29.704 1.00 103.50 ? 89  GLU A OE2 1 
ATOM   20   N  N   . GLY A 1 20  ? 21.598 16.722  -24.479 1.00 62.05  ? 90  GLY A N   1 
ATOM   21   C  CA  . GLY A 1 20  ? 21.452 17.216  -23.111 1.00 59.88  ? 90  GLY A CA  1 
ATOM   22   C  C   . GLY A 1 20  ? 20.041 17.223  -22.567 1.00 62.67  ? 90  GLY A C   1 
ATOM   23   O  O   . GLY A 1 20  ? 19.634 18.194  -21.920 1.00 61.91  ? 90  GLY A O   1 
ATOM   24   N  N   . ARG A 1 21  ? 19.286 16.143  -22.839 1.00 58.98  ? 91  ARG A N   1 
ATOM   25   C  CA  . ARG A 1 21  ? 17.906 15.984  -22.383 1.00 58.79  ? 91  ARG A CA  1 
ATOM   26   C  C   . ARG A 1 21  ? 17.902 15.730  -20.882 1.00 60.33  ? 91  ARG A C   1 
ATOM   27   O  O   . ARG A 1 21  ? 18.725 14.960  -20.379 1.00 58.89  ? 91  ARG A O   1 
ATOM   28   C  CB  . ARG A 1 21  ? 17.199 14.839  -23.121 1.00 60.10  ? 91  ARG A CB  1 
ATOM   29   C  CG  . ARG A 1 21  ? 17.134 15.004  -24.644 1.00 71.38  ? 91  ARG A CG  1 
ATOM   30   C  CD  . ARG A 1 21  ? 16.301 13.926  -25.326 1.00 80.12  ? 91  ARG A CD  1 
ATOM   31   N  NE  . ARG A 1 21  ? 16.690 12.585  -24.894 1.00 84.10  ? 91  ARG A NE  1 
ATOM   32   C  CZ  . ARG A 1 21  ? 15.917 11.767  -24.191 1.00 96.60  ? 91  ARG A CZ  1 
ATOM   33   N  NH1 . ARG A 1 21  ? 14.676 12.120  -23.876 1.00 85.15  ? 91  ARG A NH1 1 
ATOM   34   N  NH2 . ARG A 1 21  ? 16.373 10.588  -23.809 1.00 81.28  ? 91  ARG A NH2 1 
ATOM   35   N  N   . TRP A 1 22  ? 17.000 16.407  -20.168 1.00 56.42  ? 92  TRP A N   1 
ATOM   36   C  CA  . TRP A 1 22  ? 16.890 16.304  -18.718 1.00 54.86  ? 92  TRP A CA  1 
ATOM   37   C  C   . TRP A 1 22  ? 15.458 16.486  -18.227 1.00 59.10  ? 92  TRP A C   1 
ATOM   38   O  O   . TRP A 1 22  ? 14.627 17.075  -18.922 1.00 59.93  ? 92  TRP A O   1 
ATOM   39   C  CB  . TRP A 1 22  ? 17.824 17.318  -18.038 1.00 52.44  ? 92  TRP A CB  1 
ATOM   40   C  CG  . TRP A 1 22  ? 17.528 18.749  -18.387 1.00 53.92  ? 92  TRP A CG  1 
ATOM   41   C  CD1 . TRP A 1 22  ? 18.043 19.463  -19.429 1.00 57.38  ? 92  TRP A CD1 1 
ATOM   42   C  CD2 . TRP A 1 22  ? 16.671 19.646  -17.669 1.00 53.98  ? 92  TRP A CD2 1 
ATOM   43   N  NE1 . TRP A 1 22  ? 17.560 20.750  -19.406 1.00 57.33  ? 92  TRP A NE1 1 
ATOM   44   C  CE2 . TRP A 1 22  ? 16.709 20.888  -18.340 1.00 58.48  ? 92  TRP A CE2 1 
ATOM   45   C  CE3 . TRP A 1 22  ? 15.851 19.515  -16.535 1.00 55.10  ? 92  TRP A CE3 1 
ATOM   46   C  CZ2 . TRP A 1 22  ? 15.962 21.992  -17.913 1.00 58.18  ? 92  TRP A CZ2 1 
ATOM   47   C  CZ3 . TRP A 1 22  ? 15.126 20.614  -16.103 1.00 57.02  ? 92  TRP A CZ3 1 
ATOM   48   C  CH2 . TRP A 1 22  ? 15.175 21.831  -16.794 1.00 58.11  ? 92  TRP A CH2 1 
ATOM   49   N  N   . ARG A 1 23  ? 15.193 16.005  -17.006 1.00 54.81  ? 93  ARG A N   1 
ATOM   50   C  CA  . ARG A 1 23  ? 13.898 16.100  -16.340 1.00 55.38  ? 93  ARG A CA  1 
ATOM   51   C  C   . ARG A 1 23  ? 14.061 16.645  -14.929 1.00 58.62  ? 93  ARG A C   1 
ATOM   52   O  O   . ARG A 1 23  ? 15.113 16.451  -14.316 1.00 56.97  ? 93  ARG A O   1 
ATOM   53   C  CB  . ARG A 1 23  ? 13.231 14.724  -16.281 1.00 56.01  ? 93  ARG A CB  1 
ATOM   54   C  CG  . ARG A 1 23  ? 12.253 14.472  -17.417 1.00 67.53  ? 93  ARG A CG  1 
ATOM   55   C  CD  . ARG A 1 23  ? 11.408 13.242  -17.159 1.00 76.27  ? 93  ARG A CD  1 
ATOM   56   N  NE  . ARG A 1 23  ? 10.467 13.433  -16.053 1.00 83.16  ? 93  ARG A NE  1 
ATOM   57   C  CZ  . ARG A 1 23  ? 9.825  12.451  -15.426 1.00 96.44  ? 93  ARG A CZ  1 
ATOM   58   N  NH1 . ARG A 1 23  ? 10.018 11.186  -15.781 1.00 82.60  ? 93  ARG A NH1 1 
ATOM   59   N  NH2 . ARG A 1 23  ? 8.991  12.725  -14.433 1.00 84.12  ? 93  ARG A NH2 1 
ATOM   60   N  N   . VAL A 1 24  ? 13.012 17.307  -14.407 1.00 56.30  ? 94  VAL A N   1 
ATOM   61   C  CA  . VAL A 1 24  ? 13.003 17.857  -13.046 1.00 55.68  ? 94  VAL A CA  1 
ATOM   62   C  C   . VAL A 1 24  ? 13.054 16.735  -12.006 1.00 59.45  ? 94  VAL A C   1 
ATOM   63   O  O   . VAL A 1 24  ? 12.486 15.662  -12.228 1.00 59.70  ? 94  VAL A O   1 
ATOM   64   C  CB  . VAL A 1 24  ? 11.865 18.876  -12.772 1.00 60.77  ? 94  VAL A CB  1 
ATOM   65   C  CG1 . VAL A 1 24  ? 12.132 20.205  -13.473 1.00 60.38  ? 94  VAL A CG1 1 
ATOM   66   C  CG2 . VAL A 1 24  ? 10.490 18.319  -13.143 1.00 62.54  ? 94  VAL A CG2 1 
ATOM   67   N  N   . ILE A 1 25  ? 13.774 16.968  -10.898 1.00 55.32  ? 95  ILE A N   1 
ATOM   68   C  CA  . ILE A 1 25  ? 13.954 15.974  -9.836  1.00 55.21  ? 95  ILE A CA  1 
ATOM   69   C  C   . ILE A 1 25  ? 13.501 16.481  -8.455  1.00 59.73  ? 95  ILE A C   1 
ATOM   70   O  O   . ILE A 1 25  ? 13.627 17.680  -8.190  1.00 59.01  ? 95  ILE A O   1 
ATOM   71   C  CB  . ILE A 1 25  ? 15.413 15.421  -9.800  1.00 57.07  ? 95  ILE A CB  1 
ATOM   72   C  CG1 . ILE A 1 25  ? 16.478 16.538  -9.627  1.00 56.39  ? 95  ILE A CG1 1 
ATOM   73   C  CG2 . ILE A 1 25  ? 15.696 14.545  -11.018 1.00 57.64  ? 95  ILE A CG2 1 
ATOM   74   C  CD1 . ILE A 1 25  ? 17.834 16.045  -9.106  1.00 62.68  ? 95  ILE A CD1 1 
ATOM   75   N  N   . PRO A 1 26  ? 13.015 15.593  -7.545  1.00 57.36  ? 96  PRO A N   1 
ATOM   76   C  CA  . PRO A 1 26  ? 12.630 16.065  -6.201  1.00 58.14  ? 96  PRO A CA  1 
ATOM   77   C  C   . PRO A 1 26  ? 13.841 16.507  -5.371  1.00 61.38  ? 96  PRO A C   1 
ATOM   78   O  O   . PRO A 1 26  ? 14.979 16.181  -5.719  1.00 59.64  ? 96  PRO A O   1 
ATOM   79   C  CB  . PRO A 1 26  ? 11.926 14.850  -5.587  1.00 61.29  ? 96  PRO A CB  1 
ATOM   80   C  CG  . PRO A 1 26  ? 12.509 13.683  -6.287  1.00 64.88  ? 96  PRO A CG  1 
ATOM   81   C  CD  . PRO A 1 26  ? 12.794 14.137  -7.685  1.00 59.41  ? 96  PRO A CD  1 
ATOM   82   N  N   . TYR A 1 27  ? 13.591 17.256  -4.283  1.00 59.06  ? 97  TYR A N   1 
ATOM   83   C  CA  . TYR A 1 27  ? 14.613 17.795  -3.383  1.00 58.57  ? 97  TYR A CA  1 
ATOM   84   C  C   . TYR A 1 27  ? 15.524 16.725  -2.741  1.00 62.78  ? 97  TYR A C   1 
ATOM   85   O  O   . TYR A 1 27  ? 16.711 16.980  -2.577  1.00 61.53  ? 97  TYR A O   1 
ATOM   86   C  CB  . TYR A 1 27  ? 13.961 18.695  -2.309  1.00 61.05  ? 97  TYR A CB  1 
ATOM   87   C  CG  . TYR A 1 27  ? 14.921 19.260  -1.281  1.00 62.71  ? 97  TYR A CG  1 
ATOM   88   C  CD1 . TYR A 1 27  ? 15.694 20.382  -1.564  1.00 63.45  ? 97  TYR A CD1 1 
ATOM   89   C  CD2 . TYR A 1 27  ? 15.038 18.688  -0.018  1.00 64.79  ? 97  TYR A CD2 1 
ATOM   90   C  CE1 . TYR A 1 27  ? 16.587 20.899  -0.628  1.00 64.29  ? 97  TYR A CE1 1 
ATOM   91   C  CE2 . TYR A 1 27  ? 15.924 19.198  0.928   1.00 65.90  ? 97  TYR A CE2 1 
ATOM   92   C  CZ  . TYR A 1 27  ? 16.693 20.309  0.621   1.00 72.30  ? 97  TYR A CZ  1 
ATOM   93   O  OH  . TYR A 1 27  ? 17.564 20.824  1.550   1.00 73.76  ? 97  TYR A OH  1 
ATOM   94   N  N   . ASP A 1 28  ? 14.970 15.550  -2.398  1.00 60.65  ? 98  ASP A N   1 
ATOM   95   C  CA  . ASP A 1 28  ? 15.640 14.439  -1.711  1.00 60.98  ? 98  ASP A CA  1 
ATOM   96   C  C   . ASP A 1 28  ? 16.849 13.846  -2.439  1.00 63.17  ? 98  ASP A C   1 
ATOM   97   O  O   . ASP A 1 28  ? 17.818 13.476  -1.777  1.00 62.94  ? 98  ASP A O   1 
ATOM   98   C  CB  . ASP A 1 28  ? 14.631 13.323  -1.361  1.00 64.68  ? 98  ASP A CB  1 
ATOM   99   C  CG  . ASP A 1 28  ? 13.716 12.880  -2.492  1.00 76.54  ? 98  ASP A CG  1 
ATOM   100  O  OD1 . ASP A 1 28  ? 14.231 12.560  -3.588  1.00 76.17  ? 98  ASP A OD1 1 
ATOM   101  O  OD2 . ASP A 1 28  ? 12.490 12.798  -2.265  1.00 84.31  ? 98  ASP A OD2 1 
ATOM   102  N  N   . VAL A 1 29  ? 16.786 13.726  -3.779  1.00 58.45  ? 99  VAL A N   1 
ATOM   103  C  CA  . VAL A 1 29  ? 17.859 13.128  -4.592  1.00 57.02  ? 99  VAL A CA  1 
ATOM   104  C  C   . VAL A 1 29  ? 18.968 14.128  -4.994  1.00 59.14  ? 99  VAL A C   1 
ATOM   105  O  O   . VAL A 1 29  ? 19.968 13.713  -5.587  1.00 58.13  ? 99  VAL A O   1 
ATOM   106  C  CB  . VAL A 1 29  ? 17.327 12.353  -5.830  1.00 60.77  ? 99  VAL A CB  1 
ATOM   107  C  CG1 . VAL A 1 29  ? 16.684 11.030  -5.424  1.00 61.75  ? 99  VAL A CG1 1 
ATOM   108  C  CG2 . VAL A 1 29  ? 16.374 13.200  -6.675  1.00 60.49  ? 99  VAL A CG2 1 
ATOM   109  N  N   . LEU A 1 30  ? 18.799 15.421  -4.660  1.00 55.13  ? 100 LEU A N   1 
ATOM   110  C  CA  . LEU A 1 30  ? 19.759 16.484  -4.977  1.00 53.80  ? 100 LEU A CA  1 
ATOM   111  C  C   . LEU A 1 30  ? 21.090 16.333  -4.225  1.00 57.31  ? 100 LEU A C   1 
ATOM   112  O  O   . LEU A 1 30  ? 21.076 15.906  -3.067  1.00 57.89  ? 100 LEU A O   1 
ATOM   113  C  CB  . LEU A 1 30  ? 19.177 17.866  -4.607  1.00 53.96  ? 100 LEU A CB  1 
ATOM   114  C  CG  . LEU A 1 30  ? 18.035 18.452  -5.429  1.00 58.60  ? 100 LEU A CG  1 
ATOM   115  C  CD1 . LEU A 1 30  ? 17.495 19.693  -4.754  1.00 59.25  ? 100 LEU A CD1 1 
ATOM   116  C  CD2 . LEU A 1 30  ? 18.494 18.839  -6.821  1.00 59.98  ? 100 LEU A CD2 1 
ATOM   117  N  N   . PRO A 1 31  ? 22.239 16.762  -4.810  1.00 52.60  ? 101 PRO A N   1 
ATOM   118  C  CA  . PRO A 1 31  ? 23.488 16.757  -4.029  1.00 52.84  ? 101 PRO A CA  1 
ATOM   119  C  C   . PRO A 1 31  ? 23.453 17.926  -3.026  1.00 57.51  ? 101 PRO A C   1 
ATOM   120  O  O   . PRO A 1 31  ? 22.724 18.896  -3.255  1.00 56.60  ? 101 PRO A O   1 
ATOM   121  C  CB  . PRO A 1 31  ? 24.575 16.920  -5.090  1.00 53.78  ? 101 PRO A CB  1 
ATOM   122  C  CG  . PRO A 1 31  ? 23.911 17.621  -6.217  1.00 57.26  ? 101 PRO A CG  1 
ATOM   123  C  CD  . PRO A 1 31  ? 22.440 17.337  -6.159  1.00 52.95  ? 101 PRO A CD  1 
ATOM   124  N  N   . ASP A 1 32  ? 24.204 17.825  -1.912  1.00 55.34  ? 102 ASP A N   1 
ATOM   125  C  CA  . ASP A 1 32  ? 24.232 18.828  -0.834  1.00 56.13  ? 102 ASP A CA  1 
ATOM   126  C  C   . ASP A 1 32  ? 24.452 20.282  -1.293  1.00 59.05  ? 102 ASP A C   1 
ATOM   127  O  O   . ASP A 1 32  ? 23.812 21.183  -0.746  1.00 58.85  ? 102 ASP A O   1 
ATOM   128  C  CB  . ASP A 1 32  ? 25.260 18.451  0.244   1.00 59.70  ? 102 ASP A CB  1 
ATOM   129  C  CG  . ASP A 1 32  ? 24.991 17.134  0.956   1.00 73.10  ? 102 ASP A CG  1 
ATOM   130  O  OD1 . ASP A 1 32  ? 23.799 16.774  1.119   1.00 74.17  ? 102 ASP A OD1 1 
ATOM   131  O  OD2 . ASP A 1 32  ? 25.967 16.483  1.385   1.00 80.63  ? 102 ASP A OD2 1 
ATOM   132  N  N   . TRP A 1 33  ? 25.324 20.507  -2.299  1.00 54.67  ? 103 TRP A N   1 
ATOM   133  C  CA  . TRP A 1 33  ? 25.621 21.840  -2.840  1.00 53.71  ? 103 TRP A CA  1 
ATOM   134  C  C   . TRP A 1 33  ? 24.435 22.471  -3.599  1.00 57.02  ? 103 TRP A C   1 
ATOM   135  O  O   . TRP A 1 33  ? 24.403 23.693  -3.754  1.00 56.51  ? 103 TRP A O   1 
ATOM   136  C  CB  . TRP A 1 33  ? 26.903 21.836  -3.692  1.00 52.05  ? 103 TRP A CB  1 
ATOM   137  C  CG  . TRP A 1 33  ? 26.874 20.894  -4.858  1.00 52.24  ? 103 TRP A CG  1 
ATOM   138  C  CD1 . TRP A 1 33  ? 27.178 19.565  -4.846  1.00 55.42  ? 103 TRP A CD1 1 
ATOM   139  C  CD2 . TRP A 1 33  ? 26.550 21.222  -6.215  1.00 51.11  ? 103 TRP A CD2 1 
ATOM   140  N  NE1 . TRP A 1 33  ? 27.055 19.040  -6.111  1.00 54.14  ? 103 TRP A NE1 1 
ATOM   141  C  CE2 . TRP A 1 33  ? 26.658 20.033  -6.970  1.00 54.87  ? 103 TRP A CE2 1 
ATOM   142  C  CE3 . TRP A 1 33  ? 26.169 22.406  -6.868  1.00 51.82  ? 103 TRP A CE3 1 
ATOM   143  C  CZ2 . TRP A 1 33  ? 26.399 19.993  -8.344  1.00 53.56  ? 103 TRP A CZ2 1 
ATOM   144  C  CZ3 . TRP A 1 33  ? 25.924 22.368  -8.231  1.00 52.76  ? 103 TRP A CZ3 1 
ATOM   145  C  CH2 . TRP A 1 33  ? 26.007 21.166  -8.949  1.00 53.33  ? 103 TRP A CH2 1 
ATOM   146  N  N   . LEU A 1 34  ? 23.461 21.651  -4.044  1.00 53.50  ? 104 LEU A N   1 
ATOM   147  C  CA  . LEU A 1 34  ? 22.245 22.123  -4.715  1.00 53.03  ? 104 LEU A CA  1 
ATOM   148  C  C   . LEU A 1 34  ? 21.068 22.214  -3.732  1.00 58.39  ? 104 LEU A C   1 
ATOM   149  O  O   . LEU A 1 34  ? 20.033 22.793  -4.070  1.00 57.98  ? 104 LEU A O   1 
ATOM   150  C  CB  . LEU A 1 34  ? 21.878 21.246  -5.928  1.00 52.60  ? 104 LEU A CB  1 
ATOM   151  C  CG  . LEU A 1 34  ? 22.613 21.530  -7.244  1.00 56.58  ? 104 LEU A CG  1 
ATOM   152  C  CD1 . LEU A 1 34  ? 22.272 20.493  -8.292  1.00 56.53  ? 104 LEU A CD1 1 
ATOM   153  C  CD2 . LEU A 1 34  ? 22.302 22.925  -7.786  1.00 58.79  ? 104 LEU A CD2 1 
ATOM   154  N  N   . LYS A 1 35  ? 21.236 21.651  -2.518  1.00 56.62  ? 105 LYS A N   1 
ATOM   155  C  CA  . LYS A 1 35  ? 20.239 21.665  -1.445  1.00 57.90  ? 105 LYS A CA  1 
ATOM   156  C  C   . LYS A 1 35  ? 20.404 22.954  -0.628  1.00 63.94  ? 105 LYS A C   1 
ATOM   157  O  O   . LYS A 1 35  ? 21.174 22.981  0.337   1.00 64.36  ? 105 LYS A O   1 
ATOM   158  C  CB  . LYS A 1 35  ? 20.398 20.430  -0.537  1.00 60.99  ? 105 LYS A CB  1 
ATOM   159  C  CG  . LYS A 1 35  ? 19.827 19.139  -1.098  1.00 69.20  ? 105 LYS A CG  1 
ATOM   160  C  CD  . LYS A 1 35  ? 19.942 18.021  -0.071  1.00 76.89  ? 105 LYS A CD  1 
ATOM   161  C  CE  . LYS A 1 35  ? 19.191 16.782  -0.482  1.00 84.81  ? 105 LYS A CE  1 
ATOM   162  N  NZ  . LYS A 1 35  ? 19.303 15.701  0.530   1.00 94.45  ? 105 LYS A NZ  1 
ATOM   163  N  N   . ASP A 1 36  ? 19.704 24.029  -1.035  1.00 61.37  ? 106 ASP A N   1 
ATOM   164  C  CA  . ASP A 1 36  ? 19.781 25.327  -0.355  1.00 62.07  ? 106 ASP A CA  1 
ATOM   165  C  C   . ASP A 1 36  ? 18.433 25.804  0.220   1.00 66.95  ? 106 ASP A C   1 
ATOM   166  O  O   . ASP A 1 36  ? 18.410 26.768  0.991   1.00 67.26  ? 106 ASP A O   1 
ATOM   167  C  CB  . ASP A 1 36  ? 20.422 26.394  -1.269  1.00 63.19  ? 106 ASP A CB  1 
ATOM   168  C  CG  . ASP A 1 36  ? 21.918 26.223  -1.528  1.00 75.76  ? 106 ASP A CG  1 
ATOM   169  O  OD1 . ASP A 1 36  ? 22.546 25.350  -0.879  1.00 77.08  ? 106 ASP A OD1 1 
ATOM   170  O  OD2 . ASP A 1 36  ? 22.464 26.975  -2.368  1.00 82.20  ? 106 ASP A OD2 1 
ATOM   171  N  N   . ASN A 1 37  ? 17.321 25.119  -0.129  1.00 63.68  ? 107 ASN A N   1 
ATOM   172  C  CA  . ASN A 1 37  ? 15.976 25.428  0.366   1.00 64.67  ? 107 ASN A CA  1 
ATOM   173  C  C   . ASN A 1 37  ? 15.132 24.155  0.458   1.00 69.37  ? 107 ASN A C   1 
ATOM   174  O  O   . ASN A 1 37  ? 14.760 23.579  -0.568  1.00 68.43  ? 107 ASN A O   1 
ATOM   175  C  CB  . ASN A 1 37  ? 15.288 26.506  -0.497  1.00 64.84  ? 107 ASN A CB  1 
ATOM   176  C  CG  . ASN A 1 37  ? 14.017 27.109  0.081   1.00 88.12  ? 107 ASN A CG  1 
ATOM   177  O  OD1 . ASN A 1 37  ? 13.474 26.677  1.109   1.00 83.44  ? 107 ASN A OD1 1 
ATOM   178  N  ND2 . ASN A 1 37  ? 13.508 28.135  -0.582  1.00 79.94  ? 107 ASN A ND2 1 
ATOM   179  N  N   . ASP A 1 38  ? 14.831 23.725  1.697   1.00 67.62  ? 108 ASP A N   1 
ATOM   180  C  CA  . ASP A 1 38  ? 14.042 22.525  1.992   1.00 68.86  ? 108 ASP A CA  1 
ATOM   181  C  C   . ASP A 1 38  ? 12.523 22.722  1.821   1.00 74.02  ? 108 ASP A C   1 
ATOM   182  O  O   . ASP A 1 38  ? 11.775 21.744  1.896   1.00 74.84  ? 108 ASP A O   1 
ATOM   183  C  CB  . ASP A 1 38  ? 14.377 21.944  3.387   1.00 72.35  ? 108 ASP A CB  1 
ATOM   184  C  CG  . ASP A 1 38  ? 14.662 22.931  4.511   1.00 83.66  ? 108 ASP A CG  1 
ATOM   185  O  OD1 . ASP A 1 38  ? 14.256 24.112  4.392   1.00 84.04  ? 108 ASP A OD1 1 
ATOM   186  O  OD2 . ASP A 1 38  ? 15.266 22.516  5.523   1.00 90.87  ? 108 ASP A OD2 1 
ATOM   187  N  N   . TYR A 1 39  ? 12.073 23.965  1.568   1.00 70.52  ? 109 TYR A N   1 
ATOM   188  C  CA  . TYR A 1 39  ? 10.657 24.264  1.348   1.00 71.75  ? 109 TYR A CA  1 
ATOM   189  C  C   . TYR A 1 39  ? 10.254 24.104  -0.126  1.00 74.07  ? 109 TYR A C   1 
ATOM   190  O  O   . TYR A 1 39  ? 9.061  24.076  -0.438  1.00 75.05  ? 109 TYR A O   1 
ATOM   191  C  CB  . TYR A 1 39  ? 10.271 25.637  1.920   1.00 74.01  ? 109 TYR A CB  1 
ATOM   192  C  CG  . TYR A 1 39  ? 10.411 25.736  3.425   1.00 77.72  ? 109 TYR A CG  1 
ATOM   193  C  CD1 . TYR A 1 39  ? 9.693  24.893  4.271   1.00 81.97  ? 109 TYR A CD1 1 
ATOM   194  C  CD2 . TYR A 1 39  ? 11.233 26.696  4.006   1.00 78.12  ? 109 TYR A CD2 1 
ATOM   195  C  CE1 . TYR A 1 39  ? 9.822  24.977  5.656   1.00 84.57  ? 109 TYR A CE1 1 
ATOM   196  C  CE2 . TYR A 1 39  ? 11.358 26.799  5.391   1.00 80.76  ? 109 TYR A CE2 1 
ATOM   197  C  CZ  . TYR A 1 39  ? 10.652 25.936  6.212   1.00 90.78  ? 109 TYR A CZ  1 
ATOM   198  O  OH  . TYR A 1 39  ? 10.774 26.031  7.578   1.00 94.07  ? 109 TYR A OH  1 
ATOM   199  N  N   . LEU A 1 40  ? 11.253 23.972  -1.020  1.00 67.99  ? 110 LEU A N   1 
ATOM   200  C  CA  . LEU A 1 40  ? 11.055 23.715  -2.447  1.00 66.72  ? 110 LEU A CA  1 
ATOM   201  C  C   . LEU A 1 40  ? 11.260 22.205  -2.581  1.00 69.49  ? 110 LEU A C   1 
ATOM   202  O  O   . LEU A 1 40  ? 12.396 21.726  -2.535  1.00 67.90  ? 110 LEU A O   1 
ATOM   203  C  CB  . LEU A 1 40  ? 12.050 24.514  -3.325  1.00 64.93  ? 110 LEU A CB  1 
ATOM   204  C  CG  . LEU A 1 40  ? 12.153 26.038  -3.105  1.00 69.43  ? 110 LEU A CG  1 
ATOM   205  C  CD1 . LEU A 1 40  ? 13.225 26.639  -3.990  1.00 67.97  ? 110 LEU A CD1 1 
ATOM   206  C  CD2 . LEU A 1 40  ? 10.825 26.746  -3.359  1.00 73.21  ? 110 LEU A CD2 1 
ATOM   207  N  N   . LEU A 1 41  ? 10.148 21.452  -2.629  1.00 66.67  ? 111 LEU A N   1 
ATOM   208  C  CA  . LEU A 1 41  ? 10.144 19.986  -2.642  1.00 66.31  ? 111 LEU A CA  1 
ATOM   209  C  C   . LEU A 1 41  ? 10.394 19.344  -4.010  1.00 67.93  ? 111 LEU A C   1 
ATOM   210  O  O   . LEU A 1 41  ? 10.982 18.262  -4.061  1.00 66.99  ? 111 LEU A O   1 
ATOM   211  C  CB  . LEU A 1 41  ? 8.839  19.435  -2.028  1.00 68.82  ? 111 LEU A CB  1 
ATOM   212  C  CG  . LEU A 1 41  ? 8.360  20.025  -0.683  1.00 75.21  ? 111 LEU A CG  1 
ATOM   213  C  CD1 . LEU A 1 41  ? 6.981  19.510  -0.328  1.00 78.05  ? 111 LEU A CD1 1 
ATOM   214  C  CD2 . LEU A 1 41  ? 9.328  19.714  0.456   1.00 77.40  ? 111 LEU A CD2 1 
ATOM   215  N  N   . HIS A 1 42  ? 9.931  19.977  -5.104  1.00 63.44  ? 112 HIS A N   1 
ATOM   216  C  CA  . HIS A 1 42  ? 10.083 19.445  -6.463  1.00 62.08  ? 112 HIS A CA  1 
ATOM   217  C  C   . HIS A 1 42  ? 10.401 20.554  -7.481  1.00 64.12  ? 112 HIS A C   1 
ATOM   218  O  O   . HIS A 1 42  ? 10.448 21.731  -7.121  1.00 63.57  ? 112 HIS A O   1 
ATOM   219  C  CB  . HIS A 1 42  ? 8.807  18.680  -6.870  1.00 64.63  ? 112 HIS A CB  1 
ATOM   220  C  CG  . HIS A 1 42  ? 9.057  17.477  -7.727  1.00 67.52  ? 112 HIS A CG  1 
ATOM   221  N  ND1 . HIS A 1 42  ? 9.391  17.598  -9.064  1.00 68.42  ? 112 HIS A ND1 1 
ATOM   222  C  CD2 . HIS A 1 42  ? 8.980  16.164  -7.414  1.00 69.66  ? 112 HIS A CD2 1 
ATOM   223  C  CE1 . HIS A 1 42  ? 9.529  16.362  -9.514  1.00 67.71  ? 112 HIS A CE1 1 
ATOM   224  N  NE2 . HIS A 1 42  ? 9.286  15.465  -8.558  1.00 68.75  ? 112 HIS A NE2 1 
ATOM   225  N  N   . GLY A 1 43  ? 10.622 20.154  -8.734  1.00 59.57  ? 113 GLY A N   1 
ATOM   226  C  CA  . GLY A 1 43  ? 10.906 21.047  -9.851  1.00 58.60  ? 113 GLY A CA  1 
ATOM   227  C  C   . GLY A 1 43  ? 12.351 21.477  -9.979  1.00 59.95  ? 113 GLY A C   1 
ATOM   228  O  O   . GLY A 1 43  ? 12.642 22.443  -10.685 1.00 59.12  ? 113 GLY A O   1 
ATOM   229  N  N   . HIS A 1 44  ? 13.268 20.772  -9.301  1.00 55.08  ? 114 HIS A N   1 
ATOM   230  C  CA  . HIS A 1 44  ? 14.693 21.103  -9.323  1.00 53.18  ? 114 HIS A CA  1 
ATOM   231  C  C   . HIS A 1 44  ? 15.393 20.569  -10.558 1.00 55.56  ? 114 HIS A C   1 
ATOM   232  O  O   . HIS A 1 44  ? 15.136 19.438  -10.966 1.00 55.45  ? 114 HIS A O   1 
ATOM   233  C  CB  . HIS A 1 44  ? 15.398 20.564  -8.073  1.00 53.55  ? 114 HIS A CB  1 
ATOM   234  C  CG  . HIS A 1 44  ? 14.849 21.098  -6.795  1.00 57.73  ? 114 HIS A CG  1 
ATOM   235  N  ND1 . HIS A 1 44  ? 15.418 22.188  -6.168  1.00 59.10  ? 114 HIS A ND1 1 
ATOM   236  C  CD2 . HIS A 1 44  ? 13.801 20.666  -6.060  1.00 60.81  ? 114 HIS A CD2 1 
ATOM   237  C  CE1 . HIS A 1 44  ? 14.698 22.388  -5.077  1.00 59.58  ? 114 HIS A CE1 1 
ATOM   238  N  NE2 . HIS A 1 44  ? 13.713 21.496  -4.973  1.00 61.03  ? 114 HIS A NE2 1 
ATOM   239  N  N   . ARG A 1 45  ? 16.311 21.365  -11.124 1.00 50.66  ? 115 ARG A N   1 
ATOM   240  C  CA  . ARG A 1 45  ? 17.115 20.944  -12.265 1.00 49.72  ? 115 ARG A CA  1 
ATOM   241  C  C   . ARG A 1 45  ? 18.158 19.936  -11.778 1.00 52.90  ? 115 ARG A C   1 
ATOM   242  O  O   . ARG A 1 45  ? 18.790 20.174  -10.745 1.00 52.05  ? 115 ARG A O   1 
ATOM   243  C  CB  . ARG A 1 45  ? 17.849 22.131  -12.897 1.00 48.46  ? 115 ARG A CB  1 
ATOM   244  C  CG  . ARG A 1 45  ? 17.029 22.947  -13.883 1.00 55.18  ? 115 ARG A CG  1 
ATOM   245  C  CD  . ARG A 1 45  ? 17.798 24.154  -14.384 1.00 58.00  ? 115 ARG A CD  1 
ATOM   246  N  NE  . ARG A 1 45  ? 18.340 24.931  -13.269 1.00 59.82  ? 115 ARG A NE  1 
ATOM   247  C  CZ  . ARG A 1 45  ? 19.044 26.049  -13.389 1.00 69.23  ? 115 ARG A CZ  1 
ATOM   248  N  NH1 . ARG A 1 45  ? 19.298 26.558  -14.588 1.00 54.02  ? 115 ARG A NH1 1 
ATOM   249  N  NH2 . ARG A 1 45  ? 19.507 26.661  -12.312 1.00 54.64  ? 115 ARG A NH2 1 
ATOM   250  N  N   . PRO A 1 46  ? 18.354 18.810  -12.487 1.00 49.67  ? 116 PRO A N   1 
ATOM   251  C  CA  . PRO A 1 46  ? 19.396 17.854  -12.070 1.00 48.93  ? 116 PRO A CA  1 
ATOM   252  C  C   . PRO A 1 46  ? 20.759 18.466  -12.367 1.00 52.25  ? 116 PRO A C   1 
ATOM   253  O  O   . PRO A 1 46  ? 20.836 19.311  -13.276 1.00 52.03  ? 116 PRO A O   1 
ATOM   254  C  CB  . PRO A 1 46  ? 19.115 16.643  -12.975 1.00 50.95  ? 116 PRO A CB  1 
ATOM   255  C  CG  . PRO A 1 46  ? 18.487 17.213  -14.191 1.00 55.91  ? 116 PRO A CG  1 
ATOM   256  C  CD  . PRO A 1 46  ? 17.664 18.372  -13.718 1.00 51.88  ? 116 PRO A CD  1 
ATOM   257  N  N   . PRO A 1 47  ? 21.862 18.118  -11.601 1.00 48.46  ? 117 PRO A N   1 
ATOM   258  C  CA  . PRO A 1 47  ? 23.127 18.743  -11.951 1.00 48.18  ? 117 PRO A CA  1 
ATOM   259  C  C   . PRO A 1 47  ? 23.604 18.378  -13.362 1.00 52.60  ? 117 PRO A C   1 
ATOM   260  O  O   . PRO A 1 47  ? 23.624 17.202  -13.710 1.00 52.42  ? 117 PRO A O   1 
ATOM   261  C  CB  . PRO A 1 47  ? 24.080 18.231  -10.877 1.00 49.89  ? 117 PRO A CB  1 
ATOM   262  C  CG  . PRO A 1 47  ? 23.489 16.959  -10.414 1.00 54.39  ? 117 PRO A CG  1 
ATOM   263  C  CD  . PRO A 1 47  ? 22.014 17.172  -10.450 1.00 50.04  ? 117 PRO A CD  1 
ATOM   264  N  N   . MET A 1 48  ? 23.903 19.384  -14.201 1.00 49.54  ? 118 MET A N   1 
ATOM   265  C  CA  . MET A 1 48  ? 24.340 19.156  -15.585 1.00 49.89  ? 118 MET A CA  1 
ATOM   266  C  C   . MET A 1 48  ? 25.575 20.012  -15.841 1.00 53.26  ? 118 MET A C   1 
ATOM   267  O  O   . MET A 1 48  ? 25.483 21.243  -15.873 1.00 52.84  ? 118 MET A O   1 
ATOM   268  C  CB  . MET A 1 48  ? 23.223 19.541  -16.569 1.00 52.94  ? 118 MET A CB  1 
ATOM   269  C  CG  . MET A 1 48  ? 21.970 18.683  -16.430 1.00 56.95  ? 118 MET A CG  1 
ATOM   270  S  SD  . MET A 1 48  ? 20.479 19.521  -17.011 1.00 62.12  ? 118 MET A SD  1 
ATOM   271  C  CE  . MET A 1 48  ? 20.377 20.881  -15.870 1.00 58.35  ? 118 MET A CE  1 
ATOM   272  N  N   . PRO A 1 49  ? 26.774 19.343  -16.018 1.00 49.32  ? 119 PRO A N   1 
ATOM   273  C  CA  . PRO A 1 49  ? 27.964 20.143  -16.250 1.00 49.32  ? 119 PRO A CA  1 
ATOM   274  C  C   . PRO A 1 49  ? 28.141 20.644  -17.678 1.00 53.10  ? 119 PRO A C   1 
ATOM   275  O  O   . PRO A 1 49  ? 29.137 20.363  -18.339 1.00 53.41  ? 119 PRO A O   1 
ATOM   276  C  CB  . PRO A 1 49  ? 29.089 19.212  -15.819 1.00 51.34  ? 119 PRO A CB  1 
ATOM   277  C  CG  . PRO A 1 49  ? 28.576 17.857  -16.139 1.00 55.79  ? 119 PRO A CG  1 
ATOM   278  C  CD  . PRO A 1 49  ? 27.094 17.879  -15.994 1.00 50.75  ? 119 PRO A CD  1 
ATOM   279  N  N   . SER A 1 50  ? 27.134 21.370  -18.166 1.00 49.05  ? 120 SER A N   1 
ATOM   280  C  CA  . SER A 1 50  ? 27.158 21.926  -19.513 1.00 49.72  ? 120 SER A CA  1 
ATOM   281  C  C   . SER A 1 50  ? 26.589 23.328  -19.486 1.00 53.20  ? 120 SER A C   1 
ATOM   282  O  O   . SER A 1 50  ? 25.491 23.536  -18.975 1.00 52.21  ? 120 SER A O   1 
ATOM   283  C  CB  . SER A 1 50  ? 26.364 21.045  -20.470 1.00 53.61  ? 120 SER A CB  1 
ATOM   284  O  OG  . SER A 1 50  ? 26.453 21.529  -21.804 1.00 63.68  ? 120 SER A OG  1 
ATOM   285  N  N   . PHE A 1 51  ? 27.341 24.298  -20.012 1.00 50.42  ? 121 PHE A N   1 
ATOM   286  C  CA  . PHE A 1 51  ? 26.876 25.680  -20.062 1.00 50.31  ? 121 PHE A CA  1 
ATOM   287  C  C   . PHE A 1 51  ? 25.745 25.818  -21.064 1.00 55.36  ? 121 PHE A C   1 
ATOM   288  O  O   . PHE A 1 51  ? 24.784 26.527  -20.783 1.00 54.88  ? 121 PHE A O   1 
ATOM   289  C  CB  . PHE A 1 51  ? 28.022 26.662  -20.341 1.00 52.82  ? 121 PHE A CB  1 
ATOM   290  C  CG  . PHE A 1 51  ? 28.927 26.886  -19.151 1.00 53.45  ? 121 PHE A CG  1 
ATOM   291  C  CD1 . PHE A 1 51  ? 28.464 27.548  -18.018 1.00 55.32  ? 121 PHE A CD1 1 
ATOM   292  C  CD2 . PHE A 1 51  ? 30.242 26.437  -19.163 1.00 55.94  ? 121 PHE A CD2 1 
ATOM   293  C  CE1 . PHE A 1 51  ? 29.298 27.742  -16.913 1.00 55.74  ? 121 PHE A CE1 1 
ATOM   294  C  CE2 . PHE A 1 51  ? 31.077 26.642  -18.062 1.00 58.30  ? 121 PHE A CE2 1 
ATOM   295  C  CZ  . PHE A 1 51  ? 30.599 27.291  -16.944 1.00 55.37  ? 121 PHE A CZ  1 
ATOM   296  N  N   . ARG A 1 52  ? 25.816 25.064  -22.185 1.00 53.14  ? 122 ARG A N   1 
ATOM   297  C  CA  . ARG A 1 52  ? 24.789 25.008  -23.226 1.00 54.19  ? 122 ARG A CA  1 
ATOM   298  C  C   . ARG A 1 52  ? 23.458 24.558  -22.626 1.00 57.98  ? 122 ARG A C   1 
ATOM   299  O  O   . ARG A 1 52  ? 22.449 25.224  -22.841 1.00 58.23  ? 122 ARG A O   1 
ATOM   300  C  CB  . ARG A 1 52  ? 25.218 24.050  -24.345 1.00 54.72  ? 122 ARG A CB  1 
ATOM   301  C  CG  . ARG A 1 52  ? 24.392 24.162  -25.625 1.00 63.47  ? 122 ARG A CG  1 
ATOM   302  C  CD  . ARG A 1 52  ? 24.929 23.258  -26.718 1.00 68.76  ? 122 ARG A CD  1 
ATOM   303  N  NE  . ARG A 1 52  ? 26.345 23.517  -26.984 1.00 72.16  ? 122 ARG A NE  1 
ATOM   304  C  CZ  . ARG A 1 52  ? 27.082 22.854  -27.868 1.00 83.40  ? 122 ARG A CZ  1 
ATOM   305  N  NH1 . ARG A 1 52  ? 26.542 21.887  -28.602 1.00 69.05  ? 122 ARG A NH1 1 
ATOM   306  N  NH2 . ARG A 1 52  ? 28.361 23.158  -28.036 1.00 69.56  ? 122 ARG A NH2 1 
ATOM   307  N  N   . ALA A 1 53  ? 23.473 23.456  -21.843 1.00 53.91  ? 123 ALA A N   1 
ATOM   308  C  CA  . ALA A 1 53  ? 22.300 22.896  -21.167 1.00 53.24  ? 123 ALA A CA  1 
ATOM   309  C  C   . ALA A 1 53  ? 21.767 23.845  -20.092 1.00 57.01  ? 123 ALA A C   1 
ATOM   310  O  O   . ALA A 1 53  ? 20.551 23.922  -19.904 1.00 56.88  ? 123 ALA A O   1 
ATOM   311  C  CB  . ALA A 1 53  ? 22.643 21.548  -20.556 1.00 52.93  ? 123 ALA A CB  1 
ATOM   312  N  N   . CYS A 1 54  ? 22.673 24.575  -19.403 1.00 53.34  ? 124 CYS A N   1 
ATOM   313  C  CA  . CYS A 1 54  ? 22.330 25.546  -18.360 1.00 52.74  ? 124 CYS A CA  1 
ATOM   314  C  C   . CYS A 1 54  ? 21.660 26.795  -18.948 1.00 57.61  ? 124 CYS A C   1 
ATOM   315  O  O   . CYS A 1 54  ? 20.671 27.266  -18.391 1.00 57.13  ? 124 CYS A O   1 
ATOM   316  C  CB  . CYS A 1 54  ? 23.549 25.904  -17.513 1.00 52.39  ? 124 CYS A CB  1 
ATOM   317  S  SG  . CYS A 1 54  ? 24.027 24.628  -16.315 1.00 55.21  ? 124 CYS A SG  1 
ATOM   318  N  N   . PHE A 1 55  ? 22.192 27.321  -20.068 1.00 55.36  ? 125 PHE A N   1 
ATOM   319  C  CA  . PHE A 1 55  ? 21.636 28.495  -20.746 1.00 56.40  ? 125 PHE A CA  1 
ATOM   320  C  C   . PHE A 1 55  ? 20.362 28.156  -21.522 1.00 61.58  ? 125 PHE A C   1 
ATOM   321  O  O   . PHE A 1 55  ? 19.491 29.012  -21.657 1.00 62.08  ? 125 PHE A O   1 
ATOM   322  C  CB  . PHE A 1 55  ? 22.673 29.151  -21.668 1.00 59.32  ? 125 PHE A CB  1 
ATOM   323  C  CG  . PHE A 1 55  ? 23.691 30.030  -20.977 1.00 60.25  ? 125 PHE A CG  1 
ATOM   324  C  CD1 . PHE A 1 55  ? 23.351 31.302  -20.533 1.00 63.30  ? 125 PHE A CD1 1 
ATOM   325  C  CD2 . PHE A 1 55  ? 25.008 29.610  -20.829 1.00 62.00  ? 125 PHE A CD2 1 
ATOM   326  C  CE1 . PHE A 1 55  ? 24.299 32.121  -19.912 1.00 63.74  ? 125 PHE A CE1 1 
ATOM   327  C  CE2 . PHE A 1 55  ? 25.955 30.428  -20.208 1.00 64.49  ? 125 PHE A CE2 1 
ATOM   328  C  CZ  . PHE A 1 55  ? 25.596 31.678  -19.756 1.00 62.51  ? 125 PHE A CZ  1 
ATOM   329  N  N   . LYS A 1 56  ? 20.250 26.912  -22.027 1.00 58.51  ? 126 LYS A N   1 
ATOM   330  C  CA  . LYS A 1 56  ? 19.070 26.439  -22.759 1.00 59.77  ? 126 LYS A CA  1 
ATOM   331  C  C   . LYS A 1 56  ? 17.890 26.260  -21.794 1.00 63.09  ? 126 LYS A C   1 
ATOM   332  O  O   . LYS A 1 56  ? 16.741 26.428  -22.205 1.00 64.12  ? 126 LYS A O   1 
ATOM   333  C  CB  . LYS A 1 56  ? 19.376 25.116  -23.479 1.00 62.63  ? 126 LYS A CB  1 
ATOM   334  C  CG  . LYS A 1 56  ? 18.460 24.797  -24.651 1.00 79.12  ? 126 LYS A CG  1 
ATOM   335  C  CD  . LYS A 1 56  ? 18.761 23.412  -25.204 1.00 89.65  ? 126 LYS A CD  1 
ATOM   336  C  CE  . LYS A 1 56  ? 17.686 22.916  -26.136 1.00 102.62 ? 126 LYS A CE  1 
ATOM   337  N  NZ  . LYS A 1 56  ? 17.803 21.452  -26.372 1.00 111.87 ? 126 LYS A NZ  1 
ATOM   338  N  N   . SER A 1 57  ? 18.183 25.949  -20.509 1.00 57.79  ? 127 SER A N   1 
ATOM   339  C  CA  . SER A 1 57  ? 17.188 25.738  -19.453 1.00 57.08  ? 127 SER A CA  1 
ATOM   340  C  C   . SER A 1 57  ? 16.409 27.009  -19.062 1.00 61.53  ? 127 SER A C   1 
ATOM   341  O  O   . SER A 1 57  ? 15.360 26.888  -18.424 1.00 61.47  ? 127 SER A O   1 
ATOM   342  C  CB  . SER A 1 57  ? 17.819 25.077  -18.230 1.00 58.78  ? 127 SER A CB  1 
ATOM   343  O  OG  . SER A 1 57  ? 18.520 25.990  -17.402 1.00 66.26  ? 127 SER A OG  1 
ATOM   344  N  N   . ILE A 1 58  ? 16.903 28.215  -19.458 1.00 58.29  ? 128 ILE A N   1 
ATOM   345  C  CA  . ILE A 1 58  ? 16.259 29.522  -19.217 1.00 58.54  ? 128 ILE A CA  1 
ATOM   346  C  C   . ILE A 1 58  ? 14.835 29.497  -19.806 1.00 64.51  ? 128 ILE A C   1 
ATOM   347  O  O   . ILE A 1 58  ? 13.887 29.953  -19.162 1.00 64.45  ? 128 ILE A O   1 
ATOM   348  C  CB  . ILE A 1 58  ? 17.112 30.695  -19.809 1.00 61.87  ? 128 ILE A CB  1 
ATOM   349  C  CG1 . ILE A 1 58  ? 18.475 30.830  -19.092 1.00 60.57  ? 128 ILE A CG1 1 
ATOM   350  C  CG2 . ILE A 1 58  ? 16.344 32.033  -19.810 1.00 63.54  ? 128 ILE A CG2 1 
ATOM   351  C  CD1 . ILE A 1 58  ? 19.536 31.742  -19.805 1.00 68.11  ? 128 ILE A CD1 1 
ATOM   352  N  N   . PHE A 1 59  ? 14.699 28.912  -21.011 1.00 62.61  ? 129 PHE A N   1 
ATOM   353  C  CA  . PHE A 1 59  ? 13.449 28.773  -21.760 1.00 64.73  ? 129 PHE A CA  1 
ATOM   354  C  C   . PHE A 1 59  ? 12.647 27.520  -21.352 1.00 68.60  ? 129 PHE A C   1 
ATOM   355  O  O   . PHE A 1 59  ? 11.772 27.067  -22.095 1.00 70.12  ? 129 PHE A O   1 
ATOM   356  C  CB  . PHE A 1 59  ? 13.738 28.811  -23.275 1.00 68.34  ? 129 PHE A CB  1 
ATOM   357  C  CG  . PHE A 1 59  ? 14.502 30.038  -23.719 1.00 70.20  ? 129 PHE A CG  1 
ATOM   358  C  CD1 . PHE A 1 59  ? 13.841 31.232  -23.982 1.00 74.83  ? 129 PHE A CD1 1 
ATOM   359  C  CD2 . PHE A 1 59  ? 15.886 30.007  -23.849 1.00 71.20  ? 129 PHE A CD2 1 
ATOM   360  C  CE1 . PHE A 1 59  ? 14.550 32.371  -24.371 1.00 76.15  ? 129 PHE A CE1 1 
ATOM   361  C  CE2 . PHE A 1 59  ? 16.595 31.149  -24.235 1.00 74.48  ? 129 PHE A CE2 1 
ATOM   362  C  CZ  . PHE A 1 59  ? 15.921 32.322  -24.497 1.00 74.07  ? 129 PHE A CZ  1 
ATOM   363  N  N   . ARG A 1 60  ? 12.931 26.989  -20.147 1.00 63.12  ? 130 ARG A N   1 
ATOM   364  C  CA  . ARG A 1 60  ? 12.269 25.821  -19.569 1.00 62.75  ? 130 ARG A CA  1 
ATOM   365  C  C   . ARG A 1 60  ? 11.841 26.093  -18.128 1.00 65.66  ? 130 ARG A C   1 
ATOM   366  O  O   . ARG A 1 60  ? 12.412 26.970  -17.479 1.00 64.12  ? 130 ARG A O   1 
ATOM   367  C  CB  . ARG A 1 60  ? 13.166 24.583  -19.661 1.00 61.81  ? 130 ARG A CB  1 
ATOM   368  C  CG  . ARG A 1 60  ? 13.159 23.948  -21.047 1.00 73.59  ? 130 ARG A CG  1 
ATOM   369  C  CD  . ARG A 1 60  ? 13.808 22.581  -21.058 1.00 82.69  ? 130 ARG A CD  1 
ATOM   370  N  NE  . ARG A 1 60  ? 13.094 21.634  -20.201 1.00 91.12  ? 130 ARG A NE  1 
ATOM   371  C  CZ  . ARG A 1 60  ? 13.456 20.370  -20.012 1.00 105.49 ? 130 ARG A CZ  1 
ATOM   372  N  NH1 . ARG A 1 60  ? 14.525 19.879  -20.628 1.00 92.23  ? 130 ARG A NH1 1 
ATOM   373  N  NH2 . ARG A 1 60  ? 12.749 19.585  -19.211 1.00 93.26  ? 130 ARG A NH2 1 
ATOM   374  N  N   . ILE A 1 61  ? 10.825 25.358  -17.636 1.00 62.88  ? 131 ILE A N   1 
ATOM   375  C  CA  . ILE A 1 61  ? 10.270 25.547  -16.292 1.00 62.35  ? 131 ILE A CA  1 
ATOM   376  C  C   . ILE A 1 61  ? 10.933 24.627  -15.248 1.00 64.24  ? 131 ILE A C   1 
ATOM   377  O  O   . ILE A 1 61  ? 10.985 23.408  -15.418 1.00 63.55  ? 131 ILE A O   1 
ATOM   378  C  CB  . ILE A 1 61  ? 8.715  25.446  -16.313 1.00 67.78  ? 131 ILE A CB  1 
ATOM   379  C  CG1 . ILE A 1 61  ? 8.115  26.686  -17.026 1.00 69.98  ? 131 ILE A CG1 1 
ATOM   380  C  CG2 . ILE A 1 61  ? 8.120  25.261  -14.904 1.00 68.43  ? 131 ILE A CG2 1 
ATOM   381  C  CD1 . ILE A 1 61  ? 6.598  26.745  -17.192 1.00 80.30  ? 131 ILE A CD1 1 
ATOM   382  N  N   . HIS A 1 62  ? 11.443 25.253  -14.172 1.00 59.50  ? 132 HIS A N   1 
ATOM   383  C  CA  . HIS A 1 62  ? 12.111 24.652  -13.014 1.00 57.83  ? 132 HIS A CA  1 
ATOM   384  C  C   . HIS A 1 62  ? 12.109 25.668  -11.849 1.00 61.42  ? 132 HIS A C   1 
ATOM   385  O  O   . HIS A 1 62  ? 11.677 26.809  -12.040 1.00 61.76  ? 132 HIS A O   1 
ATOM   386  C  CB  . HIS A 1 62  ? 13.550 24.215  -13.365 1.00 56.94  ? 132 HIS A CB  1 
ATOM   387  C  CG  . HIS A 1 62  ? 14.330 25.236  -14.133 1.00 59.87  ? 132 HIS A CG  1 
ATOM   388  N  ND1 . HIS A 1 62  ? 15.031 26.244  -13.494 1.00 60.72  ? 132 HIS A ND1 1 
ATOM   389  C  CD2 . HIS A 1 62  ? 14.519 25.351  -15.466 1.00 62.09  ? 132 HIS A CD2 1 
ATOM   390  C  CE1 . HIS A 1 62  ? 15.605 26.947  -14.457 1.00 60.15  ? 132 HIS A CE1 1 
ATOM   391  N  NE2 . HIS A 1 62  ? 15.330 26.443  -15.659 1.00 61.37  ? 132 HIS A NE2 1 
ATOM   392  N  N   . THR A 1 63  ? 12.609 25.262  -10.655 1.00 56.99  ? 133 THR A N   1 
ATOM   393  C  CA  . THR A 1 63  ? 12.672 26.111  -9.446  1.00 56.58  ? 133 THR A CA  1 
ATOM   394  C  C   . THR A 1 63  ? 13.327 27.482  -9.666  1.00 59.86  ? 133 THR A C   1 
ATOM   395  O  O   . THR A 1 63  ? 12.947 28.459  -9.011  1.00 60.02  ? 133 THR A O   1 
ATOM   396  C  CB  . THR A 1 63  ? 13.421 25.407  -8.302  1.00 63.29  ? 133 THR A CB  1 
ATOM   397  O  OG1 . THR A 1 63  ? 14.712 25.000  -8.758  1.00 61.68  ? 133 THR A OG1 1 
ATOM   398  C  CG2 . THR A 1 63  ? 12.657 24.231  -7.728  1.00 62.53  ? 133 THR A CG2 1 
ATOM   399  N  N   . GLU A 1 64  ? 14.323 27.543  -10.568 1.00 55.37  ? 134 GLU A N   1 
ATOM   400  C  CA  . GLU A 1 64  ? 15.096 28.754  -10.828 1.00 54.58  ? 134 GLU A CA  1 
ATOM   401  C  C   . GLU A 1 64  ? 14.620 29.616  -12.015 1.00 59.25  ? 134 GLU A C   1 
ATOM   402  O  O   . GLU A 1 64  ? 15.143 30.719  -12.165 1.00 58.53  ? 134 GLU A O   1 
ATOM   403  C  CB  . GLU A 1 64  ? 16.593 28.418  -10.978 1.00 54.73  ? 134 GLU A CB  1 
ATOM   404  C  CG  . GLU A 1 64  ? 17.229 27.793  -9.739  1.00 65.11  ? 134 GLU A CG  1 
ATOM   405  C  CD  . GLU A 1 64  ? 16.985 28.492  -8.414  1.00 87.09  ? 134 GLU A CD  1 
ATOM   406  O  OE1 . GLU A 1 64  ? 17.215 29.719  -8.331  1.00 80.17  ? 134 GLU A OE1 1 
ATOM   407  O  OE2 . GLU A 1 64  ? 16.569 27.808  -7.452  1.00 83.44  ? 134 GLU A OE2 1 
ATOM   408  N  N   . THR A 1 65  ? 13.609 29.168  -12.801 1.00 56.99  ? 135 THR A N   1 
ATOM   409  C  CA  . THR A 1 65  ? 13.074 29.905  -13.965 1.00 58.09  ? 135 THR A CA  1 
ATOM   410  C  C   . THR A 1 65  ? 12.690 31.353  -13.617 1.00 62.80  ? 135 THR A C   1 
ATOM   411  O  O   . THR A 1 65  ? 13.101 32.280  -14.324 1.00 62.55  ? 135 THR A O   1 
ATOM   412  C  CB  . THR A 1 65  ? 11.921 29.132  -14.630 1.00 66.74  ? 135 THR A CB  1 
ATOM   413  O  OG1 . THR A 1 65  ? 12.357 27.803  -14.901 1.00 65.78  ? 135 THR A OG1 1 
ATOM   414  C  CG2 . THR A 1 65  ? 11.439 29.785  -15.928 1.00 66.38  ? 135 THR A CG2 1 
ATOM   415  N  N   . GLY A 1 66  ? 11.931 31.522  -12.531 1.00 59.84  ? 136 GLY A N   1 
ATOM   416  C  CA  . GLY A 1 66  ? 11.495 32.824  -12.035 1.00 60.22  ? 136 GLY A CA  1 
ATOM   417  C  C   . GLY A 1 66  ? 12.640 33.761  -11.695 1.00 62.75  ? 136 GLY A C   1 
ATOM   418  O  O   . GLY A 1 66  ? 12.648 34.921  -12.122 1.00 62.82  ? 136 GLY A O   1 
ATOM   419  N  N   . ASN A 1 67  ? 13.645 33.240  -10.969 1.00 57.71  ? 137 ASN A N   1 
ATOM   420  C  CA  . ASN A 1 67  ? 14.843 33.981  -10.567 1.00 56.34  ? 137 ASN A CA  1 
ATOM   421  C  C   . ASN A 1 67  ? 15.693 34.440  -11.737 1.00 60.21  ? 137 ASN A C   1 
ATOM   422  O  O   . ASN A 1 67  ? 16.302 35.509  -11.657 1.00 59.49  ? 137 ASN A O   1 
ATOM   423  C  CB  . ASN A 1 67  ? 15.688 33.164  -9.613  1.00 55.50  ? 137 ASN A CB  1 
ATOM   424  C  CG  . ASN A 1 67  ? 15.079 33.035  -8.258  1.00 77.33  ? 137 ASN A CG  1 
ATOM   425  O  OD1 . ASN A 1 67  ? 14.729 34.030  -7.602  1.00 72.86  ? 137 ASN A OD1 1 
ATOM   426  N  ND2 . ASN A 1 67  ? 14.980 31.801  -7.805  1.00 68.52  ? 137 ASN A ND2 1 
ATOM   427  N  N   . ILE A 1 68  ? 15.760 33.617  -12.806 1.00 57.19  ? 138 ILE A N   1 
ATOM   428  C  CA  . ILE A 1 68  ? 16.507 33.909  -14.033 1.00 57.31  ? 138 ILE A CA  1 
ATOM   429  C  C   . ILE A 1 68  ? 15.911 35.171  -14.657 1.00 62.75  ? 138 ILE A C   1 
ATOM   430  O  O   . ILE A 1 68  ? 16.575 36.204  -14.748 1.00 61.97  ? 138 ILE A O   1 
ATOM   431  C  CB  . ILE A 1 68  ? 16.387 32.758  -15.089 1.00 60.83  ? 138 ILE A CB  1 
ATOM   432  C  CG1 . ILE A 1 68  ? 16.648 31.335  -14.515 1.00 60.36  ? 138 ILE A CG1 1 
ATOM   433  C  CG2 . ILE A 1 68  ? 17.246 33.036  -16.321 1.00 61.84  ? 138 ILE A CG2 1 
ATOM   434  C  CD1 . ILE A 1 68  ? 17.955 30.945  -14.127 1.00 66.57  ? 138 ILE A CD1 1 
ATOM   435  N  N   . TRP A 1 69  ? 14.638 35.049  -15.076 1.00 61.01  ? 139 TRP A N   1 
ATOM   436  C  CA  . TRP A 1 69  ? 13.851 36.030  -15.800 1.00 62.62  ? 139 TRP A CA  1 
ATOM   437  C  C   . TRP A 1 69  ? 13.664 37.360  -15.081 1.00 66.62  ? 139 TRP A C   1 
ATOM   438  O  O   . TRP A 1 69  ? 13.839 38.383  -15.734 1.00 66.97  ? 139 TRP A O   1 
ATOM   439  C  CB  . TRP A 1 69  ? 12.512 35.425  -16.226 1.00 63.06  ? 139 TRP A CB  1 
ATOM   440  C  CG  . TRP A 1 69  ? 12.683 34.505  -17.396 1.00 64.75  ? 139 TRP A CG  1 
ATOM   441  C  CD1 . TRP A 1 69  ? 12.878 33.156  -17.357 1.00 66.85  ? 139 TRP A CD1 1 
ATOM   442  C  CD2 . TRP A 1 69  ? 12.828 34.892  -18.766 1.00 66.05  ? 139 TRP A CD2 1 
ATOM   443  N  NE1 . TRP A 1 69  ? 13.075 32.670  -18.628 1.00 67.27  ? 139 TRP A NE1 1 
ATOM   444  C  CE2 . TRP A 1 69  ? 13.051 33.715  -19.513 1.00 70.11  ? 139 TRP A CE2 1 
ATOM   445  C  CE3 . TRP A 1 69  ? 12.757 36.120  -19.443 1.00 68.78  ? 139 TRP A CE3 1 
ATOM   446  C  CZ2 . TRP A 1 69  ? 13.202 33.727  -20.901 1.00 71.05  ? 139 TRP A CZ2 1 
ATOM   447  C  CZ3 . TRP A 1 69  ? 12.913 36.131  -20.819 1.00 71.93  ? 139 TRP A CZ3 1 
ATOM   448  C  CH2 . TRP A 1 69  ? 13.133 34.946  -21.534 1.00 72.73  ? 139 TRP A CH2 1 
ATOM   449  N  N   . THR A 1 70  ? 13.368 37.369  -13.761 1.00 62.55  ? 140 THR A N   1 
ATOM   450  C  CA  . THR A 1 70  ? 13.187 38.622  -13.005 1.00 62.44  ? 140 THR A CA  1 
ATOM   451  C  C   . THR A 1 70  ? 14.385 39.560  -13.143 1.00 66.07  ? 140 THR A C   1 
ATOM   452  O  O   . THR A 1 70  ? 14.203 40.722  -13.511 1.00 66.54  ? 140 THR A O   1 
ATOM   453  C  CB  . THR A 1 70  ? 12.842 38.371  -11.529 1.00 68.81  ? 140 THR A CB  1 
ATOM   454  O  OG1 . THR A 1 70  ? 13.829 37.525  -10.942 1.00 66.08  ? 140 THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 70  ? 11.442 37.801  -11.335 1.00 68.81  ? 140 THR A CG2 1 
ATOM   456  N  N   . HIS A 1 71  ? 15.605 39.045  -12.892 1.00 61.79  ? 141 HIS A N   1 
ATOM   457  C  CA  . HIS A 1 71  ? 16.830 39.837  -12.993 1.00 61.35  ? 141 HIS A CA  1 
ATOM   458  C  C   . HIS A 1 71  ? 17.362 39.955  -14.417 1.00 66.35  ? 141 HIS A C   1 
ATOM   459  O  O   . HIS A 1 71  ? 18.144 40.870  -14.687 1.00 66.06  ? 141 HIS A O   1 
ATOM   460  C  CB  . HIS A 1 71  ? 17.897 39.343  -12.020 1.00 60.74  ? 141 HIS A CB  1 
ATOM   461  C  CG  . HIS A 1 71  ? 17.751 39.966  -10.669 1.00 63.89  ? 141 HIS A CG  1 
ATOM   462  N  ND1 . HIS A 1 71  ? 18.829 40.511  -10.006 1.00 65.13  ? 141 HIS A ND1 1 
ATOM   463  C  CD2 . HIS A 1 71  ? 16.635 40.181  -9.935  1.00 66.13  ? 141 HIS A CD2 1 
ATOM   464  C  CE1 . HIS A 1 71  ? 18.351 40.982  -8.866  1.00 64.52  ? 141 HIS A CE1 1 
ATOM   465  N  NE2 . HIS A 1 71  ? 17.037 40.795  -8.776  1.00 65.47  ? 141 HIS A NE2 1 
ATOM   466  N  N   . LEU A 1 72  ? 16.918 39.069  -15.334 1.00 63.94  ? 142 LEU A N   1 
ATOM   467  C  CA  . LEU A 1 72  ? 17.273 39.138  -16.752 1.00 65.14  ? 142 LEU A CA  1 
ATOM   468  C  C   . LEU A 1 72  ? 16.526 40.345  -17.339 1.00 71.22  ? 142 LEU A C   1 
ATOM   469  O  O   . LEU A 1 72  ? 17.112 41.115  -18.103 1.00 71.64  ? 142 LEU A O   1 
ATOM   470  C  CB  . LEU A 1 72  ? 16.890 37.832  -17.484 1.00 65.68  ? 142 LEU A CB  1 
ATOM   471  C  CG  . LEU A 1 72  ? 17.196 37.725  -18.985 1.00 71.80  ? 142 LEU A CG  1 
ATOM   472  C  CD1 . LEU A 1 72  ? 18.678 37.518  -19.245 1.00 71.25  ? 142 LEU A CD1 1 
ATOM   473  C  CD2 . LEU A 1 72  ? 16.424 36.586  -19.605 1.00 75.03  ? 142 LEU A CD2 1 
ATOM   474  N  N   . LEU A 1 73  ? 15.243 40.510  -16.948 1.00 68.91  ? 143 LEU A N   1 
ATOM   475  C  CA  . LEU A 1 73  ? 14.384 41.627  -17.350 1.00 70.72  ? 143 LEU A CA  1 
ATOM   476  C  C   . LEU A 1 73  ? 14.833 42.927  -16.688 1.00 74.82  ? 143 LEU A C   1 
ATOM   477  O  O   . LEU A 1 73  ? 14.797 43.977  -17.325 1.00 75.83  ? 143 LEU A O   1 
ATOM   478  C  CB  . LEU A 1 73  ? 12.907 41.360  -17.009 1.00 71.74  ? 143 LEU A CB  1 
ATOM   479  C  CG  . LEU A 1 73  ? 12.208 40.178  -17.697 1.00 77.41  ? 143 LEU A CG  1 
ATOM   480  C  CD1 . LEU A 1 73  ? 10.879 39.877  -17.034 1.00 78.34  ? 143 LEU A CD1 1 
ATOM   481  C  CD2 . LEU A 1 73  ? 12.033 40.398  -19.189 1.00 81.81  ? 143 LEU A CD2 1 
ATOM   482  N  N   . GLY A 1 74  ? 15.247 42.842  -15.425 1.00 70.19  ? 144 GLY A N   1 
ATOM   483  C  CA  . GLY A 1 74  ? 15.735 43.980  -14.661 1.00 69.80  ? 144 GLY A CA  1 
ATOM   484  C  C   . GLY A 1 74  ? 17.007 44.548  -15.258 1.00 74.54  ? 144 GLY A C   1 
ATOM   485  O  O   . GLY A 1 74  ? 17.153 45.769  -15.335 1.00 74.77  ? 144 GLY A O   1 
ATOM   486  N  N   . PHE A 1 75  ? 17.919 43.654  -15.714 1.00 71.28  ? 145 PHE A N   1 
ATOM   487  C  CA  . PHE A 1 75  ? 19.188 44.002  -16.352 1.00 71.69  ? 145 PHE A CA  1 
ATOM   488  C  C   . PHE A 1 75  ? 18.997 44.834  -17.615 1.00 78.43  ? 145 PHE A C   1 
ATOM   489  O  O   . PHE A 1 75  ? 19.662 45.859  -17.741 1.00 78.52  ? 145 PHE A O   1 
ATOM   490  C  CB  . PHE A 1 75  ? 20.048 42.746  -16.626 1.00 72.81  ? 145 PHE A CB  1 
ATOM   491  C  CG  . PHE A 1 75  ? 21.116 42.920  -17.680 1.00 75.37  ? 145 PHE A CG  1 
ATOM   492  C  CD1 . PHE A 1 75  ? 22.357 43.440  -17.354 1.00 78.20  ? 145 PHE A CD1 1 
ATOM   493  C  CD2 . PHE A 1 75  ? 20.864 42.584  -19.002 1.00 79.09  ? 145 PHE A CD2 1 
ATOM   494  C  CE1 . PHE A 1 75  ? 23.330 43.625  -18.328 1.00 80.39  ? 145 PHE A CE1 1 
ATOM   495  C  CE2 . PHE A 1 75  ? 21.825 42.784  -19.982 1.00 83.17  ? 145 PHE A CE2 1 
ATOM   496  C  CZ  . PHE A 1 75  ? 23.057 43.294  -19.639 1.00 80.97  ? 145 PHE A CZ  1 
ATOM   497  N  N   . VAL A 1 76  ? 18.136 44.371  -18.560 1.00 76.91  ? 146 VAL A N   1 
ATOM   498  C  CA  . VAL A 1 76  ? 17.868 45.047  -19.838 1.00 79.32  ? 146 VAL A CA  1 
ATOM   499  C  C   . VAL A 1 76  ? 17.326 46.455  -19.608 1.00 84.56  ? 146 VAL A C   1 
ATOM   500  O  O   . VAL A 1 76  ? 17.829 47.408  -20.208 1.00 85.44  ? 146 VAL A O   1 
ATOM   501  C  CB  . VAL A 1 76  ? 16.993 44.220  -20.844 1.00 84.89  ? 146 VAL A CB  1 
ATOM   502  C  CG1 . VAL A 1 76  ? 15.663 43.785  -20.237 1.00 84.57  ? 146 VAL A CG1 1 
ATOM   503  C  CG2 . VAL A 1 76  ? 16.760 44.978  -22.151 1.00 87.51  ? 146 VAL A CG2 1 
ATOM   504  N  N   . LEU A 1 77  ? 16.324 46.589  -18.716 1.00 80.91  ? 147 LEU A N   1 
ATOM   505  C  CA  . LEU A 1 77  ? 15.712 47.878  -18.425 1.00 81.81  ? 147 LEU A CA  1 
ATOM   506  C  C   . LEU A 1 77  ? 16.713 48.837  -17.772 1.00 84.80  ? 147 LEU A C   1 
ATOM   507  O  O   . LEU A 1 77  ? 16.840 49.960  -18.249 1.00 85.76  ? 147 LEU A O   1 
ATOM   508  C  CB  . LEU A 1 77  ? 14.376 47.760  -17.650 1.00 81.97  ? 147 LEU A CB  1 
ATOM   509  C  CG  . LEU A 1 77  ? 14.374 47.544  -16.138 1.00 84.65  ? 147 LEU A CG  1 
ATOM   510  C  CD1 . LEU A 1 77  ? 14.313 48.876  -15.412 1.00 84.85  ? 147 LEU A CD1 1 
ATOM   511  C  CD2 . LEU A 1 77  ? 13.156 46.743  -15.721 1.00 87.29  ? 147 LEU A CD2 1 
ATOM   512  N  N   . PHE A 1 78  ? 17.495 48.370  -16.772 1.00 79.22  ? 148 PHE A N   1 
ATOM   513  C  CA  . PHE A 1 78  ? 18.505 49.218  -16.125 1.00 78.27  ? 148 PHE A CA  1 
ATOM   514  C  C   . PHE A 1 78  ? 19.647 49.566  -17.073 1.00 83.00  ? 148 PHE A C   1 
ATOM   515  O  O   . PHE A 1 78  ? 20.267 50.620  -16.937 1.00 82.86  ? 148 PHE A O   1 
ATOM   516  C  CB  . PHE A 1 78  ? 19.003 48.631  -14.800 1.00 78.05  ? 148 PHE A CB  1 
ATOM   517  C  CG  . PHE A 1 78  ? 18.287 49.240  -13.629 1.00 79.25  ? 148 PHE A CG  1 
ATOM   518  C  CD1 . PHE A 1 78  ? 17.076 48.725  -13.196 1.00 82.41  ? 148 PHE A CD1 1 
ATOM   519  C  CD2 . PHE A 1 78  ? 18.793 50.368  -13.000 1.00 81.26  ? 148 PHE A CD2 1 
ATOM   520  C  CE1 . PHE A 1 78  ? 16.389 49.314  -12.151 1.00 83.31  ? 148 PHE A CE1 1 
ATOM   521  C  CE2 . PHE A 1 78  ? 18.114 50.951  -11.946 1.00 83.91  ? 148 PHE A CE2 1 
ATOM   522  C  CZ  . PHE A 1 78  ? 16.916 50.423  -11.530 1.00 82.14  ? 148 PHE A CZ  1 
ATOM   523  N  N   . LEU A 1 79  ? 19.891 48.682  -18.057 1.00 80.15  ? 149 LEU A N   1 
ATOM   524  C  CA  . LEU A 1 79  ? 20.881 48.856  -19.112 1.00 81.25  ? 149 LEU A CA  1 
ATOM   525  C  C   . LEU A 1 79  ? 20.462 50.019  -20.002 1.00 87.69  ? 149 LEU A C   1 
ATOM   526  O  O   . LEU A 1 79  ? 21.300 50.856  -20.342 1.00 88.15  ? 149 LEU A O   1 
ATOM   527  C  CB  . LEU A 1 79  ? 21.003 47.563  -19.936 1.00 81.56  ? 149 LEU A CB  1 
ATOM   528  C  CG  . LEU A 1 79  ? 21.934 47.574  -21.135 1.00 87.82  ? 149 LEU A CG  1 
ATOM   529  C  CD1 . LEU A 1 79  ? 23.376 47.360  -20.706 1.00 86.93  ? 149 LEU A CD1 1 
ATOM   530  C  CD2 . LEU A 1 79  ? 21.521 46.513  -22.130 1.00 91.17  ? 149 LEU A CD2 1 
ATOM   531  N  N   . PHE A 1 80  ? 19.151 50.082  -20.344 1.00 85.58  ? 150 PHE A N   1 
ATOM   532  C  CA  . PHE A 1 80  ? 18.574 51.143  -21.169 1.00 88.02  ? 150 PHE A CA  1 
ATOM   533  C  C   . PHE A 1 80  ? 18.795 52.484  -20.554 1.00 92.13  ? 150 PHE A C   1 
ATOM   534  O  O   . PHE A 1 80  ? 19.392 53.330  -21.188 1.00 93.21  ? 150 PHE A O   1 
ATOM   535  C  CB  . PHE A 1 80  ? 17.067 50.964  -21.380 1.00 91.00  ? 150 PHE A CB  1 
ATOM   536  C  CG  . PHE A 1 80  ? 16.718 50.276  -22.663 1.00 94.62  ? 150 PHE A CG  1 
ATOM   537  C  CD1 . PHE A 1 80  ? 16.634 50.990  -23.850 1.00 100.72 ? 150 PHE A CD1 1 
ATOM   538  C  CD2 . PHE A 1 80  ? 16.479 48.914  -22.690 1.00 96.01  ? 150 PHE A CD2 1 
ATOM   539  C  CE1 . PHE A 1 80  ? 16.328 50.344  -25.044 1.00 103.83 ? 150 PHE A CE1 1 
ATOM   540  C  CE2 . PHE A 1 80  ? 16.177 48.268  -23.878 1.00 100.88 ? 150 PHE A CE2 1 
ATOM   541  C  CZ  . PHE A 1 80  ? 16.112 48.984  -25.051 1.00 102.03 ? 150 PHE A CZ  1 
ATOM   542  N  N   . LEU A 1 81  ? 18.370 52.648  -19.294 1.00 87.28  ? 151 LEU A N   1 
ATOM   543  C  CA  . LEU A 1 81  ? 18.480 53.871  -18.512 1.00 87.03  ? 151 LEU A CA  1 
ATOM   544  C  C   . LEU A 1 81  ? 19.925 54.327  -18.436 1.00 90.99  ? 151 LEU A C   1 
ATOM   545  O  O   . LEU A 1 81  ? 20.188 55.476  -18.703 1.00 91.76  ? 151 LEU A O   1 
ATOM   546  C  CB  . LEU A 1 81  ? 17.911 53.657  -17.106 1.00 85.24  ? 151 LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 81  ? 16.397 53.584  -16.885 1.00 90.53  ? 151 LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 81  ? 15.694 52.657  -17.876 1.00 91.91  ? 151 LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 81  ? 16.119 53.083  -15.489 1.00 90.77  ? 151 LEU A CD2 1 
ATOM   550  N  N   . GLY A 1 82  ? 20.848 53.415  -18.143 1.00 86.73  ? 152 GLY A N   1 
ATOM   551  C  CA  . GLY A 1 82  ? 22.272 53.718  -18.090 1.00 86.75  ? 152 GLY A CA  1 
ATOM   552  C  C   . GLY A 1 82  ? 22.766 54.349  -19.371 1.00 93.72  ? 152 GLY A C   1 
ATOM   553  O  O   . GLY A 1 82  ? 23.319 55.445  -19.332 1.00 93.90  ? 152 GLY A O   1 
ATOM   554  N  N   . ILE A 1 83  ? 22.507 53.686  -20.518 1.00 92.46  ? 153 ILE A N   1 
ATOM   555  C  CA  . ILE A 1 83  ? 22.896 54.151  -21.857 1.00 95.34  ? 153 ILE A CA  1 
ATOM   556  C  C   . ILE A 1 83  ? 22.075 55.370  -22.298 1.00 102.42 ? 153 ILE A C   1 
ATOM   557  O  O   . ILE A 1 83  ? 22.652 56.336  -22.775 1.00 103.56 ? 153 ILE A O   1 
ATOM   558  C  CB  . ILE A 1 83  ? 22.879 53.013  -22.923 1.00 99.35  ? 153 ILE A CB  1 
ATOM   559  C  CG1 . ILE A 1 83  ? 23.762 51.819  -22.494 1.00 97.80  ? 153 ILE A CG1 1 
ATOM   560  C  CG2 . ILE A 1 83  ? 23.291 53.540  -24.316 1.00 103.29 ? 153 ILE A CG2 1 
ATOM   561  C  CD1 . ILE A 1 83  ? 23.796 50.613  -23.460 1.00 105.46 ? 153 ILE A CD1 1 
ATOM   562  N  N   . LEU A 1 84  ? 20.734 55.305  -22.166 1.00 100.25 ? 154 LEU A N   1 
ATOM   563  C  CA  . LEU A 1 84  ? 19.776 56.365  -22.506 1.00 102.73 ? 154 LEU A CA  1 
ATOM   564  C  C   . LEU A 1 84  ? 20.093 57.618  -21.698 1.00 108.01 ? 154 LEU A C   1 
ATOM   565  O  O   . LEU A 1 84  ? 20.206 58.685  -22.281 1.00 109.63 ? 154 LEU A O   1 
ATOM   566  C  CB  . LEU A 1 84  ? 18.322 55.906  -22.245 1.00 102.57 ? 154 LEU A CB  1 
ATOM   567  C  CG  . LEU A 1 84  ? 17.179 56.851  -22.633 1.00 109.60 ? 154 LEU A CG  1 
ATOM   568  C  CD1 . LEU A 1 84  ? 15.904 56.065  -22.897 1.00 110.45 ? 154 LEU A CD1 1 
ATOM   569  C  CD2 . LEU A 1 84  ? 16.896 57.869  -21.521 1.00 111.16 ? 154 LEU A CD2 1 
ATOM   570  N  N   . THR A 1 85  ? 20.204 57.490  -20.357 1.00 103.64 ? 155 THR A N   1 
ATOM   571  C  CA  . THR A 1 85  ? 20.558 58.583  -19.449 1.00 103.68 ? 155 THR A CA  1 
ATOM   572  C  C   . THR A 1 85  ? 21.972 59.056  -19.792 1.00 110.86 ? 155 THR A C   1 
ATOM   573  O  O   . THR A 1 85  ? 22.169 60.256  -19.852 1.00 111.56 ? 155 THR A O   1 
ATOM   574  C  CB  . THR A 1 85  ? 20.360 58.206  -17.956 1.00 107.70 ? 155 THR A CB  1 
ATOM   575  O  OG1 . THR A 1 85  ? 19.023 57.736  -17.758 1.00 106.50 ? 155 THR A OG1 1 
ATOM   576  C  CG2 . THR A 1 85  ? 20.636 59.374  -17.009 1.00 105.24 ? 155 THR A CG2 1 
ATOM   577  N  N   . MET A 1 86  ? 22.928 58.120  -20.076 1.00 109.21 ? 156 MET A N   1 
ATOM   578  C  CA  . MET A 1 86  ? 24.321 58.433  -20.459 1.00 111.15 ? 156 MET A CA  1 
ATOM   579  C  C   . MET A 1 86  ? 24.402 59.198  -21.741 1.00 121.66 ? 156 MET A C   1 
ATOM   580  O  O   . MET A 1 86  ? 25.236 60.086  -21.864 1.00 122.54 ? 156 MET A O   1 
ATOM   581  C  CB  . MET A 1 86  ? 25.206 57.186  -20.548 1.00 112.54 ? 156 MET A CB  1 
ATOM   582  C  CG  . MET A 1 86  ? 26.691 57.440  -20.280 1.00 116.24 ? 156 MET A CG  1 
ATOM   583  S  SD  . MET A 1 86  ? 27.178 58.112  -18.655 1.00 118.29 ? 156 MET A SD  1 
ATOM   584  C  CE  . MET A 1 86  ? 25.901 57.419  -17.554 1.00 112.38 ? 156 MET A CE  1 
ATOM   585  N  N   . LEU A 1 87  ? 23.528 58.898  -22.683 1.00 122.59 ? 157 LEU A N   1 
ATOM   586  C  CA  . LEU A 1 87  ? 23.500 59.692  -23.873 1.00 127.09 ? 157 LEU A CA  1 
ATOM   587  C  C   . LEU A 1 87  ? 22.382 60.642  -23.507 1.00 135.57 ? 157 LEU A C   1 
ATOM   588  O  O   . LEU A 1 87  ? 21.295 60.421  -23.975 1.00 136.00 ? 157 LEU A O   1 
ATOM   589  C  CB  . LEU A 1 87  ? 23.120 58.839  -25.111 1.00 128.92 ? 157 LEU A CB  1 
ATOM   590  C  CG  . LEU A 1 87  ? 24.061 57.724  -25.561 1.00 133.27 ? 157 LEU A CG  1 
ATOM   591  C  CD1 . LEU A 1 87  ? 23.472 56.986  -26.743 1.00 135.44 ? 157 LEU A CD1 1 
ATOM   592  C  CD2 . LEU A 1 87  ? 25.434 58.259  -25.914 1.00 137.02 ? 157 LEU A CD2 1 
ATOM   593  N  N   . ARG A 1 88  ? 22.587 61.617  -22.586 1.00 134.92 ? 158 ARG A N   1 
ATOM   594  C  CA  . ARG A 1 88  ? 21.489 62.544  -22.269 1.00 137.13 ? 158 ARG A CA  1 
ATOM   595  C  C   . ARG A 1 88  ? 21.458 63.531  -23.434 1.00 149.86 ? 158 ARG A C   1 
ATOM   596  O  O   . ARG A 1 88  ? 22.542 63.872  -23.926 1.00 150.51 ? 158 ARG A O   1 
ATOM   597  C  CB  . ARG A 1 88  ? 21.651 63.235  -20.894 1.00 134.52 ? 158 ARG A CB  1 
ATOM   598  C  CG  . ARG A 1 88  ? 20.350 63.780  -20.252 1.00 142.24 ? 158 ARG A CG  1 
ATOM   599  C  CD  . ARG A 1 88  ? 19.189 62.783  -20.188 1.00 148.46 ? 158 ARG A CD  1 
ATOM   600  N  NE  . ARG A 1 88  ? 18.061 63.235  -19.365 1.00 154.41 ? 158 ARG A NE  1 
ATOM   601  C  CZ  . ARG A 1 88  ? 17.118 64.091  -19.757 1.00 169.71 ? 158 ARG A CZ  1 
ATOM   602  N  NH1 . ARG A 1 88  ? 17.177 64.654  -20.959 1.00 159.52 ? 158 ARG A NH1 1 
ATOM   603  N  NH2 . ARG A 1 88  ? 16.128 64.417  -18.938 1.00 155.71 ? 158 ARG A NH2 1 
ATOM   604  N  N   . PRO A 1 89  ? 20.277 63.866  -24.027 0.00 153.05 ? 159 PRO A N   1 
ATOM   605  C  CA  . PRO A 1 89  ? 20.311 64.767  -25.189 0.00 158.50 ? 159 PRO A CA  1 
ATOM   606  C  C   . PRO A 1 89  ? 20.608 66.162  -24.684 0.00 168.74 ? 159 PRO A C   1 
ATOM   607  O  O   . PRO A 1 89  ? 21.499 66.852  -25.176 0.00 169.89 ? 159 PRO A O   1 
ATOM   608  C  CB  . PRO A 1 89  ? 18.903 64.644  -25.769 0.00 161.78 ? 159 PRO A CB  1 
ATOM   609  C  CG  . PRO A 1 89  ? 18.034 64.377  -24.588 0.00 162.90 ? 159 PRO A CG  1 
ATOM   610  C  CD  . PRO A 1 89  ? 18.880 63.596  -23.608 0.00 154.47 ? 159 PRO A CD  1 
ATOM   611  N  N   . ASN A 1 90  ? 19.928 66.492  -23.592 0.00 168.45 ? 160 ASN A N   1 
ATOM   612  C  CA  . ASN A 1 90  ? 20.054 67.711  -22.856 0.00 170.46 ? 160 ASN A CA  1 
ATOM   613  C  C   . ASN A 1 90  ? 21.241 67.576  -21.916 0.00 174.87 ? 160 ASN A C   1 
ATOM   614  O  O   . ASN A 1 90  ? 21.102 67.378  -20.701 0.00 171.81 ? 160 ASN A O   1 
ATOM   615  C  CB  . ASN A 1 90  ? 18.748 68.027  -22.142 0.00 177.68 ? 160 ASN A CB  1 
ATOM   616  C  CG  . ASN A 1 90  ? 17.700 68.661  -23.016 0.00 231.63 ? 160 ASN A CG  1 
ATOM   617  O  OD1 . ASN A 1 90  ? 17.986 69.526  -23.849 0.00 233.21 ? 160 ASN A OD1 1 
ATOM   618  N  ND2 . ASN A 1 90  ? 16.448 68.278  -22.813 0.00 230.18 ? 160 ASN A ND2 1 
ATOM   619  N  N   . MET A 1 91  ? 22.436 67.619  -22.533 1.00 175.48 ? 161 MET A N   1 
ATOM   620  C  CA  . MET A 1 91  ? 23.717 67.646  -21.851 1.00 175.27 ? 161 MET A CA  1 
ATOM   621  C  C   . MET A 1 91  ? 23.676 69.048  -21.235 1.00 184.35 ? 161 MET A C   1 
ATOM   622  O  O   . MET A 1 91  ? 24.072 69.235  -20.097 1.00 181.67 ? 161 MET A O   1 
ATOM   623  C  CB  . MET A 1 91  ? 24.879 67.479  -22.854 1.00 179.33 ? 161 MET A CB  1 
ATOM   624  C  CG  . MET A 1 91  ? 26.105 66.821  -22.253 1.00 180.85 ? 161 MET A CG  1 
ATOM   625  S  SD  . MET A 1 91  ? 27.328 66.277  -23.463 1.00 187.13 ? 161 MET A SD  1 
ATOM   626  C  CE  . MET A 1 91  ? 28.770 66.102  -22.415 1.00 181.95 ? 161 MET A CE  1 
ATOM   627  N  N   . TYR A 1 92  ? 23.044 69.995  -21.951 1.00 183.85 ? 162 TYR A N   1 
ATOM   628  C  CA  . TYR A 1 92  ? 22.784 71.367  -21.523 1.00 185.98 ? 162 TYR A CA  1 
ATOM   629  C  C   . TYR A 1 92  ? 21.894 71.377  -20.255 1.00 183.11 ? 162 TYR A C   1 
ATOM   630  O  O   . TYR A 1 92  ? 22.095 72.231  -19.388 1.00 183.54 ? 162 TYR A O   1 
ATOM   631  C  CB  . TYR A 1 92  ? 22.121 72.162  -22.665 1.00 194.64 ? 162 TYR A CB  1 
ATOM   632  C  CG  . TYR A 1 92  ? 22.987 72.344  -23.896 0.00 199.53 ? 162 TYR A CG  1 
ATOM   633  C  CD1 . TYR A 1 92  ? 23.888 73.401  -23.988 0.00 201.60 ? 162 TYR A CD1 1 
ATOM   634  C  CD2 . TYR A 1 92  ? 22.877 71.483  -24.985 0.00 202.79 ? 162 TYR A CD2 1 
ATOM   635  C  CE1 . TYR A 1 92  ? 24.678 73.583  -25.121 0.00 207.85 ? 162 TYR A CE1 1 
ATOM   636  C  CE2 . TYR A 1 92  ? 23.658 71.657  -26.126 0.00 203.75 ? 162 TYR A CE2 1 
ATOM   637  C  CZ  . TYR A 1 92  ? 24.556 72.710  -26.189 0.00 212.42 ? 162 TYR A CZ  1 
ATOM   638  O  OH  . TYR A 1 92  ? 25.327 72.890  -27.308 0.00 218.67 ? 162 TYR A OH  1 
ATOM   639  N  N   . PHE A 1 93  ? 20.951 70.399  -20.133 1.00 174.82 ? 163 PHE A N   1 
ATOM   640  C  CA  . PHE A 1 93  ? 20.063 70.215  -18.968 1.00 170.09 ? 163 PHE A CA  1 
ATOM   641  C  C   . PHE A 1 93  ? 20.869 69.770  -17.739 1.00 165.40 ? 163 PHE A C   1 
ATOM   642  O  O   . PHE A 1 93  ? 20.433 69.979  -16.605 1.00 163.12 ? 163 PHE A O   1 
ATOM   643  C  CB  . PHE A 1 93  ? 18.932 69.214  -19.289 1.00 171.51 ? 163 PHE A CB  1 
ATOM   644  C  CG  . PHE A 1 93  ? 18.102 68.675  -18.148 0.00 170.26 ? 163 PHE A CG  1 
ATOM   645  C  CD1 . PHE A 1 93  ? 16.953 69.334  -17.733 0.00 173.70 ? 163 PHE A CD1 1 
ATOM   646  C  CD2 . PHE A 1 93  ? 18.440 67.479  -17.525 0.00 169.50 ? 163 PHE A CD2 1 
ATOM   647  C  CE1 . PHE A 1 93  ? 16.179 68.829  -16.686 0.00 172.75 ? 163 PHE A CE1 1 
ATOM   648  C  CE2 . PHE A 1 93  ? 17.671 66.979  -16.473 0.00 170.45 ? 163 PHE A CE2 1 
ATOM   649  C  CZ  . PHE A 1 93  ? 16.543 67.655  -16.063 0.00 169.32 ? 163 PHE A CZ  1 
ATOM   650  N  N   . MET A 1 94  ? 22.027 69.133  -17.970 1.00 157.45 ? 164 MET A N   1 
ATOM   651  C  CA  . MET A 1 94  ? 22.916 68.680  -16.906 1.00 153.05 ? 164 MET A CA  1 
ATOM   652  C  C   . MET A 1 94  ? 23.964 69.758  -16.645 1.00 153.50 ? 164 MET A C   1 
ATOM   653  O  O   . MET A 1 94  ? 24.545 70.301  -17.583 1.00 155.26 ? 164 MET A O   1 
ATOM   654  C  CB  . MET A 1 94  ? 23.603 67.353  -17.281 1.00 154.50 ? 164 MET A CB  1 
ATOM   655  C  CG  . MET A 1 94  ? 22.647 66.213  -17.547 1.00 157.35 ? 164 MET A CG  1 
ATOM   656  S  SD  . MET A 1 94  ? 22.565 65.047  -16.171 1.00 158.09 ? 164 MET A SD  1 
ATOM   657  C  CE  . MET A 1 94  ? 21.106 64.157  -16.604 1.00 154.76 ? 164 MET A CE  1 
ATOM   658  N  N   . ALA A 1 95  ? 24.164 70.114  -15.380 1.00 145.26 ? 165 ALA A N   1 
ATOM   659  C  CA  . ALA A 1 95  ? 25.172 71.104  -15.014 1.00 144.14 ? 165 ALA A CA  1 
ATOM   660  C  C   . ALA A 1 95  ? 26.031 70.492  -13.923 1.00 142.42 ? 165 ALA A C   1 
ATOM   661  O  O   . ALA A 1 95  ? 25.492 70.173  -12.880 1.00 140.22 ? 165 ALA A O   1 
ATOM   662  C  CB  . ALA A 1 95  ? 24.509 72.374  -14.517 1.00 145.35 ? 165 ALA A CB  1 
ATOM   663  N  N   . PRO A 1 96  ? 27.322 70.196  -14.138 1.00 136.46 ? 166 PRO A N   1 
ATOM   664  C  CA  . PRO A 1 96  ? 28.169 70.585  -15.261 1.00 137.48 ? 166 PRO A CA  1 
ATOM   665  C  C   . PRO A 1 96  ? 28.644 69.476  -16.200 1.00 138.17 ? 166 PRO A C   1 
ATOM   666  O  O   . PRO A 1 96  ? 29.691 69.641  -16.835 1.00 139.53 ? 166 PRO A O   1 
ATOM   667  C  CB  . PRO A 1 96  ? 29.374 71.152  -14.525 1.00 139.64 ? 166 PRO A CB  1 
ATOM   668  C  CG  . PRO A 1 96  ? 29.499 70.302  -13.267 1.00 141.95 ? 166 PRO A CG  1 
ATOM   669  C  CD  . PRO A 1 96  ? 28.160 69.628  -13.065 1.00 136.01 ? 166 PRO A CD  1 
ATOM   670  N  N   . LEU A 1 97  ? 27.900 68.354  -16.293 1.00 130.42 ? 167 LEU A N   1 
ATOM   671  C  CA  . LEU A 1 97  ? 28.216 67.164  -17.119 1.00 129.05 ? 167 LEU A CA  1 
ATOM   672  C  C   . LEU A 1 97  ? 29.225 66.246  -16.416 1.00 128.02 ? 167 LEU A C   1 
ATOM   673  O  O   . LEU A 1 97  ? 29.486 65.130  -16.870 1.00 127.14 ? 167 LEU A O   1 
ATOM   674  C  CB  . LEU A 1 97  ? 28.636 67.494  -18.580 1.00 132.10 ? 167 LEU A CB  1 
ATOM   675  C  CG  . LEU A 1 97  ? 27.864 68.656  -19.202 1.00 138.77 ? 167 LEU A CG  1 
ATOM   676  C  CD1 . LEU A 1 97  ? 28.496 69.166  -20.471 1.00 142.25 ? 167 LEU A CD1 1 
ATOM   677  C  CD2 . LEU A 1 97  ? 26.442 68.320  -19.344 1.00 140.51 ? 167 LEU A CD2 1 
ATOM   678  N  N   . GLN A 1 98  ? 29.749 66.724  -15.276 1.00 121.19 ? 168 GLN A N   1 
ATOM   679  C  CA  . GLN A 1 98  ? 30.648 66.021  -14.368 1.00 118.43 ? 168 GLN A CA  1 
ATOM   680  C  C   . GLN A 1 98  ? 29.783 64.969  -13.663 1.00 116.40 ? 168 GLN A C   1 
ATOM   681  O  O   . GLN A 1 98  ? 30.250 63.874  -13.352 1.00 114.84 ? 168 GLN A O   1 
ATOM   682  C  CB  . GLN A 1 98  ? 31.198 67.030  -13.347 1.00 119.88 ? 168 GLN A CB  1 
ATOM   683  C  CG  . GLN A 1 98  ? 32.253 66.467  -12.399 1.00 134.95 ? 168 GLN A CG  1 
ATOM   684  C  CD  . GLN A 1 98  ? 32.877 67.484  -11.470 1.00 156.04 ? 168 GLN A CD  1 
ATOM   685  O  OE1 . GLN A 1 98  ? 32.594 68.693  -11.540 1.00 153.07 ? 168 GLN A OE1 1 
ATOM   686  N  NE2 . GLN A 1 98  ? 33.759 67.011  -10.589 1.00 147.85 ? 168 GLN A NE2 1 
ATOM   687  N  N   . GLU A 1 99  ? 28.499 65.330  -13.460 1.00 109.61 ? 169 GLU A N   1 
ATOM   688  C  CA  . GLU A 1 99  ? 27.402 64.585  -12.838 1.00 106.14 ? 169 GLU A CA  1 
ATOM   689  C  C   . GLU A 1 99  ? 27.121 63.219  -13.485 1.00 106.18 ? 169 GLU A C   1 
ATOM   690  O  O   . GLU A 1 99  ? 26.563 62.344  -12.815 1.00 103.91 ? 169 GLU A O   1 
ATOM   691  C  CB  . GLU A 1 99  ? 26.114 65.427  -12.847 1.00 107.80 ? 169 GLU A CB  1 
ATOM   692  C  CG  . GLU A 1 99  ? 26.232 66.768  -12.151 1.00 118.51 ? 169 GLU A CG  1 
ATOM   693  C  CD  . GLU A 1 99  ? 24.925 67.409  -11.695 1.00 137.25 ? 169 GLU A CD  1 
ATOM   694  O  OE1 . GLU A 1 99  ? 23.981 66.704  -11.280 1.00 130.19 ? 169 GLU A OE1 1 
ATOM   695  O  OE2 . GLU A 1 99  ? 24.868 68.656  -11.714 1.00 131.35 ? 169 GLU A OE2 1 
ATOM   696  N  N   . LYS A 1 100 ? 27.483 63.044  -14.769 1.00 101.85 ? 170 LYS A N   1 
ATOM   697  C  CA  . LYS A 1 100 ? 27.265 61.793  -15.496 1.00 100.17 ? 170 LYS A CA  1 
ATOM   698  C  C   . LYS A 1 100 ? 28.002 60.618  -14.876 1.00 99.90  ? 170 LYS A C   1 
ATOM   699  O  O   . LYS A 1 100 ? 27.457 59.518  -14.848 1.00 98.19  ? 170 LYS A O   1 
ATOM   700  C  CB  . LYS A 1 100 ? 27.597 61.940  -16.979 1.00 104.89 ? 170 LYS A CB  1 
ATOM   701  C  CG  . LYS A 1 100 ? 26.431 62.475  -17.767 1.00 118.30 ? 170 LYS A CG  1 
ATOM   702  C  CD  . LYS A 1 100 ? 26.712 62.447  -19.244 1.00 129.49 ? 170 LYS A CD  1 
ATOM   703  C  CE  . LYS A 1 100 ? 25.404 62.510  -19.976 1.00 140.23 ? 170 LYS A CE  1 
ATOM   704  N  NZ  . LYS A 1 100 ? 24.496 61.428  -19.540 1.00 146.91 ? 170 LYS A NZ  1 
ATOM   705  N  N   . VAL A 1 101 ? 29.231 60.859  -14.369 1.00 94.73  ? 171 VAL A N   1 
ATOM   706  C  CA  . VAL A 1 101 ? 30.063 59.846  -13.706 1.00 92.49  ? 171 VAL A CA  1 
ATOM   707  C  C   . VAL A 1 101 ? 29.293 59.303  -12.505 1.00 91.88  ? 171 VAL A C   1 
ATOM   708  O  O   . VAL A 1 101 ? 29.190 58.092  -12.339 1.00 90.32  ? 171 VAL A O   1 
ATOM   709  C  CB  . VAL A 1 101 ? 31.452 60.401  -13.266 1.00 97.45  ? 171 VAL A CB  1 
ATOM   710  C  CG1 . VAL A 1 101 ? 32.242 59.362  -12.478 1.00 96.31  ? 171 VAL A CG1 1 
ATOM   711  C  CG2 . VAL A 1 101 ? 32.260 60.870  -14.466 1.00 99.70  ? 171 VAL A CG2 1 
ATOM   712  N  N   . VAL A 1 102 ? 28.717 60.212  -11.704 1.00 86.32  ? 172 VAL A N   1 
ATOM   713  C  CA  . VAL A 1 102 ? 27.933 59.912  -10.505 1.00 83.63  ? 172 VAL A CA  1 
ATOM   714  C  C   . VAL A 1 102 ? 26.762 58.970  -10.839 1.00 84.88  ? 172 VAL A C   1 
ATOM   715  O  O   . VAL A 1 102 ? 26.585 57.950  -10.174 1.00 83.13  ? 172 VAL A O   1 
ATOM   716  C  CB  . VAL A 1 102 ? 27.494 61.233  -9.814  1.00 87.64  ? 172 VAL A CB  1 
ATOM   717  C  CG1 . VAL A 1 102 ? 26.460 61.007  -8.738  1.00 86.08  ? 172 VAL A CG1 1 
ATOM   718  C  CG2 . VAL A 1 102 ? 28.697 61.971  -9.249  1.00 88.18  ? 172 VAL A CG2 1 
ATOM   719  N  N   . PHE A 1 103 ? 26.003 59.291  -11.897 1.00 81.24  ? 173 PHE A N   1 
ATOM   720  C  CA  . PHE A 1 103 ? 24.887 58.460  -12.358 1.00 80.01  ? 173 PHE A CA  1 
ATOM   721  C  C   . PHE A 1 103 ? 25.367 57.131  -12.939 1.00 82.39  ? 173 PHE A C   1 
ATOM   722  O  O   . PHE A 1 103 ? 24.765 56.094  -12.672 1.00 80.75  ? 173 PHE A O   1 
ATOM   723  C  CB  . PHE A 1 103 ? 23.992 59.216  -13.351 1.00 83.24  ? 173 PHE A CB  1 
ATOM   724  C  CG  . PHE A 1 103 ? 22.820 59.890  -12.688 1.00 84.57  ? 173 PHE A CG  1 
ATOM   725  C  CD1 . PHE A 1 103 ? 22.945 61.162  -12.148 1.00 88.12  ? 173 PHE A CD1 1 
ATOM   726  C  CD2 . PHE A 1 103 ? 21.594 59.247  -12.586 1.00 86.17  ? 173 PHE A CD2 1 
ATOM   727  C  CE1 . PHE A 1 103 ? 21.870 61.780  -11.533 1.00 88.95  ? 173 PHE A CE1 1 
ATOM   728  C  CE2 . PHE A 1 103 ? 20.519 59.864  -11.966 1.00 89.09  ? 173 PHE A CE2 1 
ATOM   729  C  CZ  . PHE A 1 103 ? 20.660 61.128  -11.442 1.00 87.60  ? 173 PHE A CZ  1 
ATOM   730  N  N   . GLY A 1 104 ? 26.465 57.185  -13.690 1.00 79.26  ? 174 GLY A N   1 
ATOM   731  C  CA  . GLY A 1 104 ? 27.104 56.030  -14.316 1.00 78.57  ? 174 GLY A CA  1 
ATOM   732  C  C   . GLY A 1 104 ? 27.533 54.951  -13.350 1.00 79.53  ? 174 GLY A C   1 
ATOM   733  O  O   . GLY A 1 104 ? 27.272 53.772  -13.606 1.00 78.49  ? 174 GLY A O   1 
ATOM   734  N  N   . MET A 1 105 ? 28.173 55.342  -12.224 1.00 74.51  ? 175 MET A N   1 
ATOM   735  C  CA  . MET A 1 105 ? 28.643 54.441  -11.167 1.00 72.57  ? 175 MET A CA  1 
ATOM   736  C  C   . MET A 1 105 ? 27.460 53.652  -10.647 1.00 73.35  ? 175 MET A C   1 
ATOM   737  O  O   . MET A 1 105 ? 27.570 52.443  -10.465 1.00 72.03  ? 175 MET A O   1 
ATOM   738  C  CB  . MET A 1 105 ? 29.276 55.231  -10.014 1.00 75.12  ? 175 MET A CB  1 
ATOM   739  C  CG  . MET A 1 105 ? 30.414 56.110  -10.447 1.00 80.60  ? 175 MET A CG  1 
ATOM   740  S  SD  . MET A 1 105 ? 32.031 55.461  -10.002 1.00 85.59  ? 175 MET A SD  1 
ATOM   741  C  CE  . MET A 1 105 ? 32.278 56.276  -8.467  1.00 82.21  ? 175 MET A CE  1 
ATOM   742  N  N   . PHE A 1 106 ? 26.319 54.340  -10.433 1.00 68.67  ? 176 PHE A N   1 
ATOM   743  C  CA  . PHE A 1 106 ? 25.087 53.719  -9.976  1.00 66.93  ? 176 PHE A CA  1 
ATOM   744  C  C   . PHE A 1 106 ? 24.632 52.660  -10.959 1.00 69.85  ? 176 PHE A C   1 
ATOM   745  O  O   . PHE A 1 106 ? 24.300 51.549  -10.548 1.00 68.34  ? 176 PHE A O   1 
ATOM   746  C  CB  . PHE A 1 106 ? 23.975 54.767  -9.763  1.00 68.96  ? 176 PHE A CB  1 
ATOM   747  C  CG  . PHE A 1 106 ? 22.610 54.158  -9.561  1.00 69.84  ? 176 PHE A CG  1 
ATOM   748  C  CD1 . PHE A 1 106 ? 22.299 53.492  -8.387  1.00 71.78  ? 176 PHE A CD1 1 
ATOM   749  C  CD2 . PHE A 1 106 ? 21.660 54.197  -10.572 1.00 72.64  ? 176 PHE A CD2 1 
ATOM   750  C  CE1 . PHE A 1 106 ? 21.063 52.893  -8.214  1.00 72.37  ? 176 PHE A CE1 1 
ATOM   751  C  CE2 . PHE A 1 106 ? 20.422 53.597  -10.403 1.00 75.17  ? 176 PHE A CE2 1 
ATOM   752  C  CZ  . PHE A 1 106 ? 20.127 52.951  -9.222  1.00 72.22  ? 176 PHE A CZ  1 
ATOM   753  N  N   . PHE A 1 107 ? 24.599 53.012  -12.257 1.00 67.12  ? 177 PHE A N   1 
ATOM   754  C  CA  . PHE A 1 107 ? 24.156 52.107  -13.319 1.00 66.96  ? 177 PHE A CA  1 
ATOM   755  C  C   . PHE A 1 107 ? 25.022 50.880  -13.473 1.00 69.66  ? 177 PHE A C   1 
ATOM   756  O  O   . PHE A 1 107 ? 24.484 49.798  -13.681 1.00 68.66  ? 177 PHE A O   1 
ATOM   757  C  CB  . PHE A 1 107 ? 23.958 52.833  -14.647 1.00 70.56  ? 177 PHE A CB  1 
ATOM   758  C  CG  . PHE A 1 107 ? 22.675 53.609  -14.647 1.00 72.70  ? 177 PHE A CG  1 
ATOM   759  C  CD1 . PHE A 1 107 ? 21.454 52.959  -14.729 1.00 75.59  ? 177 PHE A CD1 1 
ATOM   760  C  CD2 . PHE A 1 107 ? 22.686 54.988  -14.524 1.00 75.67  ? 177 PHE A CD2 1 
ATOM   761  C  CE1 . PHE A 1 107 ? 20.272 53.673  -14.698 1.00 77.28  ? 177 PHE A CE1 1 
ATOM   762  C  CE2 . PHE A 1 107 ? 21.504 55.705  -14.497 1.00 79.15  ? 177 PHE A CE2 1 
ATOM   763  C  CZ  . PHE A 1 107 ? 20.300 55.045  -14.593 1.00 77.19  ? 177 PHE A CZ  1 
ATOM   764  N  N   . LEU A 1 108 ? 26.356 51.030  -13.330 1.00 66.00  ? 178 LEU A N   1 
ATOM   765  C  CA  . LEU A 1 108 ? 27.270 49.894  -13.402 1.00 65.24  ? 178 LEU A CA  1 
ATOM   766  C  C   . LEU A 1 108 ? 26.927 48.908  -12.309 1.00 66.97  ? 178 LEU A C   1 
ATOM   767  O  O   . LEU A 1 108 ? 26.775 47.736  -12.604 1.00 66.21  ? 178 LEU A O   1 
ATOM   768  C  CB  . LEU A 1 108 ? 28.734 50.330  -13.284 1.00 66.13  ? 178 LEU A CB  1 
ATOM   769  C  CG  . LEU A 1 108 ? 29.394 50.834  -14.545 1.00 72.77  ? 178 LEU A CG  1 
ATOM   770  C  CD1 . LEU A 1 108 ? 30.759 51.380  -14.222 1.00 73.90  ? 178 LEU A CD1 1 
ATOM   771  C  CD2 . LEU A 1 108 ? 29.505 49.717  -15.594 1.00 75.89  ? 178 LEU A CD2 1 
ATOM   772  N  N   . GLY A 1 109 ? 26.796 49.404  -11.082 1.00 62.28  ? 179 GLY A N   1 
ATOM   773  C  CA  . GLY A 1 109 ? 26.455 48.609  -9.909  1.00 60.69  ? 179 GLY A CA  1 
ATOM   774  C  C   . GLY A 1 109 ? 25.152 47.871  -10.089 1.00 63.31  ? 179 GLY A C   1 
ATOM   775  O  O   . GLY A 1 109 ? 25.105 46.662  -9.868  1.00 62.15  ? 179 GLY A O   1 
ATOM   776  N  N   . ALA A 1 110 ? 24.091 48.590  -10.511 1.00 59.92  ? 180 ALA A N   1 
ATOM   777  C  CA  . ALA A 1 110 ? 22.780 47.993  -10.752 1.00 59.40  ? 180 ALA A CA  1 
ATOM   778  C  C   . ALA A 1 110 ? 22.875 46.942  -11.855 1.00 63.22  ? 180 ALA A C   1 
ATOM   779  O  O   . ALA A 1 110 ? 22.489 45.802  -11.629 1.00 61.98  ? 180 ALA A O   1 
ATOM   780  C  CB  . ALA A 1 110 ? 21.752 49.062  -11.103 1.00 60.97  ? 180 ALA A CB  1 
ATOM   781  N  N   . VAL A 1 111 ? 23.467 47.303  -13.006 1.00 60.79  ? 181 VAL A N   1 
ATOM   782  C  CA  . VAL A 1 111 ? 23.634 46.423  -14.166 1.00 60.96  ? 181 VAL A CA  1 
ATOM   783  C  C   . VAL A 1 111 ? 24.475 45.174  -13.831 1.00 63.83  ? 181 VAL A C   1 
ATOM   784  O  O   . VAL A 1 111 ? 24.062 44.068  -14.179 1.00 63.10  ? 181 VAL A O   1 
ATOM   785  C  CB  . VAL A 1 111 ? 24.155 47.219  -15.400 1.00 66.49  ? 181 VAL A CB  1 
ATOM   786  C  CG1 . VAL A 1 111 ? 24.999 46.380  -16.359 1.00 66.92  ? 181 VAL A CG1 1 
ATOM   787  C  CG2 . VAL A 1 111 ? 22.990 47.854  -16.134 1.00 67.45  ? 181 VAL A CG2 1 
ATOM   788  N  N   . LEU A 1 112 ? 25.638 45.357  -13.172 1.00 60.01  ? 182 LEU A N   1 
ATOM   789  C  CA  . LEU A 1 112 ? 26.529 44.259  -12.790 1.00 59.09  ? 182 LEU A CA  1 
ATOM   790  C  C   . LEU A 1 112 ? 25.859 43.326  -11.806 1.00 61.64  ? 182 LEU A C   1 
ATOM   791  O  O   . LEU A 1 112 ? 25.892 42.122  -12.013 1.00 60.63  ? 182 LEU A O   1 
ATOM   792  C  CB  . LEU A 1 112 ? 27.885 44.748  -12.260 1.00 59.47  ? 182 LEU A CB  1 
ATOM   793  C  CG  . LEU A 1 112 ? 28.793 45.413  -13.286 1.00 65.53  ? 182 LEU A CG  1 
ATOM   794  C  CD1 . LEU A 1 112 ? 30.032 45.961  -12.622 1.00 66.30  ? 182 LEU A CD1 1 
ATOM   795  C  CD2 . LEU A 1 112 ? 29.160 44.450  -14.417 1.00 68.24  ? 182 LEU A CD2 1 
ATOM   796  N  N   . CYS A 1 113 ? 25.214 43.890  -10.766 1.00 58.07  ? 183 CYS A N   1 
ATOM   797  C  CA  . CYS A 1 113 ? 24.468 43.126  -9.753  1.00 57.07  ? 183 CYS A CA  1 
ATOM   798  C  C   . CYS A 1 113 ? 23.404 42.294  -10.443 1.00 60.64  ? 183 CYS A C   1 
ATOM   799  O  O   . CYS A 1 113 ? 23.265 41.115  -10.138 1.00 59.68  ? 183 CYS A O   1 
ATOM   800  C  CB  . CYS A 1 113 ? 23.860 44.066  -8.718  1.00 57.39  ? 183 CYS A CB  1 
ATOM   801  S  SG  . CYS A 1 113 ? 22.756 43.264  -7.512  1.00 60.69  ? 183 CYS A SG  1 
ATOM   802  N  N   . LEU A 1 114 ? 22.632 42.923  -11.351 1.00 57.89  ? 184 LEU A N   1 
ATOM   803  C  CA  . LEU A 1 114 ? 21.557 42.275  -12.099 1.00 57.98  ? 184 LEU A CA  1 
ATOM   804  C  C   . LEU A 1 114 ? 22.069 41.193  -13.047 1.00 61.84  ? 184 LEU A C   1 
ATOM   805  O  O   . LEU A 1 114 ? 21.483 40.115  -13.102 1.00 61.06  ? 184 LEU A O   1 
ATOM   806  C  CB  . LEU A 1 114 ? 20.671 43.303  -12.828 1.00 59.17  ? 184 LEU A CB  1 
ATOM   807  C  CG  . LEU A 1 114 ? 19.917 44.286  -11.920 1.00 63.88  ? 184 LEU A CG  1 
ATOM   808  C  CD1 . LEU A 1 114 ? 19.623 45.579  -12.644 1.00 65.25  ? 184 LEU A CD1 1 
ATOM   809  C  CD2 . LEU A 1 114 ? 18.632 43.685  -11.385 1.00 66.16  ? 184 LEU A CD2 1 
ATOM   810  N  N   . SER A 1 115 ? 23.160 41.480  -13.788 1.00 58.90  ? 185 SER A N   1 
ATOM   811  C  CA  . SER A 1 115 ? 23.776 40.530  -14.710 1.00 58.93  ? 185 SER A CA  1 
ATOM   812  C  C   . SER A 1 115 ? 24.345 39.323  -13.965 1.00 61.25  ? 185 SER A C   1 
ATOM   813  O  O   . SER A 1 115 ? 24.137 38.196  -14.405 1.00 60.77  ? 185 SER A O   1 
ATOM   814  C  CB  . SER A 1 115 ? 24.836 41.193  -15.576 1.00 63.97  ? 185 SER A CB  1 
ATOM   815  O  OG  . SER A 1 115 ? 25.932 41.655  -14.797 1.00 73.59  ? 185 SER A OG  1 
ATOM   816  N  N   . PHE A 1 116 ? 25.033 39.556  -12.824 1.00 56.75  ? 186 PHE A N   1 
ATOM   817  C  CA  . PHE A 1 116 ? 25.618 38.483  -12.010 1.00 55.60  ? 186 PHE A CA  1 
ATOM   818  C  C   . PHE A 1 116 ? 24.548 37.567  -11.453 1.00 58.36  ? 186 PHE A C   1 
ATOM   819  O  O   . PHE A 1 116 ? 24.732 36.350  -11.414 1.00 57.52  ? 186 PHE A O   1 
ATOM   820  C  CB  . PHE A 1 116 ? 26.462 39.037  -10.848 1.00 57.22  ? 186 PHE A CB  1 
ATOM   821  C  CG  . PHE A 1 116 ? 27.701 39.797  -11.241 1.00 59.62  ? 186 PHE A CG  1 
ATOM   822  C  CD1 . PHE A 1 116 ? 28.336 39.540  -12.450 1.00 63.55  ? 186 PHE A CD1 1 
ATOM   823  C  CD2 . PHE A 1 116 ? 28.243 40.755  -10.399 1.00 61.97  ? 186 PHE A CD2 1 
ATOM   824  C  CE1 . PHE A 1 116 ? 29.465 40.248  -12.821 1.00 65.55  ? 186 PHE A CE1 1 
ATOM   825  C  CE2 . PHE A 1 116 ? 29.374 41.461  -10.768 1.00 65.83  ? 186 PHE A CE2 1 
ATOM   826  C  CZ  . PHE A 1 116 ? 29.984 41.203  -11.975 1.00 64.78  ? 186 PHE A CZ  1 
ATOM   827  N  N   . SER A 1 117 ? 23.429 38.160  -11.020 1.00 54.62  ? 187 SER A N   1 
ATOM   828  C  CA  . SER A 1 117 ? 22.311 37.434  -10.442 1.00 53.86  ? 187 SER A CA  1 
ATOM   829  C  C   . SER A 1 117 ? 21.653 36.461  -11.401 1.00 57.44  ? 187 SER A C   1 
ATOM   830  O  O   . SER A 1 117 ? 21.479 35.303  -11.036 1.00 56.60  ? 187 SER A O   1 
ATOM   831  C  CB  . SER A 1 117 ? 21.294 38.382  -9.844  1.00 57.60  ? 187 SER A CB  1 
ATOM   832  O  OG  . SER A 1 117 ? 20.397 37.634  -9.040  1.00 66.42  ? 187 SER A OG  1 
ATOM   833  N  N   . TRP A 1 118 ? 21.301 36.901  -12.622 1.00 54.35  ? 188 TRP A N   1 
ATOM   834  C  CA  . TRP A 1 118 ? 20.685 35.975  -13.576 1.00 54.35  ? 188 TRP A CA  1 
ATOM   835  C  C   . TRP A 1 118 ? 21.669 34.891  -14.023 1.00 57.13  ? 188 TRP A C   1 
ATOM   836  O  O   . TRP A 1 118 ? 21.259 33.751  -14.191 1.00 56.41  ? 188 TRP A O   1 
ATOM   837  C  CB  . TRP A 1 118 ? 19.962 36.664  -14.750 1.00 54.47  ? 188 TRP A CB  1 
ATOM   838  C  CG  . TRP A 1 118 ? 20.813 37.289  -15.806 1.00 56.08  ? 188 TRP A CG  1 
ATOM   839  C  CD1 . TRP A 1 118 ? 21.166 38.599  -15.894 1.00 59.72  ? 188 TRP A CD1 1 
ATOM   840  C  CD2 . TRP A 1 118 ? 21.324 36.657  -16.979 1.00 56.85  ? 188 TRP A CD2 1 
ATOM   841  N  NE1 . TRP A 1 118 ? 21.903 38.817  -17.027 1.00 60.12  ? 188 TRP A NE1 1 
ATOM   842  C  CE2 . TRP A 1 118 ? 22.017 37.644  -17.715 1.00 61.70  ? 188 TRP A CE2 1 
ATOM   843  C  CE3 . TRP A 1 118 ? 21.274 35.348  -17.482 1.00 57.99  ? 188 TRP A CE3 1 
ATOM   844  C  CZ2 . TRP A 1 118 ? 22.659 37.368  -18.914 1.00 62.16  ? 188 TRP A CZ2 1 
ATOM   845  C  CZ3 . TRP A 1 118 ? 21.908 35.077  -18.679 1.00 60.46  ? 188 TRP A CZ3 1 
ATOM   846  C  CH2 . TRP A 1 118 ? 22.586 36.082  -19.383 1.00 62.19  ? 188 TRP A CH2 1 
ATOM   847  N  N   . LEU A 1 119 ? 22.965 35.243  -14.162 1.00 53.28  ? 189 LEU A N   1 
ATOM   848  C  CA  . LEU A 1 119 ? 24.026 34.303  -14.543 1.00 52.82  ? 189 LEU A CA  1 
ATOM   849  C  C   . LEU A 1 119 ? 24.216 33.201  -13.525 1.00 55.66  ? 189 LEU A C   1 
ATOM   850  O  O   . LEU A 1 119 ? 24.306 32.039  -13.907 1.00 55.14  ? 189 LEU A O   1 
ATOM   851  C  CB  . LEU A 1 119 ? 25.367 35.017  -14.765 1.00 53.33  ? 189 LEU A CB  1 
ATOM   852  C  CG  . LEU A 1 119 ? 25.539 35.825  -16.036 1.00 59.33  ? 189 LEU A CG  1 
ATOM   853  C  CD1 . LEU A 1 119 ? 26.970 36.291  -16.160 1.00 60.13  ? 189 LEU A CD1 1 
ATOM   854  C  CD2 . LEU A 1 119 ? 25.196 35.001  -17.257 1.00 62.47  ? 189 LEU A CD2 1 
ATOM   855  N  N   . PHE A 1 120 ? 24.297 33.568  -12.233 1.00 51.65  ? 190 PHE A N   1 
ATOM   856  C  CA  . PHE A 1 120 ? 24.475 32.614  -11.147 1.00 50.79  ? 190 PHE A CA  1 
ATOM   857  C  C   . PHE A 1 120 ? 23.327 31.617  -11.122 1.00 54.37  ? 190 PHE A C   1 
ATOM   858  O  O   . PHE A 1 120 ? 23.562 30.423  -10.983 1.00 53.76  ? 190 PHE A O   1 
ATOM   859  C  CB  . PHE A 1 120 ? 24.625 33.330  -9.789  1.00 52.46  ? 190 PHE A CB  1 
ATOM   860  C  CG  . PHE A 1 120 ? 24.268 32.472  -8.599  1.00 53.71  ? 190 PHE A CG  1 
ATOM   861  C  CD1 . PHE A 1 120 ? 25.162 31.528  -8.112  1.00 56.67  ? 190 PHE A CD1 1 
ATOM   862  C  CD2 . PHE A 1 120 ? 23.020 32.571  -8.002  1.00 55.85  ? 190 PHE A CD2 1 
ATOM   863  C  CE1 . PHE A 1 120 ? 24.824 30.722  -7.037  1.00 57.51  ? 190 PHE A CE1 1 
ATOM   864  C  CE2 . PHE A 1 120 ? 22.677 31.758  -6.935  1.00 58.66  ? 190 PHE A CE2 1 
ATOM   865  C  CZ  . PHE A 1 120 ? 23.583 30.842  -6.448  1.00 56.67  ? 190 PHE A CZ  1 
ATOM   866  N  N   . HIS A 1 121 ? 22.088 32.119  -11.204 1.00 51.26  ? 191 HIS A N   1 
ATOM   867  C  CA  . HIS A 1 121 ? 20.894 31.286  -11.182 1.00 51.22  ? 191 HIS A CA  1 
ATOM   868  C  C   . HIS A 1 121 ? 20.838 30.322  -12.350 1.00 55.48  ? 191 HIS A C   1 
ATOM   869  O  O   . HIS A 1 121 ? 20.398 29.198  -12.167 1.00 55.05  ? 191 HIS A O   1 
ATOM   870  C  CB  . HIS A 1 121 ? 19.629 32.138  -11.083 1.00 52.61  ? 191 HIS A CB  1 
ATOM   871  C  CG  . HIS A 1 121 ? 19.432 32.717  -9.702  1.00 55.93  ? 191 HIS A CG  1 
ATOM   872  N  ND1 . HIS A 1 121 ? 18.675 32.055  -8.753  1.00 57.84  ? 191 HIS A ND1 1 
ATOM   873  C  CD2 . HIS A 1 121 ? 19.962 33.825  -9.150  1.00 57.60  ? 191 HIS A CD2 1 
ATOM   874  C  CE1 . HIS A 1 121 ? 18.742 32.792  -7.672  1.00 57.24  ? 191 HIS A CE1 1 
ATOM   875  N  NE2 . HIS A 1 121 ? 19.497 33.872  -7.849  1.00 57.41  ? 191 HIS A NE2 1 
ATOM   876  N  N   . THR A 1 122 ? 21.276 30.763  -13.549 1.00 52.60  ? 192 THR A N   1 
ATOM   877  C  CA  . THR A 1 122 ? 21.301 29.931  -14.762 1.00 52.87  ? 192 THR A CA  1 
ATOM   878  C  C   . THR A 1 122 ? 22.305 28.782  -14.691 1.00 55.67  ? 192 THR A C   1 
ATOM   879  O  O   . THR A 1 122 ? 21.989 27.665  -15.093 1.00 55.41  ? 192 THR A O   1 
ATOM   880  C  CB  . THR A 1 122 ? 21.578 30.763  -16.039 1.00 63.33  ? 192 THR A CB  1 
ATOM   881  O  OG1 . THR A 1 122 ? 22.902 31.278  -16.015 1.00 63.96  ? 192 THR A OG1 1 
ATOM   882  C  CG2 . THR A 1 122 ? 20.597 31.899  -16.220 1.00 62.63  ? 192 THR A CG2 1 
ATOM   883  N  N   . VAL A 1 123 ? 23.520 29.084  -14.209 1.00 51.44  ? 193 VAL A N   1 
ATOM   884  C  CA  . VAL A 1 123 ? 24.655 28.153  -14.105 1.00 50.77  ? 193 VAL A CA  1 
ATOM   885  C  C   . VAL A 1 123 ? 24.732 27.449  -12.743 1.00 53.42  ? 193 VAL A C   1 
ATOM   886  O  O   . VAL A 1 123 ? 25.707 26.754  -12.447 1.00 53.01  ? 193 VAL A O   1 
ATOM   887  C  CB  . VAL A 1 123 ? 26.001 28.841  -14.451 1.00 55.11  ? 193 VAL A CB  1 
ATOM   888  C  CG1 . VAL A 1 123 ? 25.927 29.568  -15.784 1.00 55.82  ? 193 VAL A CG1 1 
ATOM   889  C  CG2 . VAL A 1 123 ? 26.423 29.802  -13.351 1.00 54.73  ? 193 VAL A CG2 1 
ATOM   890  N  N   . TYR A 1 124 ? 23.683 27.611  -11.936 1.00 49.33  ? 194 TYR A N   1 
ATOM   891  C  CA  . TYR A 1 124 ? 23.568 27.063  -10.593 1.00 48.66  ? 194 TYR A CA  1 
ATOM   892  C  C   . TYR A 1 124 ? 23.718 25.537  -10.517 1.00 51.11  ? 194 TYR A C   1 
ATOM   893  O  O   . TYR A 1 124 ? 24.346 25.034  -9.589  1.00 50.75  ? 194 TYR A O   1 
ATOM   894  C  CB  . TYR A 1 124 ? 22.244 27.533  -9.972  1.00 50.23  ? 194 TYR A CB  1 
ATOM   895  C  CG  . TYR A 1 124 ? 22.002 27.109  -8.540  1.00 52.41  ? 194 TYR A CG  1 
ATOM   896  C  CD1 . TYR A 1 124 ? 22.943 27.352  -7.548  1.00 54.51  ? 194 TYR A CD1 1 
ATOM   897  C  CD2 . TYR A 1 124 ? 20.802 26.513  -8.168  1.00 53.57  ? 194 TYR A CD2 1 
ATOM   898  C  CE1 . TYR A 1 124 ? 22.719 26.976  -6.234  1.00 55.87  ? 194 TYR A CE1 1 
ATOM   899  C  CE2 . TYR A 1 124 ? 20.562 26.138  -6.856  1.00 54.83  ? 194 TYR A CE2 1 
ATOM   900  C  CZ  . TYR A 1 124 ? 21.522 26.372  -5.892  1.00 62.41  ? 194 TYR A CZ  1 
ATOM   901  O  OH  . TYR A 1 124 ? 21.284 25.999  -4.603  1.00 63.68  ? 194 TYR A OH  1 
ATOM   902  N  N   . CYS A 1 125 ? 23.152 24.823  -11.487 1.00 46.55  ? 195 CYS A N   1 
ATOM   903  C  CA  . CYS A 1 125 ? 23.164 23.356  -11.565 1.00 45.76  ? 195 CYS A CA  1 
ATOM   904  C  C   . CYS A 1 125 ? 24.377 22.746  -12.289 1.00 48.47  ? 195 CYS A C   1 
ATOM   905  O  O   . CYS A 1 125 ? 24.490 21.526  -12.353 1.00 47.77  ? 195 CYS A O   1 
ATOM   906  C  CB  . CYS A 1 125 ? 21.865 22.862  -12.171 1.00 46.27  ? 195 CYS A CB  1 
ATOM   907  S  SG  . CYS A 1 125 ? 21.479 23.576  -13.795 1.00 50.73  ? 195 CYS A SG  1 
ATOM   908  N  N   . HIS A 1 126 ? 25.276 23.576  -12.837 1.00 44.73  ? 196 HIS A N   1 
ATOM   909  C  CA  . HIS A 1 126 ? 26.434 23.110  -13.596 1.00 44.55  ? 196 HIS A CA  1 
ATOM   910  C  C   . HIS A 1 126 ? 27.370 22.168  -12.826 1.00 47.76  ? 196 HIS A C   1 
ATOM   911  O  O   . HIS A 1 126 ? 27.522 21.018  -13.229 1.00 47.24  ? 196 HIS A O   1 
ATOM   912  C  CB  . HIS A 1 126 ? 27.222 24.303  -14.168 1.00 45.74  ? 196 HIS A CB  1 
ATOM   913  C  CG  . HIS A 1 126 ? 28.318 23.911  -15.140 1.00 49.80  ? 196 HIS A CG  1 
ATOM   914  N  ND1 . HIS A 1 126 ? 29.513 23.366  -14.690 1.00 51.82  ? 196 HIS A ND1 1 
ATOM   915  C  CD2 . HIS A 1 126 ? 28.347 23.986  -16.486 1.00 52.20  ? 196 HIS A CD2 1 
ATOM   916  C  CE1 . HIS A 1 126 ? 30.224 23.128  -15.768 1.00 52.09  ? 196 HIS A CE1 1 
ATOM   917  N  NE2 . HIS A 1 126 ? 29.581 23.482  -16.875 1.00 52.70  ? 196 HIS A NE2 1 
ATOM   918  N  N   . SER A 1 127 ? 27.994 22.645  -11.753 1.00 44.10  ? 197 SER A N   1 
ATOM   919  C  CA  . SER A 1 127 ? 28.906 21.875  -10.905 1.00 44.18  ? 197 SER A CA  1 
ATOM   920  C  C   . SER A 1 127 ? 29.108 22.636  -9.603  1.00 48.33  ? 197 SER A C   1 
ATOM   921  O  O   . SER A 1 127 ? 28.804 23.823  -9.541  1.00 47.62  ? 197 SER A O   1 
ATOM   922  C  CB  . SER A 1 127 ? 30.242 21.606  -11.593 1.00 48.08  ? 197 SER A CB  1 
ATOM   923  O  OG  . SER A 1 127 ? 30.770 22.775  -12.194 1.00 56.98  ? 197 SER A OG  1 
ATOM   924  N  N   . GLU A 1 128 ? 29.610 21.955  -8.568  1.00 45.65  ? 198 GLU A N   1 
ATOM   925  C  CA  . GLU A 1 128 ? 29.840 22.553  -7.262  1.00 46.00  ? 198 GLU A CA  1 
ATOM   926  C  C   . GLU A 1 128 ? 30.809 23.729  -7.337  1.00 50.71  ? 198 GLU A C   1 
ATOM   927  O  O   . GLU A 1 128 ? 30.528 24.774  -6.758  1.00 50.31  ? 198 GLU A O   1 
ATOM   928  C  CB  . GLU A 1 128 ? 30.314 21.494  -6.261  1.00 48.20  ? 198 GLU A CB  1 
ATOM   929  C  CG  . GLU A 1 128 ? 30.519 22.040  -4.860  1.00 59.54  ? 198 GLU A CG  1 
ATOM   930  C  CD  . GLU A 1 128 ? 30.503 21.028  -3.739  1.00 80.55  ? 198 GLU A CD  1 
ATOM   931  O  OE1 . GLU A 1 128 ? 30.844 19.850  -3.987  1.00 77.51  ? 198 GLU A OE1 1 
ATOM   932  O  OE2 . GLU A 1 128 ? 30.153 21.415  -2.602  1.00 72.81  ? 198 GLU A OE2 1 
ATOM   933  N  N   . LYS A 1 129 ? 31.936 23.565  -8.053  1.00 48.22  ? 199 LYS A N   1 
ATOM   934  C  CA  . LYS A 1 129 ? 32.931 24.626  -8.218  1.00 49.10  ? 199 LYS A CA  1 
ATOM   935  C  C   . LYS A 1 129 ? 32.396 25.837  -8.996  1.00 52.77  ? 199 LYS A C   1 
ATOM   936  O  O   . LYS A 1 129 ? 32.651 26.970  -8.596  1.00 52.52  ? 199 LYS A O   1 
ATOM   937  C  CB  . LYS A 1 129 ? 34.235 24.096  -8.837  1.00 52.84  ? 199 LYS A CB  1 
ATOM   938  C  CG  . LYS A 1 129 ? 34.203 23.879  -10.342 1.00 68.45  ? 199 LYS A CG  1 
ATOM   939  C  CD  . LYS A 1 129 ? 35.513 24.293  -10.996 1.00 81.33  ? 199 LYS A CD  1 
ATOM   940  C  CE  . LYS A 1 129 ? 35.547 23.892  -12.452 1.00 93.85  ? 199 LYS A CE  1 
ATOM   941  N  NZ  . LYS A 1 129 ? 34.665 24.741  -13.295 1.00 102.76 ? 199 LYS A NZ  1 
ATOM   942  N  N   . VAL A 1 130 ? 31.667 25.588  -10.106 1.00 49.04  ? 200 VAL A N   1 
ATOM   943  C  CA  . VAL A 1 130 ? 31.069 26.625  -10.959 1.00 48.71  ? 200 VAL A CA  1 
ATOM   944  C  C   . VAL A 1 130 ? 30.024 27.391  -10.162 1.00 52.28  ? 200 VAL A C   1 
ATOM   945  O  O   . VAL A 1 130 ? 29.989 28.621  -10.213 1.00 52.15  ? 200 VAL A O   1 
ATOM   946  C  CB  . VAL A 1 130 ? 30.505 26.070  -12.298 1.00 52.35  ? 200 VAL A CB  1 
ATOM   947  C  CG1 . VAL A 1 130 ? 29.693 27.121  -13.052 1.00 51.92  ? 200 VAL A CG1 1 
ATOM   948  C  CG2 . VAL A 1 130 ? 31.630 25.564  -13.183 1.00 53.17  ? 200 VAL A CG2 1 
ATOM   949  N  N   . SER A 1 131 ? 29.202 26.649  -9.392  1.00 48.34  ? 201 SER A N   1 
ATOM   950  C  CA  . SER A 1 131 ? 28.174 27.212  -8.528  1.00 47.71  ? 201 SER A CA  1 
ATOM   951  C  C   . SER A 1 131 ? 28.831 28.117  -7.496  1.00 52.13  ? 201 SER A C   1 
ATOM   952  O  O   . SER A 1 131 ? 28.339 29.213  -7.263  1.00 51.54  ? 201 SER A O   1 
ATOM   953  C  CB  . SER A 1 131 ? 27.372 26.112  -7.846  1.00 51.21  ? 201 SER A CB  1 
ATOM   954  O  OG  . SER A 1 131 ? 26.198 26.653  -7.260  1.00 60.85  ? 201 SER A OG  1 
ATOM   955  N  N   . ARG A 1 132 ? 29.962 27.668  -6.911  1.00 49.57  ? 202 ARG A N   1 
ATOM   956  C  CA  . ARG A 1 132 ? 30.752 28.415  -5.930  1.00 50.23  ? 202 ARG A CA  1 
ATOM   957  C  C   . ARG A 1 132 ? 31.274 29.725  -6.502  1.00 53.79  ? 202 ARG A C   1 
ATOM   958  O  O   . ARG A 1 132 ? 31.111 30.759  -5.869  1.00 53.56  ? 202 ARG A O   1 
ATOM   959  C  CB  . ARG A 1 132 ? 31.958 27.595  -5.472  1.00 52.48  ? 202 ARG A CB  1 
ATOM   960  C  CG  . ARG A 1 132 ? 31.769 26.769  -4.226  1.00 66.41  ? 202 ARG A CG  1 
ATOM   961  C  CD  . ARG A 1 132 ? 33.101 26.126  -3.920  1.00 82.74  ? 202 ARG A CD  1 
ATOM   962  N  NE  . ARG A 1 132 ? 33.133 25.481  -2.609  1.00 97.95  ? 202 ARG A NE  1 
ATOM   963  C  CZ  . ARG A 1 132 ? 33.221 24.173  -2.436  1.00 116.10 ? 202 ARG A CZ  1 
ATOM   964  N  NH1 . ARG A 1 132 ? 33.282 23.359  -3.482  1.00 104.54 ? 202 ARG A NH1 1 
ATOM   965  N  NH2 . ARG A 1 132 ? 33.256 23.660  -1.211  1.00 105.13 ? 202 ARG A NH2 1 
ATOM   966  N  N   . THR A 1 133 ? 31.897 29.678  -7.700  1.00 50.16  ? 203 THR A N   1 
ATOM   967  C  CA  . THR A 1 133 ? 32.465 30.841  -8.388  1.00 50.33  ? 203 THR A CA  1 
ATOM   968  C  C   . THR A 1 133 ? 31.422 31.915  -8.657  1.00 53.51  ? 203 THR A C   1 
ATOM   969  O  O   . THR A 1 133 ? 31.642 33.088  -8.351  1.00 53.47  ? 203 THR A O   1 
ATOM   970  C  CB  . THR A 1 133 ? 33.226 30.426  -9.660  1.00 56.70  ? 203 THR A CB  1 
ATOM   971  O  OG1 . THR A 1 133 ? 34.264 29.518  -9.298  1.00 55.93  ? 203 THR A OG1 1 
ATOM   972  C  CG2 . THR A 1 133 ? 33.839 31.629  -10.390 1.00 55.82  ? 203 THR A CG2 1 
ATOM   973  N  N   . PHE A 1 134 ? 30.289 31.506  -9.234  1.00 49.23  ? 204 PHE A N   1 
ATOM   974  C  CA  . PHE A 1 134 ? 29.188 32.418  -9.555  1.00 48.57  ? 204 PHE A CA  1 
ATOM   975  C  C   . PHE A 1 134 ? 28.474 32.951  -8.315  1.00 52.09  ? 204 PHE A C   1 
ATOM   976  O  O   . PHE A 1 134 ? 28.021 34.093  -8.324  1.00 51.58  ? 204 PHE A O   1 
ATOM   977  C  CB  . PHE A 1 134 ? 28.222 31.804  -10.571 1.00 49.89  ? 204 PHE A CB  1 
ATOM   978  C  CG  . PHE A 1 134 ? 28.715 32.003  -11.982 1.00 52.07  ? 204 PHE A CG  1 
ATOM   979  C  CD1 . PHE A 1 134 ? 29.683 31.165  -12.520 1.00 55.60  ? 204 PHE A CD1 1 
ATOM   980  C  CD2 . PHE A 1 134 ? 28.217 33.032  -12.767 1.00 54.47  ? 204 PHE A CD2 1 
ATOM   981  C  CE1 . PHE A 1 134 ? 30.133 31.345  -13.815 1.00 57.35  ? 204 PHE A CE1 1 
ATOM   982  C  CE2 . PHE A 1 134 ? 28.669 33.214  -14.066 1.00 58.19  ? 204 PHE A CE2 1 
ATOM   983  C  CZ  . PHE A 1 134 ? 29.626 32.368  -14.583 1.00 56.86  ? 204 PHE A CZ  1 
ATOM   984  N  N   . SER A 1 135 ? 28.420 32.133  -7.238  1.00 48.78  ? 205 SER A N   1 
ATOM   985  C  CA  . SER A 1 135 ? 27.820 32.508  -5.958  1.00 48.63  ? 205 SER A CA  1 
ATOM   986  C  C   . SER A 1 135 ? 28.556 33.693  -5.378  1.00 53.31  ? 205 SER A C   1 
ATOM   987  O  O   . SER A 1 135 ? 27.916 34.621  -4.905  1.00 52.75  ? 205 SER A O   1 
ATOM   988  C  CB  . SER A 1 135 ? 27.838 31.335  -4.991  1.00 52.33  ? 205 SER A CB  1 
ATOM   989  O  OG  . SER A 1 135 ? 27.151 31.674  -3.795  1.00 61.77  ? 205 SER A OG  1 
ATOM   990  N  N   . LYS A 1 136 ? 29.898 33.671  -5.440  1.00 50.99  ? 206 LYS A N   1 
ATOM   991  C  CA  . LYS A 1 136 ? 30.758 34.750  -4.962  1.00 51.84  ? 206 LYS A CA  1 
ATOM   992  C  C   . LYS A 1 136 ? 30.475 36.030  -5.724  1.00 55.89  ? 206 LYS A C   1 
ATOM   993  O  O   . LYS A 1 136 ? 30.464 37.100  -5.122  1.00 55.82  ? 206 LYS A O   1 
ATOM   994  C  CB  . LYS A 1 136 ? 32.219 34.380  -5.136  1.00 55.49  ? 206 LYS A CB  1 
ATOM   995  C  CG  . LYS A 1 136 ? 32.648 33.290  -4.224  1.00 69.97  ? 206 LYS A CG  1 
ATOM   996  C  CD  . LYS A 1 136 ? 33.946 32.768  -4.727  1.00 81.43  ? 206 LYS A CD  1 
ATOM   997  C  CE  . LYS A 1 136 ? 34.561 31.937  -3.687  1.00 94.03  ? 206 LYS A CE  1 
ATOM   998  N  NZ  . LYS A 1 136 ? 33.661 30.816  -3.266  1.00 103.03 ? 206 LYS A NZ  1 
ATOM   999  N  N   . LEU A 1 137 ? 30.238 35.910  -7.049  1.00 52.24  ? 207 LEU A N   1 
ATOM   1000 C  CA  . LEU A 1 137 ? 29.893 37.023  -7.933  1.00 52.09  ? 207 LEU A CA  1 
ATOM   1001 C  C   . LEU A 1 137 ? 28.579 37.665  -7.552  1.00 55.83  ? 207 LEU A C   1 
ATOM   1002 O  O   . LEU A 1 137 ? 28.469 38.886  -7.585  1.00 55.59  ? 207 LEU A O   1 
ATOM   1003 C  CB  . LEU A 1 137 ? 29.819 36.579  -9.400  1.00 52.03  ? 207 LEU A CB  1 
ATOM   1004 C  CG  . LEU A 1 137 ? 31.109 36.524  -10.180 1.00 57.76  ? 207 LEU A CG  1 
ATOM   1005 C  CD1 . LEU A 1 137 ? 30.825 36.153  -11.612 1.00 58.06  ? 207 LEU A CD1 1 
ATOM   1006 C  CD2 . LEU A 1 137 ? 31.831 37.868  -10.137 1.00 61.05  ? 207 LEU A CD2 1 
ATOM   1007 N  N   . ASP A 1 138 ? 27.578 36.835  -7.217  1.00 52.41  ? 208 ASP A N   1 
ATOM   1008 C  CA  . ASP A 1 138 ? 26.253 37.288  -6.825  1.00 52.27  ? 208 ASP A CA  1 
ATOM   1009 C  C   . ASP A 1 138 ? 26.343 38.148  -5.568  1.00 57.69  ? 208 ASP A C   1 
ATOM   1010 O  O   . ASP A 1 138 ? 25.725 39.208  -5.514  1.00 57.28  ? 208 ASP A O   1 
ATOM   1011 C  CB  . ASP A 1 138 ? 25.297 36.097  -6.622  1.00 53.62  ? 208 ASP A CB  1 
ATOM   1012 C  CG  . ASP A 1 138 ? 23.831 36.494  -6.641  1.00 63.09  ? 208 ASP A CG  1 
ATOM   1013 O  OD1 . ASP A 1 138 ? 23.506 37.512  -7.269  1.00 63.70  ? 208 ASP A OD1 1 
ATOM   1014 O  OD2 . ASP A 1 138 ? 23.015 35.770  -6.046  1.00 68.90  ? 208 ASP A OD2 1 
ATOM   1015 N  N   . TYR A 1 139 ? 27.133 37.696  -4.578  1.00 55.68  ? 209 TYR A N   1 
ATOM   1016 C  CA  . TYR A 1 139 ? 27.370 38.406  -3.319  1.00 56.65  ? 209 TYR A CA  1 
ATOM   1017 C  C   . TYR A 1 139 ? 28.070 39.733  -3.581  1.00 60.83  ? 209 TYR A C   1 
ATOM   1018 O  O   . TYR A 1 139 ? 27.697 40.748  -2.999  1.00 60.52  ? 209 TYR A O   1 
ATOM   1019 C  CB  . TYR A 1 139 ? 28.228 37.557  -2.377  1.00 59.09  ? 209 TYR A CB  1 
ATOM   1020 C  CG  . TYR A 1 139 ? 27.430 36.554  -1.580  1.00 61.48  ? 209 TYR A CG  1 
ATOM   1021 C  CD1 . TYR A 1 139 ? 26.908 36.886  -0.335  1.00 64.33  ? 209 TYR A CD1 1 
ATOM   1022 C  CD2 . TYR A 1 139 ? 27.194 35.278  -2.068  1.00 61.93  ? 209 TYR A CD2 1 
ATOM   1023 C  CE1 . TYR A 1 139 ? 26.174 35.971  0.402   1.00 65.80  ? 209 TYR A CE1 1 
ATOM   1024 C  CE2 . TYR A 1 139 ? 26.460 34.354  -1.343  1.00 63.10  ? 209 TYR A CE2 1 
ATOM   1025 C  CZ  . TYR A 1 139 ? 25.953 34.706  -0.107  1.00 72.32  ? 209 TYR A CZ  1 
ATOM   1026 O  OH  . TYR A 1 139 ? 25.234 33.800  0.611   1.00 74.83  ? 209 TYR A OH  1 
ATOM   1027 N  N   . SER A 1 140 ? 29.092 39.710  -4.459  1.00 57.81  ? 210 SER A N   1 
ATOM   1028 C  CA  . SER A 1 140 ? 29.875 40.875  -4.865  1.00 58.40  ? 210 SER A CA  1 
ATOM   1029 C  C   . SER A 1 140 ? 29.003 41.900  -5.585  1.00 62.06  ? 210 SER A C   1 
ATOM   1030 O  O   . SER A 1 140 ? 29.155 43.099  -5.355  1.00 62.25  ? 210 SER A O   1 
ATOM   1031 C  CB  . SER A 1 140 ? 31.046 40.453  -5.742  1.00 62.61  ? 210 SER A CB  1 
ATOM   1032 O  OG  . SER A 1 140 ? 31.864 39.500  -5.075  1.00 72.43  ? 210 SER A OG  1 
ATOM   1033 N  N   . GLY A 1 141 ? 28.091 41.406  -6.419  1.00 58.00  ? 211 GLY A N   1 
ATOM   1034 C  CA  . GLY A 1 141 ? 27.149 42.219  -7.179  1.00 57.77  ? 211 GLY A CA  1 
ATOM   1035 C  C   . GLY A 1 141 ? 26.287 43.086  -6.289  1.00 61.74  ? 211 GLY A C   1 
ATOM   1036 O  O   . GLY A 1 141 ? 26.139 44.277  -6.563  1.00 61.68  ? 211 GLY A O   1 
ATOM   1037 N  N   . ILE A 1 142 ? 25.736 42.502  -5.204  1.00 58.18  ? 212 ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 142 ? 24.900 43.205  -4.227  1.00 58.25  ? 212 ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 142 ? 25.674 44.363  -3.594  1.00 62.71  ? 212 ILE A C   1 
ATOM   1040 O  O   . ILE A 1 142 ? 25.139 45.465  -3.492  1.00 62.46  ? 212 ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 142 ? 24.326 42.255  -3.140  1.00 61.43  ? 212 ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 142 ? 23.564 41.083  -3.779  1.00 61.51  ? 212 ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 142 ? 23.425 43.022  -2.149  1.00 62.63  ? 212 ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 142 ? 23.334 39.899  -2.869  1.00 70.08  ? 212 ILE A CD1 1 
ATOM   1045 N  N   . ALA A 1 143 ? 26.937 44.111  -3.199  1.00 59.71  ? 213 ALA A N   1 
ATOM   1046 C  CA  . ALA A 1 143 ? 27.817 45.117  -2.608  1.00 60.38  ? 213 ALA A CA  1 
ATOM   1047 C  C   . ALA A 1 143 ? 28.024 46.260  -3.600  1.00 64.35  ? 213 ALA A C   1 
ATOM   1048 O  O   . ALA A 1 143 ? 27.965 47.420  -3.206  1.00 64.25  ? 213 ALA A O   1 
ATOM   1049 C  CB  . ALA A 1 143 ? 29.150 44.497  -2.222  1.00 61.88  ? 213 ALA A CB  1 
ATOM   1050 N  N   . LEU A 1 144 ? 28.203 45.924  -4.897  1.00 60.85  ? 214 LEU A N   1 
ATOM   1051 C  CA  . LEU A 1 144 ? 28.384 46.895  -5.976  1.00 61.11  ? 214 LEU A CA  1 
ATOM   1052 C  C   . LEU A 1 144 ? 27.181 47.793  -6.155  1.00 65.02  ? 214 LEU A C   1 
ATOM   1053 O  O   . LEU A 1 144 ? 27.353 48.993  -6.341  1.00 65.33  ? 214 LEU A O   1 
ATOM   1054 C  CB  . LEU A 1 144 ? 28.750 46.218  -7.304  1.00 61.14  ? 214 LEU A CB  1 
ATOM   1055 C  CG  . LEU A 1 144 ? 30.148 45.638  -7.379  1.00 66.35  ? 214 LEU A CG  1 
ATOM   1056 C  CD1 . LEU A 1 144 ? 30.359 44.936  -8.688  1.00 66.66  ? 214 LEU A CD1 1 
ATOM   1057 C  CD2 . LEU A 1 144 ? 31.198 46.725  -7.203  1.00 69.91  ? 214 LEU A CD2 1 
ATOM   1058 N  N   . LEU A 1 145 ? 25.970 47.213  -6.107  1.00 61.01  ? 215 LEU A N   1 
ATOM   1059 C  CA  . LEU A 1 145 ? 24.725 47.965  -6.232  1.00 60.95  ? 215 LEU A CA  1 
ATOM   1060 C  C   . LEU A 1 145 ? 24.607 48.971  -5.090  1.00 65.40  ? 215 LEU A C   1 
ATOM   1061 O  O   . LEU A 1 145 ? 24.260 50.123  -5.332  1.00 65.30  ? 215 LEU A O   1 
ATOM   1062 C  CB  . LEU A 1 145 ? 23.500 47.031  -6.260  1.00 60.46  ? 215 LEU A CB  1 
ATOM   1063 C  CG  . LEU A 1 145 ? 22.119 47.699  -6.183  1.00 65.34  ? 215 LEU A CG  1 
ATOM   1064 C  CD1 . LEU A 1 145 ? 21.926 48.716  -7.302  1.00 66.16  ? 215 LEU A CD1 1 
ATOM   1065 C  CD2 . LEU A 1 145 ? 21.028 46.675  -6.242  1.00 67.36  ? 215 LEU A CD2 1 
ATOM   1066 N  N   . ILE A 1 146 ? 24.903 48.529  -3.854  1.00 62.38  ? 216 ILE A N   1 
ATOM   1067 C  CA  . ILE A 1 146 ? 24.865 49.383  -2.670  1.00 62.91  ? 216 ILE A CA  1 
ATOM   1068 C  C   . ILE A 1 146 ? 25.876 50.519  -2.822  1.00 68.17  ? 216 ILE A C   1 
ATOM   1069 O  O   . ILE A 1 146 ? 25.548 51.669  -2.551  1.00 68.21  ? 216 ILE A O   1 
ATOM   1070 C  CB  . ILE A 1 146 ? 25.072 48.577  -1.360  1.00 66.13  ? 216 ILE A CB  1 
ATOM   1071 C  CG1 . ILE A 1 146 ? 23.884 47.622  -1.127  1.00 66.09  ? 216 ILE A CG1 1 
ATOM   1072 C  CG2 . ILE A 1 146 ? 25.281 49.515  -0.156  1.00 67.71  ? 216 ILE A CG2 1 
ATOM   1073 C  CD1 . ILE A 1 146 ? 23.904 46.820  0.156   1.00 74.27  ? 216 ILE A CD1 1 
ATOM   1074 N  N   . MET A 1 147 ? 27.091 50.192  -3.287  1.00 65.61  ? 217 MET A N   1 
ATOM   1075 C  CA  . MET A 1 147 ? 28.157 51.165  -3.521  1.00 66.69  ? 217 MET A CA  1 
ATOM   1076 C  C   . MET A 1 147 ? 27.728 52.179  -4.573  1.00 71.16  ? 217 MET A C   1 
ATOM   1077 O  O   . MET A 1 147 ? 27.904 53.380  -4.376  1.00 71.49  ? 217 MET A O   1 
ATOM   1078 C  CB  . MET A 1 147 ? 29.429 50.463  -3.993  1.00 69.63  ? 217 MET A CB  1 
ATOM   1079 C  CG  . MET A 1 147 ? 30.084 49.604  -2.946  1.00 73.70  ? 217 MET A CG  1 
ATOM   1080 S  SD  . MET A 1 147 ? 31.563 48.844  -3.647  1.00 78.89  ? 217 MET A SD  1 
ATOM   1081 C  CE  . MET A 1 147 ? 32.573 50.280  -3.872  1.00 77.08  ? 217 MET A CE  1 
ATOM   1082 N  N   . GLY A 1 148 ? 27.157 51.670  -5.658  1.00 67.66  ? 218 GLY A N   1 
ATOM   1083 C  CA  . GLY A 1 148 ? 26.650 52.454  -6.777  1.00 68.06  ? 218 GLY A CA  1 
ATOM   1084 C  C   . GLY A 1 148 ? 25.550 53.415  -6.389  1.00 72.29  ? 218 GLY A C   1 
ATOM   1085 O  O   . GLY A 1 148 ? 25.582 54.570  -6.804  1.00 72.60  ? 218 GLY A O   1 
ATOM   1086 N  N   . SER A 1 149 ? 24.594 52.958  -5.564  1.00 68.58  ? 219 SER A N   1 
ATOM   1087 C  CA  . SER A 1 149 ? 23.462 53.759  -5.098  1.00 68.86  ? 219 SER A CA  1 
ATOM   1088 C  C   . SER A 1 149 ? 23.881 55.013  -4.337  1.00 73.79  ? 219 SER A C   1 
ATOM   1089 O  O   . SER A 1 149 ? 23.278 56.072  -4.500  1.00 73.74  ? 219 SER A O   1 
ATOM   1090 C  CB  . SER A 1 149 ? 22.531 52.919  -4.237  1.00 71.90  ? 219 SER A CB  1 
ATOM   1091 O  OG  . SER A 1 149 ? 21.854 51.940  -5.011  1.00 80.43  ? 219 SER A OG  1 
ATOM   1092 N  N   . PHE A 1 150 ? 24.927 54.896  -3.520  1.00 70.98  ? 220 PHE A N   1 
ATOM   1093 C  CA  . PHE A 1 150 ? 25.394 55.991  -2.673  1.00 71.74  ? 220 PHE A CA  1 
ATOM   1094 C  C   . PHE A 1 150 ? 26.049 57.170  -3.383  1.00 76.46  ? 220 PHE A C   1 
ATOM   1095 O  O   . PHE A 1 150 ? 25.786 58.294  -2.994  1.00 76.43  ? 220 PHE A O   1 
ATOM   1096 C  CB  . PHE A 1 150 ? 26.312 55.480  -1.564  1.00 73.92  ? 220 PHE A CB  1 
ATOM   1097 C  CG  . PHE A 1 150 ? 25.587 54.681  -0.514  1.00 75.34  ? 220 PHE A CG  1 
ATOM   1098 C  CD1 . PHE A 1 150 ? 24.225 54.840  -0.313  1.00 78.29  ? 220 PHE A CD1 1 
ATOM   1099 C  CD2 . PHE A 1 150 ? 26.272 53.789  0.290   1.00 77.84  ? 220 PHE A CD2 1 
ATOM   1100 C  CE1 . PHE A 1 150 ? 23.561 54.107  0.656   1.00 79.22  ? 220 PHE A CE1 1 
ATOM   1101 C  CE2 . PHE A 1 150 ? 25.617 53.067  1.274   1.00 80.64  ? 220 PHE A CE2 1 
ATOM   1102 C  CZ  . PHE A 1 150 ? 24.259 53.227  1.450   1.00 78.52  ? 220 PHE A CZ  1 
ATOM   1103 N  N   . VAL A 1 151 ? 26.879 56.928  -4.414  1.00 73.56  ? 221 VAL A N   1 
ATOM   1104 C  CA  . VAL A 1 151 ? 27.584 57.997  -5.145  1.00 74.57  ? 221 VAL A CA  1 
ATOM   1105 C  C   . VAL A 1 151 ? 26.599 59.079  -5.659  1.00 79.15  ? 221 VAL A C   1 
ATOM   1106 O  O   . VAL A 1 151 ? 26.801 60.244  -5.314  1.00 79.35  ? 221 VAL A O   1 
ATOM   1107 C  CB  . VAL A 1 151 ? 28.483 57.471  -6.303  1.00 78.86  ? 221 VAL A CB  1 
ATOM   1108 C  CG1 . VAL A 1 151 ? 29.543 58.488  -6.670  1.00 80.12  ? 221 VAL A CG1 1 
ATOM   1109 C  CG2 . VAL A 1 151 ? 29.130 56.143  -5.959  1.00 78.14  ? 221 VAL A CG2 1 
ATOM   1110 N  N   . PRO A 1 152 ? 25.538 58.741  -6.441  1.00 75.87  ? 222 PRO A N   1 
ATOM   1111 C  CA  . PRO A 1 152 ? 24.624 59.785  -6.947  1.00 76.52  ? 222 PRO A CA  1 
ATOM   1112 C  C   . PRO A 1 152 ? 23.889 60.512  -5.838  1.00 80.99  ? 222 PRO A C   1 
ATOM   1113 O  O   . PRO A 1 152 ? 23.788 61.737  -5.840  1.00 81.24  ? 222 PRO A O   1 
ATOM   1114 C  CB  . PRO A 1 152 ? 23.643 59.004  -7.849  1.00 77.96  ? 222 PRO A CB  1 
ATOM   1115 C  CG  . PRO A 1 152 ? 23.739 57.608  -7.400  1.00 81.18  ? 222 PRO A CG  1 
ATOM   1116 C  CD  . PRO A 1 152 ? 25.167 57.425  -6.983  1.00 76.67  ? 222 PRO A CD  1 
ATOM   1117 N  N   . TRP A 1 153 ? 23.420 59.730  -4.867  1.00 77.38  ? 223 TRP A N   1 
ATOM   1118 C  CA  . TRP A 1 153 ? 22.680 60.166  -3.703  1.00 77.60  ? 223 TRP A CA  1 
ATOM   1119 C  C   . TRP A 1 153 ? 23.485 61.103  -2.805  1.00 82.44  ? 223 TRP A C   1 
ATOM   1120 O  O   . TRP A 1 153 ? 22.985 62.164  -2.447  1.00 82.60  ? 223 TRP A O   1 
ATOM   1121 C  CB  . TRP A 1 153 ? 22.219 58.928  -2.932  1.00 75.68  ? 223 TRP A CB  1 
ATOM   1122 C  CG  . TRP A 1 153 ? 21.385 59.220  -1.737  1.00 76.87  ? 223 TRP A CG  1 
ATOM   1123 C  CD1 . TRP A 1 153 ? 20.063 59.548  -1.719  1.00 80.26  ? 223 TRP A CD1 1 
ATOM   1124 C  CD2 . TRP A 1 153 ? 21.830 59.266  -0.383  1.00 77.03  ? 223 TRP A CD2 1 
ATOM   1125 N  NE1 . TRP A 1 153 ? 19.652 59.773  -0.429  1.00 80.09  ? 223 TRP A NE1 1 
ATOM   1126 C  CE2 . TRP A 1 153 ? 20.717 59.606  0.413   1.00 81.40  ? 223 TRP A CE2 1 
ATOM   1127 C  CE3 . TRP A 1 153 ? 23.061 59.027  0.245   1.00 78.31  ? 223 TRP A CE3 1 
ATOM   1128 C  CZ2 . TRP A 1 153 ? 20.800 59.733  1.793   1.00 81.25  ? 223 TRP A CZ2 1 
ATOM   1129 C  CZ3 . TRP A 1 153 ? 23.133 59.135  1.622   1.00 80.37  ? 223 TRP A CZ3 1 
ATOM   1130 C  CH2 . TRP A 1 153 ? 22.011 59.490  2.379   1.00 81.41  ? 223 TRP A CH2 1 
ATOM   1131 N  N   . LEU A 1 154 ? 24.724 60.710  -2.447  1.00 79.33  ? 224 LEU A N   1 
ATOM   1132 C  CA  . LEU A 1 154 ? 25.623 61.491  -1.593  1.00 80.08  ? 224 LEU A CA  1 
ATOM   1133 C  C   . LEU A 1 154 ? 26.033 62.779  -2.258  1.00 85.38  ? 224 LEU A C   1 
ATOM   1134 O  O   . LEU A 1 154 ? 26.092 63.818  -1.607  1.00 85.54  ? 224 LEU A O   1 
ATOM   1135 C  CB  . LEU A 1 154 ? 26.881 60.695  -1.200  1.00 80.22  ? 224 LEU A CB  1 
ATOM   1136 C  CG  . LEU A 1 154 ? 26.684 59.611  -0.156  1.00 84.38  ? 224 LEU A CG  1 
ATOM   1137 C  CD1 . LEU A 1 154 ? 27.932 58.778  -0.007  1.00 84.81  ? 224 LEU A CD1 1 
ATOM   1138 C  CD2 . LEU A 1 154 ? 26.329 60.217  1.190   1.00 87.31  ? 224 LEU A CD2 1 
ATOM   1139 N  N   . TYR A 1 155 ? 26.306 62.709  -3.569  1.00 82.62  ? 225 TYR A N   1 
ATOM   1140 C  CA  . TYR A 1 155 ? 26.743 63.851  -4.350  1.00 83.77  ? 225 TYR A CA  1 
ATOM   1141 C  C   . TYR A 1 155 ? 25.736 64.966  -4.322  1.00 88.62  ? 225 TYR A C   1 
ATOM   1142 O  O   . TYR A 1 155 ? 26.112 66.100  -4.042  1.00 89.02  ? 225 TYR A O   1 
ATOM   1143 C  CB  . TYR A 1 155 ? 27.022 63.436  -5.801  1.00 85.25  ? 225 TYR A CB  1 
ATOM   1144 C  CG  . TYR A 1 155 ? 27.642 64.508  -6.677  1.00 88.37  ? 225 TYR A CG  1 
ATOM   1145 C  CD1 . TYR A 1 155 ? 28.990 64.831  -6.569  1.00 91.33  ? 225 TYR A CD1 1 
ATOM   1146 C  CD2 . TYR A 1 155 ? 26.895 65.152  -7.651  1.00 89.72  ? 225 TYR A CD2 1 
ATOM   1147 C  CE1 . TYR A 1 155 ? 29.570 65.785  -7.389  1.00 93.65  ? 225 TYR A CE1 1 
ATOM   1148 C  CE2 . TYR A 1 155 ? 27.459 66.115  -8.474  1.00 92.18  ? 225 TYR A CE2 1 
ATOM   1149 C  CZ  . TYR A 1 155 ? 28.800 66.426  -8.341  1.00 100.42 ? 225 TYR A CZ  1 
ATOM   1150 O  OH  . TYR A 1 155 ? 29.364 67.335  -9.184  1.00 103.08 ? 225 TYR A OH  1 
ATOM   1151 N  N   . TYR A 1 156 ? 24.452 64.653  -4.575  1.00 85.27  ? 226 TYR A N   1 
ATOM   1152 C  CA  . TYR A 1 156 ? 23.427 65.703  -4.592  1.00 86.01  ? 226 TYR A CA  1 
ATOM   1153 C  C   . TYR A 1 156 ? 22.961 66.186  -3.234  1.00 90.47  ? 226 TYR A C   1 
ATOM   1154 O  O   . TYR A 1 156 ? 22.720 67.375  -3.080  1.00 90.88  ? 226 TYR A O   1 
ATOM   1155 C  CB  . TYR A 1 156 ? 22.225 65.363  -5.470  1.00 87.25  ? 226 TYR A CB  1 
ATOM   1156 C  CG  . TYR A 1 156 ? 22.626 65.141  -6.904  1.00 89.79  ? 226 TYR A CG  1 
ATOM   1157 C  CD1 . TYR A 1 156 ? 23.586 65.952  -7.503  1.00 92.84  ? 226 TYR A CD1 1 
ATOM   1158 C  CD2 . TYR A 1 156 ? 22.069 64.129  -7.657  1.00 90.40  ? 226 TYR A CD2 1 
ATOM   1159 C  CE1 . TYR A 1 156 ? 23.998 65.731  -8.792  1.00 94.61  ? 226 TYR A CE1 1 
ATOM   1160 C  CE2 . TYR A 1 156 ? 22.443 63.914  -8.969  1.00 92.12  ? 226 TYR A CE2 1 
ATOM   1161 C  CZ  . TYR A 1 156 ? 23.432 64.703  -9.529  1.00 100.84 ? 226 TYR A CZ  1 
ATOM   1162 O  OH  . TYR A 1 156 ? 23.807 64.442  -10.824 1.00 102.49 ? 226 TYR A OH  1 
ATOM   1163 N  N   . SER A 1 157 ? 22.808 65.285  -2.256  1.00 86.75  ? 227 SER A N   1 
ATOM   1164 C  CA  . SER A 1 157 ? 22.372 65.683  -0.920  1.00 86.95  ? 227 SER A CA  1 
ATOM   1165 C  C   . SER A 1 157 ? 23.405 66.604  -0.281  1.00 92.09  ? 227 SER A C   1 
ATOM   1166 O  O   . SER A 1 157 ? 23.054 67.525  0.452   1.00 92.28  ? 227 SER A O   1 
ATOM   1167 C  CB  . SER A 1 157 ? 22.126 64.450  -0.070  1.00 89.75  ? 227 SER A CB  1 
ATOM   1168 O  OG  . SER A 1 157 ? 23.277 63.622  -0.021  1.00 98.03  ? 227 SER A OG  1 
ATOM   1169 N  N   . PHE A 1 158 ? 24.680 66.347  -0.580  1.00 89.16  ? 228 PHE A N   1 
ATOM   1170 C  CA  . PHE A 1 158 ? 25.808 67.109  -0.063  1.00 90.13  ? 228 PHE A CA  1 
ATOM   1171 C  C   . PHE A 1 158 ? 26.460 67.861  -1.208  1.00 95.29  ? 228 PHE A C   1 
ATOM   1172 O  O   . PHE A 1 158 ? 27.656 68.155  -1.180  1.00 95.60  ? 228 PHE A O   1 
ATOM   1173 C  CB  . PHE A 1 158 ? 26.802 66.177  0.632   1.00 91.88  ? 228 PHE A CB  1 
ATOM   1174 C  CG  . PHE A 1 158 ? 26.276 65.594  1.911   1.00 93.20  ? 228 PHE A CG  1 
ATOM   1175 C  CD1 . PHE A 1 158 ? 25.223 64.697  1.903   1.00 95.39  ? 228 PHE A CD1 1 
ATOM   1176 C  CD2 . PHE A 1 158 ? 26.839 65.936  3.125   1.00 96.32  ? 228 PHE A CD2 1 
ATOM   1177 C  CE1 . PHE A 1 158 ? 24.721 64.179  3.081   1.00 96.36  ? 228 PHE A CE1 1 
ATOM   1178 C  CE2 . PHE A 1 158 ? 26.360 65.394  4.304   1.00 99.24  ? 228 PHE A CE2 1 
ATOM   1179 C  CZ  . PHE A 1 158 ? 25.297 64.523  4.276   1.00 96.45  ? 228 PHE A CZ  1 
ATOM   1180 N  N   . TYR A 1 159 ? 25.647 68.179  -2.227  1.00 92.43  ? 229 TYR A N   1 
ATOM   1181 C  CA  . TYR A 1 159 ? 26.094 68.895  -3.409  1.00 93.49  ? 229 TYR A CA  1 
ATOM   1182 C  C   . TYR A 1 159 ? 26.743 70.188  -2.984  1.00 98.92  ? 229 TYR A C   1 
ATOM   1183 O  O   . TYR A 1 159 ? 27.844 70.481  -3.441  1.00 99.41  ? 229 TYR A O   1 
ATOM   1184 C  CB  . TYR A 1 159 ? 24.908 69.167  -4.337  1.00 94.88  ? 229 TYR A CB  1 
ATOM   1185 C  CG  . TYR A 1 159 ? 25.225 69.989  -5.563  1.00 98.07  ? 229 TYR A CG  1 
ATOM   1186 C  CD1 . TYR A 1 159 ? 25.210 71.379  -5.519  1.00 101.25 ? 229 TYR A CD1 1 
ATOM   1187 C  CD2 . TYR A 1 159 ? 25.502 69.377  -6.779  1.00 99.14  ? 229 TYR A CD2 1 
ATOM   1188 C  CE1 . TYR A 1 159 ? 25.510 72.139  -6.637  1.00 103.52 ? 229 TYR A CE1 1 
ATOM   1189 C  CE2 . TYR A 1 159 ? 25.779 70.127  -7.914  1.00 101.63 ? 229 TYR A CE2 1 
ATOM   1190 C  CZ  . TYR A 1 159 ? 25.792 71.508  -7.836  1.00 110.40 ? 229 TYR A CZ  1 
ATOM   1191 O  OH  . TYR A 1 159 ? 26.067 72.252  -8.951  1.00 113.18 ? 229 TYR A OH  1 
ATOM   1192 N  N   . CYS A 1 160 ? 26.078 70.943  -2.090  1.00 95.95  ? 230 CYS A N   1 
ATOM   1193 C  CA  . CYS A 1 160 ? 26.604 72.201  -1.571  1.00 97.08  ? 230 CYS A CA  1 
ATOM   1194 C  C   . CYS A 1 160 ? 27.825 72.031  -0.695  1.00 101.43 ? 230 CYS A C   1 
ATOM   1195 O  O   . CYS A 1 160 ? 28.722 72.869  -0.742  1.00 102.23 ? 230 CYS A O   1 
ATOM   1196 C  CB  . CYS A 1 160 ? 25.525 73.008  -0.870  1.00 97.55  ? 230 CYS A CB  1 
ATOM   1197 S  SG  . CYS A 1 160 ? 24.284 73.671  -2.008  1.00 101.87 ? 230 CYS A SG  1 
ATOM   1198 N  N   . SER A 1 161 ? 27.852 70.975  0.113   1.00 97.21  ? 231 SER A N   1 
ATOM   1199 C  CA  . SER A 1 161 ? 28.971 70.737  1.030   1.00 97.66  ? 231 SER A CA  1 
ATOM   1200 C  C   . SER A 1 161 ? 29.990 69.679  0.518   1.00 101.08 ? 231 SER A C   1 
ATOM   1201 O  O   . SER A 1 161 ? 29.728 68.472  0.592   1.00 99.54  ? 231 SER A O   1 
ATOM   1202 C  CB  . SER A 1 161 ? 28.445 70.383  2.413   1.00 101.04 ? 231 SER A CB  1 
ATOM   1203 O  OG  . SER A 1 161 ? 27.327 71.145  2.834   1.00 109.98 ? 231 SER A OG  1 
ATOM   1204 N  N   . PRO A 1 162 ? 31.178 70.146  -0.039  1.00 98.91  ? 232 PRO A N   1 
ATOM   1205 C  CA  . PRO A 1 162 ? 32.135 69.161  -0.533  1.00 98.84  ? 232 PRO A CA  1 
ATOM   1206 C  C   . PRO A 1 162 ? 32.859 68.271  0.495   1.00 102.46 ? 232 PRO A C   1 
ATOM   1207 O  O   . PRO A 1 162 ? 32.990 67.066  0.267   1.00 101.19 ? 232 PRO A O   1 
ATOM   1208 C  CB  . PRO A 1 162 ? 33.150 70.019  -1.302  1.00 102.43 ? 232 PRO A CB  1 
ATOM   1209 C  CG  . PRO A 1 162 ? 32.500 71.337  -1.505  1.00 107.13 ? 232 PRO A CG  1 
ATOM   1210 C  CD  . PRO A 1 162 ? 31.704 71.527  -0.261  1.00 101.95 ? 232 PRO A CD  1 
ATOM   1211 N  N   . GLN A 1 163 ? 33.307 68.856  1.624   1.00 100.01 ? 233 GLN A N   1 
ATOM   1212 C  CA  . GLN A 1 163 ? 34.008 68.106  2.681   1.00 100.39 ? 233 GLN A CA  1 
ATOM   1213 C  C   . GLN A 1 163 ? 33.190 66.940  3.272   1.00 101.98 ? 233 GLN A C   1 
ATOM   1214 O  O   . GLN A 1 163 ? 33.715 65.829  3.372   1.00 101.42 ? 233 GLN A O   1 
ATOM   1215 C  CB  . GLN A 1 163 ? 34.530 69.034  3.791   1.00 103.63 ? 233 GLN A CB  1 
ATOM   1216 C  CG  . GLN A 1 163 ? 35.400 68.296  4.820   1.00 121.95 ? 233 GLN A CG  1 
ATOM   1217 C  CD  . GLN A 1 163 ? 35.248 68.810  6.234   1.00 144.42 ? 233 GLN A CD  1 
ATOM   1218 O  OE1 . GLN A 1 163 ? 34.506 69.762  6.500   1.00 140.24 ? 233 GLN A OE1 1 
ATOM   1219 N  NE2 . GLN A 1 163 ? 35.960 68.189  7.169   1.00 138.22 ? 233 GLN A NE2 1 
ATOM   1220 N  N   . PRO A 1 164 ? 31.860 67.155  3.642   1.00 97.05  ? 234 PRO A N   1 
ATOM   1221 C  CA  . PRO A 1 164 ? 31.121 66.005  4.157   1.00 95.46  ? 234 PRO A CA  1 
ATOM   1222 C  C   . PRO A 1 164 ? 30.906 64.887  3.128   1.00 97.28  ? 234 PRO A C   1 
ATOM   1223 O  O   . PRO A 1 164 ? 30.984 63.707  3.450   1.00 96.39  ? 234 PRO A O   1 
ATOM   1224 C  CB  . PRO A 1 164 ? 29.793 66.612  4.603   1.00 96.64  ? 234 PRO A CB  1 
ATOM   1225 C  CG  . PRO A 1 164 ? 29.626 67.790  3.747   1.00 101.30 ? 234 PRO A CG  1 
ATOM   1226 C  CD  . PRO A 1 164 ? 30.995 68.379  3.642   1.00 98.45  ? 234 PRO A CD  1 
ATOM   1227 N  N   . ARG A 1 165 ? 30.700 65.274  1.869   1.00 92.94  ? 235 ARG A N   1 
ATOM   1228 C  CA  . ARG A 1 165 ? 30.504 64.336  0.764   1.00 91.44  ? 235 ARG A CA  1 
ATOM   1229 C  C   . ARG A 1 165 ? 31.711 63.430  0.475   1.00 95.75  ? 235 ARG A C   1 
ATOM   1230 O  O   . ARG A 1 165 ? 31.535 62.220  0.349   1.00 94.32  ? 235 ARG A O   1 
ATOM   1231 C  CB  . ARG A 1 165 ? 30.103 65.106  -0.489  1.00 91.01  ? 235 ARG A CB  1 
ATOM   1232 C  CG  . ARG A 1 165 ? 30.109 64.289  -1.770  1.00 98.31  ? 235 ARG A CG  1 
ATOM   1233 C  CD  . ARG A 1 165 ? 29.837 65.180  -2.947  1.00 105.15 ? 235 ARG A CD  1 
ATOM   1234 N  NE  . ARG A 1 165 ? 30.890 66.175  -3.152  1.00 111.80 ? 235 ARG A NE  1 
ATOM   1235 C  CZ  . ARG A 1 165 ? 30.739 67.268  -3.884  1.00 123.92 ? 235 ARG A CZ  1 
ATOM   1236 N  NH1 . ARG A 1 165 ? 29.580 67.525  -4.477  1.00 109.02 ? 235 ARG A NH1 1 
ATOM   1237 N  NH2 . ARG A 1 165 ? 31.742 68.122  -4.027  1.00 111.57 ? 235 ARG A NH2 1 
ATOM   1238 N  N   . LEU A 1 166 ? 32.927 64.002  0.385   1.00 94.03  ? 236 LEU A N   1 
ATOM   1239 C  CA  . LEU A 1 166 ? 34.142 63.213  0.132   1.00 94.77  ? 236 LEU A CA  1 
ATOM   1240 C  C   . LEU A 1 166 ? 34.330 62.167  1.223   1.00 98.69  ? 236 LEU A C   1 
ATOM   1241 O  O   . LEU A 1 166 ? 34.693 61.030  0.925   1.00 98.04  ? 236 LEU A O   1 
ATOM   1242 C  CB  . LEU A 1 166 ? 35.399 64.113  0.057   1.00 96.99  ? 236 LEU A CB  1 
ATOM   1243 C  CG  . LEU A 1 166 ? 36.775 63.405  -0.059  1.00 103.14 ? 236 LEU A CG  1 
ATOM   1244 C  CD1 . LEU A 1 166 ? 37.792 64.292  -0.744  1.00 105.32 ? 236 LEU A CD1 1 
ATOM   1245 C  CD2 . LEU A 1 166 ? 37.323 63.017  1.314   1.00 106.75 ? 236 LEU A CD2 1 
ATOM   1246 N  N   . ILE A 1 167 ? 34.086 62.567  2.487   1.00 95.88  ? 237 ILE A N   1 
ATOM   1247 C  CA  . ILE A 1 167 ? 34.271 61.722  3.671   1.00 96.19  ? 237 ILE A CA  1 
ATOM   1248 C  C   . ILE A 1 167 ? 33.310 60.529  3.704   1.00 98.25  ? 237 ILE A C   1 
ATOM   1249 O  O   . ILE A 1 167 ? 33.732 59.417  4.003   1.00 98.06  ? 237 ILE A O   1 
ATOM   1250 C  CB  . ILE A 1 167 ? 34.258 62.522  5.012   1.00 100.67 ? 237 ILE A CB  1 
ATOM   1251 C  CG1 . ILE A 1 167 ? 32.893 63.181  5.278   1.00 100.12 ? 237 ILE A CG1 1 
ATOM   1252 C  CG2 . ILE A 1 167 ? 35.406 63.550  5.025   1.00 103.45 ? 237 ILE A CG2 1 
ATOM   1253 C  CD1 . ILE A 1 167 ? 32.619 63.822  6.607   1.00 109.06 ? 237 ILE A CD1 1 
ATOM   1254 N  N   . TYR A 1 168 ? 32.046 60.748  3.349   1.00 93.22  ? 238 TYR A N   1 
ATOM   1255 C  CA  . TYR A 1 168 ? 31.021 59.705  3.330   1.00 91.54  ? 238 TYR A CA  1 
ATOM   1256 C  C   . TYR A 1 168 ? 31.311 58.656  2.267   1.00 94.45  ? 238 TYR A C   1 
ATOM   1257 O  O   . TYR A 1 168 ? 31.135 57.460  2.506   1.00 93.39  ? 238 TYR A O   1 
ATOM   1258 C  CB  . TYR A 1 168 ? 29.655 60.340  3.116   1.00 91.75  ? 238 TYR A CB  1 
ATOM   1259 C  CG  . TYR A 1 168 ? 29.045 60.854  4.394   1.00 94.25  ? 238 TYR A CG  1 
ATOM   1260 C  CD1 . TYR A 1 168 ? 29.674 61.846  5.145   1.00 97.74  ? 238 TYR A CD1 1 
ATOM   1261 C  CD2 . TYR A 1 168 ? 27.857 60.349  4.863   1.00 94.36  ? 238 TYR A CD2 1 
ATOM   1262 C  CE1 . TYR A 1 168 ? 29.113 62.326  6.316   1.00 99.18  ? 238 TYR A CE1 1 
ATOM   1263 C  CE2 . TYR A 1 168 ? 27.290 60.820  6.036   1.00 96.05  ? 238 TYR A CE2 1 
ATOM   1264 C  CZ  . TYR A 1 168 ? 27.907 61.814  6.751   1.00 104.63 ? 238 TYR A CZ  1 
ATOM   1265 O  OH  . TYR A 1 168 ? 27.304 62.240  7.901   1.00 106.02 ? 238 TYR A OH  1 
ATOM   1266 N  N   . LEU A 1 169 ? 31.799 59.121  1.108   1.00 91.06  ? 239 LEU A N   1 
ATOM   1267 C  CA  . LEU A 1 169 ? 32.162 58.289  -0.033  1.00 90.34  ? 239 LEU A CA  1 
ATOM   1268 C  C   . LEU A 1 169 ? 33.298 57.325  0.253   1.00 94.90  ? 239 LEU A C   1 
ATOM   1269 O  O   . LEU A 1 169 ? 33.214 56.172  -0.157  1.00 93.56  ? 239 LEU A O   1 
ATOM   1270 C  CB  . LEU A 1 169 ? 32.496 59.150  -1.254  1.00 90.91  ? 239 LEU A CB  1 
ATOM   1271 C  CG  . LEU A 1 169 ? 31.299 59.692  -2.013  1.00 94.68  ? 239 LEU A CG  1 
ATOM   1272 C  CD1 . LEU A 1 169 ? 31.720 60.768  -2.980  1.00 95.83  ? 239 LEU A CD1 1 
ATOM   1273 C  CD2 . LEU A 1 169 ? 30.558 58.574  -2.746  1.00 95.78  ? 239 LEU A CD2 1 
ATOM   1274 N  N   . SER A 1 170 ? 34.355 57.791  0.949   1.00 93.31  ? 240 SER A N   1 
ATOM   1275 C  CA  . SER A 1 170 ? 35.521 56.981  1.294   1.00 94.38  ? 240 SER A CA  1 
ATOM   1276 C  C   . SER A 1 170 ? 35.095 55.787  2.139   1.00 97.69  ? 240 SER A C   1 
ATOM   1277 O  O   . SER A 1 170 ? 35.524 54.670  1.865   1.00 97.32  ? 240 SER A O   1 
ATOM   1278 C  CB  . SER A 1 170 ? 36.558 57.810  2.042   1.00 100.19 ? 240 SER A CB  1 
ATOM   1279 O  OG  . SER A 1 170 ? 36.870 59.003  1.337   1.00 109.54 ? 240 SER A OG  1 
ATOM   1280 N  N   . ILE A 1 171 ? 34.220 56.024  3.142   1.00 93.89  ? 241 ILE A N   1 
ATOM   1281 C  CA  . ILE A 1 171 ? 33.716 54.985  4.042   1.00 93.42  ? 241 ILE A CA  1 
ATOM   1282 C  C   . ILE A 1 171 ? 33.011 53.898  3.255   1.00 95.55  ? 241 ILE A C   1 
ATOM   1283 O  O   . ILE A 1 171 ? 33.343 52.728  3.416   1.00 95.26  ? 241 ILE A O   1 
ATOM   1284 C  CB  . ILE A 1 171 ? 32.781 55.526  5.161   1.00 96.61  ? 241 ILE A CB  1 
ATOM   1285 C  CG1 . ILE A 1 171 ? 33.407 56.725  5.879   1.00 98.87  ? 241 ILE A CG1 1 
ATOM   1286 C  CG2 . ILE A 1 171 ? 32.430 54.412  6.169   1.00 97.52  ? 241 ILE A CG2 1 
ATOM   1287 C  CD1 . ILE A 1 171 ? 32.453 57.547  6.700   1.00 106.15 ? 241 ILE A CD1 1 
ATOM   1288 N  N   . VAL A 1 172 ? 32.066 54.286  2.381   1.00 90.62  ? 242 VAL A N   1 
ATOM   1289 C  CA  . VAL A 1 172 ? 31.302 53.341  1.567   1.00 88.89  ? 242 VAL A CA  1 
ATOM   1290 C  C   . VAL A 1 172 ? 32.213 52.502  0.696   1.00 92.90  ? 242 VAL A C   1 
ATOM   1291 O  O   . VAL A 1 172 ? 32.053 51.287  0.683   1.00 91.85  ? 242 VAL A O   1 
ATOM   1292 C  CB  . VAL A 1 172 ? 30.183 54.000  0.733   1.00 91.64  ? 242 VAL A CB  1 
ATOM   1293 C  CG1 . VAL A 1 172 ? 29.454 52.964  -0.118  1.00 90.11  ? 242 VAL A CG1 1 
ATOM   1294 C  CG2 . VAL A 1 172 ? 29.206 54.722  1.640   1.00 91.47  ? 242 VAL A CG2 1 
ATOM   1295 N  N   . CYS A 1 173 ? 33.166 53.140  -0.012  1.00 90.42  ? 243 CYS A N   1 
ATOM   1296 C  CA  . CYS A 1 173 ? 34.116 52.423  -0.860  1.00 90.65  ? 243 CYS A CA  1 
ATOM   1297 C  C   . CYS A 1 173 ? 34.992 51.486  -0.047  1.00 95.34  ? 243 CYS A C   1 
ATOM   1298 O  O   . CYS A 1 173 ? 35.100 50.321  -0.407  1.00 94.40  ? 243 CYS A O   1 
ATOM   1299 C  CB  . CYS A 1 173 ? 34.926 53.375  -1.727  1.00 92.14  ? 243 CYS A CB  1 
ATOM   1300 S  SG  . CYS A 1 173 ? 33.949 54.228  -2.984  1.00 95.04  ? 243 CYS A SG  1 
ATOM   1301 N  N   . VAL A 1 174 ? 35.549 51.956  1.082   1.00 93.38  ? 244 VAL A N   1 
ATOM   1302 C  CA  . VAL A 1 174 ? 36.367 51.097  1.944   1.00 94.55  ? 244 VAL A CA  1 
ATOM   1303 C  C   . VAL A 1 174 ? 35.525 49.901  2.400   1.00 96.90  ? 244 VAL A C   1 
ATOM   1304 O  O   . VAL A 1 174 ? 35.969 48.760  2.272   1.00 96.76  ? 244 VAL A O   1 
ATOM   1305 C  CB  . VAL A 1 174 ? 37.025 51.872  3.122   1.00 100.57 ? 244 VAL A CB  1 
ATOM   1306 C  CG1 . VAL A 1 174 ? 37.545 50.935  4.211   1.00 101.75 ? 244 VAL A CG1 1 
ATOM   1307 C  CG2 . VAL A 1 174 ? 38.150 52.758  2.607   1.00 102.11 ? 244 VAL A CG2 1 
ATOM   1308 N  N   . LEU A 1 175 ? 34.300 50.164  2.877   1.00 92.05  ? 245 LEU A N   1 
ATOM   1309 C  CA  . LEU A 1 175 ? 33.377 49.122  3.315   1.00 90.71  ? 245 LEU A CA  1 
ATOM   1310 C  C   . LEU A 1 175 ? 32.963 48.241  2.143   1.00 92.56  ? 245 LEU A C   1 
ATOM   1311 O  O   . LEU A 1 175 ? 32.854 47.032  2.296   1.00 91.78  ? 245 LEU A O   1 
ATOM   1312 C  CB  . LEU A 1 175 ? 32.156 49.723  4.036   1.00 90.23  ? 245 LEU A CB  1 
ATOM   1313 C  CG  . LEU A 1 175 ? 32.460 50.440  5.350   1.00 96.83  ? 245 LEU A CG  1 
ATOM   1314 C  CD1 . LEU A 1 175 ? 31.195 50.872  6.028   1.00 96.59  ? 245 LEU A CD1 1 
ATOM   1315 C  CD2 . LEU A 1 175 ? 33.280 49.543  6.288   1.00 101.24 ? 245 LEU A CD2 1 
ATOM   1316 N  N   . GLY A 1 176 ? 32.762 48.861  0.988   1.00 87.92  ? 246 GLY A N   1 
ATOM   1317 C  CA  . GLY A 1 176 ? 32.383 48.208  -0.258  1.00 86.29  ? 246 GLY A CA  1 
ATOM   1318 C  C   . GLY A 1 176 ? 33.437 47.265  -0.790  1.00 90.35  ? 246 GLY A C   1 
ATOM   1319 O  O   . GLY A 1 176 ? 33.123 46.127  -1.154  1.00 88.98  ? 246 GLY A O   1 
ATOM   1320 N  N   . ILE A 1 177 ? 34.703 47.733  -0.846  1.00 88.28  ? 247 ILE A N   1 
ATOM   1321 C  CA  . ILE A 1 177 ? 35.869 46.970  -1.305  1.00 88.96  ? 247 ILE A CA  1 
ATOM   1322 C  C   . ILE A 1 177 ? 36.004 45.820  -0.336  1.00 92.75  ? 247 ILE A C   1 
ATOM   1323 O  O   . ILE A 1 177 ? 36.140 44.668  -0.748  1.00 92.09  ? 247 ILE A O   1 
ATOM   1324 C  CB  . ILE A 1 177 ? 37.175 47.834  -1.385  1.00 94.20  ? 247 ILE A CB  1 
ATOM   1325 C  CG1 . ILE A 1 177 ? 37.195 48.738  -2.640  1.00 94.52  ? 247 ILE A CG1 1 
ATOM   1326 C  CG2 . ILE A 1 177 ? 38.430 46.942  -1.433  1.00 96.59  ? 247 ILE A CG2 1 
ATOM   1327 C  CD1 . ILE A 1 177 ? 35.969 49.544  -3.007  1.00 100.50 ? 247 ILE A CD1 1 
ATOM   1328 N  N   . SER A 1 178 ? 35.898 46.140  0.956   1.00 89.64  ? 248 SER A N   1 
ATOM   1329 C  CA  . SER A 1 178 ? 35.946 45.161  2.014   1.00 89.94  ? 248 SER A CA  1 
ATOM   1330 C  C   . SER A 1 178 ? 34.867 44.094  1.749   1.00 91.58  ? 248 SER A C   1 
ATOM   1331 O  O   . SER A 1 178 ? 35.190 42.924  1.808   1.00 91.37  ? 248 SER A O   1 
ATOM   1332 C  CB  . SER A 1 178 ? 35.760 45.834  3.369   1.00 94.44  ? 248 SER A CB  1 
ATOM   1333 O  OG  . SER A 1 178 ? 35.385 44.895  4.354   1.00 103.80 ? 248 SER A OG  1 
ATOM   1334 N  N   . ALA A 1 179 ? 33.624 44.497  1.377   1.00 86.25  ? 249 ALA A N   1 
ATOM   1335 C  CA  . ALA A 1 179 ? 32.515 43.569  1.106   1.00 84.48  ? 249 ALA A CA  1 
ATOM   1336 C  C   . ALA A 1 179 ? 32.788 42.601  -0.024  1.00 87.84  ? 249 ALA A C   1 
ATOM   1337 O  O   . ALA A 1 179 ? 32.619 41.394  0.163   1.00 86.93  ? 249 ALA A O   1 
ATOM   1338 C  CB  . ALA A 1 179 ? 31.213 44.320  0.859   1.00 83.90  ? 249 ALA A CB  1 
ATOM   1339 N  N   . ILE A 1 180 ? 33.214 43.120  -1.182  1.00 84.56  ? 250 ILE A N   1 
ATOM   1340 C  CA  . ILE A 1 180 ? 33.526 42.301  -2.346  1.00 84.06  ? 250 ILE A CA  1 
ATOM   1341 C  C   . ILE A 1 180 ? 34.661 41.342  -2.008  1.00 89.98  ? 250 ILE A C   1 
ATOM   1342 O  O   . ILE A 1 180 ? 34.528 40.143  -2.240  1.00 89.02  ? 250 ILE A O   1 
ATOM   1343 C  CB  . ILE A 1 180 ? 33.898 43.159  -3.580  1.00 87.27  ? 250 ILE A CB  1 
ATOM   1344 C  CG1 . ILE A 1 180 ? 32.804 44.186  -3.899  1.00 86.69  ? 250 ILE A CG1 1 
ATOM   1345 C  CG2 . ILE A 1 180 ? 34.202 42.270  -4.793  1.00 87.71  ? 250 ILE A CG2 1 
ATOM   1346 C  CD1 . ILE A 1 180 ? 33.225 45.201  -4.873  1.00 94.21  ? 250 ILE A CD1 1 
ATOM   1347 N  N   . ILE A 1 181 ? 35.766 41.881  -1.448  1.00 89.14  ? 251 ILE A N   1 
ATOM   1348 C  CA  . ILE A 1 181 ? 36.965 41.127  -1.079  1.00 91.00  ? 251 ILE A CA  1 
ATOM   1349 C  C   . ILE A 1 181 ? 36.629 40.043  -0.077  1.00 95.62  ? 251 ILE A C   1 
ATOM   1350 O  O   . ILE A 1 181 ? 37.057 38.905  -0.243  1.00 95.61  ? 251 ILE A O   1 
ATOM   1351 C  CB  . ILE A 1 181 ? 38.107 42.056  -0.568  1.00 96.39  ? 251 ILE A CB  1 
ATOM   1352 C  CG1 . ILE A 1 181 ? 38.609 43.007  -1.676  1.00 97.15  ? 251 ILE A CG1 1 
ATOM   1353 C  CG2 . ILE A 1 181 ? 39.275 41.278  0.075   1.00 99.34  ? 251 ILE A CG2 1 
ATOM   1354 C  CD1 . ILE A 1 181 ? 39.114 42.358  -2.995  1.00 104.74 ? 251 ILE A CD1 1 
ATOM   1355 N  N   . VAL A 1 182 ? 35.827 40.388  0.938   1.00 92.57  ? 252 VAL A N   1 
ATOM   1356 C  CA  . VAL A 1 182 ? 35.410 39.428  1.953   1.00 93.00  ? 252 VAL A CA  1 
ATOM   1357 C  C   . VAL A 1 182 ? 34.596 38.301  1.312   1.00 96.07  ? 252 VAL A C   1 
ATOM   1358 O  O   . VAL A 1 182 ? 34.874 37.131  1.562   1.00 96.16  ? 252 VAL A O   1 
ATOM   1359 C  CB  . VAL A 1 182 ? 34.652 40.075  3.138   1.00 97.12  ? 252 VAL A CB  1 
ATOM   1360 C  CG1 . VAL A 1 182 ? 34.119 39.017  4.074   1.00 97.29  ? 252 VAL A CG1 1 
ATOM   1361 C  CG2 . VAL A 1 182 ? 35.550 41.032  3.903   1.00 99.01  ? 252 VAL A CG2 1 
ATOM   1362 N  N   . ALA A 1 183 ? 33.615 38.657  0.459   1.00 91.55  ? 253 ALA A N   1 
ATOM   1363 C  CA  . ALA A 1 183 ? 32.749 37.684  -0.212  1.00 90.22  ? 253 ALA A CA  1 
ATOM   1364 C  C   . ALA A 1 183 ? 33.455 36.775  -1.205  1.00 95.12  ? 253 ALA A C   1 
ATOM   1365 O  O   . ALA A 1 183 ? 33.292 35.562  -1.129  1.00 94.43  ? 253 ALA A O   1 
ATOM   1366 C  CB  . ALA A 1 183 ? 31.586 38.387  -0.891  1.00 89.39  ? 253 ALA A CB  1 
ATOM   1367 N  N   . GLN A 1 184 ? 34.240 37.351  -2.132  1.00 92.89  ? 254 GLN A N   1 
ATOM   1368 C  CA  . GLN A 1 184 ? 34.973 36.556  -3.118  1.00 93.26  ? 254 GLN A CA  1 
ATOM   1369 C  C   . GLN A 1 184 ? 36.124 35.793  -2.528  1.00 99.49  ? 254 GLN A C   1 
ATOM   1370 O  O   . GLN A 1 184 ? 36.325 34.639  -2.883  1.00 98.89  ? 254 GLN A O   1 
ATOM   1371 C  CB  . GLN A 1 184 ? 35.468 37.405  -4.285  1.00 94.94  ? 254 GLN A CB  1 
ATOM   1372 C  CG  . GLN A 1 184 ? 34.505 37.419  -5.454  1.00 110.47 ? 254 GLN A CG  1 
ATOM   1373 C  CD  . GLN A 1 184 ? 35.025 38.206  -6.629  1.00 131.80 ? 254 GLN A CD  1 
ATOM   1374 O  OE1 . GLN A 1 184 ? 34.258 38.594  -7.509  1.00 126.74 ? 254 GLN A OE1 1 
ATOM   1375 N  NE2 . GLN A 1 184 ? 36.330 38.451  -6.673  1.00 126.22 ? 254 GLN A NE2 1 
ATOM   1376 N  N   . TRP A 1 185 ? 36.913 36.455  -1.667  1.00 98.53  ? 255 TRP A N   1 
ATOM   1377 C  CA  . TRP A 1 185 ? 38.082 35.894  -0.987  1.00 100.82 ? 255 TRP A CA  1 
ATOM   1378 C  C   . TRP A 1 185 ? 39.019 35.132  -1.920  1.00 105.85 ? 255 TRP A C   1 
ATOM   1379 O  O   . TRP A 1 185 ? 39.657 34.160  -1.508  1.00 106.87 ? 255 TRP A O   1 
ATOM   1380 C  CB  . TRP A 1 185 ? 37.677 35.047  0.223   1.00 99.88  ? 255 TRP A CB  1 
ATOM   1381 C  CG  . TRP A 1 185 ? 36.583 34.054  -0.019  1.00 98.90  ? 255 TRP A CG  1 
ATOM   1382 C  CD1 . TRP A 1 185 ? 35.285 34.165  0.375   0.00 100.43 ? 255 TRP A CD1 1 
ATOM   1383 C  CD2 . TRP A 1 185 ? 36.696 32.781  -0.669  0.00 98.43  ? 255 TRP A CD2 1 
ATOM   1384 N  NE1 . TRP A 1 185 ? 34.580 33.046  0.010   0.00 98.62  ? 255 TRP A NE1 1 
ATOM   1385 C  CE2 . TRP A 1 185 ? 35.428 32.166  -0.604  0.00 100.53 ? 255 TRP A CE2 1 
ATOM   1386 C  CE3 . TRP A 1 185 ? 37.761 32.067  -1.246  0.00 100.60 ? 255 TRP A CE3 1 
ATOM   1387 C  CZ2 . TRP A 1 185 ? 35.208 30.867  -1.048  0.00 99.16  ? 255 TRP A CZ2 1 
ATOM   1388 C  CZ3 . TRP A 1 185 ? 37.511 30.820  -1.778  0.00 101.42 ? 255 TRP A CZ3 1 
ATOM   1389 C  CH2 . TRP A 1 185 ? 36.253 30.227  -1.668  0.00 100.11 ? 255 TRP A CH2 1 
ATOM   1390 N  N   . ASP A 1 186 ? 39.098 35.581  -3.180  1.00 101.70 ? 256 ASP A N   1 
ATOM   1391 C  CA  . ASP A 1 186 ? 39.927 34.938  -4.198  1.00 102.15 ? 256 ASP A CA  1 
ATOM   1392 C  C   . ASP A 1 186 ? 41.392 34.948  -3.823  1.00 107.97 ? 256 ASP A C   1 
ATOM   1393 O  O   . ASP A 1 186 ? 42.099 33.944  -3.967  1.00 107.22 ? 256 ASP A O   1 
ATOM   1394 C  CB  . ASP A 1 186 ? 39.699 35.552  -5.600  1.00 103.29 ? 256 ASP A CB  1 
ATOM   1395 C  CG  . ASP A 1 186 ? 40.116 37.001  -5.824  1.00 115.17 ? 256 ASP A CG  1 
ATOM   1396 O  OD1 . ASP A 1 186 ? 40.447 37.694  -4.829  1.00 116.60 ? 256 ASP A OD1 1 
ATOM   1397 O  OD2 . ASP A 1 186 ? 40.047 37.467  -6.994  1.00 120.71 ? 256 ASP A OD2 1 
ATOM   1398 N  N   . ARG A 1 187 ? 41.830 36.113  -3.331  1.00 107.08 ? 257 ARG A N   1 
ATOM   1399 C  CA  . ARG A 1 187 ? 43.188 36.376  -2.898  1.00 110.19 ? 257 ARG A CA  1 
ATOM   1400 C  C   . ARG A 1 187 ? 43.574 35.583  -1.670  1.00 115.74 ? 257 ARG A C   1 
ATOM   1401 O  O   . ARG A 1 187 ? 44.555 34.840  -1.722  1.00 116.23 ? 257 ARG A O   1 
ATOM   1402 C  CB  . ARG A 1 187 ? 43.440 37.878  -2.705  1.00 110.35 ? 257 ARG A CB  1 
ATOM   1403 C  CG  . ARG A 1 187 ? 43.369 38.674  -4.002  0.00 101.92 ? 257 ARG A CG  1 
ATOM   1404 C  CD  . ARG A 1 187 ? 43.449 40.164  -3.762  0.00 94.55  ? 257 ARG A CD  1 
ATOM   1405 N  NE  . ARG A 1 187 ? 43.194 40.949  -4.973  0.00 82.24  ? 257 ARG A NE  1 
ATOM   1406 C  CZ  . ARG A 1 187 ? 42.876 42.239  -4.973  0.00 82.64  ? 257 ARG A CZ  1 
ATOM   1407 N  NH1 . ARG A 1 187 ? 42.759 42.905  -3.828  0.00 64.68  ? 257 ARG A NH1 1 
ATOM   1408 N  NH2 . ARG A 1 187 ? 42.662 42.877  -6.118  0.00 63.36  ? 257 ARG A NH2 1 
ATOM   1409 N  N   . PHE A 1 188 ? 42.760 35.655  -0.609  1.00 113.30 ? 258 PHE A N   1 
ATOM   1410 C  CA  . PHE A 1 188 ? 43.028 34.931  0.628   1.00 115.81 ? 258 PHE A CA  1 
ATOM   1411 C  C   . PHE A 1 188 ? 41.837 34.695  1.553   1.00 120.52 ? 258 PHE A C   1 
ATOM   1412 O  O   . PHE A 1 188 ? 40.849 35.436  1.546   1.00 118.77 ? 258 PHE A O   1 
ATOM   1413 C  CB  . PHE A 1 188 ? 44.120 35.649  1.434   1.00 120.92 ? 258 PHE A CB  1 
ATOM   1414 C  CG  . PHE A 1 188 ? 45.514 35.179  1.121   0.00 125.49 ? 258 PHE A CG  1 
ATOM   1415 C  CD1 . PHE A 1 188 ? 45.996 33.990  1.646   0.00 130.38 ? 258 PHE A CD1 1 
ATOM   1416 C  CD2 . PHE A 1 188 ? 46.342 35.922  0.293   0.00 129.02 ? 258 PHE A CD2 1 
ATOM   1417 C  CE1 . PHE A 1 188 ? 47.273 33.541  1.333   0.00 134.15 ? 258 PHE A CE1 1 
ATOM   1418 C  CE2 . PHE A 1 188 ? 47.615 35.470  -0.032  0.00 134.75 ? 258 PHE A CE2 1 
ATOM   1419 C  CZ  . PHE A 1 188 ? 48.079 34.285  0.496   0.00 134.50 ? 258 PHE A CZ  1 
ATOM   1420 N  N   . ALA A 1 189 ? 41.998 33.662  2.406   1.00 119.36 ? 259 ALA A N   1 
ATOM   1421 C  CA  . ALA A 1 189 ? 41.115 33.199  3.483   1.00 119.34 ? 259 ALA A CA  1 
ATOM   1422 C  C   . ALA A 1 189 ? 39.818 32.506  3.001   1.00 122.06 ? 259 ALA A C   1 
ATOM   1423 O  O   . ALA A 1 189 ? 39.479 32.508  1.823   1.00 119.96 ? 259 ALA A O   1 
ATOM   1424 C  CB  . ALA A 1 189 ? 40.767 34.351  4.416   1.00 120.53 ? 259 ALA A CB  1 
ATOM   1425 N  N   . THR A 1 190 ? 39.118 31.896  3.959   1.00 119.66 ? 260 THR A N   1 
ATOM   1426 C  CA  . THR A 1 190 ? 37.793 31.206  3.923   1.00 117.83 ? 260 THR A CA  1 
ATOM   1427 C  C   . THR A 1 190 ? 37.786 29.787  3.273   1.00 122.31 ? 260 THR A C   1 
ATOM   1428 O  O   . THR A 1 190 ? 38.709 29.423  2.568   1.00 122.51 ? 260 THR A O   1 
ATOM   1429 C  CB  . THR A 1 190 ? 36.690 32.064  3.290   1.00 124.09 ? 260 THR A CB  1 
ATOM   1430 O  OG1 . THR A 1 190 ? 36.938 32.179  1.917   1.00 123.00 ? 260 THR A OG1 1 
ATOM   1431 C  CG2 . THR A 1 190 ? 36.525 33.428  3.972   1.00 123.03 ? 260 THR A CG2 1 
ATOM   1432 N  N   . PRO A 1 191 ? 36.726 28.944  3.537   1.00 118.33 ? 261 PRO A N   1 
ATOM   1433 C  CA  . PRO A 1 191 ? 35.614 29.286  4.413   1.00 117.99 ? 261 PRO A CA  1 
ATOM   1434 C  C   . PRO A 1 191 ? 36.079 29.237  5.854   1.00 125.28 ? 261 PRO A C   1 
ATOM   1435 O  O   . PRO A 1 191 ? 37.019 28.510  6.158   1.00 127.12 ? 261 PRO A O   1 
ATOM   1436 C  CB  . PRO A 1 191 ? 34.582 28.204  4.078   1.00 118.09 ? 261 PRO A CB  1 
ATOM   1437 C  CG  . PRO A 1 191 ? 35.394 27.025  3.725   1.00 123.44 ? 261 PRO A CG  1 
ATOM   1438 C  CD  . PRO A 1 191 ? 36.598 27.568  2.998   1.00 119.32 ? 261 PRO A CD  1 
ATOM   1439 N  N   . LYS A 1 192 ? 35.522 30.070  6.706   1.00 122.58 ? 262 LYS A N   1 
ATOM   1440 C  CA  . LYS A 1 192 ? 35.981 30.079  8.083   1.00 125.48 ? 262 LYS A CA  1 
ATOM   1441 C  C   . LYS A 1 192 ? 34.813 30.085  9.042   1.00 130.42 ? 262 LYS A C   1 
ATOM   1442 O  O   . LYS A 1 192 ? 33.681 30.423  8.673   1.00 127.93 ? 262 LYS A O   1 
ATOM   1443 C  CB  . LYS A 1 192 ? 36.879 31.299  8.355   1.00 129.27 ? 262 LYS A CB  1 
ATOM   1444 C  CG  . LYS A 1 192 ? 38.182 31.392  7.567   1.00 141.62 ? 262 LYS A CG  1 
ATOM   1445 C  CD  . LYS A 1 192 ? 39.205 30.355  7.990   1.00 151.84 ? 262 LYS A CD  1 
ATOM   1446 C  CE  . LYS A 1 192 ? 40.379 30.322  7.051   1.00 160.49 ? 262 LYS A CE  1 
ATOM   1447 N  NZ  . LYS A 1 192 ? 41.295 29.202  7.381   1.00 170.70 ? 262 LYS A NZ  1 
ATOM   1448 N  N   . HIS A 1 193 ? 35.117 29.712  10.290  1.00 130.21 ? 263 HIS A N   1 
ATOM   1449 C  CA  . HIS A 1 193 ? 34.225 29.703  11.441  1.00 131.56 ? 263 HIS A CA  1 
ATOM   1450 C  C   . HIS A 1 193 ? 33.717 31.146  11.620  1.00 134.81 ? 263 HIS A C   1 
ATOM   1451 O  O   . HIS A 1 193 ? 32.572 31.358  12.015  1.00 133.93 ? 263 HIS A O   1 
ATOM   1452 C  CB  . HIS A 1 193 ? 35.038 29.287  12.688  1.00 136.31 ? 263 HIS A CB  1 
ATOM   1453 C  CG  . HIS A 1 193 ? 36.201 30.218  12.989  1.00 141.62 ? 263 HIS A CG  1 
ATOM   1454 N  ND1 . HIS A 1 193 ? 37.241 30.376  12.086  1.00 142.92 ? 263 HIS A ND1 1 
ATOM   1455 C  CD2 . HIS A 1 193 ? 36.412 31.022  14.052  1.00 145.63 ? 263 HIS A CD2 1 
ATOM   1456 C  CE1 . HIS A 1 193 ? 38.052 31.254  12.628  1.00 144.54 ? 263 HIS A CE1 1 
ATOM   1457 N  NE2 . HIS A 1 193 ? 37.610 31.678  13.810  1.00 146.48 ? 263 HIS A NE2 1 
ATOM   1458 N  N   . ARG A 1 194 ? 34.591 32.124  11.290  1.00 132.00 ? 264 ARG A N   1 
ATOM   1459 C  CA  . ARG A 1 194 ? 34.358 33.561  11.360  1.00 131.53 ? 264 ARG A CA  1 
ATOM   1460 C  C   . ARG A 1 194 ? 33.173 34.018  10.521  1.00 132.35 ? 264 ARG A C   1 
ATOM   1461 O  O   . ARG A 1 194 ? 32.926 33.531  9.415   1.00 129.72 ? 264 ARG A O   1 
ATOM   1462 C  CB  . ARG A 1 194 ? 35.625 34.347  10.988  1.00 132.64 ? 264 ARG A CB  1 
ATOM   1463 C  CG  . ARG A 1 194 ? 35.991 34.287  9.511   1.00 139.64 ? 264 ARG A CG  1 
ATOM   1464 C  CD  . ARG A 1 194 ? 37.381 34.782  9.245   1.00 149.94 ? 264 ARG A CD  1 
ATOM   1465 N  NE  . ARG A 1 194 ? 37.549 35.055  7.821   1.00 155.05 ? 264 ARG A NE  1 
ATOM   1466 C  CZ  . ARG A 1 194 ? 38.647 35.554  7.280   1.00 169.38 ? 264 ARG A CZ  1 
ATOM   1467 N  NH1 . ARG A 1 194 ? 39.701 35.839  8.038   1.00 159.68 ? 264 ARG A NH1 1 
ATOM   1468 N  NH2 . ARG A 1 194 ? 38.706 35.783  5.977   1.00 153.86 ? 264 ARG A NH2 1 
ATOM   1469 N  N   . GLN A 1 195 ? 32.428 34.933  11.108  1.00 129.12 ? 265 GLN A N   1 
ATOM   1470 C  CA  . GLN A 1 195 ? 31.233 35.521  10.555  1.00 126.58 ? 265 GLN A CA  1 
ATOM   1471 C  C   . GLN A 1 195 ? 31.507 36.986  10.151  1.00 129.61 ? 265 GLN A C   1 
ATOM   1472 O  O   . GLN A 1 195 ? 30.585 37.789  10.011  1.00 128.02 ? 265 GLN A O   1 
ATOM   1473 C  CB  . GLN A 1 195 ? 30.186 35.426  11.647  1.00 129.08 ? 265 GLN A CB  1 
ATOM   1474 C  CG  . GLN A 1 195 ? 28.892 36.042  11.249  1.00 144.30 ? 265 GLN A CG  1 
ATOM   1475 C  CD  . GLN A 1 195 ? 27.915 36.144  12.362  1.00 166.86 ? 265 GLN A CD  1 
ATOM   1476 O  OE1 . GLN A 1 195 ? 28.236 36.008  13.556  1.00 165.25 ? 265 GLN A OE1 1 
ATOM   1477 N  NE2 . GLN A 1 195 ? 26.681 36.201  11.937  1.00 158.20 ? 265 GLN A NE2 1 
ATOM   1478 N  N   . THR A 1 196 ? 32.792 37.320  9.951   1.00 126.92 ? 266 THR A N   1 
ATOM   1479 C  CA  . THR A 1 196 ? 33.242 38.677  9.612   1.00 126.36 ? 266 THR A CA  1 
ATOM   1480 C  C   . THR A 1 196 ? 32.655 39.238  8.297   1.00 127.01 ? 266 THR A C   1 
ATOM   1481 O  O   . THR A 1 196 ? 32.393 40.443  8.233   1.00 126.21 ? 266 THR A O   1 
ATOM   1482 C  CB  . THR A 1 196 ? 34.765 38.786  9.632   1.00 136.22 ? 266 THR A CB  1 
ATOM   1483 O  OG1 . THR A 1 196 ? 35.182 38.592  10.983  1.00 138.50 ? 266 THR A OG1 1 
ATOM   1484 C  CG2 . THR A 1 196 ? 35.266 40.169  9.158   1.00 134.72 ? 266 THR A CG2 1 
ATOM   1485 N  N   . ARG A 1 197 ? 32.406 38.383  7.282   1.00 121.38 ? 267 ARG A N   1 
ATOM   1486 C  CA  . ARG A 1 197 ? 31.797 38.842  6.032   1.00 118.58 ? 267 ARG A CA  1 
ATOM   1487 C  C   . ARG A 1 197 ? 30.583 39.681  6.410   1.00 121.56 ? 267 ARG A C   1 
ATOM   1488 O  O   . ARG A 1 197 ? 30.359 40.748  5.835   1.00 120.13 ? 267 ARG A O   1 
ATOM   1489 C  CB  . ARG A 1 197 ? 31.380 37.653  5.151   1.00 117.19 ? 267 ARG A CB  1 
ATOM   1490 C  CG  . ARG A 1 197 ? 30.485 38.066  3.993   1.00 124.60 ? 267 ARG A CG  1 
ATOM   1491 C  CD  . ARG A 1 197 ? 29.352 37.099  3.850   1.00 131.94 ? 267 ARG A CD  1 
ATOM   1492 N  NE  . ARG A 1 197 ? 29.574 36.223  2.704   1.00 137.73 ? 267 ARG A NE  1 
ATOM   1493 C  CZ  . ARG A 1 197 ? 28.898 35.109  2.469   1.00 150.05 ? 267 ARG A CZ  1 
ATOM   1494 N  NH1 . ARG A 1 197 ? 29.162 34.378  1.394   1.00 136.42 ? 267 ARG A NH1 1 
ATOM   1495 N  NH2 . ARG A 1 197 ? 27.950 34.708  3.309   1.00 136.43 ? 267 ARG A NH2 1 
ATOM   1496 N  N   . ALA A 1 198 ? 29.842 39.199  7.427   1.00 118.88 ? 268 ALA A N   1 
ATOM   1497 C  CA  . ALA A 1 198 ? 28.658 39.826  7.997   1.00 118.56 ? 268 ALA A CA  1 
ATOM   1498 C  C   . ALA A 1 198 ? 28.972 41.216  8.554   1.00 122.86 ? 268 ALA A C   1 
ATOM   1499 O  O   . ALA A 1 198 ? 28.185 42.127  8.337   1.00 121.45 ? 268 ALA A O   1 
ATOM   1500 C  CB  . ALA A 1 198 ? 28.049 38.937  9.075   1.00 120.65 ? 268 ALA A CB  1 
ATOM   1501 N  N   . GLY A 1 199 ? 30.125 41.372  9.211   1.00 121.07 ? 269 GLY A N   1 
ATOM   1502 C  CA  . GLY A 1 199 ? 30.581 42.646  9.768   1.00 121.85 ? 269 GLY A CA  1 
ATOM   1503 C  C   . GLY A 1 199 ? 30.716 43.695  8.685   1.00 123.36 ? 269 GLY A C   1 
ATOM   1504 O  O   . GLY A 1 199 ? 30.241 44.822  8.834   1.00 122.68 ? 269 GLY A O   1 
ATOM   1505 N  N   . VAL A 1 200 ? 31.323 43.320  7.563   1.00 118.44 ? 270 VAL A N   1 
ATOM   1506 C  CA  . VAL A 1 200 ? 31.458 44.226  6.425   1.00 116.76 ? 270 VAL A CA  1 
ATOM   1507 C  C   . VAL A 1 200 ? 30.099 44.557  5.812   1.00 118.07 ? 270 VAL A C   1 
ATOM   1508 O  O   . VAL A 1 200 ? 29.848 45.712  5.456   1.00 117.18 ? 270 VAL A O   1 
ATOM   1509 C  CB  . VAL A 1 200 ? 32.439 43.682  5.388   1.00 120.40 ? 270 VAL A CB  1 
ATOM   1510 C  CG1 . VAL A 1 200 ? 32.335 44.458  4.099   1.00 118.72 ? 270 VAL A CG1 1 
ATOM   1511 C  CG2 . VAL A 1 200 ? 33.848 43.746  5.933   1.00 122.48 ? 270 VAL A CG2 1 
ATOM   1512 N  N   . PHE A 1 201 ? 29.230 43.536  5.678   1.00 113.30 ? 271 PHE A N   1 
ATOM   1513 C  CA  . PHE A 1 201 ? 27.871 43.716  5.175   1.00 111.39 ? 271 PHE A CA  1 
ATOM   1514 C  C   . PHE A 1 201 ? 27.190 44.716  6.114   1.00 114.72 ? 271 PHE A C   1 
ATOM   1515 O  O   . PHE A 1 201 ? 26.495 45.617  5.651   1.00 113.31 ? 271 PHE A O   1 
ATOM   1516 C  CB  . PHE A 1 201 ? 27.106 42.363  5.106   1.00 112.74 ? 271 PHE A CB  1 
ATOM   1517 C  CG  . PHE A 1 201 ? 25.641 42.402  5.505   1.00 114.31 ? 271 PHE A CG  1 
ATOM   1518 C  CD1 . PHE A 1 201 ? 24.778 43.346  4.959   1.00 116.70 ? 271 PHE A CD1 1 
ATOM   1519 C  CD2 . PHE A 1 201 ? 25.122 41.478  6.402   1.00 117.40 ? 271 PHE A CD2 1 
ATOM   1520 C  CE1 . PHE A 1 201 ? 23.451 43.414  5.352   1.00 117.77 ? 271 PHE A CE1 1 
ATOM   1521 C  CE2 . PHE A 1 201 ? 23.780 41.522  6.771   1.00 120.40 ? 271 PHE A CE2 1 
ATOM   1522 C  CZ  . PHE A 1 201 ? 22.950 42.491  6.243   1.00 117.80 ? 271 PHE A CZ  1 
ATOM   1523 N  N   . LEU A 1 202 ? 27.413 44.561  7.428   1.00 112.35 ? 272 LEU A N   1 
ATOM   1524 C  CA  . LEU A 1 202 ? 26.863 45.438  8.453   1.00 112.85 ? 272 LEU A CA  1 
ATOM   1525 C  C   . LEU A 1 202 ? 27.308 46.884  8.204   1.00 114.99 ? 272 LEU A C   1 
ATOM   1526 O  O   . LEU A 1 202 ? 26.482 47.786  8.266   1.00 114.16 ? 272 LEU A O   1 
ATOM   1527 C  CB  . LEU A 1 202 ? 27.230 44.940  9.862   1.00 115.26 ? 272 LEU A CB  1 
ATOM   1528 C  CG  . LEU A 1 202 ? 26.243 45.283  10.961  1.00 121.29 ? 272 LEU A CG  1 
ATOM   1529 C  CD1 . LEU A 1 202 ? 26.454 44.428  12.156  1.00 123.86 ? 272 LEU A CD1 1 
ATOM   1530 C  CD2 . LEU A 1 202 ? 26.533 46.586  11.498  1.00 123.56 ? 272 LEU A CD2 1 
ATOM   1531 N  N   . GLY A 1 203 ? 28.565 47.066  7.815   1.00 110.87 ? 273 GLY A N   1 
ATOM   1532 C  CA  . GLY A 1 203 ? 29.114 48.377  7.483   1.00 110.46 ? 273 GLY A CA  1 
ATOM   1533 C  C   . GLY A 1 203 ? 28.317 49.130  6.436   1.00 111.47 ? 273 GLY A C   1 
ATOM   1534 O  O   . GLY A 1 203 ? 28.051 50.320  6.607   1.00 111.27 ? 273 GLY A O   1 
ATOM   1535 N  N   . LEU A 1 204 ? 27.909 48.441  5.356   1.00 105.54 ? 274 LEU A N   1 
ATOM   1536 C  CA  . LEU A 1 204 ? 27.149 49.005  4.236   1.00 103.53 ? 274 LEU A CA  1 
ATOM   1537 C  C   . LEU A 1 204 ? 25.795 49.596  4.630   1.00 106.19 ? 274 LEU A C   1 
ATOM   1538 O  O   . LEU A 1 204 ? 25.514 50.751  4.307   1.00 105.60 ? 274 LEU A O   1 
ATOM   1539 C  CB  . LEU A 1 204 ? 26.977 47.957  3.124   1.00 102.29 ? 274 LEU A CB  1 
ATOM   1540 C  CG  . LEU A 1 204 ? 28.005 47.968  1.990   1.00 106.67 ? 274 LEU A CG  1 
ATOM   1541 C  CD1 . LEU A 1 204 ? 29.417 47.780  2.500   1.00 108.16 ? 274 LEU A CD1 1 
ATOM   1542 C  CD2 . LEU A 1 204 ? 27.712 46.871  1.000   1.00 107.97 ? 274 LEU A CD2 1 
ATOM   1543 N  N   . GLY A 1 205 ? 24.983 48.802  5.319   1.00 102.09 ? 275 GLY A N   1 
ATOM   1544 C  CA  . GLY A 1 205 ? 23.670 49.234  5.792   1.00 101.64 ? 275 GLY A CA  1 
ATOM   1545 C  C   . GLY A 1 205 ? 23.785 50.338  6.818   1.00 105.54 ? 275 GLY A C   1 
ATOM   1546 O  O   . GLY A 1 205 ? 23.066 51.340  6.749   1.00 105.10 ? 275 GLY A O   1 
ATOM   1547 N  N   . LEU A 1 206 ? 24.715 50.170  7.763   1.00 102.28 ? 276 LEU A N   1 
ATOM   1548 C  CA  . LEU A 1 206 ? 24.941 51.120  8.853   1.00 103.13 ? 276 LEU A CA  1 
ATOM   1549 C  C   . LEU A 1 206 ? 25.557 52.434  8.453   1.00 105.52 ? 276 LEU A C   1 
ATOM   1550 O  O   . LEU A 1 206 ? 25.218 53.457  9.048   1.00 106.00 ? 276 LEU A O   1 
ATOM   1551 C  CB  . LEU A 1 206 ? 25.776 50.520  9.969   1.00 104.90 ? 276 LEU A CB  1 
ATOM   1552 C  CG  . LEU A 1 206 ? 25.374 49.193  10.539  1.00 110.06 ? 276 LEU A CG  1 
ATOM   1553 C  CD1 . LEU A 1 206 ? 26.082 48.994  11.831  1.00 112.54 ? 276 LEU A CD1 1 
ATOM   1554 C  CD2 . LEU A 1 206 ? 23.861 49.052  10.741  1.00 112.49 ? 276 LEU A CD2 1 
ATOM   1555 N  N   . SER A 1 207 ? 26.478 52.417  7.462   1.00 99.95  ? 277 SER A N   1 
ATOM   1556 C  CA  . SER A 1 207 ? 27.144 53.628  6.977   1.00 99.17  ? 277 SER A CA  1 
ATOM   1557 C  C   . SER A 1 207 ? 26.120 54.616  6.471   1.00 100.58 ? 277 SER A C   1 
ATOM   1558 O  O   . SER A 1 207 ? 26.317 55.806  6.639   1.00 100.93 ? 277 SER A O   1 
ATOM   1559 C  CB  . SER A 1 207 ? 28.149 53.323  5.872   1.00 102.07 ? 277 SER A CB  1 
ATOM   1560 O  OG  . SER A 1 207 ? 28.738 54.525  5.396   1.00 111.46 ? 277 SER A OG  1 
ATOM   1561 N  N   . GLY A 1 208 ? 25.041 54.102  5.885   1.00 94.34  ? 278 GLY A N   1 
ATOM   1562 C  CA  . GLY A 1 208 ? 23.937 54.883  5.336   1.00 92.73  ? 278 GLY A CA  1 
ATOM   1563 C  C   . GLY A 1 208 ? 23.203 55.775  6.314   1.00 95.49  ? 278 GLY A C   1 
ATOM   1564 O  O   . GLY A 1 208 ? 22.765 56.857  5.924   1.00 94.84  ? 278 GLY A O   1 
ATOM   1565 N  N   . VAL A 1 209 ? 23.067 55.353  7.588   1.00 91.70  ? 279 VAL A N   1 
ATOM   1566 C  CA  . VAL A 1 209 ? 22.344 56.071  8.659   1.00 91.97  ? 279 VAL A CA  1 
ATOM   1567 C  C   . VAL A 1 209 ? 22.993 57.429  9.049   1.00 94.76  ? 279 VAL A C   1 
ATOM   1568 O  O   . VAL A 1 209 ? 22.269 58.421  9.146   1.00 94.51  ? 279 VAL A O   1 
ATOM   1569 C  CB  . VAL A 1 209 ? 22.073 55.172  9.899   1.00 97.10  ? 279 VAL A CB  1 
ATOM   1570 C  CG1 . VAL A 1 209 ? 21.490 55.961  11.066  1.00 98.58  ? 279 VAL A CG1 1 
ATOM   1571 C  CG2 . VAL A 1 209 ? 21.136 54.034  9.533   1.00 96.22  ? 279 VAL A CG2 1 
ATOM   1572 N  N   . VAL A 1 210 ? 24.323 57.465  9.284   1.00 90.44  ? 280 VAL A N   1 
ATOM   1573 C  CA  . VAL A 1 210 ? 25.064 58.690  9.611   1.00 90.63  ? 280 VAL A CA  1 
ATOM   1574 C  C   . VAL A 1 210 ? 24.799 59.750  8.508   1.00 92.17  ? 280 VAL A C   1 
ATOM   1575 O  O   . VAL A 1 210 ? 24.352 60.838  8.854   1.00 92.36  ? 280 VAL A O   1 
ATOM   1576 C  CB  . VAL A 1 210 ? 26.591 58.429  9.779   1.00 95.17  ? 280 VAL A CB  1 
ATOM   1577 C  CG1 . VAL A 1 210 ? 27.361 59.720  10.016  1.00 96.01  ? 280 VAL A CG1 1 
ATOM   1578 C  CG2 . VAL A 1 210 ? 26.867 57.432  10.895  1.00 96.30  ? 280 VAL A CG2 1 
ATOM   1579 N  N   . PRO A 1 211 ? 24.978 59.434  7.197   1.00 86.38  ? 281 PRO A N   1 
ATOM   1580 C  CA  . PRO A 1 211 ? 24.728 60.441  6.133   1.00 85.16  ? 281 PRO A CA  1 
ATOM   1581 C  C   . PRO A 1 211 ? 23.317 60.936  6.035   1.00 87.57  ? 281 PRO A C   1 
ATOM   1582 O  O   . PRO A 1 211 ? 23.098 62.123  5.802   1.00 87.46  ? 281 PRO A O   1 
ATOM   1583 C  CB  . PRO A 1 211 ? 25.009 59.680  4.818   1.00 85.81  ? 281 PRO A CB  1 
ATOM   1584 C  CG  . PRO A 1 211 ? 25.135 58.277  5.177   1.00 90.09  ? 281 PRO A CG  1 
ATOM   1585 C  CD  . PRO A 1 211 ? 25.450 58.165  6.627   1.00 87.02  ? 281 PRO A CD  1 
ATOM   1586 N  N   . THR A 1 212 ? 22.372 59.989  6.063   1.00 82.92  ? 282 THR A N   1 
ATOM   1587 C  CA  . THR A 1 212 ? 20.961 60.284  5.900   1.00 82.30  ? 282 THR A CA  1 
ATOM   1588 C  C   . THR A 1 212 ? 20.469 61.217  6.980   1.00 86.25  ? 282 THR A C   1 
ATOM   1589 O  O   . THR A 1 212 ? 19.810 62.197  6.650   1.00 85.93  ? 282 THR A O   1 
ATOM   1590 C  CB  . THR A 1 212 ? 20.072 59.026  5.756   1.00 90.00  ? 282 THR A CB  1 
ATOM   1591 O  OG1 . THR A 1 212 ? 18.770 59.334  6.249   1.00 90.33  ? 282 THR A OG1 1 
ATOM   1592 C  CG2 . THR A 1 212 ? 20.560 57.873  6.569   1.00 89.10  ? 282 THR A CG2 1 
ATOM   1593 N  N   . MET A 1 213 ? 20.793 60.943  8.257   1.00 83.04  ? 283 MET A N   1 
ATOM   1594 C  CA  . MET A 1 213 ? 20.379 61.816  9.362   1.00 83.92  ? 283 MET A CA  1 
ATOM   1595 C  C   . MET A 1 213 ? 21.093 63.156  9.299   1.00 86.70  ? 283 MET A C   1 
ATOM   1596 O  O   . MET A 1 213 ? 20.487 64.182  9.586   1.00 86.92  ? 283 MET A O   1 
ATOM   1597 C  CB  . MET A 1 213 ? 20.566 61.154  10.733  1.00 87.67  ? 283 MET A CB  1 
ATOM   1598 C  CG  . MET A 1 213 ? 22.005 60.909  11.129  1.00 91.89  ? 283 MET A CG  1 
ATOM   1599 S  SD  . MET A 1 213 ? 22.191 60.240  12.789  1.00 98.39  ? 283 MET A SD  1 
ATOM   1600 C  CE  . MET A 1 213 ? 20.815 59.102  12.846  1.00 94.82  ? 283 MET A CE  1 
ATOM   1601 N  N   . HIS A 1 214 ? 22.381 63.135  8.912   1.00 81.77  ? 284 HIS A N   1 
ATOM   1602 C  CA  . HIS A 1 214 ? 23.228 64.315  8.774   1.00 81.46  ? 284 HIS A CA  1 
ATOM   1603 C  C   . HIS A 1 214 ? 22.548 65.252  7.793   1.00 83.76  ? 284 HIS A C   1 
ATOM   1604 O  O   . HIS A 1 214 ? 22.503 66.454  8.031   1.00 84.10  ? 284 HIS A O   1 
ATOM   1605 C  CB  . HIS A 1 214 ? 24.608 63.907  8.231   1.00 81.80  ? 284 HIS A CB  1 
ATOM   1606 C  CG  . HIS A 1 214 ? 25.572 65.058  8.023   1.00 85.72  ? 284 HIS A CG  1 
ATOM   1607 N  ND1 . HIS A 1 214 ? 25.193 66.199  7.331   1.00 87.20  ? 284 HIS A ND1 1 
ATOM   1608 C  CD2 . HIS A 1 214 ? 26.866 65.175  8.384   1.00 88.30  ? 284 HIS A CD2 1 
ATOM   1609 C  CE1 . HIS A 1 214 ? 26.247 66.979  7.322   1.00 87.37  ? 284 HIS A CE1 1 
ATOM   1610 N  NE2 . HIS A 1 214 ? 27.288 66.416  7.928   1.00 88.45  ? 284 HIS A NE2 1 
ATOM   1611 N  N   . PHE A 1 215 ? 22.020 64.696  6.687   1.00 78.43  ? 285 PHE A N   1 
ATOM   1612 C  CA  . PHE A 1 215 ? 21.302 65.466  5.676   1.00 77.65  ? 285 PHE A CA  1 
ATOM   1613 C  C   . PHE A 1 215 ? 20.080 66.153  6.277   1.00 82.19  ? 285 PHE A C   1 
ATOM   1614 O  O   . PHE A 1 215 ? 19.864 67.334  6.032   1.00 82.09  ? 285 PHE A O   1 
ATOM   1615 C  CB  . PHE A 1 215 ? 20.895 64.579  4.487   1.00 78.22  ? 285 PHE A CB  1 
ATOM   1616 C  CG  . PHE A 1 215 ? 20.124 65.318  3.420   1.00 79.64  ? 285 PHE A CG  1 
ATOM   1617 C  CD1 . PHE A 1 215 ? 20.761 66.225  2.586   1.00 82.72  ? 285 PHE A CD1 1 
ATOM   1618 C  CD2 . PHE A 1 215 ? 18.758 65.129  3.273   1.00 81.89  ? 285 PHE A CD2 1 
ATOM   1619 C  CE1 . PHE A 1 215 ? 20.051 66.916  1.614   1.00 83.81  ? 285 PHE A CE1 1 
ATOM   1620 C  CE2 . PHE A 1 215 ? 18.045 65.824  2.302   1.00 84.93  ? 285 PHE A CE2 1 
ATOM   1621 C  CZ  . PHE A 1 215 ? 18.697 66.712  1.474   1.00 83.04  ? 285 PHE A CZ  1 
ATOM   1622 N  N   . THR A 1 216 ? 19.304 65.411  7.086   1.00 79.26  ? 286 THR A N   1 
ATOM   1623 C  CA  . THR A 1 216 ? 18.098 65.888  7.770   1.00 80.26  ? 286 THR A CA  1 
ATOM   1624 C  C   . THR A 1 216 ? 18.386 67.027  8.748   1.00 85.73  ? 286 THR A C   1 
ATOM   1625 O  O   . THR A 1 216 ? 17.664 68.014  8.750   1.00 85.91  ? 286 THR A O   1 
ATOM   1626 C  CB  . THR A 1 216 ? 17.365 64.734  8.477   1.00 88.03  ? 286 THR A CB  1 
ATOM   1627 O  OG1 . THR A 1 216 ? 17.048 63.731  7.516   1.00 86.80  ? 286 THR A OG1 1 
ATOM   1628 C  CG2 . THR A 1 216 ? 16.074 65.192  9.163   1.00 87.57  ? 286 THR A CG2 1 
ATOM   1629 N  N   . ILE A 1 217 ? 19.435 66.900  9.569   1.00 83.10  ? 287 ILE A N   1 
ATOM   1630 C  CA  . ILE A 1 217 ? 19.771 67.943  10.539  1.00 84.53  ? 287 ILE A CA  1 
ATOM   1631 C  C   . ILE A 1 217 ? 20.160 69.250  9.835   1.00 89.14  ? 287 ILE A C   1 
ATOM   1632 O  O   . ILE A 1 217 ? 19.655 70.319  10.183  1.00 89.64  ? 287 ILE A O   1 
ATOM   1633 C  CB  . ILE A 1 217 ? 20.851 67.465  11.549  1.00 88.34  ? 287 ILE A CB  1 
ATOM   1634 C  CG1 . ILE A 1 217 ? 20.321 66.297  12.399  1.00 89.28  ? 287 ILE A CG1 1 
ATOM   1635 C  CG2 . ILE A 1 217 ? 21.350 68.617  12.434  1.00 90.59  ? 287 ILE A CG2 1 
ATOM   1636 C  CD1 . ILE A 1 217 ? 21.372 65.527  13.160  1.00 96.34  ? 287 ILE A CD1 1 
ATOM   1637 N  N   . ALA A 1 218 ? 21.040 69.145  8.828   1.00 85.34  ? 288 ALA A N   1 
ATOM   1638 C  CA  . ALA A 1 218 ? 21.540 70.273  8.042   1.00 85.50  ? 288 ALA A CA  1 
ATOM   1639 C  C   . ALA A 1 218 ? 20.477 70.976  7.204   1.00 90.46  ? 288 ALA A C   1 
ATOM   1640 O  O   . ALA A 1 218 ? 20.459 72.201  7.151   1.00 90.64  ? 288 ALA A O   1 
ATOM   1641 C  CB  . ALA A 1 218 ? 22.696 69.831  7.162   1.00 85.38  ? 288 ALA A CB  1 
ATOM   1642 N  N   . GLU A 1 219 ? 19.588 70.209  6.564   1.00 87.49  ? 289 GLU A N   1 
ATOM   1643 C  CA  . GLU A 1 219 ? 18.530 70.775  5.727   1.00 88.00  ? 289 GLU A CA  1 
ATOM   1644 C  C   . GLU A 1 219 ? 17.193 70.942  6.452   1.00 94.33  ? 289 GLU A C   1 
ATOM   1645 O  O   . GLU A 1 219 ? 16.272 71.555  5.913   1.00 94.47  ? 289 GLU A O   1 
ATOM   1646 C  CB  . GLU A 1 219 ? 18.364 69.949  4.439   1.00 88.32  ? 289 GLU A CB  1 
ATOM   1647 C  CG  . GLU A 1 219 ? 19.565 69.990  3.502   1.00 98.10  ? 289 GLU A CG  1 
ATOM   1648 C  CD  . GLU A 1 219 ? 20.018 71.364  3.056   1.00 119.87 ? 289 GLU A CD  1 
ATOM   1649 O  OE1 . GLU A 1 219 ? 19.150 72.205  2.733   1.00 117.04 ? 289 GLU A OE1 1 
ATOM   1650 O  OE2 . GLU A 1 219 ? 21.245 71.598  3.009   1.00 113.67 ? 289 GLU A OE2 1 
ATOM   1651 N  N   . GLY A 1 220 ? 17.111 70.428  7.671   1.00 92.48  ? 290 GLY A N   1 
ATOM   1652 C  CA  . GLY A 1 220 ? 15.898 70.468  8.478   1.00 94.05  ? 290 GLY A CA  1 
ATOM   1653 C  C   . GLY A 1 220 ? 15.073 69.237  8.182   1.00 98.81  ? 290 GLY A C   1 
ATOM   1654 O  O   . GLY A 1 220 ? 15.083 68.754  7.047   1.00 97.21  ? 290 GLY A O   1 
ATOM   1655 N  N   . PHE A 1 221 ? 14.366 68.696  9.192   1.00 97.68  ? 291 PHE A N   1 
ATOM   1656 C  CA  . PHE A 1 221 ? 13.541 67.496  9.031   1.00 97.99  ? 291 PHE A CA  1 
ATOM   1657 C  C   . PHE A 1 221 ? 12.424 67.683  8.025   1.00 103.40 ? 291 PHE A C   1 
ATOM   1658 O  O   . PHE A 1 221 ? 12.239 66.843  7.140   1.00 102.07 ? 291 PHE A O   1 
ATOM   1659 C  CB  . PHE A 1 221 ? 12.946 67.025  10.378  1.00 101.35 ? 291 PHE A CB  1 
ATOM   1660 C  CG  . PHE A 1 221 ? 11.962 65.882  10.244  1.00 103.20 ? 291 PHE A CG  1 
ATOM   1661 C  CD1 . PHE A 1 221 ? 12.371 64.569  10.432  1.00 105.60 ? 291 PHE A CD1 1 
ATOM   1662 C  CD2 . PHE A 1 221 ? 10.640 66.117  9.884   1.00 106.46 ? 291 PHE A CD2 1 
ATOM   1663 C  CE1 . PHE A 1 221 ? 11.479 63.517  10.270  1.00 106.80 ? 291 PHE A CE1 1 
ATOM   1664 C  CE2 . PHE A 1 221 ? 9.753  65.064  9.699   1.00 109.72 ? 291 PHE A CE2 1 
ATOM   1665 C  CZ  . PHE A 1 221 ? 10.172 63.769  9.904   1.00 107.02 ? 291 PHE A CZ  1 
ATOM   1666 N  N   . VAL A 1 222 ? 11.665 68.784  8.190   1.00 102.52 ? 292 VAL A N   1 
ATOM   1667 C  CA  . VAL A 1 222 ? 10.515 69.116  7.351   1.00 103.67 ? 292 VAL A CA  1 
ATOM   1668 C  C   . VAL A 1 222 ? 10.915 69.263  5.884   1.00 107.46 ? 292 VAL A C   1 
ATOM   1669 O  O   . VAL A 1 222 ? 10.356 68.570  5.034   1.00 107.03 ? 292 VAL A O   1 
ATOM   1670 C  CB  . VAL A 1 222 ? 9.676  70.326  7.874   1.00 109.63 ? 292 VAL A CB  1 
ATOM   1671 C  CG1 . VAL A 1 222 ? 10.543 71.557  8.148   1.00 109.28 ? 292 VAL A CG1 1 
ATOM   1672 C  CG2 . VAL A 1 222 ? 8.524  70.656  6.927   1.00 110.54 ? 292 VAL A CG2 1 
ATOM   1673 N  N   . LYS A 1 223 ? 11.938 70.093  5.607   1.00 104.19 ? 293 LYS A N   1 
ATOM   1674 C  CA  . LYS A 1 223 ? 12.434 70.320  4.251   1.00 103.64 ? 293 LYS A CA  1 
ATOM   1675 C  C   . LYS A 1 223 ? 12.975 69.055  3.597   1.00 107.37 ? 293 LYS A C   1 
ATOM   1676 O  O   . LYS A 1 223 ? 12.684 68.810  2.430   1.00 106.76 ? 293 LYS A O   1 
ATOM   1677 C  CB  . LYS A 1 223 ? 13.480 71.437  4.208   1.00 105.83 ? 293 LYS A CB  1 
ATOM   1678 C  CG  . LYS A 1 223 ? 13.838 71.896  2.789   1.00 118.79 ? 293 LYS A CG  1 
ATOM   1679 C  CD  . LYS A 1 223 ? 15.228 72.507  2.731   1.00 127.47 ? 293 LYS A CD  1 
ATOM   1680 C  CE  . LYS A 1 223 ? 15.261 73.900  3.313   1.00 138.42 ? 293 LYS A CE  1 
ATOM   1681 N  NZ  . LYS A 1 223 ? 16.619 74.486  3.237   1.00 146.42 ? 293 LYS A NZ  1 
ATOM   1682 N  N   . ALA A 1 224 ? 13.750 68.251  4.347   1.00 104.18 ? 294 ALA A N   1 
ATOM   1683 C  CA  . ALA A 1 224 ? 14.338 67.015  3.827   1.00 103.19 ? 294 ALA A CA  1 
ATOM   1684 C  C   . ALA A 1 224 ? 13.328 65.942  3.408   1.00 108.66 ? 294 ALA A C   1 
ATOM   1685 O  O   . ALA A 1 224 ? 13.492 65.371  2.337   1.00 107.50 ? 294 ALA A O   1 
ATOM   1686 C  CB  . ALA A 1 224 ? 15.342 66.433  4.809   1.00 103.29 ? 294 ALA A CB  1 
ATOM   1687 N  N   . THR A 1 225 ? 12.289 65.677  4.208   1.00 107.52 ? 295 THR A N   1 
ATOM   1688 C  CA  . THR A 1 225 ? 11.292 64.673  3.825   1.00 108.22 ? 295 THR A CA  1 
ATOM   1689 C  C   . THR A 1 225 ? 10.454 65.167  2.633   1.00 113.97 ? 295 THR A C   1 
ATOM   1690 O  O   . THR A 1 225 ? 10.238 64.426  1.679   1.00 113.13 ? 295 THR A O   1 
ATOM   1691 C  CB  . THR A 1 225 ? 10.442 64.234  5.025   1.00 118.39 ? 295 THR A CB  1 
ATOM   1692 O  OG1 . THR A 1 225 ? 11.279 63.534  5.945   1.00 117.60 ? 295 THR A OG1 1 
ATOM   1693 C  CG2 . THR A 1 225 ? 9.262  63.332  4.607   1.00 118.08 ? 295 THR A CG2 1 
ATOM   1694 N  N   . THR A 1 226 ? 9.972  66.418  2.710   1.00 112.69 ? 296 THR A N   1 
ATOM   1695 C  CA  . THR A 1 226 ? 9.142  67.014  1.660   1.00 114.14 ? 296 THR A CA  1 
ATOM   1696 C  C   . THR A 1 226 ? 9.869  67.294  0.352   1.00 118.00 ? 296 THR A C   1 
ATOM   1697 O  O   . THR A 1 226 ? 9.330  67.013  -0.715  1.00 118.22 ? 296 THR A O   1 
ATOM   1698 C  CB  . THR A 1 226 ? 8.418  68.278  2.140   1.00 124.48 ? 296 THR A CB  1 
ATOM   1699 O  OG1 . THR A 1 226 ? 9.330  69.158  2.793   1.00 123.63 ? 296 THR A OG1 1 
ATOM   1700 C  CG2 . THR A 1 226 ? 7.225  67.953  3.040   1.00 124.98 ? 296 THR A CG2 1 
ATOM   1701 N  N   . VAL A 1 227 ? 11.070 67.881  0.437   1.00 114.08 ? 297 VAL A N   1 
ATOM   1702 C  CA  . VAL A 1 227 ? 11.863 68.249  -0.738  1.00 113.67 ? 297 VAL A CA  1 
ATOM   1703 C  C   . VAL A 1 227 ? 12.937 67.216  -1.061  1.00 116.51 ? 297 VAL A C   1 
ATOM   1704 O  O   . VAL A 1 227 ? 13.053 66.799  -2.216  1.00 115.91 ? 297 VAL A O   1 
ATOM   1705 C  CB  . VAL A 1 227 ? 12.471 69.672  -0.648  1.00 117.97 ? 297 VAL A CB  1 
ATOM   1706 C  CG1 . VAL A 1 227 ? 13.071 70.087  -1.982  1.00 117.76 ? 297 VAL A CG1 1 
ATOM   1707 C  CG2 . VAL A 1 227 ? 11.434 70.687  -0.194  1.00 119.55 ? 297 VAL A CG2 1 
ATOM   1708 N  N   . GLY A 1 228 ? 13.694 66.819  -0.041  1.00 112.63 ? 298 GLY A N   1 
ATOM   1709 C  CA  . GLY A 1 228 ? 14.761 65.826  -0.170  1.00 111.22 ? 298 GLY A CA  1 
ATOM   1710 C  C   . GLY A 1 228 ? 14.167 64.505  -0.576  1.00 115.37 ? 298 GLY A C   1 
ATOM   1711 O  O   . GLY A 1 228 ? 14.796 63.697  -1.273  1.00 114.08 ? 298 GLY A O   1 
ATOM   1712 N  N   . GLN A 1 229 ? 12.911 64.296  -0.148  1.00 113.27 ? 299 GLN A N   1 
ATOM   1713 C  CA  . GLN A 1 229 ? 12.104 63.114  -0.391  1.00 113.37 ? 299 GLN A CA  1 
ATOM   1714 C  C   . GLN A 1 229 ? 12.645 61.963  0.384   1.00 116.57 ? 299 GLN A C   1 
ATOM   1715 O  O   . GLN A 1 229 ? 12.264 60.836  0.128   1.00 115.94 ? 299 GLN A O   1 
ATOM   1716 C  CB  . GLN A 1 229 ? 12.104 62.760  -1.849  1.00 114.55 ? 299 GLN A CB  1 
ATOM   1717 C  CG  . GLN A 1 229 ? 12.053 63.948  -2.726  1.00 131.36 ? 299 GLN A CG  1 
ATOM   1718 C  CD  . GLN A 1 229 ? 12.212 63.445  -4.111  1.00 150.55 ? 299 GLN A CD  1 
ATOM   1719 O  OE1 . GLN A 1 229 ? 11.345 62.738  -4.633  1.00 146.97 ? 299 GLN A OE1 1 
ATOM   1720 N  NE2 . GLN A 1 229 ? 13.388 63.668  -4.669  1.00 141.76 ? 299 GLN A NE2 1 
ATOM   1721 N  N   . MET A 1 230 ? 13.538 62.254  1.342   1.00 112.91 ? 300 MET A N   1 
ATOM   1722 C  CA  . MET A 1 230 ? 14.182 61.258  2.194   1.00 112.08 ? 300 MET A CA  1 
ATOM   1723 C  C   . MET A 1 230 ? 13.161 60.356  2.883   1.00 116.96 ? 300 MET A C   1 
ATOM   1724 O  O   . MET A 1 230 ? 13.354 59.144  2.931   1.00 115.83 ? 300 MET A O   1 
ATOM   1725 C  CB  . MET A 1 230 ? 15.110 61.915  3.225   1.00 114.47 ? 300 MET A CB  1 
ATOM   1726 C  CG  . MET A 1 230 ? 16.084 60.958  3.837   1.00 117.40 ? 300 MET A CG  1 
ATOM   1727 S  SD  . MET A 1 230 ? 17.554 60.862  2.827   1.00 120.33 ? 300 MET A SD  1 
ATOM   1728 C  CE  . MET A 1 230 ? 18.205 59.511  3.472   1.00 116.51 ? 300 MET A CE  1 
ATOM   1729 N  N   . GLY A 1 231 ? 12.110 60.964  3.426   1.00 115.39 ? 301 GLY A N   1 
ATOM   1730 C  CA  . GLY A 1 231 ? 11.010 60.251  4.075   1.00 116.44 ? 301 GLY A CA  1 
ATOM   1731 C  C   . GLY A 1 231 ? 10.228 59.461  3.054   1.00 120.53 ? 301 GLY A C   1 
ATOM   1732 O  O   . GLY A 1 231 ? 9.876  58.299  3.286   1.00 120.14 ? 301 GLY A O   1 
ATOM   1733 N  N   . TRP A 1 232 ? 9.973  60.082  1.890   1.00 117.30 ? 302 TRP A N   1 
ATOM   1734 C  CA  . TRP A 1 232 ? 9.302  59.416  0.777   1.00 117.31 ? 302 TRP A CA  1 
ATOM   1735 C  C   . TRP A 1 232 ? 10.240 58.300  0.283   1.00 118.50 ? 302 TRP A C   1 
ATOM   1736 O  O   . TRP A 1 232 ? 9.773  57.222  -0.031  1.00 118.16 ? 302 TRP A O   1 
ATOM   1737 C  CB  . TRP A 1 232 ? 8.924  60.428  -0.331  1.00 117.10 ? 302 TRP A CB  1 
ATOM   1738 C  CG  . TRP A 1 232 ? 9.308  60.038  -1.730  1.00 117.39 ? 302 TRP A CG  1 
ATOM   1739 C  CD1 . TRP A 1 232 ? 10.363 60.510  -2.447  1.00 119.40 ? 302 TRP A CD1 1 
ATOM   1740 C  CD2 . TRP A 1 232 ? 8.652  59.085  -2.568  1.00 117.79 ? 302 TRP A CD2 1 
ATOM   1741 N  NE1 . TRP A 1 232 ? 10.396 59.931  -3.686  1.00 118.68 ? 302 TRP A NE1 1 
ATOM   1742 C  CE2 . TRP A 1 232 ? 9.362  59.042  -3.786  1.00 121.01 ? 302 TRP A CE2 1 
ATOM   1743 C  CE3 . TRP A 1 232 ? 7.537  58.248  -2.407  1.00 120.37 ? 302 TRP A CE3 1 
ATOM   1744 C  CZ2 . TRP A 1 232 ? 9.012  58.185  -4.822  1.00 120.67 ? 302 TRP A CZ2 1 
ATOM   1745 C  CZ3 . TRP A 1 232 ? 7.171  57.425  -3.459  1.00 122.06 ? 302 TRP A CZ3 1 
ATOM   1746 C  CH2 . TRP A 1 232 ? 7.895  57.415  -4.657  1.00 122.06 ? 302 TRP A CH2 1 
ATOM   1747 N  N   . PHE A 1 233 ? 11.558 58.581  0.261   1.00 112.90 ? 303 PHE A N   1 
ATOM   1748 C  CA  . PHE A 1 233 ? 12.709 57.742  -0.111  1.00 110.73 ? 303 PHE A CA  1 
ATOM   1749 C  C   . PHE A 1 233 ? 12.920 56.626  0.927   1.00 113.15 ? 303 PHE A C   1 
ATOM   1750 O  O   . PHE A 1 233 ? 13.583 55.621  0.651   1.00 111.55 ? 303 PHE A O   1 
ATOM   1751 C  CB  . PHE A 1 233 ? 13.981 58.625  -0.256  1.00 111.81 ? 303 PHE A CB  1 
ATOM   1752 C  CG  . PHE A 1 233 ? 15.303 57.905  -0.198  1.00 112.01 ? 303 PHE A CG  1 
ATOM   1753 C  CD1 . PHE A 1 233 ? 15.805 57.433  1.008   1.00 114.90 ? 303 PHE A CD1 1 
ATOM   1754 C  CD2 . PHE A 1 233 ? 16.053 57.711  -1.346  1.00 113.45 ? 303 PHE A CD2 1 
ATOM   1755 C  CE1 . PHE A 1 233 ? 16.981 56.709  1.052   1.00 114.83 ? 303 PHE A CE1 1 
ATOM   1756 C  CE2 . PHE A 1 233 ? 17.259 57.032  -1.296  1.00 115.28 ? 303 PHE A CE2 1 
ATOM   1757 C  CZ  . PHE A 1 233 ? 17.714 56.518  -0.097  1.00 113.12 ? 303 PHE A CZ  1 
ATOM   1758 N  N   . PHE A 1 234 ? 12.351 56.827  2.128   1.00 110.00 ? 304 PHE A N   1 
ATOM   1759 C  CA  . PHE A 1 234 ? 12.421 55.920  3.272   1.00 109.48 ? 304 PHE A CA  1 
ATOM   1760 C  C   . PHE A 1 234 ? 11.918 54.529  2.900   1.00 111.98 ? 304 PHE A C   1 
ATOM   1761 O  O   . PHE A 1 234 ? 12.419 53.530  3.418   1.00 110.97 ? 304 PHE A O   1 
ATOM   1762 C  CB  . PHE A 1 234 ? 11.635 56.510  4.451   1.00 113.05 ? 304 PHE A CB  1 
ATOM   1763 C  CG  . PHE A 1 234 ? 11.408 55.582  5.614   1.00 115.46 ? 304 PHE A CG  1 
ATOM   1764 C  CD1 . PHE A 1 234 ? 10.342 54.693  5.613   1.00 119.56 ? 304 PHE A CD1 1 
ATOM   1765 C  CD2 . PHE A 1 234 ? 12.225 55.634  6.732   1.00 117.72 ? 304 PHE A CD2 1 
ATOM   1766 C  CE1 . PHE A 1 234 ? 10.123 53.847  6.691   1.00 121.40 ? 304 PHE A CE1 1 
ATOM   1767 C  CE2 . PHE A 1 234 ? 12.009 54.784  7.810   1.00 121.54 ? 304 PHE A CE2 1 
ATOM   1768 C  CZ  . PHE A 1 234 ? 10.963 53.886  7.782   1.00 120.46 ? 304 PHE A CZ  1 
ATOM   1769 N  N   . LEU A 1 235 ? 10.932 54.481  1.982   1.00 108.22 ? 305 LEU A N   1 
ATOM   1770 C  CA  . LEU A 1 235 ? 10.329 53.258  1.451   1.00 107.70 ? 305 LEU A CA  1 
ATOM   1771 C  C   . LEU A 1 235 ? 11.360 52.273  0.913   1.00 108.96 ? 305 LEU A C   1 
ATOM   1772 O  O   . LEU A 1 235 ? 11.190 51.070  1.084   1.00 108.42 ? 305 LEU A O   1 
ATOM   1773 C  CB  . LEU A 1 235 ? 9.278  53.549  0.348   1.00 108.80 ? 305 LEU A CB  1 
ATOM   1774 C  CG  . LEU A 1 235 ? 9.474  54.656  -0.712  1.00 113.28 ? 305 LEU A CG  1 
ATOM   1775 C  CD1 . LEU A 1 235 ? 10.916 54.862  -1.109  1.00 111.58 ? 305 LEU A CD1 1 
ATOM   1776 C  CD2 . LEU A 1 235 ? 8.731  54.317  -1.974  1.00 116.55 ? 305 LEU A CD2 1 
ATOM   1777 N  N   . MET A 1 236 ? 12.408 52.788  0.235   1.00 103.68 ? 306 MET A N   1 
ATOM   1778 C  CA  . MET A 1 236 ? 13.459 51.970  -0.362  1.00 101.69 ? 306 MET A CA  1 
ATOM   1779 C  C   . MET A 1 236 ? 14.185 51.139  0.679   1.00 104.24 ? 306 MET A C   1 
ATOM   1780 O  O   . MET A 1 236 ? 14.342 49.933  0.488   1.00 103.18 ? 306 MET A O   1 
ATOM   1781 C  CB  . MET A 1 236 ? 14.462 52.797  -1.150  1.00 103.28 ? 306 MET A CB  1 
ATOM   1782 C  CG  . MET A 1 236 ? 15.647 51.963  -1.610  1.00 105.68 ? 306 MET A CG  1 
ATOM   1783 S  SD  . MET A 1 236 ? 17.121 52.957  -1.670  1.00 109.37 ? 306 MET A SD  1 
ATOM   1784 C  CE  . MET A 1 236 ? 16.604 54.044  -2.666  1.00 106.68 ? 306 MET A CE  1 
ATOM   1785 N  N   . ALA A 1 237 ? 14.618 51.781  1.780   1.00 100.62 ? 307 ALA A N   1 
ATOM   1786 C  CA  . ALA A 1 237 ? 15.306 51.111  2.883   1.00 100.05 ? 307 ALA A CA  1 
ATOM   1787 C  C   . ALA A 1 237 ? 14.386 50.026  3.442   1.00 103.83 ? 307 ALA A C   1 
ATOM   1788 O  O   . ALA A 1 237 ? 14.836 48.902  3.654   1.00 102.94 ? 307 ALA A O   1 
ATOM   1789 C  CB  . ALA A 1 237 ? 15.673 52.113  3.970   1.00 101.52 ? 307 ALA A CB  1 
ATOM   1790 N  N   . VAL A 1 238 ? 13.084 50.356  3.611   1.00 101.04 ? 308 VAL A N   1 
ATOM   1791 C  CA  . VAL A 1 238 ? 12.056 49.429  4.090   1.00 101.60 ? 308 VAL A CA  1 
ATOM   1792 C  C   . VAL A 1 238 ? 11.967 48.239  3.153   1.00 103.78 ? 308 VAL A C   1 
ATOM   1793 O  O   . VAL A 1 238 ? 12.069 47.109  3.615   1.00 103.40 ? 308 VAL A O   1 
ATOM   1794 C  CB  . VAL A 1 238 ? 10.680 50.105  4.328   1.00 107.27 ? 308 VAL A CB  1 
ATOM   1795 C  CG1 . VAL A 1 238 ? 9.590  49.080  4.633   1.00 108.45 ? 308 VAL A CG1 1 
ATOM   1796 C  CG2 . VAL A 1 238 ? 10.786 51.098  5.465   1.00 108.06 ? 308 VAL A CG2 1 
ATOM   1797 N  N   . MET A 1 239 ? 11.861 48.499  1.839   1.00 99.15  ? 309 MET A N   1 
ATOM   1798 C  CA  . MET A 1 239 ? 11.782 47.466  0.806   1.00 98.09  ? 309 MET A CA  1 
ATOM   1799 C  C   . MET A 1 239 ? 12.942 46.484  0.856   1.00 100.09 ? 309 MET A C   1 
ATOM   1800 O  O   . MET A 1 239 ? 12.708 45.279  0.815   1.00 99.56  ? 309 MET A O   1 
ATOM   1801 C  CB  . MET A 1 239 ? 11.645 48.066  -0.598  1.00 100.11 ? 309 MET A CB  1 
ATOM   1802 C  CG  . MET A 1 239 ? 10.269 48.612  -0.885  1.00 105.43 ? 309 MET A CG  1 
ATOM   1803 S  SD  . MET A 1 239 ? 10.080 49.109  -2.606  1.00 109.64 ? 309 MET A SD  1 
ATOM   1804 C  CE  . MET A 1 239 ? 11.250 50.426  -2.681  1.00 105.30 ? 309 MET A CE  1 
ATOM   1805 N  N   . TYR A 1 240 ? 14.186 46.993  0.973   1.00 95.33  ? 310 TYR A N   1 
ATOM   1806 C  CA  . TYR A 1 240 ? 15.387 46.155  1.043   1.00 93.89  ? 310 TYR A CA  1 
ATOM   1807 C  C   . TYR A 1 240 ? 15.331 45.249  2.257   1.00 97.37  ? 310 TYR A C   1 
ATOM   1808 O  O   . TYR A 1 240 ? 15.613 44.059  2.135   1.00 96.48  ? 310 TYR A O   1 
ATOM   1809 C  CB  . TYR A 1 240 ? 16.685 46.992  1.018   1.00 94.58  ? 310 TYR A CB  1 
ATOM   1810 C  CG  . TYR A 1 240 ? 17.147 47.325  -0.384  1.00 95.74  ? 310 TYR A CG  1 
ATOM   1811 C  CD1 . TYR A 1 240 ? 16.246 47.757  -1.346  1.00 98.13  ? 310 TYR A CD1 1 
ATOM   1812 C  CD2 . TYR A 1 240 ? 18.486 47.235  -0.742  1.00 95.73  ? 310 TYR A CD2 1 
ATOM   1813 C  CE1 . TYR A 1 240 ? 16.655 48.062  -2.629  1.00 98.53  ? 310 TYR A CE1 1 
ATOM   1814 C  CE2 . TYR A 1 240 ? 18.911 47.554  -2.029  1.00 96.16  ? 310 TYR A CE2 1 
ATOM   1815 C  CZ  . TYR A 1 240 ? 17.985 47.967  -2.968  1.00 103.99 ? 310 TYR A CZ  1 
ATOM   1816 O  OH  . TYR A 1 240 ? 18.360 48.288  -4.242  1.00 104.75 ? 310 TYR A OH  1 
ATOM   1817 N  N   . ILE A 1 241 ? 14.956 45.811  3.421   1.00 94.35  ? 311 ILE A N   1 
ATOM   1818 C  CA  . ILE A 1 241 ? 14.816 45.067  4.671   1.00 94.84  ? 311 ILE A CA  1 
ATOM   1819 C  C   . ILE A 1 241 ? 13.704 44.043  4.554   1.00 98.33  ? 311 ILE A C   1 
ATOM   1820 O  O   . ILE A 1 241 ? 13.877 42.919  5.015   1.00 98.07  ? 311 ILE A O   1 
ATOM   1821 C  CB  . ILE A 1 241 ? 14.661 45.994  5.909   1.00 99.42  ? 311 ILE A CB  1 
ATOM   1822 C  CG1 . ILE A 1 241 ? 15.937 46.835  6.134   1.00 99.29  ? 311 ILE A CG1 1 
ATOM   1823 C  CG2 . ILE A 1 241 ? 14.285 45.212  7.188   1.00 101.82 ? 311 ILE A CG2 1 
ATOM   1824 C  CD1 . ILE A 1 241 ? 17.315 46.060  6.092   1.00 105.55 ? 311 ILE A CD1 1 
ATOM   1825 N  N   . THR A 1 242 ? 12.580 44.420  3.908   1.00 94.67  ? 312 THR A N   1 
ATOM   1826 C  CA  . THR A 1 242 ? 11.457 43.516  3.689   1.00 95.11  ? 312 THR A CA  1 
ATOM   1827 C  C   . THR A 1 242 ? 11.939 42.309  2.898   1.00 96.92  ? 312 THR A C   1 
ATOM   1828 O  O   . THR A 1 242 ? 11.654 41.187  3.286   1.00 97.02  ? 312 THR A O   1 
ATOM   1829 C  CB  . THR A 1 242 ? 10.248 44.183  3.015   1.00 103.77 ? 312 THR A CB  1 
ATOM   1830 O  OG1 . THR A 1 242 ? 10.110 45.532  3.452   1.00 103.95 ? 312 THR A OG1 1 
ATOM   1831 C  CG2 . THR A 1 242 ? 8.957  43.429  3.311   1.00 104.13 ? 312 THR A CG2 1 
ATOM   1832 N  N   . GLY A 1 243 ? 12.669 42.566  1.815   1.00 91.26  ? 313 GLY A N   1 
ATOM   1833 C  CA  . GLY A 1 243 ? 13.243 41.535  0.952   1.00 89.59  ? 313 GLY A CA  1 
ATOM   1834 C  C   . GLY A 1 243 ? 14.207 40.629  1.684   1.00 92.28  ? 313 GLY A C   1 
ATOM   1835 O  O   . GLY A 1 243 ? 14.083 39.403  1.603   1.00 91.76  ? 313 GLY A O   1 
ATOM   1836 N  N   . ALA A 1 244 ? 15.164 41.230  2.423   1.00 88.25  ? 314 ALA A N   1 
ATOM   1837 C  CA  . ALA A 1 244 ? 16.163 40.517  3.223   1.00 87.78  ? 314 ALA A CA  1 
ATOM   1838 C  C   . ALA A 1 244 ? 15.486 39.672  4.320   1.00 92.36  ? 314 ALA A C   1 
ATOM   1839 O  O   . ALA A 1 244 ? 15.797 38.494  4.460   1.00 91.78  ? 314 ALA A O   1 
ATOM   1840 C  CB  . ALA A 1 244 ? 17.159 41.501  3.832   1.00 88.57  ? 314 ALA A CB  1 
ATOM   1841 N  N   . GLY A 1 245 ? 14.558 40.275  5.056   1.00 89.97  ? 315 GLY A N   1 
ATOM   1842 C  CA  . GLY A 1 245 ? 13.797 39.593  6.097   1.00 91.30  ? 315 GLY A CA  1 
ATOM   1843 C  C   . GLY A 1 245 ? 12.966 38.481  5.505   1.00 94.47  ? 315 GLY A C   1 
ATOM   1844 O  O   . GLY A 1 245 ? 12.909 37.386  6.063   1.00 94.83  ? 315 GLY A O   1 
ATOM   1845 N  N   . LEU A 1 246 ? 12.333 38.756  4.352   1.00 89.86  ? 316 LEU A N   1 
ATOM   1846 C  CA  . LEU A 1 246 ? 11.475 37.819  3.628   1.00 89.67  ? 316 LEU A CA  1 
ATOM   1847 C  C   . LEU A 1 246 ? 12.206 36.598  3.096   1.00 92.04  ? 316 LEU A C   1 
ATOM   1848 O  O   . LEU A 1 246 ? 11.704 35.485  3.237   1.00 92.44  ? 316 LEU A O   1 
ATOM   1849 C  CB  . LEU A 1 246 ? 10.715 38.523  2.493   1.00 89.53  ? 316 LEU A CB  1 
ATOM   1850 C  CG  . LEU A 1 246 ? 9.213  38.279  2.416   1.00 96.06  ? 316 LEU A CG  1 
ATOM   1851 C  CD1 . LEU A 1 246 ? 8.579  38.196  3.809   1.00 98.35  ? 316 LEU A CD1 1 
ATOM   1852 C  CD2 . LEU A 1 246 ? 8.541  39.374  1.614   1.00 98.89  ? 316 LEU A CD2 1 
ATOM   1853 N  N   . TYR A 1 247 ? 13.377 36.805  2.462   1.00 86.54  ? 317 TYR A N   1 
ATOM   1854 C  CA  . TYR A 1 247 ? 14.180 35.719  1.897   1.00 85.05  ? 317 TYR A CA  1 
ATOM   1855 C  C   . TYR A 1 247 ? 14.700 34.737  2.971   1.00 88.59  ? 317 TYR A C   1 
ATOM   1856 O  O   . TYR A 1 247 ? 14.613 33.527  2.771   1.00 88.06  ? 317 TYR A O   1 
ATOM   1857 C  CB  . TYR A 1 247 ? 15.321 36.268  0.992   1.00 84.80  ? 317 TYR A CB  1 
ATOM   1858 C  CG  . TYR A 1 247 ? 16.726 36.179  1.554   1.00 86.39  ? 317 TYR A CG  1 
ATOM   1859 C  CD1 . TYR A 1 247 ? 17.097 36.917  2.674   1.00 89.31  ? 317 TYR A CD1 1 
ATOM   1860 C  CD2 . TYR A 1 247 ? 17.684 35.365  0.966   1.00 86.19  ? 317 TYR A CD2 1 
ATOM   1861 C  CE1 . TYR A 1 247 ? 18.352 36.784  3.240   1.00 90.27  ? 317 TYR A CE1 1 
ATOM   1862 C  CE2 . TYR A 1 247 ? 18.964 35.260  1.495   1.00 87.07  ? 317 TYR A CE2 1 
ATOM   1863 C  CZ  . TYR A 1 247 ? 19.292 35.974  2.635   1.00 95.79  ? 317 TYR A CZ  1 
ATOM   1864 O  OH  . TYR A 1 247 ? 20.542 35.889  3.175   1.00 97.35  ? 317 TYR A OH  1 
ATOM   1865 N  N   . ALA A 1 248 ? 15.222 35.264  4.103   1.00 85.26  ? 318 ALA A N   1 
ATOM   1866 C  CA  . ALA A 1 248 ? 15.775 34.472  5.206   1.00 85.82  ? 318 ALA A CA  1 
ATOM   1867 C  C   . ALA A 1 248 ? 14.668 33.647  5.828   1.00 90.60  ? 318 ALA A C   1 
ATOM   1868 O  O   . ALA A 1 248 ? 14.843 32.455  6.084   1.00 90.49  ? 318 ALA A O   1 
ATOM   1869 C  CB  . ALA A 1 248 ? 16.416 35.378  6.248   1.00 87.40  ? 318 ALA A CB  1 
ATOM   1870 N  N   . ALA A 1 249 ? 13.505 34.291  6.020   1.00 87.76  ? 319 ALA A N   1 
ATOM   1871 C  CA  . ALA A 1 249 ? 12.302 33.663  6.542   1.00 89.23  ? 319 ALA A CA  1 
ATOM   1872 C  C   . ALA A 1 249 ? 11.802 32.627  5.560   1.00 91.48  ? 319 ALA A C   1 
ATOM   1873 O  O   . ALA A 1 249 ? 11.273 31.605  5.972   1.00 92.26  ? 319 ALA A O   1 
ATOM   1874 C  CB  . ALA A 1 249 ? 11.232 34.711  6.781   1.00 91.30  ? 319 ALA A CB  1 
ATOM   1875 N  N   . ARG A 1 250 ? 12.003 32.872  4.262   1.00 85.63  ? 320 ARG A N   1 
ATOM   1876 C  CA  . ARG A 1 250 ? 11.554 31.963  3.214   1.00 84.57  ? 320 ARG A CA  1 
ATOM   1877 C  C   . ARG A 1 250 ? 10.013 31.894  3.144   1.00 89.18  ? 320 ARG A C   1 
ATOM   1878 O  O   . ARG A 1 250 ? 9.425  30.853  2.825   1.00 89.32  ? 320 ARG A O   1 
ATOM   1879 C  CB  . ARG A 1 250 ? 12.212 30.576  3.353   1.00 84.71  ? 320 ARG A CB  1 
ATOM   1880 C  CG  . ARG A 1 250 ? 13.410 30.410  2.437   1.00 92.92  ? 320 ARG A CG  1 
ATOM   1881 C  CD  . ARG A 1 250 ? 14.536 29.672  3.104   1.00 103.18 ? 320 ARG A CD  1 
ATOM   1882 N  NE  . ARG A 1 250 ? 15.821 30.110  2.569   1.00 110.87 ? 320 ARG A NE  1 
ATOM   1883 C  CZ  . ARG A 1 250 ? 16.974 29.505  2.800   1.00 125.48 ? 320 ARG A CZ  1 
ATOM   1884 N  NH1 . ARG A 1 250 ? 17.024 28.416  3.560   1.00 114.19 ? 320 ARG A NH1 1 
ATOM   1885 N  NH2 . ARG A 1 250 ? 18.096 29.973  2.267   1.00 111.52 ? 320 ARG A NH2 1 
ATOM   1886 N  N   . ILE A 1 251 ? 9.368  33.025  3.437   1.00 86.05  ? 321 ILE A N   1 
ATOM   1887 C  CA  . ILE A 1 251 ? 7.921  33.123  3.338   1.00 87.45  ? 321 ILE A CA  1 
ATOM   1888 C  C   . ILE A 1 251 ? 7.639  33.436  1.861   1.00 89.41  ? 321 ILE A C   1 
ATOM   1889 O  O   . ILE A 1 251 ? 8.441  34.148  1.267   1.00 87.19  ? 321 ILE A O   1 
ATOM   1890 C  CB  . ILE A 1 251 ? 7.365  34.223  4.261   1.00 92.27  ? 321 ILE A CB  1 
ATOM   1891 C  CG1 . ILE A 1 251 ? 7.930  34.106  5.671   1.00 93.45  ? 321 ILE A CG1 1 
ATOM   1892 C  CG2 . ILE A 1 251 ? 5.838  34.206  4.263   1.00 95.42  ? 321 ILE A CG2 1 
ATOM   1893 C  CD1 . ILE A 1 251 ? 7.741  35.389  6.452   1.00 102.12 ? 321 ILE A CD1 1 
ATOM   1894 N  N   . PRO A 1 252 ? 6.569  32.934  1.227   1.00 86.68  ? 322 PRO A N   1 
ATOM   1895 C  CA  . PRO A 1 252 ? 5.485  32.107  1.777   1.00 88.76  ? 322 PRO A CA  1 
ATOM   1896 C  C   . PRO A 1 252 ? 5.736  30.604  1.750   1.00 91.93  ? 322 PRO A C   1 
ATOM   1897 O  O   . PRO A 1 252 ? 4.862  29.854  2.192   1.00 93.53  ? 322 PRO A O   1 
ATOM   1898 C  CB  . PRO A 1 252 ? 4.297  32.522  0.915   1.00 91.97  ? 322 PRO A CB  1 
ATOM   1899 C  CG  . PRO A 1 252 ? 4.910  32.767  -0.432  1.00 94.19  ? 322 PRO A CG  1 
ATOM   1900 C  CD  . PRO A 1 252 ? 6.283  33.323  -0.167  1.00 87.53  ? 322 PRO A CD  1 
ATOM   1901 N  N   . GLU A 1 253 ? 6.924  30.166  1.281   1.00 85.88  ? 323 GLU A N   1 
ATOM   1902 C  CA  . GLU A 1 253 ? 7.252  28.736  1.179   1.00 85.09  ? 323 GLU A CA  1 
ATOM   1903 C  C   . GLU A 1 253 ? 7.216  28.007  2.487   1.00 90.28  ? 323 GLU A C   1 
ATOM   1904 O  O   . GLU A 1 253 ? 6.804  26.856  2.505   1.00 90.70  ? 323 GLU A O   1 
ATOM   1905 C  CB  . GLU A 1 253 ? 8.596  28.445  0.496   1.00 83.83  ? 323 GLU A CB  1 
ATOM   1906 C  CG  . GLU A 1 253 ? 9.001  29.399  -0.608  1.00 92.82  ? 323 GLU A CG  1 
ATOM   1907 C  CD  . GLU A 1 253 ? 9.796  30.559  -0.026  1.00 112.47 ? 323 GLU A CD  1 
ATOM   1908 O  OE1 . GLU A 1 253 ? 10.500 30.273  0.970   1.00 107.70 ? 323 GLU A OE1 1 
ATOM   1909 O  OE2 . GLU A 1 253 ? 9.579  31.732  -0.410  1.00 105.40 ? 323 GLU A OE2 1 
ATOM   1910 N  N   . ARG A 1 254 ? 7.654  28.660  3.576   1.00 87.40  ? 324 ARG A N   1 
ATOM   1911 C  CA  . ARG A 1 254 ? 7.649  28.070  4.911   1.00 89.04  ? 324 ARG A CA  1 
ATOM   1912 C  C   . ARG A 1 254 ? 6.245  27.623  5.309   1.00 96.11  ? 324 ARG A C   1 
ATOM   1913 O  O   . ARG A 1 254 ? 6.061  26.512  5.807   1.00 96.86  ? 324 ARG A O   1 
ATOM   1914 C  CB  . ARG A 1 254 ? 8.171  29.085  5.937   1.00 89.55  ? 324 ARG A CB  1 
ATOM   1915 C  CG  . ARG A 1 254 ? 8.021  28.625  7.385   1.00 101.50 ? 324 ARG A CG  1 
ATOM   1916 C  CD  . ARG A 1 254 ? 8.408  29.713  8.356   1.00 110.14 ? 324 ARG A CD  1 
ATOM   1917 N  NE  . ARG A 1 254 ? 9.455  29.264  9.274   1.00 117.03 ? 324 ARG A NE  1 
ATOM   1918 C  CZ  . ARG A 1 254 ? 10.748 29.323  9.003   1.00 128.35 ? 324 ARG A CZ  1 
ATOM   1919 N  NH1 . ARG A 1 254 ? 11.165 29.796  7.836   1.00 112.74 ? 324 ARG A NH1 1 
ATOM   1920 N  NH2 . ARG A 1 254 ? 11.642 28.900  9.883   1.00 115.61 ? 324 ARG A NH2 1 
ATOM   1921 N  N   . PHE A 1 255 ? 5.259  28.498  5.076   1.00 94.32  ? 325 PHE A N   1 
ATOM   1922 C  CA  . PHE A 1 255 ? 3.857  28.240  5.410   1.00 97.37  ? 325 PHE A CA  1 
ATOM   1923 C  C   . PHE A 1 255 ? 3.190  27.190  4.525   1.00 102.01 ? 325 PHE A C   1 
ATOM   1924 O  O   . PHE A 1 255 ? 2.419  26.375  5.020   1.00 104.06 ? 325 PHE A O   1 
ATOM   1925 C  CB  . PHE A 1 255 ? 3.049  29.546  5.451   1.00 100.40 ? 325 PHE A CB  1 
ATOM   1926 C  CG  . PHE A 1 255 ? 3.687  30.593  6.324   1.00 101.54 ? 325 PHE A CG  1 
ATOM   1927 C  CD1 . PHE A 1 255 ? 4.020  30.316  7.641   1.00 105.80 ? 325 PHE A CD1 1 
ATOM   1928 C  CD2 . PHE A 1 255 ? 3.964  31.853  5.825   1.00 102.20 ? 325 PHE A CD2 1 
ATOM   1929 C  CE1 . PHE A 1 255 ? 4.628  31.274  8.437   1.00 106.52 ? 325 PHE A CE1 1 
ATOM   1930 C  CE2 . PHE A 1 255 ? 4.555  32.818  6.628   1.00 104.71 ? 325 PHE A CE2 1 
ATOM   1931 C  CZ  . PHE A 1 255 ? 4.896  32.522  7.927   1.00 104.07 ? 325 PHE A CZ  1 
ATOM   1932 N  N   . PHE A 1 256 ? 3.501  27.193  3.222   1.00 96.66  ? 326 PHE A N   1 
ATOM   1933 C  CA  . PHE A 1 256 ? 2.922  26.234  2.284   1.00 97.04  ? 326 PHE A CA  1 
ATOM   1934 C  C   . PHE A 1 256 ? 4.009  25.484  1.481   1.00 98.45  ? 326 PHE A C   1 
ATOM   1935 O  O   . PHE A 1 256 ? 4.175  25.745  0.290   1.00 96.64  ? 326 PHE A O   1 
ATOM   1936 C  CB  . PHE A 1 256 ? 1.900  26.928  1.371   1.00 100.03 ? 326 PHE A CB  1 
ATOM   1937 C  CG  . PHE A 1 256 ? 0.743  27.567  2.100   1.00 104.78 ? 326 PHE A CG  1 
ATOM   1938 C  CD1 . PHE A 1 256 ? 0.891  28.797  2.726   1.00 108.05 ? 326 PHE A CD1 1 
ATOM   1939 C  CD2 . PHE A 1 256 ? -0.492 26.939  2.159   1.00 110.17 ? 326 PHE A CD2 1 
ATOM   1940 C  CE1 . PHE A 1 256 ? -0.158 29.367  3.437   1.00 112.00 ? 326 PHE A CE1 1 
ATOM   1941 C  CE2 . PHE A 1 256 ? -1.552 27.520  2.850   1.00 116.19 ? 326 PHE A CE2 1 
ATOM   1942 C  CZ  . PHE A 1 256 ? -1.379 28.732  3.485   1.00 114.22 ? 326 PHE A CZ  1 
ATOM   1943 N  N   . PRO A 1 257 ? 4.740  24.537  2.115   1.00 94.56  ? 327 PRO A N   1 
ATOM   1944 C  CA  . PRO A 1 257 ? 5.798  23.804  1.392   1.00 91.96  ? 327 PRO A CA  1 
ATOM   1945 C  C   . PRO A 1 257 ? 5.228  23.026  0.217   1.00 96.04  ? 327 PRO A C   1 
ATOM   1946 O  O   . PRO A 1 257 ? 4.176  22.403  0.341   1.00 97.95  ? 327 PRO A O   1 
ATOM   1947 C  CB  . PRO A 1 257 ? 6.367  22.860  2.461   1.00 94.15  ? 327 PRO A CB  1 
ATOM   1948 C  CG  . PRO A 1 257 ? 6.055  23.529  3.763   1.00 100.44 ? 327 PRO A CG  1 
ATOM   1949 C  CD  . PRO A 1 257 ? 4.724  24.179  3.544   1.00 97.88  ? 327 PRO A CD  1 
ATOM   1950 N  N   . GLY A 1 258 ? 5.911  23.118  -0.912  1.00 90.34  ? 328 GLY A N   1 
ATOM   1951 C  CA  . GLY A 1 258 ? 5.507  22.435  -2.138  1.00 90.07  ? 328 GLY A CA  1 
ATOM   1952 C  C   . GLY A 1 258 ? 4.478  23.161  -2.976  1.00 95.08  ? 328 GLY A C   1 
ATOM   1953 O  O   . GLY A 1 258 ? 4.113  22.679  -4.052  1.00 94.90  ? 328 GLY A O   1 
ATOM   1954 N  N   . LYS A 1 259 ? 3.972  24.299  -2.481  1.00 92.60  ? 329 LYS A N   1 
ATOM   1955 C  CA  . LYS A 1 259 ? 2.978  25.113  -3.181  1.00 93.83  ? 329 LYS A CA  1 
ATOM   1956 C  C   . LYS A 1 259 ? 3.650  26.281  -3.918  1.00 95.35  ? 329 LYS A C   1 
ATOM   1957 O  O   . LYS A 1 259 ? 3.046  26.891  -4.801  1.00 95.85  ? 329 LYS A O   1 
ATOM   1958 C  CB  . LYS A 1 259 ? 1.906  25.605  -2.190  1.00 99.30  ? 329 LYS A CB  1 
ATOM   1959 C  CG  . LYS A 1 259 ? 0.700  26.303  -2.814  1.00 118.34 ? 329 LYS A CG  1 
ATOM   1960 C  CD  . LYS A 1 259 ? -0.270 25.335  -3.492  1.00 131.54 ? 329 LYS A CD  1 
ATOM   1961 C  CE  . LYS A 1 259 ? -1.441 26.062  -4.105  1.00 145.90 ? 329 LYS A CE  1 
ATOM   1962 N  NZ  . LYS A 1 259 ? -2.198 26.863  -3.099  1.00 157.29 ? 329 LYS A NZ  1 
ATOM   1963 N  N   . PHE A 1 260 ? 4.909  26.571  -3.565  1.00 89.13  ? 330 PHE A N   1 
ATOM   1964 C  CA  . PHE A 1 260 ? 5.680  27.659  -4.164  1.00 86.95  ? 330 PHE A CA  1 
ATOM   1965 C  C   . PHE A 1 260 ? 6.961  27.169  -4.849  1.00 87.58  ? 330 PHE A C   1 
ATOM   1966 O  O   . PHE A 1 260 ? 7.943  27.908  -4.920  1.00 85.51  ? 330 PHE A O   1 
ATOM   1967 C  CB  . PHE A 1 260 ? 5.995  28.742  -3.120  1.00 88.54  ? 330 PHE A CB  1 
ATOM   1968 C  CG  . PHE A 1 260 ? 4.766  29.376  -2.531  1.00 92.59  ? 330 PHE A CG  1 
ATOM   1969 C  CD1 . PHE A 1 260 ? 4.038  30.312  -3.250  1.00 96.74  ? 330 PHE A CD1 1 
ATOM   1970 C  CD2 . PHE A 1 260 ? 4.326  29.026  -1.263  1.00 96.39  ? 330 PHE A CD2 1 
ATOM   1971 C  CE1 . PHE A 1 260 ? 2.890  30.879  -2.719  1.00 100.18 ? 330 PHE A CE1 1 
ATOM   1972 C  CE2 . PHE A 1 260 ? 3.182  29.594  -0.727  1.00 101.77 ? 330 PHE A CE2 1 
ATOM   1973 C  CZ  . PHE A 1 260 ? 2.465  30.517  -1.460  1.00 100.81 ? 330 PHE A CZ  1 
ATOM   1974 N  N   . ASP A 1 261 ? 6.941  25.931  -5.366  1.00 83.45  ? 331 ASP A N   1 
ATOM   1975 C  CA  . ASP A 1 261 ? 8.095  25.315  -6.016  1.00 80.93  ? 331 ASP A CA  1 
ATOM   1976 C  C   . ASP A 1 261 ? 8.601  26.085  -7.224  1.00 83.10  ? 331 ASP A C   1 
ATOM   1977 O  O   . ASP A 1 261 ? 9.802  26.302  -7.352  1.00 80.88  ? 331 ASP A O   1 
ATOM   1978 C  CB  . ASP A 1 261 ? 7.794  23.855  -6.399  1.00 83.16  ? 331 ASP A CB  1 
ATOM   1979 C  CG  . ASP A 1 261 ? 7.558  22.951  -5.210  1.00 93.26  ? 331 ASP A CG  1 
ATOM   1980 O  OD1 . ASP A 1 261 ? 7.799  23.396  -4.076  1.00 93.71  ? 331 ASP A OD1 1 
ATOM   1981 O  OD2 . ASP A 1 261 ? 7.148  21.794  -5.420  1.00 99.53  ? 331 ASP A OD2 1 
ATOM   1982 N  N   . ILE A 1 262 ? 7.683  26.513  -8.095  1.00 80.55  ? 332 ILE A N   1 
ATOM   1983 C  CA  . ILE A 1 262 ? 8.041  27.238  -9.312  1.00 79.54  ? 332 ILE A CA  1 
ATOM   1984 C  C   . ILE A 1 262 ? 7.714  28.748  -9.237  1.00 83.18  ? 332 ILE A C   1 
ATOM   1985 O  O   . ILE A 1 262 ? 8.523  29.550  -9.703  1.00 81.58  ? 332 ILE A O   1 
ATOM   1986 C  CB  . ILE A 1 262 ? 7.440  26.528  -10.577 1.00 83.83  ? 332 ILE A CB  1 
ATOM   1987 C  CG1 . ILE A 1 262 ? 7.505  27.373  -11.876 1.00 84.56  ? 332 ILE A CG1 1 
ATOM   1988 C  CG2 . ILE A 1 262 ? 6.012  26.042  -10.349 1.00 87.17  ? 332 ILE A CG2 1 
ATOM   1989 C  CD1 . ILE A 1 262 ? 8.868  27.882  -12.341 1.00 90.10  ? 332 ILE A CD1 1 
ATOM   1990 N  N   . TRP A 1 263 ? 6.579  29.132  -8.650  1.00 81.03  ? 333 TRP A N   1 
ATOM   1991 C  CA  . TRP A 1 263 ? 6.203  30.543  -8.588  1.00 81.29  ? 333 TRP A CA  1 
ATOM   1992 C  C   . TRP A 1 263 ? 5.918  31.082  -7.185  1.00 84.85  ? 333 TRP A C   1 
ATOM   1993 O  O   . TRP A 1 263 ? 5.554  30.344  -6.275  1.00 85.00  ? 333 TRP A O   1 
ATOM   1994 C  CB  . TRP A 1 263 ? 5.025  30.835  -9.518  1.00 82.35  ? 333 TRP A CB  1 
ATOM   1995 C  CG  . TRP A 1 263 ? 5.189  30.389  -10.939 1.00 83.39  ? 333 TRP A CG  1 
ATOM   1996 C  CD1 . TRP A 1 263 ? 4.452  29.440  -11.581 1.00 87.80  ? 333 TRP A CD1 1 
ATOM   1997 C  CD2 . TRP A 1 263 ? 6.109  30.904  -11.907 1.00 81.89  ? 333 TRP A CD2 1 
ATOM   1998 N  NE1 . TRP A 1 263 ? 4.851  29.335  -12.889 1.00 87.08  ? 333 TRP A NE1 1 
ATOM   1999 C  CE2 . TRP A 1 263 ? 5.867  30.220  -13.119 1.00 86.82  ? 333 TRP A CE2 1 
ATOM   2000 C  CE3 . TRP A 1 263 ? 7.121  31.877  -11.872 1.00 81.54  ? 333 TRP A CE3 1 
ATOM   2001 C  CZ2 . TRP A 1 263 ? 6.602  30.464  -14.278 1.00 85.55  ? 333 TRP A CZ2 1 
ATOM   2002 C  CZ3 . TRP A 1 263 ? 7.846  32.120  -13.027 1.00 82.39  ? 333 TRP A CZ3 1 
ATOM   2003 C  CH2 . TRP A 1 263 ? 7.582  31.418  -14.211 1.00 84.10  ? 333 TRP A CH2 1 
ATOM   2004 N  N   . PHE A 1 264 ? 6.133  32.386  -7.025  1.00 80.71  ? 334 PHE A N   1 
ATOM   2005 C  CA  . PHE A 1 264 ? 5.966  33.201  -5.816  1.00 80.62  ? 334 PHE A CA  1 
ATOM   2006 C  C   . PHE A 1 264 ? 6.831  32.770  -4.634  1.00 82.04  ? 334 PHE A C   1 
ATOM   2007 O  O   . PHE A 1 264 ? 6.482  33.032  -3.484  1.00 82.55  ? 334 PHE A O   1 
ATOM   2008 C  CB  . PHE A 1 264 ? 4.490  33.343  -5.428  1.00 85.24  ? 334 PHE A CB  1 
ATOM   2009 C  CG  . PHE A 1 264 ? 3.652  33.798  -6.584  1.00 88.48  ? 334 PHE A CG  1 
ATOM   2010 C  CD1 . PHE A 1 264 ? 3.804  35.071  -7.114  1.00 91.58  ? 334 PHE A CD1 1 
ATOM   2011 C  CD2 . PHE A 1 264 ? 2.771  32.924  -7.199  1.00 92.53  ? 334 PHE A CD2 1 
ATOM   2012 C  CE1 . PHE A 1 264 ? 3.050  35.479  -8.201  1.00 94.42  ? 334 PHE A CE1 1 
ATOM   2013 C  CE2 . PHE A 1 264 ? 2.014  33.329  -8.282  1.00 97.34  ? 334 PHE A CE2 1 
ATOM   2014 C  CZ  . PHE A 1 264 ? 2.154  34.608  -8.779  1.00 95.52  ? 334 PHE A CZ  1 
ATOM   2015 N  N   . GLN A 1 265 ? 8.019  32.199  -4.925  1.00 75.70  ? 335 GLN A N   1 
ATOM   2016 C  CA  . GLN A 1 265 ? 8.990  31.843  -3.894  1.00 73.95  ? 335 GLN A CA  1 
ATOM   2017 C  C   . GLN A 1 265 ? 9.610  33.134  -3.337  1.00 76.04  ? 335 GLN A C   1 
ATOM   2018 O  O   . GLN A 1 265 ? 9.464  34.195  -3.939  1.00 75.48  ? 335 GLN A O   1 
ATOM   2019 C  CB  . GLN A 1 265 ? 10.050 30.846  -4.404  1.00 73.65  ? 335 GLN A CB  1 
ATOM   2020 C  CG  . GLN A 1 265 ? 11.103 31.463  -5.309  1.00 87.89  ? 335 GLN A CG  1 
ATOM   2021 C  CD  . GLN A 1 265 ? 11.928 30.464  -6.084  1.00 106.42 ? 335 GLN A CD  1 
ATOM   2022 O  OE1 . GLN A 1 265 ? 11.533 29.315  -6.304  1.00 102.07 ? 335 GLN A OE1 1 
ATOM   2023 N  NE2 . GLN A 1 265 ? 13.100 30.894  -6.507  1.00 97.98  ? 335 GLN A NE2 1 
ATOM   2024 N  N   . SER A 1 266 ? 10.277 33.037  -2.172  1.00 71.60  ? 336 SER A N   1 
ATOM   2025 C  CA  . SER A 1 266 ? 10.874 34.146  -1.421  1.00 70.77  ? 336 SER A CA  1 
ATOM   2026 C  C   . SER A 1 266 ? 11.962 34.792  -2.206  1.00 72.53  ? 336 SER A C   1 
ATOM   2027 O  O   . SER A 1 266 ? 12.078 36.012  -2.197  1.00 72.22  ? 336 SER A O   1 
ATOM   2028 C  CB  . SER A 1 266 ? 11.399 33.708  -0.056  1.00 74.47  ? 336 SER A CB  1 
ATOM   2029 O  OG  . SER A 1 266 ? 12.246 32.563  -0.156  1.00 81.77  ? 336 SER A OG  1 
ATOM   2030 N  N   . HIS A 1 267 ? 12.771 33.976  -2.877  1.00 67.27  ? 337 HIS A N   1 
ATOM   2031 C  CA  . HIS A 1 267 ? 13.879 34.479  -3.664  1.00 65.44  ? 337 HIS A CA  1 
ATOM   2032 C  C   . HIS A 1 267 ? 13.421 35.345  -4.822  1.00 69.14  ? 337 HIS A C   1 
ATOM   2033 O  O   . HIS A 1 267 ? 13.994 36.411  -5.020  1.00 68.14  ? 337 HIS A O   1 
ATOM   2034 C  CB  . HIS A 1 267 ? 14.800 33.350  -4.126  1.00 65.05  ? 337 HIS A CB  1 
ATOM   2035 C  CG  . HIS A 1 267 ? 16.200 33.817  -4.447  1.00 67.24  ? 337 HIS A CG  1 
ATOM   2036 N  ND1 . HIS A 1 267 ? 17.157 33.942  -3.460  1.00 68.62  ? 337 HIS A ND1 1 
ATOM   2037 C  CD2 . HIS A 1 267 ? 16.742 34.159  -5.628  1.00 68.39  ? 337 HIS A CD2 1 
ATOM   2038 C  CE1 . HIS A 1 267 ? 18.250 34.359  -4.071  1.00 67.27  ? 337 HIS A CE1 1 
ATOM   2039 N  NE2 . HIS A 1 267 ? 18.062 34.503  -5.369  1.00 67.40  ? 337 HIS A NE2 1 
ATOM   2040 N  N   . GLN A 1 268 ? 12.358 34.935  -5.545  1.00 66.47  ? 338 GLN A N   1 
ATOM   2041 C  CA  . GLN A 1 268 ? 11.863 35.752  -6.658  1.00 66.76  ? 338 GLN A CA  1 
ATOM   2042 C  C   . GLN A 1 268 ? 11.261 37.070  -6.205  1.00 70.99  ? 338 GLN A C   1 
ATOM   2043 O  O   . GLN A 1 268 ? 11.482 38.065  -6.881  1.00 70.54  ? 338 GLN A O   1 
ATOM   2044 C  CB  . GLN A 1 268 ? 10.919 35.017  -7.608  1.00 69.22  ? 338 GLN A CB  1 
ATOM   2045 C  CG  . GLN A 1 268 ? 9.828  34.210  -6.944  1.00 85.68  ? 338 GLN A CG  1 
ATOM   2046 C  CD  . GLN A 1 268 ? 9.439  33.025  -7.780  1.00 104.51 ? 338 GLN A CD  1 
ATOM   2047 O  OE1 . GLN A 1 268 ? 8.398  32.423  -7.534  1.00 101.71 ? 338 GLN A OE1 1 
ATOM   2048 N  NE2 . GLN A 1 268 ? 10.332 32.619  -8.716  1.00 94.84  ? 338 GLN A NE2 1 
ATOM   2049 N  N   . ILE A 1 269 ? 10.527 37.092  -5.069  1.00 68.10  ? 339 ILE A N   1 
ATOM   2050 C  CA  . ILE A 1 269 ? 9.955  38.326  -4.505  1.00 68.66  ? 339 ILE A CA  1 
ATOM   2051 C  C   . ILE A 1 269 ? 11.109 39.263  -4.152  1.00 70.82  ? 339 ILE A C   1 
ATOM   2052 O  O   . ILE A 1 269 ? 11.068 40.452  -4.472  1.00 70.53  ? 339 ILE A O   1 
ATOM   2053 C  CB  . ILE A 1 269 ? 9.054  38.048  -3.267  1.00 73.15  ? 339 ILE A CB  1 
ATOM   2054 C  CG1 . ILE A 1 269 ? 7.788  37.282  -3.681  1.00 75.20  ? 339 ILE A CG1 1 
ATOM   2055 C  CG2 . ILE A 1 269 ? 8.695  39.353  -2.518  1.00 74.75  ? 339 ILE A CG2 1 
ATOM   2056 C  CD1 . ILE A 1 269 ? 6.997  36.679  -2.548  1.00 83.24  ? 339 ILE A CD1 1 
ATOM   2057 N  N   . PHE A 1 270 ? 12.150 38.702  -3.508  1.00 66.10  ? 340 PHE A N   1 
ATOM   2058 C  CA  . PHE A 1 270 ? 13.356 39.424  -3.136  1.00 64.88  ? 340 PHE A CA  1 
ATOM   2059 C  C   . PHE A 1 270 ? 14.037 39.967  -4.394  1.00 67.78  ? 340 PHE A C   1 
ATOM   2060 O  O   . PHE A 1 270 ? 14.455 41.119  -4.399  1.00 67.06  ? 340 PHE A O   1 
ATOM   2061 C  CB  . PHE A 1 270 ? 14.297 38.544  -2.295  1.00 65.98  ? 340 PHE A CB  1 
ATOM   2062 C  CG  . PHE A 1 270 ? 15.701 39.077  -2.184  1.00 66.56  ? 340 PHE A CG  1 
ATOM   2063 C  CD1 . PHE A 1 270 ? 15.969 40.221  -1.443  1.00 70.03  ? 340 PHE A CD1 1 
ATOM   2064 C  CD2 . PHE A 1 270 ? 16.750 38.451  -2.840  1.00 67.71  ? 340 PHE A CD2 1 
ATOM   2065 C  CE1 . PHE A 1 270 ? 17.256 40.725  -1.361  1.00 70.28  ? 340 PHE A CE1 1 
ATOM   2066 C  CE2 . PHE A 1 270 ? 18.038 38.953  -2.755  1.00 69.92  ? 340 PHE A CE2 1 
ATOM   2067 C  CZ  . PHE A 1 270 ? 18.289 40.087  -2.014  1.00 68.38  ? 340 PHE A CZ  1 
ATOM   2068 N  N   . HIS A 1 271 ? 14.110 39.152  -5.460  1.00 64.00  ? 341 HIS A N   1 
ATOM   2069 C  CA  . HIS A 1 271 ? 14.675 39.547  -6.744  1.00 63.41  ? 341 HIS A CA  1 
ATOM   2070 C  C   . HIS A 1 271 ? 13.909 40.700  -7.359  1.00 68.08  ? 341 HIS A C   1 
ATOM   2071 O  O   . HIS A 1 271 ? 14.520 41.608  -7.917  1.00 67.57  ? 341 HIS A O   1 
ATOM   2072 C  CB  . HIS A 1 271 ? 14.736 38.350  -7.703  1.00 64.02  ? 341 HIS A CB  1 
ATOM   2073 C  CG  . HIS A 1 271 ? 16.043 37.612  -7.631  1.00 66.22  ? 341 HIS A CG  1 
ATOM   2074 N  ND1 . HIS A 1 271 ? 16.984 37.742  -8.616  1.00 67.51  ? 341 HIS A ND1 1 
ATOM   2075 C  CD2 . HIS A 1 271 ? 16.551 36.870  -6.634  1.00 67.47  ? 341 HIS A CD2 1 
ATOM   2076 C  CE1 . HIS A 1 271 ? 18.025 37.018  -8.220  1.00 66.09  ? 341 HIS A CE1 1 
ATOM   2077 N  NE2 . HIS A 1 271 ? 17.822 36.509  -7.020  1.00 66.35  ? 341 HIS A NE2 1 
ATOM   2078 N  N   . VAL A 1 272 ? 12.572 40.633  -7.282  1.00 65.67  ? 342 VAL A N   1 
ATOM   2079 C  CA  . VAL A 1 272 ? 11.645 41.657  -7.784  1.00 66.73  ? 342 VAL A CA  1 
ATOM   2080 C  C   . VAL A 1 272 ? 11.829 42.966  -7.013  1.00 70.06  ? 342 VAL A C   1 
ATOM   2081 O  O   . VAL A 1 272 ? 11.903 44.045  -7.608  1.00 70.05  ? 342 VAL A O   1 
ATOM   2082 C  CB  . VAL A 1 272 ? 10.159 41.191  -7.713  1.00 72.34  ? 342 VAL A CB  1 
ATOM   2083 C  CG1 . VAL A 1 272 ? 9.196  42.312  -8.105  1.00 73.86  ? 342 VAL A CG1 1 
ATOM   2084 C  CG2 . VAL A 1 272 ? 9.923  39.964  -8.579  1.00 72.35  ? 342 VAL A CG2 1 
ATOM   2085 N  N   . LEU A 1 273 ? 11.933 42.847  -5.681  1.00 65.88  ? 343 LEU A N   1 
ATOM   2086 C  CA  . LEU A 1 273 ? 12.093 43.965  -4.759  1.00 65.61  ? 343 LEU A CA  1 
ATOM   2087 C  C   . LEU A 1 273 ? 13.354 44.767  -5.002  1.00 68.09  ? 343 LEU A C   1 
ATOM   2088 O  O   . LEU A 1 273 ? 13.319 45.983  -4.869  1.00 68.17  ? 343 LEU A O   1 
ATOM   2089 C  CB  . LEU A 1 273 ? 12.024 43.491  -3.302  1.00 65.68  ? 343 LEU A CB  1 
ATOM   2090 C  CG  . LEU A 1 273 ? 11.155 44.302  -2.350  1.00 71.71  ? 343 LEU A CG  1 
ATOM   2091 C  CD1 . LEU A 1 273 ? 9.844  44.730  -3.017  1.00 73.52  ? 343 LEU A CD1 1 
ATOM   2092 C  CD2 . LEU A 1 273 ? 10.833 43.480  -1.139  1.00 74.66  ? 343 LEU A CD2 1 
ATOM   2093 N  N   . VAL A 1 274 ? 14.459 44.088  -5.362  1.00 63.12  ? 344 VAL A N   1 
ATOM   2094 C  CA  . VAL A 1 274 ? 15.745 44.723  -5.655  1.00 61.98  ? 344 VAL A CA  1 
ATOM   2095 C  C   . VAL A 1 274 ? 15.576 45.689  -6.835  1.00 66.35  ? 344 VAL A C   1 
ATOM   2096 O  O   . VAL A 1 274 ? 16.033 46.826  -6.759  1.00 66.01  ? 344 VAL A O   1 
ATOM   2097 C  CB  . VAL A 1 274 ? 16.882 43.690  -5.911  1.00 64.66  ? 344 VAL A CB  1 
ATOM   2098 C  CG1 . VAL A 1 274 ? 18.194 44.380  -6.265  1.00 63.97  ? 344 VAL A CG1 1 
ATOM   2099 C  CG2 . VAL A 1 274 ? 17.079 42.788  -4.702  1.00 64.05  ? 344 VAL A CG2 1 
ATOM   2100 N  N   . VAL A 1 275 ? 14.903 45.232  -7.909  1.00 63.47  ? 345 VAL A N   1 
ATOM   2101 C  CA  . VAL A 1 275 ? 14.639 46.035  -9.109  1.00 64.21  ? 345 VAL A CA  1 
ATOM   2102 C  C   . VAL A 1 275 ? 13.752 47.228  -8.752  1.00 69.14  ? 345 VAL A C   1 
ATOM   2103 O  O   . VAL A 1 275 ? 14.083 48.359  -9.106  1.00 69.07  ? 345 VAL A O   1 
ATOM   2104 C  CB  . VAL A 1 275 ? 14.030 45.213  -10.281 1.00 68.95  ? 345 VAL A CB  1 
ATOM   2105 C  CG1 . VAL A 1 275 ? 14.004 46.030  -11.568 1.00 69.95  ? 345 VAL A CG1 1 
ATOM   2106 C  CG2 . VAL A 1 275 ? 14.798 43.919  -10.504 1.00 67.62  ? 345 VAL A CG2 1 
ATOM   2107 N  N   . ALA A 1 276 ? 12.650 46.971  -8.014  1.00 66.38  ? 346 ALA A N   1 
ATOM   2108 C  CA  . ALA A 1 276 ? 11.699 48.001  -7.586  1.00 67.44  ? 346 ALA A CA  1 
ATOM   2109 C  C   . ALA A 1 276 ? 12.393 49.028  -6.706  1.00 70.85  ? 346 ALA A C   1 
ATOM   2110 O  O   . ALA A 1 276 ? 12.248 50.229  -6.920  1.00 71.25  ? 346 ALA A O   1 
ATOM   2111 C  CB  . ALA A 1 276 ? 10.529 47.369  -6.840  1.00 69.11  ? 346 ALA A CB  1 
ATOM   2112 N  N   . ALA A 1 277 ? 13.201 48.543  -5.763  1.00 66.40  ? 347 ALA A N   1 
ATOM   2113 C  CA  . ALA A 1 277 ? 13.932 49.388  -4.844  1.00 65.87  ? 347 ALA A CA  1 
ATOM   2114 C  C   . ALA A 1 277 ? 15.029 50.217  -5.512  1.00 69.49  ? 347 ALA A C   1 
ATOM   2115 O  O   . ALA A 1 277 ? 15.172 51.396  -5.189  1.00 69.21  ? 347 ALA A O   1 
ATOM   2116 C  CB  . ALA A 1 277 ? 14.475 48.566  -3.702  1.00 65.74  ? 347 ALA A CB  1 
ATOM   2117 N  N   . ALA A 1 278 ? 15.784 49.617  -6.456  1.00 65.78  ? 348 ALA A N   1 
ATOM   2118 C  CA  . ALA A 1 278 ? 16.832 50.316  -7.208  1.00 65.62  ? 348 ALA A CA  1 
ATOM   2119 C  C   . ALA A 1 278 ? 16.184 51.407  -8.062  1.00 71.33  ? 348 ALA A C   1 
ATOM   2120 O  O   . ALA A 1 278 ? 16.722 52.508  -8.159  1.00 71.02  ? 348 ALA A O   1 
ATOM   2121 C  CB  . ALA A 1 278 ? 17.601 49.342  -8.091  1.00 65.73  ? 348 ALA A CB  1 
ATOM   2122 N  N   . PHE A 1 279 ? 15.016 51.098  -8.669  1.00 69.47  ? 349 PHE A N   1 
ATOM   2123 C  CA  . PHE A 1 279 ? 14.252 52.047  -9.481  1.00 71.21  ? 349 PHE A CA  1 
ATOM   2124 C  C   . PHE A 1 279 ? 13.726 53.207  -8.639  1.00 76.05  ? 349 PHE A C   1 
ATOM   2125 O  O   . PHE A 1 279 ? 13.784 54.353  -9.079  1.00 76.36  ? 349 PHE A O   1 
ATOM   2126 C  CB  . PHE A 1 279 ? 13.093 51.359  -10.218 1.00 74.34  ? 349 PHE A CB  1 
ATOM   2127 C  CG  . PHE A 1 279 ? 12.362 52.279  -11.164 1.00 78.04  ? 349 PHE A CG  1 
ATOM   2128 C  CD1 . PHE A 1 279 ? 12.794 52.438  -12.473 1.00 82.03  ? 349 PHE A CD1 1 
ATOM   2129 C  CD2 . PHE A 1 279 ? 11.263 53.013  -10.735 1.00 81.71  ? 349 PHE A CD2 1 
ATOM   2130 C  CE1 . PHE A 1 279 ? 12.137 53.302  -13.337 1.00 85.13  ? 349 PHE A CE1 1 
ATOM   2131 C  CE2 . PHE A 1 279 ? 10.612 53.886  -11.596 1.00 86.68  ? 349 PHE A CE2 1 
ATOM   2132 C  CZ  . PHE A 1 279 ? 11.048 54.022  -12.895 1.00 85.56  ? 349 PHE A CZ  1 
ATOM   2133 N  N   . VAL A 1 280 ? 13.185 52.893  -7.447  1.00 72.78  ? 350 VAL A N   1 
ATOM   2134 C  CA  . VAL A 1 280 ? 12.658 53.882  -6.509  1.00 73.47  ? 350 VAL A CA  1 
ATOM   2135 C  C   . VAL A 1 280 ? 13.788 54.832  -6.132  1.00 77.11  ? 350 VAL A C   1 
ATOM   2136 O  O   . VAL A 1 280 ? 13.585 56.047  -6.084  1.00 77.62  ? 350 VAL A O   1 
ATOM   2137 C  CB  . VAL A 1 280 ? 12.006 53.222  -5.265  1.00 77.35  ? 350 VAL A CB  1 
ATOM   2138 C  CG1 . VAL A 1 280 ? 11.773 54.240  -4.164  1.00 77.64  ? 350 VAL A CG1 1 
ATOM   2139 C  CG2 . VAL A 1 280 ? 10.688 52.544  -5.631  1.00 78.47  ? 350 VAL A CG2 1 
ATOM   2140 N  N   . HIS A 1 281 ? 14.990 54.265  -5.911  1.00 72.63  ? 351 HIS A N   1 
ATOM   2141 C  CA  . HIS A 1 281 ? 16.197 55.011  -5.587  1.00 72.12  ? 351 HIS A CA  1 
ATOM   2142 C  C   . HIS A 1 281 ? 16.458 55.998  -6.694  1.00 77.76  ? 351 HIS A C   1 
ATOM   2143 O  O   . HIS A 1 281 ? 16.729 57.157  -6.415  1.00 77.75  ? 351 HIS A O   1 
ATOM   2144 C  CB  . HIS A 1 281 ? 17.417 54.082  -5.461  1.00 71.52  ? 351 HIS A CB  1 
ATOM   2145 C  CG  . HIS A 1 281 ? 18.672 54.813  -5.024  1.00 74.45  ? 351 HIS A CG  1 
ATOM   2146 N  ND1 . HIS A 1 281 ? 19.651 55.171  -5.934  1.00 76.15  ? 351 HIS A ND1 1 
ATOM   2147 C  CD2 . HIS A 1 281 ? 19.016 55.268  -3.802  1.00 75.98  ? 351 HIS A CD2 1 
ATOM   2148 C  CE1 . HIS A 1 281 ? 20.562 55.806  -5.234  1.00 75.41  ? 351 HIS A CE1 1 
ATOM   2149 N  NE2 . HIS A 1 281 ? 20.240 55.882  -3.946  1.00 75.64  ? 351 HIS A NE2 1 
ATOM   2150 N  N   . PHE A 1 282 ? 16.356 55.529  -7.952  1.00 75.38  ? 352 PHE A N   1 
ATOM   2151 C  CA  . PHE A 1 282 ? 16.568 56.332  -9.147  1.00 76.65  ? 352 PHE A CA  1 
ATOM   2152 C  C   . PHE A 1 282 ? 15.570 57.478  -9.285  1.00 83.05  ? 352 PHE A C   1 
ATOM   2153 O  O   . PHE A 1 282 ? 15.975 58.601  -9.569  1.00 83.22  ? 352 PHE A O   1 
ATOM   2154 C  CB  . PHE A 1 282 ? 16.590 55.458  -10.406 1.00 78.79  ? 352 PHE A CB  1 
ATOM   2155 C  CG  . PHE A 1 282 ? 16.755 56.238  -11.684 1.00 81.86  ? 352 PHE A CG  1 
ATOM   2156 C  CD1 . PHE A 1 282 ? 17.857 57.060  -11.875 1.00 85.01  ? 352 PHE A CD1 1 
ATOM   2157 C  CD2 . PHE A 1 282 ? 15.796 56.173  -12.682 1.00 85.59  ? 352 PHE A CD2 1 
ATOM   2158 C  CE1 . PHE A 1 282 ? 17.995 57.799  -13.038 1.00 87.55  ? 352 PHE A CE1 1 
ATOM   2159 C  CE2 . PHE A 1 282 ? 15.938 56.904  -13.851 1.00 90.07  ? 352 PHE A CE2 1 
ATOM   2160 C  CZ  . PHE A 1 282 ? 17.039 57.715  -14.024 1.00 88.25  ? 352 PHE A CZ  1 
ATOM   2161 N  N   . TYR A 1 283 ? 14.274 57.201  -9.099  1.00 81.29  ? 353 TYR A N   1 
ATOM   2162 C  CA  . TYR A 1 283 ? 13.257 58.239  -9.194  1.00 83.25  ? 353 TYR A CA  1 
ATOM   2163 C  C   . TYR A 1 283 ? 13.458 59.297  -8.095  1.00 87.63  ? 353 TYR A C   1 
ATOM   2164 O  O   . TYR A 1 283 ? 13.450 60.490  -8.395  1.00 88.22  ? 353 TYR A O   1 
ATOM   2165 C  CB  . TYR A 1 283 ? 11.853 57.620  -9.161  1.00 85.59  ? 353 TYR A CB  1 
ATOM   2166 C  CG  . TYR A 1 283 ? 10.737 58.620  -8.959  1.00 89.42  ? 353 TYR A CG  1 
ATOM   2167 C  CD1 . TYR A 1 283 ? 10.352 59.483  -9.978  1.00 93.37  ? 353 TYR A CD1 1 
ATOM   2168 C  CD2 . TYR A 1 283 ? 10.075 58.709  -7.743  1.00 90.32  ? 353 TYR A CD2 1 
ATOM   2169 C  CE1 . TYR A 1 283 ? 9.332  60.406  -9.793  1.00 96.18  ? 353 TYR A CE1 1 
ATOM   2170 C  CE2 . TYR A 1 283 ? 9.052  59.629  -7.546  1.00 93.14  ? 353 TYR A CE2 1 
ATOM   2171 C  CZ  . TYR A 1 283 ? 8.681  60.471  -8.573  1.00 102.66 ? 353 TYR A CZ  1 
ATOM   2172 O  OH  . TYR A 1 283 ? 7.668  61.369  -8.372  1.00 105.85 ? 353 TYR A OH  1 
ATOM   2173 N  N   . GLY A 1 284 ? 13.650 58.832  -6.861  1.00 83.56  ? 354 GLY A N   1 
ATOM   2174 C  CA  . GLY A 1 284 ? 13.897 59.680  -5.697  1.00 83.54  ? 354 GLY A CA  1 
ATOM   2175 C  C   . GLY A 1 284 ? 15.159 60.498  -5.866  1.00 87.80  ? 354 GLY A C   1 
ATOM   2176 O  O   . GLY A 1 284 ? 15.150 61.701  -5.587  1.00 88.03  ? 354 GLY A O   1 
ATOM   2177 N  N   . VAL A 1 285 ? 16.254 59.848  -6.355  1.00 84.11  ? 355 VAL A N   1 
ATOM   2178 C  CA  . VAL A 1 285 ? 17.569 60.461  -6.624  1.00 84.03  ? 355 VAL A CA  1 
ATOM   2179 C  C   . VAL A 1 285 ? 17.471 61.560  -7.678  1.00 90.17  ? 355 VAL A C   1 
ATOM   2180 O  O   . VAL A 1 285 ? 18.062 62.628  -7.509  1.00 90.02  ? 355 VAL A O   1 
ATOM   2181 C  CB  . VAL A 1 285 ? 18.717 59.449  -6.954  1.00 86.92  ? 355 VAL A CB  1 
ATOM   2182 C  CG1 . VAL A 1 285 ? 18.609 58.903  -8.375  1.00 87.21  ? 355 VAL A CG1 1 
ATOM   2183 C  CG2 . VAL A 1 285 ? 20.089 60.083  -6.735  1.00 86.59  ? 355 VAL A CG2 1 
ATOM   2184 N  N   . SER A 1 286 ? 16.703 61.301  -8.757  1.00 88.41  ? 356 SER A N   1 
ATOM   2185 C  CA  . SER A 1 286 ? 16.503 62.253  -9.849  1.00 90.16  ? 356 SER A CA  1 
ATOM   2186 C  C   . SER A 1 286 ? 15.815 63.496  -9.344  1.00 95.81  ? 356 SER A C   1 
ATOM   2187 O  O   . SER A 1 286 ? 16.142 64.592  -9.776  1.00 96.32  ? 356 SER A O   1 
ATOM   2188 C  CB  . SER A 1 286 ? 15.709 61.631  -10.989 1.00 94.71  ? 356 SER A CB  1 
ATOM   2189 O  OG  . SER A 1 286 ? 16.519 60.729  -11.728 1.00 102.72 ? 356 SER A OG  1 
ATOM   2190 N  N   . ASN A 1 287 ? 14.910 63.342  -8.383  1.00 92.93  ? 357 ASN A N   1 
ATOM   2191 C  CA  . ASN A 1 287 ? 14.254 64.506  -7.820  1.00 94.11  ? 357 ASN A CA  1 
ATOM   2192 C  C   . ASN A 1 287 ? 15.236 65.383  -7.034  1.00 98.28  ? 357 ASN A C   1 
ATOM   2193 O  O   . ASN A 1 287 ? 15.109 66.607  -7.039  1.00 99.03  ? 357 ASN A O   1 
ATOM   2194 C  CB  . ASN A 1 287 ? 13.047 64.120  -7.000  1.00 94.89  ? 357 ASN A CB  1 
ATOM   2195 C  CG  . ASN A 1 287 ? 11.920 63.530  -7.799  1.00 118.10 ? 357 ASN A CG  1 
ATOM   2196 O  OD1 . ASN A 1 287 ? 11.847 63.677  -9.035  1.00 113.28 ? 357 ASN A OD1 1 
ATOM   2197 N  ND2 . ASN A 1 287 ? 10.979 62.927  -7.082  1.00 110.21 ? 357 ASN A ND2 1 
ATOM   2198 N  N   . LEU A 1 288 ? 16.220 64.748  -6.380  1.00 93.89  ? 358 LEU A N   1 
ATOM   2199 C  CA  . LEU A 1 288 ? 17.246 65.439  -5.609  1.00 93.56  ? 358 LEU A CA  1 
ATOM   2200 C  C   . LEU A 1 288 ? 18.062 66.398  -6.496  1.00 98.97  ? 358 LEU A C   1 
ATOM   2201 O  O   . LEU A 1 288 ? 18.420 67.489  -6.052  1.00 98.99  ? 358 LEU A O   1 
ATOM   2202 C  CB  . LEU A 1 288 ? 18.154 64.439  -4.885  1.00 92.20  ? 358 LEU A CB  1 
ATOM   2203 C  CG  . LEU A 1 288 ? 18.741 64.986  -3.600  1.00 96.72  ? 358 LEU A CG  1 
ATOM   2204 C  CD1 . LEU A 1 288 ? 19.029 63.897  -2.618  1.00 95.89  ? 358 LEU A CD1 1 
ATOM   2205 C  CD2 . LEU A 1 288 ? 19.984 65.729  -3.860  1.00 99.57  ? 358 LEU A CD2 1 
ATOM   2206 N  N   . GLN A 1 289 ? 18.315 65.999  -7.761  1.00 96.47  ? 359 GLN A N   1 
ATOM   2207 C  CA  . GLN A 1 289 ? 19.039 66.825  -8.736  1.00 97.65  ? 359 GLN A CA  1 
ATOM   2208 C  C   . GLN A 1 289 ? 18.297 68.160  -8.957  1.00 103.37 ? 359 GLN A C   1 
ATOM   2209 O  O   . GLN A 1 289 ? 18.931 69.213  -8.974  1.00 103.57 ? 359 GLN A O   1 
ATOM   2210 C  CB  . GLN A 1 289 ? 19.211 66.086  -10.081 1.00 99.55  ? 359 GLN A CB  1 
ATOM   2211 C  CG  . GLN A 1 289 ? 17.885 65.738  -10.738 1.00 116.77 ? 359 GLN A CG  1 
ATOM   2212 C  CD  . GLN A 1 289 ? 17.873 65.424  -12.217 1.00 137.45 ? 359 GLN A CD  1 
ATOM   2213 O  OE1 . GLN A 1 289 ? 16.875 64.911  -12.734 1.00 133.62 ? 359 GLN A OE1 1 
ATOM   2214 N  NE2 . GLN A 1 289 ? 18.932 65.773  -12.937 1.00 130.20 ? 359 GLN A NE2 1 
ATOM   2215 N  N   . GLU A 1 290 ? 16.950 68.105  -9.096  1.00 100.96 ? 360 GLU A N   1 
ATOM   2216 C  CA  . GLU A 1 290 ? 16.082 69.273  -9.299  1.00 102.63 ? 360 GLU A CA  1 
ATOM   2217 C  C   . GLU A 1 290 ? 16.124 70.195  -8.103  1.00 105.91 ? 360 GLU A C   1 
ATOM   2218 O  O   . GLU A 1 290 ? 16.171 71.414  -8.270  1.00 106.66 ? 360 GLU A O   1 
ATOM   2219 C  CB  . GLU A 1 290 ? 14.642 68.863  -9.606  1.00 105.11 ? 360 GLU A CB  1 
ATOM   2220 C  CG  . GLU A 1 290 ? 14.473 68.349  -11.023 1.00 117.73 ? 360 GLU A CG  1 
ATOM   2221 C  CD  . GLU A 1 290 ? 13.106 67.782  -11.338 1.00 141.73 ? 360 GLU A CD  1 
ATOM   2222 O  OE1 . GLU A 1 290 ? 12.922 67.290  -12.473 1.00 137.56 ? 360 GLU A OE1 1 
ATOM   2223 O  OE2 . GLU A 1 290 ? 12.218 67.823  -10.456 1.00 137.24 ? 360 GLU A OE2 1 
ATOM   2224 N  N   . PHE A 1 291 ? 16.133 69.603  -6.892  1.00 100.80 ? 361 PHE A N   1 
ATOM   2225 C  CA  . PHE A 1 291 ? 16.238 70.344  -5.643  1.00 100.34 ? 361 PHE A CA  1 
ATOM   2226 C  C   . PHE A 1 291 ? 17.524 71.161  -5.666  1.00 103.51 ? 361 PHE A C   1 
ATOM   2227 O  O   . PHE A 1 291 ? 17.500 72.325  -5.288  1.00 103.86 ? 361 PHE A O   1 
ATOM   2228 C  CB  . PHE A 1 291 ? 16.209 69.399  -4.409  1.00 100.89 ? 361 PHE A CB  1 
ATOM   2229 C  CG  . PHE A 1 291 ? 16.802 69.981  -3.140  1.00 102.17 ? 361 PHE A CG  1 
ATOM   2230 C  CD1 . PHE A 1 291 ? 18.167 69.954  -2.914  1.00 104.64 ? 361 PHE A CD1 1 
ATOM   2231 C  CD2 . PHE A 1 291 ? 15.991 70.559  -2.176  1.00 105.10 ? 361 PHE A CD2 1 
ATOM   2232 C  CE1 . PHE A 1 291 ? 18.709 70.515  -1.765  1.00 105.51 ? 361 PHE A CE1 1 
ATOM   2233 C  CE2 . PHE A 1 291 ? 16.532 71.095  -1.010  1.00 107.82 ? 361 PHE A CE2 1 
ATOM   2234 C  CZ  . PHE A 1 291 ? 17.894 71.072  -0.812  1.00 105.23 ? 361 PHE A CZ  1 
ATOM   2235 N  N   . ARG A 1 292 ? 18.639 70.555  -6.114  1.00 98.79  ? 362 ARG A N   1 
ATOM   2236 C  CA  . ARG A 1 292 ? 19.948 71.207  -6.128  1.00 98.46  ? 362 ARG A CA  1 
ATOM   2237 C  C   . ARG A 1 292 ? 20.053 72.425  -7.024  1.00 103.63 ? 362 ARG A C   1 
ATOM   2238 O  O   . ARG A 1 292 ? 20.708 73.395  -6.643  1.00 103.75 ? 362 ARG A O   1 
ATOM   2239 C  CB  . ARG A 1 292 ? 21.069 70.219  -6.443  1.00 97.32  ? 362 ARG A CB  1 
ATOM   2240 C  CG  . ARG A 1 292 ? 21.447 69.427  -5.211  1.00 103.81 ? 362 ARG A CG  1 
ATOM   2241 C  CD  . ARG A 1 292 ? 21.848 70.352  -4.070  1.00 110.44 ? 362 ARG A CD  1 
ATOM   2242 N  NE  . ARG A 1 292 ? 21.456 69.818  -2.770  1.00 114.70 ? 362 ARG A NE  1 
ATOM   2243 C  CZ  . ARG A 1 292 ? 22.024 70.149  -1.622  1.00 126.83 ? 362 ARG A CZ  1 
ATOM   2244 N  NH1 . ARG A 1 292 ? 23.046 70.990  -1.601  1.00 114.88 ? 362 ARG A NH1 1 
ATOM   2245 N  NH2 . ARG A 1 292 ? 21.598 69.621  -0.482  1.00 111.72 ? 362 ARG A NH2 1 
ATOM   2246 N  N   . TYR A 1 293 ? 19.426 72.386  -8.199  1.00 100.86 ? 363 TYR A N   1 
ATOM   2247 C  CA  . TYR A 1 293 ? 19.478 73.521  -9.118  1.00 102.41 ? 363 TYR A CA  1 
ATOM   2248 C  C   . TYR A 1 293 ? 18.758 74.761  -8.589  1.00 105.98 ? 363 TYR A C   1 
ATOM   2249 O  O   . TYR A 1 293 ? 19.231 75.875  -8.814  1.00 106.72 ? 363 TYR A O   1 
ATOM   2250 C  CB  . TYR A 1 293 ? 18.990 73.147  -10.518 1.00 105.13 ? 363 TYR A CB  1 
ATOM   2251 C  CG  . TYR A 1 293 ? 19.836 73.789  -11.595 1.00 108.85 ? 363 TYR A CG  1 
ATOM   2252 C  CD1 . TYR A 1 293 ? 21.073 73.252  -11.943 1.00 110.47 ? 363 TYR A CD1 1 
ATOM   2253 C  CD2 . TYR A 1 293 ? 19.431 74.957  -12.227 1.00 111.81 ? 363 TYR A CD2 1 
ATOM   2254 C  CE1 . TYR A 1 293 ? 21.871 73.852  -12.904 1.00 113.19 ? 363 TYR A CE1 1 
ATOM   2255 C  CE2 . TYR A 1 293 ? 20.216 75.563  -13.199 1.00 114.50 ? 363 TYR A CE2 1 
ATOM   2256 C  CZ  . TYR A 1 293 ? 21.437 75.004  -13.536 1.00 121.69 ? 363 TYR A CZ  1 
ATOM   2257 O  OH  . TYR A 1 293 ? 22.220 75.588  -14.495 1.00 124.65 ? 363 TYR A OH  1 
ATOM   2258 N  N   . GLY A 1 294 ? 17.660 74.550  -7.866  1.00 101.13 ? 364 GLY A N   1 
ATOM   2259 C  CA  . GLY A 1 294 ? 16.857 75.623  -7.284  1.00 101.41 ? 364 GLY A CA  1 
ATOM   2260 C  C   . GLY A 1 294 ? 17.612 76.489  -6.303  1.00 103.66 ? 364 GLY A C   1 
ATOM   2261 O  O   . GLY A 1 294 ? 17.473 77.716  -6.322  1.00 104.41 ? 364 GLY A O   1 
ATOM   2262 N  N   . LEU A 1 295 ? 18.405 75.856  -5.434  1.00 97.62  ? 365 LEU A N   1 
ATOM   2263 C  CA  . LEU A 1 295 ? 19.190 76.544  -4.424  1.00 96.71  ? 365 LEU A CA  1 
ATOM   2264 C  C   . LEU A 1 295 ? 20.648 76.286  -4.569  1.00 98.73  ? 365 LEU A C   1 
ATOM   2265 O  O   . LEU A 1 295 ? 21.106 75.148  -4.535  1.00 97.03  ? 365 LEU A O   1 
ATOM   2266 C  CB  . LEU A 1 295 ? 18.715 76.261  -2.981  1.00 95.89  ? 365 LEU A CB  1 
ATOM   2267 C  CG  . LEU A 1 295 ? 18.597 74.819  -2.399  1.00 99.01  ? 365 LEU A CG  1 
ATOM   2268 C  CD1 . LEU A 1 295 ? 17.876 73.878  -3.305  1.00 99.01  ? 365 LEU A CD1 1 
ATOM   2269 C  CD2 . LEU A 1 295 ? 19.935 74.238  -1.954  1.00 100.52 ? 365 LEU A CD2 1 
ATOM   2270 N  N   . GLU A 1 296 ? 21.376 77.357  -4.757  1.00 95.48  ? 366 GLU A N   1 
ATOM   2271 C  CA  . GLU A 1 296 ? 22.798 77.255  -4.863  1.00 94.76  ? 366 GLU A CA  1 
ATOM   2272 C  C   . GLU A 1 296 ? 23.267 76.755  -3.503  1.00 96.52  ? 366 GLU A C   1 
ATOM   2273 O  O   . GLU A 1 296 ? 23.646 75.597  -3.402  1.00 94.82  ? 366 GLU A O   1 
ATOM   2274 C  CB  . GLU A 1 296 ? 23.379 78.603  -5.226  1.00 97.63  ? 366 GLU A CB  1 
ATOM   2275 C  CG  . GLU A 1 296 ? 22.702 79.246  -6.415  1.00 108.42 ? 366 GLU A CG  1 
ATOM   2276 C  CD  . GLU A 1 296 ? 23.342 80.582  -6.656  1.00 127.33 ? 366 GLU A CD  1 
ATOM   2277 O  OE1 . GLU A 1 296 ? 22.604 81.576  -6.832  1.00 117.93 ? 366 GLU A OE1 1 
ATOM   2278 O  OE2 . GLU A 1 296 ? 24.589 80.632  -6.658  1.00 121.89 ? 366 GLU A OE2 1 
ATOM   2279 N  N   . GLY A 1 297 ? 23.111 77.585  -2.476  1.00 92.94  ? 367 GLY A N   1 
ATOM   2280 C  CA  . GLY A 1 297 ? 23.472 77.261  -1.096  1.00 91.88  ? 367 GLY A CA  1 
ATOM   2281 C  C   . GLY A 1 297 ? 22.733 78.100  -0.085  1.00 95.53  ? 367 GLY A C   1 
ATOM   2282 O  O   . GLY A 1 297 ? 22.184 79.153  -0.426  1.00 95.94  ? 367 GLY A O   1 
ATOM   2283 N  N   . GLY A 1 298 ? 22.684 77.619  1.148   1.00 91.10  ? 368 GLY A N   1 
ATOM   2284 C  CA  . GLY A 1 298 ? 21.980 78.271  2.247   1.00 114.55 ? 368 GLY A CA  1 
ATOM   2285 C  C   . GLY A 1 298 ? 22.354 77.681  3.582   1.00 128.49 ? 368 GLY A C   1 
ATOM   2286 O  O   . GLY A 1 298 ? 23.396 78.025  4.144   1.00 87.21  ? 368 GLY A O   1 
ATOM   2287 N  N   . GLU B 2 1   ? 15.890 1.366   0.769   1.00 75.95  ? 1   GLU H N   1 
ATOM   2288 C  CA  . GLU B 2 1   ? 16.374 2.000   -0.462  1.00 73.90  ? 1   GLU H CA  1 
ATOM   2289 C  C   . GLU B 2 1   ? 15.619 1.602   -1.722  1.00 75.65  ? 1   GLU H C   1 
ATOM   2290 O  O   . GLU B 2 1   ? 14.689 0.805   -1.662  1.00 75.68  ? 1   GLU H O   1 
ATOM   2291 C  CB  . GLU B 2 1   ? 17.881 1.806   -0.659  1.00 74.46  ? 1   GLU H CB  1 
ATOM   2292 C  CG  . GLU B 2 1   ? 18.555 3.076   -1.159  1.00 85.87  ? 1   GLU H CG  1 
ATOM   2293 C  CD  . GLU B 2 1   ? 20.049 3.128   -0.931  1.00 110.42 ? 1   GLU H CD  1 
ATOM   2294 O  OE1 . GLU B 2 1   ? 20.785 2.405   -1.639  1.00 105.54 ? 1   GLU H OE1 1 
ATOM   2295 O  OE2 . GLU B 2 1   ? 20.488 3.916   -0.064  1.00 107.15 ? 1   GLU H OE2 1 
ATOM   2296 N  N   . VAL B 2 2   ? 15.999 2.204   -2.863  1.00 70.12  ? 2   VAL H N   1 
ATOM   2297 C  CA  . VAL B 2 2   ? 15.398 1.957   -4.165  1.00 68.45  ? 2   VAL H CA  1 
ATOM   2298 C  C   . VAL B 2 2   ? 15.766 0.557   -4.617  1.00 70.70  ? 2   VAL H C   1 
ATOM   2299 O  O   . VAL B 2 2   ? 16.905 0.113   -4.463  1.00 69.90  ? 2   VAL H O   1 
ATOM   2300 C  CB  . VAL B 2 2   ? 15.836 3.030   -5.189  1.00 71.19  ? 2   VAL H CB  1 
ATOM   2301 C  CG1 . VAL B 2 2   ? 15.346 2.705   -6.587  1.00 69.89  ? 2   VAL H CG1 1 
ATOM   2302 C  CG2 . VAL B 2 2   ? 15.358 4.412   -4.764  1.00 72.11  ? 2   VAL H CG2 1 
ATOM   2303 N  N   . LEU B 2 3   ? 14.766 -0.160  -5.106  1.00 66.46  ? 3   LEU H N   1 
ATOM   2304 C  CA  . LEU B 2 3   ? 14.964 -1.500  -5.607  1.00 65.29  ? 3   LEU H CA  1 
ATOM   2305 C  C   . LEU B 2 3   ? 14.221 -1.704  -6.910  1.00 67.51  ? 3   LEU H C   1 
ATOM   2306 O  O   . LEU B 2 3   ? 13.073 -1.286  -7.058  1.00 67.52  ? 3   LEU H O   1 
ATOM   2307 C  CB  . LEU B 2 3   ? 14.553 -2.557  -4.577  1.00 66.65  ? 3   LEU H CB  1 
ATOM   2308 C  CG  . LEU B 2 3   ? 15.204 -3.924  -4.760  1.00 71.02  ? 3   LEU H CG  1 
ATOM   2309 C  CD1 . LEU B 2 3   ? 16.685 -3.881  -4.355  1.00 71.02  ? 3   LEU H CD1 1 
ATOM   2310 C  CD2 . LEU B 2 3   ? 14.478 -4.972  -3.942  1.00 75.04  ? 3   LEU H CD2 1 
ATOM   2311 N  N   . LEU B 2 4   ? 14.910 -2.322  -7.867  1.00 62.42  ? 4   LEU H N   1 
ATOM   2312 C  CA  . LEU B 2 4   ? 14.357 -2.672  -9.164  1.00 61.27  ? 4   LEU H CA  1 
ATOM   2313 C  C   . LEU B 2 4   ? 14.401 -4.185  -9.249  1.00 64.80  ? 4   LEU H C   1 
ATOM   2314 O  O   . LEU B 2 4   ? 15.465 -4.792  -9.115  1.00 64.23  ? 4   LEU H O   1 
ATOM   2315 C  CB  . LEU B 2 4   ? 15.131 -2.018  -10.322 1.00 60.11  ? 4   LEU H CB  1 
ATOM   2316 C  CG  . LEU B 2 4   ? 15.126 -0.488  -10.388 1.00 64.62  ? 4   LEU H CG  1 
ATOM   2317 C  CD1 . LEU B 2 4   ? 15.874 -0.006  -11.606 1.00 63.75  ? 4   LEU H CD1 1 
ATOM   2318 C  CD2 . LEU B 2 4   ? 13.711 0.063   -10.433 1.00 67.73  ? 4   LEU H CD2 1 
ATOM   2319 N  N   . GLN B 2 5   ? 13.230 -4.795  -9.414  1.00 61.44  ? 5   GLN H N   1 
ATOM   2320 C  CA  . GLN B 2 5   ? 13.110 -6.244  -9.487  1.00 61.37  ? 5   GLN H CA  1 
ATOM   2321 C  C   . GLN B 2 5   ? 12.663 -6.715  -10.843 1.00 64.53  ? 5   GLN H C   1 
ATOM   2322 O  O   . GLN B 2 5   ? 11.717 -6.187  -11.411 1.00 64.00  ? 5   GLN H O   1 
ATOM   2323 C  CB  . GLN B 2 5   ? 12.180 -6.779  -8.406  1.00 64.10  ? 5   GLN H CB  1 
ATOM   2324 C  CG  . GLN B 2 5   ? 12.928 -7.241  -7.172  1.00 79.79  ? 5   GLN H CG  1 
ATOM   2325 C  CD  . GLN B 2 5   ? 12.008 -7.674  -6.066  1.00 100.94 ? 5   GLN H CD  1 
ATOM   2326 O  OE1 . GLN B 2 5   ? 10.889 -7.175  -5.923  1.00 96.92  ? 5   GLN H OE1 1 
ATOM   2327 N  NE2 . GLN B 2 5   ? 12.479 -8.595  -5.243  1.00 94.69  ? 5   GLN H NE2 1 
ATOM   2328 N  N   . GLN B 2 6   ? 13.339 -7.730  -11.351 1.00 60.86  ? 6   GLN H N   1 
ATOM   2329 C  CA  . GLN B 2 6   ? 13.036 -8.268  -12.661 1.00 60.29  ? 6   GLN H CA  1 
ATOM   2330 C  C   . GLN B 2 6   ? 12.475 -9.672  -12.615 1.00 65.25  ? 6   GLN H C   1 
ATOM   2331 O  O   . GLN B 2 6   ? 12.610 -10.371 -11.613 1.00 65.67  ? 6   GLN H O   1 
ATOM   2332 C  CB  . GLN B 2 6   ? 14.265 -8.204  -13.569 1.00 60.71  ? 6   GLN H CB  1 
ATOM   2333 C  CG  . GLN B 2 6   ? 14.747 -6.785  -13.844 1.00 72.26  ? 6   GLN H CG  1 
ATOM   2334 C  CD  . GLN B 2 6   ? 15.703 -6.707  -15.005 1.00 89.43  ? 6   GLN H CD  1 
ATOM   2335 O  OE1 . GLN B 2 6   ? 16.661 -5.936  -14.985 1.00 83.90  ? 6   GLN H OE1 1 
ATOM   2336 N  NE2 . GLN B 2 6   ? 15.461 -7.507  -16.037 1.00 81.97  ? 6   GLN H NE2 1 
ATOM   2337 N  N   . SER B 2 7   ? 11.839 -10.075 -13.717 1.00 61.97  ? 7   SER H N   1 
ATOM   2338 C  CA  . SER B 2 7   ? 11.249 -11.396 -13.875 1.00 62.72  ? 7   SER H CA  1 
ATOM   2339 C  C   . SER B 2 7   ? 12.334 -12.475 -14.033 1.00 67.23  ? 7   SER H C   1 
ATOM   2340 O  O   . SER B 2 7   ? 13.501 -12.159 -14.279 1.00 66.30  ? 7   SER H O   1 
ATOM   2341 C  CB  . SER B 2 7   ? 10.276 -11.413 -15.048 1.00 66.06  ? 7   SER H CB  1 
ATOM   2342 O  OG  . SER B 2 7   ? 10.787 -10.689 -16.159 1.00 73.35  ? 7   SER H OG  1 
ATOM   2343 N  N   . GLY B 2 8   ? 11.922 -13.727 -13.883 1.00 65.00  ? 8   GLY H N   1 
ATOM   2344 C  CA  . GLY B 2 8   ? 12.795 -14.890 -13.970 1.00 65.47  ? 8   GLY H CA  1 
ATOM   2345 C  C   . GLY B 2 8   ? 13.327 -15.202 -15.357 1.00 68.99  ? 8   GLY H C   1 
ATOM   2346 O  O   . GLY B 2 8   ? 12.850 -14.645 -16.349 1.00 67.79  ? 8   GLY H O   1 
ATOM   2347 N  N   . PRO B 2 9   ? 14.313 -16.119 -15.439 1.00 66.40  ? 9   PRO H N   1 
ATOM   2348 C  CA  . PRO B 2 9   ? 14.894 -16.492 -16.741 1.00 66.25  ? 9   PRO H CA  1 
ATOM   2349 C  C   . PRO B 2 9   ? 13.845 -17.033 -17.692 1.00 70.42  ? 9   PRO H C   1 
ATOM   2350 O  O   . PRO B 2 9   ? 12.904 -17.717 -17.281 1.00 70.82  ? 9   PRO H O   1 
ATOM   2351 C  CB  . PRO B 2 9   ? 15.911 -17.580 -16.376 1.00 69.25  ? 9   PRO H CB  1 
ATOM   2352 C  CG  . PRO B 2 9   ? 16.245 -17.329 -14.954 1.00 73.85  ? 9   PRO H CG  1 
ATOM   2353 C  CD  . PRO B 2 9   ? 14.980 -16.826 -14.334 1.00 69.02  ? 9   PRO H CD  1 
ATOM   2354 N  N   . GLU B 2 10  ? 14.006 -16.688 -18.965 1.00 66.46  ? 10  GLU H N   1 
ATOM   2355 C  CA  . GLU B 2 10  ? 13.096 -17.093 -20.020 1.00 66.62  ? 10  GLU H CA  1 
ATOM   2356 C  C   . GLU B 2 10  ? 13.772 -17.928 -21.081 1.00 70.97  ? 10  GLU H C   1 
ATOM   2357 O  O   . GLU B 2 10  ? 14.832 -17.566 -21.578 1.00 70.21  ? 10  GLU H O   1 
ATOM   2358 C  CB  . GLU B 2 10  ? 12.437 -15.867 -20.661 1.00 66.99  ? 10  GLU H CB  1 
ATOM   2359 C  CG  . GLU B 2 10  ? 11.288 -15.305 -19.843 1.00 77.76  ? 10  GLU H CG  1 
ATOM   2360 C  CD  . GLU B 2 10  ? 10.012 -16.120 -19.776 1.00 100.57 ? 10  GLU H CD  1 
ATOM   2361 O  OE1 . GLU B 2 10  ? 10.005 -17.299 -20.199 1.00 95.66  ? 10  GLU H OE1 1 
ATOM   2362 O  OE2 . GLU B 2 10  ? 9.007  -15.571 -19.275 1.00 95.54  ? 10  GLU H OE2 1 
ATOM   2363 N  N   . LEU B 2 11  ? 13.168 -19.063 -21.416 1.00 68.60  ? 11  LEU H N   1 
ATOM   2364 C  CA  . LEU B 2 11  ? 13.676 -19.929 -22.466 1.00 69.51  ? 11  LEU H CA  1 
ATOM   2365 C  C   . LEU B 2 11  ? 12.607 -19.992 -23.526 1.00 73.65  ? 11  LEU H C   1 
ATOM   2366 O  O   . LEU B 2 11  ? 11.456 -20.320 -23.240 1.00 73.42  ? 11  LEU H O   1 
ATOM   2367 C  CB  . LEU B 2 11  ? 14.010 -21.318 -21.943 1.00 71.19  ? 11  LEU H CB  1 
ATOM   2368 C  CG  . LEU B 2 11  ? 14.615 -22.328 -22.921 1.00 77.57  ? 11  LEU H CG  1 
ATOM   2369 C  CD1 . LEU B 2 11  ? 15.593 -21.685 -23.917 1.00 77.40  ? 11  LEU H CD1 1 
ATOM   2370 C  CD2 . LEU B 2 11  ? 15.367 -23.330 -22.159 1.00 81.33  ? 11  LEU H CD2 1 
ATOM   2371 N  N   . VAL B 2 12  ? 12.970 -19.621 -24.745 1.00 70.36  ? 12  VAL H N   1 
ATOM   2372 C  CA  . VAL B 2 12  ? 11.990 -19.553 -25.824 1.00 70.58  ? 12  VAL H CA  1 
ATOM   2373 C  C   . VAL B 2 12  ? 12.493 -19.981 -27.203 1.00 75.56  ? 12  VAL H C   1 
ATOM   2374 O  O   . VAL B 2 12  ? 13.690 -19.983 -27.486 1.00 75.29  ? 12  VAL H O   1 
ATOM   2375 C  CB  . VAL B 2 12  ? 11.352 -18.144 -25.922 1.00 73.13  ? 12  VAL H CB  1 
ATOM   2376 C  CG1 . VAL B 2 12  ? 10.343 -17.908 -24.814 1.00 72.40  ? 12  VAL H CG1 1 
ATOM   2377 C  CG2 . VAL B 2 12  ? 12.418 -17.061 -25.926 1.00 71.80  ? 12  VAL H CG2 1 
ATOM   2378 N  N   . LYS B 2 13  ? 11.525 -20.306 -28.058 1.00 73.09  ? 13  LYS H N   1 
ATOM   2379 C  CA  . LYS B 2 13  ? 11.700 -20.713 -29.444 1.00 74.34  ? 13  LYS H CA  1 
ATOM   2380 C  C   . LYS B 2 13  ? 11.868 -19.490 -30.372 1.00 77.60  ? 13  LYS H C   1 
ATOM   2381 O  O   . LYS B 2 13  ? 11.278 -18.450 -30.111 1.00 75.83  ? 13  LYS H O   1 
ATOM   2382 C  CB  . LYS B 2 13  ? 10.473 -21.529 -29.888 1.00 78.22  ? 13  LYS H CB  1 
ATOM   2383 C  CG  . LYS B 2 13  ? 9.176  -20.728 -29.853 1.00 92.74  ? 13  LYS H CG  1 
ATOM   2384 C  CD  . LYS B 2 13  ? 7.924  -21.551 -30.113 1.00 104.30 ? 13  LYS H CD  1 
ATOM   2385 C  CE  . LYS B 2 13  ? 6.688  -20.680 -30.005 1.00 114.20 ? 13  LYS H CE  1 
ATOM   2386 N  NZ  . LYS B 2 13  ? 6.556  -20.042 -28.659 1.00 121.34 ? 13  LYS H NZ  1 
ATOM   2387 N  N   . PRO B 2 14  ? 12.627 -19.621 -31.467 1.00 75.25  ? 14  PRO H N   1 
ATOM   2388 C  CA  . PRO B 2 14  ? 12.804 -18.487 -32.406 1.00 74.77  ? 14  PRO H CA  1 
ATOM   2389 C  C   . PRO B 2 14  ? 11.449 -18.047 -32.939 1.00 79.09  ? 14  PRO H C   1 
ATOM   2390 O  O   . PRO B 2 14  ? 10.585 -18.887 -33.175 1.00 79.87  ? 14  PRO H O   1 
ATOM   2391 C  CB  . PRO B 2 14  ? 13.661 -19.100 -33.517 1.00 78.25  ? 14  PRO H CB  1 
ATOM   2392 C  CG  . PRO B 2 14  ? 14.409 -20.197 -32.852 1.00 83.45  ? 14  PRO H CG  1 
ATOM   2393 C  CD  . PRO B 2 14  ? 13.530 -20.734 -31.787 1.00 78.44  ? 14  PRO H CD  1 
ATOM   2394 N  N   . GLY B 2 15  ? 11.295 -16.746 -33.105 1.00 74.92  ? 15  GLY H N   1 
ATOM   2395 C  CA  . GLY B 2 15  ? 10.051 -16.144 -33.575 1.00 75.10  ? 15  GLY H CA  1 
ATOM   2396 C  C   . GLY B 2 15  ? 9.078  -15.878 -32.449 1.00 78.19  ? 15  GLY H C   1 
ATOM   2397 O  O   . GLY B 2 15  ? 8.019  -15.277 -32.668 1.00 77.86  ? 15  GLY H O   1 
ATOM   2398 N  N   . ALA B 2 16  ? 9.417  -16.336 -31.227 1.00 74.13  ? 16  ALA H N   1 
ATOM   2399 C  CA  . ALA B 2 16  ? 8.595  -16.124 -30.040 1.00 73.19  ? 16  ALA H CA  1 
ATOM   2400 C  C   . ALA B 2 16  ? 8.765  -14.689 -29.576 1.00 75.68  ? 16  ALA H C   1 
ATOM   2401 O  O   . ALA B 2 16  ? 9.639  -13.976 -30.059 1.00 74.73  ? 16  ALA H O   1 
ATOM   2402 C  CB  . ALA B 2 16  ? 8.993  -17.084 -28.927 1.00 73.85  ? 16  ALA H CB  1 
ATOM   2403 N  N   . SER B 2 17  ? 7.915  -14.264 -28.651 1.00 71.81  ? 17  SER H N   1 
ATOM   2404 C  CA  . SER B 2 17  ? 7.972  -12.934 -28.081 1.00 70.47  ? 17  SER H CA  1 
ATOM   2405 C  C   . SER B 2 17  ? 7.974  -13.080 -26.568 1.00 73.51  ? 17  SER H C   1 
ATOM   2406 O  O   . SER B 2 17  ? 7.380  -14.020 -26.046 1.00 73.67  ? 17  SER H O   1 
ATOM   2407 C  CB  . SER B 2 17  ? 6.797  -12.086 -28.560 1.00 74.60  ? 17  SER H CB  1 
ATOM   2408 O  OG  . SER B 2 17  ? 5.625  -12.300 -27.791 1.00 83.76  ? 17  SER H OG  1 
ATOM   2409 N  N   . VAL B 2 18  ? 8.660  -12.176 -25.866 1.00 68.89  ? 18  VAL H N   1 
ATOM   2410 C  CA  . VAL B 2 18  ? 8.747  -12.236 -24.412 1.00 68.07  ? 18  VAL H CA  1 
ATOM   2411 C  C   . VAL B 2 18  ? 8.550  -10.863 -23.759 1.00 70.75  ? 18  VAL H C   1 
ATOM   2412 O  O   . VAL B 2 18  ? 8.752  -9.829  -24.389 1.00 70.00  ? 18  VAL H O   1 
ATOM   2413 C  CB  . VAL B 2 18  ? 10.057 -12.935 -23.945 1.00 71.74  ? 18  VAL H CB  1 
ATOM   2414 C  CG1 . VAL B 2 18  ? 11.281 -12.046 -24.142 1.00 70.65  ? 18  VAL H CG1 1 
ATOM   2415 C  CG2 . VAL B 2 18  ? 9.951  -13.411 -22.500 1.00 71.54  ? 18  VAL H CG2 1 
ATOM   2416 N  N   . ARG B 2 19  ? 8.101  -10.876 -22.504 1.00 66.95  ? 19  ARG H N   1 
ATOM   2417 C  CA  . ARG B 2 19  ? 7.877  -9.671  -21.729 1.00 66.18  ? 19  ARG H CA  1 
ATOM   2418 C  C   . ARG B 2 19  ? 8.762  -9.665  -20.484 1.00 68.97  ? 19  ARG H C   1 
ATOM   2419 O  O   . ARG B 2 19  ? 8.818  -10.652 -19.751 1.00 68.69  ? 19  ARG H O   1 
ATOM   2420 C  CB  . ARG B 2 19  ? 6.409  -9.559  -21.343 1.00 67.61  ? 19  ARG H CB  1 
ATOM   2421 C  CG  . ARG B 2 19  ? 5.980  -8.154  -21.000 1.00 79.54  ? 19  ARG H CG  1 
ATOM   2422 C  CD  . ARG B 2 19  ? 4.887  -8.229  -19.981 1.00 93.50  ? 19  ARG H CD  1 
ATOM   2423 N  NE  . ARG B 2 19  ? 3.912  -7.155  -20.149 1.00 106.14 ? 19  ARG H NE  1 
ATOM   2424 C  CZ  . ARG B 2 19  ? 2.770  -7.088  -19.486 1.00 123.60 ? 19  ARG H CZ  1 
ATOM   2425 N  NH1 . ARG B 2 19  ? 2.445  -8.031  -18.608 1.00 111.62 ? 19  ARG H NH1 1 
ATOM   2426 N  NH2 . ARG B 2 19  ? 1.933  -6.079  -19.693 1.00 112.53 ? 19  ARG H NH2 1 
ATOM   2427 N  N   . ILE B 2 20  ? 9.482  -8.559  -20.279 1.00 64.61  ? 20  ILE H N   1 
ATOM   2428 C  CA  . ILE B 2 20  ? 10.378 -8.378  -19.142 1.00 63.79  ? 20  ILE H CA  1 
ATOM   2429 C  C   . ILE B 2 20  ? 9.737  -7.387  -18.193 1.00 67.92  ? 20  ILE H C   1 
ATOM   2430 O  O   . ILE B 2 20  ? 9.189  -6.374  -18.615 1.00 67.47  ? 20  ILE H O   1 
ATOM   2431 C  CB  . ILE B 2 20  ? 11.805 -7.937  -19.567 1.00 66.00  ? 20  ILE H CB  1 
ATOM   2432 C  CG1 . ILE B 2 20  ? 12.327 -8.726  -20.791 1.00 66.54  ? 20  ILE H CG1 1 
ATOM   2433 C  CG2 . ILE B 2 20  ? 12.795 -7.988  -18.394 1.00 66.39  ? 20  ILE H CG2 1 
ATOM   2434 C  CD1 . ILE B 2 20  ? 12.471 -10.257 -20.646 1.00 74.73  ? 20  ILE H CD1 1 
ATOM   2435 N  N   . THR B 2 21  ? 9.791  -7.706  -16.911 1.00 65.03  ? 21  THR H N   1 
ATOM   2436 C  CA  . THR B 2 21  ? 9.178  -6.903  -15.877 1.00 65.41  ? 21  THR H CA  1 
ATOM   2437 C  C   . THR B 2 21  ? 10.201 -6.278  -14.964 1.00 68.96  ? 21  THR H C   1 
ATOM   2438 O  O   . THR B 2 21  ? 11.128 -6.936  -14.495 1.00 68.43  ? 21  THR H O   1 
ATOM   2439 C  CB  . THR B 2 21  ? 8.210  -7.739  -15.045 1.00 75.11  ? 21  THR H CB  1 
ATOM   2440 O  OG1 . THR B 2 21  ? 7.581  -8.704  -15.874 1.00 75.58  ? 21  THR H OG1 1 
ATOM   2441 C  CG2 . THR B 2 21  ? 7.146  -6.895  -14.381 1.00 74.48  ? 21  THR H CG2 1 
ATOM   2442 N  N   . CYS B 2 22  ? 10.007 -4.991  -14.710 1.00 65.60  ? 22  CYS H N   1 
ATOM   2443 C  CA  . CYS B 2 22  ? 10.836 -4.221  -13.804 1.00 65.16  ? 22  CYS H CA  1 
ATOM   2444 C  C   . CYS B 2 22  ? 9.918  -3.680  -12.726 1.00 69.94  ? 22  CYS H C   1 
ATOM   2445 O  O   . CYS B 2 22  ? 9.038  -2.872  -13.003 1.00 70.14  ? 22  CYS H O   1 
ATOM   2446 C  CB  . CYS B 2 22  ? 11.576 -3.095  -14.510 1.00 64.68  ? 22  CYS H CB  1 
ATOM   2447 S  SG  . CYS B 2 22  ? 12.981 -2.425  -13.568 1.00 67.99  ? 22  CYS H SG  1 
ATOM   2448 N  N   . LYS B 2 23  ? 10.146 -4.101  -11.491 1.00 66.76  ? 23  LYS H N   1 
ATOM   2449 C  CA  . LYS B 2 23  ? 9.356  -3.682  -10.350 1.00 67.66  ? 23  LYS H CA  1 
ATOM   2450 C  C   . LYS B 2 23  ? 10.126 -2.646  -9.557  1.00 71.15  ? 23  LYS H C   1 
ATOM   2451 O  O   . LYS B 2 23  ? 11.195 -2.937  -9.031  1.00 70.31  ? 23  LYS H O   1 
ATOM   2452 C  CB  . LYS B 2 23  ? 9.001  -4.895  -9.489  1.00 71.06  ? 23  LYS H CB  1 
ATOM   2453 C  CG  . LYS B 2 23  ? 8.026  -4.594  -8.366  1.00 86.75  ? 23  LYS H CG  1 
ATOM   2454 C  CD  . LYS B 2 23  ? 7.701  -5.827  -7.560  1.00 97.61  ? 23  LYS H CD  1 
ATOM   2455 C  CE  . LYS B 2 23  ? 6.779  -5.494  -6.415  1.00 109.75 ? 23  LYS H CE  1 
ATOM   2456 N  NZ  . LYS B 2 23  ? 6.434  -6.706  -5.629  1.00 120.10 ? 23  LYS H NZ  1 
ATOM   2457 N  N   . ALA B 2 24  ? 9.599  -1.426  -9.504  1.00 68.10  ? 24  ALA H N   1 
ATOM   2458 C  CA  . ALA B 2 24  ? 10.253 -0.330  -8.810  1.00 67.93  ? 24  ALA H CA  1 
ATOM   2459 C  C   . ALA B 2 24  ? 9.637  -0.049  -7.447  1.00 73.04  ? 24  ALA H C   1 
ATOM   2460 O  O   . ALA B 2 24  ? 8.423  0.099   -7.332  1.00 73.87  ? 24  ALA H O   1 
ATOM   2461 C  CB  . ALA B 2 24  ? 10.212 0.916   -9.673  1.00 68.35  ? 24  ALA H CB  1 
ATOM   2462 N  N   . SER B 2 25  ? 10.483 0.005   -6.411  1.00 69.50  ? 25  SER H N   1 
ATOM   2463 C  CA  . SER B 2 25  ? 10.065 0.279   -5.040  1.00 70.93  ? 25  SER H CA  1 
ATOM   2464 C  C   . SER B 2 25  ? 11.025 1.252   -4.363  1.00 74.59  ? 25  SER H C   1 
ATOM   2465 O  O   . SER B 2 25  ? 12.168 1.394   -4.794  1.00 72.79  ? 25  SER H O   1 
ATOM   2466 C  CB  . SER B 2 25  ? 9.970  -1.011  -4.234  1.00 75.15  ? 25  SER H CB  1 
ATOM   2467 O  OG  . SER B 2 25  ? 11.232 -1.428  -3.729  1.00 83.20  ? 25  SER H OG  1 
ATOM   2468 N  N   . GLY B 2 26  ? 10.549 1.893   -3.304  1.00 72.72  ? 26  GLY H N   1 
ATOM   2469 C  CA  . GLY B 2 26  ? 11.337 2.835   -2.510  1.00 72.85  ? 26  GLY H CA  1 
ATOM   2470 C  C   . GLY B 2 26  ? 11.460 4.245   -3.042  1.00 76.01  ? 26  GLY H C   1 
ATOM   2471 O  O   . GLY B 2 26  ? 12.253 5.033   -2.517  1.00 75.84  ? 26  GLY H O   1 
ATOM   2472 N  N   . TYR B 2 27  ? 10.705 4.584   -4.092  1.00 71.79  ? 27  TYR H N   1 
ATOM   2473 C  CA  . TYR B 2 27  ? 10.723 5.913   -4.704  1.00 71.35  ? 27  TYR H CA  1 
ATOM   2474 C  C   . TYR B 2 27  ? 9.424  6.164   -5.462  1.00 75.50  ? 27  TYR H C   1 
ATOM   2475 O  O   . TYR B 2 27  ? 8.689  5.217   -5.745  1.00 75.02  ? 27  TYR H O   1 
ATOM   2476 C  CB  . TYR B 2 27  ? 11.975 6.104   -5.603  1.00 70.38  ? 27  TYR H CB  1 
ATOM   2477 C  CG  . TYR B 2 27  ? 11.853 5.511   -6.992  1.00 70.43  ? 27  TYR H CG  1 
ATOM   2478 C  CD1 . TYR B 2 27  ? 12.071 4.162   -7.220  1.00 71.30  ? 27  TYR H CD1 1 
ATOM   2479 C  CD2 . TYR B 2 27  ? 11.556 6.317   -8.085  1.00 70.95  ? 27  TYR H CD2 1 
ATOM   2480 C  CE1 . TYR B 2 27  ? 11.959 3.617   -8.488  1.00 70.75  ? 27  TYR H CE1 1 
ATOM   2481 C  CE2 . TYR B 2 27  ? 11.399 5.778   -9.352  1.00 70.68  ? 27  TYR H CE2 1 
ATOM   2482 C  CZ  . TYR B 2 27  ? 11.600 4.427   -9.550  1.00 76.83  ? 27  TYR H CZ  1 
ATOM   2483 O  OH  . TYR B 2 27  ? 11.490 3.901   -10.804 1.00 76.62  ? 27  TYR H OH  1 
ATOM   2484 N  N   . THR B 2 28  ? 9.146  7.428   -5.816  1.00 72.56  ? 28  THR H N   1 
ATOM   2485 C  CA  . THR B 2 28  ? 7.964  7.759   -6.598  1.00 73.11  ? 28  THR H CA  1 
ATOM   2486 C  C   . THR B 2 28  ? 8.278  7.306   -8.014  1.00 74.61  ? 28  THR H C   1 
ATOM   2487 O  O   . THR B 2 28  ? 9.204  7.812   -8.644  1.00 72.94  ? 28  THR H O   1 
ATOM   2488 C  CB  . THR B 2 28  ? 7.643  9.253   -6.540  1.00 82.56  ? 28  THR H CB  1 
ATOM   2489 O  OG1 . THR B 2 28  ? 7.594  9.682   -5.182  1.00 83.50  ? 28  THR H OG1 1 
ATOM   2490 C  CG2 . THR B 2 28  ? 6.324  9.586   -7.242  1.00 82.48  ? 28  THR H CG2 1 
ATOM   2491 N  N   . PHE B 2 29  ? 7.502  6.336   -8.495  1.00 70.74  ? 29  PHE H N   1 
ATOM   2492 C  CA  . PHE B 2 29  ? 7.669  5.714   -9.800  1.00 68.83  ? 29  PHE H CA  1 
ATOM   2493 C  C   . PHE B 2 29  ? 7.664  6.691   -10.982 1.00 71.98  ? 29  PHE H C   1 
ATOM   2494 O  O   . PHE B 2 29  ? 8.497  6.570   -11.878 1.00 70.02  ? 29  PHE H O   1 
ATOM   2495 C  CB  . PHE B 2 29  ? 6.606  4.627   -9.988  1.00 71.10  ? 29  PHE H CB  1 
ATOM   2496 C  CG  . PHE B 2 29  ? 6.729  3.897   -11.294 1.00 71.31  ? 29  PHE H CG  1 
ATOM   2497 C  CD1 . PHE B 2 29  ? 7.684  2.903   -11.462 1.00 72.80  ? 29  PHE H CD1 1 
ATOM   2498 C  CD2 . PHE B 2 29  ? 5.911  4.220   -12.364 1.00 74.08  ? 29  PHE H CD2 1 
ATOM   2499 C  CE1 . PHE B 2 29  ? 7.819  2.248   -12.673 1.00 72.62  ? 29  PHE H CE1 1 
ATOM   2500 C  CE2 . PHE B 2 29  ? 6.052  3.574   -13.574 1.00 75.82  ? 29  PHE H CE2 1 
ATOM   2501 C  CZ  . PHE B 2 29  ? 7.004  2.586   -13.723 1.00 72.25  ? 29  PHE H CZ  1 
ATOM   2502 N  N   . THR B 2 30  ? 6.740  7.660   -10.966 1.00 69.80  ? 30  THR H N   1 
ATOM   2503 C  CA  . THR B 2 30  ? 6.584  8.662   -12.028 1.00 69.63  ? 30  THR H CA  1 
ATOM   2504 C  C   . THR B 2 30  ? 7.702  9.707   -12.083 1.00 71.91  ? 30  THR H C   1 
ATOM   2505 O  O   . THR B 2 30  ? 7.867  10.392  -13.092 1.00 71.47  ? 30  THR H O   1 
ATOM   2506 C  CB  . THR B 2 30  ? 5.197  9.338   -11.944 1.00 80.48  ? 30  THR H CB  1 
ATOM   2507 O  OG1 . THR B 2 30  ? 4.904  9.967   -13.190 1.00 80.76  ? 30  THR H OG1 1 
ATOM   2508 C  CG2 . THR B 2 30  ? 5.111  10.359  -10.797 1.00 80.89  ? 30  THR H CG2 1 
ATOM   2509 N  N   . ASP B 2 31  ? 8.471  9.825   -10.991 1.00 67.36  ? 31  ASP H N   1 
ATOM   2510 C  CA  . ASP B 2 31  ? 9.526  10.827  -10.846 1.00 66.53  ? 31  ASP H CA  1 
ATOM   2511 C  C   . ASP B 2 31  ? 10.682 10.742  -11.841 1.00 67.39  ? 31  ASP H C   1 
ATOM   2512 O  O   . ASP B 2 31  ? 11.178 11.787  -12.253 1.00 67.05  ? 31  ASP H O   1 
ATOM   2513 C  CB  . ASP B 2 31  ? 10.083 10.842  -9.418  1.00 68.68  ? 31  ASP H CB  1 
ATOM   2514 C  CG  . ASP B 2 31  ? 9.316  11.749  -8.466  1.00 81.52  ? 31  ASP H CG  1 
ATOM   2515 O  OD1 . ASP B 2 31  ? 8.491  12.550  -8.947  1.00 83.64  ? 31  ASP H OD1 1 
ATOM   2516 O  OD2 . ASP B 2 31  ? 9.568  11.677  -7.246  1.00 87.91  ? 31  ASP H OD2 1 
ATOM   2517 N  N   . PHE B 2 32  ? 11.104 9.543   -12.227 1.00 61.49  ? 32  PHE H N   1 
ATOM   2518 C  CA  . PHE B 2 32  ? 12.235 9.407   -13.139 1.00 59.23  ? 32  PHE H CA  1 
ATOM   2519 C  C   . PHE B 2 32  ? 11.957 8.470   -14.306 1.00 62.04  ? 32  PHE H C   1 
ATOM   2520 O  O   . PHE B 2 32  ? 11.120 7.574   -14.208 1.00 61.95  ? 32  PHE H O   1 
ATOM   2521 C  CB  . PHE B 2 32  ? 13.477 8.911   -12.384 1.00 59.62  ? 32  PHE H CB  1 
ATOM   2522 C  CG  . PHE B 2 32  ? 13.734 9.592   -11.070 1.00 61.86  ? 32  PHE H CG  1 
ATOM   2523 C  CD1 . PHE B 2 32  ? 14.462 10.771  -11.014 1.00 65.05  ? 32  PHE H CD1 1 
ATOM   2524 C  CD2 . PHE B 2 32  ? 13.236 9.063   -9.889  1.00 64.57  ? 32  PHE H CD2 1 
ATOM   2525 C  CE1 . PHE B 2 32  ? 14.681 11.407  -9.806  1.00 66.91  ? 32  PHE H CE1 1 
ATOM   2526 C  CE2 . PHE B 2 32  ? 13.450 9.703   -8.682  1.00 68.41  ? 32  PHE H CE2 1 
ATOM   2527 C  CZ  . PHE B 2 32  ? 14.173 10.873  -8.644  1.00 66.73  ? 32  PHE H CZ  1 
ATOM   2528 N  N   . ASN B 2 33  ? 12.695 8.666   -15.405 1.00 57.36  ? 33  ASN H N   1 
ATOM   2529 C  CA  . ASN B 2 33  ? 12.595 7.824   -16.587 1.00 56.23  ? 33  ASN H CA  1 
ATOM   2530 C  C   . ASN B 2 33  ? 13.204 6.460   -16.321 1.00 58.49  ? 33  ASN H C   1 
ATOM   2531 O  O   . ASN B 2 33  ? 14.033 6.302   -15.424 1.00 57.54  ? 33  ASN H O   1 
ATOM   2532 C  CB  . ASN B 2 33  ? 13.289 8.476   -17.784 1.00 56.22  ? 33  ASN H CB  1 
ATOM   2533 C  CG  . ASN B 2 33  ? 12.564 9.666   -18.347 1.00 78.13  ? 33  ASN H CG  1 
ATOM   2534 O  OD1 . ASN B 2 33  ? 11.672 10.226  -17.720 1.00 74.13  ? 33  ASN H OD1 1 
ATOM   2535 N  ND2 . ASN B 2 33  ? 12.930 10.062  -19.559 1.00 68.94  ? 33  ASN H ND2 1 
ATOM   2536 N  N   . MET B 2 34  ? 12.763 5.473   -17.089 1.00 54.51  ? 34  MET H N   1 
ATOM   2537 C  CA  . MET B 2 34  ? 13.258 4.113   -16.993 1.00 53.21  ? 34  MET H CA  1 
ATOM   2538 C  C   . MET B 2 34  ? 13.921 3.758   -18.318 1.00 55.40  ? 34  MET H C   1 
ATOM   2539 O  O   . MET B 2 34  ? 13.396 4.091   -19.372 1.00 55.42  ? 34  MET H O   1 
ATOM   2540 C  CB  . MET B 2 34  ? 12.120 3.140   -16.653 1.00 56.22  ? 34  MET H CB  1 
ATOM   2541 C  CG  . MET B 2 34  ? 12.598 1.764   -16.237 1.00 59.43  ? 34  MET H CG  1 
ATOM   2542 S  SD  . MET B 2 34  ? 13.579 1.757   -14.714 1.00 63.60  ? 34  MET H SD  1 
ATOM   2543 C  CE  . MET B 2 34  ? 12.294 1.766   -13.500 1.00 61.55  ? 34  MET H CE  1 
ATOM   2544 N  N   . ASP B 2 35  ? 15.099 3.132   -18.259 1.00 50.19  ? 35  ASP H N   1 
ATOM   2545 C  CA  . ASP B 2 35  ? 15.864 2.741   -19.438 1.00 49.00  ? 35  ASP H CA  1 
ATOM   2546 C  C   . ASP B 2 35  ? 16.037 1.264   -19.490 1.00 51.86  ? 35  ASP H C   1 
ATOM   2547 O  O   . ASP B 2 35  ? 16.020 0.605   -18.459 1.00 51.41  ? 35  ASP H O   1 
ATOM   2548 C  CB  . ASP B 2 35  ? 17.236 3.415   -19.464 1.00 50.10  ? 35  ASP H CB  1 
ATOM   2549 C  CG  . ASP B 2 35  ? 17.126 4.890   -19.682 1.00 57.90  ? 35  ASP H CG  1 
ATOM   2550 O  OD1 . ASP B 2 35  ? 16.214 5.496   -19.105 1.00 58.78  ? 35  ASP H OD1 1 
ATOM   2551 O  OD2 . ASP B 2 35  ? 17.915 5.431   -20.470 1.00 62.14  ? 35  ASP H OD2 1 
ATOM   2552 N  N   . TRP B 2 36  ? 16.212 0.741   -20.693 1.00 47.75  ? 36  TRP H N   1 
ATOM   2553 C  CA  . TRP B 2 36  ? 16.406 -0.679  -20.884 1.00 47.14  ? 36  TRP H CA  1 
ATOM   2554 C  C   . TRP B 2 36  ? 17.752 -0.934  -21.533 1.00 49.36  ? 36  TRP H C   1 
ATOM   2555 O  O   . TRP B 2 36  ? 18.139 -0.234  -22.463 1.00 48.91  ? 36  TRP H O   1 
ATOM   2556 C  CB  . TRP B 2 36  ? 15.243 -1.292  -21.662 1.00 46.55  ? 36  TRP H CB  1 
ATOM   2557 C  CG  . TRP B 2 36  ? 13.968 -1.254  -20.885 1.00 48.15  ? 36  TRP H CG  1 
ATOM   2558 C  CD1 . TRP B 2 36  ? 13.058 -0.241  -20.859 1.00 51.53  ? 36  TRP H CD1 1 
ATOM   2559 C  CD2 . TRP B 2 36  ? 13.503 -2.232  -19.957 1.00 48.04  ? 36  TRP H CD2 1 
ATOM   2560 N  NE1 . TRP B 2 36  ? 12.021 -0.558  -20.023 1.00 51.57  ? 36  TRP H NE1 1 
ATOM   2561 C  CE2 . TRP B 2 36  ? 12.269 -1.769  -19.446 1.00 52.66  ? 36  TRP H CE2 1 
ATOM   2562 C  CE3 . TRP B 2 36  ? 13.991 -3.473  -19.522 1.00 49.23  ? 36  TRP H CE3 1 
ATOM   2563 C  CZ2 . TRP B 2 36  ? 11.520 -2.492  -18.527 1.00 52.44  ? 36  TRP H CZ2 1 
ATOM   2564 C  CZ3 . TRP B 2 36  ? 13.235 -4.196  -18.618 1.00 51.17  ? 36  TRP H CZ3 1 
ATOM   2565 C  CH2 . TRP B 2 36  ? 12.019 -3.700  -18.125 1.00 52.40  ? 36  TRP H CH2 1 
ATOM   2566 N  N   . VAL B 2 37  ? 18.488 -1.903  -20.989 1.00 44.78  ? 37  VAL H N   1 
ATOM   2567 C  CA  . VAL B 2 37  ? 19.824 -2.265  -21.449 1.00 44.08  ? 37  VAL H CA  1 
ATOM   2568 C  C   . VAL B 2 37  ? 19.897 -3.757  -21.776 1.00 47.52  ? 37  VAL H C   1 
ATOM   2569 O  O   . VAL B 2 37  ? 19.289 -4.584  -21.104 1.00 47.13  ? 37  VAL H O   1 
ATOM   2570 C  CB  . VAL B 2 37  ? 20.910 -1.838  -20.414 1.00 47.44  ? 37  VAL H CB  1 
ATOM   2571 C  CG1 . VAL B 2 37  ? 22.291 -2.374  -20.775 1.00 47.40  ? 37  VAL H CG1 1 
ATOM   2572 C  CG2 . VAL B 2 37  ? 20.954 -0.325  -20.264 1.00 46.87  ? 37  VAL H CG2 1 
ATOM   2573 N  N   . LYS B 2 38  ? 20.621 -4.084  -22.846 1.00 43.96  ? 38  LYS H N   1 
ATOM   2574 C  CA  . LYS B 2 38  ? 20.831 -5.454  -23.285 1.00 44.21  ? 38  LYS H CA  1 
ATOM   2575 C  C   . LYS B 2 38  ? 22.312 -5.786  -23.317 1.00 48.49  ? 38  LYS H C   1 
ATOM   2576 O  O   . LYS B 2 38  ? 23.106 -5.031  -23.868 1.00 48.07  ? 38  LYS H O   1 
ATOM   2577 C  CB  . LYS B 2 38  ? 20.260 -5.659  -24.687 1.00 46.98  ? 38  LYS H CB  1 
ATOM   2578 C  CG  . LYS B 2 38  ? 20.574 -7.022  -25.277 1.00 57.69  ? 38  LYS H CG  1 
ATOM   2579 C  CD  . LYS B 2 38  ? 20.456 -7.028  -26.776 1.00 65.56  ? 38  LYS H CD  1 
ATOM   2580 C  CE  . LYS B 2 38  ? 20.753 -8.398  -27.316 1.00 73.55  ? 38  LYS H CE  1 
ATOM   2581 N  NZ  . LYS B 2 38  ? 20.482 -8.486  -28.764 1.00 81.60  ? 38  LYS H NZ  1 
ATOM   2582 N  N   . GLN B 2 39  ? 22.687 -6.910  -22.723 1.00 45.76  ? 39  GLN H N   1 
ATOM   2583 C  CA  . GLN B 2 39  ? 24.072 -7.331  -22.766 1.00 46.38  ? 39  GLN H CA  1 
ATOM   2584 C  C   . GLN B 2 39  ? 24.184 -8.746  -23.325 1.00 52.43  ? 39  GLN H C   1 
ATOM   2585 O  O   . GLN B 2 39  ? 23.782 -9.704  -22.668 1.00 52.37  ? 39  GLN H O   1 
ATOM   2586 C  CB  . GLN B 2 39  ? 24.725 -7.239  -21.385 1.00 47.29  ? 39  GLN H CB  1 
ATOM   2587 C  CG  . GLN B 2 39  ? 26.241 -7.360  -21.445 1.00 57.21  ? 39  GLN H CG  1 
ATOM   2588 C  CD  . GLN B 2 39  ? 26.907 -7.207  -20.108 1.00 71.31  ? 39  GLN H CD  1 
ATOM   2589 O  OE1 . GLN B 2 39  ? 26.273 -7.299  -19.059 1.00 64.95  ? 39  GLN H OE1 1 
ATOM   2590 N  NE2 . GLN B 2 39  ? 28.208 -6.977  -20.126 1.00 63.46  ? 39  GLN H NE2 1 
ATOM   2591 N  N   . SER B 2 40  ? 24.724 -8.872  -24.546 1.00 50.58  ? 40  SER H N   1 
ATOM   2592 C  CA  . SER B 2 40  ? 24.949 -10.163 -25.178 1.00 52.11  ? 40  SER H CA  1 
ATOM   2593 C  C   . SER B 2 40  ? 26.062 -10.876 -24.386 1.00 57.45  ? 40  SER H C   1 
ATOM   2594 O  O   . SER B 2 40  ? 26.934 -10.192 -23.847 1.00 56.76  ? 40  SER H O   1 
ATOM   2595 C  CB  . SER B 2 40  ? 25.309 -9.993  -26.651 1.00 56.57  ? 40  SER H CB  1 
ATOM   2596 O  OG  . SER B 2 40  ? 24.141 -9.815  -27.440 1.00 64.99  ? 40  SER H OG  1 
ATOM   2597 N  N   . PRO B 2 41  ? 26.027 -12.217 -24.248 1.00 55.83  ? 41  PRO H N   1 
ATOM   2598 C  CA  . PRO B 2 41  ? 27.065 -12.909 -23.461 1.00 56.82  ? 41  PRO H CA  1 
ATOM   2599 C  C   . PRO B 2 41  ? 28.483 -12.622 -23.946 1.00 61.71  ? 41  PRO H C   1 
ATOM   2600 O  O   . PRO B 2 41  ? 28.740 -12.631 -25.152 1.00 61.86  ? 41  PRO H O   1 
ATOM   2601 C  CB  . PRO B 2 41  ? 26.699 -14.388 -23.623 1.00 60.06  ? 41  PRO H CB  1 
ATOM   2602 C  CG  . PRO B 2 41  ? 25.241 -14.386 -23.920 1.00 63.64  ? 41  PRO H CG  1 
ATOM   2603 C  CD  . PRO B 2 41  ? 25.050 -13.178 -24.789 1.00 58.00  ? 41  PRO H CD  1 
ATOM   2604 N  N   . GLY B 2 42  ? 29.353 -12.305 -22.987 1.00 58.57  ? 42  GLY H N   1 
ATOM   2605 C  CA  . GLY B 2 42  ? 30.752 -11.940 -23.206 1.00 59.42  ? 42  GLY H CA  1 
ATOM   2606 C  C   . GLY B 2 42  ? 30.894 -10.686 -24.041 1.00 62.59  ? 42  GLY H C   1 
ATOM   2607 O  O   . GLY B 2 42  ? 31.881 -10.522 -24.762 1.00 63.42  ? 42  GLY H O   1 
ATOM   2608 N  N   . LYS B 2 43  ? 29.903 -9.793  -23.950 1.00 57.28  ? 43  LYS H N   1 
ATOM   2609 C  CA  . LYS B 2 43  ? 29.832 -8.553  -24.717 1.00 56.24  ? 43  LYS H CA  1 
ATOM   2610 C  C   . LYS B 2 43  ? 29.549 -7.339  -23.847 1.00 58.16  ? 43  LYS H C   1 
ATOM   2611 O  O   . LYS B 2 43  ? 29.208 -7.467  -22.674 1.00 57.20  ? 43  LYS H O   1 
ATOM   2612 C  CB  . LYS B 2 43  ? 28.736 -8.670  -25.793 1.00 58.77  ? 43  LYS H CB  1 
ATOM   2613 C  CG  . LYS B 2 43  ? 29.235 -8.843  -27.215 1.00 72.96  ? 43  LYS H CG  1 
ATOM   2614 C  CD  . LYS B 2 43  ? 29.990 -10.160 -27.433 1.00 84.31  ? 43  LYS H CD  1 
ATOM   2615 C  CE  . LYS B 2 43  ? 30.915 -10.104 -28.623 1.00 96.71  ? 43  LYS H CE  1 
ATOM   2616 N  NZ  . LYS B 2 43  ? 31.856 -8.946  -28.562 1.00 105.43 ? 43  LYS H NZ  1 
ATOM   2617 N  N   . SER B 2 44  ? 29.703 -6.156  -24.439 1.00 53.98  ? 44  SER H N   1 
ATOM   2618 C  CA  . SER B 2 44  ? 29.439 -4.890  -23.774 1.00 52.30  ? 44  SER H CA  1 
ATOM   2619 C  C   . SER B 2 44  ? 27.947 -4.577  -23.754 1.00 54.73  ? 44  SER H C   1 
ATOM   2620 O  O   . SER B 2 44  ? 27.158 -5.214  -24.456 1.00 54.58  ? 44  SER H O   1 
ATOM   2621 C  CB  . SER B 2 44  ? 30.203 -3.765  -24.460 1.00 55.63  ? 44  SER H CB  1 
ATOM   2622 O  OG  . SER B 2 44  ? 29.971 -2.532  -23.794 1.00 62.00  ? 44  SER H OG  1 
ATOM   2623 N  N   . LEU B 2 45  ? 27.575 -3.596  -22.926 1.00 50.00  ? 45  LEU H N   1 
ATOM   2624 C  CA  . LEU B 2 45  ? 26.213 -3.121  -22.741 1.00 48.90  ? 45  LEU H CA  1 
ATOM   2625 C  C   . LEU B 2 45  ? 25.723 -2.355  -23.948 1.00 52.81  ? 45  LEU H C   1 
ATOM   2626 O  O   . LEU B 2 45  ? 26.497 -1.669  -24.610 1.00 52.77  ? 45  LEU H O   1 
ATOM   2627 C  CB  . LEU B 2 45  ? 26.136 -2.222  -21.500 1.00 48.13  ? 45  LEU H CB  1 
ATOM   2628 C  CG  . LEU B 2 45  ? 26.665 -2.826  -20.202 1.00 52.87  ? 45  LEU H CG  1 
ATOM   2629 C  CD1 . LEU B 2 45  ? 27.125 -1.745  -19.245 1.00 52.62  ? 45  LEU H CD1 1 
ATOM   2630 C  CD2 . LEU B 2 45  ? 25.632 -3.737  -19.552 1.00 55.16  ? 45  LEU H CD2 1 
ATOM   2631 N  N   . GLU B 2 46  ? 24.431 -2.488  -24.233 1.00 49.36  ? 46  GLU H N   1 
ATOM   2632 C  CA  . GLU B 2 46  ? 23.775 -1.807  -25.341 1.00 49.47  ? 46  GLU H CA  1 
ATOM   2633 C  C   . GLU B 2 46  ? 22.553 -1.096  -24.803 1.00 52.92  ? 46  GLU H C   1 
ATOM   2634 O  O   . GLU B 2 46  ? 21.827 -1.651  -23.984 1.00 52.14  ? 46  GLU H O   1 
ATOM   2635 C  CB  . GLU B 2 46  ? 23.354 -2.801  -26.426 1.00 51.69  ? 46  GLU H CB  1 
ATOM   2636 C  CG  . GLU B 2 46  ? 24.510 -3.473  -27.145 1.00 63.25  ? 46  GLU H CG  1 
ATOM   2637 C  CD  . GLU B 2 46  ? 24.078 -4.539  -28.123 1.00 85.02  ? 46  GLU H CD  1 
ATOM   2638 O  OE1 . GLU B 2 46  ? 24.588 -5.676  -28.023 1.00 79.93  ? 46  GLU H OE1 1 
ATOM   2639 O  OE2 . GLU B 2 46  ? 23.213 -4.252  -28.978 1.00 79.81  ? 46  GLU H OE2 1 
ATOM   2640 N  N   . TRP B 2 47  ? 22.330 0.134   -25.252 1.00 49.71  ? 47  TRP H N   1 
ATOM   2641 C  CA  . TRP B 2 47  ? 21.186 0.912   -24.805 1.00 49.41  ? 47  TRP H CA  1 
ATOM   2642 C  C   . TRP B 2 47  ? 20.019 0.705   -25.753 1.00 54.25  ? 47  TRP H C   1 
ATOM   2643 O  O   . TRP B 2 47  ? 20.070 1.131   -26.903 1.00 54.46  ? 47  TRP H O   1 
ATOM   2644 C  CB  . TRP B 2 47  ? 21.553 2.394   -24.709 1.00 48.11  ? 47  TRP H CB  1 
ATOM   2645 C  CG  . TRP B 2 47  ? 20.454 3.285   -24.218 1.00 49.19  ? 47  TRP H CG  1 
ATOM   2646 C  CD1 . TRP B 2 47  ? 20.014 3.413   -22.933 1.00 51.70  ? 47  TRP H CD1 1 
ATOM   2647 C  CD2 . TRP B 2 47  ? 19.682 4.200   -24.998 1.00 49.71  ? 47  TRP H CD2 1 
ATOM   2648 N  NE1 . TRP B 2 47  ? 19.009 4.343   -22.868 1.00 51.66  ? 47  TRP H NE1 1 
ATOM   2649 C  CE2 . TRP B 2 47  ? 18.789 4.851   -24.118 1.00 53.72  ? 47  TRP H CE2 1 
ATOM   2650 C  CE3 . TRP B 2 47  ? 19.648 4.532   -26.359 1.00 51.74  ? 47  TRP H CE3 1 
ATOM   2651 C  CZ2 . TRP B 2 47  ? 17.889 5.826   -24.548 1.00 53.84  ? 47  TRP H CZ2 1 
ATOM   2652 C  CZ3 . TRP B 2 47  ? 18.739 5.484   -26.785 1.00 54.02  ? 47  TRP H CZ3 1 
ATOM   2653 C  CH2 . TRP B 2 47  ? 17.877 6.122   -25.882 1.00 54.69  ? 47  TRP H CH2 1 
ATOM   2654 N  N   . ILE B 2 48  ? 18.982 0.007   -25.273 1.00 51.20  ? 48  ILE H N   1 
ATOM   2655 C  CA  . ILE B 2 48  ? 17.778 -0.264  -26.056 1.00 51.93  ? 48  ILE H CA  1 
ATOM   2656 C  C   . ILE B 2 48  ? 16.966 1.014   -26.257 1.00 57.54  ? 48  ILE H C   1 
ATOM   2657 O  O   . ILE B 2 48  ? 16.513 1.291   -27.366 1.00 57.85  ? 48  ILE H O   1 
ATOM   2658 C  CB  . ILE B 2 48  ? 16.917 -1.414  -25.462 1.00 54.81  ? 48  ILE H CB  1 
ATOM   2659 C  CG1 . ILE B 2 48  ? 17.751 -2.695  -25.301 1.00 54.97  ? 48  ILE H CG1 1 
ATOM   2660 C  CG2 . ILE B 2 48  ? 15.664 -1.678  -26.318 1.00 56.21  ? 48  ILE H CG2 1 
ATOM   2661 C  CD1 . ILE B 2 48  ? 17.127 -3.737  -24.430 1.00 61.60  ? 48  ILE H CD1 1 
ATOM   2662 N  N   . GLY B 2 49  ? 16.814 1.778   -25.189 1.00 55.04  ? 49  GLY H N   1 
ATOM   2663 C  CA  . GLY B 2 49  ? 16.067 3.026   -25.220 1.00 56.10  ? 49  GLY H CA  1 
ATOM   2664 C  C   . GLY B 2 49  ? 15.535 3.431   -23.870 1.00 61.27  ? 49  GLY H C   1 
ATOM   2665 O  O   . GLY B 2 49  ? 15.784 2.755   -22.868 1.00 60.17  ? 49  GLY H O   1 
ATOM   2666 N  N   . ASP B 2 50  ? 14.813 4.552   -23.815 1.00 60.00  ? 50  ASP H N   1 
ATOM   2667 C  CA  . ASP B 2 50  ? 14.251 5.025   -22.554 1.00 60.69  ? 50  ASP H CA  1 
ATOM   2668 C  C   . ASP B 2 50  ? 12.760 5.214   -22.635 1.00 66.82  ? 50  ASP H C   1 
ATOM   2669 O  O   . ASP B 2 50  ? 12.214 5.395   -23.714 1.00 67.17  ? 50  ASP H O   1 
ATOM   2670 C  CB  . ASP B 2 50  ? 14.916 6.322   -22.073 1.00 62.70  ? 50  ASP H CB  1 
ATOM   2671 C  CG  . ASP B 2 50  ? 14.666 7.539   -22.949 1.00 75.55  ? 50  ASP H CG  1 
ATOM   2672 O  OD1 . ASP B 2 50  ? 13.488 7.947   -23.078 1.00 77.51  ? 50  ASP H OD1 1 
ATOM   2673 O  OD2 . ASP B 2 50  ? 15.645 8.122   -23.424 1.00 81.93  ? 50  ASP H OD2 1 
ATOM   2674 N  N   . PHE B 2 51  ? 12.119 5.220   -21.476 1.00 64.39  ? 51  PHE H N   1 
ATOM   2675 C  CA  . PHE B 2 51  ? 10.685 5.393   -21.336 1.00 65.85  ? 51  PHE H CA  1 
ATOM   2676 C  C   . PHE B 2 51  ? 10.373 6.369   -20.210 1.00 71.10  ? 51  PHE H C   1 
ATOM   2677 O  O   . PHE B 2 51  ? 10.985 6.312   -19.151 1.00 69.92  ? 51  PHE H O   1 
ATOM   2678 C  CB  . PHE B 2 51  ? 10.026 4.029   -21.071 1.00 67.55  ? 51  PHE H CB  1 
ATOM   2679 C  CG  . PHE B 2 51  ? 8.538  4.086   -20.832 1.00 70.62  ? 51  PHE H CG  1 
ATOM   2680 C  CD1 . PHE B 2 51  ? 8.031  4.471   -19.599 1.00 74.41  ? 51  PHE H CD1 1 
ATOM   2681 C  CD2 . PHE B 2 51  ? 7.644  3.743   -21.835 1.00 73.75  ? 51  PHE H CD2 1 
ATOM   2682 C  CE1 . PHE B 2 51  ? 6.668  4.568   -19.394 1.00 76.92  ? 51  PHE H CE1 1 
ATOM   2683 C  CE2 . PHE B 2 51  ? 6.277  3.807   -21.619 1.00 78.09  ? 51  PHE H CE2 1 
ATOM   2684 C  CZ  . PHE B 2 51  ? 5.795  4.232   -20.404 1.00 76.90  ? 51  PHE H CZ  1 
ATOM   2685 N  N   . ASN B 2 52  ? 9.408  7.253   -20.436 1.00 69.82  ? 52  ASN H N   1 
ATOM   2686 C  CA  . ASN B 2 52  ? 8.990  8.238   -19.446 1.00 70.93  ? 52  ASN H CA  1 
ATOM   2687 C  C   . ASN B 2 52  ? 7.658  7.812   -18.789 1.00 76.76  ? 52  ASN H C   1 
ATOM   2688 O  O   . ASN B 2 52  ? 6.646  7.763   -19.477 1.00 77.65  ? 52  ASN H O   1 
ATOM   2689 C  CB  . ASN B 2 52  ? 8.846  9.620   -20.102 1.00 72.48  ? 52  ASN H CB  1 
ATOM   2690 C  CG  . ASN B 2 52  ? 8.467  10.730  -19.139 1.00 92.91  ? 52  ASN H CG  1 
ATOM   2691 O  OD1 . ASN B 2 52  ? 7.888  10.493  -18.079 1.00 87.06  ? 52  ASN H OD1 1 
ATOM   2692 N  ND2 . ASN B 2 52  ? 8.799  11.970  -19.499 1.00 84.50  ? 52  ASN H ND2 1 
ATOM   2693 N  N   . PRO B 2 53  ? 7.633  7.518   -17.472 1.00 73.67  ? 53  PRO H N   1 
ATOM   2694 C  CA  . PRO B 2 53  ? 6.366  7.125   -16.821 1.00 75.08  ? 53  PRO H CA  1 
ATOM   2695 C  C   . PRO B 2 53  ? 5.339  8.253   -16.873 1.00 81.94  ? 53  PRO H C   1 
ATOM   2696 O  O   . PRO B 2 53  ? 4.164  8.003   -17.129 1.00 82.83  ? 53  PRO H O   1 
ATOM   2697 C  CB  . PRO B 2 53  ? 6.796  6.809   -15.378 1.00 76.35  ? 53  PRO H CB  1 
ATOM   2698 C  CG  . PRO B 2 53  ? 8.259  6.503   -15.471 1.00 78.79  ? 53  PRO H CG  1 
ATOM   2699 C  CD  . PRO B 2 53  ? 8.770  7.413   -16.542 1.00 74.09  ? 53  PRO H CD  1 
ATOM   2700 N  N   . ASN B 2 54  ? 5.806  9.499   -16.652 1.00 79.60  ? 54  ASN H N   1 
ATOM   2701 C  CA  . ASN B 2 54  ? 5.009  10.727  -16.658 1.00 81.93  ? 54  ASN H CA  1 
ATOM   2702 C  C   . ASN B 2 54  ? 4.348  11.003  -18.020 1.00 86.86  ? 54  ASN H C   1 
ATOM   2703 O  O   . ASN B 2 54  ? 3.148  11.255  -18.072 1.00 88.50  ? 54  ASN H O   1 
ATOM   2704 C  CB  . ASN B 2 54  ? 5.879  11.922  -16.224 1.00 83.13  ? 54  ASN H CB  1 
ATOM   2705 C  CG  . ASN B 2 54  ? 5.172  13.262  -16.273 1.00 110.02 ? 54  ASN H CG  1 
ATOM   2706 O  OD1 . ASN B 2 54  ? 4.071  13.428  -15.747 1.00 107.11 ? 54  ASN H OD1 1 
ATOM   2707 N  ND2 . ASN B 2 54  ? 5.791  14.242  -16.922 1.00 101.98 ? 54  ASN H ND2 1 
ATOM   2708 N  N   . SER B 2 55  ? 5.130  10.996  -19.110 1.00 82.23  ? 55  SER H N   1 
ATOM   2709 C  CA  . SER B 2 55  ? 4.597  11.270  -20.454 1.00 83.14  ? 55  SER H CA  1 
ATOM   2710 C  C   . SER B 2 55  ? 4.217  10.021  -21.259 1.00 86.08  ? 55  SER H C   1 
ATOM   2711 O  O   . SER B 2 55  ? 3.619  10.148  -22.335 1.00 86.86  ? 55  SER H O   1 
ATOM   2712 C  CB  . SER B 2 55  ? 5.580  12.114  -21.257 1.00 86.31  ? 55  SER H CB  1 
ATOM   2713 O  OG  . SER B 2 55  ? 6.579  11.343  -21.911 1.00 92.55  ? 55  SER H OG  1 
ATOM   2714 N  N   . GLY B 2 56  ? 4.602  8.852   -20.761 1.00 80.65  ? 56  GLY H N   1 
ATOM   2715 C  CA  . GLY B 2 56  ? 4.407  7.580   -21.452 1.00 79.58  ? 56  GLY H CA  1 
ATOM   2716 C  C   . GLY B 2 56  ? 5.105  7.672   -22.793 1.00 82.45  ? 56  GLY H C   1 
ATOM   2717 O  O   . GLY B 2 56  ? 4.642  7.093   -23.776 1.00 82.57  ? 56  GLY H O   1 
ATOM   2718 N  N   . GLY B 2 57  ? 6.192  8.443   -22.829 1.00 77.77  ? 57  GLY H N   1 
ATOM   2719 C  CA  . GLY B 2 57  ? 6.978  8.705   -24.028 1.00 76.95  ? 57  GLY H CA  1 
ATOM   2720 C  C   . GLY B 2 57  ? 8.290  7.970   -23.994 1.00 77.99  ? 57  GLY H C   1 
ATOM   2721 O  O   . GLY B 2 57  ? 9.024  8.047   -23.009 1.00 76.61  ? 57  GLY H O   1 
ATOM   2722 N  N   . SER B 2 58  ? 8.580  7.219   -25.051 1.00 73.38  ? 58  SER H N   1 
ATOM   2723 C  CA  . SER B 2 58  ? 9.785  6.413   -25.102 1.00 71.10  ? 58  SER H CA  1 
ATOM   2724 C  C   . SER B 2 58  ? 10.587 6.604   -26.381 1.00 73.94  ? 58  SER H C   1 
ATOM   2725 O  O   . SER B 2 58  ? 10.035 6.949   -27.419 1.00 74.87  ? 58  SER H O   1 
ATOM   2726 C  CB  . SER B 2 58  ? 9.453  4.944   -24.866 1.00 74.08  ? 58  SER H CB  1 
ATOM   2727 O  OG  . SER B 2 58  ? 8.428  4.496   -25.738 1.00 84.06  ? 58  SER H OG  1 
ATOM   2728 N  N   . ILE B 2 59  ? 11.906 6.419   -26.277 1.00 68.34  ? 59  ILE H N   1 
ATOM   2729 C  CA  . ILE B 2 59  ? 12.858 6.560   -27.374 1.00 67.70  ? 59  ILE H CA  1 
ATOM   2730 C  C   . ILE B 2 59  ? 13.560 5.219   -27.532 1.00 69.31  ? 59  ILE H C   1 
ATOM   2731 O  O   . ILE B 2 59  ? 13.863 4.553   -26.544 1.00 67.80  ? 59  ILE H O   1 
ATOM   2732 C  CB  . ILE B 2 59  ? 13.898 7.688   -27.115 1.00 70.64  ? 59  ILE H CB  1 
ATOM   2733 C  CG1 . ILE B 2 59  ? 13.288 8.932   -26.396 1.00 72.02  ? 59  ILE H CG1 1 
ATOM   2734 C  CG2 . ILE B 2 59  ? 14.636 8.092   -28.398 1.00 72.02  ? 59  ILE H CG2 1 
ATOM   2735 C  CD1 . ILE B 2 59  ? 11.968 9.610   -26.981 1.00 81.10  ? 59  ILE H CD1 1 
ATOM   2736 N  N   . TYR B 2 60  ? 13.786 4.810   -28.766 1.00 65.42  ? 60  TYR H N   1 
ATOM   2737 C  CA  . TYR B 2 60  ? 14.424 3.532   -29.028 1.00 64.05  ? 60  TYR H CA  1 
ATOM   2738 C  C   . TYR B 2 60  ? 15.656 3.718   -29.882 1.00 67.10  ? 60  TYR H C   1 
ATOM   2739 O  O   . TYR B 2 60  ? 15.691 4.583   -30.762 1.00 67.71  ? 60  TYR H O   1 
ATOM   2740 C  CB  . TYR B 2 60  ? 13.470 2.591   -29.779 1.00 65.81  ? 60  TYR H CB  1 
ATOM   2741 C  CG  . TYR B 2 60  ? 12.145 2.346   -29.097 1.00 67.36  ? 60  TYR H CG  1 
ATOM   2742 C  CD1 . TYR B 2 60  ? 11.072 3.212   -29.291 1.00 70.50  ? 60  TYR H CD1 1 
ATOM   2743 C  CD2 . TYR B 2 60  ? 11.950 1.240   -28.286 1.00 67.23  ? 60  TYR H CD2 1 
ATOM   2744 C  CE1 . TYR B 2 60  ? 9.856  2.998   -28.665 1.00 71.58  ? 60  TYR H CE1 1 
ATOM   2745 C  CE2 . TYR B 2 60  ? 10.735 1.010   -27.661 1.00 68.44  ? 60  TYR H CE2 1 
ATOM   2746 C  CZ  . TYR B 2 60  ? 9.690  1.893   -27.855 1.00 76.97  ? 60  TYR H CZ  1 
ATOM   2747 O  OH  . TYR B 2 60  ? 8.493  1.671   -27.246 1.00 78.44  ? 60  TYR H OH  1 
ATOM   2748 N  N   . ASN B 2 61  ? 16.675 2.891   -29.631 1.00 62.05  ? 61  ASN H N   1 
ATOM   2749 C  CA  . ASN B 2 61  ? 17.880 2.876   -30.441 1.00 61.79  ? 61  ASN H CA  1 
ATOM   2750 C  C   . ASN B 2 61  ? 17.392 2.358   -31.788 1.00 66.78  ? 61  ASN H C   1 
ATOM   2751 O  O   . ASN B 2 61  ? 16.469 1.538   -31.835 1.00 66.56  ? 61  ASN H O   1 
ATOM   2752 C  CB  . ASN B 2 61  ? 18.909 1.905   -29.849 1.00 60.56  ? 61  ASN H CB  1 
ATOM   2753 C  CG  . ASN B 2 61  ? 20.264 1.890   -30.530 1.00 79.91  ? 61  ASN H CG  1 
ATOM   2754 O  OD1 . ASN B 2 61  ? 20.382 1.967   -31.760 1.00 75.62  ? 61  ASN H OD1 1 
ATOM   2755 N  ND2 . ASN B 2 61  ? 21.313 1.724   -29.732 1.00 69.54  ? 61  ASN H ND2 1 
ATOM   2756 N  N   . GLN B 2 62  ? 18.015 2.823   -32.873 1.00 64.13  ? 62  GLN H N   1 
ATOM   2757 C  CA  . GLN B 2 62  ? 17.654 2.412   -34.226 1.00 65.32  ? 62  GLN H CA  1 
ATOM   2758 C  C   . GLN B 2 62  ? 17.723 0.898   -34.375 1.00 68.80  ? 62  GLN H C   1 
ATOM   2759 O  O   . GLN B 2 62  ? 16.889 0.308   -35.057 1.00 69.30  ? 62  GLN H O   1 
ATOM   2760 C  CB  . GLN B 2 62  ? 18.539 3.102   -35.277 1.00 67.82  ? 62  GLN H CB  1 
ATOM   2761 C  CG  . GLN B 2 62  ? 18.045 2.906   -36.720 1.00 83.27  ? 62  GLN H CG  1 
ATOM   2762 C  CD  . GLN B 2 62  ? 16.620 3.377   -36.925 1.00 101.59 ? 62  GLN H CD  1 
ATOM   2763 O  OE1 . GLN B 2 62  ? 16.200 4.403   -36.384 1.00 96.44  ? 62  GLN H OE1 1 
ATOM   2764 N  NE2 . GLN B 2 62  ? 15.866 2.654   -37.738 1.00 94.55  ? 62  GLN H NE2 1 
ATOM   2765 N  N   . LYS B 2 63  ? 18.702 0.280   -33.704 1.00 64.28  ? 63  LYS H N   1 
ATOM   2766 C  CA  . LYS B 2 63  ? 18.920 -1.166  -33.703 1.00 64.02  ? 63  LYS H CA  1 
ATOM   2767 C  C   . LYS B 2 63  ? 17.721 -1.949  -33.159 1.00 67.44  ? 63  LYS H C   1 
ATOM   2768 O  O   . LYS B 2 63  ? 17.431 -3.035  -33.650 1.00 67.86  ? 63  LYS H O   1 
ATOM   2769 C  CB  . LYS B 2 63  ? 20.194 -1.527  -32.918 1.00 65.47  ? 63  LYS H CB  1 
ATOM   2770 C  CG  . LYS B 2 63  ? 21.465 -0.948  -33.523 1.00 78.73  ? 63  LYS H CG  1 
ATOM   2771 C  CD  . LYS B 2 63  ? 22.695 -1.347  -32.729 1.00 87.63  ? 63  LYS H CD  1 
ATOM   2772 C  CE  . LYS B 2 63  ? 23.964 -0.866  -33.389 1.00 98.99  ? 63  LYS H CE  1 
ATOM   2773 N  NZ  . LYS B 2 63  ? 24.326 -1.684  -34.581 1.00 109.37 ? 63  LYS H NZ  1 
ATOM   2774 N  N   . PHE B 2 64  ? 17.026 -1.388  -32.162 1.00 63.00  ? 64  PHE H N   1 
ATOM   2775 C  CA  . PHE B 2 64  ? 15.897 -2.041  -31.492 1.00 62.62  ? 64  PHE H CA  1 
ATOM   2776 C  C   . PHE B 2 64  ? 14.515 -1.431  -31.761 1.00 68.44  ? 64  PHE H C   1 
ATOM   2777 O  O   . PHE B 2 64  ? 13.596 -1.645  -30.968 1.00 67.52  ? 64  PHE H O   1 
ATOM   2778 C  CB  . PHE B 2 64  ? 16.144 -2.093  -29.976 1.00 62.77  ? 64  PHE H CB  1 
ATOM   2779 C  CG  . PHE B 2 64  ? 17.536 -2.499  -29.580 1.00 63.36  ? 64  PHE H CG  1 
ATOM   2780 C  CD1 . PHE B 2 64  ? 17.876 -3.837  -29.460 1.00 66.28  ? 64  PHE H CD1 1 
ATOM   2781 C  CD2 . PHE B 2 64  ? 18.509 -1.544  -29.339 1.00 64.77  ? 64  PHE H CD2 1 
ATOM   2782 C  CE1 . PHE B 2 64  ? 19.162 -4.209  -29.110 1.00 66.80  ? 64  PHE H CE1 1 
ATOM   2783 C  CE2 . PHE B 2 64  ? 19.794 -1.913  -28.987 1.00 67.09  ? 64  PHE H CE2 1 
ATOM   2784 C  CZ  . PHE B 2 64  ? 20.117 -3.246  -28.872 1.00 65.29  ? 64  PHE H CZ  1 
ATOM   2785 N  N   . LYS B 2 65  ? 14.354 -0.695  -32.870 1.00 67.43  ? 65  LYS H N   1 
ATOM   2786 C  CA  . LYS B 2 65  ? 13.095 -0.029  -33.189 1.00 68.81  ? 65  LYS H CA  1 
ATOM   2787 C  C   . LYS B 2 65  ? 11.891 -0.959  -33.266 1.00 74.60  ? 65  LYS H C   1 
ATOM   2788 O  O   . LYS B 2 65  ? 10.892 -0.699  -32.598 1.00 74.23  ? 65  LYS H O   1 
ATOM   2789 C  CB  . LYS B 2 65  ? 13.221 0.796   -34.467 1.00 72.90  ? 65  LYS H CB  1 
ATOM   2790 C  CG  . LYS B 2 65  ? 13.798 2.169   -34.213 1.00 88.72  ? 65  LYS H CG  1 
ATOM   2791 C  CD  . LYS B 2 65  ? 13.255 3.177   -35.184 1.00 101.48 ? 65  LYS H CD  1 
ATOM   2792 C  CE  . LYS B 2 65  ? 13.697 4.565   -34.815 1.00 113.22 ? 65  LYS H CE  1 
ATOM   2793 N  NZ  . LYS B 2 65  ? 13.026 5.574   -35.669 1.00 125.10 ? 65  LYS H NZ  1 
ATOM   2794 N  N   . ASP B 2 66  ? 11.980 -2.039  -34.053 1.00 72.72  ? 66  ASP H N   1 
ATOM   2795 C  CA  . ASP B 2 66  ? 10.867 -2.980  -34.173 1.00 73.66  ? 66  ASP H CA  1 
ATOM   2796 C  C   . ASP B 2 66  ? 10.876 -4.075  -33.114 1.00 77.18  ? 66  ASP H C   1 
ATOM   2797 O  O   . ASP B 2 66  ? 9.815  -4.565  -32.719 1.00 77.02  ? 66  ASP H O   1 
ATOM   2798 C  CB  . ASP B 2 66  ? 10.791 -3.580  -35.582 1.00 77.22  ? 66  ASP H CB  1 
ATOM   2799 C  CG  . ASP B 2 66  ? 10.077 -2.690  -36.589 1.00 89.61  ? 66  ASP H CG  1 
ATOM   2800 O  OD1 . ASP B 2 66  ? 9.422  -1.715  -36.162 1.00 90.20  ? 66  ASP H OD1 1 
ATOM   2801 O  OD2 . ASP B 2 66  ? 10.148 -2.988  -37.791 1.00 97.32  ? 66  ASP H OD2 1 
ATOM   2802 N  N   . LYS B 2 67  ? 12.072 -4.442  -32.656 1.00 73.14  ? 67  LYS H N   1 
ATOM   2803 C  CA  . LYS B 2 67  ? 12.284 -5.478  -31.660 1.00 72.23  ? 67  LYS H CA  1 
ATOM   2804 C  C   . LYS B 2 67  ? 11.684 -5.226  -30.287 1.00 75.36  ? 67  LYS H C   1 
ATOM   2805 O  O   . LYS B 2 67  ? 11.141 -6.148  -29.689 1.00 74.87  ? 67  LYS H O   1 
ATOM   2806 C  CB  . LYS B 2 67  ? 13.774 -5.747  -31.495 1.00 74.22  ? 67  LYS H CB  1 
ATOM   2807 C  CG  . LYS B 2 67  ? 14.024 -7.134  -31.059 1.00 88.37  ? 67  LYS H CG  1 
ATOM   2808 C  CD  . LYS B 2 67  ? 13.726 -8.054  -32.235 1.00 100.23 ? 67  LYS H CD  1 
ATOM   2809 C  CE  . LYS B 2 67  ? 14.331 -9.301  -31.711 1.00 112.00 ? 67  LYS H CE  1 
ATOM   2810 N  NZ  . LYS B 2 67  ? 15.688 -9.028  -31.253 1.00 121.61 ? 67  LYS H NZ  1 
ATOM   2811 N  N   . ALA B 2 68  ? 11.803 -3.999  -29.770 1.00 71.58  ? 68  ALA H N   1 
ATOM   2812 C  CA  . ALA B 2 68  ? 11.308 -3.714  -28.429 1.00 70.74  ? 68  ALA H CA  1 
ATOM   2813 C  C   . ALA B 2 68  ? 10.238 -2.634  -28.321 1.00 75.38  ? 68  ALA H C   1 
ATOM   2814 O  O   . ALA B 2 68  ? 10.289 -1.634  -29.025 1.00 75.53  ? 68  ALA H O   1 
ATOM   2815 C  CB  . ALA B 2 68  ? 12.468 -3.375  -27.522 1.00 70.28  ? 68  ALA H CB  1 
ATOM   2816 N  N   . THR B 2 69  ? 9.271  -2.863  -27.416 1.00 72.16  ? 69  THR H N   1 
ATOM   2817 C  CA  . THR B 2 69  ? 8.161  -1.958  -27.099 1.00 72.72  ? 69  THR H CA  1 
ATOM   2818 C  C   . THR B 2 69  ? 8.080  -1.834  -25.574 1.00 75.83  ? 69  THR H C   1 
ATOM   2819 O  O   . THR B 2 69  ? 8.083  -2.844  -24.874 1.00 74.88  ? 69  THR H O   1 
ATOM   2820 C  CB  . THR B 2 69  ? 6.833  -2.463  -27.687 1.00 82.17  ? 69  THR H CB  1 
ATOM   2821 O  OG1 . THR B 2 69  ? 6.993  -2.681  -29.089 1.00 82.33  ? 69  THR H OG1 1 
ATOM   2822 C  CG2 . THR B 2 69  ? 5.685  -1.470  -27.453 1.00 81.86  ? 69  THR H CG2 1 
ATOM   2823 N  N   . PHE B 2 70  ? 8.018  -0.603  -25.063 1.00 72.55  ? 70  PHE H N   1 
ATOM   2824 C  CA  . PHE B 2 70  ? 7.950  -0.380  -23.623 1.00 72.01  ? 70  PHE H CA  1 
ATOM   2825 C  C   . PHE B 2 70  ? 6.559  0.029   -23.172 1.00 77.80  ? 70  PHE H C   1 
ATOM   2826 O  O   . PHE B 2 70  ? 5.933  0.906   -23.765 1.00 78.49  ? 70  PHE H O   1 
ATOM   2827 C  CB  . PHE B 2 70  ? 8.988  0.645   -23.151 1.00 72.92  ? 70  PHE H CB  1 
ATOM   2828 C  CG  . PHE B 2 70  ? 10.388 0.416   -23.653 1.00 73.20  ? 70  PHE H CG  1 
ATOM   2829 C  CD1 . PHE B 2 70  ? 10.971 -0.839  -23.579 1.00 75.41  ? 70  PHE H CD1 1 
ATOM   2830 C  CD2 . PHE B 2 70  ? 11.131 1.459   -24.177 1.00 75.03  ? 70  PHE H CD2 1 
ATOM   2831 C  CE1 . PHE B 2 70  ? 12.252 -1.051  -24.051 1.00 75.54  ? 70  PHE H CE1 1 
ATOM   2832 C  CE2 . PHE B 2 70  ? 12.421 1.250   -24.635 1.00 76.96  ? 70  PHE H CE2 1 
ATOM   2833 C  CZ  . PHE B 2 70  ? 12.977 -0.006  -24.570 1.00 74.39  ? 70  PHE H CZ  1 
ATOM   2834 N  N   . THR B 2 71  ? 6.078  -0.637  -22.121 1.00 74.84  ? 71  THR H N   1 
ATOM   2835 C  CA  . THR B 2 71  ? 4.779  -0.403  -21.506 1.00 76.18  ? 71  THR H CA  1 
ATOM   2836 C  C   . THR B 2 71  ? 4.996  -0.274  -20.007 1.00 80.22  ? 71  THR H C   1 
ATOM   2837 O  O   . THR B 2 71  ? 5.985  -0.779  -19.480 1.00 78.67  ? 71  THR H O   1 
ATOM   2838 C  CB  . THR B 2 71  ? 3.802  -1.552  -21.817 1.00 85.14  ? 71  THR H CB  1 
ATOM   2839 O  OG1 . THR B 2 71  ? 4.288  -2.757  -21.238 1.00 83.97  ? 71  THR H OG1 1 
ATOM   2840 C  CG2 . THR B 2 71  ? 3.576  -1.737  -23.314 1.00 84.27  ? 71  THR H CG2 1 
ATOM   2841 N  N   . VAL B 2 72  ? 4.075  0.393   -19.320 1.00 78.28  ? 72  VAL H N   1 
ATOM   2842 C  CA  . VAL B 2 72  ? 4.190  0.595   -17.881 1.00 78.20  ? 72  VAL H CA  1 
ATOM   2843 C  C   . VAL B 2 72  ? 2.870  0.475   -17.142 1.00 83.91  ? 72  VAL H C   1 
ATOM   2844 O  O   . VAL B 2 72  ? 1.805  0.791   -17.672 1.00 84.91  ? 72  VAL H O   1 
ATOM   2845 C  CB  . VAL B 2 72  ? 4.883  1.942   -17.543 1.00 81.93  ? 72  VAL H CB  1 
ATOM   2846 C  CG1 . VAL B 2 72  ? 4.030  3.123   -17.976 1.00 83.40  ? 72  VAL H CG1 1 
ATOM   2847 C  CG2 . VAL B 2 72  ? 5.208  2.040   -16.064 1.00 81.74  ? 72  VAL H CG2 1 
ATOM   2848 N  N   . ASP B 2 73  ? 2.956  -0.014  -15.916 1.00 80.48  ? 73  ASP H N   1 
ATOM   2849 C  CA  . ASP B 2 73  ? 1.831  -0.092  -15.017 1.00 81.91  ? 73  ASP H CA  1 
ATOM   2850 C  C   . ASP B 2 73  ? 2.131  0.810   -13.821 1.00 85.89  ? 73  ASP H C   1 
ATOM   2851 O  O   . ASP B 2 73  ? 2.976  0.489   -12.980 1.00 84.59  ? 73  ASP H O   1 
ATOM   2852 C  CB  . ASP B 2 73  ? 1.588  -1.518  -14.564 1.00 83.61  ? 73  ASP H CB  1 
ATOM   2853 C  CG  . ASP B 2 73  ? 0.409  -1.623  -13.620 1.00 95.81  ? 73  ASP H CG  1 
ATOM   2854 O  OD1 . ASP B 2 73  ? 0.286  -0.774  -12.752 1.00 97.54  ? 73  ASP H OD1 1 
ATOM   2855 O  OD2 . ASP B 2 73  ? -0.319 -2.589  -13.706 1.00 102.71 ? 73  ASP H OD2 1 
ATOM   2856 N  N   . LYS B 2 74  ? 1.430  1.949   -13.756 1.00 83.74  ? 74  LYS H N   1 
ATOM   2857 C  CA  . LYS B 2 74  ? 1.607  2.954   -12.700 1.00 84.24  ? 74  LYS H CA  1 
ATOM   2858 C  C   . LYS B 2 74  ? 1.097  2.517   -11.322 1.00 89.02  ? 74  LYS H C   1 
ATOM   2859 O  O   . LYS B 2 74  ? 1.728  2.852   -10.324 1.00 88.49  ? 74  LYS H O   1 
ATOM   2860 C  CB  . LYS B 2 74  ? 1.033  4.314   -13.116 1.00 88.24  ? 74  LYS H CB  1 
ATOM   2861 C  CG  . LYS B 2 74  ? 1.640  4.810   -14.427 1.00 100.49 ? 74  LYS H CG  1 
ATOM   2862 C  CD  . LYS B 2 74  ? 1.594  6.315   -14.549 1.00 111.34 ? 74  LYS H CD  1 
ATOM   2863 C  CE  . LYS B 2 74  ? 0.299  6.801   -15.146 1.00 124.18 ? 74  LYS H CE  1 
ATOM   2864 N  NZ  . LYS B 2 74  ? 0.324  8.269   -15.345 1.00 134.39 ? 74  LYS H NZ  1 
ATOM   2865 N  N   . SER B 2 75  ? -0.038 1.781   -11.265 1.00 86.76  ? 75  SER H N   1 
ATOM   2866 C  CA  . SER B 2 75  ? -0.611 1.275   -10.014 1.00 87.95  ? 75  SER H CA  1 
ATOM   2867 C  C   . SER B 2 75  ? 0.353  0.294   -9.355  1.00 89.83  ? 75  SER H C   1 
ATOM   2868 O  O   . SER B 2 75  ? 0.599  0.403   -8.154  1.00 90.05  ? 75  SER H O   1 
ATOM   2869 C  CB  . SER B 2 75  ? -1.969 0.634   -10.266 1.00 93.14  ? 75  SER H CB  1 
ATOM   2870 O  OG  . SER B 2 75  ? -1.850 -0.632  -10.901 1.00 100.34 ? 75  SER H OG  1 
ATOM   2871 N  N   . SER B 2 76  ? 0.882  -0.666  -10.153 1.00 84.18  ? 76  SER H N   1 
ATOM   2872 C  CA  . SER B 2 76  ? 1.865  -1.630  -9.664  1.00 82.55  ? 76  SER H CA  1 
ATOM   2873 C  C   . SER B 2 76  ? 3.285  -1.053  -9.641  1.00 84.55  ? 76  SER H C   1 
ATOM   2874 O  O   . SER B 2 76  ? 4.209  -1.702  -9.136  1.00 83.37  ? 76  SER H O   1 
ATOM   2875 C  CB  . SER B 2 76  ? 1.784  -2.957  -10.437 1.00 85.26  ? 76  SER H CB  1 
ATOM   2876 O  OG  . SER B 2 76  ? 1.875  -2.823  -11.843 1.00 93.54  ? 76  SER H OG  1 
ATOM   2877 N  N   . SER B 2 77  ? 3.463  0.160   -10.206 1.00 80.47  ? 77  SER H N   1 
ATOM   2878 C  CA  . SER B 2 77  ? 4.761  0.845   -10.277 1.00 78.74  ? 77  SER H CA  1 
ATOM   2879 C  C   . SER B 2 77  ? 5.767  -0.082  -10.985 1.00 80.04  ? 77  SER H C   1 
ATOM   2880 O  O   . SER B 2 77  ? 6.925  -0.195  -10.588 1.00 78.57  ? 77  SER H O   1 
ATOM   2881 C  CB  . SER B 2 77  ? 5.244  1.224   -8.877  1.00 82.92  ? 77  SER H CB  1 
ATOM   2882 O  OG  . SER B 2 77  ? 4.183  1.727   -8.079  1.00 93.67  ? 77  SER H OG  1 
ATOM   2883 N  N   . THR B 2 78  ? 5.293  -0.757  -12.034 1.00 75.89  ? 78  THR H N   1 
ATOM   2884 C  CA  . THR B 2 78  ? 6.057  -1.740  -12.785 1.00 74.05  ? 78  THR H CA  1 
ATOM   2885 C  C   . THR B 2 78  ? 6.244  -1.324  -14.237 1.00 76.75  ? 78  THR H C   1 
ATOM   2886 O  O   . THR B 2 78  ? 5.317  -0.827  -14.858 1.00 77.22  ? 78  THR H O   1 
ATOM   2887 C  CB  . THR B 2 78  ? 5.379  -3.116  -12.677 1.00 82.66  ? 78  THR H CB  1 
ATOM   2888 O  OG1 . THR B 2 78  ? 5.354  -3.523  -11.312 1.00 83.15  ? 78  THR H OG1 1 
ATOM   2889 C  CG2 . THR B 2 78  ? 6.092  -4.177  -13.487 1.00 80.02  ? 78  THR H CG2 1 
ATOM   2890 N  N   . ALA B 2 79  ? 7.445  -1.550  -14.776 1.00 71.53  ? 79  ALA H N   1 
ATOM   2891 C  CA  . ALA B 2 79  ? 7.786  -1.249  -16.162 1.00 70.53  ? 79  ALA H CA  1 
ATOM   2892 C  C   . ALA B 2 79  ? 8.000  -2.545  -16.924 1.00 73.26  ? 79  ALA H C   1 
ATOM   2893 O  O   . ALA B 2 79  ? 8.509  -3.515  -16.375 1.00 72.43  ? 79  ALA H O   1 
ATOM   2894 C  CB  . ALA B 2 79  ? 9.028  -0.378  -16.227 1.00 70.38  ? 79  ALA H CB  1 
ATOM   2895 N  N   . TYR B 2 80  ? 7.602  -2.561  -18.187 1.00 69.60  ? 80  TYR H N   1 
ATOM   2896 C  CA  . TYR B 2 80  ? 7.739  -3.735  -19.032 1.00 68.98  ? 80  TYR H CA  1 
ATOM   2897 C  C   . TYR B 2 80  ? 8.407  -3.385  -20.343 1.00 72.16  ? 80  TYR H C   1 
ATOM   2898 O  O   . TYR B 2 80  ? 8.347  -2.248  -20.809 1.00 71.87  ? 80  TYR H O   1 
ATOM   2899 C  CB  . TYR B 2 80  ? 6.375  -4.372  -19.357 1.00 71.21  ? 80  TYR H CB  1 
ATOM   2900 C  CG  . TYR B 2 80  ? 5.413  -4.508  -18.201 1.00 73.82  ? 80  TYR H CG  1 
ATOM   2901 C  CD1 . TYR B 2 80  ? 5.322  -5.695  -17.484 1.00 75.93  ? 80  TYR H CD1 1 
ATOM   2902 C  CD2 . TYR B 2 80  ? 4.559  -3.469  -17.854 1.00 75.53  ? 80  TYR H CD2 1 
ATOM   2903 C  CE1 . TYR B 2 80  ? 4.417  -5.837  -16.443 1.00 77.86  ? 80  TYR H CE1 1 
ATOM   2904 C  CE2 . TYR B 2 80  ? 3.671  -3.590  -16.798 1.00 77.52  ? 80  TYR H CE2 1 
ATOM   2905 C  CZ  . TYR B 2 80  ? 3.601  -4.778  -16.096 1.00 85.09  ? 80  TYR H CZ  1 
ATOM   2906 O  OH  . TYR B 2 80  ? 2.719  -4.905  -15.059 1.00 87.31  ? 80  TYR H OH  1 
ATOM   2907 N  N   . MET B 2 81  ? 9.053  -4.385  -20.931 1.00 68.26  ? 81  MET H N   1 
ATOM   2908 C  CA  . MET B 2 81  ? 9.687  -4.306  -22.231 1.00 67.83  ? 81  MET H CA  1 
ATOM   2909 C  C   . MET B 2 81  ? 9.258  -5.562  -22.972 1.00 72.43  ? 81  MET H C   1 
ATOM   2910 O  O   . MET B 2 81  ? 9.299  -6.657  -22.416 1.00 71.93  ? 81  MET H O   1 
ATOM   2911 C  CB  . MET B 2 81  ? 11.210 -4.215  -22.126 1.00 69.15  ? 81  MET H CB  1 
ATOM   2912 C  CG  . MET B 2 81  ? 11.890 -4.251  -23.481 1.00 72.63  ? 81  MET H CG  1 
ATOM   2913 S  SD  . MET B 2 81  ? 13.679 -4.355  -23.403 1.00 75.90  ? 81  MET H SD  1 
ATOM   2914 C  CE  . MET B 2 81  ? 13.859 -5.877  -22.542 1.00 72.59  ? 81  MET H CE  1 
ATOM   2915 N  N   . GLU B 2 82  ? 8.815  -5.397  -24.212 1.00 69.96  ? 82  GLU H N   1 
ATOM   2916 C  CA  . GLU B 2 82  ? 8.348  -6.510  -25.021 1.00 70.64  ? 82  GLU H CA  1 
ATOM   2917 C  C   . GLU B 2 82  ? 9.279  -6.783  -26.178 1.00 74.01  ? 82  GLU H C   1 
ATOM   2918 O  O   . GLU B 2 82  ? 9.606  -5.882  -26.939 1.00 73.59  ? 82  GLU H O   1 
ATOM   2919 C  CB  . GLU B 2 82  ? 6.940  -6.238  -25.548 1.00 73.35  ? 82  GLU H CB  1 
ATOM   2920 C  CG  . GLU B 2 82  ? 5.883  -6.122  -24.466 1.00 85.94  ? 82  GLU H CG  1 
ATOM   2921 C  CD  . GLU B 2 82  ? 4.468  -6.065  -24.995 1.00 111.39 ? 82  GLU H CD  1 
ATOM   2922 O  OE1 . GLU B 2 82  ? 4.256  -6.431  -26.172 1.00 107.14 ? 82  GLU H OE1 1 
ATOM   2923 O  OE2 . GLU B 2 82  ? 3.562  -5.667  -24.229 1.00 108.25 ? 82  GLU H OE2 1 
ATOM   2924 N  N   . LEU B 2 83  ? 9.718  -8.028  -26.297 1.00 70.49  ? 83  LEU H N   1 
ATOM   2925 C  CA  . LEU B 2 83  ? 10.600 -8.449  -27.367 1.00 70.49  ? 83  LEU H CA  1 
ATOM   2926 C  C   . LEU B 2 83  ? 9.836  -9.406  -28.251 1.00 75.74  ? 83  LEU H C   1 
ATOM   2927 O  O   . LEU B 2 83  ? 9.258  -10.360 -27.757 1.00 75.46  ? 83  LEU H O   1 
ATOM   2928 C  CB  . LEU B 2 83  ? 11.853 -9.109  -26.789 1.00 69.88  ? 83  LEU H CB  1 
ATOM   2929 C  CG  . LEU B 2 83  ? 12.770 -8.218  -25.969 1.00 73.29  ? 83  LEU H CG  1 
ATOM   2930 C  CD1 . LEU B 2 83  ? 13.853 -9.036  -25.312 1.00 73.12  ? 83  LEU H CD1 1 
ATOM   2931 C  CD2 . LEU B 2 83  ? 13.381 -7.114  -26.826 1.00 75.30  ? 83  LEU H CD2 1 
ATOM   2932 N  N   . ARG B 2 84  ? 9.797  -9.127  -29.546 1.00 73.48  ? 84  ARG H N   1 
ATOM   2933 C  CA  . ARG B 2 84  ? 9.067  -9.938  -30.514 1.00 74.77  ? 84  ARG H CA  1 
ATOM   2934 C  C   . ARG B 2 84  ? 9.983  -10.428 -31.615 1.00 78.94  ? 84  ARG H C   1 
ATOM   2935 O  O   . ARG B 2 84  ? 11.044 -9.847  -31.818 1.00 78.06  ? 84  ARG H O   1 
ATOM   2936 C  CB  . ARG B 2 84  ? 7.906  -9.132  -31.105 1.00 76.69  ? 84  ARG H CB  1 
ATOM   2937 C  CG  . ARG B 2 84  ? 8.299  -7.709  -31.496 1.00 89.34  ? 84  ARG H CG  1 
ATOM   2938 C  CD  . ARG B 2 84  ? 7.095  -6.854  -31.790 1.00 103.63 ? 84  ARG H CD  1 
ATOM   2939 N  NE  . ARG B 2 84  ? 6.683  -6.975  -33.188 1.00 117.04 ? 84  ARG H NE  1 
ATOM   2940 C  CZ  . ARG B 2 84  ? 5.755  -6.220  -33.760 1.00 134.45 ? 84  ARG H CZ  1 
ATOM   2941 N  NH1 . ARG B 2 84  ? 5.128  -5.280  -33.063 1.00 122.99 ? 84  ARG H NH1 1 
ATOM   2942 N  NH2 . ARG B 2 84  ? 5.445  -6.394  -35.038 1.00 123.01 ? 84  ARG H NH2 1 
ATOM   2943 N  N   . SER B 2 85  ? 9.561  -11.485 -32.338 1.00 76.36  ? 85  SER H N   1 
ATOM   2944 C  CA  . SER B 2 85  ? 10.320 -12.097 -33.429 1.00 76.98  ? 85  SER H CA  1 
ATOM   2945 C  C   . SER B 2 85  ? 11.724 -12.412 -32.917 1.00 78.96  ? 85  SER H C   1 
ATOM   2946 O  O   . SER B 2 85  ? 12.711 -11.971 -33.505 1.00 78.73  ? 85  SER H O   1 
ATOM   2947 C  CB  . SER B 2 85  ? 10.350 -11.183 -34.658 1.00 81.61  ? 85  SER H CB  1 
ATOM   2948 O  OG  . SER B 2 85  ? 9.073  -10.632 -34.932 1.00 91.89  ? 85  SER H OG  1 
ATOM   2949 N  N   . LEU B 2 86  ? 11.789 -13.149 -31.779 1.00 73.89  ? 86  LEU H N   1 
ATOM   2950 C  CA  . LEU B 2 86  ? 13.042 -13.496 -31.121 1.00 72.70  ? 86  LEU H CA  1 
ATOM   2951 C  C   . LEU B 2 86  ? 13.927 -14.256 -32.053 1.00 76.51  ? 86  LEU H C   1 
ATOM   2952 O  O   . LEU B 2 86  ? 13.469 -15.054 -32.860 1.00 77.45  ? 86  LEU H O   1 
ATOM   2953 C  CB  . LEU B 2 86  ? 12.855 -14.253 -29.789 1.00 72.37  ? 86  LEU H CB  1 
ATOM   2954 C  CG  . LEU B 2 86  ? 11.979 -13.579 -28.737 1.00 76.02  ? 86  LEU H CG  1 
ATOM   2955 C  CD1 . LEU B 2 86  ? 11.919 -14.396 -27.490 1.00 76.02  ? 86  LEU H CD1 1 
ATOM   2956 C  CD2 . LEU B 2 86  ? 12.455 -12.180 -28.426 1.00 77.19  ? 86  LEU H CD2 1 
ATOM   2957 N  N   . THR B 2 87  ? 15.199 -13.942 -31.992 1.00 71.78  ? 87  THR H N   1 
ATOM   2958 C  CA  . THR B 2 87  ? 16.172 -14.575 -32.843 1.00 72.55  ? 87  THR H CA  1 
ATOM   2959 C  C   . THR B 2 87  ? 17.321 -15.014 -31.994 1.00 74.72  ? 87  THR H C   1 
ATOM   2960 O  O   . THR B 2 87  ? 17.384 -14.753 -30.794 1.00 72.84  ? 87  THR H O   1 
ATOM   2961 C  CB  . THR B 2 87  ? 16.630 -13.623 -33.980 1.00 82.01  ? 87  THR H CB  1 
ATOM   2962 O  OG1 . THR B 2 87  ? 17.240 -12.460 -33.422 1.00 81.12  ? 87  THR H OG1 1 
ATOM   2963 C  CG2 . THR B 2 87  ? 15.488 -13.237 -34.920 1.00 81.25  ? 87  THR H CG2 1 
ATOM   2964 N  N   . PHE B 2 88  ? 18.248 -15.638 -32.646 1.00 71.81  ? 88  PHE H N   1 
ATOM   2965 C  CA  . PHE B 2 88  ? 19.445 -16.127 -32.043 1.00 71.42  ? 88  PHE H CA  1 
ATOM   2966 C  C   . PHE B 2 88  ? 20.219 -14.951 -31.399 1.00 72.53  ? 88  PHE H C   1 
ATOM   2967 O  O   . PHE B 2 88  ? 20.570 -14.992 -30.211 1.00 71.23  ? 88  PHE H O   1 
ATOM   2968 C  CB  . PHE B 2 88  ? 20.220 -16.906 -33.120 1.00 75.43  ? 88  PHE H CB  1 
ATOM   2969 C  CG  . PHE B 2 88  ? 19.617 -18.249 -33.519 1.00 78.65  ? 88  PHE H CG  1 
ATOM   2970 C  CD1 . PHE B 2 88  ? 18.288 -18.540 -33.273 1.00 81.19  ? 88  PHE H CD1 1 
ATOM   2971 C  CD2 . PHE B 2 88  ? 20.369 -19.201 -34.162 1.00 82.97  ? 88  PHE H CD2 1 
ATOM   2972 C  CE1 . PHE B 2 88  ? 17.754 -19.789 -33.613 1.00 83.73  ? 88  PHE H CE1 1 
ATOM   2973 C  CE2 . PHE B 2 88  ? 19.845 -20.456 -34.482 1.00 87.46  ? 88  PHE H CE2 1 
ATOM   2974 C  CZ  . PHE B 2 88  ? 18.541 -20.740 -34.212 1.00 84.98  ? 88  PHE H CZ  1 
ATOM   2975 N  N   . GLU B 2 89  ? 20.336 -13.862 -32.147 1.00 68.12  ? 89  GLU H N   1 
ATOM   2976 C  CA  . GLU B 2 89  ? 21.030 -12.633 -31.776 1.00 66.39  ? 89  GLU H CA  1 
ATOM   2977 C  C   . GLU B 2 89  ? 20.547 -11.992 -30.466 1.00 67.14  ? 89  GLU H C   1 
ATOM   2978 O  O   . GLU B 2 89  ? 21.321 -11.394 -29.724 1.00 65.67  ? 89  GLU H O   1 
ATOM   2979 C  CB  . GLU B 2 89  ? 20.930 -11.648 -32.932 1.00 68.05  ? 89  GLU H CB  1 
ATOM   2980 C  CG  . GLU B 2 89  ? 21.745 -12.040 -34.161 1.00 80.93  ? 89  GLU H CG  1 
ATOM   2981 C  CD  . GLU B 2 89  ? 21.682 -13.435 -34.781 1.00 104.56 ? 89  GLU H CD  1 
ATOM   2982 O  OE1 . GLU B 2 89  ? 20.685 -14.171 -34.587 1.00 100.35 ? 89  GLU H OE1 1 
ATOM   2983 O  OE2 . GLU B 2 89  ? 22.622 -13.754 -35.545 1.00 100.45 ? 89  GLU H OE2 1 
ATOM   2984 N  N   . ASP B 2 90  ? 19.313 -12.292 -30.111 1.00 62.47  ? 90  ASP H N   1 
ATOM   2985 C  CA  . ASP B 2 90  ? 18.659 -11.755 -28.924 1.00 60.40  ? 90  ASP H CA  1 
ATOM   2986 C  C   . ASP B 2 90  ? 18.963 -12.452 -27.657 1.00 62.68  ? 90  ASP H C   1 
ATOM   2987 O  O   . ASP B 2 90  ? 18.362 -12.097 -26.652 1.00 61.08  ? 90  ASP H O   1 
ATOM   2988 C  CB  . ASP B 2 90  ? 17.133 -11.747 -29.103 1.00 62.31  ? 90  ASP H CB  1 
ATOM   2989 C  CG  . ASP B 2 90  ? 16.742 -11.193 -30.440 1.00 74.32  ? 90  ASP H CG  1 
ATOM   2990 O  OD1 . ASP B 2 90  ? 17.516 -10.506 -31.007 1.00 75.22  ? 90  ASP H OD1 1 
ATOM   2991 O  OD2 . ASP B 2 90  ? 15.657 -11.455 -30.869 1.00 81.36  ? 90  ASP H OD2 1 
ATOM   2992 N  N   . THR B 2 91  ? 19.803 -13.484 -27.690 1.00 59.55  ? 91  THR H N   1 
ATOM   2993 C  CA  . THR B 2 91  ? 20.141 -14.198 -26.483 1.00 58.95  ? 91  THR H CA  1 
ATOM   2994 C  C   . THR B 2 91  ? 21.092 -13.311 -25.716 1.00 61.02  ? 91  THR H C   1 
ATOM   2995 O  O   . THR B 2 91  ? 22.276 -13.230 -26.022 1.00 61.10  ? 91  THR H O   1 
ATOM   2996 C  CB  . THR B 2 91  ? 20.733 -15.570 -26.781 1.00 67.92  ? 91  THR H CB  1 
ATOM   2997 O  OG1 . THR B 2 91  ? 19.775 -16.351 -27.495 1.00 67.94  ? 91  THR H OG1 1 
ATOM   2998 C  CG2 . THR B 2 91  ? 21.124 -16.306 -25.494 1.00 66.56  ? 91  THR H CG2 1 
ATOM   2999 N  N   . ALA B 2 92  ? 20.539 -12.601 -24.742 1.00 55.72  ? 92  ALA H N   1 
ATOM   3000 C  CA  . ALA B 2 92  ? 21.291 -11.688 -23.904 1.00 54.33  ? 92  ALA H CA  1 
ATOM   3001 C  C   . ALA B 2 92  ? 20.559 -11.480 -22.598 1.00 56.50  ? 92  ALA H C   1 
ATOM   3002 O  O   . ALA B 2 92  ? 19.363 -11.748 -22.513 1.00 55.99  ? 92  ALA H O   1 
ATOM   3003 C  CB  . ALA B 2 92  ? 21.439 -10.358 -24.614 1.00 54.31  ? 92  ALA H CB  1 
ATOM   3004 N  N   . VAL B 2 93  ? 21.278 -10.993 -21.580 1.00 52.03  ? 93  VAL H N   1 
ATOM   3005 C  CA  . VAL B 2 93  ? 20.687 -10.645 -20.297 1.00 50.91  ? 93  VAL H CA  1 
ATOM   3006 C  C   . VAL B 2 93  ? 20.163 -9.212  -20.452 1.00 52.90  ? 93  VAL H C   1 
ATOM   3007 O  O   . VAL B 2 93  ? 20.868 -8.349  -20.969 1.00 51.92  ? 93  VAL H O   1 
ATOM   3008 C  CB  . VAL B 2 93  ? 21.649 -10.851 -19.089 1.00 55.06  ? 93  VAL H CB  1 
ATOM   3009 C  CG1 . VAL B 2 93  ? 23.082 -10.469 -19.435 1.00 55.04  ? 93  VAL H CG1 1 
ATOM   3010 C  CG2 . VAL B 2 93  ? 21.165 -10.110 -17.845 1.00 54.14  ? 93  VAL H CG2 1 
ATOM   3011 N  N   . TYR B 2 94  ? 18.909 -8.983  -20.048 1.00 48.71  ? 94  TYR H N   1 
ATOM   3012 C  CA  . TYR B 2 94  ? 18.241 -7.690  -20.177 1.00 47.55  ? 94  TYR H CA  1 
ATOM   3013 C  C   . TYR B 2 94  ? 18.029 -7.013  -18.833 1.00 51.19  ? 94  TYR H C   1 
ATOM   3014 O  O   . TYR B 2 94  ? 17.554 -7.627  -17.883 1.00 50.96  ? 94  TYR H O   1 
ATOM   3015 C  CB  . TYR B 2 94  ? 16.913 -7.836  -20.930 1.00 48.65  ? 94  TYR H CB  1 
ATOM   3016 C  CG  . TYR B 2 94  ? 17.097 -8.221  -22.379 1.00 50.34  ? 94  TYR H CG  1 
ATOM   3017 C  CD1 . TYR B 2 94  ? 17.282 -9.546  -22.748 1.00 53.02  ? 94  TYR H CD1 1 
ATOM   3018 C  CD2 . TYR B 2 94  ? 17.121 -7.257  -23.377 1.00 50.77  ? 94  TYR H CD2 1 
ATOM   3019 C  CE1 . TYR B 2 94  ? 17.490 -9.903  -24.068 1.00 54.31  ? 94  TYR H CE1 1 
ATOM   3020 C  CE2 . TYR B 2 94  ? 17.289 -7.605  -24.707 1.00 52.25  ? 94  TYR H CE2 1 
ATOM   3021 C  CZ  . TYR B 2 94  ? 17.503 -8.927  -25.044 1.00 60.34  ? 94  TYR H CZ  1 
ATOM   3022 O  OH  . TYR B 2 94  ? 17.691 -9.276  -26.345 1.00 61.93  ? 94  TYR H OH  1 
ATOM   3023 N  N   . TYR B 2 95  ? 18.406 -5.740  -18.759 1.00 47.53  ? 95  TYR H N   1 
ATOM   3024 C  CA  . TYR B 2 95  ? 18.308 -4.938  -17.546 1.00 47.15  ? 95  TYR H CA  1 
ATOM   3025 C  C   . TYR B 2 95  ? 17.415 -3.734  -17.748 1.00 51.85  ? 95  TYR H C   1 
ATOM   3026 O  O   . TYR B 2 95  ? 17.234 -3.242  -18.856 1.00 51.33  ? 95  TYR H O   1 
ATOM   3027 C  CB  . TYR B 2 95  ? 19.681 -4.378  -17.159 1.00 47.67  ? 95  TYR H CB  1 
ATOM   3028 C  CG  . TYR B 2 95  ? 20.753 -5.391  -16.843 1.00 49.36  ? 95  TYR H CG  1 
ATOM   3029 C  CD1 . TYR B 2 95  ? 20.779 -6.048  -15.623 1.00 51.74  ? 95  TYR H CD1 1 
ATOM   3030 C  CD2 . TYR B 2 95  ? 21.784 -5.638  -17.738 1.00 50.09  ? 95  TYR H CD2 1 
ATOM   3031 C  CE1 . TYR B 2 95  ? 21.761 -6.978  -15.327 1.00 53.05  ? 95  TYR H CE1 1 
ATOM   3032 C  CE2 . TYR B 2 95  ? 22.785 -6.551  -17.448 1.00 51.57  ? 95  TYR H CE2 1 
ATOM   3033 C  CZ  . TYR B 2 95  ? 22.769 -7.220  -16.239 1.00 58.93  ? 95  TYR H CZ  1 
ATOM   3034 O  OH  . TYR B 2 95  ? 23.746 -8.120  -15.942 1.00 60.08  ? 95  TYR H OH  1 
ATOM   3035 N  N   . CYS B 2 96  ? 16.927 -3.217  -16.648 1.00 49.44  ? 96  CYS H N   1 
ATOM   3036 C  CA  . CYS B 2 96  ? 16.125 -2.026  -16.587 1.00 49.65  ? 96  CYS H CA  1 
ATOM   3037 C  C   . CYS B 2 96  ? 16.945 -1.148  -15.673 1.00 53.10  ? 96  CYS H C   1 
ATOM   3038 O  O   . CYS B 2 96  ? 17.315 -1.565  -14.574 1.00 53.08  ? 96  CYS H O   1 
ATOM   3039 C  CB  . CYS B 2 96  ? 14.763 -2.336  -15.990 1.00 50.88  ? 96  CYS H CB  1 
ATOM   3040 S  SG  . CYS B 2 96  ? 14.831 -3.056  -14.323 1.00 55.38  ? 96  CYS H SG  1 
ATOM   3041 N  N   . ALA B 2 97  ? 17.165 0.083   -16.072 1.00 49.04  ? 97  ALA H N   1 
ATOM   3042 C  CA  . ALA B 2 97  ? 17.958 1.005   -15.294 1.00 48.57  ? 97  ALA H CA  1 
ATOM   3043 C  C   . ALA B 2 97  ? 17.214 2.311   -15.107 1.00 52.19  ? 97  ALA H C   1 
ATOM   3044 O  O   . ALA B 2 97  ? 16.610 2.822   -16.043 1.00 51.80  ? 97  ALA H O   1 
ATOM   3045 C  CB  . ALA B 2 97  ? 19.282 1.232   -15.989 1.00 48.77  ? 97  ALA H CB  1 
ATOM   3046 N  N   . ARG B 2 98  ? 17.221 2.830   -13.885 1.00 48.60  ? 98  ARG H N   1 
ATOM   3047 C  CA  . ARG B 2 98  ? 16.535 4.076   -13.585 1.00 48.75  ? 98  ARG H CA  1 
ATOM   3048 C  C   . ARG B 2 98  ? 17.513 5.232   -13.556 1.00 51.90  ? 98  ARG H C   1 
ATOM   3049 O  O   . ARG B 2 98  ? 18.528 5.166   -12.870 1.00 51.42  ? 98  ARG H O   1 
ATOM   3050 C  CB  . ARG B 2 98  ? 15.821 3.973   -12.240 1.00 49.27  ? 98  ARG H CB  1 
ATOM   3051 C  CG  . ARG B 2 98  ? 14.820 5.090   -11.995 1.00 57.39  ? 98  ARG H CG  1 
ATOM   3052 C  CD  . ARG B 2 98  ? 14.712 5.395   -10.526 1.00 62.75  ? 98  ARG H CD  1 
ATOM   3053 N  NE  . ARG B 2 98  ? 15.618 6.466   -10.110 1.00 66.22  ? 98  ARG H NE  1 
ATOM   3054 C  CZ  . ARG B 2 98  ? 15.792 6.848   -8.854  1.00 77.60  ? 98  ARG H CZ  1 
ATOM   3055 N  NH1 . ARG B 2 98  ? 15.137 6.243   -7.872  1.00 65.77  ? 98  ARG H NH1 1 
ATOM   3056 N  NH2 . ARG B 2 98  ? 16.624 7.834   -8.562  1.00 61.59  ? 98  ARG H NH2 1 
ATOM   3057 N  N   . GLU B 2 99  ? 17.216 6.272   -14.335 1.00 48.00  ? 99  GLU H N   1 
ATOM   3058 C  CA  . GLU B 2 99  ? 18.030 7.481   -14.406 1.00 47.55  ? 99  GLU H CA  1 
ATOM   3059 C  C   . GLU B 2 99  ? 17.657 8.466   -13.294 1.00 52.09  ? 99  GLU H C   1 
ATOM   3060 O  O   . GLU B 2 99  ? 16.661 8.252   -12.616 1.00 52.43  ? 99  GLU H O   1 
ATOM   3061 C  CB  . GLU B 2 99  ? 17.961 8.130   -15.792 1.00 48.86  ? 99  GLU H CB  1 
ATOM   3062 C  CG  . GLU B 2 99  ? 16.664 7.914   -16.547 1.00 58.14  ? 99  GLU H CG  1 
ATOM   3063 C  CD  . GLU B 2 99  ? 16.770 8.231   -18.024 1.00 73.45  ? 99  GLU H CD  1 
ATOM   3064 O  OE1 . GLU B 2 99  ? 17.127 9.381   -18.360 1.00 64.60  ? 99  GLU H OE1 1 
ATOM   3065 O  OE2 . GLU B 2 99  ? 16.428 7.362   -18.851 1.00 65.40  ? 99  GLU H OE2 1 
ATOM   3066 N  N   . THR B 2 100 ? 18.466 9.514   -13.084 1.00 48.50  ? 100 THR H N   1 
ATOM   3067 C  CA  . THR B 2 100 ? 18.237 10.527  -12.055 1.00 49.29  ? 100 THR H CA  1 
ATOM   3068 C  C   . THR B 2 100 ? 18.363 11.918  -12.683 1.00 53.12  ? 100 THR H C   1 
ATOM   3069 O  O   . THR B 2 100 ? 19.392 12.572  -12.530 1.00 52.55  ? 100 THR H O   1 
ATOM   3070 C  CB  . THR B 2 100 ? 19.195 10.360  -10.866 1.00 57.40  ? 100 THR H CB  1 
ATOM   3071 O  OG1 . THR B 2 100 ? 19.512 8.989   -10.671 1.00 56.79  ? 100 THR H OG1 1 
ATOM   3072 C  CG2 . THR B 2 100 ? 18.608 10.914  -9.592  1.00 56.98  ? 100 THR H CG2 1 
ATOM   3073 N  N   . GLY B 2 101 ? 17.325 12.344  -13.394 1.00 50.11  ? 101 GLY H N   1 
ATOM   3074 C  CA  . GLY B 2 101 ? 17.316 13.636  -14.081 1.00 50.66  ? 101 GLY H CA  1 
ATOM   3075 C  C   . GLY B 2 101 ? 18.015 13.548  -15.416 1.00 53.27  ? 101 GLY H C   1 
ATOM   3076 O  O   . GLY B 2 101 ? 17.466 13.962  -16.440 1.00 53.40  ? 101 GLY H O   1 
ATOM   3077 N  N   . THR B 2 102 ? 19.230 12.996  -15.415 1.00 48.33  ? 102 THR H N   1 
ATOM   3078 C  CA  . THR B 2 102 ? 20.026 12.747  -16.608 1.00 47.22  ? 102 THR H CA  1 
ATOM   3079 C  C   . THR B 2 102 ? 20.171 11.236  -16.732 1.00 49.49  ? 102 THR H C   1 
ATOM   3080 O  O   . THR B 2 102 ? 19.962 10.525  -15.752 1.00 48.73  ? 102 THR H O   1 
ATOM   3081 C  CB  . THR B 2 102 ? 21.366 13.493  -16.579 1.00 55.81  ? 102 THR H CB  1 
ATOM   3082 O  OG1 . THR B 2 102 ? 21.986 13.300  -15.318 1.00 56.47  ? 102 THR H OG1 1 
ATOM   3083 C  CG2 . THR B 2 102 ? 21.208 14.967  -16.855 1.00 55.54  ? 102 THR H CG2 1 
ATOM   3084 N  N   . ALA B 2 103 ? 20.504 10.740  -17.923 1.00 45.24  ? 103 ALA H N   1 
ATOM   3085 C  CA  . ALA B 2 103 ? 20.585 9.301   -18.137 1.00 43.97  ? 103 ALA H CA  1 
ATOM   3086 C  C   . ALA B 2 103 ? 21.847 8.604   -17.598 1.00 46.72  ? 103 ALA H C   1 
ATOM   3087 O  O   . ALA B 2 103 ? 22.578 7.954   -18.343 1.00 46.16  ? 103 ALA H O   1 
ATOM   3088 C  CB  . ALA B 2 103 ? 20.376 8.974   -19.604 1.00 44.64  ? 103 ALA H CB  1 
ATOM   3089 N  N   . TRP B 2 104 ? 22.070 8.709   -16.286 1.00 42.60  ? 104 TRP H N   1 
ATOM   3090 C  CA  . TRP B 2 104 ? 23.140 7.997   -15.582 1.00 41.74  ? 104 TRP H CA  1 
ATOM   3091 C  C   . TRP B 2 104 ? 22.361 7.082   -14.647 1.00 45.90  ? 104 TRP H C   1 
ATOM   3092 O  O   . TRP B 2 104 ? 21.395 7.529   -14.043 1.00 46.14  ? 104 TRP H O   1 
ATOM   3093 C  CB  . TRP B 2 104 ? 24.140 8.933   -14.876 1.00 40.59  ? 104 TRP H CB  1 
ATOM   3094 C  CG  . TRP B 2 104 ? 23.607 9.692   -13.710 1.00 42.01  ? 104 TRP H CG  1 
ATOM   3095 C  CD1 . TRP B 2 104 ? 23.073 10.945  -13.726 1.00 45.72  ? 104 TRP H CD1 1 
ATOM   3096 C  CD2 . TRP B 2 104 ? 23.588 9.267   -12.352 1.00 42.27  ? 104 TRP H CD2 1 
ATOM   3097 N  NE1 . TRP B 2 104 ? 22.710 11.321  -12.462 1.00 45.84  ? 104 TRP H NE1 1 
ATOM   3098 C  CE2 . TRP B 2 104 ? 23.011 10.311  -11.596 1.00 47.02  ? 104 TRP H CE2 1 
ATOM   3099 C  CE3 . TRP B 2 104 ? 23.988 8.096   -11.695 1.00 43.18  ? 104 TRP H CE3 1 
ATOM   3100 C  CZ2 . TRP B 2 104 ? 22.836 10.230  -10.223 1.00 47.02  ? 104 TRP H CZ2 1 
ATOM   3101 C  CZ3 . TRP B 2 104 ? 23.831 8.030   -10.327 1.00 45.30  ? 104 TRP H CZ3 1 
ATOM   3102 C  CH2 . TRP B 2 104 ? 23.233 9.078   -9.611  1.00 46.85  ? 104 TRP H CH2 1 
ATOM   3103 N  N   . PHE B 2 105 ? 22.719 5.802   -14.575 1.00 42.12  ? 105 PHE H N   1 
ATOM   3104 C  CA  . PHE B 2 105 ? 21.920 4.858   -13.804 1.00 42.14  ? 105 PHE H CA  1 
ATOM   3105 C  C   . PHE B 2 105 ? 22.505 4.415   -12.464 1.00 45.99  ? 105 PHE H C   1 
ATOM   3106 O  O   . PHE B 2 105 ? 23.415 3.588   -12.399 1.00 45.37  ? 105 PHE H O   1 
ATOM   3107 C  CB  . PHE B 2 105 ? 21.575 3.635   -14.664 1.00 43.74  ? 105 PHE H CB  1 
ATOM   3108 C  CG  . PHE B 2 105 ? 21.391 3.938   -16.126 1.00 45.24  ? 105 PHE H CG  1 
ATOM   3109 C  CD1 . PHE B 2 105 ? 20.307 4.688   -16.564 1.00 48.82  ? 105 PHE H CD1 1 
ATOM   3110 C  CD2 . PHE B 2 105 ? 22.313 3.497   -17.060 1.00 47.18  ? 105 PHE H CD2 1 
ATOM   3111 C  CE1 . PHE B 2 105 ? 20.154 4.993   -17.909 1.00 49.76  ? 105 PHE H CE1 1 
ATOM   3112 C  CE2 . PHE B 2 105 ? 22.154 3.787   -18.408 1.00 50.05  ? 105 PHE H CE2 1 
ATOM   3113 C  CZ  . PHE B 2 105 ? 21.075 4.536   -18.829 1.00 48.46  ? 105 PHE H CZ  1 
ATOM   3114 N  N   . ALA B 2 106 ? 21.964 5.002   -11.398 1.00 43.15  ? 106 ALA H N   1 
ATOM   3115 C  CA  . ALA B 2 106 ? 22.312 4.701   -10.016 1.00 43.56  ? 106 ALA H CA  1 
ATOM   3116 C  C   . ALA B 2 106 ? 21.769 3.349   -9.613  1.00 47.59  ? 106 ALA H C   1 
ATOM   3117 O  O   . ALA B 2 106 ? 22.399 2.650   -8.830  1.00 47.49  ? 106 ALA H O   1 
ATOM   3118 C  CB  . ALA B 2 106 ? 21.750 5.770   -9.092  1.00 45.23  ? 106 ALA H CB  1 
ATOM   3119 N  N   . TYR B 2 107 ? 20.593 2.992   -10.143 1.00 44.05  ? 107 TYR H N   1 
ATOM   3120 C  CA  . TYR B 2 107 ? 19.905 1.754   -9.803  1.00 44.13  ? 107 TYR H CA  1 
ATOM   3121 C  C   . TYR B 2 107 ? 19.662 0.849   -10.997 1.00 47.39  ? 107 TYR H C   1 
ATOM   3122 O  O   . TYR B 2 107 ? 19.284 1.293   -12.080 1.00 46.59  ? 107 TYR H O   1 
ATOM   3123 C  CB  . TYR B 2 107 ? 18.593 2.048   -9.072  1.00 46.21  ? 107 TYR H CB  1 
ATOM   3124 C  CG  . TYR B 2 107 ? 18.756 3.023   -7.927  1.00 48.72  ? 107 TYR H CG  1 
ATOM   3125 C  CD1 . TYR B 2 107 ? 19.126 2.582   -6.663  1.00 51.51  ? 107 TYR H CD1 1 
ATOM   3126 C  CD2 . TYR B 2 107 ? 18.567 4.385   -8.115  1.00 49.59  ? 107 TYR H CD2 1 
ATOM   3127 C  CE1 . TYR B 2 107 ? 19.307 3.472   -5.618  1.00 53.28  ? 107 TYR H CE1 1 
ATOM   3128 C  CE2 . TYR B 2 107 ? 18.747 5.284   -7.081  1.00 51.41  ? 107 TYR H CE2 1 
ATOM   3129 C  CZ  . TYR B 2 107 ? 19.109 4.822   -5.831  1.00 59.96  ? 107 TYR H CZ  1 
ATOM   3130 O  OH  . TYR B 2 107 ? 19.277 5.703   -4.810  1.00 62.94  ? 107 TYR H OH  1 
ATOM   3131 N  N   . TRP B 2 108 ? 19.896 -0.442  -10.782 1.00 44.05  ? 108 TRP H N   1 
ATOM   3132 C  CA  . TRP B 2 108 ? 19.766 -1.462  -11.810 1.00 43.35  ? 108 TRP H CA  1 
ATOM   3133 C  C   . TRP B 2 108 ? 18.986 -2.660  -11.296 1.00 48.08  ? 108 TRP H C   1 
ATOM   3134 O  O   . TRP B 2 108 ? 19.001 -2.965  -10.101 1.00 48.37  ? 108 TRP H O   1 
ATOM   3135 C  CB  . TRP B 2 108 ? 21.163 -1.955  -12.226 1.00 41.74  ? 108 TRP H CB  1 
ATOM   3136 C  CG  . TRP B 2 108 ? 22.017 -0.938  -12.911 1.00 42.01  ? 108 TRP H CG  1 
ATOM   3137 C  CD1 . TRP B 2 108 ? 22.655 0.124   -12.337 1.00 44.94  ? 108 TRP H CD1 1 
ATOM   3138 C  CD2 . TRP B 2 108 ? 22.360 -0.909  -14.295 1.00 41.33  ? 108 TRP H CD2 1 
ATOM   3139 N  NE1 . TRP B 2 108 ? 23.348 0.828   -13.285 1.00 43.80  ? 108 TRP H NE1 1 
ATOM   3140 C  CE2 . TRP B 2 108 ? 23.193 0.215   -14.495 1.00 44.90  ? 108 TRP H CE2 1 
ATOM   3141 C  CE3 . TRP B 2 108 ? 22.034 -1.715  -15.396 1.00 42.46  ? 108 TRP H CE3 1 
ATOM   3142 C  CZ2 . TRP B 2 108 ? 23.714 0.547   -15.740 1.00 43.90  ? 108 TRP H CZ2 1 
ATOM   3143 C  CZ3 . TRP B 2 108 ? 22.546 -1.376  -16.635 1.00 43.58  ? 108 TRP H CZ3 1 
ATOM   3144 C  CH2 . TRP B 2 108 ? 23.374 -0.254  -16.796 1.00 44.03  ? 108 TRP H CH2 1 
ATOM   3145 N  N   . GLY B 2 109 ? 18.318 -3.333  -12.218 1.00 44.64  ? 109 GLY H N   1 
ATOM   3146 C  CA  . GLY B 2 109 ? 17.617 -4.574  -11.929 1.00 45.08  ? 109 GLY H CA  1 
ATOM   3147 C  C   . GLY B 2 109 ? 18.646 -5.675  -11.936 1.00 49.24  ? 109 GLY H C   1 
ATOM   3148 O  O   . GLY B 2 109 ? 19.750 -5.482  -12.456 1.00 48.43  ? 109 GLY H O   1 
ATOM   3149 N  N   . GLN B 2 110 ? 18.323 -6.841  -11.360 1.00 46.67  ? 110 GLN H N   1 
ATOM   3150 C  CA  . GLN B 2 110 ? 19.246 -7.978  -11.338 1.00 47.03  ? 110 GLN H CA  1 
ATOM   3151 C  C   . GLN B 2 110 ? 19.527 -8.476  -12.760 1.00 50.90  ? 110 GLN H C   1 
ATOM   3152 O  O   . GLN B 2 110 ? 20.599 -9.017  -13.031 1.00 50.98  ? 110 GLN H O   1 
ATOM   3153 C  CB  . GLN B 2 110 ? 18.742 -9.107  -10.420 1.00 49.44  ? 110 GLN H CB  1 
ATOM   3154 C  CG  . GLN B 2 110 ? 17.483 -9.821  -10.906 1.00 59.82  ? 110 GLN H CG  1 
ATOM   3155 C  CD  . GLN B 2 110 ? 16.179 -9.141  -10.583 1.00 75.92  ? 110 GLN H CD  1 
ATOM   3156 O  OE1 . GLN B 2 110 ? 16.121 -7.960  -10.222 1.00 71.02  ? 110 GLN H OE1 1 
ATOM   3157 N  NE2 . GLN B 2 110 ? 15.109 -9.919  -10.680 1.00 67.36  ? 110 GLN H NE2 1 
ATOM   3158 N  N   . GLY B 2 111 ? 18.566 -8.250  -13.648 1.00 46.98  ? 111 GLY H N   1 
ATOM   3159 C  CA  . GLY B 2 111 ? 18.653 -8.650  -15.040 1.00 46.67  ? 111 GLY H CA  1 
ATOM   3160 C  C   . GLY B 2 111 ? 17.888 -9.909  -15.331 1.00 51.45  ? 111 GLY H C   1 
ATOM   3161 O  O   . GLY B 2 111 ? 17.694 -10.752 -14.450 1.00 51.85  ? 111 GLY H O   1 
ATOM   3162 N  N   . THR B 2 112 ? 17.428 -10.043 -16.570 1.00 47.98  ? 112 THR H N   1 
ATOM   3163 C  CA  . THR B 2 112 ? 16.671 -11.195 -17.020 1.00 48.62  ? 112 THR H CA  1 
ATOM   3164 C  C   . THR B 2 112 ? 17.418 -11.877 -18.138 1.00 53.40  ? 112 THR H C   1 
ATOM   3165 O  O   . THR B 2 112 ? 17.758 -11.247 -19.135 1.00 52.43  ? 112 THR H O   1 
ATOM   3166 C  CB  . THR B 2 112 ? 15.269 -10.796 -17.479 1.00 55.13  ? 112 THR H CB  1 
ATOM   3167 O  OG1 . THR B 2 112 ? 14.602 -10.133 -16.410 1.00 54.07  ? 112 THR H OG1 1 
ATOM   3168 C  CG2 . THR B 2 112 ? 14.450 -12.005 -17.923 1.00 54.09  ? 112 THR H CG2 1 
ATOM   3169 N  N   . LEU B 2 113 ? 17.664 -13.170 -17.984 1.00 51.49  ? 113 LEU H N   1 
ATOM   3170 C  CA  . LEU B 2 113 ? 18.326 -13.901 -19.044 1.00 52.21  ? 113 LEU H CA  1 
ATOM   3171 C  C   . LEU B 2 113 ? 17.297 -14.499 -19.990 1.00 57.40  ? 113 LEU H C   1 
ATOM   3172 O  O   . LEU B 2 113 ? 16.475 -15.322 -19.593 1.00 57.49  ? 113 LEU H O   1 
ATOM   3173 C  CB  . LEU B 2 113 ? 19.282 -14.966 -18.499 1.00 53.43  ? 113 LEU H CB  1 
ATOM   3174 C  CG  . LEU B 2 113 ? 19.886 -15.934 -19.528 1.00 59.22  ? 113 LEU H CG  1 
ATOM   3175 C  CD1 . LEU B 2 113 ? 20.671 -15.195 -20.619 1.00 58.82  ? 113 LEU H CD1 1 
ATOM   3176 C  CD2 . LEU B 2 113 ? 20.770 -16.952 -18.844 1.00 62.96  ? 113 LEU H CD2 1 
ATOM   3177 N  N   . VAL B 2 114 ? 17.336 -14.038 -21.244 1.00 54.69  ? 114 VAL H N   1 
ATOM   3178 C  CA  . VAL B 2 114 ? 16.473 -14.518 -22.313 1.00 55.55  ? 114 VAL H CA  1 
ATOM   3179 C  C   . VAL B 2 114 ? 17.329 -15.431 -23.178 1.00 61.92  ? 114 VAL H C   1 
ATOM   3180 O  O   . VAL B 2 114 ? 18.288 -14.988 -23.803 1.00 61.37  ? 114 VAL H O   1 
ATOM   3181 C  CB  . VAL B 2 114 ? 15.843 -13.367 -23.139 1.00 58.62  ? 114 VAL H CB  1 
ATOM   3182 C  CG1 . VAL B 2 114 ? 15.100 -13.900 -24.358 1.00 59.22  ? 114 VAL H CG1 1 
ATOM   3183 C  CG2 . VAL B 2 114 ? 14.906 -12.533 -22.277 1.00 57.60  ? 114 VAL H CG2 1 
ATOM   3184 N  N   . THR B 2 115 ? 17.022 -16.727 -23.150 1.00 60.97  ? 115 THR H N   1 
ATOM   3185 C  CA  . THR B 2 115 ? 17.746 -17.718 -23.927 1.00 62.84  ? 115 THR H CA  1 
ATOM   3186 C  C   . THR B 2 115 ? 16.849 -18.176 -25.060 1.00 68.99  ? 115 THR H C   1 
ATOM   3187 O  O   . THR B 2 115 ? 15.715 -18.578 -24.824 1.00 68.67  ? 115 THR H O   1 
ATOM   3188 C  CB  . THR B 2 115 ? 18.218 -18.895 -23.063 1.00 72.04  ? 115 THR H CB  1 
ATOM   3189 O  OG1 . THR B 2 115 ? 18.251 -18.514 -21.687 1.00 70.45  ? 115 THR H OG1 1 
ATOM   3190 C  CG2 . THR B 2 115 ? 19.587 -19.401 -23.499 1.00 72.13  ? 115 THR H CG2 1 
ATOM   3191 N  N   . VAL B 2 116 ? 17.330 -18.047 -26.298 1.00 67.41  ? 116 VAL H N   1 
ATOM   3192 C  CA  . VAL B 2 116 ? 16.567 -18.459 -27.472 1.00 68.70  ? 116 VAL H CA  1 
ATOM   3193 C  C   . VAL B 2 116 ? 17.247 -19.673 -28.091 1.00 75.81  ? 116 VAL H C   1 
ATOM   3194 O  O   . VAL B 2 116 ? 18.410 -19.612 -28.486 1.00 75.97  ? 116 VAL H O   1 
ATOM   3195 C  CB  . VAL B 2 116 ? 16.369 -17.330 -28.516 1.00 71.93  ? 116 VAL H CB  1 
ATOM   3196 C  CG1 . VAL B 2 116 ? 15.461 -17.790 -29.645 1.00 72.86  ? 116 VAL H CG1 1 
ATOM   3197 C  CG2 . VAL B 2 116 ? 15.807 -16.073 -27.870 1.00 69.92  ? 116 VAL H CG2 1 
ATOM   3198 N  N   . SER B 2 117 ? 16.546 -20.800 -28.107 1.00 74.62  ? 117 SER H N   1 
ATOM   3199 C  CA  . SER B 2 117 ? 17.103 -22.022 -28.664 1.00 77.15  ? 117 SER H CA  1 
ATOM   3200 C  C   . SER B 2 117 ? 16.181 -22.639 -29.697 1.00 83.44  ? 117 SER H C   1 
ATOM   3201 O  O   . SER B 2 117 ? 14.970 -22.708 -29.486 1.00 82.70  ? 117 SER H O   1 
ATOM   3202 C  CB  . SER B 2 117 ? 17.398 -23.032 -27.566 1.00 81.62  ? 117 SER H CB  1 
ATOM   3203 O  OG  . SER B 2 117 ? 16.209 -23.499 -26.941 1.00 90.71  ? 117 SER H OG  1 
ATOM   3204 N  N   . ALA B 2 118 ? 16.763 -23.102 -30.814 1.00 82.44  ? 118 ALA H N   1 
ATOM   3205 C  CA  . ALA B 2 118 ? 16.014 -23.762 -31.879 1.00 84.17  ? 118 ALA H CA  1 
ATOM   3206 C  C   . ALA B 2 118 ? 15.476 -25.083 -31.322 1.00 89.66  ? 118 ALA H C   1 
ATOM   3207 O  O   . ALA B 2 118 ? 14.358 -25.480 -31.649 1.00 89.67  ? 118 ALA H O   1 
ATOM   3208 C  CB  . ALA B 2 118 ? 16.912 -24.005 -33.078 1.00 86.85  ? 118 ALA H CB  1 
ATOM   3209 N  N   . ALA B 2 119 ? 16.270 -25.716 -30.431 1.00 87.27  ? 119 ALA H N   1 
ATOM   3210 C  CA  . ALA B 2 119 ? 15.984 -26.941 -29.683 1.00 125.51 ? 119 ALA H CA  1 
ATOM   3211 C  C   . ALA B 2 119 ? 14.533 -26.986 -29.188 1.00 161.37 ? 119 ALA H C   1 
ATOM   3212 O  O   . ALA B 2 119 ? 13.936 -28.058 -29.088 1.00 125.60 ? 119 ALA H O   1 
ATOM   3213 C  CB  . ALA B 2 119 ? 16.924 -27.023 -28.492 1.00 126.07 ? 119 ALA H CB  1 
ATOM   3214 N  N   . ASP C 3 1   ? 25.639 9.030   -34.142 1.00 59.33  ? 1   ASP L N   1 
ATOM   3215 C  CA  . ASP C 3 1   ? 25.781 8.302   -32.888 1.00 57.48  ? 1   ASP L CA  1 
ATOM   3216 C  C   . ASP C 3 1   ? 27.215 8.385   -32.377 1.00 59.16  ? 1   ASP L C   1 
ATOM   3217 O  O   . ASP C 3 1   ? 28.158 8.114   -33.124 1.00 59.03  ? 1   ASP L O   1 
ATOM   3218 C  CB  . ASP C 3 1   ? 25.372 6.830   -33.064 1.00 59.72  ? 1   ASP L CB  1 
ATOM   3219 C  CG  . ASP C 3 1   ? 23.948 6.607   -33.535 1.00 72.54  ? 1   ASP L CG  1 
ATOM   3220 O  OD1 . ASP C 3 1   ? 23.265 7.601   -33.860 1.00 74.20  ? 1   ASP L OD1 1 
ATOM   3221 O  OD2 . ASP C 3 1   ? 23.507 5.440   -33.550 1.00 79.06  ? 1   ASP L OD2 1 
ATOM   3222 N  N   . ILE C 3 2   ? 27.371 8.784   -31.105 1.00 53.59  ? 2   ILE L N   1 
ATOM   3223 C  CA  . ILE C 3 2   ? 28.675 8.901   -30.460 1.00 51.78  ? 2   ILE L CA  1 
ATOM   3224 C  C   . ILE C 3 2   ? 29.252 7.519   -30.211 1.00 54.04  ? 2   ILE L C   1 
ATOM   3225 O  O   . ILE C 3 2   ? 28.560 6.626   -29.740 1.00 53.26  ? 2   ILE L O   1 
ATOM   3226 C  CB  . ILE C 3 2   ? 28.626 9.745   -29.159 1.00 53.99  ? 2   ILE L CB  1 
ATOM   3227 C  CG1 . ILE C 3 2   ? 28.125 11.163  -29.459 1.00 55.49  ? 2   ILE L CG1 1 
ATOM   3228 C  CG2 . ILE C 3 2   ? 30.002 9.784   -28.457 1.00 53.46  ? 2   ILE L CG2 1 
ATOM   3229 C  CD1 . ILE C 3 2   ? 27.537 11.847  -28.327 1.00 62.39  ? 2   ILE L CD1 1 
ATOM   3230 N  N   . GLN C 3 3   ? 30.519 7.343   -30.564 1.00 49.75  ? 3   GLN L N   1 
ATOM   3231 C  CA  . GLN C 3 3   ? 31.201 6.081   -30.371 1.00 48.67  ? 3   GLN L CA  1 
ATOM   3232 C  C   . GLN C 3 3   ? 32.167 6.228   -29.209 1.00 50.26  ? 3   GLN L C   1 
ATOM   3233 O  O   . GLN C 3 3   ? 32.951 7.171   -29.167 1.00 49.91  ? 3   GLN L O   1 
ATOM   3234 C  CB  . GLN C 3 3   ? 31.932 5.671   -31.649 1.00 51.08  ? 3   GLN L CB  1 
ATOM   3235 C  CG  . GLN C 3 3   ? 32.135 4.171   -31.778 1.00 71.21  ? 3   GLN L CG  1 
ATOM   3236 C  CD  . GLN C 3 3   ? 32.763 3.788   -33.092 1.00 96.11  ? 3   GLN L CD  1 
ATOM   3237 O  OE1 . GLN C 3 3   ? 32.631 2.653   -33.547 1.00 92.95  ? 3   GLN L OE1 1 
ATOM   3238 N  NE2 . GLN C 3 3   ? 33.455 4.725   -33.729 1.00 90.22  ? 3   GLN L NE2 1 
ATOM   3239 N  N   . MET C 3 4   ? 32.076 5.306   -28.250 1.00 45.09  ? 4   MET L N   1 
ATOM   3240 C  CA  . MET C 3 4   ? 32.917 5.312   -27.064 1.00 43.33  ? 4   MET L CA  1 
ATOM   3241 C  C   . MET C 3 4   ? 33.979 4.230   -27.181 1.00 45.95  ? 4   MET L C   1 
ATOM   3242 O  O   . MET C 3 4   ? 33.659 3.058   -27.356 1.00 45.81  ? 4   MET L O   1 
ATOM   3243 C  CB  . MET C 3 4   ? 32.066 5.090   -25.804 1.00 44.98  ? 4   MET L CB  1 
ATOM   3244 C  CG  . MET C 3 4   ? 30.951 6.097   -25.627 1.00 48.85  ? 4   MET L CG  1 
ATOM   3245 S  SD  . MET C 3 4   ? 31.552 7.735   -25.188 1.00 52.86  ? 4   MET L SD  1 
ATOM   3246 C  CE  . MET C 3 4   ? 31.632 7.567   -23.472 1.00 48.57  ? 4   MET L CE  1 
ATOM   3247 N  N   . THR C 3 5   ? 35.246 4.642   -27.127 1.00 41.67  ? 5   THR L N   1 
ATOM   3248 C  CA  . THR C 3 5   ? 36.389 3.746   -27.218 1.00 41.29  ? 5   THR L CA  1 
ATOM   3249 C  C   . THR C 3 5   ? 37.040 3.670   -25.851 1.00 43.33  ? 5   THR L C   1 
ATOM   3250 O  O   . THR C 3 5   ? 37.426 4.687   -25.278 1.00 42.40  ? 5   THR L O   1 
ATOM   3251 C  CB  . THR C 3 5   ? 37.372 4.193   -28.304 1.00 51.36  ? 5   THR L CB  1 
ATOM   3252 O  OG1 . THR C 3 5   ? 36.644 4.583   -29.467 1.00 52.84  ? 5   THR L OG1 1 
ATOM   3253 C  CG2 . THR C 3 5   ? 38.356 3.088   -28.672 1.00 50.57  ? 5   THR L CG2 1 
ATOM   3254 N  N   . GLN C 3 6   ? 37.122 2.456   -25.313 1.00 39.01  ? 6   GLN L N   1 
ATOM   3255 C  CA  . GLN C 3 6   ? 37.691 2.214   -23.998 1.00 37.78  ? 6   GLN L CA  1 
ATOM   3256 C  C   . GLN C 3 6   ? 39.050 1.555   -24.073 1.00 42.09  ? 6   GLN L C   1 
ATOM   3257 O  O   . GLN C 3 6   ? 39.264 0.660   -24.891 1.00 42.60  ? 6   GLN L O   1 
ATOM   3258 C  CB  . GLN C 3 6   ? 36.737 1.355   -23.188 1.00 38.53  ? 6   GLN L CB  1 
ATOM   3259 C  CG  . GLN C 3 6   ? 36.774 1.683   -21.713 1.00 45.85  ? 6   GLN L CG  1 
ATOM   3260 C  CD  . GLN C 3 6   ? 35.616 1.071   -20.981 1.00 57.12  ? 6   GLN L CD  1 
ATOM   3261 O  OE1 . GLN C 3 6   ? 34.513 0.945   -21.511 1.00 48.53  ? 6   GLN L OE1 1 
ATOM   3262 N  NE2 . GLN C 3 6   ? 35.845 0.710   -19.736 1.00 50.48  ? 6   GLN L NE2 1 
ATOM   3263 N  N   . SER C 3 7   ? 39.965 2.007   -23.215 1.00 38.07  ? 7   SER L N   1 
ATOM   3264 C  CA  . SER C 3 7   ? 41.315 1.491   -23.165 1.00 38.25  ? 7   SER L CA  1 
ATOM   3265 C  C   . SER C 3 7   ? 41.812 1.201   -21.740 1.00 40.97  ? 7   SER L C   1 
ATOM   3266 O  O   . SER C 3 7   ? 41.644 2.043   -20.863 1.00 39.97  ? 7   SER L O   1 
ATOM   3267 C  CB  . SER C 3 7   ? 42.257 2.442   -23.888 1.00 42.57  ? 7   SER L CB  1 
ATOM   3268 O  OG  . SER C 3 7   ? 43.533 1.831   -23.887 1.00 53.33  ? 7   SER L OG  1 
ATOM   3269 N  N   . PRO C 3 8   ? 42.431 0.030   -21.484 1.00 37.33  ? 8   PRO L N   1 
ATOM   3270 C  CA  . PRO C 3 8   ? 42.713 -1.057  -22.436 1.00 37.87  ? 8   PRO L CA  1 
ATOM   3271 C  C   . PRO C 3 8   ? 41.607 -2.105  -22.444 1.00 41.56  ? 8   PRO L C   1 
ATOM   3272 O  O   . PRO C 3 8   ? 40.610 -1.917  -21.757 1.00 40.42  ? 8   PRO L O   1 
ATOM   3273 C  CB  . PRO C 3 8   ? 44.028 -1.619  -21.905 1.00 40.25  ? 8   PRO L CB  1 
ATOM   3274 C  CG  . PRO C 3 8   ? 43.958 -1.402  -20.411 1.00 43.88  ? 8   PRO L CG  1 
ATOM   3275 C  CD  . PRO C 3 8   ? 42.994 -0.271  -20.152 1.00 38.41  ? 8   PRO L CD  1 
ATOM   3276 N  N   . ALA C 3 9   ? 41.767 -3.187  -23.226 1.00 39.04  ? 9   ALA L N   1 
ATOM   3277 C  CA  . ALA C 3 9   ? 40.796 -4.282  -23.281 1.00 39.17  ? 9   ALA L CA  1 
ATOM   3278 C  C   . ALA C 3 9   ? 40.747 -4.953  -21.906 1.00 42.76  ? 9   ALA L C   1 
ATOM   3279 O  O   . ALA C 3 9   ? 39.670 -5.240  -21.388 1.00 42.06  ? 9   ALA L O   1 
ATOM   3280 C  CB  . ALA C 3 9   ? 41.198 -5.290  -24.348 1.00 41.30  ? 9   ALA L CB  1 
ATOM   3281 N  N   . SER C 3 10  ? 41.926 -5.163  -21.304 1.00 39.41  ? 10  SER L N   1 
ATOM   3282 C  CA  . SER C 3 10  ? 42.077 -5.749  -19.980 1.00 39.04  ? 10  SER L CA  1 
ATOM   3283 C  C   . SER C 3 10  ? 43.381 -5.303  -19.324 1.00 42.53  ? 10  SER L C   1 
ATOM   3284 O  O   . SER C 3 10  ? 44.326 -4.928  -20.011 1.00 42.33  ? 10  SER L O   1 
ATOM   3285 C  CB  . SER C 3 10  ? 42.001 -7.270  -20.043 1.00 43.80  ? 10  SER L CB  1 
ATOM   3286 O  OG  . SER C 3 10  ? 43.204 -7.852  -20.519 1.00 53.88  ? 10  SER L OG  1 
ATOM   3287 N  N   . LEU C 3 11  ? 43.433 -5.348  -17.991 1.00 38.66  ? 11  LEU L N   1 
ATOM   3288 C  CA  . LEU C 3 11  ? 44.618 -4.973  -17.226 1.00 38.70  ? 11  LEU L CA  1 
ATOM   3289 C  C   . LEU C 3 11  ? 44.666 -5.660  -15.862 1.00 42.94  ? 11  LEU L C   1 
ATOM   3290 O  O   . LEU C 3 11  ? 43.653 -6.152  -15.373 1.00 42.26  ? 11  LEU L O   1 
ATOM   3291 C  CB  . LEU C 3 11  ? 44.743 -3.439  -17.092 1.00 37.84  ? 11  LEU L CB  1 
ATOM   3292 C  CG  . LEU C 3 11  ? 43.961 -2.717  -15.991 1.00 41.43  ? 11  LEU L CG  1 
ATOM   3293 C  CD1 . LEU C 3 11  ? 44.491 -1.315  -15.806 1.00 41.25  ? 11  LEU L CD1 1 
ATOM   3294 C  CD2 . LEU C 3 11  ? 42.492 -2.638  -16.309 1.00 43.24  ? 11  LEU L CD2 1 
ATOM   3295 N  N   . SER C 3 12  ? 45.858 -5.719  -15.273 1.00 40.23  ? 12  SER L N   1 
ATOM   3296 C  CA  . SER C 3 12  ? 46.048 -6.334  -13.969 1.00 40.46  ? 12  SER L CA  1 
ATOM   3297 C  C   . SER C 3 12  ? 46.946 -5.493  -13.072 1.00 44.34  ? 12  SER L C   1 
ATOM   3298 O  O   . SER C 3 12  ? 47.810 -4.761  -13.553 1.00 43.95  ? 12  SER L O   1 
ATOM   3299 C  CB  . SER C 3 12  ? 46.597 -7.749  -14.107 1.00 45.54  ? 12  SER L CB  1 
ATOM   3300 O  OG  . SER C 3 12  ? 48.013 -7.763  -14.219 1.00 55.78  ? 12  SER L OG  1 
ATOM   3301 N  N   . ALA C 3 13  ? 46.727 -5.600  -11.762 1.00 41.14  ? 13  ALA L N   1 
ATOM   3302 C  CA  . ALA C 3 13  ? 47.498 -4.897  -10.745 1.00 41.31  ? 13  ALA L CA  1 
ATOM   3303 C  C   . ALA C 3 13  ? 47.395 -5.607  -9.401  1.00 45.91  ? 13  ALA L C   1 
ATOM   3304 O  O   . ALA C 3 13  ? 46.591 -6.519  -9.231  1.00 45.60  ? 13  ALA L O   1 
ATOM   3305 C  CB  . ALA C 3 13  ? 47.031 -3.457  -10.616 1.00 40.88  ? 13  ALA L CB  1 
ATOM   3306 N  N   . SER C 3 14  ? 48.229 -5.192  -8.452  1.00 43.11  ? 14  SER L N   1 
ATOM   3307 C  CA  . SER C 3 14  ? 48.236 -5.753  -7.111  1.00 43.74  ? 14  SER L CA  1 
ATOM   3308 C  C   . SER C 3 14  ? 47.486 -4.831  -6.160  1.00 46.86  ? 14  SER L C   1 
ATOM   3309 O  O   . SER C 3 14  ? 47.233 -3.678  -6.499  1.00 45.52  ? 14  SER L O   1 
ATOM   3310 C  CB  . SER C 3 14  ? 49.664 -5.975  -6.631  1.00 48.79  ? 14  SER L CB  1 
ATOM   3311 O  OG  . SER C 3 14  ? 50.276 -7.043  -7.338  1.00 57.90  ? 14  SER L OG  1 
ATOM   3312 N  N   . VAL C 3 15  ? 47.117 -5.349  -4.978  1.00 44.13  ? 15  VAL L N   1 
ATOM   3313 C  CA  . VAL C 3 15  ? 46.400 -4.603  -3.948  1.00 43.44  ? 15  VAL L CA  1 
ATOM   3314 C  C   . VAL C 3 15  ? 47.237 -3.390  -3.524  1.00 47.59  ? 15  VAL L C   1 
ATOM   3315 O  O   . VAL C 3 15  ? 48.441 -3.507  -3.292  1.00 48.42  ? 15  VAL L O   1 
ATOM   3316 C  CB  . VAL C 3 15  ? 46.027 -5.507  -2.736  1.00 48.38  ? 15  VAL L CB  1 
ATOM   3317 C  CG1 . VAL C 3 15  ? 45.382 -4.711  -1.611  1.00 48.00  ? 15  VAL L CG1 1 
ATOM   3318 C  CG2 . VAL C 3 15  ? 45.108 -6.643  -3.156  1.00 48.14  ? 15  VAL L CG2 1 
ATOM   3319 N  N   . GLY C 3 16  ? 46.590 -2.236  -3.494  1.00 43.31  ? 16  GLY L N   1 
ATOM   3320 C  CA  . GLY C 3 16  ? 47.226 -0.972  -3.130  1.00 43.53  ? 16  GLY L CA  1 
ATOM   3321 C  C   . GLY C 3 16  ? 47.768 -0.180  -4.299  1.00 47.13  ? 16  GLY L C   1 
ATOM   3322 O  O   . GLY C 3 16  ? 48.143 0.987   -4.139  1.00 46.94  ? 16  GLY L O   1 
ATOM   3323 N  N   . GLU C 3 17  ? 47.824 -0.802  -5.483  1.00 43.36  ? 17  GLU L N   1 
ATOM   3324 C  CA  . GLU C 3 17  ? 48.321 -0.161  -6.697  1.00 42.96  ? 17  GLU L CA  1 
ATOM   3325 C  C   . GLU C 3 17  ? 47.271 0.747   -7.331  1.00 45.59  ? 17  GLU L C   1 
ATOM   3326 O  O   . GLU C 3 17  ? 46.096 0.669   -6.995  1.00 44.17  ? 17  GLU L O   1 
ATOM   3327 C  CB  . GLU C 3 17  ? 48.831 -1.202  -7.699  1.00 44.74  ? 17  GLU L CB  1 
ATOM   3328 C  CG  . GLU C 3 17  ? 50.078 -1.946  -7.243  1.00 57.08  ? 17  GLU L CG  1 
ATOM   3329 C  CD  . GLU C 3 17  ? 50.712 -2.824  -8.296  1.00 78.00  ? 17  GLU L CD  1 
ATOM   3330 O  OE1 . GLU C 3 17  ? 50.413 -2.637  -9.495  1.00 72.26  ? 17  GLU L OE1 1 
ATOM   3331 O  OE2 . GLU C 3 17  ? 51.545 -3.680  -7.930  1.00 72.82  ? 17  GLU L OE2 1 
ATOM   3332 N  N   . THR C 3 18  ? 47.702 1.615   -8.240  1.00 42.34  ? 18  THR L N   1 
ATOM   3333 C  CA  . THR C 3 18  ? 46.827 2.546   -8.930  1.00 41.25  ? 18  THR L CA  1 
ATOM   3334 C  C   . THR C 3 18  ? 46.703 2.121   -10.380 1.00 45.02  ? 18  THR L C   1 
ATOM   3335 O  O   . THR C 3 18  ? 47.693 1.742   -10.998 1.00 45.21  ? 18  THR L O   1 
ATOM   3336 C  CB  . THR C 3 18  ? 47.377 3.971   -8.830  1.00 50.53  ? 18  THR L CB  1 
ATOM   3337 O  OG1 . THR C 3 18  ? 47.538 4.307   -7.455  1.00 51.46  ? 18  THR L OG1 1 
ATOM   3338 C  CG2 . THR C 3 18  ? 46.465 5.000   -9.508  1.00 48.47  ? 18  THR L CG2 1 
ATOM   3339 N  N   . VAL C 3 19  ? 45.474 2.151   -10.904 1.00 40.98  ? 19  VAL L N   1 
ATOM   3340 C  CA  . VAL C 3 19  ? 45.180 1.824   -12.299 1.00 40.70  ? 19  VAL L CA  1 
ATOM   3341 C  C   . VAL C 3 19  ? 44.335 2.927   -12.931 1.00 44.25  ? 19  VAL L C   1 
ATOM   3342 O  O   . VAL C 3 19  ? 43.494 3.517   -12.265 1.00 43.40  ? 19  VAL L O   1 
ATOM   3343 C  CB  . VAL C 3 19  ? 44.536 0.428   -12.513 1.00 44.40  ? 19  VAL L CB  1 
ATOM   3344 C  CG1 . VAL C 3 19  ? 45.389 -0.677  -11.915 1.00 45.20  ? 19  VAL L CG1 1 
ATOM   3345 C  CG2 . VAL C 3 19  ? 43.109 0.362   -11.989 1.00 43.40  ? 19  VAL L CG2 1 
ATOM   3346 N  N   . THR C 3 20  ? 44.587 3.232   -14.205 1.00 41.14  ? 20  THR L N   1 
ATOM   3347 C  CA  . THR C 3 20  ? 43.821 4.249   -14.908 1.00 40.55  ? 20  THR L CA  1 
ATOM   3348 C  C   . THR C 3 20  ? 43.188 3.648   -16.155 1.00 44.16  ? 20  THR L C   1 
ATOM   3349 O  O   . THR C 3 20  ? 43.860 2.982   -16.937 1.00 44.30  ? 20  THR L O   1 
ATOM   3350 C  CB  . THR C 3 20  ? 44.648 5.507   -15.210 1.00 49.80  ? 20  THR L CB  1 
ATOM   3351 O  OG1 . THR C 3 20  ? 45.472 5.811   -14.086 1.00 50.47  ? 20  THR L OG1 1 
ATOM   3352 C  CG2 . THR C 3 20  ? 43.758 6.709   -15.527 1.00 48.38  ? 20  THR L CG2 1 
ATOM   3353 N  N   . ILE C 3 21  ? 41.879 3.864   -16.314 1.00 40.02  ? 21  ILE L N   1 
ATOM   3354 C  CA  . ILE C 3 21  ? 41.110 3.407   -17.463 1.00 39.67  ? 21  ILE L CA  1 
ATOM   3355 C  C   . ILE C 3 21  ? 40.698 4.650   -18.238 1.00 43.13  ? 21  ILE L C   1 
ATOM   3356 O  O   . ILE C 3 21  ? 40.146 5.583   -17.665 1.00 42.39  ? 21  ILE L O   1 
ATOM   3357 C  CB  . ILE C 3 21  ? 39.869 2.569   -17.061 1.00 42.55  ? 21  ILE L CB  1 
ATOM   3358 C  CG1 . ILE C 3 21  ? 40.253 1.425   -16.105 1.00 43.21  ? 21  ILE L CG1 1 
ATOM   3359 C  CG2 . ILE C 3 21  ? 39.140 2.037   -18.311 1.00 43.61  ? 21  ILE L CG2 1 
ATOM   3360 C  CD1 . ILE C 3 21  ? 39.097 0.658   -15.500 1.00 50.12  ? 21  ILE L CD1 1 
ATOM   3361 N  N   . THR C 3 22  ? 40.998 4.676   -19.533 1.00 40.10  ? 22  THR L N   1 
ATOM   3362 C  CA  . THR C 3 22  ? 40.663 5.820   -20.370 1.00 40.08  ? 22  THR L CA  1 
ATOM   3363 C  C   . THR C 3 22  ? 39.536 5.543   -21.337 1.00 44.18  ? 22  THR L C   1 
ATOM   3364 O  O   . THR C 3 22  ? 39.420 4.441   -21.868 1.00 43.86  ? 22  THR L O   1 
ATOM   3365 C  CB  . THR C 3 22  ? 41.889 6.375   -21.102 1.00 47.90  ? 22  THR L CB  1 
ATOM   3366 O  OG1 . THR C 3 22  ? 42.572 5.310   -21.754 1.00 47.57  ? 22  THR L OG1 1 
ATOM   3367 C  CG2 . THR C 3 22  ? 42.837 7.098   -20.161 1.00 46.80  ? 22  THR L CG2 1 
ATOM   3368 N  N   . CYS C 3 23  ? 38.700 6.552   -21.544 1.00 41.25  ? 23  CYS L N   1 
ATOM   3369 C  CA  . CYS C 3 23  ? 37.578 6.522   -22.457 1.00 41.32  ? 23  CYS L CA  1 
ATOM   3370 C  C   . CYS C 3 23  ? 37.645 7.689   -23.415 1.00 44.99  ? 23  CYS L C   1 
ATOM   3371 O  O   . CYS C 3 23  ? 37.801 8.830   -22.993 1.00 44.63  ? 23  CYS L O   1 
ATOM   3372 C  CB  . CYS C 3 23  ? 36.269 6.520   -21.692 1.00 41.41  ? 23  CYS L CB  1 
ATOM   3373 S  SG  . CYS C 3 23  ? 34.824 6.740   -22.759 1.00 45.99  ? 23  CYS L SG  1 
ATOM   3374 N  N   . ARG C 3 24  ? 37.506 7.403   -24.711 1.00 41.73  ? 24  ARG L N   1 
ATOM   3375 C  CA  . ARG C 3 24  ? 37.516 8.418   -25.753 1.00 42.20  ? 24  ARG L CA  1 
ATOM   3376 C  C   . ARG C 3 24  ? 36.212 8.402   -26.546 1.00 45.64  ? 24  ARG L C   1 
ATOM   3377 O  O   . ARG C 3 24  ? 35.759 7.346   -26.974 1.00 45.42  ? 24  ARG L O   1 
ATOM   3378 C  CB  . ARG C 3 24  ? 38.727 8.251   -26.678 1.00 43.62  ? 24  ARG L CB  1 
ATOM   3379 C  CG  . ARG C 3 24  ? 38.736 9.236   -27.852 1.00 58.15  ? 24  ARG L CG  1 
ATOM   3380 C  CD  . ARG C 3 24  ? 39.987 9.167   -28.702 1.00 74.86  ? 24  ARG L CD  1 
ATOM   3381 N  NE  . ARG C 3 24  ? 40.256 7.817   -29.206 1.00 88.94  ? 24  ARG L NE  1 
ATOM   3382 C  CZ  . ARG C 3 24  ? 41.340 7.110   -28.908 1.00 105.87 ? 24  ARG L CZ  1 
ATOM   3383 N  NH1 . ARG C 3 24  ? 42.281 7.621   -28.120 1.00 94.28  ? 24  ARG L NH1 1 
ATOM   3384 N  NH2 . ARG C 3 24  ? 41.500 5.889   -29.400 1.00 93.69  ? 24  ARG L NH2 1 
ATOM   3385 N  N   . ALA C 3 25  ? 35.610 9.577   -26.727 1.00 41.89  ? 25  ALA L N   1 
ATOM   3386 C  CA  . ALA C 3 25  ? 34.362 9.723   -27.469 1.00 41.94  ? 25  ALA L CA  1 
ATOM   3387 C  C   . ALA C 3 25  ? 34.594 10.286  -28.871 1.00 46.30  ? 25  ALA L C   1 
ATOM   3388 O  O   . ALA C 3 25  ? 35.503 11.088  -29.069 1.00 46.34  ? 25  ALA L O   1 
ATOM   3389 C  CB  . ALA C 3 25  ? 33.401 10.609  -26.699 1.00 42.55  ? 25  ALA L CB  1 
ATOM   3390 N  N   . SER C 3 26  ? 33.772 9.847   -29.845 1.00 43.18  ? 26  SER L N   1 
ATOM   3391 C  CA  . SER C 3 26  ? 33.832 10.278  -31.248 1.00 44.25  ? 26  SER L CA  1 
ATOM   3392 C  C   . SER C 3 26  ? 33.562 11.778  -31.384 1.00 48.56  ? 26  SER L C   1 
ATOM   3393 O  O   . SER C 3 26  ? 34.202 12.455  -32.189 1.00 49.22  ? 26  SER L O   1 
ATOM   3394 C  CB  . SER C 3 26  ? 32.847 9.486   -32.096 1.00 48.37  ? 26  SER L CB  1 
ATOM   3395 O  OG  . SER C 3 26  ? 31.501 9.860   -31.832 1.00 57.42  ? 26  SER L OG  1 
ATOM   3396 N  N   . GLY C 3 27  ? 32.629 12.266  -30.577 1.00 44.28  ? 27  GLY L N   1 
ATOM   3397 C  CA  . GLY C 3 27  ? 32.251 13.671  -30.516 1.00 44.71  ? 27  GLY L CA  1 
ATOM   3398 C  C   . GLY C 3 27  ? 32.247 14.159  -29.093 1.00 47.16  ? 27  GLY L C   1 
ATOM   3399 O  O   . GLY C 3 27  ? 32.284 13.353  -28.158 1.00 45.48  ? 27  GLY L O   1 
ATOM   3400 N  N   . ASN C 3 28  ? 32.213 15.484  -28.889 1.00 44.34  ? 28  ASN L N   1 
ATOM   3401 C  CA  . ASN C 3 28  ? 32.179 16.084  -27.557 1.00 43.47  ? 28  ASN L CA  1 
ATOM   3402 C  C   . ASN C 3 28  ? 30.878 15.687  -26.861 1.00 46.34  ? 28  ASN L C   1 
ATOM   3403 O  O   . ASN C 3 28  ? 29.801 15.828  -27.438 1.00 46.66  ? 28  ASN L O   1 
ATOM   3404 C  CB  . ASN C 3 28  ? 32.291 17.605  -27.667 1.00 45.48  ? 28  ASN L CB  1 
ATOM   3405 C  CG  . ASN C 3 28  ? 32.366 18.341  -26.346 1.00 67.61  ? 28  ASN L CG  1 
ATOM   3406 O  OD1 . ASN C 3 28  ? 32.132 17.784  -25.271 1.00 61.64  ? 28  ASN L OD1 1 
ATOM   3407 N  ND2 . ASN C 3 28  ? 32.691 19.625  -26.408 1.00 59.60  ? 28  ASN L ND2 1 
ATOM   3408 N  N   . ILE C 3 29  ? 30.992 15.133  -25.646 1.00 41.42  ? 29  ILE L N   1 
ATOM   3409 C  CA  . ILE C 3 29  ? 29.823 14.679  -24.879 1.00 40.74  ? 29  ILE L CA  1 
ATOM   3410 C  C   . ILE C 3 29  ? 29.484 15.610  -23.703 1.00 44.77  ? 29  ILE L C   1 
ATOM   3411 O  O   . ILE C 3 29  ? 28.577 15.329  -22.933 1.00 44.19  ? 29  ILE L O   1 
ATOM   3412 C  CB  . ILE C 3 29  ? 29.924 13.196  -24.442 1.00 42.64  ? 29  ILE L CB  1 
ATOM   3413 C  CG1 . ILE C 3 29  ? 31.133 12.949  -23.518 1.00 42.11  ? 29  ILE L CG1 1 
ATOM   3414 C  CG2 . ILE C 3 29  ? 29.959 12.281  -25.665 1.00 43.59  ? 29  ILE L CG2 1 
ATOM   3415 C  CD1 . ILE C 3 29  ? 31.217 11.580  -22.913 1.00 48.19  ? 29  ILE L CD1 1 
ATOM   3416 N  N   . HIS C 3 30  ? 30.194 16.737  -23.604 1.00 41.88  ? 30  HIS L N   1 
ATOM   3417 C  CA  . HIS C 3 30  ? 29.997 17.814  -22.624 1.00 42.01  ? 30  HIS L CA  1 
ATOM   3418 C  C   . HIS C 3 30  ? 29.934 17.412  -21.149 1.00 44.26  ? 30  HIS L C   1 
ATOM   3419 O  O   . HIS C 3 30  ? 29.112 17.940  -20.407 1.00 44.32  ? 30  HIS L O   1 
ATOM   3420 C  CB  . HIS C 3 30  ? 28.751 18.619  -23.000 1.00 44.24  ? 30  HIS L CB  1 
ATOM   3421 C  CG  . HIS C 3 30  ? 28.799 19.135  -24.415 1.00 48.96  ? 30  HIS L CG  1 
ATOM   3422 N  ND1 . HIS C 3 30  ? 28.294 18.389  -25.462 1.00 50.86  ? 30  HIS L ND1 1 
ATOM   3423 C  CD2 . HIS C 3 30  ? 29.360 20.257  -24.900 1.00 51.88  ? 30  HIS L CD2 1 
ATOM   3424 C  CE1 . HIS C 3 30  ? 28.513 19.096  -26.547 1.00 51.56  ? 30  HIS L CE1 1 
ATOM   3425 N  NE2 . HIS C 3 30  ? 29.155 20.228  -26.274 1.00 52.59  ? 30  HIS L NE2 1 
ATOM   3426 N  N   . ASN C 3 31  ? 30.806 16.486  -20.734 1.00 39.09  ? 31  ASN L N   1 
ATOM   3427 C  CA  . ASN C 3 31  ? 30.923 15.988  -19.353 1.00 37.83  ? 31  ASN L CA  1 
ATOM   3428 C  C   . ASN C 3 31  ? 29.783 15.060  -18.906 1.00 40.98  ? 31  ASN L C   1 
ATOM   3429 O  O   . ASN C 3 31  ? 29.708 14.696  -17.735 1.00 40.10  ? 31  ASN L O   1 
ATOM   3430 C  CB  . ASN C 3 31  ? 31.110 17.133  -18.357 1.00 38.46  ? 31  ASN L CB  1 
ATOM   3431 C  CG  . ASN C 3 31  ? 32.427 17.849  -18.501 1.00 58.42  ? 31  ASN L CG  1 
ATOM   3432 O  OD1 . ASN C 3 31  ? 33.494 17.238  -18.534 1.00 50.78  ? 31  ASN L OD1 1 
ATOM   3433 N  ND2 . ASN C 3 31  ? 32.375 19.167  -18.539 1.00 52.24  ? 31  ASN L ND2 1 
ATOM   3434 N  N   . PHE C 3 32  ? 28.910 14.662  -19.837 1.00 37.43  ? 32  PHE L N   1 
ATOM   3435 C  CA  . PHE C 3 32  ? 27.801 13.767  -19.542 1.00 36.80  ? 32  PHE L CA  1 
ATOM   3436 C  C   . PHE C 3 32  ? 28.296 12.331  -19.707 1.00 39.72  ? 32  PHE L C   1 
ATOM   3437 O  O   . PHE C 3 32  ? 27.912 11.625  -20.638 1.00 39.30  ? 32  PHE L O   1 
ATOM   3438 C  CB  . PHE C 3 32  ? 26.615 14.068  -20.467 1.00 39.51  ? 32  PHE L CB  1 
ATOM   3439 C  CG  . PHE C 3 32  ? 25.748 15.234  -20.074 1.00 42.04  ? 32  PHE L CG  1 
ATOM   3440 C  CD1 . PHE C 3 32  ? 26.310 16.464  -19.764 1.00 45.60  ? 32  PHE L CD1 1 
ATOM   3441 C  CD2 . PHE C 3 32  ? 24.366 15.117  -20.064 1.00 44.81  ? 32  PHE L CD2 1 
ATOM   3442 C  CE1 . PHE C 3 32  ? 25.514 17.537  -19.406 1.00 47.68  ? 32  PHE L CE1 1 
ATOM   3443 C  CE2 . PHE C 3 32  ? 23.568 16.191  -19.710 1.00 48.83  ? 32  PHE L CE2 1 
ATOM   3444 C  CZ  . PHE C 3 32  ? 24.145 17.400  -19.388 1.00 47.44  ? 32  PHE L CZ  1 
ATOM   3445 N  N   . LEU C 3 33  ? 29.183 11.913  -18.807 1.00 35.61  ? 33  LEU L N   1 
ATOM   3446 C  CA  . LEU C 3 33  ? 29.768 10.581  -18.834 1.00 34.47  ? 33  LEU L CA  1 
ATOM   3447 C  C   . LEU C 3 33  ? 29.669 9.895   -17.478 1.00 37.18  ? 33  LEU L C   1 
ATOM   3448 O  O   . LEU C 3 33  ? 29.754 10.548  -16.444 1.00 36.78  ? 33  LEU L O   1 
ATOM   3449 C  CB  . LEU C 3 33  ? 31.226 10.658  -19.313 1.00 34.30  ? 33  LEU L CB  1 
ATOM   3450 C  CG  . LEU C 3 33  ? 32.068 9.382   -19.212 1.00 38.50  ? 33  LEU L CG  1 
ATOM   3451 C  CD1 . LEU C 3 33  ? 32.808 9.101   -20.492 1.00 38.94  ? 33  LEU L CD1 1 
ATOM   3452 C  CD2 . LEU C 3 33  ? 33.041 9.474   -18.068 1.00 40.52  ? 33  LEU L CD2 1 
ATOM   3453 N  N   . ALA C 3 34  ? 29.480 8.574   -17.493 1.00 33.18  ? 34  ALA L N   1 
ATOM   3454 C  CA  . ALA C 3 34  ? 29.386 7.771   -16.281 1.00 32.57  ? 34  ALA L CA  1 
ATOM   3455 C  C   . ALA C 3 34  ? 30.277 6.532   -16.335 1.00 36.05  ? 34  ALA L C   1 
ATOM   3456 O  O   . ALA C 3 34  ? 30.529 5.998   -17.406 1.00 35.64  ? 34  ALA L O   1 
ATOM   3457 C  CB  . ALA C 3 34  ? 27.943 7.373   -16.023 1.00 33.80  ? 34  ALA L CB  1 
ATOM   3458 N  N   . TRP C 3 35  ? 30.759 6.092   -15.167 1.00 32.34  ? 35  TRP L N   1 
ATOM   3459 C  CA  . TRP C 3 35  ? 31.607 4.914   -15.009 1.00 31.84  ? 35  TRP L CA  1 
ATOM   3460 C  C   . TRP C 3 35  ? 30.886 3.867   -14.174 1.00 35.95  ? 35  TRP L C   1 
ATOM   3461 O  O   . TRP C 3 35  ? 30.282 4.184   -13.151 1.00 35.60  ? 35  TRP L O   1 
ATOM   3462 C  CB  . TRP C 3 35  ? 32.944 5.275   -14.361 1.00 30.32  ? 35  TRP L CB  1 
ATOM   3463 C  CG  . TRP C 3 35  ? 33.886 5.980   -15.276 1.00 31.17  ? 35  TRP L CG  1 
ATOM   3464 C  CD1 . TRP C 3 35  ? 34.148 7.316   -15.305 1.00 34.36  ? 35  TRP L CD1 1 
ATOM   3465 C  CD2 . TRP C 3 35  ? 34.677 5.394   -16.311 1.00 31.06  ? 35  TRP L CD2 1 
ATOM   3466 N  NE1 . TRP C 3 35  ? 35.083 7.595   -16.266 1.00 33.91  ? 35  TRP L NE1 1 
ATOM   3467 C  CE2 . TRP C 3 35  ? 35.410 6.440   -16.917 1.00 35.15  ? 35  TRP L CE2 1 
ATOM   3468 C  CE3 . TRP C 3 35  ? 34.856 4.084   -16.779 1.00 32.34  ? 35  TRP L CE3 1 
ATOM   3469 C  CZ2 . TRP C 3 35  ? 36.305 6.222   -17.957 1.00 34.61  ? 35  TRP L CZ2 1 
ATOM   3470 C  CZ3 . TRP C 3 35  ? 35.748 3.871   -17.816 1.00 33.97  ? 35  TRP L CZ3 1 
ATOM   3471 C  CH2 . TRP C 3 35  ? 36.457 4.935   -18.392 1.00 34.80  ? 35  TRP L CH2 1 
ATOM   3472 N  N   . TYR C 3 36  ? 30.927 2.619   -14.634 1.00 32.69  ? 36  TYR L N   1 
ATOM   3473 C  CA  . TYR C 3 36  ? 30.257 1.506   -13.978 1.00 32.95  ? 36  TYR L CA  1 
ATOM   3474 C  C   . TYR C 3 36  ? 31.202 0.345   -13.768 1.00 37.43  ? 36  TYR L C   1 
ATOM   3475 O  O   . TYR C 3 36  ? 32.112 0.112   -14.557 1.00 37.02  ? 36  TYR L O   1 
ATOM   3476 C  CB  . TYR C 3 36  ? 29.069 1.002   -14.816 1.00 34.68  ? 36  TYR L CB  1 
ATOM   3477 C  CG  . TYR C 3 36  ? 28.035 2.055   -15.121 1.00 36.40  ? 36  TYR L CG  1 
ATOM   3478 C  CD1 . TYR C 3 36  ? 26.956 2.264   -14.271 1.00 38.87  ? 36  TYR L CD1 1 
ATOM   3479 C  CD2 . TYR C 3 36  ? 28.125 2.832   -16.265 1.00 37.03  ? 36  TYR L CD2 1 
ATOM   3480 C  CE1 . TYR C 3 36  ? 26.014 3.242   -14.534 1.00 40.03  ? 36  TYR L CE1 1 
ATOM   3481 C  CE2 . TYR C 3 36  ? 27.188 3.812   -16.542 1.00 38.39  ? 36  TYR L CE2 1 
ATOM   3482 C  CZ  . TYR C 3 36  ? 26.132 4.012   -15.674 1.00 46.19  ? 36  TYR L CZ  1 
ATOM   3483 O  OH  . TYR C 3 36  ? 25.205 4.970   -15.942 1.00 47.45  ? 36  TYR L OH  1 
ATOM   3484 N  N   . GLN C 3 37  ? 30.966 -0.397  -12.693 1.00 34.57  ? 37  GLN L N   1 
ATOM   3485 C  CA  . GLN C 3 37  ? 31.725 -1.585  -12.373 1.00 34.69  ? 37  GLN L CA  1 
ATOM   3486 C  C   . GLN C 3 37  ? 30.769 -2.757  -12.372 1.00 39.92  ? 37  GLN L C   1 
ATOM   3487 O  O   . GLN C 3 37  ? 29.709 -2.699  -11.759 1.00 40.06  ? 37  GLN L O   1 
ATOM   3488 C  CB  . GLN C 3 37  ? 32.385 -1.452  -11.006 1.00 35.86  ? 37  GLN L CB  1 
ATOM   3489 C  CG  . GLN C 3 37  ? 33.184 -2.686  -10.608 1.00 48.11  ? 37  GLN L CG  1 
ATOM   3490 C  CD  . GLN C 3 37  ? 33.207 -2.878  -9.124  1.00 65.77  ? 37  GLN L CD  1 
ATOM   3491 O  OE1 . GLN C 3 37  ? 32.165 -2.981  -8.478  1.00 62.46  ? 37  GLN L OE1 1 
ATOM   3492 N  NE2 . GLN C 3 37  ? 34.395 -2.947  -8.561  1.00 56.17  ? 37  GLN L NE2 1 
ATOM   3493 N  N   . GLN C 3 38  ? 31.139 -3.812  -13.077 1.00 37.20  ? 38  GLN L N   1 
ATOM   3494 C  CA  . GLN C 3 38  ? 30.332 -5.007  -13.147 1.00 38.39  ? 38  GLN L CA  1 
ATOM   3495 C  C   . GLN C 3 38  ? 31.105 -6.247  -12.739 1.00 44.15  ? 38  GLN L C   1 
ATOM   3496 O  O   . GLN C 3 38  ? 32.114 -6.601  -13.348 1.00 43.62  ? 38  GLN L O   1 
ATOM   3497 C  CB  . GLN C 3 38  ? 29.737 -5.182  -14.545 1.00 39.94  ? 38  GLN L CB  1 
ATOM   3498 C  CG  . GLN C 3 38  ? 28.788 -6.371  -14.645 1.00 50.08  ? 38  GLN L CG  1 
ATOM   3499 C  CD  . GLN C 3 38  ? 28.142 -6.535  -15.997 1.00 66.97  ? 38  GLN L CD  1 
ATOM   3500 O  OE1 . GLN C 3 38  ? 28.723 -6.221  -17.035 1.00 61.05  ? 38  GLN L OE1 1 
ATOM   3501 N  NE2 . GLN C 3 38  ? 26.934 -7.071  -16.003 1.00 61.10  ? 38  GLN L NE2 1 
ATOM   3502 N  N   . LYS C 3 39  ? 30.630 -6.891  -11.677 1.00 42.46  ? 39  LYS L N   1 
ATOM   3503 C  CA  . LYS C 3 39  ? 31.190 -8.143  -11.194 1.00 43.65  ? 39  LYS L CA  1 
ATOM   3504 C  C   . LYS C 3 39  ? 30.576 -9.211  -12.082 1.00 49.71  ? 39  LYS L C   1 
ATOM   3505 O  O   . LYS C 3 39  ? 29.464 -9.022  -12.573 1.00 49.50  ? 39  LYS L O   1 
ATOM   3506 C  CB  . LYS C 3 39  ? 30.794 -8.383  -9.735  1.00 46.78  ? 39  LYS L CB  1 
ATOM   3507 C  CG  . LYS C 3 39  ? 31.361 -7.359  -8.775  1.00 59.40  ? 39  LYS L CG  1 
ATOM   3508 C  CD  . LYS C 3 39  ? 32.726 -7.753  -8.254  1.00 68.75  ? 39  LYS L CD  1 
ATOM   3509 C  CE  . LYS C 3 39  ? 33.208 -6.742  -7.256  1.00 77.94  ? 39  LYS L CE  1 
ATOM   3510 N  NZ  . LYS C 3 39  ? 32.230 -6.494  -6.159  1.00 86.62  ? 39  LYS L NZ  1 
ATOM   3511 N  N   . GLN C 3 40  ? 31.293 -10.319 -12.303 1.00 48.05  ? 40  GLN L N   1 
ATOM   3512 C  CA  . GLN C 3 40  ? 30.812 -11.406 -13.150 1.00 49.80  ? 40  GLN L CA  1 
ATOM   3513 C  C   . GLN C 3 40  ? 29.478 -11.970 -12.665 1.00 55.69  ? 40  GLN L C   1 
ATOM   3514 O  O   . GLN C 3 40  ? 29.329 -12.290 -11.486 1.00 55.89  ? 40  GLN L O   1 
ATOM   3515 C  CB  . GLN C 3 40  ? 31.869 -12.516 -13.262 1.00 52.30  ? 40  GLN L CB  1 
ATOM   3516 C  CG  . GLN C 3 40  ? 31.433 -13.745 -14.079 1.00 72.11  ? 40  GLN L CG  1 
ATOM   3517 C  CD  . GLN C 3 40  ? 31.232 -13.498 -15.562 1.00 92.73  ? 40  GLN L CD  1 
ATOM   3518 O  OE1 . GLN C 3 40  ? 31.749 -12.538 -16.139 1.00 86.76  ? 40  GLN L OE1 1 
ATOM   3519 N  NE2 . GLN C 3 40  ? 30.512 -14.402 -16.213 1.00 87.21  ? 40  GLN L NE2 1 
ATOM   3520 N  N   . GLY C 3 41  ? 28.522 -12.033 -13.587 1.00 53.37  ? 41  GLY L N   1 
ATOM   3521 C  CA  . GLY C 3 41  ? 27.168 -12.530 -13.336 1.00 54.93  ? 41  GLY L CA  1 
ATOM   3522 C  C   . GLY C 3 41  ? 26.291 -11.613 -12.512 1.00 58.61  ? 41  GLY L C   1 
ATOM   3523 O  O   . GLY C 3 41  ? 25.257 -12.044 -11.994 1.00 59.65  ? 41  GLY L O   1 
ATOM   3524 N  N   . LYS C 3 42  ? 26.697 -10.351 -12.363 1.00 53.35  ? 42  LYS L N   1 
ATOM   3525 C  CA  . LYS C 3 42  ? 25.966 -9.361  -11.581 1.00 52.61  ? 42  LYS L CA  1 
ATOM   3526 C  C   . LYS C 3 42  ? 25.684 -8.123  -12.409 1.00 55.09  ? 42  LYS L C   1 
ATOM   3527 O  O   . LYS C 3 42  ? 26.363 -7.877  -13.401 1.00 54.08  ? 42  LYS L O   1 
ATOM   3528 C  CB  . LYS C 3 42  ? 26.784 -8.954  -10.351 1.00 54.38  ? 42  LYS L CB  1 
ATOM   3529 C  CG  . LYS C 3 42  ? 27.071 -10.071 -9.365  1.00 70.63  ? 42  LYS L CG  1 
ATOM   3530 C  CD  . LYS C 3 42  ? 25.973 -10.225 -8.331  1.00 82.39  ? 42  LYS L CD  1 
ATOM   3531 C  CE  . LYS C 3 42  ? 26.468 -11.000 -7.137  1.00 93.94  ? 42  LYS L CE  1 
ATOM   3532 N  NZ  . LYS C 3 42  ? 25.437 -11.082 -6.071  1.00 103.62 ? 42  LYS L NZ  1 
ATOM   3533 N  N   . SER C 3 43  ? 24.673 -7.346  -12.002 1.00 51.28  ? 43  SER L N   1 
ATOM   3534 C  CA  . SER C 3 43  ? 24.317 -6.110  -12.680 1.00 50.02  ? 43  SER L CA  1 
ATOM   3535 C  C   . SER C 3 43  ? 25.374 -5.037  -12.384 1.00 51.39  ? 43  SER L C   1 
ATOM   3536 O  O   . SER C 3 43  ? 25.921 -5.018  -11.280 1.00 50.50  ? 43  SER L O   1 
ATOM   3537 C  CB  . SER C 3 43  ? 22.934 -5.635  -12.256 1.00 54.73  ? 43  SER L CB  1 
ATOM   3538 O  OG  . SER C 3 43  ? 22.869 -5.366  -10.865 1.00 64.63  ? 43  SER L OG  1 
ATOM   3539 N  N   . PRO C 3 44  ? 25.671 -4.144  -13.345 1.00 46.45  ? 44  PRO L N   1 
ATOM   3540 C  CA  . PRO C 3 44  ? 26.688 -3.100  -13.105 1.00 44.54  ? 44  PRO L CA  1 
ATOM   3541 C  C   . PRO C 3 44  ? 26.270 -2.077  -12.061 1.00 47.74  ? 44  PRO L C   1 
ATOM   3542 O  O   . PRO C 3 44  ? 25.081 -1.833  -11.881 1.00 47.99  ? 44  PRO L O   1 
ATOM   3543 C  CB  . PRO C 3 44  ? 26.854 -2.443  -14.480 1.00 45.71  ? 44  PRO L CB  1 
ATOM   3544 C  CG  . PRO C 3 44  ? 25.596 -2.721  -15.192 1.00 51.31  ? 44  PRO L CG  1 
ATOM   3545 C  CD  . PRO C 3 44  ? 25.149 -4.073  -14.718 1.00 48.16  ? 44  PRO L CD  1 
ATOM   3546 N  N   . GLN C 3 45  ? 27.251 -1.510  -11.356 1.00 43.25  ? 45  GLN L N   1 
ATOM   3547 C  CA  . GLN C 3 45  ? 27.032 -0.492  -10.332 1.00 42.71  ? 45  GLN L CA  1 
ATOM   3548 C  C   . GLN C 3 45  ? 27.785 0.775   -10.698 1.00 44.90  ? 45  GLN L C   1 
ATOM   3549 O  O   . GLN C 3 45  ? 28.945 0.711   -11.095 1.00 43.95  ? 45  GLN L O   1 
ATOM   3550 C  CB  . GLN C 3 45  ? 27.479 -0.972  -8.941  1.00 44.34  ? 45  GLN L CB  1 
ATOM   3551 C  CG  . GLN C 3 45  ? 26.969 -2.345  -8.504  1.00 62.24  ? 45  GLN L CG  1 
ATOM   3552 C  CD  . GLN C 3 45  ? 25.466 -2.493  -8.343  1.00 85.88  ? 45  GLN L CD  1 
ATOM   3553 O  OE1 . GLN C 3 45  ? 24.660 -1.660  -8.777  1.00 81.52  ? 45  GLN L OE1 1 
ATOM   3554 N  NE2 . GLN C 3 45  ? 25.064 -3.598  -7.733  1.00 80.61  ? 45  GLN L NE2 1 
ATOM   3555 N  N   . VAL C 3 46  ? 27.109 1.925   -10.584 1.00 40.90  ? 46  VAL L N   1 
ATOM   3556 C  CA  . VAL C 3 46  ? 27.682 3.234   -10.881 1.00 39.69  ? 46  VAL L CA  1 
ATOM   3557 C  C   . VAL C 3 46  ? 28.769 3.615   -9.882  1.00 42.26  ? 46  VAL L C   1 
ATOM   3558 O  O   . VAL C 3 46  ? 28.625 3.380   -8.686  1.00 42.26  ? 46  VAL L O   1 
ATOM   3559 C  CB  . VAL C 3 46  ? 26.593 4.343   -11.018 1.00 44.24  ? 46  VAL L CB  1 
ATOM   3560 C  CG1 . VAL C 3 46  ? 25.895 4.616   -9.689  1.00 44.77  ? 46  VAL L CG1 1 
ATOM   3561 C  CG2 . VAL C 3 46  ? 27.170 5.629   -11.601 1.00 43.64  ? 46  VAL L CG2 1 
ATOM   3562 N  N   . LEU C 3 47  ? 29.883 4.138   -10.396 1.00 37.44  ? 47  LEU L N   1 
ATOM   3563 C  CA  . LEU C 3 47  ? 30.988 4.593   -9.572  1.00 36.55  ? 47  LEU L CA  1 
ATOM   3564 C  C   . LEU C 3 47  ? 31.050 6.109   -9.608  1.00 39.82  ? 47  LEU L C   1 
ATOM   3565 O  O   . LEU C 3 47  ? 31.057 6.759   -8.571  1.00 39.60  ? 47  LEU L O   1 
ATOM   3566 C  CB  . LEU C 3 47  ? 32.323 4.030   -10.073 1.00 36.05  ? 47  LEU L CB  1 
ATOM   3567 C  CG  . LEU C 3 47  ? 32.443 2.530   -10.241 1.00 40.66  ? 47  LEU L CG  1 
ATOM   3568 C  CD1 . LEU C 3 47  ? 33.639 2.207   -11.096 1.00 40.47  ? 47  LEU L CD1 1 
ATOM   3569 C  CD2 . LEU C 3 47  ? 32.551 1.835   -8.895  1.00 43.30  ? 47  LEU L CD2 1 
ATOM   3570 N  N   . VAL C 3 48  ? 31.122 6.660   -10.822 1.00 35.90  ? 48  VAL L N   1 
ATOM   3571 C  CA  . VAL C 3 48  ? 31.240 8.089   -11.080 1.00 35.69  ? 48  VAL L CA  1 
ATOM   3572 C  C   . VAL C 3 48  ? 30.243 8.497   -12.163 1.00 39.82  ? 48  VAL L C   1 
ATOM   3573 O  O   . VAL C 3 48  ? 29.984 7.741   -13.087 1.00 39.38  ? 48  VAL L O   1 
ATOM   3574 C  CB  . VAL C 3 48  ? 32.701 8.435   -11.504 1.00 39.15  ? 48  VAL L CB  1 
ATOM   3575 C  CG1 . VAL C 3 48  ? 32.844 9.872   -11.979 1.00 39.29  ? 48  VAL L CG1 1 
ATOM   3576 C  CG2 . VAL C 3 48  ? 33.687 8.152   -10.381 1.00 38.93  ? 48  VAL L CG2 1 
ATOM   3577 N  N   . TYR C 3 49  ? 29.647 9.672   -12.012 1.00 37.01  ? 49  TYR L N   1 
ATOM   3578 C  CA  . TYR C 3 49  ? 28.725 10.216  -12.994 1.00 37.34  ? 49  TYR L CA  1 
ATOM   3579 C  C   . TYR C 3 49  ? 29.074 11.673  -13.196 1.00 41.08  ? 49  TYR L C   1 
ATOM   3580 O  O   . TYR C 3 49  ? 29.748 12.255  -12.354 1.00 40.76  ? 49  TYR L O   1 
ATOM   3581 C  CB  . TYR C 3 49  ? 27.253 9.997   -12.607 1.00 39.48  ? 49  TYR L CB  1 
ATOM   3582 C  CG  . TYR C 3 49  ? 26.808 10.724  -11.358 1.00 42.16  ? 49  TYR L CG  1 
ATOM   3583 C  CD1 . TYR C 3 49  ? 26.385 12.048  -11.416 1.00 44.89  ? 49  TYR L CD1 1 
ATOM   3584 C  CD2 . TYR C 3 49  ? 26.742 10.072  -10.136 1.00 43.12  ? 49  TYR L CD2 1 
ATOM   3585 C  CE1 . TYR C 3 49  ? 25.955 12.715  -10.285 1.00 46.55  ? 49  TYR L CE1 1 
ATOM   3586 C  CE2 . TYR C 3 49  ? 26.300 10.725  -8.996  1.00 44.96  ? 49  TYR L CE2 1 
ATOM   3587 C  CZ  . TYR C 3 49  ? 25.901 12.046  -9.079  1.00 53.48  ? 49  TYR L CZ  1 
ATOM   3588 O  OH  . TYR C 3 49  ? 25.471 12.698  -7.966  1.00 56.03  ? 49  TYR L OH  1 
ATOM   3589 N  N   . ASN C 3 50  ? 28.617 12.266  -14.303 1.00 37.78  ? 50  ASN L N   1 
ATOM   3590 C  CA  . ASN C 3 50  ? 28.889 13.664  -14.647 1.00 38.09  ? 50  ASN L CA  1 
ATOM   3591 C  C   . ASN C 3 50  ? 30.380 13.957  -14.698 1.00 41.69  ? 50  ASN L C   1 
ATOM   3592 O  O   . ASN C 3 50  ? 30.837 15.006  -14.255 1.00 41.69  ? 50  ASN L O   1 
ATOM   3593 C  CB  . ASN C 3 50  ? 28.139 14.633  -13.736 1.00 38.22  ? 50  ASN L CB  1 
ATOM   3594 C  CG  . ASN C 3 50  ? 26.693 14.830  -14.142 1.00 55.34  ? 50  ASN L CG  1 
ATOM   3595 O  OD1 . ASN C 3 50  ? 26.322 14.740  -15.316 1.00 48.57  ? 50  ASN L OD1 1 
ATOM   3596 N  ND2 . ASN C 3 50  ? 25.844 15.112  -13.177 1.00 46.31  ? 50  ASN L ND2 1 
ATOM   3597 N  N   . ALA C 3 51  ? 31.132 12.999  -15.252 1.00 37.78  ? 51  ALA L N   1 
ATOM   3598 C  CA  . ALA C 3 51  ? 32.584 12.981  -15.447 1.00 37.42  ? 51  ALA L CA  1 
ATOM   3599 C  C   . ALA C 3 51  ? 33.446 12.841  -14.184 1.00 41.02  ? 51  ALA L C   1 
ATOM   3600 O  O   . ALA C 3 51  ? 34.292 11.958  -14.139 1.00 40.11  ? 51  ALA L O   1 
ATOM   3601 C  CB  . ALA C 3 51  ? 33.047 14.184  -16.255 1.00 39.03  ? 51  ALA L CB  1 
ATOM   3602 N  N   . LYS C 3 52  ? 33.246 13.704  -13.180 1.00 38.15  ? 52  LYS L N   1 
ATOM   3603 C  CA  . LYS C 3 52  ? 34.059 13.678  -11.962 1.00 38.00  ? 52  LYS L CA  1 
ATOM   3604 C  C   . LYS C 3 52  ? 33.304 13.517  -10.631 1.00 41.93  ? 52  LYS L C   1 
ATOM   3605 O  O   . LYS C 3 52  ? 33.929 13.548  -9.578  1.00 41.70  ? 52  LYS L O   1 
ATOM   3606 C  CB  . LYS C 3 52  ? 34.956 14.923  -11.917 1.00 41.55  ? 52  LYS L CB  1 
ATOM   3607 C  CG  . LYS C 3 52  ? 34.235 16.254  -12.076 1.00 56.91  ? 52  LYS L CG  1 
ATOM   3608 C  CD  . LYS C 3 52  ? 35.158 17.424  -11.784 1.00 68.24  ? 52  LYS L CD  1 
ATOM   3609 C  CE  . LYS C 3 52  ? 34.361 18.688  -11.601 1.00 79.87  ? 52  LYS L CE  1 
ATOM   3610 N  NZ  . LYS C 3 52  ? 35.245 19.868  -11.450 1.00 90.21  ? 52  LYS L NZ  1 
ATOM   3611 N  N   . THR C 3 53  ? 31.986 13.318  -10.664 1.00 38.54  ? 53  THR L N   1 
ATOM   3612 C  CA  . THR C 3 53  ? 31.206 13.170  -9.434  1.00 38.77  ? 53  THR L CA  1 
ATOM   3613 C  C   . THR C 3 53  ? 31.117 11.728  -8.962  1.00 42.19  ? 53  THR L C   1 
ATOM   3614 O  O   . THR C 3 53  ? 30.632 10.854  -9.675  1.00 41.34  ? 53  THR L O   1 
ATOM   3615 C  CB  . THR C 3 53  ? 29.815 13.797  -9.566  1.00 47.39  ? 53  THR L CB  1 
ATOM   3616 O  OG1 . THR C 3 53  ? 29.946 15.167  -9.930  1.00 48.65  ? 53  THR L OG1 1 
ATOM   3617 C  CG2 . THR C 3 53  ? 29.001 13.690  -8.269  1.00 46.08  ? 53  THR L CG2 1 
ATOM   3618 N  N   . LEU C 3 54  ? 31.580 11.501  -7.735  1.00 38.92  ? 54  LEU L N   1 
ATOM   3619 C  CA  . LEU C 3 54  ? 31.538 10.199  -7.091  1.00 38.32  ? 54  LEU L CA  1 
ATOM   3620 C  C   . LEU C 3 54  ? 30.111 9.916   -6.620  1.00 43.00  ? 54  LEU L C   1 
ATOM   3621 O  O   . LEU C 3 54  ? 29.505 10.760  -5.963  1.00 43.42  ? 54  LEU L O   1 
ATOM   3622 C  CB  . LEU C 3 54  ? 32.513 10.181  -5.901  1.00 38.55  ? 54  LEU L CB  1 
ATOM   3623 C  CG  . LEU C 3 54  ? 32.883 8.820   -5.325  1.00 42.83  ? 54  LEU L CG  1 
ATOM   3624 C  CD1 . LEU C 3 54  ? 33.739 8.042   -6.294  1.00 42.20  ? 54  LEU L CD1 1 
ATOM   3625 C  CD2 . LEU C 3 54  ? 33.612 8.982   -4.013  1.00 45.63  ? 54  LEU L CD2 1 
ATOM   3626 N  N   . ALA C 3 55  ? 29.568 8.743   -6.988  1.00 39.47  ? 55  ALA L N   1 
ATOM   3627 C  CA  . ALA C 3 55  ? 28.225 8.321   -6.595  1.00 40.02  ? 55  ALA L CA  1 
ATOM   3628 C  C   . ALA C 3 55  ? 28.202 8.037   -5.092  1.00 44.55  ? 55  ALA L C   1 
ATOM   3629 O  O   . ALA C 3 55  ? 29.239 7.717   -4.511  1.00 43.93  ? 55  ALA L O   1 
ATOM   3630 C  CB  . ALA C 3 55  ? 27.810 7.082   -7.374  1.00 40.50  ? 55  ALA L CB  1 
ATOM   3631 N  N   . ASP C 3 56  ? 27.032 8.195   -4.461  1.00 41.99  ? 56  ASP L N   1 
ATOM   3632 C  CA  . ASP C 3 56  ? 26.883 7.989   -3.027  1.00 42.45  ? 56  ASP L CA  1 
ATOM   3633 C  C   . ASP C 3 56  ? 27.115 6.546   -2.610  1.00 45.03  ? 56  ASP L C   1 
ATOM   3634 O  O   . ASP C 3 56  ? 26.610 5.625   -3.249  1.00 44.35  ? 56  ASP L O   1 
ATOM   3635 C  CB  . ASP C 3 56  ? 25.532 8.517   -2.525  1.00 45.87  ? 56  ASP L CB  1 
ATOM   3636 C  CG  . ASP C 3 56  ? 25.419 10.036  -2.533  1.00 59.06  ? 56  ASP L CG  1 
ATOM   3637 O  OD1 . ASP C 3 56  ? 26.469 10.709  -2.527  1.00 59.27  ? 56  ASP L OD1 1 
ATOM   3638 O  OD2 . ASP C 3 56  ? 24.284 10.543  -2.519  1.00 67.26  ? 56  ASP L OD2 1 
ATOM   3639 N  N   . GLY C 3 57  ? 27.911 6.387   -1.560  1.00 41.17  ? 57  GLY L N   1 
ATOM   3640 C  CA  . GLY C 3 57  ? 28.295 5.092   -1.008  1.00 40.60  ? 57  GLY L CA  1 
ATOM   3641 C  C   . GLY C 3 57  ? 29.495 4.458   -1.673  1.00 42.24  ? 57  GLY L C   1 
ATOM   3642 O  O   . GLY C 3 57  ? 29.942 3.398   -1.227  1.00 42.20  ? 57  GLY L O   1 
ATOM   3643 N  N   . VAL C 3 58  ? 30.017 5.071   -2.760  1.00 36.62  ? 58  VAL L N   1 
ATOM   3644 C  CA  . VAL C 3 58  ? 31.167 4.569   -3.518  1.00 34.96  ? 58  VAL L CA  1 
ATOM   3645 C  C   . VAL C 3 58  ? 32.501 4.877   -2.823  1.00 37.98  ? 58  VAL L C   1 
ATOM   3646 O  O   . VAL C 3 58  ? 32.678 5.984   -2.337  1.00 38.04  ? 58  VAL L O   1 
ATOM   3647 C  CB  . VAL C 3 58  ? 31.160 5.049   -4.995  1.00 37.83  ? 58  VAL L CB  1 
ATOM   3648 C  CG1 . VAL C 3 58  ? 32.428 4.623   -5.728  1.00 36.90  ? 58  VAL L CG1 1 
ATOM   3649 C  CG2 . VAL C 3 58  ? 29.940 4.504   -5.728  1.00 37.66  ? 58  VAL L CG2 1 
ATOM   3650 N  N   . PRO C 3 59  ? 33.432 3.902   -2.772  1.00 33.56  ? 59  PRO L N   1 
ATOM   3651 C  CA  . PRO C 3 59  ? 34.745 4.122   -2.123  1.00 33.37  ? 59  PRO L CA  1 
ATOM   3652 C  C   . PRO C 3 59  ? 35.473 5.301   -2.747  1.00 36.55  ? 59  PRO L C   1 
ATOM   3653 O  O   . PRO C 3 59  ? 35.363 5.510   -3.954  1.00 35.36  ? 59  PRO L O   1 
ATOM   3654 C  CB  . PRO C 3 59  ? 35.476 2.811   -2.418  1.00 34.96  ? 59  PRO L CB  1 
ATOM   3655 C  CG  . PRO C 3 59  ? 34.401 1.787   -2.509  1.00 39.44  ? 59  PRO L CG  1 
ATOM   3656 C  CD  . PRO C 3 59  ? 33.248 2.494   -3.150  1.00 34.72  ? 59  PRO L CD  1 
ATOM   3657 N  N   . SER C 3 60  ? 36.201 6.059   -1.920  1.00 33.67  ? 60  SER L N   1 
ATOM   3658 C  CA  . SER C 3 60  ? 36.960 7.252   -2.310  1.00 33.42  ? 60  SER L CA  1 
ATOM   3659 C  C   . SER C 3 60  ? 38.107 6.993   -3.296  1.00 36.71  ? 60  SER L C   1 
ATOM   3660 O  O   . SER C 3 60  ? 38.557 7.928   -3.956  1.00 36.53  ? 60  SER L O   1 
ATOM   3661 C  CB  . SER C 3 60  ? 37.482 7.980   -1.082  1.00 37.92  ? 60  SER L CB  1 
ATOM   3662 O  OG  . SER C 3 60  ? 38.489 7.219   -0.431  1.00 47.49  ? 60  SER L OG  1 
ATOM   3663 N  N   . ARG C 3 61  ? 38.572 5.735   -3.401  1.00 32.63  ? 61  ARG L N   1 
ATOM   3664 C  CA  . ARG C 3 61  ? 39.652 5.354   -4.311  1.00 31.92  ? 61  ARG L CA  1 
ATOM   3665 C  C   . ARG C 3 61  ? 39.303 5.625   -5.777  1.00 35.68  ? 61  ARG L C   1 
ATOM   3666 O  O   . ARG C 3 61  ? 40.189 5.938   -6.565  1.00 35.79  ? 61  ARG L O   1 
ATOM   3667 C  CB  . ARG C 3 61  ? 40.106 3.903   -4.079  1.00 30.97  ? 61  ARG L CB  1 
ATOM   3668 C  CG  . ARG C 3 61  ? 39.045 2.820   -4.216  1.00 37.16  ? 61  ARG L CG  1 
ATOM   3669 C  CD  . ARG C 3 61  ? 39.565 1.507   -3.679  1.00 41.24  ? 61  ARG L CD  1 
ATOM   3670 N  NE  . ARG C 3 61  ? 38.595 0.426   -3.874  1.00 44.32  ? 61  ARG L NE  1 
ATOM   3671 C  CZ  . ARG C 3 61  ? 37.786 -0.036  -2.932  1.00 54.43  ? 61  ARG L CZ  1 
ATOM   3672 N  NH1 . ARG C 3 61  ? 37.844 0.453   -1.700  1.00 40.98  ? 61  ARG L NH1 1 
ATOM   3673 N  NH2 . ARG C 3 61  ? 36.932 -1.013  -3.199  1.00 39.18  ? 61  ARG L NH2 1 
ATOM   3674 N  N   . PHE C 3 62  ? 38.012 5.533   -6.125  1.00 31.83  ? 62  PHE L N   1 
ATOM   3675 C  CA  . PHE C 3 62  ? 37.518 5.786   -7.475  1.00 31.20  ? 62  PHE L CA  1 
ATOM   3676 C  C   . PHE C 3 62  ? 37.369 7.281   -7.722  1.00 35.89  ? 62  PHE L C   1 
ATOM   3677 O  O   . PHE C 3 62  ? 36.846 8.013   -6.887  1.00 35.65  ? 62  PHE L O   1 
ATOM   3678 C  CB  . PHE C 3 62  ? 36.173 5.089   -7.720  1.00 32.65  ? 62  PHE L CB  1 
ATOM   3679 C  CG  . PHE C 3 62  ? 36.186 3.604   -7.487  1.00 34.31  ? 62  PHE L CG  1 
ATOM   3680 C  CD1 . PHE C 3 62  ? 36.552 2.730   -8.501  1.00 37.13  ? 62  PHE L CD1 1 
ATOM   3681 C  CD2 . PHE C 3 62  ? 35.835 3.079   -6.253  1.00 36.88  ? 62  PHE L CD2 1 
ATOM   3682 C  CE1 . PHE C 3 62  ? 36.575 1.362   -8.281  1.00 38.24  ? 62  PHE L CE1 1 
ATOM   3683 C  CE2 . PHE C 3 62  ? 35.862 1.713   -6.030  1.00 39.91  ? 62  PHE L CE2 1 
ATOM   3684 C  CZ  . PHE C 3 62  ? 36.230 0.859   -7.047  1.00 37.68  ? 62  PHE L CZ  1 
ATOM   3685 N  N   . SER C 3 63  ? 37.870 7.739   -8.863  1.00 33.04  ? 63  SER L N   1 
ATOM   3686 C  CA  . SER C 3 63  ? 37.796 9.144   -9.256  1.00 33.41  ? 63  SER L CA  1 
ATOM   3687 C  C   . SER C 3 63  ? 37.679 9.286   -10.769 1.00 37.56  ? 63  SER L C   1 
ATOM   3688 O  O   . SER C 3 63  ? 38.092 8.396   -11.511 1.00 36.99  ? 63  SER L O   1 
ATOM   3689 C  CB  . SER C 3 63  ? 38.971 9.953   -8.713  1.00 37.64  ? 63  SER L CB  1 
ATOM   3690 O  OG  . SER C 3 63  ? 40.214 9.269   -8.819  1.00 46.70  ? 63  SER L OG  1 
ATOM   3691 N  N   . GLY C 3 64  ? 37.055 10.372  -11.196 1.00 34.63  ? 64  GLY L N   1 
ATOM   3692 C  CA  . GLY C 3 64  ? 36.848 10.682  -12.601 1.00 34.29  ? 64  GLY L CA  1 
ATOM   3693 C  C   . GLY C 3 64  ? 37.412 12.032  -12.954 1.00 38.71  ? 64  GLY L C   1 
ATOM   3694 O  O   . GLY C 3 64  ? 37.395 12.954  -12.135 1.00 38.77  ? 64  GLY L O   1 
ATOM   3695 N  N   . SER C 3 65  ? 37.947 12.162  -14.174 1.00 35.59  ? 65  SER L N   1 
ATOM   3696 C  CA  . SER C 3 65  ? 38.538 13.396  -14.677 1.00 36.34  ? 65  SER L CA  1 
ATOM   3697 C  C   . SER C 3 65  ? 38.430 13.458  -16.192 1.00 41.04  ? 65  SER L C   1 
ATOM   3698 O  O   . SER C 3 65  ? 38.254 12.428  -16.842 1.00 39.97  ? 65  SER L O   1 
ATOM   3699 C  CB  . SER C 3 65  ? 40.000 13.505  -14.262 1.00 40.02  ? 65  SER L CB  1 
ATOM   3700 O  OG  . SER C 3 65  ? 40.804 12.537  -14.924 1.00 48.17  ? 65  SER L OG  1 
ATOM   3701 N  N   . GLY C 3 66  ? 38.553 14.659  -16.733 1.00 39.17  ? 66  GLY L N   1 
ATOM   3702 C  CA  . GLY C 3 66  ? 38.489 14.881  -18.168 1.00 39.61  ? 66  GLY L CA  1 
ATOM   3703 C  C   . GLY C 3 66  ? 37.349 15.768  -18.594 1.00 44.58  ? 66  GLY L C   1 
ATOM   3704 O  O   . GLY C 3 66  ? 36.443 16.077  -17.812 1.00 44.04  ? 66  GLY L O   1 
ATOM   3705 N  N   . SER C 3 67  ? 37.393 16.193  -19.856 1.00 42.52  ? 67  SER L N   1 
ATOM   3706 C  CA  . SER C 3 67  ? 36.406 17.062  -20.481 1.00 43.43  ? 67  SER L CA  1 
ATOM   3707 C  C   . SER C 3 67  ? 36.417 16.826  -21.987 1.00 47.74  ? 67  SER L C   1 
ATOM   3708 O  O   . SER C 3 67  ? 37.370 16.249  -22.516 1.00 47.06  ? 67  SER L O   1 
ATOM   3709 C  CB  . SER C 3 67  ? 36.699 18.527  -20.166 1.00 48.50  ? 67  SER L CB  1 
ATOM   3710 O  OG  . SER C 3 67  ? 38.036 18.871  -20.504 1.00 58.23  ? 67  SER L OG  1 
ATOM   3711 N  N   . GLY C 3 68  ? 35.361 17.273  -22.654 1.00 45.00  ? 68  GLY L N   1 
ATOM   3712 C  CA  . GLY C 3 68  ? 35.219 17.130  -24.094 1.00 45.23  ? 68  GLY L CA  1 
ATOM   3713 C  C   . GLY C 3 68  ? 35.110 15.684  -24.522 1.00 47.79  ? 68  GLY L C   1 
ATOM   3714 O  O   . GLY C 3 68  ? 34.162 14.986  -24.151 1.00 46.70  ? 68  GLY L O   1 
ATOM   3715 N  N   . THR C 3 69  ? 36.098 15.224  -25.298 1.00 44.19  ? 69  THR L N   1 
ATOM   3716 C  CA  . THR C 3 69  ? 36.136 13.859  -25.819 1.00 43.01  ? 69  THR L CA  1 
ATOM   3717 C  C   . THR C 3 69  ? 36.958 12.840  -25.002 1.00 45.09  ? 69  THR L C   1 
ATOM   3718 O  O   . THR C 3 69  ? 36.851 11.646  -25.266 1.00 44.09  ? 69  THR L O   1 
ATOM   3719 C  CB  . THR C 3 69  ? 36.617 13.856  -27.279 1.00 52.18  ? 69  THR L CB  1 
ATOM   3720 O  OG1 . THR C 3 69  ? 37.911 14.451  -27.359 1.00 53.11  ? 69  THR L OG1 1 
ATOM   3721 C  CG2 . THR C 3 69  ? 35.653 14.595  -28.207 1.00 51.33  ? 69  THR L CG2 1 
ATOM   3722 N  N   . GLN C 3 70  ? 37.786 13.281  -24.047 1.00 41.10  ? 70  GLN L N   1 
ATOM   3723 C  CA  . GLN C 3 70  ? 38.615 12.349  -23.276 1.00 39.85  ? 70  GLN L CA  1 
ATOM   3724 C  C   . GLN C 3 70  ? 38.333 12.339  -21.779 1.00 41.57  ? 70  GLN L C   1 
ATOM   3725 O  O   . GLN C 3 70  ? 38.321 13.389  -21.137 1.00 41.67  ? 70  GLN L O   1 
ATOM   3726 C  CB  . GLN C 3 70  ? 40.095 12.608  -23.549 1.00 42.17  ? 70  GLN L CB  1 
ATOM   3727 C  CG  . GLN C 3 70  ? 40.521 12.220  -24.954 1.00 63.92  ? 70  GLN L CG  1 
ATOM   3728 C  CD  . GLN C 3 70  ? 41.981 11.862  -25.019 1.00 88.53  ? 70  GLN L CD  1 
ATOM   3729 O  OE1 . GLN C 3 70  ? 42.388 10.763  -24.634 1.00 83.97  ? 70  GLN L OE1 1 
ATOM   3730 N  NE2 . GLN C 3 70  ? 42.795 12.791  -25.498 1.00 83.68  ? 70  GLN L NE2 1 
ATOM   3731 N  N   . TYR C 3 71  ? 38.078 11.146  -21.235 1.00 36.14  ? 71  TYR L N   1 
ATOM   3732 C  CA  . TYR C 3 71  ? 37.759 10.941  -19.822 1.00 34.80  ? 71  TYR L CA  1 
ATOM   3733 C  C   . TYR C 3 71  ? 38.538 9.767   -19.231 1.00 37.69  ? 71  TYR L C   1 
ATOM   3734 O  O   . TYR C 3 71  ? 38.844 8.797   -19.918 1.00 36.83  ? 71  TYR L O   1 
ATOM   3735 C  CB  . TYR C 3 71  ? 36.249 10.721  -19.627 1.00 35.29  ? 71  TYR L CB  1 
ATOM   3736 C  CG  . TYR C 3 71  ? 35.410 11.872  -20.129 1.00 37.27  ? 71  TYR L CG  1 
ATOM   3737 C  CD1 . TYR C 3 71  ? 35.006 11.936  -21.454 1.00 39.71  ? 71  TYR L CD1 1 
ATOM   3738 C  CD2 . TYR C 3 71  ? 35.036 12.906  -19.282 1.00 38.19  ? 71  TYR L CD2 1 
ATOM   3739 C  CE1 . TYR C 3 71  ? 34.288 13.010  -21.934 1.00 41.20  ? 71  TYR L CE1 1 
ATOM   3740 C  CE2 . TYR C 3 71  ? 34.289 13.980  -19.746 1.00 39.81  ? 71  TYR L CE2 1 
ATOM   3741 C  CZ  . TYR C 3 71  ? 33.912 14.022  -21.074 1.00 46.76  ? 71  TYR L CZ  1 
ATOM   3742 O  OH  . TYR C 3 71  ? 33.185 15.066  -21.555 1.00 47.47  ? 71  TYR L OH  1 
ATOM   3743 N  N   . SER C 3 72  ? 38.868 9.869   -17.948 1.00 34.17  ? 72  SER L N   1 
ATOM   3744 C  CA  . SER C 3 72  ? 39.620 8.828   -17.257 1.00 33.74  ? 72  SER L CA  1 
ATOM   3745 C  C   . SER C 3 72  ? 39.020 8.425   -15.919 1.00 36.71  ? 72  SER L C   1 
ATOM   3746 O  O   . SER C 3 72  ? 38.449 9.246   -15.207 1.00 36.57  ? 72  SER L O   1 
ATOM   3747 C  CB  . SER C 3 72  ? 41.056 9.272   -17.027 1.00 38.24  ? 72  SER L CB  1 
ATOM   3748 O  OG  . SER C 3 72  ? 41.733 9.485   -18.257 1.00 48.41  ? 72  SER L OG  1 
ATOM   3749 N  N   . LEU C 3 73  ? 39.148 7.138   -15.598 1.00 32.23  ? 73  LEU L N   1 
ATOM   3750 C  CA  . LEU C 3 73  ? 38.732 6.571   -14.330 1.00 31.42  ? 73  LEU L CA  1 
ATOM   3751 C  C   . LEU C 3 73  ? 40.000 6.103   -13.649 1.00 35.26  ? 73  LEU L C   1 
ATOM   3752 O  O   . LEU C 3 73  ? 40.763 5.320   -14.207 1.00 34.84  ? 73  LEU L O   1 
ATOM   3753 C  CB  . LEU C 3 73  ? 37.753 5.398   -14.504 1.00 31.06  ? 73  LEU L CB  1 
ATOM   3754 C  CG  . LEU C 3 73  ? 37.360 4.635   -13.223 1.00 35.41  ? 73  LEU L CG  1 
ATOM   3755 C  CD1 . LEU C 3 73  ? 36.562 5.513   -12.264 1.00 35.42  ? 73  LEU L CD1 1 
ATOM   3756 C  CD2 . LEU C 3 73  ? 36.567 3.398   -13.553 1.00 37.57  ? 73  LEU L CD2 1 
ATOM   3757 N  N   . LYS C 3 74  ? 40.237 6.608   -12.451 1.00 32.27  ? 74  LYS L N   1 
ATOM   3758 C  CA  . LYS C 3 74  ? 41.418 6.234   -11.706 1.00 32.72  ? 74  LYS L CA  1 
ATOM   3759 C  C   . LYS C 3 74  ? 41.039 5.565   -10.402 1.00 36.96  ? 74  LYS L C   1 
ATOM   3760 O  O   . LYS C 3 74  ? 40.168 6.043   -9.682  1.00 36.28  ? 74  LYS L O   1 
ATOM   3761 C  CB  . LYS C 3 74  ? 42.329 7.444   -11.470 1.00 35.79  ? 74  LYS L CB  1 
ATOM   3762 C  CG  . LYS C 3 74  ? 43.582 7.118   -10.662 1.00 49.12  ? 74  LYS L CG  1 
ATOM   3763 C  CD  . LYS C 3 74  ? 44.548 8.296   -10.549 1.00 59.91  ? 74  LYS L CD  1 
ATOM   3764 C  CE  . LYS C 3 74  ? 44.054 9.425   -9.666  1.00 71.76  ? 74  LYS L CE  1 
ATOM   3765 N  NZ  . LYS C 3 74  ? 43.722 8.970   -8.287  1.00 81.47  ? 74  LYS L NZ  1 
ATOM   3766 N  N   . ILE C 3 75  ? 41.676 4.427   -10.128 1.00 34.26  ? 75  ILE L N   1 
ATOM   3767 C  CA  . ILE C 3 75  ? 41.451 3.683   -8.902  1.00 34.58  ? 75  ILE L CA  1 
ATOM   3768 C  C   . ILE C 3 75  ? 42.739 3.671   -8.096  1.00 40.42  ? 75  ILE L C   1 
ATOM   3769 O  O   . ILE C 3 75  ? 43.773 3.225   -8.574  1.00 40.29  ? 75  ILE L O   1 
ATOM   3770 C  CB  . ILE C 3 75  ? 40.907 2.249   -9.127  1.00 37.37  ? 75  ILE L CB  1 
ATOM   3771 C  CG1 . ILE C 3 75  ? 39.951 2.196   -10.338 1.00 37.12  ? 75  ILE L CG1 1 
ATOM   3772 C  CG2 . ILE C 3 75  ? 40.242 1.731   -7.840  1.00 38.15  ? 75  ILE L CG2 1 
ATOM   3773 C  CD1 . ILE C 3 75  ? 39.375 0.850   -10.696 1.00 43.94  ? 75  ILE L CD1 1 
ATOM   3774 N  N   . ASN C 3 76  ? 42.674 4.223   -6.889  1.00 38.34  ? 76  ASN L N   1 
ATOM   3775 C  CA  . ASN C 3 76  ? 43.793 4.300   -5.965  1.00 39.59  ? 76  ASN L CA  1 
ATOM   3776 C  C   . ASN C 3 76  ? 43.681 3.189   -4.955  1.00 44.02  ? 76  ASN L C   1 
ATOM   3777 O  O   . ASN C 3 76  ? 42.572 2.783   -4.631  1.00 43.60  ? 76  ASN L O   1 
ATOM   3778 C  CB  . ASN C 3 76  ? 43.752 5.626   -5.217  1.00 42.59  ? 76  ASN L CB  1 
ATOM   3779 C  CG  . ASN C 3 76  ? 44.794 6.627   -5.646  1.00 73.40  ? 76  ASN L CG  1 
ATOM   3780 O  OD1 . ASN C 3 76  ? 44.734 7.794   -5.259  1.00 69.69  ? 76  ASN L OD1 1 
ATOM   3781 N  ND2 . ASN C 3 76  ? 45.776 6.199   -6.425  1.00 67.24  ? 76  ASN L ND2 1 
ATOM   3782 N  N   . SER C 3 77  ? 44.811 2.710   -4.430  1.00 41.16  ? 77  SER L N   1 
ATOM   3783 C  CA  . SER C 3 77  ? 44.811 1.663   -3.416  1.00 41.35  ? 77  SER L CA  1 
ATOM   3784 C  C   . SER C 3 77  ? 43.863 0.529   -3.791  1.00 43.63  ? 77  SER L C   1 
ATOM   3785 O  O   . SER C 3 77  ? 42.857 0.303   -3.121  1.00 43.10  ? 77  SER L O   1 
ATOM   3786 C  CB  . SER C 3 77  ? 44.487 2.251   -2.047  1.00 45.36  ? 77  SER L CB  1 
ATOM   3787 O  OG  . SER C 3 77  ? 44.434 1.238   -1.053  1.00 55.12  ? 77  SER L OG  1 
ATOM   3788 N  N   . LEU C 3 78  ? 44.190 -0.162  -4.897  1.00 39.27  ? 78  LEU L N   1 
ATOM   3789 C  CA  . LEU C 3 78  ? 43.399 -1.249  -5.463  1.00 38.33  ? 78  LEU L CA  1 
ATOM   3790 C  C   . LEU C 3 78  ? 43.050 -2.297  -4.427  1.00 42.24  ? 78  LEU L C   1 
ATOM   3791 O  O   . LEU C 3 78  ? 43.859 -2.611  -3.561  1.00 42.65  ? 78  LEU L O   1 
ATOM   3792 C  CB  . LEU C 3 78  ? 44.119 -1.870  -6.668  1.00 38.51  ? 78  LEU L CB  1 
ATOM   3793 C  CG  . LEU C 3 78  ? 43.267 -2.482  -7.769  1.00 42.59  ? 78  LEU L CG  1 
ATOM   3794 C  CD1 . LEU C 3 78  ? 42.149 -1.543  -8.195  1.00 41.51  ? 78  LEU L CD1 1 
ATOM   3795 C  CD2 . LEU C 3 78  ? 44.114 -2.768  -8.963  1.00 45.37  ? 78  LEU L CD2 1 
ATOM   3796 N  N   . GLN C 3 79  ? 41.818 -2.796  -4.489  1.00 38.07  ? 79  GLN L N   1 
ATOM   3797 C  CA  . GLN C 3 79  ? 41.312 -3.758  -3.516  1.00 38.33  ? 79  GLN L CA  1 
ATOM   3798 C  C   . GLN C 3 79  ? 40.936 -5.096  -4.143  1.00 42.58  ? 79  GLN L C   1 
ATOM   3799 O  O   . GLN C 3 79  ? 40.675 -5.132  -5.336  1.00 41.52  ? 79  GLN L O   1 
ATOM   3800 C  CB  . GLN C 3 79  ? 40.099 -3.168  -2.784  1.00 39.11  ? 79  GLN L CB  1 
ATOM   3801 C  CG  . GLN C 3 79  ? 40.419 -1.984  -1.879  1.00 45.41  ? 79  GLN L CG  1 
ATOM   3802 C  CD  . GLN C 3 79  ? 41.285 -2.324  -0.694  1.00 57.11  ? 79  GLN L CD  1 
ATOM   3803 O  OE1 . GLN C 3 79  ? 42.366 -1.775  -0.532  1.00 51.08  ? 79  GLN L OE1 1 
ATOM   3804 N  NE2 . GLN C 3 79  ? 40.829 -3.229  0.149   1.00 48.35  ? 79  GLN L NE2 1 
ATOM   3805 N  N   . PRO C 3 80  ? 40.867 -6.189  -3.355  1.00 40.72  ? 80  PRO L N   1 
ATOM   3806 C  CA  . PRO C 3 80  ? 40.515 -7.508  -3.922  1.00 41.24  ? 80  PRO L CA  1 
ATOM   3807 C  C   . PRO C 3 80  ? 39.156 -7.555  -4.616  1.00 44.89  ? 80  PRO L C   1 
ATOM   3808 O  O   . PRO C 3 80  ? 39.039 -8.220  -5.637  1.00 44.56  ? 80  PRO L O   1 
ATOM   3809 C  CB  . PRO C 3 80  ? 40.557 -8.428  -2.700  1.00 44.43  ? 80  PRO L CB  1 
ATOM   3810 C  CG  . PRO C 3 80  ? 41.533 -7.767  -1.772  1.00 49.11  ? 80  PRO L CG  1 
ATOM   3811 C  CD  . PRO C 3 80  ? 41.264 -6.306  -1.941  1.00 43.29  ? 80  PRO L CD  1 
ATOM   3812 N  N   . GLU C 3 81  ? 38.143 -6.852  -4.070  1.00 41.33  ? 81  GLU L N   1 
ATOM   3813 C  CA  . GLU C 3 81  ? 36.787 -6.797  -4.629  1.00 40.91  ? 81  GLU L CA  1 
ATOM   3814 C  C   . GLU C 3 81  ? 36.662 -5.938  -5.892  1.00 44.43  ? 81  GLU L C   1 
ATOM   3815 O  O   . GLU C 3 81  ? 35.625 -5.962  -6.549  1.00 44.00  ? 81  GLU L O   1 
ATOM   3816 C  CB  . GLU C 3 81  ? 35.748 -6.368  -3.576  1.00 42.38  ? 81  GLU L CB  1 
ATOM   3817 C  CG  . GLU C 3 81  ? 35.942 -4.986  -2.964  1.00 50.80  ? 81  GLU L CG  1 
ATOM   3818 C  CD  . GLU C 3 81  ? 36.833 -4.928  -1.743  1.00 65.89  ? 81  GLU L CD  1 
ATOM   3819 O  OE1 . GLU C 3 81  ? 37.756 -5.760  -1.621  1.00 56.65  ? 81  GLU L OE1 1 
ATOM   3820 O  OE2 . GLU C 3 81  ? 36.625 -4.019  -0.913  1.00 56.42  ? 81  GLU L OE2 1 
ATOM   3821 N  N   . ASP C 3 82  ? 37.716 -5.198  -6.243  1.00 40.72  ? 82  ASP L N   1 
ATOM   3822 C  CA  . ASP C 3 82  ? 37.699 -4.334  -7.429  1.00 39.70  ? 82  ASP L CA  1 
ATOM   3823 C  C   . ASP C 3 82  ? 37.768 -5.081  -8.761  1.00 44.64  ? 82  ASP L C   1 
ATOM   3824 O  O   . ASP C 3 82  ? 37.582 -4.475  -9.811  1.00 43.32  ? 82  ASP L O   1 
ATOM   3825 C  CB  . ASP C 3 82  ? 38.786 -3.256  -7.349  1.00 40.88  ? 82  ASP L CB  1 
ATOM   3826 C  CG  . ASP C 3 82  ? 38.556 -2.255  -6.233  1.00 49.44  ? 82  ASP L CG  1 
ATOM   3827 O  OD1 . ASP C 3 82  ? 37.501 -2.330  -5.584  1.00 49.98  ? 82  ASP L OD1 1 
ATOM   3828 O  OD2 . ASP C 3 82  ? 39.428 -1.400  -6.025  1.00 54.78  ? 82  ASP L OD2 1 
ATOM   3829 N  N   . PHE C 3 83  ? 37.994 -6.399  -8.729  1.00 43.28  ? 83  PHE L N   1 
ATOM   3830 C  CA  . PHE C 3 83  ? 38.048 -7.179  -9.960  1.00 43.83  ? 83  PHE L CA  1 
ATOM   3831 C  C   . PHE C 3 83  ? 36.684 -7.170  -10.633 1.00 47.31  ? 83  PHE L C   1 
ATOM   3832 O  O   . PHE C 3 83  ? 35.653 -7.219  -9.960  1.00 47.39  ? 83  PHE L O   1 
ATOM   3833 C  CB  . PHE C 3 83  ? 38.547 -8.611  -9.700  1.00 47.43  ? 83  PHE L CB  1 
ATOM   3834 C  CG  . PHE C 3 83  ? 37.491 -9.547  -9.188  1.00 50.52  ? 83  PHE L CG  1 
ATOM   3835 C  CD1 . PHE C 3 83  ? 36.891 -9.333  -7.954  1.00 54.12  ? 83  PHE L CD1 1 
ATOM   3836 C  CD2 . PHE C 3 83  ? 37.080 -10.631 -9.946  1.00 54.16  ? 83  PHE L CD2 1 
ATOM   3837 C  CE1 . PHE C 3 83  ? 35.887 -10.170 -7.498  1.00 56.34  ? 83  PHE L CE1 1 
ATOM   3838 C  CE2 . PHE C 3 83  ? 36.086 -11.484 -9.483  1.00 58.29  ? 83  PHE L CE2 1 
ATOM   3839 C  CZ  . PHE C 3 83  ? 35.493 -11.250 -8.259  1.00 56.49  ? 83  PHE L CZ  1 
ATOM   3840 N  N   . GLY C 3 84  ? 36.698 -7.072  -11.945 1.00 42.98  ? 84  GLY L N   1 
ATOM   3841 C  CA  . GLY C 3 84  ? 35.471 -7.053  -12.724 1.00 42.36  ? 84  GLY L CA  1 
ATOM   3842 C  C   . GLY C 3 84  ? 35.636 -6.321  -14.023 1.00 44.74  ? 84  GLY L C   1 
ATOM   3843 O  O   . GLY C 3 84  ? 36.757 -6.054  -14.465 1.00 43.98  ? 84  GLY L O   1 
ATOM   3844 N  N   . SER C 3 85  ? 34.511 -5.998  -14.653 1.00 40.63  ? 85  SER L N   1 
ATOM   3845 C  CA  . SER C 3 85  ? 34.477 -5.280  -15.910 1.00 39.68  ? 85  SER L CA  1 
ATOM   3846 C  C   . SER C 3 85  ? 34.005 -3.865  -15.661 1.00 41.85  ? 85  SER L C   1 
ATOM   3847 O  O   . SER C 3 85  ? 33.047 -3.654  -14.932 1.00 41.38  ? 85  SER L O   1 
ATOM   3848 C  CB  . SER C 3 85  ? 33.584 -5.997  -16.909 1.00 44.10  ? 85  SER L CB  1 
ATOM   3849 O  OG  . SER C 3 85  ? 34.298 -7.072  -17.504 1.00 54.17  ? 85  SER L OG  1 
ATOM   3850 N  N   . TYR C 3 86  ? 34.695 -2.892  -16.239 1.00 37.38  ? 86  TYR L N   1 
ATOM   3851 C  CA  . TYR C 3 86  ? 34.367 -1.490  -16.060 1.00 36.22  ? 86  TYR L CA  1 
ATOM   3852 C  C   . TYR C 3 86  ? 33.898 -0.900  -17.370 1.00 39.57  ? 86  TYR L C   1 
ATOM   3853 O  O   . TYR C 3 86  ? 34.457 -1.193  -18.422 1.00 39.32  ? 86  TYR L O   1 
ATOM   3854 C  CB  . TYR C 3 86  ? 35.567 -0.731  -15.503 1.00 36.86  ? 86  TYR L CB  1 
ATOM   3855 C  CG  . TYR C 3 86  ? 35.890 -1.112  -14.073 1.00 38.78  ? 86  TYR L CG  1 
ATOM   3856 C  CD1 . TYR C 3 86  ? 36.610 -2.266  -13.783 1.00 41.22  ? 86  TYR L CD1 1 
ATOM   3857 C  CD2 . TYR C 3 86  ? 35.465 -0.325  -13.014 1.00 39.32  ? 86  TYR L CD2 1 
ATOM   3858 C  CE1 . TYR C 3 86  ? 36.891 -2.627  -12.477 1.00 42.02  ? 86  TYR L CE1 1 
ATOM   3859 C  CE2 . TYR C 3 86  ? 35.774 -0.655  -11.706 1.00 40.44  ? 86  TYR L CE2 1 
ATOM   3860 C  CZ  . TYR C 3 86  ? 36.470 -1.815  -11.441 1.00 48.56  ? 86  TYR L CZ  1 
ATOM   3861 O  OH  . TYR C 3 86  ? 36.731 -2.117  -10.142 1.00 50.75  ? 86  TYR L OH  1 
ATOM   3862 N  N   . TYR C 3 87  ? 32.837 -0.102  -17.309 1.00 35.70  ? 87  TYR L N   1 
ATOM   3863 C  CA  . TYR C 3 87  ? 32.244 0.503   -18.492 1.00 35.47  ? 87  TYR L CA  1 
ATOM   3864 C  C   . TYR C 3 87  ? 32.058 1.993   -18.325 1.00 38.65  ? 87  TYR L C   1 
ATOM   3865 O  O   . TYR C 3 87  ? 31.909 2.500   -17.218 1.00 37.97  ? 87  TYR L O   1 
ATOM   3866 C  CB  . TYR C 3 87  ? 30.869 -0.116  -18.786 1.00 37.36  ? 87  TYR L CB  1 
ATOM   3867 C  CG  . TYR C 3 87  ? 30.908 -1.600  -19.054 1.00 39.75  ? 87  TYR L CG  1 
ATOM   3868 C  CD1 . TYR C 3 87  ? 31.140 -2.085  -20.336 1.00 42.31  ? 87  TYR L CD1 1 
ATOM   3869 C  CD2 . TYR C 3 87  ? 30.711 -2.517  -18.035 1.00 40.80  ? 87  TYR L CD2 1 
ATOM   3870 C  CE1 . TYR C 3 87  ? 31.197 -3.445  -20.589 1.00 44.10  ? 87  TYR L CE1 1 
ATOM   3871 C  CE2 . TYR C 3 87  ? 30.764 -3.880  -18.272 1.00 42.60  ? 87  TYR L CE2 1 
ATOM   3872 C  CZ  . TYR C 3 87  ? 31.007 -4.340  -19.553 1.00 50.82  ? 87  TYR L CZ  1 
ATOM   3873 O  OH  . TYR C 3 87  ? 31.055 -5.677  -19.797 1.00 53.57  ? 87  TYR L OH  1 
ATOM   3874 N  N   . CYS C 3 88  ? 32.055 2.692   -19.450 1.00 35.14  ? 88  CYS L N   1 
ATOM   3875 C  CA  . CYS C 3 88  ? 31.833 4.118   -19.526 1.00 34.60  ? 88  CYS L CA  1 
ATOM   3876 C  C   . CYS C 3 88  ? 30.661 4.304   -20.449 1.00 38.30  ? 88  CYS L C   1 
ATOM   3877 O  O   . CYS C 3 88  ? 30.495 3.540   -21.398 1.00 38.52  ? 88  CYS L O   1 
ATOM   3878 C  CB  . CYS C 3 88  ? 33.065 4.830   -20.060 1.00 34.98  ? 88  CYS L CB  1 
ATOM   3879 S  SG  . CYS C 3 88  ? 33.461 4.412   -21.781 1.00 39.67  ? 88  CYS L SG  1 
ATOM   3880 N  N   . GLN C 3 89  ? 29.852 5.319   -20.198 1.00 34.45  ? 89  GLN L N   1 
ATOM   3881 C  CA  . GLN C 3 89  ? 28.724 5.612   -21.055 1.00 34.74  ? 89  GLN L CA  1 
ATOM   3882 C  C   . GLN C 3 89  ? 28.512 7.093   -21.188 1.00 38.82  ? 89  GLN L C   1 
ATOM   3883 O  O   . GLN C 3 89  ? 28.828 7.854   -20.281 1.00 38.08  ? 89  GLN L O   1 
ATOM   3884 C  CB  . GLN C 3 89  ? 27.441 4.935   -20.564 1.00 36.37  ? 89  GLN L CB  1 
ATOM   3885 C  CG  . GLN C 3 89  ? 26.811 5.581   -19.338 1.00 49.31  ? 89  GLN L CG  1 
ATOM   3886 C  CD  . GLN C 3 89  ? 25.314 5.751   -19.435 1.00 68.02  ? 89  GLN L CD  1 
ATOM   3887 O  OE1 . GLN C 3 89  ? 24.640 5.943   -18.429 1.00 63.29  ? 89  GLN L OE1 1 
ATOM   3888 N  NE2 . GLN C 3 89  ? 24.766 5.710   -20.640 1.00 61.23  ? 89  GLN L NE2 1 
ATOM   3889 N  N   . GLN C 3 90  ? 27.970 7.503   -22.326 1.00 36.15  ? 90  GLN L N   1 
ATOM   3890 C  CA  . GLN C 3 90  ? 27.662 8.894   -22.563 1.00 36.63  ? 90  GLN L CA  1 
ATOM   3891 C  C   . GLN C 3 90  ? 26.158 9.089   -22.608 1.00 42.28  ? 90  GLN L C   1 
ATOM   3892 O  O   . GLN C 3 90  ? 25.459 8.368   -23.312 1.00 42.49  ? 90  GLN L O   1 
ATOM   3893 C  CB  . GLN C 3 90  ? 28.373 9.435   -23.816 1.00 38.28  ? 90  GLN L CB  1 
ATOM   3894 C  CG  . GLN C 3 90  ? 27.985 8.814   -25.164 1.00 47.70  ? 90  GLN L CG  1 
ATOM   3895 C  CD  . GLN C 3 90  ? 26.729 9.403   -25.755 1.00 60.12  ? 90  GLN L CD  1 
ATOM   3896 O  OE1 . GLN C 3 90  ? 26.374 10.548  -25.496 1.00 55.37  ? 90  GLN L OE1 1 
ATOM   3897 N  NE2 . GLN C 3 90  ? 25.995 8.598   -26.497 1.00 49.28  ? 90  GLN L NE2 1 
ATOM   3898 N  N   . PHE C 3 91  ? 25.652 10.006  -21.788 1.00 39.68  ? 91  PHE L N   1 
ATOM   3899 C  CA  . PHE C 3 91  ? 24.223 10.270  -21.752 1.00 40.91  ? 91  PHE L CA  1 
ATOM   3900 C  C   . PHE C 3 91  ? 23.900 11.632  -22.343 1.00 46.60  ? 91  PHE L C   1 
ATOM   3901 O  O   . PHE C 3 91  ? 22.784 12.136  -22.217 1.00 47.54  ? 91  PHE L O   1 
ATOM   3902 C  CB  . PHE C 3 91  ? 23.613 10.060  -20.368 1.00 42.61  ? 91  PHE L CB  1 
ATOM   3903 C  CG  . PHE C 3 91  ? 24.373 10.671  -19.235 1.00 43.53  ? 91  PHE L CG  1 
ATOM   3904 C  CD1 . PHE C 3 91  ? 25.442 10.002  -18.658 1.00 45.42  ? 91  PHE L CD1 1 
ATOM   3905 C  CD2 . PHE C 3 91  ? 24.006 11.904  -18.723 1.00 46.36  ? 91  PHE L CD2 1 
ATOM   3906 C  CE1 . PHE C 3 91  ? 26.148 10.566  -17.614 1.00 45.80  ? 91  PHE L CE1 1 
ATOM   3907 C  CE2 . PHE C 3 91  ? 24.709 12.469  -17.677 1.00 48.67  ? 91  PHE L CE2 1 
ATOM   3908 C  CZ  . PHE C 3 91  ? 25.776 11.797  -17.124 1.00 45.54  ? 91  PHE L CZ  1 
ATOM   3909 N  N   . TRP C 3 92  ? 24.900 12.223  -23.002 1.00 43.22  ? 92  TRP L N   1 
ATOM   3910 C  CA  . TRP C 3 92  ? 24.782 13.512  -23.658 1.00 44.24  ? 92  TRP L CA  1 
ATOM   3911 C  C   . TRP C 3 92  ? 23.900 13.453  -24.891 1.00 49.66  ? 92  TRP L C   1 
ATOM   3912 O  O   . TRP C 3 92  ? 23.081 14.341  -25.099 1.00 50.68  ? 92  TRP L O   1 
ATOM   3913 C  CB  . TRP C 3 92  ? 26.170 14.049  -24.031 1.00 42.62  ? 92  TRP L CB  1 
ATOM   3914 C  CG  . TRP C 3 92  ? 26.125 15.251  -24.914 1.00 44.58  ? 92  TRP L CG  1 
ATOM   3915 C  CD1 . TRP C 3 92  ? 26.480 15.312  -26.228 1.00 48.56  ? 92  TRP L CD1 1 
ATOM   3916 C  CD2 . TRP C 3 92  ? 25.596 16.535  -24.582 1.00 46.07  ? 92  TRP L CD2 1 
ATOM   3917 N  NE1 . TRP C 3 92  ? 26.250 16.570  -26.721 1.00 49.33  ? 92  TRP L NE1 1 
ATOM   3918 C  CE2 . TRP C 3 92  ? 25.668 17.330  -25.748 1.00 51.17  ? 92  TRP L CE2 1 
ATOM   3919 C  CE3 . TRP C 3 92  ? 25.075 17.100  -23.410 1.00 47.24  ? 92  TRP L CE3 1 
ATOM   3920 C  CZ2 . TRP C 3 92  ? 25.263 18.661  -25.771 1.00 52.12  ? 92  TRP L CZ2 1 
ATOM   3921 C  CZ3 . TRP C 3 92  ? 24.680 18.424  -23.436 1.00 50.38  ? 92  TRP L CZ3 1 
ATOM   3922 C  CH2 . TRP C 3 92  ? 24.783 19.190  -24.605 1.00 52.28  ? 92  TRP L CH2 1 
ATOM   3923 N  N   . SER C 3 93  ? 24.100 12.433  -25.727 1.00 46.11  ? 93  SER L N   1 
ATOM   3924 C  CA  . SER C 3 93  ? 23.358 12.296  -26.971 1.00 47.32  ? 93  SER L CA  1 
ATOM   3925 C  C   . SER C 3 93  ? 22.694 10.951  -27.153 1.00 51.28  ? 93  SER L C   1 
ATOM   3926 O  O   . SER C 3 93  ? 23.190 9.928   -26.700 1.00 49.68  ? 93  SER L O   1 
ATOM   3927 C  CB  . SER C 3 93  ? 24.273 12.581  -28.149 1.00 51.24  ? 93  SER L CB  1 
ATOM   3928 O  OG  . SER C 3 93  ? 23.738 12.141  -29.393 1.00 61.72  ? 93  SER L OG  1 
ATOM   3929 N  N   . THR C 3 94  ? 21.580 10.972  -27.884 1.00 49.43  ? 94  THR L N   1 
ATOM   3930 C  CA  . THR C 3 94  ? 20.781 9.802   -28.220 1.00 49.63  ? 94  THR L CA  1 
ATOM   3931 C  C   . THR C 3 94  ? 21.193 9.265   -29.609 1.00 53.61  ? 94  THR L C   1 
ATOM   3932 O  O   . THR C 3 94  ? 21.339 10.052  -30.541 1.00 54.15  ? 94  THR L O   1 
ATOM   3933 C  CB  . THR C 3 94  ? 19.277 10.117  -28.112 1.00 58.84  ? 94  THR L CB  1 
ATOM   3934 O  OG1 . THR C 3 94  ? 18.999 10.641  -26.816 1.00 57.29  ? 94  THR L OG1 1 
ATOM   3935 C  CG2 . THR C 3 94  ? 18.399 8.876   -28.326 1.00 58.66  ? 94  THR L CG2 1 
ATOM   3936 N  N   . PRO C 3 95  ? 21.378 7.945   -29.770 1.00 49.60  ? 95  PRO L N   1 
ATOM   3937 C  CA  . PRO C 3 95  ? 21.287 6.925   -28.719 1.00 48.34  ? 95  PRO L CA  1 
ATOM   3938 C  C   . PRO C 3 95  ? 22.455 6.940   -27.738 1.00 49.77  ? 95  PRO L C   1 
ATOM   3939 O  O   . PRO C 3 95  ? 23.579 7.257   -28.122 1.00 48.68  ? 95  PRO L O   1 
ATOM   3940 C  CB  . PRO C 3 95  ? 21.232 5.627   -29.514 1.00 50.73  ? 95  PRO L CB  1 
ATOM   3941 C  CG  . PRO C 3 95  ? 22.059 5.913   -30.712 1.00 55.42  ? 95  PRO L CG  1 
ATOM   3942 C  CD  . PRO C 3 95  ? 21.811 7.355   -31.052 1.00 51.78  ? 95  PRO L CD  1 
ATOM   3943 N  N   . TYR C 3 96  ? 22.170 6.659   -26.459 1.00 45.04  ? 96  TYR L N   1 
ATOM   3944 C  CA  . TYR C 3 96  ? 23.194 6.637   -25.423 1.00 42.99  ? 96  TYR L CA  1 
ATOM   3945 C  C   . TYR C 3 96  ? 24.062 5.429   -25.701 1.00 46.27  ? 96  TYR L C   1 
ATOM   3946 O  O   . TYR C 3 96  ? 23.564 4.397   -26.139 1.00 46.96  ? 96  TYR L O   1 
ATOM   3947 C  CB  . TYR C 3 96  ? 22.565 6.599   -24.028 1.00 43.76  ? 96  TYR L CB  1 
ATOM   3948 C  CG  . TYR C 3 96  ? 21.695 7.807   -23.754 1.00 46.03  ? 96  TYR L CG  1 
ATOM   3949 C  CD1 . TYR C 3 96  ? 22.126 9.085   -24.097 1.00 47.85  ? 96  TYR L CD1 1 
ATOM   3950 C  CD2 . TYR C 3 96  ? 20.461 7.682   -23.142 1.00 47.67  ? 96  TYR L CD2 1 
ATOM   3951 C  CE1 . TYR C 3 96  ? 21.328 10.190  -23.883 1.00 49.43  ? 96  TYR L CE1 1 
ATOM   3952 C  CE2 . TYR C 3 96  ? 19.654 8.784   -22.910 1.00 49.46  ? 96  TYR L CE2 1 
ATOM   3953 C  CZ  . TYR C 3 96  ? 20.113 10.043  -23.248 1.00 56.81  ? 96  TYR L CZ  1 
ATOM   3954 O  OH  . TYR C 3 96  ? 19.350 11.138  -23.000 1.00 59.41  ? 96  TYR L OH  1 
ATOM   3955 N  N   . THR C 3 97  ? 25.366 5.590   -25.570 1.00 41.39  ? 97  THR L N   1 
ATOM   3956 C  CA  . THR C 3 97  ? 26.295 4.522   -25.906 1.00 40.52  ? 97  THR L CA  1 
ATOM   3957 C  C   . THR C 3 97  ? 27.251 4.179   -24.784 1.00 42.85  ? 97  THR L C   1 
ATOM   3958 O  O   . THR C 3 97  ? 27.532 5.011   -23.928 1.00 41.77  ? 97  THR L O   1 
ATOM   3959 C  CB  . THR C 3 97  ? 27.074 4.873   -27.183 1.00 47.63  ? 97  THR L CB  1 
ATOM   3960 O  OG1 . THR C 3 97  ? 27.911 5.998   -26.936 1.00 46.54  ? 97  THR L OG1 1 
ATOM   3961 C  CG2 . THR C 3 97  ? 26.156 5.142   -28.371 1.00 46.68  ? 97  THR L CG2 1 
ATOM   3962 N  N   . PHE C 3 98  ? 27.768 2.952   -24.818 1.00 39.04  ? 98  PHE L N   1 
ATOM   3963 C  CA  . PHE C 3 98  ? 28.710 2.430   -23.846 1.00 37.75  ? 98  PHE L CA  1 
ATOM   3964 C  C   . PHE C 3 98  ? 30.030 2.063   -24.522 1.00 42.47  ? 98  PHE L C   1 
ATOM   3965 O  O   . PHE C 3 98  ? 30.055 1.729   -25.708 1.00 43.28  ? 98  PHE L O   1 
ATOM   3966 C  CB  . PHE C 3 98  ? 28.151 1.165   -23.180 1.00 39.49  ? 98  PHE L CB  1 
ATOM   3967 C  CG  . PHE C 3 98  ? 26.983 1.379   -22.261 1.00 40.90  ? 98  PHE L CG  1 
ATOM   3968 C  CD1 . PHE C 3 98  ? 25.686 1.370   -22.752 1.00 44.90  ? 98  PHE L CD1 1 
ATOM   3969 C  CD2 . PHE C 3 98  ? 27.177 1.571   -20.903 1.00 42.05  ? 98  PHE L CD2 1 
ATOM   3970 C  CE1 . PHE C 3 98  ? 24.609 1.579   -21.909 1.00 46.00  ? 98  PHE L CE1 1 
ATOM   3971 C  CE2 . PHE C 3 98  ? 26.100 1.777   -20.055 1.00 45.12  ? 98  PHE L CE2 1 
ATOM   3972 C  CZ  . PHE C 3 98  ? 24.819 1.786   -20.563 1.00 44.30  ? 98  PHE L CZ  1 
ATOM   3973 N  N   . GLY C 3 99  ? 31.108 2.114   -23.750 1.00 38.42  ? 99  GLY L N   1 
ATOM   3974 C  CA  . GLY C 3 99  ? 32.428 1.711   -24.216 1.00 38.26  ? 99  GLY L CA  1 
ATOM   3975 C  C   . GLY C 3 99  ? 32.487 0.202   -24.277 1.00 42.87  ? 99  GLY L C   1 
ATOM   3976 O  O   . GLY C 3 99  ? 31.619 -0.469  -23.707 1.00 42.58  ? 99  GLY L O   1 
ATOM   3977 N  N   . GLY C 3 100 ? 33.504 -0.332  -24.945 1.00 40.05  ? 100 GLY L N   1 
ATOM   3978 C  CA  . GLY C 3 100 ? 33.691 -1.775  -25.091 1.00 40.63  ? 100 GLY L CA  1 
ATOM   3979 C  C   . GLY C 3 100 ? 33.821 -2.491  -23.765 1.00 44.41  ? 100 GLY L C   1 
ATOM   3980 O  O   . GLY C 3 100 ? 33.433 -3.658  -23.650 1.00 44.65  ? 100 GLY L O   1 
ATOM   3981 N  N   . GLY C 3 101 ? 34.335 -1.778  -22.770 1.00 40.32  ? 101 GLY L N   1 
ATOM   3982 C  CA  . GLY C 3 101 ? 34.536 -2.297  -21.427 1.00 39.74  ? 101 GLY L CA  1 
ATOM   3983 C  C   . GLY C 3 101 ? 35.971 -2.671  -21.175 1.00 43.86  ? 101 GLY L C   1 
ATOM   3984 O  O   . GLY C 3 101 ? 36.716 -2.970  -22.112 1.00 43.90  ? 101 GLY L O   1 
ATOM   3985 N  N   . THR C 3 102 ? 36.379 -2.641  -19.907 1.00 40.32  ? 102 THR L N   1 
ATOM   3986 C  CA  . THR C 3 102 ? 37.728 -2.994  -19.491 1.00 40.39  ? 102 THR L CA  1 
ATOM   3987 C  C   . THR C 3 102 ? 37.641 -4.084  -18.438 1.00 44.87  ? 102 THR L C   1 
ATOM   3988 O  O   . THR C 3 102 ? 36.879 -3.965  -17.488 1.00 44.04  ? 102 THR L O   1 
ATOM   3989 C  CB  . THR C 3 102 ? 38.498 -1.765  -18.993 1.00 47.43  ? 102 THR L CB  1 
ATOM   3990 O  OG1 . THR C 3 102 ? 38.665 -0.863  -20.084 1.00 47.55  ? 102 THR L OG1 1 
ATOM   3991 C  CG2 . THR C 3 102 ? 39.868 -2.130  -18.450 1.00 45.77  ? 102 THR L CG2 1 
ATOM   3992 N  N   . LYS C 3 103 ? 38.419 -5.146  -18.610 1.00 42.62  ? 103 LYS L N   1 
ATOM   3993 C  CA  . LYS C 3 103 ? 38.453 -6.250  -17.668 1.00 43.19  ? 103 LYS L CA  1 
ATOM   3994 C  C   . LYS C 3 103 ? 39.624 -6.032  -16.707 1.00 47.00  ? 103 LYS L C   1 
ATOM   3995 O  O   . LYS C 3 103 ? 40.733 -5.726  -17.134 1.00 46.76  ? 103 LYS L O   1 
ATOM   3996 C  CB  . LYS C 3 103 ? 38.579 -7.571  -18.424 1.00 47.27  ? 103 LYS L CB  1 
ATOM   3997 C  CG  . LYS C 3 103 ? 38.311 -8.806  -17.580 1.00 66.70  ? 103 LYS L CG  1 
ATOM   3998 C  CD  . LYS C 3 103 ? 38.985 -10.027 -18.181 1.00 81.44  ? 103 LYS L CD  1 
ATOM   3999 C  CE  . LYS C 3 103 ? 40.495 -9.956  -18.089 1.00 95.30  ? 103 LYS L CE  1 
ATOM   4000 N  NZ  . LYS C 3 103 ? 41.149 -11.129 -18.718 1.00 106.89 ? 103 LYS L NZ  1 
ATOM   4001 N  N   . LEU C 3 104 ? 39.356 -6.130  -15.406 1.00 43.44  ? 104 LEU L N   1 
ATOM   4002 C  CA  . LEU C 3 104 ? 40.370 -5.907  -14.381 1.00 43.21  ? 104 LEU L CA  1 
ATOM   4003 C  C   . LEU C 3 104 ? 40.651 -7.148  -13.548 1.00 48.30  ? 104 LEU L C   1 
ATOM   4004 O  O   . LEU C 3 104 ? 39.730 -7.827  -13.104 1.00 48.11  ? 104 LEU L O   1 
ATOM   4005 C  CB  . LEU C 3 104 ? 39.993 -4.718  -13.477 1.00 42.29  ? 104 LEU L CB  1 
ATOM   4006 C  CG  . LEU C 3 104 ? 40.974 -4.338  -12.356 1.00 47.06  ? 104 LEU L CG  1 
ATOM   4007 C  CD1 . LEU C 3 104 ? 42.214 -3.677  -12.916 1.00 47.35  ? 104 LEU L CD1 1 
ATOM   4008 C  CD2 . LEU C 3 104 ? 40.323 -3.377  -11.386 1.00 48.58  ? 104 LEU L CD2 1 
ATOM   4009 N  N   . GLU C 3 105 ? 41.939 -7.447  -13.367 1.00 45.86  ? 105 GLU L N   1 
ATOM   4010 C  CA  . GLU C 3 105 ? 42.410 -8.581  -12.585 1.00 46.98  ? 105 GLU L CA  1 
ATOM   4011 C  C   . GLU C 3 105 ? 43.278 -8.078  -11.437 1.00 50.67  ? 105 GLU L C   1 
ATOM   4012 O  O   . GLU C 3 105 ? 44.043 -7.136  -11.602 1.00 49.84  ? 105 GLU L O   1 
ATOM   4013 C  CB  . GLU C 3 105 ? 43.192 -9.557  -13.469 1.00 49.72  ? 105 GLU L CB  1 
ATOM   4014 C  CG  . GLU C 3 105 ? 43.494 -10.884 -12.794 1.00 62.90  ? 105 GLU L CG  1 
ATOM   4015 C  CD  . GLU C 3 105 ? 44.020 -11.953 -13.723 1.00 86.27  ? 105 GLU L CD  1 
ATOM   4016 O  OE1 . GLU C 3 105 ? 43.588 -11.990 -14.897 1.00 84.68  ? 105 GLU L OE1 1 
ATOM   4017 O  OE2 . GLU C 3 105 ? 44.844 -12.778 -13.270 1.00 79.18  ? 105 GLU L OE2 1 
ATOM   4018 N  N   . ILE C 3 106 ? 43.135 -8.694  -10.263 1.00 47.78  ? 106 ILE L N   1 
ATOM   4019 C  CA  . ILE C 3 106 ? 43.896 -8.313  -9.076  1.00 47.63  ? 106 ILE L CA  1 
ATOM   4020 C  C   . ILE C 3 106 ? 44.786 -9.477  -8.652  1.00 53.16  ? 106 ILE L C   1 
ATOM   4021 O  O   . ILE C 3 106 ? 44.353 -10.628 -8.630  1.00 53.56  ? 106 ILE L O   1 
ATOM   4022 C  CB  . ILE C 3 106 ? 42.997 -7.780  -7.912  1.00 49.95  ? 106 ILE L CB  1 
ATOM   4023 C  CG1 . ILE C 3 106 ? 42.239 -6.521  -8.318  1.00 48.74  ? 106 ILE L CG1 1 
ATOM   4024 C  CG2 . ILE C 3 106 ? 43.814 -7.437  -6.669  1.00 51.09  ? 106 ILE L CG2 1 
ATOM   4025 C  CD1 . ILE C 3 106 ? 41.099 -6.744  -8.958  1.00 55.49  ? 106 ILE L CD1 1 
ATOM   4026 N  N   . ASN C 3 107 ? 46.048 -9.162  -8.362  1.00 50.34  ? 107 ASN L N   1 
ATOM   4027 C  CA  . ASN C 3 107 ? 47.043 -10.141 -7.952  1.00 82.92  ? 107 ASN L CA  1 
ATOM   4028 C  C   . ASN C 3 107 ? 47.398 -10.002 -6.465  1.00 119.83 ? 107 ASN L C   1 
ATOM   4029 O  O   . ASN C 3 107 ? 47.007 -9.037  -5.804  1.00 81.88  ? 107 ASN L O   1 
ATOM   4030 C  CB  . ASN C 3 107 ? 48.298 -10.016 -8.826  1.00 83.86  ? 107 ASN L CB  1 
ATOM   4031 C  CG  . ASN C 3 107 ? 48.013 -9.943  -10.315 1.00 104.47 ? 107 ASN L CG  1 
ATOM   4032 O  OD1 . ASN C 3 107 ? 47.012 -10.468 -10.813 1.00 96.99  ? 107 ASN L OD1 1 
ATOM   4033 N  ND2 . ASN C 3 107 ? 48.890 -9.276  -11.052 1.00 96.73  ? 107 ASN L ND2 1 
HETATM 4034 ZN ZN  . ZN  D 4 .   ? 19.675 35.751  -6.454  1.00 63.28  2 401 ZN  A ZN  1 
HETATM 4035 S  S   . SO4 E 5 .   ? 29.528 23.492  -22.733 1.00 49.28  ? 402 SO4 A S   1 
HETATM 4036 O  O1  . SO4 E 5 .   ? 30.607 23.417  -23.717 1.00 49.07  ? 402 SO4 A O1  1 
HETATM 4037 O  O2  . SO4 E 5 .   ? 28.426 24.290  -23.269 1.00 49.01  ? 402 SO4 A O2  1 
HETATM 4038 O  O3  . SO4 E 5 .   ? 29.048 22.148  -22.431 1.00 49.83  ? 402 SO4 A O3  1 
HETATM 4039 O  O4  . SO4 E 5 .   ? 30.032 24.108  -21.507 1.00 49.57  ? 402 SO4 A O4  1 
HETATM 4040 S  S   . SO4 F 5 .   ? 29.546 19.867  -30.117 1.00 118.68 ? 201 SO4 L S   1 
HETATM 4041 O  O1  . SO4 F 5 .   ? 30.585 19.898  -31.146 1.00 118.76 ? 201 SO4 L O1  1 
HETATM 4042 O  O2  . SO4 F 5 .   ? 28.281 20.332  -30.685 1.00 118.70 ? 201 SO4 L O2  1 
HETATM 4043 O  O3  . SO4 F 5 .   ? 29.384 18.500  -29.626 1.00 118.74 ? 201 SO4 L O3  1 
HETATM 4044 O  O4  . SO4 F 5 .   ? 29.938 20.740  -29.013 1.00 118.65 ? 201 SO4 L O4  1 
HETATM 4045 O  O   . HOH G 6 .   ? 27.839 18.503  -12.209 1.00 38.14  ? 501 HOH A O   1 
HETATM 4046 O  O   . HOH G 6 .   ? 19.954 12.536  -20.026 1.00 37.98  ? 502 HOH A O   1 
HETATM 4047 O  O   . HOH G 6 .   ? 21.980 13.487  -2.144  1.00 78.94  ? 503 HOH A O   1 
HETATM 4048 O  O   . HOH G 6 .   ? 19.250 50.844  -4.695  1.00 69.16  ? 504 HOH A O   1 
HETATM 4049 O  O   . HOH G 6 .   ? 21.957 82.938  -9.125  1.00 75.91  ? 505 HOH A O   1 
HETATM 4050 O  O   . HOH G 6 .   ? 31.340 41.369  2.609   1.00 75.64  ? 506 HOH A O   1 
HETATM 4051 O  O   . HOH G 6 .   ? 35.606 67.806  -8.684  1.00 79.37  ? 507 HOH A O   1 
HETATM 4052 O  O   . HOH G 6 .   ? 12.379 15.971  -1.510  1.00 75.31  ? 508 HOH A O   1 
HETATM 4053 O  O   . HOH G 6 .   ? 31.497 23.081  -18.879 1.00 48.11  ? 509 HOH A O   1 
HETATM 4054 O  O   . HOH G 6 .   ? 26.936 32.186  2.626   1.00 60.20  ? 510 HOH A O   1 
HETATM 4055 O  O   . HOH G 6 .   ? 4.445  27.874  -7.327  1.00 73.22  ? 511 HOH A O   1 
HETATM 4056 O  O   . HOH G 6 .   ? 13.826 16.719  -21.596 1.00 69.97  ? 512 HOH A O   1 
HETATM 4057 O  O   . HOH G 6 .   ? 18.395 22.694  -21.287 1.00 49.02  ? 513 HOH A O   1 
HETATM 4058 O  O   . HOH G 6 .   ? 42.622 41.764  -1.186  1.00 62.52  ? 514 HOH A O   1 
HETATM 4059 O  O   . HOH G 6 .   ? 9.232  16.119  -16.732 1.00 65.68  ? 515 HOH A O   1 
HETATM 4060 O  O   . HOH G 6 .   ? 34.874 28.213  -11.982 1.00 58.47  ? 516 HOH A O   1 
HETATM 4061 O  O   . HOH G 6 .   ? 32.675 20.734  -8.969  1.00 35.29  ? 517 HOH A O   1 
HETATM 4062 O  O   . HOH G 6 .   ? 14.617 27.109  5.291   1.00 53.87  ? 518 HOH A O   1 
HETATM 4063 O  O   . HOH G 6 .   ? 20.861 38.117  5.419   1.00 45.18  ? 519 HOH A O   1 
HETATM 4064 O  O   . HOH G 6 .   ? 33.088 45.900  9.808   1.00 69.39  ? 520 HOH A O   1 
HETATM 4065 O  O   . HOH G 6 .   ? 19.867 73.092  -15.964 1.00 45.86  ? 521 HOH A O   1 
HETATM 4066 O  O   . HOH G 6 .   ? 23.707 46.222  7.234   1.00 73.00  ? 522 HOH A O   1 
HETATM 4067 O  O   . HOH G 6 .   ? 8.507  27.421  -22.104 1.00 53.84  ? 523 HOH A O   1 
HETATM 4068 O  O   . HOH G 6 .   ? 14.127 70.913  11.609  1.00 70.04  ? 524 HOH A O   1 
HETATM 4069 O  O   . HOH G 6 .   ? 12.836 25.969  10.788  1.00 72.04  ? 525 HOH A O   1 
HETATM 4070 O  O   . HOH G 6 .   ? 14.708 27.839  9.116   1.00 76.23  ? 526 HOH A O   1 
HETATM 4071 O  O   . HOH G 6 .   ? 27.287 16.481  -1.948  1.00 71.05  ? 527 HOH A O   1 
HETATM 4072 O  O   . HOH G 6 .   ? 18.965 29.514  -5.464  1.00 72.57  ? 528 HOH A O   1 
HETATM 4073 O  O   . HOH G 6 .   ? 19.747 33.221  5.120   1.00 79.01  ? 529 HOH A O   1 
HETATM 4074 O  O   . HOH G 6 .   ? 28.960 31.634  4.437   1.00 68.53  ? 530 HOH A O   1 
HETATM 4075 O  O   . HOH G 6 .   ? 21.143 53.156  4.558   1.00 67.19  ? 531 HOH A O   1 
HETATM 4076 O  O   . HOH G 6 .   ? 9.705  29.380  -20.617 1.00 49.60  ? 532 HOH A O   1 
HETATM 4077 O  O   . HOH G 6 .   ? 34.094 21.185  -6.024  1.00 63.53  ? 533 HOH A O   1 
HETATM 4078 O  O   . HOH G 6 .   ? 8.675  64.960  -9.724  1.00 76.88  ? 534 HOH A O   1 
HETATM 4079 O  O   . HOH G 6 .   ? 25.541 80.057  0.200   1.00 51.46  ? 535 HOH A O   1 
HETATM 4080 O  O   . HOH G 6 .   ? 28.677 40.581  -16.842 1.00 52.58  ? 536 HOH A O   1 
HETATM 4081 O  O   . HOH G 6 .   ? 20.834 10.554  -7.182  1.00 75.28  ? 537 HOH A O   1 
HETATM 4082 O  O   . HOH G 6 .   ? 21.137 48.960  8.836   1.00 82.49  ? 538 HOH A O   1 
HETATM 4083 O  O   . HOH G 6 .   ? 9.981  40.805  6.626   1.00 57.10  ? 539 HOH A O   1 
HETATM 4084 O  O   . HOH G 6 .   ? 8.915  24.657  -21.692 1.00 73.60  ? 540 HOH A O   1 
HETATM 4085 O  O   . HOH G 6 .   ? 3.571  27.037  -15.631 1.00 54.17  ? 541 HOH A O   1 
HETATM 4086 O  O   . HOH G 6 .   ? 9.192  24.735  10.783  1.00 70.39  ? 542 HOH A O   1 
HETATM 4087 O  O   . HOH G 6 .   ? 29.791 54.666  -16.333 1.00 76.07  ? 543 HOH A O   1 
HETATM 4088 O  O   . HOH G 6 .   ? 37.354 65.843  -11.312 1.00 75.27  ? 544 HOH A O   1 
HETATM 4089 O  O   . HOH G 6 .   ? 20.965 40.192  -6.014  1.00 55.98  ? 545 HOH A O   1 
HETATM 4090 O  O   . HOH G 6 .   ? 17.286 61.952  -15.423 1.00 53.75  ? 546 HOH A O   1 
HETATM 4091 O  O   . HOH G 6 .   ? 25.430 52.127  -18.334 1.00 41.91  ? 547 HOH A O   1 
HETATM 4092 O  O   . HOH G 6 .   ? 14.874 27.988  12.010  1.00 72.25  ? 548 HOH A O   1 
HETATM 4093 O  O   . HOH G 6 .   ? 20.494 79.019  -15.629 1.00 47.42  ? 549 HOH A O   1 
HETATM 4094 O  O   . HOH G 6 .   ? 38.502 27.296  9.825   1.00 60.11  ? 550 HOH A O   1 
HETATM 4095 O  O   . HOH G 6 .   ? 21.710 36.849  -2.369  1.00 52.65  ? 551 HOH A O   1 
HETATM 4096 O  O   . HOH G 6 .   ? 24.736 70.500  10.037  1.00 65.00  ? 552 HOH A O   1 
HETATM 4097 O  O   . HOH G 6 .   ? 31.348 66.605  8.856   1.00 62.29  ? 553 HOH A O   1 
HETATM 4098 O  O   . HOH G 6 .   ? 7.415  63.226  -3.248  1.00 69.53  ? 554 HOH A O   1 
HETATM 4099 O  O   . HOH G 6 .   ? 34.404 43.588  10.452  1.00 70.41  ? 555 HOH A O   1 
HETATM 4100 O  O   . HOH G 6 .   ? 35.936 63.656  -12.154 1.00 51.14  ? 556 HOH A O   1 
HETATM 4101 O  O   . HOH G 6 .   ? 8.840  29.954  -23.540 1.00 69.71  ? 557 HOH A O   1 
HETATM 4102 O  O   . HOH G 6 .   ? 33.920 65.187  -16.733 1.00 74.10  ? 558 HOH A O   1 
HETATM 4103 O  O   . HOH G 6 .   ? 20.212 31.873  -25.012 1.00 55.86  ? 559 HOH A O   1 
HETATM 4104 O  O   . HOH G 6 .   ? 16.405 78.020  -11.538 1.00 77.49  ? 560 HOH A O   1 
HETATM 4105 O  O   . HOH G 6 .   ? 36.003 66.192  11.205  1.00 60.95  ? 561 HOH A O   1 
HETATM 4106 O  O   . HOH G 6 .   ? 33.864 26.285  -20.572 1.00 75.91  ? 562 HOH A O   1 
HETATM 4107 O  O   . HOH G 6 .   ? 5.185  65.170  -8.834  1.00 71.49  ? 563 HOH A O   1 
HETATM 4108 O  O   . HOH G 6 .   ? -3.607 27.927  -7.399  1.00 69.75  ? 564 HOH A O   1 
HETATM 4109 O  O   . HOH G 6 .   ? 20.161 55.295  2.353   1.00 58.20  ? 565 HOH A O   1 
HETATM 4110 O  O   . HOH G 6 .   ? 15.540 26.493  -26.799 1.00 71.45  ? 566 HOH A O   1 
HETATM 4111 O  O   . HOH G 6 .   ? 25.785 62.323  13.192  1.00 53.81  ? 567 HOH A O   1 
HETATM 4112 O  O   . HOH G 6 .   ? 30.725 29.594  4.896   1.00 70.01  ? 568 HOH A O   1 
HETATM 4113 O  O   . HOH G 6 .   ? 29.095 43.216  -18.201 1.00 78.62  ? 569 HOH A O   1 
HETATM 4114 O  O   . HOH G 6 .   ? 34.066 29.546  -14.242 1.00 68.79  ? 570 HOH A O   1 
HETATM 4115 O  O   . HOH G 6 .   ? 31.583 29.848  2.295   1.00 72.22  ? 571 HOH A O   1 
HETATM 4116 O  O   . HOH G 6 .   ? -5.877 30.036  -1.814  1.00 72.90  ? 572 HOH A O   1 
HETATM 4117 O  O   . HOH G 6 .   ? 17.995 32.405  10.045  1.00 53.72  ? 573 HOH A O   1 
HETATM 4118 O  O   . HOH G 6 .   ? 14.933 24.266  10.335  1.00 76.33  ? 574 HOH A O   1 
HETATM 4119 O  O   . HOH G 6 .   ? 23.601 37.350  7.040   1.00 55.88  ? 575 HOH A O   1 
HETATM 4120 O  O   . HOH G 6 .   ? 16.777 66.961  13.986  1.00 77.40  ? 576 HOH A O   1 
HETATM 4121 O  O   . HOH G 6 .   ? 38.474 47.546  7.574   1.00 71.13  ? 577 HOH A O   1 
HETATM 4122 O  O   . HOH G 6 .   ? 40.309 61.852  -1.351  1.00 64.34  ? 578 HOH A O   1 
HETATM 4123 O  O   . HOH G 6 .   ? 19.727 48.965  1.799   1.00 73.64  ? 579 HOH A O   1 
HETATM 4124 O  O   . HOH G 6 .   ? 13.431 19.112  -32.911 1.00 77.86  ? 580 HOH A O   1 
HETATM 4125 O  O   . HOH G 6 .   ? 25.375 58.879  14.574  1.00 70.04  ? 581 HOH A O   1 
HETATM 4126 O  O   . HOH G 6 .   ? 28.216 20.676  4.599   1.00 65.81  ? 582 HOH A O   1 
HETATM 4127 O  O   . HOH G 6 .   ? 10.421 34.305  -24.019 1.00 65.65  ? 583 HOH A O   1 
HETATM 4128 O  O   . HOH G 6 .   ? 14.739 24.528  13.128  1.00 65.82  ? 584 HOH A O   1 
HETATM 4129 O  O   . HOH G 6 .   ? 34.170 67.298  -20.833 1.00 74.01  ? 585 HOH A O   1 
HETATM 4130 O  O   . HOH G 6 .   ? 4.798  25.848  -19.866 1.00 69.29  ? 586 HOH A O   1 
HETATM 4131 O  O   . HOH G 6 .   ? 13.599 77.305  -12.084 1.00 65.24  ? 587 HOH A O   1 
HETATM 4132 O  O   . HOH G 6 .   ? 35.473 28.573  -18.466 1.00 71.85  ? 588 HOH A O   1 
HETATM 4133 O  O   . HOH G 6 .   ? 34.440 33.114  -14.723 1.00 55.93  ? 589 HOH A O   1 
HETATM 4134 O  O   . HOH G 6 .   ? 4.380  40.549  -4.968  1.00 65.40  ? 590 HOH A O   1 
HETATM 4135 O  O   . HOH G 6 .   ? 6.146  30.779  -23.266 1.00 75.13  ? 591 HOH A O   1 
HETATM 4136 O  O   . HOH G 6 .   ? 4.972  28.371  -20.906 1.00 72.99  ? 592 HOH A O   1 
HETATM 4137 O  O   . HOH G 6 .   ? 15.398 76.883  -15.863 1.00 75.67  ? 593 HOH A O   1 
HETATM 4138 O  O   . HOH G 6 .   ? 5.144  40.421  -0.218  1.00 67.21  ? 594 HOH A O   1 
HETATM 4139 O  O   . HOH G 6 .   ? 30.062 47.596  -19.231 1.00 61.75  ? 595 HOH A O   1 
HETATM 4140 O  O   . HOH G 6 .   ? 32.274 46.941  -17.749 1.00 53.61  ? 596 HOH A O   1 
HETATM 4141 O  O   . HOH G 6 .   ? 4.131  23.937  -21.695 1.00 55.81  ? 597 HOH A O   1 
HETATM 4142 O  O   . HOH G 6 .   ? 30.616 31.686  -18.814 1.00 47.67  ? 598 HOH A O   1 
HETATM 4143 O  O   . HOH G 6 .   ? 1.097  28.774  -20.054 1.00 61.43  ? 599 HOH A O   1 
HETATM 4144 O  O   . HOH G 6 .   ? 36.426 29.050  -22.616 1.00 77.96  ? 600 HOH A O   1 
HETATM 4145 O  O   . HOH G 6 .   ? 3.545  27.660  -23.393 1.00 81.75  ? 601 HOH A O   1 
HETATM 4146 O  O   . HOH G 6 .   ? 37.281 30.383  -20.198 1.00 64.91  ? 602 HOH A O   1 
HETATM 4147 O  O   . HOH H 6 .   ? 20.128 6.888   -11.814 1.00 50.38  ? 201 HOH H O   1 
HETATM 4148 O  O   . HOH H 6 .   ? 10.584 5.219   -12.992 1.00 52.49  ? 202 HOH H O   1 
HETATM 4149 O  O   . HOH H 6 .   ? 11.231 -12.734 -17.917 1.00 75.07  ? 203 HOH H O   1 
HETATM 4150 O  O   . HOH H 6 .   ? 21.553 14.255  -12.142 1.00 38.29  ? 204 HOH H O   1 
HETATM 4151 O  O   . HOH H 6 .   ? 1.355  2.398   -6.379  1.00 79.31  ? 205 HOH H O   1 
HETATM 4152 O  O   . HOH H 6 .   ? 22.990 4.010   -2.342  1.00 60.89  ? 206 HOH H O   1 
HETATM 4153 O  O   . HOH H 6 .   ? 21.742 2.917   -34.042 1.00 70.96  ? 207 HOH H O   1 
HETATM 4154 O  O   . HOH H 6 .   ? 24.187 1.323   -27.057 1.00 42.08  ? 208 HOH H O   1 
HETATM 4155 O  O   . HOH H 6 .   ? 28.588 -12.039 -20.227 1.00 80.86  ? 209 HOH H O   1 
HETATM 4156 O  O   . HOH H 6 .   ? 23.116 -10.151 -13.871 1.00 73.27  ? 210 HOH H O   1 
HETATM 4157 O  O   . HOH H 6 .   ? 19.577 5.338   -32.962 1.00 61.91  ? 211 HOH H O   1 
HETATM 4158 O  O   . HOH H 6 .   ? 33.640 -8.192  -25.264 1.00 80.79  ? 212 HOH H O   1 
HETATM 4159 O  O   . HOH H 6 .   ? 17.397 -14.155 -15.172 1.00 59.13  ? 213 HOH H O   1 
HETATM 4160 O  O   . HOH H 6 .   ? 34.911 -9.066  -28.438 1.00 75.78  ? 214 HOH H O   1 
HETATM 4161 O  O   . HOH H 6 .   ? 11.742 -4.162  -6.075  1.00 68.85  ? 215 HOH H O   1 
HETATM 4162 O  O   . HOH H 6 .   ? 14.778 11.151  -14.835 1.00 64.25  ? 216 HOH H O   1 
HETATM 4163 O  O   . HOH H 6 .   ? 26.027 -11.207 -20.685 1.00 49.31  ? 217 HOH H O   1 
HETATM 4164 O  O   . HOH H 6 .   ? 0.204  -9.137  -16.375 1.00 60.26  ? 218 HOH H O   1 
HETATM 4165 O  O   . HOH H 6 .   ? 6.440  -0.158  -4.544  1.00 68.72  ? 219 HOH H O   1 
HETATM 4166 O  O   . HOH H 6 .   ? 31.034 -5.082  -27.634 1.00 35.85  ? 220 HOH H O   1 
HETATM 4167 O  O   . HOH H 6 .   ? 24.421 -0.293  -29.927 1.00 63.16  ? 221 HOH H O   1 
HETATM 4168 O  O   . HOH H 6 .   ? 20.418 -13.291 -13.128 1.00 53.50  ? 222 HOH H O   1 
HETATM 4169 O  O   . HOH H 6 .   ? 2.966  -2.335  -34.842 1.00 78.27  ? 223 HOH H O   1 
HETATM 4170 O  O   . HOH H 6 .   ? 5.700  -1.314  -38.295 1.00 80.59  ? 224 HOH H O   1 
HETATM 4171 O  O   . HOH H 6 .   ? 22.813 7.836   -6.066  1.00 51.96  ? 225 HOH H O   1 
HETATM 4172 O  O   . HOH H 6 .   ? 5.503  8.716   -27.682 1.00 67.85  ? 226 HOH H O   1 
HETATM 4173 O  O   . HOH H 6 .   ? 11.680 -14.641 -36.870 1.00 72.38  ? 227 HOH H O   1 
HETATM 4174 O  O   . HOH H 6 .   ? -2.311 0.368   -3.740  1.00 77.10  ? 228 HOH H O   1 
HETATM 4175 O  O   . HOH H 6 .   ? -0.846 2.028   -1.287  1.00 72.05  ? 229 HOH H O   1 
HETATM 4176 O  O   . HOH I 6 .   ? 44.734 4.007   -22.885 1.00 75.51  ? 301 HOH L O   1 
HETATM 4177 O  O   . HOH I 6 .   ? 24.812 8.913   -29.857 1.00 52.91  ? 302 HOH L O   1 
HETATM 4178 O  O   . HOH I 6 .   ? 38.318 -3.865  1.190   1.00 39.32  ? 303 HOH L O   1 
HETATM 4179 O  O   . HOH I 6 .   ? 35.976 7.171   -29.940 1.00 41.37  ? 304 HOH L O   1 
HETATM 4180 O  O   . HOH I 6 .   ? 41.136 10.125  -13.710 1.00 49.48  ? 305 HOH L O   1 
HETATM 4181 O  O   . HOH I 6 .   ? 41.118 -0.155  -26.754 1.00 52.71  ? 306 HOH L O   1 
HETATM 4182 O  O   . HOH I 6 .   ? 36.016 0.119   -26.335 1.00 41.95  ? 307 HOH L O   1 
HETATM 4183 O  O   . HOH I 6 .   ? 43.109 8.179   -25.516 1.00 68.68  ? 308 HOH L O   1 
HETATM 4184 O  O   . HOH I 6 .   ? 36.004 10.920  -16.096 1.00 31.59  ? 309 HOH L O   1 
HETATM 4185 O  O   . HOH I 6 .   ? 28.510 -5.714  -10.257 1.00 40.04  ? 310 HOH L O   1 
HETATM 4186 O  O   . HOH I 6 .   ? 26.848 0.927   -26.556 1.00 37.32  ? 311 HOH L O   1 
HETATM 4187 O  O   . HOH I 6 .   ? 33.040 -6.404  -21.752 1.00 55.07  ? 312 HOH L O   1 
HETATM 4188 O  O   . HOH I 6 .   ? 34.616 -2.420  -5.721  1.00 35.70  ? 313 HOH L O   1 
HETATM 4189 O  O   . HOH I 6 .   ? 40.243 4.947   -26.104 1.00 35.90  ? 314 HOH L O   1 
HETATM 4190 O  O   . HOH I 6 .   ? 23.669 12.626  -4.548  1.00 47.13  ? 315 HOH L O   1 
HETATM 4191 O  O   . HOH I 6 .   ? 27.310 16.391  -10.579 1.00 25.10  ? 316 HOH L O   1 
HETATM 4192 O  O   . HOH I 6 .   ? 37.483 -1.883  -24.872 1.00 33.59  ? 317 HOH L O   1 
HETATM 4193 O  O   . HOH I 6 .   ? 19.383 11.030  -32.755 1.00 66.40  ? 318 HOH L O   1 
HETATM 4194 O  O   . HOH I 6 .   ? 36.272 11.076  -6.182  1.00 42.34  ? 319 HOH L O   1 
HETATM 4195 O  O   . HOH I 6 .   ? 39.148 17.193  -14.785 1.00 43.44  ? 320 HOH L O   1 
HETATM 4196 O  O   . HOH I 6 .   ? 47.572 2.056   -0.754  1.00 49.24  ? 321 HOH L O   1 
HETATM 4197 O  O   . HOH I 6 .   ? 32.940 13.747  -5.726  1.00 36.50  ? 322 HOH L O   1 
HETATM 4198 O  O   . HOH I 6 .   ? 30.338 6.221   -34.770 1.00 65.71  ? 323 HOH L O   1 
HETATM 4199 O  O   . HOH I 6 .   ? 21.564 9.609   -4.220  1.00 75.97  ? 324 HOH L O   1 
HETATM 4200 O  O   . HOH I 6 .   ? 43.287 -5.328  1.124   1.00 46.75  ? 325 HOH L O   1 
HETATM 4201 O  O   . HOH I 6 .   ? 40.868 -10.684 -22.078 1.00 49.81  ? 326 HOH L O   1 
HETATM 4202 O  O   . HOH I 6 .   ? 47.065 9.828   -6.853  1.00 72.24  ? 327 HOH L O   1 
HETATM 4203 O  O   . HOH I 6 .   ? 25.334 6.751   -37.079 1.00 53.73  ? 328 HOH L O   1 
HETATM 4204 O  O   . HOH I 6 .   ? 23.606 6.281   -0.843  1.00 68.88  ? 329 HOH L O   1 
HETATM 4205 O  O   . HOH I 6 .   ? 44.632 9.888   -21.533 1.00 64.21  ? 330 HOH L O   1 
HETATM 4206 O  O   . HOH I 6 .   ? 32.625 2.160   1.515   1.00 48.80  ? 331 HOH L O   1 
HETATM 4207 O  O   . HOH I 6 .   ? 36.968 -10.668 -3.079  1.00 51.64  ? 332 HOH L O   1 
HETATM 4208 O  O   . HOH I 6 .   ? 45.289 7.818   -1.098  1.00 57.59  ? 333 HOH L O   1 
HETATM 4209 O  O   . HOH I 6 .   ? 32.049 -5.087  -2.127  1.00 44.59  ? 334 HOH L O   1 
HETATM 4210 O  O   . HOH I 6 .   ? 39.203 11.339  0.737   1.00 51.45  ? 335 HOH L O   1 
HETATM 4211 O  O   . HOH I 6 .   ? 38.499 -9.216  -23.020 1.00 54.01  ? 336 HOH L O   1 
HETATM 4212 O  O   . HOH I 6 .   ? 32.680 -0.664  -4.639  1.00 43.61  ? 337 HOH L O   1 
HETATM 4213 O  O   . HOH I 6 .   ? 22.218 -13.802 -15.126 1.00 60.44  ? 338 HOH L O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLY A 17  ? 1.4294 0.8595 0.7476 0.2108  -0.2140 -0.1235 -1  GLY A N   
2    C  CA  . GLY A 17  ? 1.3523 0.8557 0.7601 0.2178  -0.2330 -0.1262 -1  GLY A CA  
3    C  C   . GLY A 17  ? 1.3261 0.8931 0.8121 0.2102  -0.2203 -0.1298 -1  GLY A C   
4    O  O   . GLY A 17  ? 1.2611 0.8868 0.8217 0.2140  -0.2277 -0.1318 -1  GLY A O   
5    N  N   . SER A 18  ? 1.2884 0.8398 0.7555 0.1993  -0.1992 -0.1310 0   SER A N   
6    C  CA  . SER A 18  ? 1.2246 0.8276 0.7564 0.1913  -0.1838 -0.1338 0   SER A CA  
7    C  C   . SER A 18  ? 1.2117 0.8428 0.7714 0.1804  -0.1412 -0.1233 0   SER A C   
8    O  O   . SER A 18  ? 1.1627 0.8300 0.7686 0.1731  -0.1236 -0.1236 0   SER A O   
9    C  CB  . SER A 18  ? 1.3170 0.8854 0.8139 0.1867  -0.1887 -0.1424 0   SER A CB  
10   O  OG  . SER A 18  ? 1.4810 0.9943 0.9097 0.1774  -0.1605 -0.1377 0   SER A OG  
11   N  N   . GLU A 19  ? 1.1684 0.7803 0.7003 0.1800  -0.1267 -0.1150 89  GLU A N   
12   C  CA  . GLU A 19  ? 1.1225 0.7559 0.6803 0.1716  -0.0917 -0.1066 89  GLU A CA  
13   C  C   . GLU A 19  ? 1.0971 0.7820 0.7105 0.1775  -0.0981 -0.1019 89  GLU A C   
14   O  O   . GLU A 19  ? 1.0989 0.7816 0.7060 0.1875  -0.1224 -0.1028 89  GLU A O   
15   C  CB  . GLU A 19  ? 1.1935 0.7702 0.6876 0.1675  -0.0721 -0.1025 89  GLU A CB  
16   C  CG  . GLU A 19  ? 1.3977 0.9115 0.8268 0.1596  -0.0557 -0.1063 89  GLU A CG  
17   C  CD  . GLU A 19  ? 1.7452 1.1961 1.1082 0.1556  -0.0331 -0.1031 89  GLU A CD  
18   O  OE1 . GLU A 19  ? 1.6974 1.1200 1.0441 0.1435  0.0033  -0.1039 89  GLU A OE1 
19   O  OE2 . GLU A 19  ? 1.7248 1.1533 1.0546 0.1642  -0.0497 -0.1002 89  GLU A OE2 
20   N  N   . GLY A 20  ? 0.9893 0.7150 0.6532 0.1717  -0.0767 -0.0973 90  GLY A N   
21   C  CA  . GLY A 20  ? 0.9315 0.7007 0.6430 0.1758  -0.0781 -0.0924 90  GLY A CA  
22   C  C   . GLY A 20  ? 0.9467 0.7442 0.6902 0.1847  -0.1026 -0.0964 90  GLY A C   
23   O  O   . GLY A 20  ? 0.9296 0.7387 0.6839 0.1911  -0.1111 -0.0937 90  GLY A O   
24   N  N   . ARG A 21  ? 0.8906 0.6981 0.6523 0.1847  -0.1126 -0.1040 91  ARG A N   
25   C  CA  . ARG A 21  ? 0.8652 0.7003 0.6682 0.1918  -0.1328 -0.1112 91  ARG A CA  
26   C  C   . ARG A 21  ? 0.8528 0.7306 0.7089 0.1905  -0.1176 -0.1069 91  ARG A C   
27   O  O   . ARG A 21  ? 0.8261 0.7162 0.6953 0.1836  -0.0967 -0.1022 91  ARG A O   
28   C  CB  . ARG A 21  ? 0.8801 0.7125 0.6909 0.1908  -0.1451 -0.1221 91  ARG A CB  
29   C  CG  . ARG A 21  ? 1.0608 0.8418 0.8097 0.1927  -0.1631 -0.1274 91  ARG A CG  
30   C  CD  . ARG A 21  ? 1.1687 0.9471 0.9282 0.1930  -0.1812 -0.1402 91  ARG A CD  
31   N  NE  . ARG A 21  ? 1.1981 1.0041 0.9933 0.1836  -0.1578 -0.1402 91  ARG A NE  
32   C  CZ  . ARG A 21  ? 1.3226 1.1681 1.1796 0.1834  -0.1586 -0.1470 91  ARG A CZ  
33   N  NH1 . ARG A 21  ? 1.1583 1.0225 1.0544 0.1916  -0.1806 -0.1559 91  ARG A NH1 
34   N  NH2 . ARG A 21  ? 1.1139 0.9786 0.9957 0.1750  -0.1356 -0.1456 91  ARG A NH2 
35   N  N   . TRP A 22  ? 0.7883 0.6838 0.6717 0.1975  -0.1280 -0.1088 92  TRP A N   
36   C  CA  . TRP A 22  ? 0.7446 0.6709 0.6688 0.1969  -0.1132 -0.1051 92  TRP A CA  
37   C  C   . TRP A 22  ? 0.7780 0.7230 0.7447 0.2031  -0.1243 -0.1140 92  TRP A C   
38   O  O   . TRP A 22  ? 0.7920 0.7278 0.7573 0.2100  -0.1478 -0.1217 92  TRP A O   
39   C  CB  . TRP A 22  ? 0.7215 0.6437 0.6273 0.1968  -0.1026 -0.0942 92  TRP A CB  
40   C  CG  . TRP A 22  ? 0.7534 0.6594 0.6360 0.2037  -0.1176 -0.0936 92  TRP A CG  
41   C  CD1 . TRP A 22  ? 0.8239 0.6973 0.6591 0.2044  -0.1244 -0.0916 92  TRP A CD1 
42   C  CD2 . TRP A 22  ? 0.7434 0.6608 0.6467 0.2106  -0.1252 -0.0949 92  TRP A CD2 
43   N  NE1 . TRP A 22  ? 0.8300 0.6943 0.6541 0.2121  -0.1377 -0.0911 92  TRP A NE1 
44   C  CE2 . TRP A 22  ? 0.8203 0.7133 0.6884 0.2161  -0.1392 -0.0933 92  TRP A CE2 
45   C  CE3 . TRP A 22  ? 0.7349 0.6769 0.6818 0.2123  -0.1192 -0.0978 92  TRP A CE3 
46   C  CZ2 . TRP A 22  ? 0.8117 0.7081 0.6909 0.2238  -0.1496 -0.0944 92  TRP A CZ2 
47   C  CZ3 . TRP A 22  ? 0.7544 0.6990 0.7130 0.2192  -0.1269 -0.0995 92  TRP A CZ3 
48   C  CH2 . TRP A 22  ? 0.7856 0.7097 0.7128 0.2252  -0.1433 -0.0978 92  TRP A CH2 
49   N  N   . ARG A 23  ? 0.7037 0.6712 0.7076 0.2008  -0.1068 -0.1134 93  ARG A N   
50   C  CA  . ARG A 23  ? 0.6893 0.6743 0.7408 0.2046  -0.1077 -0.1225 93  ARG A CA  
51   C  C   . ARG A 23  ? 0.7268 0.7171 0.7833 0.2046  -0.0888 -0.1148 93  ARG A C   
52   O  O   . ARG A 23  ? 0.7154 0.7007 0.7485 0.2005  -0.0737 -0.1039 93  ARG A O   
53   C  CB  . ARG A 23  ? 0.6788 0.6783 0.7711 0.2003  -0.0998 -0.1326 93  ARG A CB  
54   C  CG  . ARG A 23  ? 0.8175 0.8174 0.9310 0.2040  -0.1253 -0.1479 93  ARG A CG  
55   C  CD  . ARG A 23  ? 0.9041 0.9223 1.0716 0.1998  -0.1153 -0.1606 93  ARG A CD  
56   N  NE  . ARG A 23  ? 0.9685 1.0030 1.1882 0.2007  -0.0998 -0.1672 93  ARG A NE  
57   C  CZ  . ARG A 23  ? 1.1165 1.1641 1.3836 0.1954  -0.0785 -0.1761 93  ARG A CZ  
58   N  NH1 . ARG A 23  ? 0.9395 0.9890 1.2101 0.1892  -0.0719 -0.1791 93  ARG A NH1 
59   N  NH2 . ARG A 23  ? 0.9432 0.9992 1.2538 0.1957  -0.0606 -0.1826 93  ARG A NH2 
60   N  N   . VAL A 24  ? 0.6842 0.6823 0.7727 0.2094  -0.0903 -0.1215 94  VAL A N   
61   C  CA  . VAL A 24  ? 0.6754 0.6733 0.7668 0.2093  -0.0711 -0.1158 94  VAL A CA  
62   C  C   . VAL A 24  ? 0.7188 0.7179 0.8223 0.2029  -0.0437 -0.1144 94  VAL A C   
63   O  O   . VAL A 24  ? 0.7088 0.7166 0.8430 0.1997  -0.0383 -0.1233 94  VAL A O   
64   C  CB  . VAL A 24  ? 0.7275 0.7304 0.8510 0.2156  -0.0769 -0.1241 94  VAL A CB  
65   C  CG1 . VAL A 24  ? 0.7357 0.7286 0.8300 0.2225  -0.1001 -0.1201 94  VAL A CG1 
66   C  CG2 . VAL A 24  ? 0.7245 0.7428 0.9090 0.2172  -0.0830 -0.1421 94  VAL A CG2 
67   N  N   . ILE A 25  ? 0.6801 0.6666 0.7552 0.2014  -0.0277 -0.1033 95  ILE A N   
68   C  CA  . ILE A 25  ? 0.6834 0.6598 0.7547 0.1966  -0.0030 -0.0998 95  ILE A CA  
69   C  C   . ILE A 25  ? 0.7469 0.7074 0.8150 0.1972  0.0176  -0.0985 95  ILE A C   
70   O  O   . ILE A 25  ? 0.7447 0.7001 0.7973 0.2009  0.0113  -0.0946 95  ILE A O   
71   C  CB  . ILE A 25  ? 0.7231 0.6899 0.7556 0.1943  -0.0041 -0.0880 95  ILE A CB  
72   C  CG1 . ILE A 25  ? 0.7296 0.6872 0.7259 0.1972  -0.0150 -0.0777 95  ILE A CG1 
73   C  CG2 . ILE A 25  ? 0.7237 0.7018 0.7643 0.1915  -0.0141 -0.0914 95  ILE A CG2 
74   C  CD1 . ILE A 25  ? 0.8234 0.7679 0.7902 0.1957  -0.0127 -0.0677 95  ILE A CD1 
75   N  N   . PRO A 26  ? 0.7183 0.6656 0.7955 0.1931  0.0444  -0.1014 96  PRO A N   
76   C  CA  . PRO A 26  ? 0.7413 0.6630 0.8047 0.1930  0.0677  -0.0999 96  PRO A CA  
77   C  C   . PRO A 26  ? 0.8118 0.7069 0.8135 0.1950  0.0648  -0.0848 96  PRO A C   
78   O  O   . PRO A 26  ? 0.7976 0.6942 0.7743 0.1956  0.0492  -0.0765 96  PRO A O   
79   C  CB  . PRO A 26  ? 0.7797 0.6876 0.8615 0.1873  0.0984  -0.1067 96  PRO A CB  
80   C  CG  . PRO A 26  ? 0.8219 0.7404 0.9029 0.1851  0.0897  -0.1047 96  PRO A CG  
81   C  CD  . PRO A 26  ? 0.7373 0.6867 0.8331 0.1881  0.0571  -0.1064 96  PRO A CD  
82   N  N   . TYR A 27  ? 0.7981 0.6676 0.7782 0.1960  0.0793  -0.0827 97  TYR A N   
83   C  CA  . TYR A 27  ? 0.8214 0.6609 0.7430 0.1986  0.0748  -0.0706 97  TYR A CA  
84   C  C   . TYR A 27  ? 0.8985 0.7092 0.7778 0.1980  0.0783  -0.0620 97  TYR A C   
85   O  O   . TYR A 27  ? 0.8972 0.6990 0.7418 0.2013  0.0591  -0.0530 97  TYR A O   
86   C  CB  . TYR A 27  ? 0.8672 0.6789 0.7736 0.1990  0.0942  -0.0721 97  TYR A CB  
87   C  CG  . TYR A 27  ? 0.9219 0.6965 0.7642 0.2019  0.0890  -0.0610 97  TYR A CG  
88   C  CD1 . TYR A 27  ? 0.9317 0.7179 0.7614 0.2058  0.0641  -0.0559 97  TYR A CD1 
89   C  CD2 . TYR A 27  ? 0.9822 0.7053 0.7741 0.2009  0.1087  -0.0564 97  TYR A CD2 
90   C  CE1 . TYR A 27  ? 0.9716 0.7243 0.7470 0.2086  0.0564  -0.0476 97  TYR A CE1 
91   C  CE2 . TYR A 27  ? 1.0301 0.7143 0.7597 0.2047  0.0990  -0.0473 97  TYR A CE2 
92   C  CZ  . TYR A 27  ? 1.1067 0.8084 0.8319 0.2084  0.0718  -0.0435 97  TYR A CZ  
93   O  OH  . TYR A 27  ? 1.1568 0.8207 0.8252 0.2122  0.0598  -0.0364 97  TYR A OH  
94   N  N   . ASP A 28  ? 0.8747 0.6698 0.7597 0.1942  0.1020  -0.0658 98  ASP A N   
95   C  CA  . ASP A 28  ? 0.9043 0.6651 0.7477 0.1942  0.1083  -0.0584 98  ASP A CA  
96   C  C   . ASP A 28  ? 0.9264 0.7061 0.7678 0.1963  0.0822  -0.0523 98  ASP A C   
97   O  O   . ASP A 28  ? 0.9481 0.6977 0.7458 0.1998  0.0740  -0.0436 98  ASP A O   
98   C  CB  . ASP A 28  ? 0.9518 0.6954 0.8103 0.1887  0.1423  -0.0657 98  ASP A CB  
99   C  CG  . ASP A 28  ? 1.0630 0.8518 0.9934 0.1842  0.1461  -0.0786 98  ASP A CG  
100  O  OD1 . ASP A 28  ? 1.0394 0.8630 0.9916 0.1848  0.1227  -0.0783 98  ASP A OD1 
101  O  OD2 . ASP A 28  ? 1.1509 0.9368 1.1158 0.1799  0.1733  -0.0901 98  ASP A OD2 
102  N  N   . VAL A 29  ? 0.8362 0.6609 0.7238 0.1943  0.0694  -0.0577 99  VAL A N   
103  C  CA  . VAL A 29  ? 0.8109 0.6534 0.7023 0.1947  0.0499  -0.0538 99  VAL A CA  
104  C  C   . VAL A 29  ? 0.8371 0.6914 0.7184 0.1982  0.0239  -0.0486 99  VAL A C   
105  O  O   . VAL A 29  ? 0.8195 0.6847 0.7045 0.1982  0.0101  -0.0460 99  VAL A O   
106  C  CB  . VAL A 29  ? 0.8319 0.7076 0.7693 0.1902  0.0512  -0.0624 99  VAL A CB  
107  C  CG1 . VAL A 29  ? 0.8466 0.7078 0.7917 0.1864  0.0753  -0.0663 99  VAL A CG1 
108  C  CG2 . VAL A 29  ? 0.8067 0.7106 0.7812 0.1896  0.0460  -0.0718 99  VAL A CG2 
109  N  N   . LEU A 30  ? 0.7911 0.6418 0.6620 0.2005  0.0197  -0.0480 100 LEU A N   
110  C  CA  . LEU A 30  ? 0.7740 0.6335 0.6368 0.2032  -0.0015 -0.0443 100 LEU A CA  
111  C  C   . LEU A 30  ? 0.8366 0.6728 0.6679 0.2067  -0.0144 -0.0371 100 LEU A C   
112  O  O   . LEU A 30  ? 0.8669 0.6676 0.6650 0.2092  -0.0077 -0.0334 100 LEU A O   
113  C  CB  . LEU A 30  ? 0.7795 0.6352 0.6357 0.2051  -0.0002 -0.0454 100 LEU A CB  
114  C  CG  . LEU A 30  ? 0.8186 0.6988 0.7092 0.2040  0.0032  -0.0533 100 LEU A CG  
115  C  CD1 . LEU A 30  ? 0.8341 0.7028 0.7145 0.2064  0.0077  -0.0537 100 LEU A CD1 
116  C  CD2 . LEU A 30  ? 0.8216 0.7283 0.7292 0.2038  -0.0150 -0.0548 100 LEU A CD2 
117  N  N   . PRO A 31  ? 0.7695 0.6199 0.6090 0.2074  -0.0331 -0.0359 101 PRO A N   
118  C  CA  . PRO A 31  ? 0.7869 0.6158 0.6048 0.2119  -0.0492 -0.0316 101 PRO A CA  
119  C  C   . PRO A 31  ? 0.8645 0.6698 0.6509 0.2156  -0.0544 -0.0294 101 PRO A C   
120  O  O   . PRO A 31  ? 0.8478 0.6636 0.6391 0.2140  -0.0477 -0.0314 101 PRO A O   
121  C  CB  . PRO A 31  ? 0.7802 0.6349 0.6284 0.2098  -0.0621 -0.0340 101 PRO A CB  
122  C  CG  . PRO A 31  ? 0.8094 0.6897 0.6767 0.2056  -0.0555 -0.0378 101 PRO A CG  
123  C  CD  . PRO A 31  ? 0.7545 0.6357 0.6215 0.2045  -0.0399 -0.0396 101 PRO A CD  
124  N  N   . ASP A 32  ? 0.8599 0.6305 0.6125 0.2211  -0.0674 -0.0258 102 ASP A N   
125  C  CA  . ASP A 32  ? 0.8931 0.6325 0.6071 0.2250  -0.0738 -0.0238 102 ASP A CA  
126  C  C   . ASP A 32  ? 0.9171 0.6787 0.6479 0.2236  -0.0817 -0.0266 102 ASP A C   
127  O  O   . ASP A 32  ? 0.9267 0.6740 0.6355 0.2240  -0.0744 -0.0261 102 ASP A O   
128  C  CB  . ASP A 32  ? 0.9641 0.6626 0.6417 0.2323  -0.0956 -0.0209 102 ASP A CB  
129  C  CG  . ASP A 32  ? 1.1577 0.8185 0.8013 0.2352  -0.0875 -0.0169 102 ASP A CG  
130  O  OD1 . ASP A 32  ? 1.1792 0.8293 0.8096 0.2315  -0.0595 -0.0161 102 ASP A OD1 
131  O  OD2 . ASP A 32  ? 1.2646 0.9036 0.8952 0.2414  -0.1090 -0.0154 102 ASP A OD2 
132  N  N   . TRP A 33  ? 0.8384 0.6316 0.6071 0.2216  -0.0933 -0.0298 103 TRP A N   
133  C  CA  . TRP A 33  ? 0.8148 0.6264 0.5994 0.2197  -0.0987 -0.0327 103 TRP A CA  
134  C  C   . TRP A 33  ? 0.8470 0.6781 0.6414 0.2162  -0.0820 -0.0336 103 TRP A C   
135  O  O   . TRP A 33  ? 0.8391 0.6748 0.6332 0.2159  -0.0840 -0.0348 103 TRP A O   
136  C  CB  . TRP A 33  ? 0.7745 0.6074 0.5959 0.2176  -0.1106 -0.0369 103 TRP A CB  
137  C  CG  . TRP A 33  ? 0.7592 0.6156 0.6100 0.2130  -0.1007 -0.0385 103 TRP A CG  
138  C  CD1 . TRP A 33  ? 0.7973 0.6520 0.6564 0.2136  -0.1015 -0.0380 103 TRP A CD1 
139  C  CD2 . TRP A 33  ? 0.7303 0.6104 0.6012 0.2076  -0.0896 -0.0410 103 TRP A CD2 
140  N  NE1 . TRP A 33  ? 0.7646 0.6426 0.6500 0.2081  -0.0902 -0.0404 103 TRP A NE1 
141  C  CE2 . TRP A 33  ? 0.7678 0.6592 0.6576 0.2045  -0.0834 -0.0423 103 TRP A CE2 
142  C  CE3 . TRP A 33  ? 0.7368 0.6250 0.6070 0.2056  -0.0851 -0.0423 103 TRP A CE3 
143  C  CZ2 . TRP A 33  ? 0.7411 0.6487 0.6452 0.1993  -0.0735 -0.0450 103 TRP A CZ2 
144  C  CZ3 . TRP A 33  ? 0.7399 0.6422 0.6225 0.2012  -0.0765 -0.0447 103 TRP A CZ3 
145  C  CH2 . TRP A 33  ? 0.7395 0.6500 0.6367 0.1981  -0.0709 -0.0461 103 TRP A CH2 
146  N  N   . LEU A 34  ? 0.7958 0.6367 0.6003 0.2140  -0.0673 -0.0341 104 LEU A N   
147  C  CA  . LEU A 34  ? 0.7798 0.6371 0.5981 0.2122  -0.0555 -0.0368 104 LEU A CA  
148  C  C   . LEU A 34  ? 0.8598 0.6977 0.6611 0.2136  -0.0403 -0.0368 104 LEU A C   
149  O  O   . LEU A 34  ? 0.8461 0.6947 0.6621 0.2133  -0.0319 -0.0403 104 LEU A O   
150  C  CB  . LEU A 34  ? 0.7571 0.6380 0.6037 0.2089  -0.0508 -0.0401 104 LEU A CB  
151  C  CG  . LEU A 34  ? 0.7960 0.6949 0.6588 0.2063  -0.0591 -0.0420 104 LEU A CG  
152  C  CD1 . LEU A 34  ? 0.7841 0.6977 0.6659 0.2032  -0.0545 -0.0452 104 LEU A CD1 
153  C  CD2 . LEU A 34  ? 0.8232 0.7265 0.6839 0.2073  -0.0623 -0.0433 104 LEU A CD2 
154  N  N   . LYS A 35  ? 0.8590 0.6640 0.6285 0.2154  -0.0364 -0.0334 105 LYS A N   
155  C  CA  . LYS A 35  ? 0.8937 0.6682 0.6380 0.2158  -0.0169 -0.0335 105 LYS A CA  
156  C  C   . LYS A 35  ? 0.9878 0.7399 0.7018 0.2183  -0.0214 -0.0318 105 LYS A C   
157  O  O   . LYS A 35  ? 1.0179 0.7359 0.6914 0.2215  -0.0317 -0.0280 105 LYS A O   
158  C  CB  . LYS A 35  ? 0.9554 0.6941 0.6679 0.2168  -0.0096 -0.0302 105 LYS A CB  
159  C  CG  . LYS A 35  ? 1.0456 0.7989 0.7849 0.2134  0.0044  -0.0329 105 LYS A CG  
160  C  CD  . LYS A 35  ? 1.1712 0.8800 0.8704 0.2148  0.0142  -0.0290 105 LYS A CD  
161  C  CE  . LYS A 35  ? 1.2597 0.9782 0.9844 0.2106  0.0342  -0.0327 105 LYS A CE  
162  N  NZ  . LYS A 35  ? 1.4133 1.0823 1.0932 0.2122  0.0457  -0.0284 105 LYS A NZ  
163  N  N   . ASP A 36  ? 0.9430 0.7126 0.6762 0.2176  -0.0162 -0.0351 106 ASP A N   
164  C  CA  . ASP A 36  ? 0.9663 0.7174 0.6747 0.2195  -0.0187 -0.0342 106 ASP A CA  
165  C  C   . ASP A 36  ? 1.0340 0.7697 0.7401 0.2184  0.0063  -0.0377 106 ASP A C   
166  O  O   . ASP A 36  ? 1.0552 0.7669 0.7335 0.2196  0.0088  -0.0369 106 ASP A O   
167  C  CB  . ASP A 36  ? 0.9639 0.7439 0.6931 0.2200  -0.0368 -0.0347 106 ASP A CB  
168  C  CG  . ASP A 36  ? 1.1217 0.9070 0.8500 0.2205  -0.0588 -0.0328 106 ASP A CG  
169  O  OD1 . ASP A 36  ? 1.1518 0.9166 0.8605 0.2219  -0.0653 -0.0306 106 ASP A OD1 
170  O  OD2 . ASP A 36  ? 1.1895 0.9963 0.9372 0.2197  -0.0688 -0.0342 106 ASP A OD2 
171  N  N   . ASN A 37  ? 0.9776 0.7259 0.7159 0.2160  0.0255  -0.0429 107 ASN A N   
172  C  CA  . ASN A 37  ? 0.9906 0.7264 0.7404 0.2143  0.0529  -0.0490 107 ASN A CA  
173  C  C   . ASN A 37  ? 1.0453 0.7762 0.8143 0.2107  0.0766  -0.0541 107 ASN A C   
174  O  O   . ASN A 37  ? 1.0055 0.7725 0.8218 0.2098  0.0724  -0.0590 107 ASN A O   
175  C  CB  . ASN A 37  ? 0.9662 0.7364 0.7611 0.2160  0.0481  -0.0548 107 ASN A CB  
176  C  CG  . ASN A 37  ? 1.2599 1.0170 1.0711 0.2151  0.0739  -0.0621 107 ASN A CG  
177  O  OD1 . ASN A 37  ? 1.2187 0.9402 1.0114 0.2118  0.1022  -0.0644 107 ASN A OD1 
178  N  ND2 . ASN A 37  ? 1.1362 0.9186 0.9825 0.2181  0.0660  -0.0667 107 ASN A ND2 
179  N  N   . ASP A 38  ? 1.0532 0.7344 0.7817 0.2084  0.1022  -0.0534 108 ASP A N   
180  C  CA  . ASP A 38  ? 1.0710 0.7359 0.8095 0.2041  0.1314  -0.0584 108 ASP A CA  
181  C  C   . ASP A 38  ? 1.1121 0.7913 0.9090 0.2003  0.1601  -0.0714 108 ASP A C   
182  O  O   . ASP A 38  ? 1.1164 0.7899 0.9374 0.1959  0.1854  -0.0785 108 ASP A O   
183  C  CB  . ASP A 38  ? 1.1636 0.7592 0.8262 0.2033  0.1489  -0.0522 108 ASP A CB  
184  C  CG  . ASP A 38  ? 1.3443 0.8904 0.9440 0.2052  0.1513  -0.0477 108 ASP A CG  
185  O  OD1 . ASP A 38  ? 1.3368 0.8987 0.9576 0.2054  0.1520  -0.0513 108 ASP A OD1 
186  O  OD2 . ASP A 38  ? 1.4792 0.9671 1.0061 0.2070  0.1518  -0.0409 108 ASP A OD2 
187  N  N   . TYR A 39  ? 1.0521 0.7507 0.8768 0.2024  0.1556  -0.0758 109 TYR A N   
188  C  CA  . TYR A 39  ? 1.0399 0.7560 0.9302 0.2003  0.1777  -0.0899 109 TYR A CA  
189  C  C   . TYR A 39  ? 1.0252 0.8004 0.9885 0.2030  0.1547  -0.0978 109 TYR A C   
190  O  O   . TYR A 39  ? 1.0095 0.8035 1.0386 0.2019  0.1683  -0.1119 109 TYR A O   
191  C  CB  . TYR A 39  ? 1.0760 0.7763 0.9596 0.2016  0.1874  -0.0919 109 TYR A CB  
192  C  CG  . TYR A 39  ? 1.1692 0.8025 0.9811 0.1981  0.2163  -0.0871 109 TYR A CG  
193  C  CD1 . TYR A 39  ? 1.2406 0.8313 1.0425 0.1916  0.2589  -0.0930 109 TYR A CD1 
194  C  CD2 . TYR A 39  ? 1.2030 0.8104 0.9546 0.2010  0.2023  -0.0777 109 TYR A CD2 
195  C  CE1 . TYR A 39  ? 1.3237 0.8419 1.0478 0.1886  0.2864  -0.0884 109 TYR A CE1 
196  C  CE2 . TYR A 39  ? 1.2839 0.8228 0.9620 0.1984  0.2263  -0.0738 109 TYR A CE2 
197  C  CZ  . TYR A 39  ? 1.4325 0.9240 1.0927 0.1923  0.2683  -0.0787 109 TYR A CZ  
198  O  OH  . TYR A 39  ? 1.5282 0.9416 1.1045 0.1899  0.2929  -0.0747 109 TYR A OH  
199  N  N   . LEU A 40  ? 0.9438 0.7444 0.8952 0.2064  0.1200  -0.0897 110 LEU A N   
200  C  CA  . LEU A 40  ? 0.8954 0.7417 0.8981 0.2089  0.0957  -0.0954 110 LEU A CA  
201  C  C   . LEU A 40  ? 0.9303 0.7766 0.9332 0.2048  0.1019  -0.0952 110 LEU A C   
202  O  O   . LEU A 40  ? 0.9279 0.7650 0.8870 0.2046  0.0903  -0.0844 110 LEU A O   
203  C  CB  . LEU A 40  ? 0.8729 0.7383 0.8558 0.2140  0.0599  -0.0869 110 LEU A CB  
204  C  CG  . LEU A 40  ? 0.9370 0.7965 0.9046 0.2180  0.0526  -0.0840 110 LEU A CG  
205  C  CD1 . LEU A 40  ? 0.9207 0.7947 0.8672 0.2216  0.0217  -0.0761 110 LEU A CD1 
206  C  CD2 . LEU A 40  ? 0.9618 0.8354 0.9844 0.2211  0.0581  -0.0963 110 LEU A CD2 
207  N  N   . LEU A 41  ? 0.8754 0.7284 0.9292 0.2012  0.1229  -0.1081 111 LEU A N   
208  C  CA  . LEU A 41  ? 0.8705 0.7198 0.9293 0.1964  0.1357  -0.1100 111 LEU A CA  
209  C  C   . LEU A 41  ? 0.8686 0.7558 0.9564 0.1978  0.1078  -0.1122 111 LEU A C   
210  O  O   . LEU A 41  ? 0.8651 0.7470 0.9331 0.1949  0.1090  -0.1072 111 LEU A O   
211  C  CB  . LEU A 41  ? 0.8922 0.7279 0.9947 0.1906  0.1756  -0.1245 111 LEU A CB  
212  C  CG  . LEU A 41  ? 0.9956 0.7875 1.0747 0.1877  0.2117  -0.1257 111 LEU A CG  
213  C  CD1 . LEU A 41  ? 1.0136 0.7987 1.1534 0.1813  0.2521  -0.1437 111 LEU A CD1 
214  C  CD2 . LEU A 41  ? 1.0718 0.8094 1.0595 0.1861  0.2240  -0.1104 111 LEU A CD2 
215  N  N   . HIS A 42  ? 0.7862 0.7068 0.9174 0.2024  0.0831  -0.1199 112 HIS A N   
216  C  CA  . HIS A 42  ? 0.7519 0.7016 0.9052 0.2041  0.0558  -0.1232 112 HIS A CA  
217  C  C   . HIS A 42  ? 0.7745 0.7400 0.9216 0.2111  0.0211  -0.1205 112 HIS A C   
218  O  O   . HIS A 42  ? 0.7751 0.7330 0.9074 0.2147  0.0188  -0.1168 112 HIS A O   
219  C  CB  . HIS A 42  ? 0.7541 0.7223 0.9790 0.2019  0.0640  -0.1417 112 HIS A CB  
220  C  CG  . HIS A 42  ? 0.7832 0.7656 1.0167 0.1994  0.0530  -0.1438 112 HIS A CG  
221  N  ND1 . HIS A 42  ? 0.7886 0.7898 1.0210 0.2037  0.0177  -0.1438 112 HIS A ND1 
222  C  CD2 . HIS A 42  ? 0.8098 0.7860 1.0510 0.1928  0.0747  -0.1465 112 HIS A CD2 
223  C  CE1 . HIS A 42  ? 0.7751 0.7824 1.0150 0.1994  0.0187  -0.1465 112 HIS A CE1 
224  N  NE2 . HIS A 42  ? 0.7898 0.7846 1.0376 0.1930  0.0520  -0.1482 112 HIS A NE2 
225  N  N   . GLY A 43  ? 0.7089 0.6915 0.8628 0.2128  -0.0038 -0.1226 113 GLY A N   
226  C  CA  . GLY A 43  ? 0.6985 0.6882 0.8399 0.2192  -0.0359 -0.1208 113 GLY A CA  
227  C  C   . GLY A 43  ? 0.7397 0.7173 0.8207 0.2189  -0.0444 -0.1053 113 GLY A C   
228  O  O   . GLY A 43  ? 0.7360 0.7115 0.7988 0.2237  -0.0644 -0.1024 113 GLY A O   
229  N  N   . HIS A 44  ? 0.6914 0.6586 0.7429 0.2135  -0.0294 -0.0961 114 HIS A N   
230  C  CA  . HIS A 44  ? 0.6865 0.6434 0.6909 0.2127  -0.0363 -0.0836 114 HIS A CA  
231  C  C   . HIS A 44  ? 0.7179 0.6806 0.7125 0.2112  -0.0511 -0.0824 114 HIS A C   
232  O  O   . HIS A 44  ? 0.7079 0.6784 0.7205 0.2083  -0.0489 -0.0874 114 HIS A O   
233  C  CB  . HIS A 44  ? 0.7052 0.6453 0.6841 0.2090  -0.0183 -0.0756 114 HIS A CB  
234  C  CG  . HIS A 44  ? 0.7651 0.6886 0.7395 0.2097  -0.0009 -0.0756 114 HIS A CG  
235  N  ND1 . HIS A 44  ? 0.7979 0.7067 0.7409 0.2119  -0.0036 -0.0687 114 HIS A ND1 
236  C  CD2 . HIS A 44  ? 0.7992 0.7155 0.7959 0.2078  0.0215  -0.0826 114 HIS A CD2 
237  C  CE1 . HIS A 44  ? 0.8101 0.7012 0.7525 0.2115  0.0165  -0.0710 114 HIS A CE1 
238  N  NE2 . HIS A 44  ? 0.8167 0.7107 0.7914 0.2087  0.0339  -0.0794 114 HIS A NE2 
239  N  N   . ARG A 45  ? 0.6680 0.6239 0.6328 0.2125  -0.0633 -0.0762 115 ARG A N   
240  C  CA  . ARG A 45  ? 0.6624 0.6160 0.6108 0.2099  -0.0724 -0.0748 115 ARG A CA  
241  C  C   . ARG A 45  ? 0.7057 0.6580 0.6465 0.2044  -0.0606 -0.0691 115 ARG A C   
242  O  O   . ARG A 45  ? 0.7014 0.6466 0.6294 0.2041  -0.0539 -0.0628 115 ARG A O   
243  C  CB  . ARG A 45  ? 0.6609 0.6016 0.5788 0.2117  -0.0825 -0.0703 115 ARG A CB  
244  C  CG  . ARG A 45  ? 0.7489 0.6835 0.6641 0.2178  -0.0998 -0.0757 115 ARG A CG  
245  C  CD  . ARG A 45  ? 0.8030 0.7184 0.6821 0.2192  -0.1052 -0.0704 115 ARG A CD  
246  N  NE  . ARG A 45  ? 0.8274 0.7435 0.7020 0.2186  -0.0955 -0.0642 115 ARG A NE  
247  C  CZ  . ARG A 45  ? 0.9597 0.8615 0.8093 0.2191  -0.0963 -0.0598 115 ARG A CZ  
248  N  NH1 . ARG A 45  ? 0.7827 0.6648 0.6052 0.2200  -0.1037 -0.0601 115 ARG A NH1 
249  N  NH2 . ARG A 45  ? 0.7749 0.6778 0.6232 0.2184  -0.0889 -0.0554 115 ARG A NH2 
250  N  N   . PRO A 46  ? 0.6611 0.6176 0.6087 0.2007  -0.0599 -0.0719 116 PRO A N   
251  C  CA  . PRO A 46  ? 0.6542 0.6085 0.5965 0.1963  -0.0504 -0.0667 116 PRO A CA  
252  C  C   . PRO A 46  ? 0.7061 0.6516 0.6275 0.1949  -0.0539 -0.0613 116 PRO A C   
253  O  O   . PRO A 46  ? 0.7094 0.6491 0.6184 0.1953  -0.0606 -0.0624 116 PRO A O   
254  C  CB  . PRO A 46  ? 0.6733 0.6339 0.6289 0.1927  -0.0500 -0.0725 116 PRO A CB  
255  C  CG  . PRO A 46  ? 0.7380 0.6966 0.6896 0.1950  -0.0646 -0.0787 116 PRO A CG  
256  C  CD  . PRO A 46  ? 0.6849 0.6447 0.6414 0.2008  -0.0705 -0.0799 116 PRO A CD  
257  N  N   . PRO A 47  ? 0.6607 0.6019 0.5787 0.1933  -0.0497 -0.0562 117 PRO A N   
258  C  CA  . PRO A 47  ? 0.6621 0.5968 0.5717 0.1914  -0.0522 -0.0542 117 PRO A CA  
259  C  C   . PRO A 47  ? 0.7193 0.6512 0.6281 0.1864  -0.0491 -0.0577 117 PRO A C   
260  O  O   . PRO A 47  ? 0.7123 0.6482 0.6311 0.1833  -0.0444 -0.0597 117 PRO A O   
261  C  CB  . PRO A 47  ? 0.6829 0.6146 0.5983 0.1919  -0.0516 -0.0505 117 PRO A CB  
262  C  CG  . PRO A 47  ? 0.7365 0.6709 0.6590 0.1920  -0.0459 -0.0506 117 PRO A CG  
263  C  CD  . PRO A 47  ? 0.6799 0.6188 0.6027 0.1937  -0.0432 -0.0534 117 PRO A CD  
264  N  N   . MET A 48  ? 0.6899 0.6103 0.5821 0.1855  -0.0505 -0.0587 118 MET A N   
265  C  CA  . MET A 48  ? 0.7028 0.6096 0.5830 0.1803  -0.0447 -0.0622 118 MET A CA  
266  C  C   . MET A 48  ? 0.7521 0.6450 0.6265 0.1765  -0.0365 -0.0620 118 MET A C   
267  O  O   . MET A 48  ? 0.7552 0.6386 0.6138 0.1786  -0.0394 -0.0610 118 MET A O   
268  C  CB  . MET A 48  ? 0.7533 0.6483 0.6099 0.1831  -0.0536 -0.0653 118 MET A CB  
269  C  CG  . MET A 48  ? 0.7943 0.7035 0.6659 0.1860  -0.0610 -0.0687 118 MET A CG  
270  S  SD  . MET A 48  ? 0.8655 0.7688 0.7261 0.1936  -0.0799 -0.0734 118 MET A SD  
271  C  CE  . MET A 48  ? 0.8148 0.7238 0.6783 0.1987  -0.0814 -0.0684 118 MET A CE  
272  N  N   . PRO A 49  ? 0.6969 0.5880 0.5888 0.1705  -0.0247 -0.0643 119 PRO A N   
273  C  CA  . PRO A 49  ? 0.6998 0.5781 0.5961 0.1660  -0.0142 -0.0667 119 PRO A CA  
274  C  C   . PRO A 49  ? 0.7690 0.6161 0.6324 0.1607  -0.0008 -0.0699 119 PRO A C   
275  O  O   . PRO A 49  ? 0.7755 0.6078 0.6460 0.1530  0.0177  -0.0747 119 PRO A O   
276  C  CB  . PRO A 49  ? 0.7079 0.5981 0.6448 0.1626  -0.0082 -0.0695 119 PRO A CB  
277  C  CG  . PRO A 49  ? 0.7631 0.6579 0.6988 0.1615  -0.0066 -0.0695 119 PRO A CG  
278  C  CD  . PRO A 49  ? 0.7047 0.6053 0.6182 0.1674  -0.0195 -0.0658 119 PRO A CD  
279  N  N   . SER A 50  ? 0.7353 0.5677 0.5608 0.1652  -0.0099 -0.0679 120 SER A N   
280  C  CA  . SER A 50  ? 0.7722 0.5644 0.5527 0.1619  -0.0003 -0.0701 120 SER A CA  
281  C  C   . SER A 50  ? 0.8303 0.6089 0.5823 0.1678  -0.0100 -0.0672 120 SER A C   
282  O  O   . SER A 50  ? 0.8119 0.6070 0.5649 0.1760  -0.0296 -0.0645 120 SER A O   
283  C  CB  . SER A 50  ? 0.8350 0.6130 0.5890 0.1621  -0.0054 -0.0722 120 SER A CB  
284  O  OG  . SER A 50  ? 0.9969 0.7255 0.6970 0.1591  0.0037  -0.0744 120 SER A OG  
285  N  N   . PHE A 51  ? 0.8129 0.5603 0.5426 0.1635  0.0059  -0.0686 121 PHE A N   
286  C  CA  . PHE A 51  ? 0.8280 0.5573 0.5262 0.1692  -0.0019 -0.0657 121 PHE A CA  
287  C  C   . PHE A 51  ? 0.9196 0.6183 0.5653 0.1756  -0.0172 -0.0649 121 PHE A C   
288  O  O   . PHE A 51  ? 0.9154 0.6184 0.5516 0.1848  -0.0371 -0.0622 121 PHE A O   
289  C  CB  . PHE A 51  ? 0.8718 0.5738 0.5612 0.1625  0.0211  -0.0680 121 PHE A CB  
290  C  CG  . PHE A 51  ? 0.8501 0.5854 0.5952 0.1598  0.0255  -0.0696 121 PHE A CG  
291  C  CD1 . PHE A 51  ? 0.8601 0.6212 0.6208 0.1669  0.0077  -0.0658 121 PHE A CD1 
292  C  CD2 . PHE A 51  ? 0.8687 0.6062 0.6507 0.1504  0.0466  -0.0762 121 PHE A CD2 
293  C  CE1 . PHE A 51  ? 0.8421 0.6279 0.6480 0.1652  0.0082  -0.0680 121 PHE A CE1 
294  C  CE2 . PHE A 51  ? 0.8714 0.6371 0.7065 0.1492  0.0452  -0.0794 121 PHE A CE2 
295  C  CZ  . PHE A 51  ? 0.8242 0.6123 0.6674 0.1569  0.0246  -0.0750 121 PHE A CZ  
296  N  N   . ARG A 52  ? 0.9122 0.5803 0.5267 0.1714  -0.0099 -0.0681 122 ARG A N   
297  C  CA  . ARG A 52  ? 0.9549 0.5879 0.5164 0.1777  -0.0281 -0.0690 122 ARG A CA  
298  C  C   . ARG A 52  ? 0.9799 0.6519 0.5711 0.1874  -0.0583 -0.0692 122 ARG A C   
299  O  O   . ARG A 52  ? 0.9945 0.6544 0.5636 0.1973  -0.0814 -0.0692 122 ARG A O   
300  C  CB  . ARG A 52  ? 0.9835 0.5816 0.5141 0.1700  -0.0132 -0.0733 122 ARG A CB  
301  C  CG  . ARG A 52  ? 1.1369 0.6797 0.5951 0.1759  -0.0304 -0.0752 122 ARG A CG  
302  C  CD  . ARG A 52  ? 1.2301 0.7313 0.6512 0.1669  -0.0114 -0.0796 122 ARG A CD  
303  N  NE  . ARG A 52  ? 1.2849 0.7586 0.6983 0.1545  0.0297  -0.0805 122 ARG A NE  
304  C  CZ  . ARG A 52  ? 1.4497 0.8836 0.8357 0.1439  0.0575  -0.0849 122 ARG A CZ  
305  N  NH1 . ARG A 52  ? 1.2842 0.6989 0.6404 0.1445  0.0464  -0.0881 122 ARG A NH1 
306  N  NH2 . ARG A 52  ? 1.2805 0.6921 0.6706 0.1323  0.0973  -0.0874 122 ARG A NH2 
307  N  N   . ALA A 53  ? 0.8959 0.6128 0.5397 0.1845  -0.0568 -0.0701 123 ALA A N   
308  C  CA  . ALA A 53  ? 0.8628 0.6175 0.5427 0.1914  -0.0778 -0.0716 123 ALA A CA  
309  C  C   . ALA A 53  ? 0.8947 0.6737 0.5979 0.1984  -0.0878 -0.0684 123 ALA A C   
310  O  O   . ALA A 53  ? 0.8847 0.6760 0.6004 0.2065  -0.1078 -0.0710 123 ALA A O   
311  C  CB  . ALA A 53  ? 0.8329 0.6216 0.5568 0.1855  -0.0676 -0.0724 123 ALA A CB  
312  N  N   . CYS A 54  ? 0.8437 0.6278 0.5552 0.1952  -0.0737 -0.0641 124 CYS A N   
313  C  CA  . CYS A 54  ? 0.8245 0.6266 0.5529 0.2007  -0.0801 -0.0609 124 CYS A CA  
314  C  C   . CYS A 54  ? 0.9075 0.6816 0.5999 0.2085  -0.0935 -0.0605 124 CYS A C   
315  O  O   . CYS A 54  ? 0.8910 0.6804 0.5992 0.2163  -0.1083 -0.0608 124 CYS A O   
316  C  CB  . CYS A 54  ? 0.8106 0.6228 0.5571 0.1950  -0.0637 -0.0579 124 CYS A CB  
317  S  SG  . CYS A 54  ? 0.8179 0.6672 0.6127 0.1910  -0.0579 -0.0576 124 CYS A SG  
318  N  N   . PHE A 55  ? 0.9102 0.6398 0.5534 0.2064  -0.0870 -0.0604 125 PHE A N   
319  C  CA  . PHE A 55  ? 0.9508 0.6432 0.5490 0.2144  -0.1002 -0.0596 125 PHE A CA  
320  C  C   . PHE A 55  ? 1.0265 0.7054 0.6077 0.2237  -0.1283 -0.0642 125 PHE A C   
321  O  O   . PHE A 55  ? 1.0414 0.7079 0.6095 0.2342  -0.1492 -0.0648 125 PHE A O   
322  C  CB  . PHE A 55  ? 1.0226 0.6635 0.5677 0.2084  -0.0803 -0.0581 125 PHE A CB  
323  C  CG  . PHE A 55  ? 1.0274 0.6746 0.5873 0.2027  -0.0592 -0.0553 125 PHE A CG  
324  C  CD1 . PHE A 55  ? 1.0688 0.7135 0.6228 0.2091  -0.0665 -0.0523 125 PHE A CD1 
325  C  CD2 . PHE A 55  ? 1.0409 0.6933 0.6214 0.1909  -0.0324 -0.0570 125 PHE A CD2 
326  C  CE1 . PHE A 55  ? 1.0684 0.7173 0.6362 0.2035  -0.0479 -0.0510 125 PHE A CE1 
327  C  CE2 . PHE A 55  ? 1.0645 0.7220 0.6638 0.1858  -0.0155 -0.0568 125 PHE A CE2 
328  C  CZ  . PHE A 55  ? 1.0428 0.6982 0.6343 0.1919  -0.0234 -0.0538 125 PHE A CZ  
329  N  N   . LYS A 56  ? 0.9862 0.6666 0.5702 0.2204  -0.1304 -0.0685 126 LYS A N   
330  C  CA  . LYS A 56  ? 1.0092 0.6784 0.5834 0.2288  -0.1593 -0.0751 126 LYS A CA  
331  C  C   . LYS A 56  ? 1.0139 0.7321 0.6513 0.2359  -0.1770 -0.0793 126 LYS A C   
332  O  O   . LYS A 56  ? 1.0287 0.7397 0.6677 0.2464  -0.2059 -0.0858 126 LYS A O   
333  C  CB  . LYS A 56  ? 1.0523 0.7117 0.6158 0.2216  -0.1531 -0.0791 126 LYS A CB  
334  C  CG  . LYS A 56  ? 1.2857 0.9089 0.8117 0.2293  -0.1824 -0.0864 126 LYS A CG  
335  C  CD  . LYS A 56  ? 1.4214 1.0410 0.9441 0.2211  -0.1740 -0.0906 126 LYS A CD  
336  C  CE  . LYS A 56  ? 1.6003 1.1962 1.1025 0.2293  -0.2079 -0.1002 126 LYS A CE  
337  N  NZ  . LYS A 56  ? 1.7072 1.3163 1.2270 0.2214  -0.2006 -0.1053 126 LYS A NZ  
338  N  N   . SER A 57  ? 0.9144 0.6780 0.6031 0.2304  -0.1594 -0.0764 127 SER A N   
339  C  CA  . SER A 57  ? 0.8719 0.6778 0.6192 0.2347  -0.1665 -0.0802 127 SER A CA  
340  C  C   . SER A 57  ? 0.9256 0.7318 0.6806 0.2445  -0.1800 -0.0805 127 SER A C   
341  O  O   . SER A 57  ? 0.8998 0.7333 0.7024 0.2494  -0.1884 -0.0865 127 SER A O   
342  C  CB  . SER A 57  ? 0.8697 0.7102 0.6535 0.2263  -0.1428 -0.0761 127 SER A CB  
343  O  OG  . SER A 57  ? 0.9645 0.8078 0.7451 0.2246  -0.1297 -0.0692 127 SER A OG  
344  N  N   . ILE A 58  ? 0.9101 0.6841 0.6204 0.2470  -0.1802 -0.0751 128 ILE A N   
345  C  CA  . ILE A 58  ? 0.9155 0.6832 0.6255 0.2567  -0.1931 -0.0747 128 ILE A CA  
346  C  C   . ILE A 58  ? 0.9878 0.7507 0.7126 0.2689  -0.2263 -0.0847 128 ILE A C   
347  O  O   . ILE A 58  ? 0.9654 0.7500 0.7332 0.2761  -0.2359 -0.0893 128 ILE A O   
348  C  CB  . ILE A 58  ? 0.9926 0.7165 0.6417 0.2566  -0.1869 -0.0677 128 ILE A CB  
349  C  CG1 . ILE A 58  ? 0.9727 0.7064 0.6223 0.2450  -0.1556 -0.0606 128 ILE A CG1 
350  C  CG2 . ILE A 58  ? 1.0214 0.7305 0.6624 0.2686  -0.2051 -0.0679 128 ILE A CG2 
351  C  CD1 . ILE A 58  ? 1.1023 0.7906 0.6951 0.2413  -0.1419 -0.0556 128 ILE A CD1 
352  N  N   . PHE A 59  ? 0.9843 0.7181 0.6766 0.2711  -0.2435 -0.0893 129 PHE A N   
353  C  CA  . PHE A 59  ? 1.0121 0.7342 0.7131 0.2832  -0.2808 -0.1006 129 PHE A CA  
354  C  C   . PHE A 59  ? 1.0237 0.7890 0.7937 0.2813  -0.2848 -0.1113 129 PHE A C   
355  O  O   . PHE A 59  ? 1.0427 0.7991 0.8225 0.2888  -0.3145 -0.1227 129 PHE A O   
356  C  CB  . PHE A 59  ? 1.1054 0.7648 0.7264 0.2868  -0.2985 -0.1005 129 PHE A CB  
357  C  CG  . PHE A 59  ? 1.1689 0.7791 0.7191 0.2882  -0.2907 -0.0907 129 PHE A CG  
358  C  CD1 . PHE A 59  ? 1.2433 0.8262 0.7736 0.3020  -0.3162 -0.0915 129 PHE A CD1 
359  C  CD2 . PHE A 59  ? 1.2024 0.7929 0.7099 0.2755  -0.2567 -0.0816 129 PHE A CD2 
360  C  CE1 . PHE A 59  ? 1.2986 0.8329 0.7617 0.3029  -0.3063 -0.0824 129 PHE A CE1 
361  C  CE2 . PHE A 59  ? 1.2798 0.8237 0.7263 0.2757  -0.2454 -0.0740 129 PHE A CE2 
362  C  CZ  . PHE A 59  ? 1.2927 0.8074 0.7142 0.2892  -0.2696 -0.0740 129 PHE A CZ  
363  N  N   . ARG A 60  ? 0.9243 0.7328 0.7411 0.2718  -0.2555 -0.1084 130 ARG A N   
364  C  CA  . ARG A 60  ? 0.8849 0.7329 0.7663 0.2681  -0.2504 -0.1174 130 ARG A CA  
365  C  C   . ARG A 60  ? 0.8909 0.7751 0.8287 0.2668  -0.2317 -0.1176 130 ARG A C   
366  O  O   . ARG A 60  ? 0.8781 0.7598 0.7983 0.2653  -0.2167 -0.1081 130 ARG A O   
367  C  CB  . ARG A 60  ? 0.8760 0.7284 0.7442 0.2561  -0.2300 -0.1134 130 ARG A CB  
368  C  CG  . ARG A 60  ? 1.0479 0.8695 0.8789 0.2574  -0.2499 -0.1187 130 ARG A CG  
369  C  CD  . ARG A 60  ? 1.1583 0.9911 0.9925 0.2460  -0.2300 -0.1176 130 ARG A CD  
370  N  NE  . ARG A 60  ? 1.2276 1.1032 1.1314 0.2432  -0.2220 -0.1252 130 ARG A NE  
371  C  CZ  . ARG A 60  ? 1.3992 1.2904 1.3184 0.2341  -0.2045 -0.1255 130 ARG A CZ  
372  N  NH1 . ARG A 60  ? 1.2530 1.1237 1.1277 0.2270  -0.1941 -0.1192 130 ARG A NH1 
373  N  NH2 . ARG A 60  ? 1.2131 1.1377 1.1926 0.2318  -0.1953 -0.1325 130 ARG A NH2 
374  N  N   . ILE A 61  ? 0.8237 0.7377 0.8276 0.2670  -0.2310 -0.1294 131 ILE A N   
375  C  CA  . ILE A 61  ? 0.7901 0.7316 0.8473 0.2655  -0.2104 -0.1319 131 ILE A CA  
376  C  C   . ILE A 61  ? 0.8068 0.7648 0.8694 0.2533  -0.1753 -0.1251 131 ILE A C   
377  O  O   . ILE A 61  ? 0.7911 0.7578 0.8658 0.2476  -0.1696 -0.1286 131 ILE A O   
378  C  CB  . ILE A 61  ? 0.8285 0.7877 0.9591 0.2732  -0.2272 -0.1506 131 ILE A CB  
379  C  CG1 . ILE A 61  ? 0.8649 0.8051 0.9888 0.2873  -0.2617 -0.1553 131 ILE A CG1 
380  C  CG2 . ILE A 61  ? 0.8081 0.7936 0.9984 0.2682  -0.1961 -0.1554 131 ILE A CG2 
381  C  CD1 . ILE A 61  ? 0.9650 0.9201 1.1658 0.2975  -0.2856 -0.1756 131 ILE A CD1 
382  N  N   . HIS A 62  ? 0.7504 0.7090 0.8014 0.2502  -0.1536 -0.1157 132 HIS A N   
383  C  CA  . HIS A 62  ? 0.7285 0.6939 0.7751 0.2409  -0.1232 -0.1081 132 HIS A CA  
384  C  C   . HIS A 62  ? 0.7755 0.7379 0.8203 0.2415  -0.1078 -0.1032 132 HIS A C   
385  O  O   . HIS A 62  ? 0.7807 0.7381 0.8280 0.2486  -0.1202 -0.1052 132 HIS A O   
386  C  CB  . HIS A 62  ? 0.7370 0.6916 0.7351 0.2346  -0.1191 -0.0969 132 HIS A CB  
387  C  CG  . HIS A 62  ? 0.7964 0.7304 0.7478 0.2374  -0.1320 -0.0899 132 HIS A CG  
388  N  ND1 . HIS A 62  ? 0.8180 0.7437 0.7453 0.2369  -0.1234 -0.0812 132 HIS A ND1 
389  C  CD2 . HIS A 62  ? 0.8403 0.7561 0.7627 0.2402  -0.1507 -0.0909 132 HIS A CD2 
390  C  CE1 . HIS A 62  ? 0.8305 0.7353 0.7196 0.2390  -0.1350 -0.0776 132 HIS A CE1 
391  N  NE2 . HIS A 62  ? 0.8520 0.7471 0.7327 0.2410  -0.1507 -0.0828 132 HIS A NE2 
392  N  N   . THR A 63  ? 0.7228 0.6837 0.7588 0.2348  -0.0824 -0.0969 133 THR A N   
393  C  CA  . THR A 63  ? 0.7240 0.6756 0.7502 0.2345  -0.0661 -0.0922 133 THR A CA  
394  C  C   . THR A 63  ? 0.7812 0.7213 0.7720 0.2382  -0.0777 -0.0845 133 THR A C   
395  O  O   . THR A 63  ? 0.7838 0.7184 0.7784 0.2410  -0.0720 -0.0849 133 THR A O   
396  C  CB  . THR A 63  ? 0.8201 0.7617 0.8228 0.2273  -0.0438 -0.0846 133 THR A CB  
397  O  OG1 . THR A 63  ? 0.8121 0.7506 0.7808 0.2243  -0.0518 -0.0762 133 THR A OG1 
398  C  CG2 . THR A 63  ? 0.7990 0.7440 0.8328 0.2232  -0.0238 -0.0918 133 THR A CG2 
399  N  N   . GLU A 64  ? 0.7376 0.6715 0.6948 0.2376  -0.0911 -0.0784 134 GLU A N   
400  C  CA  . GLU A 64  ? 0.7443 0.6638 0.6657 0.2396  -0.0984 -0.0714 134 GLU A CA  
401  C  C   . GLU A 64  ? 0.8084 0.7189 0.7238 0.2475  -0.1203 -0.0748 134 GLU A C   
402  O  O   . GLU A 64  ? 0.8141 0.7095 0.7001 0.2494  -0.1237 -0.0694 134 GLU A O   
403  C  CB  . GLU A 64  ? 0.7598 0.6720 0.6478 0.2331  -0.0945 -0.0633 134 GLU A CB  
404  C  CG  . GLU A 64  ? 0.8916 0.8053 0.7772 0.2274  -0.0784 -0.0591 134 GLU A CG  
405  C  CD  . GLU A 64  ? 1.1732 1.0798 1.0561 0.2283  -0.0676 -0.0574 134 GLU A CD  
406  O  OE1 . GLU A 64  ? 1.0934 0.9914 0.9611 0.2307  -0.0712 -0.0549 134 GLU A OE1 
407  O  OE2 . GLU A 64  ? 1.1242 1.0296 1.0167 0.2263  -0.0539 -0.0587 134 GLU A OE2 
408  N  N   . THR A 65  ? 0.7689 0.6853 0.7111 0.2528  -0.1361 -0.0842 135 THR A N   
409  C  CA  . THR A 65  ? 0.7912 0.6924 0.7236 0.2624  -0.1626 -0.0884 135 THR A CA  
410  C  C   . THR A 65  ? 0.8537 0.7468 0.7856 0.2694  -0.1664 -0.0875 135 THR A C   
411  O  O   . THR A 65  ? 0.8720 0.7410 0.7636 0.2737  -0.1782 -0.0827 135 THR A O   
412  C  CB  . THR A 65  ? 0.8842 0.7953 0.8564 0.2676  -0.1813 -0.1014 135 THR A CB  
413  O  OG1 . THR A 65  ? 0.8707 0.7882 0.8402 0.2602  -0.1751 -0.1015 135 THR A OG1 
414  C  CG2 . THR A 65  ? 0.8940 0.7814 0.8469 0.2789  -0.2149 -0.1061 135 THR A CG2 
415  N  N   . GLY A 66  ? 0.7968 0.7061 0.7706 0.2699  -0.1535 -0.0921 136 GLY A N   
416  C  CA  . GLY A 66  ? 0.8009 0.7051 0.7821 0.2757  -0.1529 -0.0923 136 GLY A CA  
417  C  C   . GLY A 66  ? 0.8548 0.7426 0.7866 0.2720  -0.1428 -0.0803 136 GLY A C   
418  O  O   . GLY A 66  ? 0.8683 0.7393 0.7794 0.2785  -0.1543 -0.0780 136 GLY A O   
419  N  N   . ASN A 67  ? 0.7965 0.6870 0.7095 0.2621  -0.1231 -0.0732 137 ASN A N   
420  C  CA  . ASN A 67  ? 0.7968 0.6739 0.6699 0.2576  -0.1139 -0.0638 137 ASN A CA  
421  C  C   . ASN A 67  ? 0.8658 0.7233 0.6984 0.2582  -0.1253 -0.0590 137 ASN A C   
422  O  O   . ASN A 67  ? 0.8704 0.7129 0.6771 0.2582  -0.1225 -0.0543 137 ASN A O   
423  C  CB  . ASN A 67  ? 0.7863 0.6692 0.6533 0.2484  -0.0965 -0.0596 137 ASN A CB  
424  C  CG  . ASN A 67  ? 1.0546 0.9419 0.9415 0.2468  -0.0796 -0.0619 137 ASN A CG  
425  O  OD1 . ASN A 67  ? 1.0008 0.8806 0.8869 0.2490  -0.0735 -0.0618 137 ASN A OD1 
426  N  ND2 . ASN A 67  ? 0.9358 0.8308 0.8370 0.2425  -0.0696 -0.0639 137 ASN A ND2 
427  N  N   . ILE A 68  ? 0.8312 0.6853 0.6565 0.2582  -0.1359 -0.0610 138 ILE A N   
428  C  CA  . ILE A 68  ? 0.8563 0.6834 0.6377 0.2582  -0.1436 -0.0576 138 ILE A CA  
429  C  C   . ILE A 68  ? 0.9393 0.7428 0.7020 0.2686  -0.1598 -0.0583 138 ILE A C   
430  O  O   . ILE A 68  ? 0.9475 0.7297 0.6775 0.2680  -0.1543 -0.0531 138 ILE A O   
431  C  CB  . ILE A 68  ? 0.9036 0.7271 0.6805 0.2576  -0.1537 -0.0613 138 ILE A CB  
432  C  CG1 . ILE A 68  ? 0.8800 0.7294 0.6839 0.2493  -0.1408 -0.0623 138 ILE A CG1 
433  C  CG2 . ILE A 68  ? 0.9465 0.7334 0.6698 0.2561  -0.1560 -0.0578 138 ILE A CG2 
434  C  CD1 . ILE A 68  ? 0.9625 0.8131 0.7539 0.2399  -0.1238 -0.0569 138 ILE A CD1 
435  N  N   . TRP A 69  ? 0.9082 0.7148 0.6950 0.2783  -0.1806 -0.0660 139 TRP A N   
436  C  CA  . TRP A 69  ? 0.9406 0.7236 0.7153 0.2910  -0.2042 -0.0689 139 TRP A CA  
437  C  C   . TRP A 69  ? 0.9901 0.7713 0.7697 0.2950  -0.1988 -0.0664 139 TRP A C   
438  O  O   . TRP A 69  ? 1.0191 0.7673 0.7580 0.3011  -0.2085 -0.0629 139 TRP A O   
439  C  CB  . TRP A 69  ? 0.9286 0.7228 0.7447 0.3002  -0.2291 -0.0805 139 TRP A CB  
440  C  CG  . TRP A 69  ? 0.9648 0.7416 0.7537 0.3000  -0.2440 -0.0828 139 TRP A CG  
441  C  CD1 . TRP A 69  ? 0.9791 0.7756 0.7853 0.2917  -0.2355 -0.0852 139 TRP A CD1 
442  C  CD2 . TRP A 69  ? 1.0176 0.7463 0.7456 0.3071  -0.2662 -0.0814 139 TRP A CD2 
443  N  NE1 . TRP A 69  ? 1.0081 0.7748 0.7730 0.2934  -0.2520 -0.0864 139 TRP A NE1 
444  C  CE2 . TRP A 69  ? 1.0763 0.7983 0.7894 0.3028  -0.2708 -0.0841 139 TRP A CE2 
445  C  CE3 . TRP A 69  ? 1.0824 0.7679 0.7630 0.3173  -0.2827 -0.0784 139 TRP A CE3 
446  C  CZ2 . TRP A 69  ? 1.1266 0.7973 0.7754 0.3079  -0.2908 -0.0841 139 TRP A CZ2 
447  C  CZ3 . TRP A 69  ? 1.1620 0.7945 0.7764 0.3229  -0.3028 -0.0779 139 TRP A CZ3 
448  C  CH2 . TRP A 69  ? 1.1808 0.8047 0.7780 0.3180  -0.3065 -0.0808 139 TRP A CH2 
449  N  N   . THR A 70  ? 0.9148 0.7250 0.7369 0.2913  -0.1818 -0.0680 140 THR A N   
450  C  CA  . THR A 70  ? 0.9128 0.7202 0.7393 0.2943  -0.1743 -0.0661 140 THR A CA  
451  C  C   . THR A 70  ? 0.9849 0.7670 0.7583 0.2902  -0.1648 -0.0566 140 THR A C   
452  O  O   . THR A 70  ? 1.0055 0.7646 0.7583 0.2977  -0.1736 -0.0550 140 THR A O   
453  C  CB  . THR A 70  ? 0.9704 0.8047 0.8392 0.2887  -0.1525 -0.0687 140 THR A CB  
454  O  OG1 . THR A 70  ? 0.9372 0.7803 0.7931 0.2769  -0.1339 -0.0637 140 THR A OG1 
455  C  CG2 . THR A 70  ? 0.9431 0.7983 0.8729 0.2940  -0.1581 -0.0805 140 THR A CG2 
456  N  N   . HIS A 71  ? 0.9363 0.7211 0.6904 0.2786  -0.1476 -0.0514 141 HIS A N   
457  C  CA  . HIS A 71  ? 0.9512 0.7147 0.6651 0.2730  -0.1358 -0.0448 141 HIS A CA  
458  C  C   . HIS A 71  ? 1.0419 0.7703 0.7089 0.2741  -0.1428 -0.0426 141 HIS A C   
459  O  O   . HIS A 71  ? 1.0586 0.7606 0.6910 0.2718  -0.1339 -0.0386 141 HIS A O   
460  C  CB  . HIS A 71  ? 0.9353 0.7159 0.6566 0.2610  -0.1162 -0.0425 141 HIS A CB  
461  C  CG  . HIS A 71  ? 0.9659 0.7577 0.7040 0.2599  -0.1062 -0.0423 141 HIS A CG  
462  N  ND1 . HIS A 71  ? 0.9881 0.7744 0.7123 0.2530  -0.0940 -0.0394 141 HIS A ND1 
463  C  CD2 . HIS A 71  ? 0.9810 0.7843 0.7472 0.2651  -0.1066 -0.0457 141 HIS A CD2 
464  C  CE1 . HIS A 71  ? 0.9736 0.7666 0.7114 0.2541  -0.0884 -0.0403 141 HIS A CE1 
465  N  NE2 . HIS A 71  ? 0.9740 0.7766 0.7370 0.2609  -0.0933 -0.0439 141 HIS A NE2 
466  N  N   . LEU A 72  ? 1.0145 0.7374 0.6774 0.2776  -0.1577 -0.0457 142 LEU A N   
467  C  CA  . LEU A 72  ? 1.0619 0.7417 0.6712 0.2796  -0.1654 -0.0442 142 LEU A CA  
468  C  C   . LEU A 72  ? 1.1596 0.8052 0.7414 0.2931  -0.1848 -0.0440 142 LEU A C   
469  O  O   . LEU A 72  ? 1.1983 0.7989 0.7248 0.2935  -0.1805 -0.0397 142 LEU A O   
470  C  CB  . LEU A 72  ? 1.0665 0.7492 0.6799 0.2805  -0.1789 -0.0487 142 LEU A CB  
471  C  CG  . LEU A 72  ? 1.1817 0.8133 0.7331 0.2825  -0.1876 -0.0480 142 LEU A CG  
472  C  CD1 . LEU A 72  ? 1.1908 0.8052 0.7110 0.2688  -0.1587 -0.0437 142 LEU A CD1 
473  C  CD2 . LEU A 72  ? 1.2173 0.8537 0.7796 0.2870  -0.2090 -0.0545 142 LEU A CD2 
474  N  N   . LEU A 73  ? 1.1097 0.7756 0.7330 0.3037  -0.2039 -0.0493 143 LEU A N   
475  C  CA  . LEU A 73  ? 1.1455 0.7850 0.7565 0.3184  -0.2263 -0.0508 143 LEU A CA  
476  C  C   . LEU A 73  ? 1.2033 0.8359 0.8034 0.3164  -0.2088 -0.0452 143 LEU A C   
477  O  O   . LEU A 73  ? 1.2444 0.8354 0.8013 0.3244  -0.2177 -0.0421 143 LEU A O   
478  C  CB  . LEU A 73  ? 1.1273 0.7967 0.8020 0.3291  -0.2488 -0.0606 143 LEU A CB  
479  C  CG  . LEU A 73  ? 1.1901 0.8665 0.8844 0.3334  -0.2719 -0.0690 143 LEU A CG  
480  C  CD1 . LEU A 73  ? 1.1620 0.8776 0.9369 0.3401  -0.2837 -0.0806 143 LEU A CD1 
481  C  CD2 . LEU A 73  ? 1.2844 0.9059 0.9183 0.3448  -0.3027 -0.0694 143 LEU A CD2 
482  N  N   . GLY A 74  ? 1.1203 0.7898 0.7568 0.3065  -0.1855 -0.0442 144 GLY A N   
483  C  CA  . GLY A 74  ? 1.1185 0.7850 0.7486 0.3029  -0.1678 -0.0400 144 GLY A CA  
484  C  C   . GLY A 74  ? 1.2095 0.8392 0.7836 0.2962  -0.1528 -0.0340 144 GLY A C   
485  O  O   . GLY A 74  ? 1.2303 0.8330 0.7776 0.2995  -0.1493 -0.0309 144 GLY A O   
486  N  N   . PHE A 75  ? 1.1748 0.8010 0.7326 0.2866  -0.1426 -0.0332 145 PHE A N   
487  C  CA  . PHE A 75  ? 1.2067 0.7982 0.7190 0.2779  -0.1233 -0.0298 145 PHE A CA  
488  C  C   . PHE A 75  ? 1.3336 0.8641 0.7821 0.2867  -0.1324 -0.0271 145 PHE A C   
489  O  O   . PHE A 75  ? 1.3557 0.8554 0.7724 0.2837  -0.1162 -0.0242 145 PHE A O   
490  C  CB  . PHE A 75  ? 1.2165 0.8176 0.7322 0.2667  -0.1114 -0.0311 145 PHE A CB  
491  C  CG  . PHE A 75  ? 1.2822 0.8356 0.7458 0.2597  -0.0936 -0.0297 145 PHE A CG  
492  C  CD1 . PHE A 75  ? 1.3195 0.8680 0.7837 0.2481  -0.0664 -0.0300 145 PHE A CD1 
493  C  CD2 . PHE A 75  ? 1.3604 0.8703 0.7745 0.2646  -0.1036 -0.0293 145 PHE A CD2 
494  C  CE1 . PHE A 75  ? 1.3774 0.8788 0.7980 0.2406  -0.0446 -0.0304 145 PHE A CE1 
495  C  CE2 . PHE A 75  ? 1.4481 0.9048 0.8073 0.2575  -0.0823 -0.0284 145 PHE A CE2 
496  C  CZ  . PHE A 75  ? 1.4191 0.8727 0.7846 0.2449  -0.0505 -0.0292 145 PHE A CZ  
497  N  N   . VAL A 76  ? 1.3285 0.8378 0.7560 0.2975  -0.1586 -0.0287 146 VAL A N   
498  C  CA  . VAL A 76  ? 1.4046 0.8469 0.7621 0.3084  -0.1736 -0.0264 146 VAL A CA  
499  C  C   . VAL A 76  ? 1.4793 0.9047 0.8288 0.3191  -0.1821 -0.0241 146 VAL A C   
500  O  O   . VAL A 76  ? 1.5284 0.8994 0.8184 0.3198  -0.1717 -0.0197 146 VAL A O   
501  C  CB  . VAL A 76  ? 1.4880 0.9105 0.8268 0.3195  -0.2068 -0.0301 146 VAL A CB  
502  C  CG1 . VAL A 76  ? 1.4442 0.9165 0.8524 0.3296  -0.2350 -0.0368 146 VAL A CG1 
503  C  CG2 . VAL A 76  ? 1.5761 0.9183 0.8306 0.3319  -0.2250 -0.0274 146 VAL A CG2 
504  N  N   . LEU A 77  ? 1.3985 0.8678 0.8080 0.3267  -0.1979 -0.0277 147 LEU A N   
505  C  CA  . LEU A 77  ? 1.4132 0.8710 0.8243 0.3375  -0.2070 -0.0266 147 LEU A CA  
506  C  C   . LEU A 77  ? 1.4549 0.9104 0.8567 0.3268  -0.1745 -0.0220 147 LEU A C   
507  O  O   . LEU A 77  ? 1.4982 0.9070 0.8532 0.3324  -0.1733 -0.0181 147 LEU A O   
508  C  CB  . LEU A 77  ? 1.3758 0.8796 0.8589 0.3475  -0.2284 -0.0334 147 LEU A CB  
509  C  CG  . LEU A 77  ? 1.3670 0.9310 0.9182 0.3379  -0.2077 -0.0359 147 LEU A CG  
510  C  CD1 . LEU A 77  ? 1.3687 0.9300 0.9251 0.3396  -0.1964 -0.0335 147 LEU A CD1 
511  C  CD2 . LEU A 77  ? 1.3649 0.9692 0.9826 0.3443  -0.2253 -0.0446 147 LEU A CD2 
512  N  N   . PHE A 78  ? 1.3567 0.8558 0.7974 0.3117  -0.1494 -0.0228 148 PHE A N   
513  C  CA  . PHE A 78  ? 1.3468 0.8443 0.7830 0.3010  -0.1210 -0.0205 148 PHE A CA  
514  C  C   . PHE A 78  ? 1.4432 0.8898 0.8204 0.2936  -0.1010 -0.0177 148 PHE A C   
515  O  O   . PHE A 78  ? 1.4553 0.8796 0.8133 0.2896  -0.0825 -0.0161 148 PHE A O   
516  C  CB  . PHE A 78  ? 1.3080 0.8596 0.7981 0.2885  -0.1052 -0.0233 148 PHE A CB  
517  C  CG  . PHE A 78  ? 1.3005 0.8806 0.8299 0.2927  -0.1079 -0.0247 148 PHE A CG  
518  C  CD1 . PHE A 78  ? 1.3169 0.9264 0.8878 0.3008  -0.1248 -0.0282 148 PHE A CD1 
519  C  CD2 . PHE A 78  ? 1.3296 0.9032 0.8547 0.2885  -0.0919 -0.0237 148 PHE A CD2 
520  C  CE1 . PHE A 78  ? 1.3099 0.9396 0.9157 0.3042  -0.1230 -0.0304 148 PHE A CE1 
521  C  CE2 . PHE A 78  ? 1.3456 0.9401 0.9023 0.2922  -0.0927 -0.0252 148 PHE A CE2 
522  C  CZ  . PHE A 78  ? 1.3014 0.9224 0.8971 0.2999  -0.1070 -0.0285 148 PHE A CZ  
523  N  N   . LEU A 79  ? 1.4249 0.8487 0.7718 0.2919  -0.1035 -0.0178 149 LEU A N   
524  C  CA  . LEU A 79  ? 1.4783 0.8450 0.7638 0.2848  -0.0822 -0.0161 149 LEU A CA  
525  C  C   . LEU A 79  ? 1.6056 0.9038 0.8225 0.2971  -0.0907 -0.0117 149 LEU A C   
526  O  O   . LEU A 79  ? 1.6396 0.8940 0.8158 0.2905  -0.0640 -0.0101 149 LEU A O   
527  C  CB  . LEU A 79  ? 1.4911 0.8483 0.7597 0.2821  -0.0867 -0.0177 149 LEU A CB  
528  C  CG  . LEU A 79  ? 1.6151 0.9062 0.8154 0.2747  -0.0632 -0.0168 149 LEU A CG  
529  C  CD1 . LEU A 79  ? 1.5879 0.8973 0.8176 0.2554  -0.0242 -0.0207 149 LEU A CD1 
530  C  CD2 . LEU A 79  ? 1.6770 0.9437 0.8434 0.2792  -0.0806 -0.0174 149 LEU A CD2 
531  N  N   . PHE A 80  ? 1.5858 0.8733 0.7926 0.3153  -0.1283 -0.0109 150 PHE A N   
532  C  CA  . PHE A 80  ? 1.6601 0.8815 0.8027 0.3305  -0.1452 -0.0069 150 PHE A CA  
533  C  C   . PHE A 80  ? 1.7115 0.9300 0.8589 0.3295  -0.1286 -0.0045 150 PHE A C   
534  O  O   . PHE A 80  ? 1.7676 0.9233 0.8507 0.3285  -0.1114 -0.0008 150 PHE A O   
535  C  CB  . PHE A 80  ? 1.6907 0.9184 0.8487 0.3507  -0.1926 -0.0092 150 PHE A CB  
536  C  CG  . PHE A 80  ? 1.7722 0.9499 0.8728 0.3592  -0.2173 -0.0099 150 PHE A CG  
537  C  CD1 . PHE A 80  ? 1.9116 0.9986 0.9168 0.3704  -0.2289 -0.0056 150 PHE A CD1 
538  C  CD2 . PHE A 80  ? 1.7651 0.9808 0.9020 0.3564  -0.2297 -0.0150 150 PHE A CD2 
539  C  CE1 . PHE A 80  ? 1.9896 1.0223 0.9330 0.3787  -0.2540 -0.0067 150 PHE A CE1 
540  C  CE2 . PHE A 80  ? 1.8616 1.0283 0.9430 0.3640  -0.2537 -0.0164 150 PHE A CE2 
541  C  CZ  . PHE A 80  ? 1.9398 1.0140 0.9228 0.3751  -0.2663 -0.0124 150 PHE A CZ  
542  N  N   . LEU A 81  ? 1.6049 0.8865 0.8247 0.3296  -0.1321 -0.0070 151 LEU A N   
543  C  CA  . LEU A 81  ? 1.5955 0.8822 0.8289 0.3289  -0.1186 -0.0056 151 LEU A CA  
544  C  C   . LEU A 81  ? 1.6584 0.9274 0.8715 0.3119  -0.0780 -0.0051 151 LEU A C   
545  O  O   . LEU A 81  ? 1.6965 0.9206 0.8691 0.3137  -0.0658 -0.0022 151 LEU A O   
546  C  CB  . LEU A 81  ? 1.5209 0.8808 0.8369 0.3279  -0.1237 -0.0096 151 LEU A CB  
547  C  CG  . LEU A 81  ? 1.5666 0.9508 0.9225 0.3443  -0.1581 -0.0127 151 LEU A CG  
548  C  CD1 . LEU A 81  ? 1.5935 0.9634 0.9352 0.3545  -0.1883 -0.0147 151 LEU A CD1 
549  C  CD2 . LEU A 81  ? 1.5212 0.9740 0.9536 0.3376  -0.1515 -0.0174 151 LEU A CD2 
550  N  N   . GLY A 82  ? 1.5839 0.8851 0.8263 0.2959  -0.0578 -0.0088 152 GLY A N   
551  C  CA  . GLY A 82  ? 1.5914 0.8786 0.8262 0.2789  -0.0195 -0.0112 152 GLY A CA  
552  C  C   . GLY A 82  ? 1.7344 0.9385 0.8878 0.2788  -0.0017 -0.0083 152 GLY A C   
553  O  O   . GLY A 82  ? 1.7538 0.9271 0.8868 0.2744  0.0214  -0.0082 152 GLY A O   
554  N  N   . ILE A 83  ? 1.7498 0.9119 0.8514 0.2844  -0.0129 -0.0060 153 ILE A N   
555  C  CA  . ILE A 83  ? 1.8480 0.9177 0.8567 0.2854  0.0030  -0.0028 153 ILE A CA  
556  C  C   . ILE A 83  ? 1.9758 0.9893 0.9265 0.3028  -0.0155 0.0034  153 ILE A C   
557  O  O   . ILE A 83  ? 2.0297 0.9804 0.9248 0.2996  0.0110  0.0054  153 ILE A O   
558  C  CB  . ILE A 83  ? 1.9241 0.9612 0.8896 0.2858  -0.0039 -0.0028 153 ILE A CB  
559  C  CG1 . ILE A 83  ? 1.8660 0.9582 0.8918 0.2682  0.0166  -0.0093 153 ILE A CG1 
560  C  CG2 . ILE A 83  ? 2.0469 0.9749 0.9029 0.2867  0.0158  0.0006  153 ILE A CG2 
561  C  CD1 . ILE A 83  ? 1.9855 1.0484 0.9731 0.2669  0.0133  -0.0099 153 ILE A CD1 
562  N  N   . LEU A 84  ? 1.9370 0.9701 0.9020 0.3214  -0.0604 0.0056  154 LEU A N   
563  C  CA  . LEU A 84  ? 1.9974 0.9855 0.9203 0.3412  -0.0873 0.0104  154 LEU A CA  
564  C  C   . LEU A 84  ? 2.0534 1.0522 0.9984 0.3370  -0.0655 0.0111  154 LEU A C   
565  O  O   . LEU A 84  ? 2.1192 1.0483 0.9979 0.3424  -0.0563 0.0155  154 LEU A O   
566  C  CB  . LEU A 84  ? 1.9669 0.9964 0.9340 0.3594  -0.1381 0.0087  154 LEU A CB  
567  C  CG  . LEU A 84  ? 2.0797 1.0682 1.0162 0.3829  -0.1750 0.0116  154 LEU A CG  
568  C  CD1 . LEU A 84  ? 2.0762 1.0827 1.0378 0.4001  -0.2251 0.0076  154 LEU A CD1 
569  C  CD2 . LEU A 84  ? 2.0689 1.0959 1.0587 0.3844  -0.1686 0.0115  154 LEU A CD2 
570  N  N   . THR A 85  ? 1.9410 1.0223 0.9745 0.3280  -0.0581 0.0068  155 THR A N   
571  C  CA  . THR A 85  ? 1.9265 1.0249 0.9881 0.3224  -0.0375 0.0060  155 THR A CA  
572  C  C   . THR A 85  ? 2.0424 1.1003 1.0696 0.3054  0.0079  0.0045  155 THR A C   
573  O  O   . THR A 85  ? 2.0751 1.0928 1.0708 0.3068  0.0229  0.0066  155 THR A O   
574  C  CB  . THR A 85  ? 1.9157 1.1047 1.0717 0.3164  -0.0411 0.0010  155 THR A CB  
575  O  OG1 . THR A 85  ? 1.8786 1.1001 1.0678 0.3314  -0.0789 0.0009  155 THR A OG1 
576  C  CG2 . THR A 85  ? 1.8713 1.0746 1.0526 0.3115  -0.0229 -0.0003 155 THR A CG2 
577  N  N   . MET A 86  ? 2.0185 1.0809 1.0500 0.2900  0.0306  0.0002  156 MET A N   
578  C  CA  . MET A 86  ? 2.0645 1.0872 1.0716 0.2722  0.0777  -0.0040 156 MET A CA  
579  C  C   . MET A 86  ? 2.2666 1.1853 1.1706 0.2783  0.0912  0.0015  156 MET A C   
580  O  O   . MET A 86  ? 2.3009 1.1761 1.1788 0.2687  0.1285  -0.0006 156 MET A O   
581  C  CB  . MET A 86  ? 2.0640 1.1117 1.1003 0.2566  0.0956  -0.0104 156 MET A CB  
582  C  CG  . MET A 86  ? 2.1012 1.1492 1.1663 0.2355  0.1423  -0.0197 156 MET A CG  
583  S  SD  . MET A 86  ? 2.0713 1.1938 1.2293 0.2257  0.1495  -0.0278 156 MET A SD  
584  C  CE  . MET A 86  ? 1.9526 1.1540 1.1634 0.2396  0.0997  -0.0232 156 MET A CE  
585  N  N   . LEU A 87  ? 2.3138 1.1876 1.1564 0.2939  0.0616  0.0077  157 LEU A N   
586  C  CA  . LEU A 87  ? 2.4423 1.2091 1.1774 0.3021  0.0702  0.0137  157 LEU A CA  
587  C  C   . LEU A 87  ? 2.5506 1.3171 1.2833 0.3215  0.0368  0.0192  157 LEU A C   
588  O  O   . LEU A 87  ? 2.5698 1.3213 1.2764 0.3405  -0.0066 0.0233  157 LEU A O   
589  C  CB  . LEU A 87  ? 2.5115 1.2175 1.1696 0.3113  0.0500  0.0173  157 LEU A CB  
590  C  CG  . LEU A 87  ? 2.5680 1.2709 1.2248 0.2937  0.0797  0.0119  157 LEU A CG  
591  C  CD1 . LEU A 87  ? 2.6439 1.2833 1.2190 0.3054  0.0538  0.0158  157 LEU A CD1 
592  C  CD2 . LEU A 87  ? 2.6436 1.2927 1.2698 0.2737  0.1423  0.0074  157 LEU A CD2 
593  N  N   . ARG A 88  ? 2.5156 1.3160 1.2949 0.3174  0.0506  0.0175  158 ARG A N   
594  C  CA  . ARG A 88  ? 2.5441 1.3432 1.3230 0.3368  0.0184  0.0225  158 ARG A CA  
595  C  C   . ARG A 88  ? 2.7813 1.4658 1.4471 0.3473  0.0252  0.0295  158 ARG A C   
596  O  O   . ARG A 88  ? 2.8226 1.4535 1.4428 0.3327  0.0708  0.0283  158 ARG A O   
597  C  CB  . ARG A 88  ? 2.4622 1.3283 1.3207 0.3288  0.0321  0.0184  158 ARG A CB  
598  C  CG  . ARG A 88  ? 2.5380 1.4355 1.4308 0.3475  -0.0060 0.0210  158 ARG A CG  
599  C  CD  . ARG A 88  ? 2.5903 1.5307 1.5196 0.3618  -0.0525 0.0206  158 ARG A CD  
600  N  NE  . ARG A 88  ? 2.6327 1.6167 1.6176 0.3756  -0.0811 0.0198  158 ARG A NE  
601  C  CZ  . ARG A 88  ? 2.8504 1.7927 1.8050 0.3962  -0.1080 0.0237  158 ARG A CZ  
602  N  NH1 . ARG A 88  ? 2.7844 1.6335 1.6429 0.4065  -0.1117 0.0299  158 ARG A NH1 
603  N  NH2 . ARG A 88  ? 2.6364 1.6253 1.6546 0.4068  -0.1300 0.0210  158 ARG A NH2 
604  N  N   . PRO A 89  ? 2.8548 1.4922 1.4681 0.3721  -0.0191 0.0359  159 PRO A N   
605  C  CA  . PRO A 89  ? 3.0041 1.5210 1.4972 0.3830  -0.0140 0.0431  159 PRO A CA  
606  C  C   . PRO A 89  ? 3.1355 1.6421 1.6337 0.3797  0.0130  0.0443  159 PRO A C   
607  O  O   . PRO A 89  ? 3.1955 1.6303 1.6291 0.3694  0.0566  0.0456  159 PRO A O   
608  C  CB  . PRO A 89  ? 3.0657 1.5553 1.5261 0.4119  -0.0784 0.0474  159 PRO A CB  
609  C  CG  . PRO A 89  ? 3.0044 1.6030 1.5820 0.4170  -0.1086 0.0426  159 PRO A CG  
610  C  CD  . PRO A 89  ? 2.8375 1.5275 1.5042 0.3918  -0.0741 0.0358  159 PRO A CD  
611  N  N   . ASN A 90  ? 3.0782 1.6614 1.6607 0.3861  -0.0088 0.0425  160 ASN A N   
612  C  CA  . ASN A 90  ? 3.0922 1.6852 1.6994 0.3837  0.0102  0.0425  160 ASN A CA  
613  C  C   . ASN A 90  ? 3.1036 1.7596 1.7811 0.3563  0.0570  0.0343  160 ASN A C   
614  O  O   . ASN A 90  ? 3.0033 1.7498 1.7748 0.3505  0.0518  0.0290  160 ASN A O   
615  C  CB  . ASN A 90  ? 3.1470 1.7912 1.8130 0.4029  -0.0348 0.0431  160 ASN A CB  
616  C  CG  . ASN A 90  ? 3.6590 2.5448 2.5970 0.3355  -0.0615 0.0541  160 ASN A CG  
617  O  OD1 . ASN A 90  ? 3.6419 2.5785 2.6407 0.3035  -0.0471 0.0603  160 ASN A OD1 
618  N  ND2 . ASN A 90  ? 3.6082 2.5380 2.5996 0.3470  -0.1003 0.0563  160 ASN A ND2 
619  N  N   . MET A 91  ? 3.1452 1.7478 1.7744 0.3394  0.1032  0.0321  161 MET A N   
620  C  CA  . MET A 91  ? 3.1100 1.7533 1.7963 0.3135  0.1512  0.0225  161 MET A CA  
621  C  C   . MET A 91  ? 3.2238 1.8612 1.9195 0.3149  0.1638  0.0228  161 MET A C   
622  O  O   . MET A 91  ? 3.1395 1.8470 1.9163 0.3025  0.1765  0.0152  161 MET A O   
623  C  CB  . MET A 91  ? 3.2075 1.7764 1.8300 0.2980  0.1980  0.0197  161 MET A CB  
624  C  CG  . MET A 91  ? 3.1812 1.8093 1.8812 0.2720  0.2352  0.0070  161 MET A CG  
625  S  SD  . MET A 91  ? 3.3054 1.8581 1.9464 0.2541  0.2859  0.0017  161 MET A SD  
626  C  CE  . MET A 91  ? 3.1759 1.8051 1.9322 0.2252  0.3297  -0.0162 161 MET A CE  
627  N  N   . TYR A 92  ? 3.2724 1.8279 1.8853 0.3330  0.1522  0.0319  162 TYR A N   
628  C  CA  . TYR A 92  ? 3.3057 1.8453 1.9155 0.3395  0.1568  0.0342  162 TYR A CA  
629  C  C   . TYR A 92  ? 3.2060 1.8414 1.9100 0.3474  0.1222  0.0324  162 TYR A C   
630  O  O   . TYR A 92  ? 3.1878 1.8518 1.9340 0.3409  0.1388  0.0287  162 TYR A O   
631  C  CB  . TYR A 92  ? 3.4898 1.9193 1.9865 0.3616  0.1406  0.0453  162 TYR A CB  
632  C  CG  . TYR A 92  ? 3.5598 1.9738 2.0478 0.3337  0.1702  0.0452  162 TYR A CG  
633  C  CD1 . TYR A 92  ? 3.5792 1.9927 2.0882 0.3113  0.2122  0.0410  162 TYR A CD1 
634  C  CD2 . TYR A 92  ? 3.6160 2.0146 2.0744 0.3315  0.1537  0.0487  162 TYR A CD2 
635  C  CE1 . TYR A 92  ? 3.6376 2.0782 2.1815 0.2812  0.2308  0.0384  162 TYR A CE1 
636  C  CE2 . TYR A 92  ? 3.6205 2.0275 2.0935 0.3034  0.1779  0.0477  162 TYR A CE2 
637  C  CZ  . TYR A 92  ? 3.6028 2.1893 2.2787 0.2512  0.1925  0.0383  162 TYR A CZ  
638  O  OH  . TYR A 92  ? 3.6472 2.2833 2.3780 0.2227  0.2048  0.0348  162 TYR A OH  
639  N  N   . PHE A 93  ? 3.0736 1.7570 1.8119 0.3597  0.0775  0.0338  163 PHE A N   
640  C  CA  . PHE A 93  ? 2.9541 1.7260 1.7825 0.3662  0.0475  0.0309  163 PHE A CA  
641  C  C   . PHE A 93  ? 2.8375 1.6943 1.7526 0.3435  0.0721  0.0213  163 PHE A C   
642  O  O   . PHE A 93  ? 2.7659 1.6840 1.7477 0.3437  0.0632  0.0179  163 PHE A O   
643  C  CB  . PHE A 93  ? 2.9616 1.7541 1.8009 0.3836  -0.0017 0.0331  163 PHE A CB  
644  C  CG  . PHE A 93  ? 2.8823 1.7679 1.8189 0.3869  -0.0275 0.0281  163 PHE A CG  
645  C  CD1 . PHE A 93  ? 2.9124 1.8099 1.8775 0.4046  -0.0548 0.0290  163 PHE A CD1 
646  C  CD2 . PHE A 93  ? 2.8283 1.7853 1.8269 0.3726  -0.0233 0.0221  163 PHE A CD2 
647  C  CE1 . PHE A 93  ? 2.8438 1.8218 1.8982 0.4063  -0.0727 0.0232  163 PHE A CE1 
648  C  CE2 . PHE A 93  ? 2.7866 1.8214 1.8683 0.3750  -0.0426 0.0174  163 PHE A CE2 
649  C  CZ  . PHE A 93  ? 2.7603 1.8040 1.8691 0.3913  -0.0655 0.0178  163 PHE A CZ  
650  N  N   . MET A 94  ? 2.7379 1.5940 1.6506 0.3243  0.1025  0.0163  164 MET A N   
651  C  CA  . MET A 94  ? 2.6325 1.5602 1.6224 0.3033  0.1237  0.0061  164 MET A CA  
652  C  C   . MET A 94  ? 2.6470 1.5509 1.6345 0.2883  0.1658  0.0002  164 MET A C   
653  O  O   . MET A 94  ? 2.7154 1.5451 1.6389 0.2847  0.1941  0.0016  164 MET A O   
654  C  CB  . MET A 94  ? 2.6421 1.5864 1.6418 0.2914  0.1309  0.0020  164 MET A CB  
655  C  CG  . MET A 94  ? 2.6687 1.6369 1.6729 0.3046  0.0912  0.0065  164 MET A CG  
656  S  SD  . MET A 94  ? 2.6079 1.6845 1.7142 0.2960  0.0761  -0.0007 164 MET A SD  
657  C  CE  . MET A 94  ? 2.5637 1.6510 1.6654 0.3169  0.0283  0.0055  164 MET A CE  
658  N  N   . ALA A 95  ? 2.5009 1.4629 1.5552 0.2796  0.1708  -0.0069 165 ALA A N   
659  C  CA  . ALA A 95  ? 2.4879 1.4363 1.5525 0.2643  0.2084  -0.0150 165 ALA A CA  
660  C  C   . ALA A 95  ? 2.4154 1.4354 1.5604 0.2459  0.2161  -0.0278 165 ALA A C   
661  O  O   . ALA A 95  ? 2.3508 1.4314 1.5455 0.2489  0.1918  -0.0289 165 ALA A O   
662  C  CB  . ALA A 95  ? 2.5085 1.4463 1.5676 0.2741  0.2036  -0.0116 165 ALA A CB  
663  N  N   . PRO A 96  ? 2.3369 1.3508 1.4970 0.2274  0.2471  -0.0382 166 PRO A N   
664  C  CA  . PRO A 96  ? 2.3909 1.3322 1.5005 0.2190  0.2865  -0.0404 166 PRO A CA  
665  C  C   . PRO A 96  ? 2.4126 1.3349 1.5024 0.2138  0.2954  -0.0409 166 PRO A C   
666  O  O   . PRO A 96  ? 2.4493 1.3276 1.5245 0.1995  0.3366  -0.0487 166 PRO A O   
667  C  CB  . PRO A 96  ? 2.3924 1.3539 1.5594 0.1989  0.3181  -0.0568 166 PRO A CB  
668  C  CG  . PRO A 96  ? 2.3642 1.4146 1.6147 0.1931  0.2928  -0.0649 166 PRO A CG  
669  C  CD  . PRO A 96  ? 2.2824 1.3630 1.5225 0.2114  0.2495  -0.0518 166 PRO A CD  
670  N  N   . LEU A 97  ? 2.3028 1.2573 1.3954 0.2240  0.2603  -0.0340 167 LEU A N   
671  C  CA  . LEU A 97  ? 2.2946 1.2378 1.3710 0.2203  0.2633  -0.0339 167 LEU A CA  
672  C  C   . LEU A 97  ? 2.2328 1.2397 1.3915 0.2023  0.2731  -0.0477 167 LEU A C   
673  O  O   . LEU A 97  ? 2.2178 1.2324 1.3808 0.1984  0.2721  -0.0489 167 LEU A O   
674  C  CB  . LEU A 97  ? 2.3954 1.2398 1.3841 0.2187  0.2966  -0.0308 167 LEU A CB  
675  C  CG  . LEU A 97  ? 2.5331 1.3024 1.4371 0.2351  0.2926  -0.0191 167 LEU A CG  
676  C  CD1 . LEU A 97  ? 2.6401 1.3059 1.4588 0.2296  0.3351  -0.0185 167 LEU A CD1 
677  C  CD2 . LEU A 97  ? 2.5609 1.3384 1.4396 0.2578  0.2426  -0.0068 167 LEU A CD2 
678  N  N   . GLN A 98  ? 2.1093 1.1620 1.3335 0.1925  0.2784  -0.0582 168 GLN A N   
679  C  CA  . GLN A 98  ? 2.0246 1.1418 1.3334 0.1778  0.2789  -0.0725 168 GLN A CA  
680  C  C   . GLN A 98  ? 1.9691 1.1482 1.3053 0.1880  0.2355  -0.0662 168 GLN A C   
681  O  O   . GLN A 98  ? 1.9205 1.1411 1.3020 0.1810  0.2283  -0.0725 168 GLN A O   
682  C  CB  . GLN A 98  ? 2.0197 1.1586 1.3766 0.1688  0.2889  -0.0840 168 GLN A CB  
683  C  CG  . GLN A 98  ? 2.1629 1.3589 1.6059 0.1538  0.2883  -0.1013 168 GLN A CG  
684  C  CD  . GLN A 98  ? 2.4115 1.6196 1.8977 0.1444  0.2987  -0.1146 168 GLN A CD  
685  O  OE1 . GLN A 98  ? 2.3957 1.5697 1.8506 0.1471  0.3118  -0.1118 168 GLN A OE1 
686  N  NE2 . GLN A 98  ? 2.2678 1.5228 1.8271 0.1335  0.2915  -0.1302 168 GLN A NE2 
687  N  N   . GLU A 99  ? 1.8924 1.0726 1.1996 0.2048  0.2083  -0.0541 169 GLU A N   
688  C  CA  . GLU A 99  ? 1.8262 1.0549 1.1518 0.2168  0.1697  -0.0471 169 GLU A CA  
689  C  C   . GLU A 99  ? 1.8269 1.0637 1.1436 0.2207  0.1550  -0.0426 169 GLU A C   
690  O  O   . GLU A 99  ? 1.7707 1.0573 1.1200 0.2255  0.1284  -0.0409 169 GLU A O   
691  C  CB  . GLU A 99  ? 1.8665 1.0745 1.1547 0.2345  0.1519  -0.0361 169 GLU A CB  
692  C  CG  . GLU A 99  ? 2.0017 1.2033 1.2978 0.2322  0.1641  -0.0396 169 GLU A CG  
693  C  CD  . GLU A 99  ? 2.2397 1.4468 1.5283 0.2481  0.1418  -0.0318 169 GLU A CD  
694  O  OE1 . GLU A 99  ? 2.1291 1.3761 1.4414 0.2563  0.1148  -0.0286 169 GLU A OE1 
695  O  OE2 . GLU A 99  ? 2.1847 1.3573 1.4486 0.2517  0.1530  -0.0300 169 GLU A OE2 
696  N  N   . LYS A 100 ? 1.8065 0.9896 1.0738 0.2195  0.1725  -0.0402 170 LYS A N   
697  C  CA  . LYS A 100 ? 1.7904 0.9733 1.0423 0.2228  0.1606  -0.0363 170 LYS A CA  
698  C  C   . LYS A 100 ? 1.7464 0.9862 1.0632 0.2104  0.1603  -0.0454 170 LYS A C   
699  O  O   . LYS A 100 ? 1.7103 0.9818 1.0388 0.2162  0.1359  -0.0416 170 LYS A O   
700  C  CB  . LYS A 100 ? 1.9003 1.0051 1.0797 0.2221  0.1840  -0.0331 170 LYS A CB  
701  C  CG  . LYS A 100 ? 2.1124 1.1644 1.2179 0.2418  0.1634  -0.0205 170 LYS A CG  
702  C  CD  . LYS A 100 ? 2.3108 1.2774 1.3320 0.2425  0.1823  -0.0166 170 LYS A CD  
703  C  CE  . LYS A 100 ? 2.4835 1.4073 1.4374 0.2645  0.1476  -0.0048 170 LYS A CE  
704  N  NZ  . LYS A 100 ? 2.5312 1.5199 1.5306 0.2729  0.1077  -0.0032 170 LYS A NZ  
705  N  N   . VAL A 101 ? 1.6606 0.9151 1.0238 0.1941  0.1847  -0.0583 171 VAL A N   
706  C  CA  . VAL A 101 ? 1.5918 0.8997 1.0228 0.1828  0.1819  -0.0688 171 VAL A CA  
707  C  C   . VAL A 101 ? 1.5525 0.9200 1.0185 0.1906  0.1456  -0.0656 171 VAL A C   
708  O  O   . VAL A 101 ? 1.5136 0.9148 1.0034 0.1907  0.1299  -0.0655 171 VAL A O   
709  C  CB  . VAL A 101 ? 1.6362 0.9486 1.1176 0.1657  0.2095  -0.0854 171 VAL A CB  
710  C  CG1 . VAL A 101 ? 1.5787 0.9472 1.1335 0.1567  0.1987  -0.0969 171 VAL A CG1 
711  C  CG2 . VAL A 101 ? 1.6965 0.9457 1.1459 0.1562  0.2524  -0.0902 171 VAL A CG2 
712  N  N   . VAL A 102 ? 1.4793 0.8549 0.9454 0.1967  0.1352  -0.0631 172 VAL A N   
713  C  CA  . VAL A 102 ? 1.4212 0.8428 0.9137 0.2034  0.1069  -0.0606 172 VAL A CA  
714  C  C   . VAL A 102 ? 1.4392 0.8719 0.9141 0.2161  0.0833  -0.0501 172 VAL A C   
715  O  O   . VAL A 102 ? 1.3928 0.8665 0.8991 0.2159  0.0665  -0.0511 172 VAL A O   
716  C  CB  . VAL A 102 ? 1.4767 0.8909 0.9621 0.2076  0.1068  -0.0596 172 VAL A CB  
717  C  CG1 . VAL A 102 ? 1.4395 0.8900 0.9411 0.2157  0.0816  -0.0558 172 VAL A CG1 
718  C  CG2 . VAL A 102 ? 1.4731 0.8879 0.9893 0.1939  0.1249  -0.0727 172 VAL A CG2 
719  N  N   . PHE A 103 ? 1.4232 0.8160 0.8476 0.2269  0.0818  -0.0411 173 PHE A N   
720  C  CA  . PHE A 103 ? 1.4104 0.8096 0.8201 0.2395  0.0578  -0.0331 173 PHE A CA  
721  C  C   . PHE A 103 ? 1.4358 0.8433 0.8511 0.2339  0.0583  -0.0348 173 PHE A C   
722  O  O   . PHE A 103 ? 1.3973 0.8384 0.8326 0.2386  0.0379  -0.0327 173 PHE A O   
723  C  CB  . PHE A 103 ? 1.4867 0.8359 0.8403 0.2537  0.0516  -0.0246 173 PHE A CB  
724  C  CG  . PHE A 103 ? 1.4964 0.8580 0.8587 0.2664  0.0331  -0.0208 173 PHE A CG  
725  C  CD1 . PHE A 103 ? 1.5452 0.8959 0.9071 0.2651  0.0450  -0.0222 173 PHE A CD1 
726  C  CD2 . PHE A 103 ? 1.5044 0.8891 0.8805 0.2790  0.0054  -0.0172 173 PHE A CD2 
727  C  CE1 . PHE A 103 ? 1.5488 0.9097 0.9212 0.2766  0.0303  -0.0194 173 PHE A CE1 
728  C  CE2 . PHE A 103 ? 1.5323 0.9284 0.9244 0.2902  -0.0085 -0.0156 173 PHE A CE2 
729  C  CZ  . PHE A 103 ? 1.5184 0.9022 0.9077 0.2890  0.0043  -0.0164 173 PHE A CZ  
730  N  N   . GLY A 104 ? 1.4111 0.7880 0.8124 0.2229  0.0843  -0.0395 174 GLY A N   
731  C  CA  . GLY A 104 ? 1.4011 0.7782 0.8061 0.2157  0.0915  -0.0424 174 GLY A CA  
732  C  C   . GLY A 104 ? 1.3728 0.8091 0.8400 0.2084  0.0819  -0.0487 174 GLY A C   
733  O  O   . GLY A 104 ? 1.3517 0.8058 0.8248 0.2105  0.0694  -0.0466 174 GLY A O   
734  N  N   . MET A 105 ? 1.2850 0.7496 0.7966 0.2007  0.0855  -0.0568 175 MET A N   
735  C  CA  . MET A 105 ? 1.2253 0.7402 0.7919 0.1949  0.0729  -0.0635 175 MET A CA  
736  C  C   . MET A 105 ? 1.2244 0.7698 0.7927 0.2056  0.0454  -0.0557 175 MET A C   
737  O  O   . MET A 105 ? 1.1917 0.7634 0.7818 0.2040  0.0357  -0.0567 175 MET A O   
738  C  CB  . MET A 105 ? 1.2404 0.7715 0.8422 0.1882  0.0747  -0.0726 175 MET A CB  
739  C  CG  . MET A 105 ? 1.3173 0.8199 0.9254 0.1774  0.1031  -0.0822 175 MET A CG  
740  S  SD  . MET A 105 ? 1.3491 0.8764 1.0265 0.1620  0.1113  -0.1002 175 MET A SD  
741  C  CE  . MET A 105 ? 1.2880 0.8379 0.9979 0.1605  0.0959  -0.1086 175 MET A CE  
742  N  N   . PHE A 106 ? 1.1749 0.7137 0.7207 0.2165  0.0349  -0.0487 176 PHE A N   
743  C  CA  . PHE A 106 ? 1.1434 0.7062 0.6934 0.2268  0.0129  -0.0427 176 PHE A CA  
744  C  C   . PHE A 106 ? 1.1858 0.7460 0.7222 0.2317  0.0043  -0.0382 176 PHE A C   
745  O  O   . PHE A 106 ? 1.1485 0.7399 0.7083 0.2325  -0.0082 -0.0382 176 PHE A O   
746  C  CB  . PHE A 106 ? 1.1789 0.7297 0.7114 0.2376  0.0066  -0.0377 176 PHE A CB  
747  C  CG  . PHE A 106 ? 1.1810 0.7513 0.7213 0.2488  -0.0133 -0.0330 176 PHE A CG  
748  C  CD1 . PHE A 106 ? 1.1835 0.7887 0.7552 0.2474  -0.0208 -0.0352 176 PHE A CD1 
749  C  CD2 . PHE A 106 ? 1.2313 0.7812 0.7474 0.2608  -0.0246 -0.0276 176 PHE A CD2 
750  C  CE1 . PHE A 106 ? 1.1811 0.8030 0.7657 0.2565  -0.0344 -0.0327 176 PHE A CE1 
751  C  CE2 . PHE A 106 ? 1.2506 0.8208 0.7848 0.2709  -0.0432 -0.0260 176 PHE A CE2 
752  C  CZ  . PHE A 106 ? 1.1885 0.7959 0.7597 0.2681  -0.0456 -0.0289 176 PHE A CZ  
753  N  N   . PHE A 107 ? 1.1791 0.6974 0.6739 0.2349  0.0115  -0.0348 177 PHE A N   
754  C  CA  . PHE A 107 ? 1.1887 0.6946 0.6609 0.2401  0.0025  -0.0310 177 PHE A CA  
755  C  C   . PHE A 107 ? 1.2104 0.7331 0.7033 0.2299  0.0097  -0.0354 177 PHE A C   
756  O  O   . PHE A 107 ? 1.1903 0.7297 0.6889 0.2341  -0.0052 -0.0333 177 PHE A O   
757  C  CB  . PHE A 107 ? 1.2740 0.7207 0.6862 0.2464  0.0077  -0.0266 177 PHE A CB  
758  C  CG  . PHE A 107 ? 1.3109 0.7459 0.7053 0.2620  -0.0123 -0.0211 177 PHE A CG  
759  C  CD1 . PHE A 107 ? 1.3398 0.7906 0.7418 0.2744  -0.0400 -0.0185 177 PHE A CD1 
760  C  CD2 . PHE A 107 ? 1.3638 0.7723 0.7390 0.2645  -0.0034 -0.0198 177 PHE A CD2 
761  C  CE1 . PHE A 107 ? 1.3662 0.8079 0.7621 0.2894  -0.0595 -0.0156 177 PHE A CE1 
762  C  CE2 . PHE A 107 ? 1.4153 0.8132 0.7789 0.2798  -0.0226 -0.0155 177 PHE A CE2 
763  C  CZ  . PHE A 107 ? 1.3809 0.7954 0.7567 0.2925  -0.0513 -0.0138 177 PHE A CZ  
764  N  N   . LEU A 108 ? 1.1589 0.6794 0.6693 0.2167  0.0316  -0.0425 178 LEU A N   
765  C  CA  . LEU A 108 ? 1.1334 0.6722 0.6732 0.2066  0.0389  -0.0484 178 LEU A CA  
766  C  C   . LEU A 108 ? 1.1244 0.7141 0.7059 0.2081  0.0186  -0.0489 178 LEU A C   
767  O  O   . LEU A 108 ? 1.1088 0.7113 0.6958 0.2087  0.0113  -0.0476 178 LEU A O   
768  C  CB  . LEU A 108 ? 1.1377 0.6708 0.7040 0.1928  0.0635  -0.0587 178 LEU A CB  
769  C  CG  . LEU A 108 ? 1.2513 0.7312 0.7825 0.1864  0.0934  -0.0611 178 LEU A CG  
770  C  CD1 . LEU A 108 ? 1.2529 0.7319 0.8229 0.1728  0.1180  -0.0736 178 LEU A CD1 
771  C  CD2 . LEU A 108 ? 1.3033 0.7659 0.8144 0.1845  0.0998  -0.0599 178 LEU A CD2 
772  N  N   . GLY A 109 ? 1.0502 0.6624 0.6539 0.2093  0.0102  -0.0503 179 GLY A N   
773  C  CA  . GLY A 109 ? 1.0073 0.6579 0.6407 0.2111  -0.0072 -0.0505 179 GLY A CA  
774  C  C   . GLY A 109 ? 1.0400 0.7013 0.6640 0.2210  -0.0227 -0.0436 179 GLY A C   
775  O  O   . GLY A 109 ? 1.0120 0.6954 0.6538 0.2200  -0.0302 -0.0439 179 GLY A O   
776  N  N   . ALA A 110 ? 1.0119 0.6551 0.6097 0.2308  -0.0275 -0.0383 180 ALA A N   
777  C  CA  . ALA A 110 ? 1.0030 0.6549 0.5988 0.2411  -0.0437 -0.0341 180 ALA A CA  
778  C  C   . ALA A 110 ? 1.0574 0.7025 0.6421 0.2409  -0.0465 -0.0333 180 ALA A C   
779  O  O   . ALA A 110 ? 1.0264 0.6967 0.6319 0.2417  -0.0557 -0.0336 180 ALA A O   
780  C  CB  . ALA A 110 ? 1.0366 0.6680 0.6118 0.2524  -0.0507 -0.0306 180 ALA A CB  
781  N  N   . VAL A 111 ? 1.0493 0.6587 0.6016 0.2377  -0.0349 -0.0331 181 VAL A N   
782  C  CA  . VAL A 111 ? 1.0642 0.6564 0.5956 0.2368  -0.0345 -0.0326 181 VAL A CA  
783  C  C   . VAL A 111 ? 1.0801 0.7004 0.6446 0.2266  -0.0281 -0.0368 181 VAL A C   
784  O  O   . VAL A 111 ? 1.0655 0.6977 0.6345 0.2290  -0.0383 -0.0359 181 VAL A O   
785  C  CB  . VAL A 111 ? 1.1703 0.7062 0.6498 0.2355  -0.0191 -0.0315 181 VAL A CB  
786  C  CG1 . VAL A 111 ? 1.1873 0.7033 0.6521 0.2267  -0.0036 -0.0342 181 VAL A CG1 
787  C  CG2 . VAL A 111 ? 1.2083 0.7102 0.6443 0.2502  -0.0370 -0.0262 181 VAL A CG2 
788  N  N   . LEU A 112 ? 1.0185 0.6513 0.6104 0.2164  -0.0143 -0.0420 182 LEU A N   
789  C  CA  . LEU A 112 ? 0.9860 0.6446 0.6144 0.2076  -0.0103 -0.0472 182 LEU A CA  
790  C  C   . LEU A 112 ? 0.9969 0.6932 0.6520 0.2116  -0.0284 -0.0456 182 LEU A C   
791  O  O   . LEU A 112 ? 0.9760 0.6854 0.6423 0.2102  -0.0318 -0.0459 182 LEU A O   
792  C  CB  . LEU A 112 ? 0.9808 0.6418 0.6372 0.1973  0.0043  -0.0552 182 LEU A CB  
793  C  CG  . LEU A 112 ? 1.0758 0.6987 0.7154 0.1894  0.0304  -0.0597 182 LEU A CG  
794  C  CD1 . LEU A 112 ? 1.0700 0.7002 0.7488 0.1798  0.0425  -0.0699 182 LEU A CD1 
795  C  CD2 . LEU A 112 ? 1.1197 0.7256 0.7475 0.1849  0.0424  -0.0607 182 LEU A CD2 
796  N  N   . CYS A 113 ? 0.9456 0.6542 0.6065 0.2169  -0.0378 -0.0438 183 CYS A N   
797  C  CA  . CYS A 113 ? 0.9175 0.6537 0.5972 0.2209  -0.0508 -0.0423 183 CYS A CA  
798  C  C   . CYS A 113 ? 0.9630 0.7037 0.6374 0.2276  -0.0599 -0.0390 183 CYS A C   
799  O  O   . CYS A 113 ? 0.9384 0.6988 0.6305 0.2264  -0.0645 -0.0395 183 CYS A O   
800  C  CB  . CYS A 113 ? 0.9214 0.6591 0.6002 0.2251  -0.0540 -0.0414 183 CYS A CB  
801  S  SG  . CYS A 113 ? 0.9507 0.7106 0.6448 0.2300  -0.0632 -0.0399 183 CYS A SG  
802  N  N   . LEU A 114 ? 0.9437 0.6629 0.5930 0.2347  -0.0636 -0.0364 184 LEU A N   
803  C  CA  . LEU A 114 ? 0.9463 0.6656 0.5909 0.2425  -0.0767 -0.0351 184 LEU A CA  
804  C  C   . LEU A 114 ? 0.9997 0.7136 0.6364 0.2381  -0.0749 -0.0359 184 LEU A C   
805  O  O   . LEU A 114 ? 0.9783 0.7104 0.6312 0.2401  -0.0838 -0.0367 184 LEU A O   
806  C  CB  . LEU A 114 ? 0.9791 0.6718 0.5974 0.2530  -0.0860 -0.0331 184 LEU A CB  
807  C  CG  . LEU A 114 ? 1.0320 0.7317 0.6633 0.2590  -0.0890 -0.0328 184 LEU A CG  
808  C  CD1 . LEU A 114 ? 1.0719 0.7368 0.6705 0.2663  -0.0921 -0.0306 184 LEU A CD1 
809  C  CD2 . LEU A 114 ? 1.0416 0.7663 0.7058 0.2657  -0.1006 -0.0351 184 LEU A CD2 
810  N  N   . SER A 115 ? 0.9780 0.6668 0.5932 0.2309  -0.0601 -0.0367 185 SER A N   
811  C  CA  . SER A 115 ? 0.9852 0.6631 0.5907 0.2252  -0.0532 -0.0383 185 SER A CA  
812  C  C   . SER A 115 ? 0.9894 0.7024 0.6353 0.2181  -0.0507 -0.0411 185 SER A C   
813  O  O   . SER A 115 ? 0.9796 0.7001 0.6294 0.2180  -0.0553 -0.0414 185 SER A O   
814  C  CB  . SER A 115 ? 1.0724 0.7107 0.6476 0.2181  -0.0324 -0.0398 185 SER A CB  
815  O  OG  . SER A 115 ? 1.1809 0.8311 0.7842 0.2095  -0.0177 -0.0438 185 SER A OG  
816  N  N   . PHE A 116 ? 0.9164 0.6491 0.5908 0.2134  -0.0464 -0.0433 186 PHE A N   
817  C  CA  . PHE A 116 ? 0.8807 0.6418 0.5901 0.2085  -0.0479 -0.0459 186 PHE A CA  
818  C  C   . PHE A 116 ? 0.9044 0.6880 0.6249 0.2142  -0.0612 -0.0433 186 PHE A C   
819  O  O   . PHE A 116 ? 0.8838 0.6815 0.6202 0.2115  -0.0623 -0.0444 186 PHE A O   
820  C  CB  . PHE A 116 ? 0.8907 0.6614 0.6220 0.2045  -0.0464 -0.0495 186 PHE A CB  
821  C  CG  . PHE A 116 ? 0.9254 0.6789 0.6610 0.1967  -0.0311 -0.0552 186 PHE A CG  
822  C  CD1 . PHE A 116 ? 0.9839 0.7181 0.7126 0.1907  -0.0151 -0.0580 186 PHE A CD1 
823  C  CD2 . PHE A 116 ? 0.9512 0.7048 0.6986 0.1946  -0.0306 -0.0590 186 PHE A CD2 
824  C  CE1 . PHE A 116 ? 1.0129 0.7282 0.7496 0.1823  0.0044  -0.0650 186 PHE A CE1 
825  C  CE2 . PHE A 116 ? 1.0015 0.7396 0.7600 0.1867  -0.0145 -0.0663 186 PHE A CE2 
826  C  CZ  . PHE A 116 ? 0.9956 0.7148 0.7510 0.1802  0.0045  -0.0696 186 PHE A CZ  
827  N  N   . SER A 117 ? 0.8583 0.6439 0.5730 0.2218  -0.0692 -0.0408 187 SER A N   
828  C  CA  . SER A 117 ? 0.8376 0.6417 0.5671 0.2269  -0.0776 -0.0400 187 SER A CA  
829  C  C   . SER A 117 ? 0.8820 0.6887 0.6118 0.2295  -0.0839 -0.0406 187 SER A C   
830  O  O   . SER A 117 ? 0.8591 0.6836 0.6079 0.2280  -0.0849 -0.0415 187 SER A O   
831  C  CB  . SER A 117 ? 0.8859 0.6885 0.6142 0.2337  -0.0811 -0.0391 187 SER A CB  
832  O  OG  . SER A 117 ? 0.9851 0.8049 0.7338 0.2362  -0.0831 -0.0401 187 SER A OG  
833  N  N   . TRP A 118 ? 0.8582 0.6431 0.5638 0.2336  -0.0888 -0.0404 188 TRP A N   
834  C  CA  . TRP A 118 ? 0.8594 0.6432 0.5626 0.2366  -0.0982 -0.0420 188 TRP A CA  
835  C  C   . TRP A 118 ? 0.8947 0.6787 0.5971 0.2282  -0.0893 -0.0429 188 TRP A C   
836  O  O   . TRP A 118 ? 0.8761 0.6742 0.5932 0.2282  -0.0942 -0.0446 188 TRP A O   
837  C  CB  . TRP A 118 ? 0.8808 0.6355 0.5534 0.2453  -0.1113 -0.0422 188 TRP A CB  
838  C  CG  . TRP A 118 ? 0.9297 0.6444 0.5568 0.2422  -0.1029 -0.0403 188 TRP A CG  
839  C  CD1 . TRP A 118 ? 0.9929 0.6821 0.5943 0.2434  -0.0969 -0.0380 188 TRP A CD1 
840  C  CD2 . TRP A 118 ? 0.9584 0.6465 0.5551 0.2383  -0.0987 -0.0411 188 TRP A CD2 
841  N  NE1 . TRP A 118 ? 1.0266 0.6739 0.5837 0.2395  -0.0862 -0.0374 188 TRP A NE1 
842  C  CE2 . TRP A 118 ? 1.0494 0.6937 0.6013 0.2362  -0.0867 -0.0393 188 TRP A CE2 
843  C  CE3 . TRP A 118 ? 0.9694 0.6633 0.5706 0.2355  -0.1015 -0.0435 188 TRP A CE3 
844  C  CZ2 . TRP A 118 ? 1.0831 0.6862 0.5924 0.2311  -0.0751 -0.0400 188 TRP A CZ2 
845  C  CZ3 . TRP A 118 ? 1.0270 0.6830 0.5873 0.2309  -0.0927 -0.0441 188 TRP A CZ3 
846  C  CH2 . TRP A 118 ? 1.0801 0.6894 0.5935 0.2286  -0.0787 -0.0424 188 TRP A CH2 
847  N  N   . LEU A 119 ? 0.8528 0.6248 0.5468 0.2204  -0.0746 -0.0427 189 LEU A N   
848  C  CA  . LEU A 119 ? 0.8447 0.6169 0.5455 0.2116  -0.0632 -0.0450 189 LEU A CA  
849  C  C   . LEU A 119 ? 0.8575 0.6622 0.5952 0.2090  -0.0649 -0.0458 189 LEU A C   
850  O  O   . LEU A 119 ? 0.8459 0.6573 0.5919 0.2062  -0.0639 -0.0471 189 LEU A O   
851  C  CB  . LEU A 119 ? 0.8590 0.6129 0.5546 0.2038  -0.0456 -0.0471 189 LEU A CB  
852  C  CG  . LEU A 119 ? 0.9644 0.6743 0.6157 0.2031  -0.0354 -0.0470 189 LEU A CG  
853  C  CD1 . LEU A 119 ? 0.9776 0.6721 0.6350 0.1930  -0.0124 -0.0515 189 LEU A CD1 
854  C  CD2 . LEU A 119 ? 1.0214 0.7091 0.6431 0.2040  -0.0374 -0.0471 189 LEU A CD2 
855  N  N   . PHE A 120 ? 0.7959 0.6157 0.5508 0.2098  -0.0672 -0.0450 190 PHE A N   
856  C  CA  . PHE A 120 ? 0.7696 0.6108 0.5495 0.2085  -0.0700 -0.0453 190 PHE A CA  
857  C  C   . PHE A 120 ? 0.8084 0.6626 0.5950 0.2126  -0.0760 -0.0444 190 PHE A C   
858  O  O   . PHE A 120 ? 0.7923 0.6572 0.5930 0.2098  -0.0750 -0.0451 190 PHE A O   
859  C  CB  . PHE A 120 ? 0.7883 0.6324 0.5724 0.2099  -0.0730 -0.0446 190 PHE A CB  
860  C  CG  . PHE A 120 ? 0.7970 0.6527 0.5911 0.2117  -0.0778 -0.0434 190 PHE A CG  
861  C  CD1 . PHE A 120 ? 0.8281 0.6889 0.6361 0.2085  -0.0801 -0.0448 190 PHE A CD1 
862  C  CD2 . PHE A 120 ? 0.8250 0.6826 0.6146 0.2169  -0.0787 -0.0416 190 PHE A CD2 
863  C  CE1 . PHE A 120 ? 0.8384 0.7009 0.6459 0.2108  -0.0840 -0.0431 190 PHE A CE1 
864  C  CE2 . PHE A 120 ? 0.8588 0.7187 0.6513 0.2178  -0.0782 -0.0408 190 PHE A CE2 
865  C  CZ  . PHE A 120 ? 0.8323 0.6921 0.6289 0.2150  -0.0812 -0.0408 190 PHE A CZ  
866  N  N   . HIS A 121 ? 0.7714 0.6242 0.5518 0.2191  -0.0819 -0.0439 191 HIS A N   
867  C  CA  . HIS A 121 ? 0.7619 0.6272 0.5571 0.2230  -0.0868 -0.0456 191 HIS A CA  
868  C  C   . HIS A 121 ? 0.8166 0.6810 0.6105 0.2216  -0.0900 -0.0479 191 HIS A C   
869  O  O   . HIS A 121 ? 0.8002 0.6788 0.6125 0.2206  -0.0895 -0.0496 191 HIS A O   
870  C  CB  . HIS A 121 ? 0.7790 0.6430 0.5769 0.2306  -0.0931 -0.0470 191 HIS A CB  
871  C  CG  . HIS A 121 ? 0.8184 0.6850 0.6219 0.2313  -0.0868 -0.0457 191 HIS A CG  
872  N  ND1 . HIS A 121 ? 0.8329 0.7093 0.6555 0.2320  -0.0810 -0.0476 191 HIS A ND1 
873  C  CD2 . HIS A 121 ? 0.8474 0.7041 0.6371 0.2308  -0.0840 -0.0434 191 HIS A CD2 
874  C  CE1 . HIS A 121 ? 0.8305 0.6992 0.6452 0.2321  -0.0749 -0.0459 191 HIS A CE1 
875  N  NE2 . HIS A 121 ? 0.8422 0.7007 0.6385 0.2316  -0.0778 -0.0435 191 HIS A NE2 
876  N  N   . THR A 122 ? 0.7954 0.6390 0.5641 0.2204  -0.0905 -0.0479 192 THR A N   
877  C  CA  . THR A 122 ? 0.8061 0.6395 0.5632 0.2189  -0.0929 -0.0503 192 THR A CA  
878  C  C   . THR A 122 ? 0.8342 0.6765 0.6043 0.2105  -0.0815 -0.0506 192 THR A C   
879  O  O   . THR A 122 ? 0.8262 0.6751 0.6040 0.2095  -0.0836 -0.0529 192 THR A O   
880  C  CB  . THR A 122 ? 0.9648 0.7615 0.6798 0.2198  -0.0937 -0.0500 192 THR A CB  
881  O  OG1 . THR A 122 ? 0.9796 0.7645 0.6860 0.2126  -0.0770 -0.0485 192 THR A OG1 
882  C  CG2 . THR A 122 ? 0.9657 0.7489 0.6649 0.2294  -0.1076 -0.0497 192 THR A CG2 
883  N  N   . VAL A 123 ? 0.7788 0.6211 0.5547 0.2050  -0.0707 -0.0494 193 VAL A N   
884  C  CA  . VAL A 123 ? 0.7620 0.6112 0.5559 0.1977  -0.0610 -0.0509 193 VAL A CA  
885  C  C   . VAL A 123 ? 0.7786 0.6509 0.6000 0.1984  -0.0644 -0.0497 193 VAL A C   
886  O  O   . VAL A 123 ? 0.7655 0.6435 0.6053 0.1941  -0.0602 -0.0511 193 VAL A O   
887  C  CB  . VAL A 123 ? 0.8237 0.6562 0.6142 0.1914  -0.0479 -0.0530 193 VAL A CB  
888  C  CG1 . VAL A 123 ? 0.8568 0.6553 0.6088 0.1905  -0.0409 -0.0537 193 VAL A CG1 
889  C  CG2 . VAL A 123 ? 0.8125 0.6516 0.6152 0.1924  -0.0501 -0.0525 193 VAL A CG2 
890  N  N   . TYR A 124 ? 0.7235 0.6044 0.5463 0.2041  -0.0715 -0.0478 194 TYR A N   
891  C  CA  . TYR A 124 ? 0.7070 0.5988 0.5430 0.2055  -0.0730 -0.0462 194 TYR A CA  
892  C  C   . TYR A 124 ? 0.7301 0.6311 0.5809 0.2031  -0.0707 -0.0468 194 TYR A C   
893  O  O   . TYR A 124 ? 0.7229 0.6247 0.5808 0.2025  -0.0716 -0.0456 194 TYR A O   
894  C  CB  . TYR A 124 ? 0.7271 0.6209 0.5603 0.2112  -0.0754 -0.0455 194 TYR A CB  
895  C  CG  . TYR A 124 ? 0.7537 0.6479 0.5899 0.2124  -0.0727 -0.0438 194 TYR A CG  
896  C  CD1 . TYR A 124 ? 0.7859 0.6712 0.6139 0.2117  -0.0748 -0.0418 194 TYR A CD1 
897  C  CD2 . TYR A 124 ? 0.7638 0.6625 0.6090 0.2146  -0.0678 -0.0453 194 TYR A CD2 
898  C  CE1 . TYR A 124 ? 0.8098 0.6847 0.6282 0.2136  -0.0731 -0.0399 194 TYR A CE1 
899  C  CE2 . TYR A 124 ? 0.7848 0.6743 0.6242 0.2152  -0.0608 -0.0438 194 TYR A CE2 
900  C  CZ  . TYR A 124 ? 0.8921 0.7666 0.7126 0.2150  -0.0639 -0.0404 194 TYR A CZ  
901  O  OH  . TYR A 124 ? 0.9203 0.7756 0.7235 0.2162  -0.0576 -0.0386 194 TYR A OH  
902  N  N   . CYS A 125 ? 0.6703 0.5750 0.5236 0.2021  -0.0695 -0.0490 195 CYS A N   
903  C  CA  . CYS A 125 ? 0.6526 0.5660 0.5201 0.1997  -0.0662 -0.0501 195 CYS A CA  
904  C  C   . CYS A 125 ? 0.6859 0.5965 0.5593 0.1938  -0.0609 -0.0516 195 CYS A C   
905  O  O   . CYS A 125 ? 0.6707 0.5878 0.5565 0.1916  -0.0578 -0.0524 195 CYS A O   
906  C  CB  . CYS A 125 ? 0.6558 0.5749 0.5275 0.2017  -0.0684 -0.0534 195 CYS A CB  
907  S  SG  . CYS A 125 ? 0.7234 0.6289 0.5751 0.2029  -0.0758 -0.0567 195 CYS A SG  
908  N  N   . HIS A 126 ? 0.6445 0.5439 0.5113 0.1907  -0.0573 -0.0527 196 HIS A N   
909  C  CA  . HIS A 126 ? 0.6410 0.5344 0.5172 0.1840  -0.0474 -0.0561 196 HIS A CA  
910  C  C   . HIS A 126 ? 0.6681 0.5725 0.5740 0.1825  -0.0477 -0.0569 196 HIS A C   
911  O  O   . HIS A 126 ? 0.6565 0.5645 0.5739 0.1795  -0.0424 -0.0586 196 HIS A O   
912  C  CB  . HIS A 126 ? 0.6654 0.5412 0.5312 0.1806  -0.0395 -0.0583 196 HIS A CB  
913  C  CG  . HIS A 126 ? 0.7180 0.5817 0.5924 0.1725  -0.0233 -0.0634 196 HIS A CG  
914  N  ND1 . HIS A 126 ? 0.7277 0.6010 0.6401 0.1687  -0.0189 -0.0674 196 HIS A ND1 
915  C  CD2 . HIS A 126 ? 0.7651 0.6043 0.6140 0.1680  -0.0108 -0.0657 196 HIS A CD2 
916  C  CE1 . HIS A 126 ? 0.7358 0.5930 0.6503 0.1611  -0.0004 -0.0726 196 HIS A CE1 
917  N  NE2 . HIS A 126 ? 0.7655 0.5990 0.6380 0.1599  0.0065  -0.0714 196 HIS A NE2 
918  N  N   . SER A 127 ? 0.6174 0.5240 0.5344 0.1851  -0.0553 -0.0564 197 SER A N   
919  C  CA  . SER A 127 ? 0.6080 0.5196 0.5509 0.1859  -0.0617 -0.0579 197 SER A CA  
920  C  C   . SER A 127 ? 0.6633 0.5706 0.6026 0.1911  -0.0756 -0.0565 197 SER A C   
921  O  O   . SER A 127 ? 0.6613 0.5638 0.5844 0.1920  -0.0760 -0.0556 197 SER A O   
922  C  CB  . SER A 127 ? 0.6472 0.5583 0.6213 0.1795  -0.0527 -0.0649 197 SER A CB  
923  O  OG  . SER A 127 ? 0.7627 0.6646 0.7377 0.1751  -0.0434 -0.0692 197 SER A OG  
924  N  N   . GLU A 128 ? 0.6268 0.5319 0.5758 0.1952  -0.0882 -0.0562 198 GLU A N   
925  C  CA  . GLU A 128 ? 0.6387 0.5322 0.5769 0.2009  -0.1046 -0.0553 198 GLU A CA  
926  C  C   . GLU A 128 ? 0.6923 0.5852 0.6494 0.1988  -0.1089 -0.0617 198 GLU A C   
927  O  O   . GLU A 128 ? 0.6965 0.5814 0.6335 0.2012  -0.1141 -0.0603 198 GLU A O   
928  C  CB  . GLU A 128 ? 0.6690 0.5525 0.6098 0.2065  -0.1200 -0.0546 198 GLU A CB  
929  C  CG  . GLU A 128 ? 0.8271 0.6892 0.7461 0.2134  -0.1399 -0.0538 198 GLU A CG  
930  C  CD  . GLU A 128 ? 1.1085 0.9474 1.0047 0.2207  -0.1540 -0.0500 198 GLU A CD  
931  O  OE1 . GLU A 128 ? 1.0629 0.9057 0.9765 0.2211  -0.1542 -0.0504 198 GLU A OE1 
932  O  OE2 . GLU A 128 ? 1.0329 0.8448 0.8887 0.2262  -0.1637 -0.0464 198 GLU A OE2 
933  N  N   . LYS A 129 ? 0.6447 0.5452 0.6423 0.1935  -0.1033 -0.0697 199 LYS A N   
934  C  CA  . LYS A 129 ? 0.6470 0.5468 0.6717 0.1901  -0.1034 -0.0782 199 LYS A CA  
935  C  C   . LYS A 129 ? 0.7024 0.5982 0.7042 0.1857  -0.0868 -0.0766 199 LYS A C   
936  O  O   . LYS A 129 ? 0.7015 0.5919 0.7022 0.1862  -0.0915 -0.0792 199 LYS A O   
937  C  CB  . LYS A 129 ? 0.6737 0.5807 0.7535 0.1845  -0.0967 -0.0890 199 LYS A CB  
938  C  CG  . LYS A 129 ? 0.8702 0.7778 0.9528 0.1753  -0.0675 -0.0906 199 LYS A CG  
939  C  CD  . LYS A 129 ? 1.0170 0.9235 1.1497 0.1674  -0.0526 -0.1036 199 LYS A CD  
940  C  CE  . LYS A 129 ? 1.1789 1.0776 1.3095 0.1581  -0.0220 -0.1056 199 LYS A CE  
941  N  NZ  . LYS A 129 ? 1.3151 1.1971 1.3922 0.1553  -0.0064 -0.0993 199 LYS A NZ  
942  N  N   . VAL A 130 ? 0.6621 0.5575 0.6438 0.1821  -0.0693 -0.0726 200 VAL A N   
943  C  CA  . VAL A 130 ? 0.6704 0.5557 0.6247 0.1793  -0.0557 -0.0708 200 VAL A CA  
944  C  C   . VAL A 130 ? 0.7268 0.6101 0.6494 0.1859  -0.0666 -0.0642 200 VAL A C   
945  O  O   . VAL A 130 ? 0.7321 0.6069 0.6427 0.1855  -0.0637 -0.0647 200 VAL A O   
946  C  CB  . VAL A 130 ? 0.7247 0.6041 0.6602 0.1756  -0.0402 -0.0689 200 VAL A CB  
947  C  CG1 . VAL A 130 ? 0.7377 0.6009 0.6342 0.1760  -0.0334 -0.0657 200 VAL A CG1 
948  C  CG2 . VAL A 130 ? 0.7273 0.6017 0.6911 0.1673  -0.0231 -0.0766 200 VAL A CG2 
949  N  N   . SER A 131 ? 0.6794 0.5681 0.5893 0.1914  -0.0767 -0.0586 201 SER A N   
950  C  CA  . SER A 131 ? 0.6818 0.5664 0.5646 0.1972  -0.0837 -0.0533 201 SER A CA  
951  C  C   . SER A 131 ? 0.7400 0.6168 0.6240 0.1993  -0.0947 -0.0555 201 SER A C   
952  O  O   . SER A 131 ? 0.7409 0.6112 0.6062 0.2009  -0.0940 -0.0538 201 SER A O   
953  C  CB  . SER A 131 ? 0.7285 0.6152 0.6020 0.2013  -0.0879 -0.0489 201 SER A CB  
954  O  OG  . SER A 131 ? 0.8603 0.7416 0.7100 0.2054  -0.0874 -0.0450 201 SER A OG  
955  N  N   . ARG A 132 ? 0.6996 0.5758 0.6080 0.1993  -0.1062 -0.0605 202 ARG A N   
956  C  CA  . ARG A 132 ? 0.7090 0.5760 0.6234 0.2017  -0.1218 -0.0651 202 ARG A CA  
957  C  C   . ARG A 132 ? 0.7498 0.6171 0.6770 0.1968  -0.1131 -0.0706 202 ARG A C   
958  O  O   . ARG A 132 ? 0.7554 0.6134 0.6663 0.1989  -0.1190 -0.0704 202 ARG A O   
959  C  CB  . ARG A 132 ? 0.7260 0.5936 0.6742 0.2030  -0.1379 -0.0718 202 ARG A CB  
960  C  CG  . ARG A 132 ? 0.9154 0.7677 0.8401 0.2108  -0.1570 -0.0676 202 ARG A CG  
961  C  CD  . ARG A 132 ? 1.1088 0.9613 1.0738 0.2128  -0.1761 -0.0762 202 ARG A CD  
962  N  NE  . ARG A 132 ? 1.3185 1.1465 1.2567 0.2220  -0.2010 -0.0736 202 ARG A NE  
963  C  CZ  . ARG A 132 ? 1.5496 1.3729 1.4888 0.2257  -0.2074 -0.0713 202 ARG A CZ  
964  N  NH1 . ARG A 132 ? 1.3862 1.2308 1.3551 0.2207  -0.1910 -0.0716 202 ARG A NH1 
965  N  NH2 . ARG A 132 ? 1.4325 1.2242 1.3377 0.2349  -0.2310 -0.0688 202 ARG A NH2 
966  N  N   . THR A 133 ? 0.6927 0.5662 0.6470 0.1897  -0.0970 -0.0760 203 THR A N   
967  C  CA  . THR A 133 ? 0.6929 0.5608 0.6587 0.1839  -0.0834 -0.0821 203 THR A CA  
968  C  C   . THR A 133 ? 0.7502 0.6084 0.6746 0.1853  -0.0754 -0.0753 203 THR A C   
969  O  O   . THR A 133 ? 0.7528 0.6036 0.6755 0.1847  -0.0757 -0.0782 203 THR A O   
970  C  CB  . THR A 133 ? 0.7640 0.6321 0.7584 0.1755  -0.0624 -0.0887 203 THR A CB  
971  O  OG1 . THR A 133 ? 0.7351 0.6134 0.7766 0.1747  -0.0714 -0.0967 203 THR A OG1 
972  C  CG2 . THR A 133 ? 0.7546 0.6093 0.7569 0.1683  -0.0426 -0.0956 203 THR A CG2 
973  N  N   . PHE A 134 ? 0.7059 0.5640 0.6005 0.1876  -0.0696 -0.0673 204 PHE A N   
974  C  CA  . PHE A 134 ? 0.7123 0.5611 0.5719 0.1905  -0.0649 -0.0616 204 PHE A CA  
975  C  C   . PHE A 134 ? 0.7623 0.6111 0.6057 0.1967  -0.0772 -0.0577 204 PHE A C   
976  O  O   . PHE A 134 ? 0.7647 0.6047 0.5904 0.1983  -0.0745 -0.0562 204 PHE A O   
977  C  CB  . PHE A 134 ? 0.7359 0.5838 0.5761 0.1917  -0.0589 -0.0570 204 PHE A CB  
978  C  CG  . PHE A 134 ? 0.7709 0.6026 0.6048 0.1857  -0.0421 -0.0601 204 PHE A CG  
979  C  CD1 . PHE A 134 ? 0.8075 0.6398 0.6652 0.1790  -0.0319 -0.0655 204 PHE A CD1 
980  C  CD2 . PHE A 134 ? 0.8193 0.6296 0.6206 0.1869  -0.0354 -0.0580 204 PHE A CD2 
981  C  CE1 . PHE A 134 ? 0.8412 0.6504 0.6874 0.1724  -0.0115 -0.0690 204 PHE A CE1 
982  C  CE2 . PHE A 134 ? 0.8810 0.6651 0.6650 0.1814  -0.0178 -0.0607 204 PHE A CE2 
983  C  CZ  . PHE A 134 ? 0.8577 0.6399 0.6628 0.1735  -0.0041 -0.0663 204 PHE A CZ  
984  N  N   . SER A 135 ? 0.7176 0.5717 0.5642 0.2001  -0.0896 -0.0563 205 SER A N   
985  C  CA  . SER A 135 ? 0.7256 0.5715 0.5507 0.2054  -0.0990 -0.0531 205 SER A CA  
986  C  C   . SER A 135 ? 0.7876 0.6237 0.6143 0.2047  -0.1053 -0.0577 205 SER A C   
987  O  O   . SER A 135 ? 0.7910 0.6178 0.5954 0.2073  -0.1044 -0.0552 205 SER A O   
988  C  CB  . SER A 135 ? 0.7743 0.6174 0.5966 0.2086  -0.1097 -0.0516 205 SER A CB  
989  O  OG  . SER A 135 ? 0.9094 0.7361 0.7016 0.2131  -0.1140 -0.0483 205 SER A OG  
990  N  N   . LYS A 136 ? 0.7470 0.5855 0.6049 0.2008  -0.1106 -0.0658 206 LYS A N   
991  C  CA  . LYS A 136 ? 0.7560 0.5872 0.6264 0.1991  -0.1174 -0.0732 206 LYS A CA  
992  C  C   . LYS A 136 ? 0.8120 0.6387 0.6727 0.1960  -0.1008 -0.0727 206 LYS A C   
993  O  O   . LYS A 136 ? 0.8185 0.6353 0.6670 0.1972  -0.1047 -0.0739 206 LYS A O   
994  C  CB  . LYS A 136 ? 0.7840 0.6220 0.7025 0.1949  -0.1235 -0.0843 206 LYS A CB  
995  C  CG  . LYS A 136 ? 0.9648 0.8019 0.8920 0.1998  -0.1459 -0.0858 206 LYS A CG  
996  C  CD  . LYS A 136 ? 1.0876 0.9356 1.0706 0.1955  -0.1479 -0.0970 206 LYS A CD  
997  C  CE  . LYS A 136 ? 1.2451 1.0873 1.2404 0.2019  -0.1772 -0.1013 206 LYS A CE  
998  N  NZ  . LYS A 136 ? 1.3733 1.2092 1.3320 0.2078  -0.1827 -0.0906 206 LYS A NZ  
999  N  N   . LEU A 137 ? 0.7655 0.5946 0.6248 0.1928  -0.0832 -0.0704 207 LEU A N   
1000 C  CA  . LEU A 137 ? 0.7734 0.5907 0.6149 0.1910  -0.0675 -0.0690 207 LEU A CA  
1001 C  C   . LEU A 137 ? 0.8341 0.6461 0.6412 0.1976  -0.0707 -0.0612 207 LEU A C   
1002 O  O   . LEU A 137 ? 0.8390 0.6395 0.6336 0.1978  -0.0657 -0.0615 207 LEU A O   
1003 C  CB  . LEU A 137 ? 0.7760 0.5886 0.6123 0.1877  -0.0516 -0.0676 207 LEU A CB  
1004 C  CG  . LEU A 137 ? 0.8411 0.6474 0.7060 0.1787  -0.0358 -0.0767 207 LEU A CG  
1005 C  CD1 . LEU A 137 ? 0.8570 0.6483 0.7006 0.1760  -0.0187 -0.0741 207 LEU A CD1 
1006 C  CD2 . LEU A 137 ? 0.8841 0.6771 0.7584 0.1742  -0.0263 -0.0837 207 LEU A CD2 
1007 N  N   . ASP A 138 ? 0.7922 0.6119 0.5874 0.2027  -0.0770 -0.0552 208 ASP A N   
1008 C  CA  . ASP A 138 ? 0.7993 0.6156 0.5711 0.2089  -0.0782 -0.0496 208 ASP A CA  
1009 C  C   . ASP A 138 ? 0.8741 0.6812 0.6367 0.2104  -0.0839 -0.0508 208 ASP A C   
1010 O  O   . ASP A 138 ? 0.8766 0.6753 0.6244 0.2128  -0.0796 -0.0490 208 ASP A O   
1011 C  CB  . ASP A 138 ? 0.8138 0.6396 0.5840 0.2125  -0.0810 -0.0458 208 ASP A CB  
1012 C  CG  . ASP A 138 ? 0.9383 0.7629 0.6959 0.2183  -0.0783 -0.0422 208 ASP A CG  
1013 O  OD1 . ASP A 138 ? 0.9516 0.7687 0.7001 0.2202  -0.0754 -0.0417 208 ASP A OD1 
1014 O  OD2 . ASP A 138 ? 1.0100 0.8392 0.7687 0.2209  -0.0783 -0.0408 208 ASP A OD2 
1015 N  N   . TYR A 139 ? 0.8466 0.6520 0.6168 0.2092  -0.0950 -0.0544 209 TYR A N   
1016 C  CA  . TYR A 139 ? 0.8683 0.6589 0.6253 0.2104  -0.1040 -0.0568 209 TYR A CA  
1017 C  C   . TYR A 139 ? 0.9202 0.7057 0.6853 0.2070  -0.1009 -0.0621 209 TYR A C   
1018 O  O   . TYR A 139 ? 0.9266 0.6999 0.6728 0.2087  -0.1000 -0.0614 209 TYR A O   
1019 C  CB  . TYR A 139 ? 0.8990 0.6843 0.6618 0.2108  -0.1213 -0.0607 209 TYR A CB  
1020 C  CG  . TYR A 139 ? 0.9407 0.7168 0.6785 0.2152  -0.1241 -0.0551 209 TYR A CG  
1021 C  CD1 . TYR A 139 ? 0.9973 0.7480 0.6988 0.2186  -0.1273 -0.0532 209 TYR A CD1 
1022 C  CD2 . TYR A 139 ? 0.9390 0.7273 0.6869 0.2155  -0.1211 -0.0521 209 TYR A CD2 
1023 C  CE1 . TYR A 139 ? 1.0303 0.7650 0.7049 0.2218  -0.1251 -0.0486 209 TYR A CE1 
1024 C  CE2 . TYR A 139 ? 0.9652 0.7420 0.6904 0.2188  -0.1206 -0.0476 209 TYR A CE2 
1025 C  CZ  . TYR A 139 ? 1.1039 0.8523 0.7915 0.2219  -0.1213 -0.0459 209 TYR A CZ  
1026 O  OH  . TYR A 139 ? 1.1507 0.8806 0.8120 0.2244  -0.1159 -0.0419 209 TYR A OH  
1027 N  N   . SER A 140 ? 0.8698 0.6626 0.6641 0.2015  -0.0963 -0.0679 210 SER A N   
1028 C  CA  . SER A 140 ? 0.8748 0.6612 0.6828 0.1965  -0.0886 -0.0747 210 SER A CA  
1029 C  C   . SER A 140 ? 0.9328 0.7098 0.7155 0.1980  -0.0733 -0.0690 210 SER A C   
1030 O  O   . SER A 140 ? 0.9408 0.7067 0.7178 0.1969  -0.0699 -0.0717 210 SER A O   
1031 C  CB  . SER A 140 ? 0.9133 0.7064 0.7593 0.1895  -0.0808 -0.0828 210 SER A CB  
1032 O  OG  . SER A 140 ? 1.0250 0.8274 0.8997 0.1894  -0.0979 -0.0889 210 SER A OG  
1033 N  N   . GLY A 141 ? 0.8854 0.6651 0.6532 0.2011  -0.0666 -0.0617 211 GLY A N   
1034 C  CA  . GLY A 141 ? 0.8948 0.6630 0.6371 0.2050  -0.0574 -0.0561 211 GLY A CA  
1035 C  C   . GLY A 141 ? 0.9528 0.7155 0.6776 0.2104  -0.0613 -0.0531 211 GLY A C   
1036 O  O   . GLY A 141 ? 0.9609 0.7097 0.6730 0.2112  -0.0545 -0.0528 211 GLY A O   
1037 N  N   . ILE A 142 ? 0.9061 0.6756 0.6289 0.2134  -0.0702 -0.0514 212 ILE A N   
1038 C  CA  . ILE A 142 ? 0.9157 0.6764 0.6214 0.2176  -0.0706 -0.0493 212 ILE A CA  
1039 C  C   . ILE A 142 ? 0.9778 0.7255 0.6794 0.2145  -0.0712 -0.0542 212 ILE A C   
1040 O  O   . ILE A 142 ? 0.9827 0.7198 0.6708 0.2169  -0.0653 -0.0527 212 ILE A O   
1041 C  CB  . ILE A 142 ? 0.9577 0.7196 0.6569 0.2200  -0.0756 -0.0476 212 ILE A CB  
1042 C  CG1 . ILE A 142 ? 0.9507 0.7270 0.6593 0.2225  -0.0739 -0.0442 212 ILE A CG1 
1043 C  CG2 . ILE A 142 ? 0.9844 0.7313 0.6639 0.2234  -0.0705 -0.0463 212 ILE A CG2 
1044 C  CD1 . ILE A 142 ? 1.0609 0.8364 0.7654 0.2230  -0.0766 -0.0434 212 ILE A CD1 
1045 N  N   . ALA A 143 ? 0.9343 0.6828 0.6515 0.2093  -0.0797 -0.0610 213 ALA A N   
1046 C  CA  . ALA A 143 ? 0.9453 0.6826 0.6662 0.2057  -0.0834 -0.0683 213 ALA A CA  
1047 C  C   . ALA A 143 ? 0.9960 0.7279 0.7211 0.2028  -0.0685 -0.0697 213 ALA A C   
1048 O  O   . ALA A 143 ? 1.0025 0.7219 0.7166 0.2028  -0.0653 -0.0713 213 ALA A O   
1049 C  CB  . ALA A 143 ? 0.9541 0.6957 0.7015 0.2015  -0.0978 -0.0773 213 ALA A CB  
1050 N  N   . LEU A 144 ? 0.9472 0.6835 0.6814 0.2009  -0.0578 -0.0684 214 LEU A N   
1051 C  CA  . LEU A 144 ? 0.9572 0.6790 0.6858 0.1983  -0.0409 -0.0690 214 LEU A CA  
1052 C  C   . LEU A 144 ? 1.0212 0.7304 0.7190 0.2053  -0.0364 -0.0614 214 LEU A C   
1053 O  O   . LEU A 144 ? 1.0335 0.7262 0.7225 0.2040  -0.0271 -0.0631 214 LEU A O   
1054 C  CB  . LEU A 144 ? 0.9559 0.6764 0.6907 0.1950  -0.0302 -0.0688 214 LEU A CB  
1055 C  CG  . LEU A 144 ? 1.0063 0.7349 0.7799 0.1864  -0.0279 -0.0791 214 LEU A CG  
1056 C  CD1 . LEU A 144 ? 1.0119 0.7349 0.7857 0.1831  -0.0138 -0.0783 214 LEU A CD1 
1057 C  CD2 . LEU A 144 ? 1.0475 0.7662 0.8427 0.1793  -0.0194 -0.0899 214 LEU A CD2 
1058 N  N   . LEU A 145 ? 0.9718 0.6887 0.6576 0.2128  -0.0430 -0.0541 215 LEU A N   
1059 C  CA  . LEU A 145 ? 0.9807 0.6885 0.6465 0.2208  -0.0416 -0.0483 215 LEU A CA  
1060 C  C   . LEU A 145 ? 1.0414 0.7420 0.7016 0.2210  -0.0410 -0.0502 215 LEU A C   
1061 O  O   . LEU A 145 ? 1.0497 0.7350 0.6965 0.2239  -0.0345 -0.0488 215 LEU A O   
1062 C  CB  . LEU A 145 ? 0.9696 0.6906 0.6369 0.2277  -0.0490 -0.0435 215 LEU A CB  
1063 C  CG  . LEU A 145 ? 1.0361 0.7513 0.6952 0.2368  -0.0496 -0.0400 215 LEU A CG  
1064 C  CD1 . LEU A 145 ? 1.0598 0.7537 0.7005 0.2414  -0.0466 -0.0377 215 LEU A CD1 
1065 C  CD2 . LEU A 145 ? 1.0529 0.7826 0.7240 0.2423  -0.0557 -0.0382 215 LEU A CD2 
1066 N  N   . ILE A 146 ? 0.9989 0.7060 0.6652 0.2183  -0.0484 -0.0536 216 ILE A N   
1067 C  CA  . ILE A 146 ? 1.0133 0.7085 0.6685 0.2178  -0.0489 -0.0562 216 ILE A CA  
1068 C  C   . ILE A 146 ? 1.0824 0.7663 0.7413 0.2123  -0.0442 -0.0623 216 ILE A C   
1069 O  O   . ILE A 146 ? 1.0919 0.7621 0.7378 0.2137  -0.0379 -0.0622 216 ILE A O   
1070 C  CB  . ILE A 146 ? 1.0556 0.7505 0.7067 0.2163  -0.0599 -0.0588 216 ILE A CB  
1071 C  CG1 . ILE A 146 ? 1.0552 0.7559 0.7002 0.2215  -0.0584 -0.0530 216 ILE A CG1 
1072 C  CG2 . ILE A 146 ? 1.0880 0.7629 0.7217 0.2146  -0.0620 -0.0633 216 ILE A CG2 
1073 C  CD1 . ILE A 146 ? 1.1678 0.8575 0.7968 0.2208  -0.0652 -0.0544 216 ILE A CD1 
1074 N  N   . MET A 147 ? 1.0411 0.7303 0.7216 0.2056  -0.0450 -0.0685 217 MET A N   
1075 C  CA  . MET A 147 ? 1.0540 0.7330 0.7471 0.1989  -0.0373 -0.0768 217 MET A CA  
1076 C  C   . MET A 147 ? 1.1219 0.7843 0.7977 0.2009  -0.0199 -0.0722 217 MET A C   
1077 O  O   . MET A 147 ? 1.1328 0.7805 0.8028 0.1990  -0.0125 -0.0754 217 MET A O   
1078 C  CB  . MET A 147 ? 1.0766 0.7649 0.8039 0.1914  -0.0378 -0.0854 217 MET A CB  
1079 C  CG  . MET A 147 ? 1.1176 0.8179 0.8647 0.1901  -0.0585 -0.0918 217 MET A CG  
1080 S  SD  . MET A 147 ? 1.1623 0.8751 0.9601 0.1819  -0.0572 -0.1033 217 MET A SD  
1081 C  CE  . MET A 147 ? 1.1362 0.8350 0.9575 0.1734  -0.0420 -0.1159 217 MET A CE  
1082 N  N   . GLY A 148 ? 1.0817 0.7431 0.7461 0.2051  -0.0152 -0.0650 218 GLY A N   
1083 C  CA  . GLY A 148 ? 1.1028 0.7413 0.7419 0.2092  -0.0027 -0.0596 218 GLY A CA  
1084 C  C   . GLY A 148 ? 1.1662 0.7953 0.7852 0.2174  -0.0045 -0.0543 218 GLY A C   
1085 O  O   . GLY A 148 ? 1.1834 0.7893 0.7859 0.2181  0.0063  -0.0539 218 GLY A O   
1086 N  N   . SER A 149 ? 1.1130 0.7579 0.7347 0.2233  -0.0159 -0.0510 219 SER A N   
1087 C  CA  . SER A 149 ? 1.1226 0.7606 0.7331 0.2309  -0.0160 -0.0474 219 SER A CA  
1088 C  C   . SER A 149 ? 1.1916 0.8157 0.7966 0.2270  -0.0086 -0.0518 219 SER A C   
1089 O  O   . SER A 149 ? 1.2008 0.8087 0.7922 0.2323  -0.0027 -0.0490 219 SER A O   
1090 C  CB  . SER A 149 ? 1.1525 0.8075 0.7718 0.2351  -0.0240 -0.0456 219 SER A CB  
1091 O  OG  . SER A 149 ? 1.2548 0.9210 0.8803 0.2405  -0.0305 -0.0417 219 SER A OG  
1092 N  N   . PHE A 150 ? 1.1506 0.7793 0.7670 0.2182  -0.0107 -0.0593 220 PHE A N   
1093 C  CA  . PHE A 150 ? 1.1656 0.7816 0.7787 0.2138  -0.0068 -0.0653 220 PHE A CA  
1094 C  C   . PHE A 150 ? 1.2323 0.8301 0.8428 0.2101  0.0069  -0.0684 220 PHE A C   
1095 O  O   . PHE A 150 ? 1.2404 0.8240 0.8397 0.2111  0.0129  -0.0692 220 PHE A O   
1096 C  CB  . PHE A 150 ? 1.1865 0.8098 0.8123 0.2069  -0.0187 -0.0739 220 PHE A CB  
1097 C  CG  . PHE A 150 ? 1.2069 0.8345 0.8212 0.2107  -0.0291 -0.0711 220 PHE A CG  
1098 C  CD1 . PHE A 150 ? 1.2507 0.8743 0.8497 0.2179  -0.0228 -0.0640 220 PHE A CD1 
1099 C  CD2 . PHE A 150 ? 1.2355 0.8672 0.8548 0.2071  -0.0442 -0.0764 220 PHE A CD2 
1100 C  CE1 . PHE A 150 ? 1.2666 0.8889 0.8546 0.2201  -0.0266 -0.0625 220 PHE A CE1 
1101 C  CE2 . PHE A 150 ? 1.2793 0.9056 0.8791 0.2102  -0.0509 -0.0737 220 PHE A CE2 
1102 C  CZ  . PHE A 150 ? 1.2596 0.8804 0.8432 0.2161  -0.0395 -0.0667 220 PHE A CZ  
1103 N  N   . VAL A 151 ? 1.1933 0.7883 0.8134 0.2051  0.0145  -0.0710 221 VAL A N   
1104 C  CA  . VAL A 151 ? 1.2154 0.7864 0.8314 0.2001  0.0331  -0.0750 221 VAL A CA  
1105 C  C   . VAL A 151 ? 1.2931 0.8385 0.8757 0.2086  0.0421  -0.0668 221 VAL A C   
1106 O  O   . VAL A 151 ? 1.3019 0.8321 0.8807 0.2058  0.0514  -0.0708 221 VAL A O   
1107 C  CB  . VAL A 151 ? 1.2686 0.8333 0.8944 0.1936  0.0453  -0.0783 221 VAL A CB  
1108 C  CG1 . VAL A 151 ? 1.2895 0.8308 0.9238 0.1840  0.0675  -0.0879 221 VAL A CG1 
1109 C  CG2 . VAL A 151 ? 1.2393 0.8321 0.8977 0.1889  0.0326  -0.0837 221 VAL A CG2 
1110 N  N   . PRO A 152 ? 1.2607 0.8005 0.8217 0.2192  0.0373  -0.0565 222 PRO A N   
1111 C  CA  . PRO A 152 ? 1.2873 0.8012 0.8191 0.2293  0.0408  -0.0494 222 PRO A CA  
1112 C  C   . PRO A 152 ? 1.3406 0.8602 0.8763 0.2334  0.0371  -0.0493 222 PRO A C   
1113 O  O   . PRO A 152 ? 1.3562 0.8531 0.8775 0.2349  0.0470  -0.0493 222 PRO A O   
1114 C  CB  . PRO A 152 ? 1.3102 0.8235 0.8282 0.2401  0.0285  -0.0411 222 PRO A CB  
1115 C  CG  . PRO A 152 ? 1.3311 0.8783 0.8749 0.2367  0.0176  -0.0431 222 PRO A CG  
1116 C  CD  . PRO A 152 ? 1.2644 0.8202 0.8286 0.2231  0.0260  -0.0520 222 PRO A CD  
1117 N  N   . TRP A 153 ? 1.2801 0.8265 0.8337 0.2341  0.0254  -0.0501 223 TRP A N   
1118 C  CA  . TRP A 153 ? 1.2802 0.8312 0.8370 0.2371  0.0236  -0.0506 223 TRP A CA  
1119 C  C   . TRP A 153 ? 1.3452 0.8862 0.9010 0.2284  0.0317  -0.0582 223 TRP A C   
1120 O  O   . TRP A 153 ? 1.3555 0.8816 0.9014 0.2317  0.0388  -0.0576 223 TRP A O   
1121 C  CB  . TRP A 153 ? 1.2431 0.8183 0.8142 0.2376  0.0129  -0.0506 223 TRP A CB  
1122 C  CG  . TRP A 153 ? 1.2589 0.8326 0.8294 0.2400  0.0155  -0.0515 223 TRP A CG  
1123 C  CD1 . TRP A 153 ? 1.3011 0.8727 0.8757 0.2497  0.0179  -0.0479 223 TRP A CD1 
1124 C  CD2 . TRP A 153 ? 1.2637 0.8341 0.8288 0.2326  0.0162  -0.0575 223 TRP A CD2 
1125 N  NE1 . TRP A 153 ? 1.3012 0.8681 0.8739 0.2476  0.0249  -0.0512 223 TRP A NE1 
1126 C  CE2 . TRP A 153 ? 1.3229 0.8859 0.8839 0.2373  0.0233  -0.0565 223 TRP A CE2 
1127 C  CE3 . TRP A 153 ? 1.2805 0.8506 0.8442 0.2229  0.0100  -0.0647 223 TRP A CE3 
1128 C  CZ2 . TRP A 153 ? 1.3307 0.8802 0.8762 0.2320  0.0270  -0.0614 223 TRP A CZ2 
1129 C  CZ3 . TRP A 153 ? 1.3155 0.8734 0.8647 0.2191  0.0081  -0.0697 223 TRP A CZ3 
1130 C  CH2 . TRP A 153 ? 1.3376 0.8827 0.8730 0.2233  0.0177  -0.0675 223 TRP A CH2 
1131 N  N   . LEU A 154 ? 1.2988 0.8473 0.8679 0.2177  0.0296  -0.0663 224 LEU A N   
1132 C  CA  . LEU A 154 ? 1.3096 0.8497 0.8833 0.2089  0.0327  -0.0763 224 LEU A CA  
1133 C  C   . LEU A 154 ? 1.3864 0.9038 0.9537 0.2065  0.0495  -0.0782 224 LEU A C   
1134 O  O   . LEU A 154 ? 1.3947 0.8992 0.9562 0.2044  0.0549  -0.0824 224 LEU A O   
1135 C  CB  . LEU A 154 ? 1.2989 0.8530 0.8963 0.1995  0.0222  -0.0862 224 LEU A CB  
1136 C  CG  . LEU A 154 ? 1.3469 0.9148 0.9443 0.2004  0.0041  -0.0867 224 LEU A CG  
1137 C  CD1 . LEU A 154 ? 1.3397 0.9199 0.9628 0.1931  -0.0089 -0.0963 224 LEU A CD1 
1138 C  CD2 . LEU A 154 ? 1.3956 0.9490 0.9729 0.2008  0.0009  -0.0892 224 LEU A CD2 
1139 N  N   . TYR A 155 ? 1.3558 0.8636 0.9196 0.2068  0.0591  -0.0752 225 TYR A N   
1140 C  CA  . TYR A 155 ? 1.3847 0.8630 0.9354 0.2047  0.0786  -0.0762 225 TYR A CA  
1141 C  C   . TYR A 155 ? 1.4615 0.9192 0.9865 0.2139  0.0837  -0.0693 225 TYR A C   
1142 O  O   . TYR A 155 ? 1.4727 0.9139 0.9955 0.2092  0.0956  -0.0747 225 TYR A O   
1143 C  CB  . TYR A 155 ? 1.4119 0.8753 0.9517 0.2048  0.0885  -0.0726 225 TYR A CB  
1144 C  CG  . TYR A 155 ? 1.4702 0.8949 0.9926 0.2003  0.1136  -0.0752 225 TYR A CG  
1145 C  CD1 . TYR A 155 ? 1.4996 0.9207 1.0496 0.1861  0.1299  -0.0888 225 TYR A CD1 
1146 C  CD2 . TYR A 155 ? 1.5139 0.9022 0.9930 0.2103  0.1212  -0.0649 225 TYR A CD2 
1147 C  CE1 . TYR A 155 ? 1.5473 0.9290 1.0819 0.1807  0.1580  -0.0922 225 TYR A CE1 
1148 C  CE2 . TYR A 155 ? 1.5678 0.9121 1.0225 0.2062  0.1468  -0.0666 225 TYR A CE2 
1149 C  CZ  . TYR A 155 ? 1.6642 1.0049 1.1465 0.1906  0.1679  -0.0803 225 TYR A CZ  
1150 O  OH  . TYR A 155 ? 1.7220 1.0149 1.1797 0.1855  0.1981  -0.0827 225 TYR A OH  
1151 N  N   . TYR A 156 ? 1.4227 0.8830 0.9343 0.2266  0.0737  -0.0592 226 TYR A N   
1152 C  CA  . TYR A 156 ? 1.4445 0.8856 0.9379 0.2369  0.0766  -0.0533 226 TYR A CA  
1153 C  C   . TYR A 156 ? 1.4950 0.9449 0.9977 0.2363  0.0757  -0.0567 226 TYR A C   
1154 O  O   . TYR A 156 ? 1.5107 0.9401 1.0022 0.2386  0.0856  -0.0565 226 TYR A O   
1155 C  CB  . TYR A 156 ? 1.4651 0.9030 0.9469 0.2513  0.0648  -0.0434 226 TYR A CB  
1156 C  CG  . TYR A 156 ? 1.5149 0.9262 0.9704 0.2538  0.0681  -0.0390 226 TYR A CG  
1157 C  CD1 . TYR A 156 ? 1.5712 0.9495 1.0068 0.2461  0.0889  -0.0422 226 TYR A CD1 
1158 C  CD2 . TYR A 156 ? 1.5238 0.9381 0.9727 0.2615  0.0543  -0.0335 226 TYR A CD2 
1159 C  CE1 . TYR A 156 ? 1.6140 0.9608 1.0200 0.2463  0.0968  -0.0391 226 TYR A CE1 
1160 C  CE2 . TYR A 156 ? 1.5664 0.9501 0.9838 0.2628  0.0583  -0.0300 226 TYR A CE2 
1161 C  CZ  . TYR A 156 ? 1.6965 1.0447 1.0904 0.2545  0.0812  -0.0328 226 TYR A CZ  
1162 O  OH  . TYR A 156 ? 1.7388 1.0556 1.0997 0.2550  0.0863  -0.0297 226 TYR A OH  
1163 N  N   . SER A 157 ? 1.4342 0.9092 0.9527 0.2338  0.0652  -0.0593 227 SER A N   
1164 C  CA  . SER A 157 ? 1.4364 0.9119 0.9556 0.2325  0.0667  -0.0629 227 SER A CA  
1165 C  C   . SER A 157 ? 1.5072 0.9689 1.0229 0.2216  0.0748  -0.0725 227 SER A C   
1166 O  O   . SER A 157 ? 1.5175 0.9647 1.0241 0.2217  0.0825  -0.0746 227 SER A O   
1167 C  CB  . SER A 157 ? 1.4621 0.9581 0.9900 0.2307  0.0557  -0.0644 227 SER A CB  
1168 O  OG  . SER A 157 ? 1.5602 1.0681 1.0964 0.2218  0.0470  -0.0699 227 SER A OG  
1169 N  N   . PHE A 158 ? 1.4651 0.9308 0.9919 0.2120  0.0736  -0.0794 228 PHE A N   
1170 C  CA  . PHE A 158 ? 1.4784 0.9339 1.0123 0.2010  0.0790  -0.0913 228 PHE A CA  
1171 C  C   . PHE A 158 ? 1.5491 0.9874 1.0841 0.1980  0.0960  -0.0924 228 PHE A C   
1172 O  O   . PHE A 158 ? 1.5478 0.9829 1.1015 0.1871  0.1016  -0.1041 228 PHE A O   
1173 C  CB  . PHE A 158 ? 1.4881 0.9608 1.0422 0.1923  0.0630  -0.1015 228 PHE A CB  
1174 C  CG  . PHE A 158 ? 1.5073 0.9848 1.0492 0.1942  0.0481  -0.1015 228 PHE A CG  
1175 C  CD1 . PHE A 158 ? 1.5344 1.0225 1.0675 0.2024  0.0436  -0.0916 228 PHE A CD1 
1176 C  CD2 . PHE A 158 ? 1.5520 1.0186 1.0890 0.1876  0.0390  -0.1125 228 PHE A CD2 
1177 C  CE1 . PHE A 158 ? 1.5533 1.0378 1.0702 0.2035  0.0355  -0.0919 228 PHE A CE1 
1178 C  CE2 . PHE A 158 ? 1.5987 1.0588 1.1130 0.1893  0.0270  -0.1124 228 PHE A CE2 
1179 C  CZ  . PHE A 158 ? 1.5645 1.0323 1.0677 0.1969  0.0277  -0.1018 228 PHE A CZ  
1180 N  N   . TYR A 159 ? 1.5248 0.9478 1.0392 0.2080  0.1042  -0.0812 229 TYR A N   
1181 C  CA  . TYR A 159 ? 1.5521 0.9468 1.0533 0.2070  0.1227  -0.0801 229 TYR A CA  
1182 C  C   . TYR A 159 ? 1.6266 1.0019 1.1298 0.1989  0.1387  -0.0892 229 TYR A C   
1183 O  O   . TYR A 159 ? 1.6328 0.9965 1.1477 0.1887  0.1537  -0.0979 229 TYR A O   
1184 C  CB  . TYR A 159 ? 1.5867 0.9611 1.0570 0.2221  0.1228  -0.0663 229 TYR A CB  
1185 C  CG  . TYR A 159 ? 1.6507 0.9832 1.0924 0.2232  0.1419  -0.0634 229 TYR A CG  
1186 C  CD1 . TYR A 159 ? 1.7066 1.0087 1.1316 0.2236  0.1578  -0.0642 229 TYR A CD1 
1187 C  CD2 . TYR A 159 ? 1.6749 0.9920 1.0998 0.2243  0.1453  -0.0593 229 TYR A CD2 
1188 C  CE1 . TYR A 159 ? 1.7619 1.0179 1.1538 0.2246  0.1776  -0.0613 229 TYR A CE1 
1189 C  CE2 . TYR A 159 ? 1.7355 1.0031 1.1228 0.2255  0.1652  -0.0561 229 TYR A CE2 
1190 C  CZ  . TYR A 159 ? 1.8628 1.0989 1.2329 0.2256  0.1818  -0.0571 229 TYR A CZ  
1191 O  OH  . TYR A 159 ? 1.9313 1.1112 1.2578 0.2268  0.2036  -0.0537 229 TYR A OH  
1192 N  N   . CYS A 160 ? 1.5924 0.9648 1.0886 0.2022  0.1368  -0.0889 230 CYS A N   
1193 C  CA  . CYS A 160 ? 1.6127 0.9664 1.1096 0.1949  0.1509  -0.0978 230 CYS A CA  
1194 C  C   . CYS A 160 ? 1.6528 1.0210 1.1799 0.1808  0.1449  -0.1142 230 CYS A C   
1195 O  O   . CYS A 160 ? 1.6637 1.0171 1.2034 0.1713  0.1597  -0.1250 230 CYS A O   
1196 C  CB  . CYS A 160 ? 1.6280 0.9715 1.1071 0.2030  0.1517  -0.0926 230 CYS A CB  
1197 S  SG  . CYS A 160 ? 1.7021 1.0180 1.1505 0.2201  0.1599  -0.0767 230 CYS A SG  
1198 N  N   . SER A 161 ? 1.5864 0.9807 1.1265 0.1796  0.1229  -0.1172 231 SER A N   
1199 C  CA  . SER A 161 ? 1.5796 0.9840 1.1471 0.1680  0.1105  -0.1340 231 SER A CA  
1200 C  C   . SER A 161 ? 1.6049 1.0287 1.2069 0.1617  0.1037  -0.1409 231 SER A C   
1201 O  O   . SER A 161 ? 1.5787 1.0214 1.1820 0.1655  0.0877  -0.1361 231 SER A O   
1202 C  CB  . SER A 161 ? 1.6256 1.0356 1.1779 0.1707  0.0902  -0.1343 231 SER A CB  
1203 O  OG  . SER A 161 ? 1.7545 1.1479 1.2764 0.1775  0.0990  -0.1264 231 SER A OG  
1204 N  N   . PRO A 162 ? 1.5682 0.9868 1.2031 0.1510  0.1171  -0.1542 232 PRO A N   
1205 C  CA  . PRO A 162 ? 1.5486 0.9847 1.2220 0.1447  0.1138  -0.1620 232 PRO A CA  
1206 C  C   . PRO A 162 ? 1.5760 1.0357 1.2814 0.1406  0.0829  -0.1748 232 PRO A C   
1207 O  O   . PRO A 162 ? 1.5490 1.0279 1.2677 0.1422  0.0711  -0.1726 232 PRO A O   
1208 C  CB  . PRO A 162 ? 1.5909 1.0082 1.2927 0.1334  0.1429  -0.1749 232 PRO A CB  
1209 C  CG  . PRO A 162 ? 1.6740 1.0610 1.3356 0.1378  0.1632  -0.1662 232 PRO A CG  
1210 C  CD  . PRO A 162 ? 1.6141 1.0073 1.2521 0.1446  0.1417  -0.1616 232 PRO A CD  
1211 N  N   . GLN A 163 ? 1.5430 0.9976 1.2594 0.1356  0.0690  -0.1889 233 GLN A N   
1212 C  CA  . GLN A 163 ? 1.5352 1.0040 1.2751 0.1333  0.0344  -0.2020 233 GLN A CA  
1213 C  C   . GLN A 163 ? 1.5637 1.0416 1.2695 0.1429  0.0110  -0.1892 233 GLN A C   
1214 O  O   . GLN A 163 ? 1.5433 1.0374 1.2727 0.1424  -0.0085 -0.1942 233 GLN A O   
1215 C  CB  . GLN A 163 ? 1.5782 1.0327 1.3268 0.1275  0.0206  -0.2192 233 GLN A CB  
1216 C  CG  . GLN A 163 ? 1.7985 1.2616 1.5734 0.1256  -0.0195 -0.2354 233 GLN A CG  
1217 C  CD  . GLN A 163 ? 2.1024 1.5418 1.8433 0.1267  -0.0425 -0.2422 233 GLN A CD  
1218 O  OE1 . GLN A 163 ? 2.0696 1.4884 1.7706 0.1280  -0.0265 -0.2352 233 GLN A OE1 
1219 N  NE2 . GLN A 163 ? 2.0195 1.4578 1.7743 0.1265  -0.0812 -0.2564 233 GLN A NE2 
1220 N  N   . PRO A 164 ? 1.5227 0.9889 1.1758 0.1514  0.0140  -0.1737 234 PRO A N   
1221 C  CA  . PRO A 164 ? 1.5100 0.9825 1.1344 0.1593  -0.0034 -0.1630 234 PRO A CA  
1222 C  C   . PRO A 164 ? 1.5211 1.0160 1.1589 0.1630  0.0009  -0.1531 234 PRO A C   
1223 O  O   . PRO A 164 ? 1.5047 1.0115 1.1463 0.1648  -0.0190 -0.1532 234 PRO A O   
1224 C  CB  . PRO A 164 ? 1.5473 1.0007 1.1238 0.1660  0.0098  -0.1507 234 PRO A CB  
1225 C  CG  . PRO A 164 ? 1.6061 1.0533 1.1895 0.1648  0.0361  -0.1482 234 PRO A CG  
1226 C  CD  . PRO A 164 ? 1.5577 1.0037 1.1793 0.1541  0.0362  -0.1658 234 PRO A CD  
1227 N  N   . ARG A 165 ? 1.4636 0.9600 1.1077 0.1635  0.0256  -0.1461 235 ARG A N   
1228 C  CA  . ARG A 165 ? 1.4373 0.9488 1.0882 0.1669  0.0313  -0.1369 235 ARG A CA  
1229 C  C   . ARG A 165 ? 1.4713 1.0004 1.1666 0.1600  0.0218  -0.1482 235 ARG A C   
1230 O  O   . ARG A 165 ? 1.4471 0.9926 1.1441 0.1637  0.0108  -0.1424 235 ARG A O   
1231 C  CB  . ARG A 165 ? 1.4413 0.9380 1.0786 0.1692  0.0591  -0.1281 235 ARG A CB  
1232 C  CG  . ARG A 165 ? 1.5299 1.0332 1.1724 0.1709  0.0673  -0.1214 235 ARG A CG  
1233 C  CD  . ARG A 165 ? 1.6326 1.1094 1.2531 0.1731  0.0933  -0.1145 235 ARG A CD  
1234 N  NE  . ARG A 165 ? 1.7165 1.1751 1.3563 0.1624  0.1135  -0.1273 235 ARG A NE  
1235 C  CZ  . ARG A 165 ? 1.8885 1.3153 1.5047 0.1630  0.1379  -0.1237 235 ARG A CZ  
1236 N  NH1 . ARG A 165 ? 1.7203 1.1294 1.2926 0.1750  0.1414  -0.1078 235 ARG A NH1 
1237 N  NH2 . ARG A 165 ? 1.7306 1.1404 1.3682 0.1520  0.1586  -0.1369 235 ARG A NH2 
1238 N  N   . LEU A 166 ? 1.4370 0.9630 1.1726 0.1498  0.0281  -0.1650 236 LEU A N   
1239 C  CA  . LEU A 166 ? 1.4229 0.9661 1.2119 0.1427  0.0208  -0.1786 236 LEU A CA  
1240 C  C   . LEU A 166 ? 1.4654 1.0234 1.2609 0.1460  -0.0167 -0.1829 236 LEU A C   
1241 O  O   . LEU A 166 ? 1.4429 1.0186 1.2636 0.1461  -0.0262 -0.1843 236 LEU A O   
1242 C  CB  . LEU A 166 ? 1.4365 0.9730 1.2757 0.1308  0.0331  -0.1993 236 LEU A CB  
1243 C  CG  . LEU A 166 ? 1.4845 1.0399 1.3945 0.1227  0.0227  -0.2188 236 LEU A CG  
1244 C  CD1 . LEU A 166 ? 1.4986 1.0451 1.4582 0.1106  0.0509  -0.2358 236 LEU A CD1 
1245 C  CD2 . LEU A 166 ? 1.5195 1.0852 1.4514 0.1241  -0.0210 -0.2325 236 LEU A CD2 
1246 N  N   . ILE A 167 ? 1.4430 0.9882 1.2119 0.1487  -0.0368 -0.1855 237 ILE A N   
1247 C  CA  . ILE A 167 ? 1.4493 0.9947 1.2109 0.1523  -0.0732 -0.1905 237 ILE A CA  
1248 C  C   . ILE A 167 ? 1.4853 1.0371 1.2108 0.1610  -0.0793 -0.1735 237 ILE A C   
1249 O  O   . ILE A 167 ? 1.4747 1.0363 1.2148 0.1626  -0.1025 -0.1774 237 ILE A O   
1250 C  CB  . ILE A 167 ? 1.5240 1.0434 1.2575 0.1522  -0.0908 -0.1986 237 ILE A CB  
1251 C  CG1 . ILE A 167 ? 1.5437 1.0439 1.2164 0.1576  -0.0730 -0.1826 237 ILE A CG1 
1252 C  CG2 . ILE A 167 ? 1.5442 1.0607 1.3259 0.1428  -0.0899 -0.2194 237 ILE A CG2 
1253 C  CD1 . ILE A 167 ? 1.6812 1.1511 1.3114 0.1586  -0.0850 -0.1862 237 ILE A CD1 
1254 N  N   . TYR A 168 ? 1.4370 0.9838 1.1213 0.1667  -0.0591 -0.1561 238 TYR A N   
1255 C  CA  . TYR A 168 ? 1.4232 0.9764 1.0785 0.1745  -0.0617 -0.1412 238 TYR A CA  
1256 C  C   . TYR A 168 ? 1.4418 1.0192 1.1275 0.1743  -0.0587 -0.1382 238 TYR A C   
1257 O  O   . TYR A 168 ? 1.4272 1.0132 1.1080 0.1780  -0.0738 -0.1344 238 TYR A O   
1258 C  CB  . TYR A 168 ? 1.4414 0.9849 1.0599 0.1802  -0.0405 -0.1271 238 TYR A CB  
1259 C  CG  . TYR A 168 ? 1.4951 1.0132 1.0726 0.1825  -0.0455 -0.1267 238 TYR A CG  
1260 C  CD1 . TYR A 168 ? 1.5467 1.0453 1.1216 0.1773  -0.0516 -0.1389 238 TYR A CD1 
1261 C  CD2 . TYR A 168 ? 1.5108 1.0212 1.0532 0.1892  -0.0420 -0.1157 238 TYR A CD2 
1262 C  CE1 . TYR A 168 ? 1.5893 1.0586 1.1204 0.1790  -0.0543 -0.1388 238 TYR A CE1 
1263 C  CE2 . TYR A 168 ? 1.5556 1.0365 1.0575 0.1903  -0.0413 -0.1160 238 TYR A CE2 
1264 C  CZ  . TYR A 168 ? 1.6746 1.1335 1.1673 0.1853  -0.0473 -0.1269 238 TYR A CZ  
1265 O  OH  . TYR A 168 ? 1.7192 1.1439 1.1651 0.1864  -0.0444 -0.1266 238 TYR A OH  
1266 N  N   . LEU A 169 ? 1.3868 0.9706 1.1023 0.1691  -0.0382 -0.1412 239 LEU A N   
1267 C  CA  . LEU A 169 ? 1.3632 0.9636 1.1057 0.1674  -0.0295 -0.1396 239 LEU A CA  
1268 C  C   . LEU A 169 ? 1.4012 1.0173 1.1872 0.1633  -0.0500 -0.1522 239 LEU A C   
1269 O  O   . LEU A 169 ? 1.3775 1.0082 1.1692 0.1658  -0.0542 -0.1467 239 LEU A O   
1270 C  CB  . LEU A 169 ? 1.3691 0.9605 1.1246 0.1619  0.0004  -0.1413 239 LEU A CB  
1271 C  CG  . LEU A 169 ? 1.4360 1.0132 1.1482 0.1688  0.0199  -0.1252 239 LEU A CG  
1272 C  CD1 . LEU A 169 ? 1.4565 1.0129 1.1718 0.1633  0.0480  -0.1285 239 LEU A CD1 
1273 C  CD2 . LEU A 169 ? 1.4515 1.0394 1.1484 0.1756  0.0185  -0.1122 239 LEU A CD2 
1274 N  N   . SER A 170 ? 1.3711 0.9838 1.1904 0.1574  -0.0643 -0.1701 240 SER A N   
1275 C  CA  . SER A 170 ? 1.3636 0.9898 1.2328 0.1544  -0.0888 -0.1854 240 SER A CA  
1276 C  C   . SER A 170 ? 1.4142 1.0421 1.2557 0.1627  -0.1183 -0.1786 240 SER A C   
1277 O  O   . SER A 170 ? 1.3949 1.0390 1.2637 0.1633  -0.1275 -0.1802 240 SER A O   
1278 C  CB  . SER A 170 ? 1.4270 1.0458 1.3339 0.1485  -0.1042 -0.2067 240 SER A CB  
1279 O  OG  . SER A 170 ? 1.5412 1.1535 1.4673 0.1406  -0.0732 -0.2124 240 SER A OG  
1280 N  N   . ILE A 171 ? 1.3919 0.9998 1.1759 0.1689  -0.1287 -0.1701 241 ILE A N   
1281 C  CA  . ILE A 171 ? 1.4016 1.0006 1.1472 0.1765  -0.1519 -0.1629 241 ILE A CA  
1282 C  C   . ILE A 171 ? 1.4249 1.0416 1.1640 0.1802  -0.1397 -0.1486 241 ILE A C   
1283 O  O   . ILE A 171 ? 1.4157 1.0393 1.1645 0.1828  -0.1586 -0.1497 241 ILE A O   
1284 C  CB  . ILE A 171 ? 1.4742 1.0416 1.1551 0.1810  -0.1560 -0.1565 241 ILE A CB  
1285 C  CG1 . ILE A 171 ? 1.5082 1.0559 1.1927 0.1767  -0.1656 -0.1709 241 ILE A CG1 
1286 C  CG2 . ILE A 171 ? 1.5055 1.0548 1.1449 0.1878  -0.1797 -0.1517 241 ILE A CG2 
1287 C  CD1 . ILE A 171 ? 1.6311 1.1478 1.2544 0.1793  -0.1586 -0.1640 241 ILE A CD1 
1288 N  N   . VAL A 172 ? 1.3658 0.9880 1.0892 0.1810  -0.1107 -0.1359 242 VAL A N   
1289 C  CA  . VAL A 172 ? 1.3413 0.9786 1.0576 0.1849  -0.0998 -0.1229 242 VAL A CA  
1290 C  C   . VAL A 172 ? 1.3698 1.0279 1.1322 0.1810  -0.1007 -0.1286 242 VAL A C   
1291 O  O   . VAL A 172 ? 1.3540 1.0217 1.1144 0.1845  -0.1100 -0.1236 242 VAL A O   
1292 C  CB  . VAL A 172 ? 1.3842 1.0201 1.0776 0.1877  -0.0732 -0.1104 242 VAL A CB  
1293 C  CG1 . VAL A 172 ? 1.3608 1.0120 1.0510 0.1920  -0.0663 -0.0991 242 VAL A CG1 
1294 C  CG2 . VAL A 172 ? 1.4026 1.0182 1.0544 0.1919  -0.0714 -0.1054 242 VAL A CG2 
1295 N  N   . CYS A 173 ? 1.3230 0.9856 1.1268 0.1734  -0.0884 -0.1394 243 CYS A N   
1296 C  CA  . CYS A 173 ? 1.3040 0.9833 1.1569 0.1682  -0.0835 -0.1469 243 CYS A CA  
1297 C  C   . CYS A 173 ? 1.3499 1.0377 1.2348 0.1688  -0.1148 -0.1582 243 CYS A C   
1298 O  O   . CYS A 173 ? 1.3289 1.0305 1.2276 0.1702  -0.1187 -0.1555 243 CYS A O   
1299 C  CB  . CYS A 173 ? 1.3123 0.9876 1.2010 0.1589  -0.0584 -0.1574 243 CYS A CB  
1300 S  SG  . CYS A 173 ? 1.3686 1.0272 1.2152 0.1594  -0.0214 -0.1430 243 CYS A SG  
1301 N  N   . VAL A 174 ? 1.3267 1.0034 1.2181 0.1690  -0.1397 -0.1701 244 VAL A N   
1302 C  CA  . VAL A 174 ? 1.3325 1.0109 1.2489 0.1719  -0.1763 -0.1813 244 VAL A CA  
1303 C  C   . VAL A 174 ? 1.3797 1.0534 1.2487 0.1807  -0.1905 -0.1670 244 VAL A C   
1304 O  O   . VAL A 174 ? 1.3653 1.0516 1.2595 0.1824  -0.2029 -0.1689 244 VAL A O   
1305 C  CB  . VAL A 174 ? 1.4133 1.0730 1.3348 0.1718  -0.2040 -0.1967 244 VAL A CB  
1306 C  CG1 . VAL A 174 ? 1.4321 1.0812 1.3527 0.1789  -0.2488 -0.2041 244 VAL A CG1 
1307 C  CG2 . VAL A 174 ? 1.4065 1.0761 1.3973 0.1620  -0.1927 -0.2160 244 VAL A CG2 
1308 N  N   . LEU A 175 ? 1.3455 1.0019 1.1500 0.1854  -0.1832 -0.1527 245 LEU A N   
1309 C  CA  . LEU A 175 ? 1.3469 0.9954 1.1044 0.1927  -0.1888 -0.1389 245 LEU A CA  
1310 C  C   . LEU A 175 ? 1.3570 1.0305 1.1293 0.1925  -0.1696 -0.1290 245 LEU A C   
1311 O  O   . LEU A 175 ? 1.3470 1.0241 1.1161 0.1963  -0.1818 -0.1256 245 LEU A O   
1312 C  CB  . LEU A 175 ? 1.3702 0.9938 1.0645 0.1963  -0.1796 -0.1283 245 LEU A CB  
1313 C  CG  . LEU A 175 ? 1.4758 1.0648 1.1384 0.1977  -0.2017 -0.1366 245 LEU A CG  
1314 C  CD1 . LEU A 175 ? 1.5024 1.0647 1.1029 0.2009  -0.1885 -0.1260 245 LEU A CD1 
1315 C  CD2 . LEU A 175 ? 1.5374 1.1097 1.1996 0.2016  -0.2403 -0.1461 245 LEU A CD2 
1316 N  N   . GLY A 176 ? 1.2879 0.9750 1.0777 0.1879  -0.1418 -0.1264 246 GLY A N   
1317 C  CA  . GLY A 176 ? 1.2582 0.9633 1.0572 0.1872  -0.1216 -0.1179 246 GLY A CA  
1318 C  C   . GLY A 176 ? 1.2873 1.0096 1.1360 0.1835  -0.1272 -0.1264 246 GLY A C   
1319 O  O   . GLY A 176 ? 1.2674 1.0001 1.1133 0.1862  -0.1283 -0.1196 246 GLY A O   
1320 N  N   . ILE A 177 ? 1.2435 0.9686 1.1420 0.1773  -0.1319 -0.1429 247 ILE A N   
1321 C  CA  . ILE A 177 ? 1.2266 0.9677 1.1855 0.1728  -0.1363 -0.1550 247 ILE A CA  
1322 C  C   . ILE A 177 ? 1.2753 1.0171 1.2315 0.1798  -0.1698 -0.1557 247 ILE A C   
1323 O  O   . ILE A 177 ? 1.2568 1.0118 1.2304 0.1806  -0.1703 -0.1535 247 ILE A O   
1324 C  CB  . ILE A 177 ? 1.2723 1.0147 1.2922 0.1645  -0.1335 -0.1753 247 ILE A CB  
1325 C  CG1 . ILE A 177 ? 1.2760 1.0137 1.3015 0.1560  -0.0925 -0.1749 247 ILE A CG1 
1326 C  CG2 . ILE A 177 ? 1.2734 1.0319 1.3648 0.1617  -0.1480 -0.1914 247 ILE A CG2 
1327 C  CD1 . ILE A 177 ? 1.3774 1.1006 1.3406 0.1589  -0.0731 -0.1587 247 ILE A CD1 
1328 N  N   . SER A 178 ? 1.2531 0.9753 1.1774 0.1853  -0.1959 -0.1570 248 SER A N   
1329 C  CA  . SER A 178 ? 1.2680 0.9778 1.1714 0.1933  -0.2290 -0.1563 248 SER A CA  
1330 C  C   . SER A 178 ? 1.3012 1.0137 1.1646 0.1979  -0.2189 -0.1390 248 SER A C   
1331 O  O   . SER A 178 ? 1.2911 1.0099 1.1705 0.2008  -0.2331 -0.1400 248 SER A O   
1332 C  CB  . SER A 178 ? 1.3508 1.0285 1.2092 0.1978  -0.2522 -0.1587 248 SER A CB  
1333 O  OG  . SER A 178 ? 1.4938 1.1484 1.3017 0.2064  -0.2738 -0.1510 248 SER A OG  
1334 N  N   . ALA A 179 ? 1.2475 0.9591 1.0704 0.1978  -0.1924 -0.1249 249 ALA A N   
1335 C  CA  . ALA A 179 ? 1.2348 0.9500 1.0252 0.2018  -0.1813 -0.1101 249 ALA A CA  
1336 C  C   . ALA A 179 ? 1.2566 0.9971 1.0837 0.1991  -0.1705 -0.1091 249 ALA A C   
1337 O  O   . ALA A 179 ? 1.2463 0.9890 1.0677 0.2029  -0.1799 -0.1049 249 ALA A O   
1338 C  CB  . ALA A 179 ? 1.2424 0.9520 0.9934 0.2027  -0.1579 -0.0987 249 ALA A CB  
1339 N  N   . ILE A 180 ? 1.1986 0.9533 1.0609 0.1923  -0.1504 -0.1136 250 ILE A N   
1340 C  CA  . ILE A 180 ? 1.1760 0.9487 1.0693 0.1886  -0.1364 -0.1135 250 ILE A CA  
1341 C  C   . ILE A 180 ? 1.2332 1.0144 1.1711 0.1885  -0.1573 -0.1243 250 ILE A C   
1342 O  O   . ILE A 180 ? 1.2171 1.0073 1.1577 0.1906  -0.1592 -0.1196 250 ILE A O   
1343 C  CB  . ILE A 180 ? 1.2083 0.9835 1.1239 0.1807  -0.1083 -0.1177 250 ILE A CB  
1344 C  CG1 . ILE A 180 ? 1.2200 0.9830 1.0907 0.1823  -0.0911 -0.1075 250 ILE A CG1 
1345 C  CG2 . ILE A 180 ? 1.2017 0.9883 1.1426 0.1764  -0.0921 -0.1179 250 ILE A CG2 
1346 C  CD1 . ILE A 180 ? 1.3135 1.0688 1.1973 0.1754  -0.0662 -0.1122 250 ILE A CD1 
1347 N  N   . ILE A 181 ? 1.2112 0.9890 1.1866 0.1865  -0.1741 -0.1396 251 ILE A N   
1348 C  CA  . ILE A 181 ? 1.2152 0.9996 1.2429 0.1874  -0.1991 -0.1535 251 ILE A CA  
1349 C  C   . ILE A 181 ? 1.2885 1.0620 1.2828 0.1971  -0.2281 -0.1469 251 ILE A C   
1350 O  O   . ILE A 181 ? 1.2753 1.0589 1.2985 0.1987  -0.2372 -0.1495 251 ILE A O   
1351 C  CB  . ILE A 181 ? 1.2686 1.0494 1.3442 0.1843  -0.2152 -0.1730 251 ILE A CB  
1352 C  CG1 . ILE A 181 ? 1.2611 1.0513 1.3789 0.1729  -0.1799 -0.1815 251 ILE A CG1 
1353 C  CG2 . ILE A 181 ? 1.2868 1.0713 1.4165 0.1882  -0.2510 -0.1887 251 ILE A CG2 
1354 C  CD1 . ILE A 181 ? 1.3357 1.1424 1.5016 0.1655  -0.1534 -0.1856 251 ILE A CD1 
1355 N  N   . VAL A 182 ? 1.2787 1.0277 1.2108 0.2031  -0.2400 -0.1387 252 VAL A N   
1356 C  CA  . VAL A 182 ? 1.3065 1.0338 1.1932 0.2121  -0.2635 -0.1318 252 VAL A CA  
1357 C  C   . VAL A 182 ? 1.3462 1.0860 1.2179 0.2129  -0.2452 -0.1185 252 VAL A C   
1358 O  O   . VAL A 182 ? 1.3467 1.0838 1.2232 0.2175  -0.2620 -0.1185 252 VAL A O   
1359 C  CB  . VAL A 182 ? 1.3938 1.0858 1.2105 0.2168  -0.2718 -0.1257 252 VAL A CB  
1360 C  CG1 . VAL A 182 ? 1.4233 1.0867 1.1865 0.2251  -0.2881 -0.1173 252 VAL A CG1 
1361 C  CG2 . VAL A 182 ? 1.4201 1.0940 1.2477 0.2175  -0.2982 -0.1402 252 VAL A CG2 
1362 N  N   . ALA A 183 ? 1.2900 1.0423 1.1461 0.2088  -0.2127 -0.1083 253 ALA A N   
1363 C  CA  . ALA A 183 ? 1.2740 1.0377 1.1164 0.2094  -0.1959 -0.0969 253 ALA A CA  
1364 C  C   . ALA A 183 ? 1.3115 1.0985 1.2040 0.2057  -0.1910 -0.1015 253 ALA A C   
1365 O  O   . ALA A 183 ? 1.3045 1.0926 1.1910 0.2092  -0.1970 -0.0969 253 ALA A O   
1366 C  CB  . ALA A 183 ? 1.2707 1.0389 1.0868 0.2073  -0.1681 -0.0871 253 ALA A CB  
1367 N  N   . GLN A 184 ? 1.2624 1.0647 1.2022 0.1983  -0.1770 -0.1106 254 GLN A N   
1368 C  CA  . GLN A 184 ? 1.2451 1.0656 1.2326 0.1934  -0.1669 -0.1159 254 GLN A CA  
1369 C  C   . GLN A 184 ? 1.3086 1.1314 1.3402 0.1961  -0.1938 -0.1276 254 GLN A C   
1370 O  O   . GLN A 184 ? 1.2924 1.1245 1.3406 0.1969  -0.1943 -0.1264 254 GLN A O   
1371 C  CB  . GLN A 184 ? 1.2534 1.0807 1.2733 0.1840  -0.1396 -0.1229 254 GLN A CB  
1372 C  CG  . GLN A 184 ? 1.4612 1.2885 1.4477 0.1814  -0.1111 -0.1113 254 GLN A CG  
1373 C  CD  . GLN A 184 ? 1.7257 1.5488 1.7335 0.1722  -0.0823 -0.1179 254 GLN A CD  
1374 O  OE1 . GLN A 184 ? 1.6764 1.4901 1.6493 0.1709  -0.0616 -0.1096 254 GLN A OE1 
1375 N  NE2 . GLN A 184 ? 1.6350 1.4609 1.6999 0.1659  -0.0801 -0.1338 254 GLN A NE2 
1376 N  N   . TRP A 185 ? 1.2931 1.1060 1.3447 0.1981  -0.2183 -0.1397 255 TRP A N   
1377 C  CA  . TRP A 185 ? 1.3067 1.1185 1.4056 0.2024  -0.2520 -0.1540 255 TRP A CA  
1378 C  C   . TRP A 185 ? 1.3384 1.1735 1.5099 0.1967  -0.2403 -0.1641 255 TRP A C   
1379 O  O   . TRP A 185 ? 1.3413 1.1778 1.5414 0.2023  -0.2647 -0.1697 255 TRP A O   
1380 C  CB  . TRP A 185 ? 1.3195 1.1076 1.3677 0.2140  -0.2842 -0.1462 255 TRP A CB  
1381 C  CG  . TRP A 185 ? 1.3232 1.1108 1.3237 0.2163  -0.2685 -0.1289 255 TRP A CG  
1382 C  CD1 . TRP A 185 ? 1.3716 1.1427 1.3017 0.2190  -0.2582 -0.1140 255 TRP A CD1 
1383 C  CD2 . TRP A 185 ? 1.3037 1.1076 1.3288 0.2156  -0.2604 -0.1264 255 TRP A CD2 
1384 N  NE1 . TRP A 185 ? 1.3523 1.1301 1.2649 0.2198  -0.2442 -0.1031 255 TRP A NE1 
1385 C  CE2 . TRP A 185 ? 1.3527 1.1486 1.3185 0.2184  -0.2479 -0.1100 255 TRP A CE2 
1386 C  CE3 . TRP A 185 ? 1.3016 1.1246 1.3960 0.2131  -0.2633 -0.1377 255 TRP A CE3 
1387 C  CZ2 . TRP A 185 ? 1.3309 1.1361 1.3008 0.2192  -0.2410 -0.1042 255 TRP A CZ2 
1388 C  CZ3 . TRP A 185 ? 1.3076 1.1410 1.4048 0.2131  -0.2523 -0.1310 255 TRP A CZ3 
1389 C  CH2 . TRP A 185 ? 1.3149 1.1395 1.3492 0.2162  -0.2425 -0.1143 255 TRP A CH2 
1390 N  N   . ASP A 186 ? 1.2731 1.1217 1.4694 0.1860  -0.2018 -0.1658 256 ASP A N   
1391 C  CA  . ASP A 186 ? 1.2520 1.1171 1.5122 0.1791  -0.1835 -0.1755 256 ASP A CA  
1392 C  C   . ASP A 186 ? 1.2942 1.1668 1.6415 0.1784  -0.2050 -0.1989 256 ASP A C   
1393 O  O   . ASP A 186 ? 1.2643 1.1476 1.6621 0.1796  -0.2133 -0.2067 256 ASP A O   
1394 C  CB  . ASP A 186 ? 1.2671 1.1329 1.5244 0.1675  -0.1363 -0.1734 256 ASP A CB  
1395 C  CG  . ASP A 186 ? 1.4128 1.2719 1.6913 0.1598  -0.1197 -0.1841 256 ASP A CG  
1396 O  OD1 . ASP A 186 ? 1.4279 1.2837 1.7189 0.1634  -0.1451 -0.1924 256 ASP A OD1 
1397 O  OD2 . ASP A 186 ? 1.4873 1.3394 1.7596 0.1509  -0.0817 -0.1829 256 ASP A OD2 
1398 N  N   . ARG A 187 ? 1.2794 1.1455 1.6438 0.1778  -0.2182 -0.2102 257 ARG A N   
1399 C  CA  . ARG A 187 ? 1.2868 1.1600 1.7401 0.1762  -0.2373 -0.2353 257 ARG A CA  
1400 C  C   . ARG A 187 ? 1.3582 1.2243 1.8152 0.1896  -0.2904 -0.2392 257 ARG A C   
1401 O  O   . ARG A 187 ? 1.3349 1.2133 1.8680 0.1907  -0.3045 -0.2547 257 ARG A O   
1402 C  CB  . ARG A 187 ? 1.2877 1.1542 1.7509 0.1705  -0.2309 -0.2452 257 ARG A CB  
1403 C  CG  . ARG A 187 ? 1.1794 1.0472 1.6461 0.1566  -0.1756 -0.2441 257 ARG A CG  
1404 C  CD  . ARG A 187 ? 1.0895 0.9475 1.5553 0.1521  -0.1702 -0.2515 257 ARG A CD  
1405 N  NE  . ARG A 187 ? 0.9409 0.7913 1.3926 0.1403  -0.1177 -0.2477 257 ARG A NE  
1406 C  CZ  . ARG A 187 ? 0.9602 0.7970 1.3827 0.1366  -0.1034 -0.2461 257 ARG A CZ  
1407 N  NH1 . ARG A 187 ? 0.7407 0.5720 1.1449 0.1431  -0.1359 -0.2478 257 ARG A NH1 
1408 N  NH2 . ARG A 187 ? 0.7261 0.5497 1.1315 0.1266  -0.0560 -0.2424 257 ARG A NH2 
1409 N  N   . PHE A 188 ? 1.3631 1.2058 1.7358 0.2002  -0.3183 -0.2247 258 PHE A N   
1410 C  CA  . PHE A 188 ? 1.4056 1.2287 1.7658 0.2144  -0.3717 -0.2277 258 PHE A CA  
1411 C  C   . PHE A 188 ? 1.5117 1.3035 1.7640 0.2240  -0.3866 -0.2070 258 PHE A C   
1412 O  O   . PHE A 188 ? 1.5127 1.2958 1.7043 0.2206  -0.3651 -0.1946 258 PHE A O   
1413 C  CB  . PHE A 188 ? 1.4538 1.2699 1.8707 0.2177  -0.4105 -0.2514 258 PHE A CB  
1414 C  CG  . PHE A 188 ? 1.4654 1.3034 1.9994 0.2165  -0.4246 -0.2761 258 PHE A CG  
1415 C  CD1 . PHE A 188 ? 1.5225 1.3542 2.0773 0.2284  -0.4646 -0.2807 258 PHE A CD1 
1416 C  CD2 . PHE A 188 ? 1.4715 1.3342 2.0966 0.2035  -0.3958 -0.2956 258 PHE A CD2 
1417 C  CE1 . PHE A 188 ? 1.5243 1.3777 2.1952 0.2278  -0.4776 -0.3048 258 PHE A CE1 
1418 C  CE2 . PHE A 188 ? 1.4983 1.3820 2.2396 0.2013  -0.4031 -0.3199 258 PHE A CE2 
1419 C  CZ  . PHE A 188 ? 1.4874 1.3681 2.2549 0.2139  -0.4459 -0.3250 258 PHE A CZ  
1420 N  N   . ALA A 189 ? 1.5112 1.2819 1.7419 0.2365  -0.4249 -0.2049 259 ALA A N   
1421 C  CA  . ALA A 189 ? 1.5580 1.2871 1.6895 0.2475  -0.4469 -0.1893 259 ALA A CA  
1422 C  C   . ALA A 189 ? 1.6120 1.3423 1.6836 0.2456  -0.4136 -0.1676 259 ALA A C   
1423 O  O   . ALA A 189 ? 1.5645 1.3281 1.6654 0.2352  -0.3734 -0.1641 259 ALA A O   
1424 C  CB  . ALA A 189 ? 1.6003 1.3003 1.6791 0.2491  -0.4593 -0.1895 259 ALA A CB  
1425 N  N   . THR A 190 ? 1.6227 1.3130 1.6109 0.2554  -0.4303 -0.1544 260 THR A N   
1426 C  CA  . THR A 190 ? 1.6261 1.3061 1.5447 0.2554  -0.4037 -0.1342 260 THR A CA  
1427 C  C   . THR A 190 ? 1.6676 1.3666 1.6131 0.2558  -0.3946 -0.1298 260 THR A C   
1428 O  O   . THR A 190 ? 1.6337 1.3632 1.6578 0.2532  -0.3964 -0.1407 260 THR A O   
1429 C  CB  . THR A 190 ? 1.7085 1.4051 1.6014 0.2456  -0.3600 -0.1236 260 THR A CB  
1430 O  OG1 . THR A 190 ? 1.6578 1.3993 1.6162 0.2356  -0.3312 -0.1277 260 THR A OG1 
1431 C  CG2 . THR A 190 ? 1.7132 1.3888 1.5727 0.2451  -0.3653 -0.1261 260 THR A CG2 
1432 N  N   . PRO A 191 ? 1.6473 1.3255 1.5233 0.2587  -0.3803 -0.1130 261 PRO A N   
1433 C  CA  . PRO A 191 ? 1.6872 1.3241 1.4718 0.2618  -0.3747 -0.1010 261 PRO A CA  
1434 C  C   . PRO A 191 ? 1.8142 1.3947 1.5513 0.2739  -0.4196 -0.1055 261 PRO A C   
1435 O  O   . PRO A 191 ? 1.8320 1.4023 1.5957 0.2822  -0.4550 -0.1138 261 PRO A O   
1436 C  CB  . PRO A 191 ? 1.6992 1.3368 1.4508 0.2607  -0.3469 -0.0865 261 PRO A CB  
1437 C  CG  . PRO A 191 ? 1.7467 1.3973 1.5462 0.2645  -0.3637 -0.0917 261 PRO A CG  
1438 C  CD  . PRO A 191 ? 1.6519 1.3409 1.5408 0.2600  -0.3728 -0.1076 261 PRO A CD  
1439 N  N   . LYS A 192 ? 1.8143 1.3576 1.4855 0.2752  -0.4200 -0.1017 262 LYS A N   
1440 C  CA  . LYS A 192 ? 1.8908 1.3717 1.5051 0.2867  -0.4630 -0.1061 262 LYS A CA  
1441 C  C   . LYS A 192 ? 2.0096 1.4304 1.5152 0.2895  -0.4493 -0.0928 262 LYS A C   
1442 O  O   . LYS A 192 ? 1.9805 1.4144 1.4659 0.2813  -0.4068 -0.0829 262 LYS A O   
1443 C  CB  . LYS A 192 ? 1.9268 1.4097 1.5752 0.2870  -0.4915 -0.1220 262 LYS A CB  
1444 C  CG  . LYS A 192 ? 2.0288 1.5625 1.7897 0.2845  -0.5081 -0.1395 262 LYS A CG  
1445 C  CD  . LYS A 192 ? 2.1560 1.6718 1.9412 0.2964  -0.5538 -0.1485 262 LYS A CD  
1446 C  CE  . LYS A 192 ? 2.2067 1.7779 2.1133 0.2921  -0.5601 -0.1660 262 LYS A CE  
1447 N  NZ  . LYS A 192 ? 2.3300 1.8876 2.2680 0.3041  -0.6025 -0.1746 262 LYS A NZ  
1448 N  N   . HIS A 193 ? 2.0540 1.4041 1.4892 0.3015  -0.4868 -0.0937 263 HIS A N   
1449 C  CA  . HIS A 193 ? 2.1354 1.4083 1.4548 0.3056  -0.4806 -0.0839 263 HIS A CA  
1450 C  C   . HIS A 193 ? 2.1831 1.4557 1.4836 0.2982  -0.4611 -0.0848 263 HIS A C   
1451 O  O   . HIS A 193 ? 2.2049 1.4458 1.4382 0.2943  -0.4268 -0.0745 263 HIS A O   
1452 C  CB  . HIS A 193 ? 2.2424 1.4378 1.4990 0.3209  -0.5363 -0.0896 263 HIS A CB  
1453 C  CG  . HIS A 193 ? 2.2962 1.4933 1.5915 0.3256  -0.5840 -0.1071 263 HIS A CG  
1454 N  ND1 . HIS A 193 ? 2.2493 1.5174 1.6637 0.3228  -0.5992 -0.1210 263 HIS A ND1 
1455 C  CD2 . HIS A 193 ? 2.3872 1.5257 1.6203 0.3311  -0.6128 -0.1130 263 HIS A CD2 
1456 C  CE1 . HIS A 193 ? 2.2722 1.5233 1.6966 0.3271  -0.6385 -0.1357 263 HIS A CE1 
1457 N  NE2 . HIS A 193 ? 2.3580 1.5323 1.6755 0.3326  -0.6509 -0.1317 263 HIS A NE2 
1458 N  N   . ARG A 194 ? 2.1133 1.4225 1.4797 0.2958  -0.4812 -0.0982 264 ARG A N   
1459 C  CA  . ARG A 194 ? 2.1059 1.4213 1.4702 0.2892  -0.4693 -0.1020 264 ARG A CA  
1460 C  C   . ARG A 194 ? 2.0992 1.4551 1.4744 0.2775  -0.4123 -0.0914 264 ARG A C   
1461 O  O   . ARG A 194 ? 2.0277 1.4395 1.4615 0.2717  -0.3872 -0.0875 264 ARG A O   
1462 C  CB  . ARG A 194 ? 2.0783 1.4330 1.5286 0.2883  -0.5001 -0.1200 264 ARG A CB  
1463 C  CG  . ARG A 194 ? 2.1042 1.5402 1.6612 0.2796  -0.4783 -0.1236 264 ARG A CG  
1464 C  CD  . ARG A 194 ? 2.1964 1.6617 1.8391 0.2796  -0.5096 -0.1433 264 ARG A CD  
1465 N  NE  . ARG A 194 ? 2.2072 1.7432 1.9407 0.2683  -0.4767 -0.1464 264 ARG A NE  
1466 C  CZ  . ARG A 194 ? 2.3474 1.9188 2.1695 0.2644  -0.4884 -0.1637 264 ARG A CZ  
1467 N  NH1 . ARG A 194 ? 2.2253 1.7743 2.0677 0.2714  -0.5358 -0.1809 264 ARG A NH1 
1468 N  NH2 . ARG A 194 ? 2.1096 1.7354 2.0009 0.2534  -0.4526 -0.1653 264 ARG A NH2 
1469 N  N   . GLN A 195 ? 2.0880 1.4120 1.4059 0.2745  -0.3944 -0.0877 265 GLN A N   
1470 C  CA  . GLN A 195 ? 2.0462 1.3971 1.3662 0.2651  -0.3450 -0.0792 265 GLN A CA  
1471 C  C   . GLN A 195 ? 2.0592 1.4430 1.4225 0.2591  -0.3425 -0.0872 265 GLN A C   
1472 O  O   . GLN A 195 ? 2.0421 1.4310 1.3913 0.2533  -0.3097 -0.0820 265 GLN A O   
1473 C  CB  . GLN A 195 ? 2.1347 1.4157 1.3542 0.2667  -0.3253 -0.0703 265 GLN A CB  
1474 C  CG  . GLN A 195 ? 2.3218 1.6210 1.5400 0.2584  -0.2767 -0.0633 265 GLN A CG  
1475 C  CD  . GLN A 195 ? 2.6634 1.8891 1.7874 0.2592  -0.2574 -0.0578 265 GLN A CD  
1476 O  OE1 . GLN A 195 ? 2.6949 1.8452 1.7386 0.2658  -0.2799 -0.0590 265 GLN A OE1 
1477 N  NE2 . GLN A 195 ? 2.5426 1.7898 1.6787 0.2529  -0.2137 -0.0516 265 GLN A NE2 
1478 N  N   . THR A 196 ? 1.9992 1.4043 1.4187 0.2603  -0.3760 -0.1006 266 THR A N   
1479 C  CA  . THR A 196 ? 1.9688 1.4010 1.4314 0.2545  -0.3753 -0.1100 266 THR A CA  
1480 C  C   . THR A 196 ? 1.9401 1.4306 1.4552 0.2450  -0.3341 -0.1052 266 THR A C   
1481 O  O   . THR A 196 ? 1.9287 1.4232 1.4437 0.2404  -0.3211 -0.1072 266 THR A O   
1482 C  CB  . THR A 196 ? 2.0698 1.5140 1.5920 0.2575  -0.4178 -0.1274 266 THR A CB  
1483 O  OG1 . THR A 196 ? 2.1410 1.5201 1.6013 0.2676  -0.4604 -0.1326 266 THR A OG1 
1484 C  CG2 . THR A 196 ? 2.0209 1.4979 1.5998 0.2501  -0.4129 -0.1387 266 THR A CG2 
1485 N  N   . ARG A 197 ? 1.8391 1.3728 1.3999 0.2423  -0.3163 -0.1002 267 ARG A N   
1486 C  CA  . ARG A 197 ? 1.7755 1.3559 1.3743 0.2345  -0.2783 -0.0947 267 ARG A CA  
1487 C  C   . ARG A 197 ? 1.8368 1.3972 1.3845 0.2328  -0.2525 -0.0866 267 ARG A C   
1488 O  O   . ARG A 197 ? 1.8048 1.3861 1.3734 0.2278  -0.2346 -0.0875 267 ARG A O   
1489 C  CB  . ARG A 197 ? 1.7408 1.3500 1.3617 0.2336  -0.2606 -0.0868 267 ARG A CB  
1490 C  CG  . ARG A 197 ? 1.8165 1.4605 1.4570 0.2275  -0.2240 -0.0797 267 ARG A CG  
1491 C  CD  . ARG A 197 ? 1.9181 1.5610 1.5342 0.2290  -0.2049 -0.0687 267 ARG A CD  
1492 N  NE  . ARG A 197 ? 1.9635 1.6434 1.6261 0.2267  -0.1984 -0.0679 267 ARG A NE  
1493 C  CZ  . ARG A 197 ? 2.1199 1.8050 1.7761 0.2277  -0.1872 -0.0609 267 ARG A CZ  
1494 N  NH1 . ARG A 197 ? 1.9228 1.6400 1.6205 0.2252  -0.1816 -0.0610 267 ARG A NH1 
1495 N  NH2 . ARG A 197 ? 1.9746 1.6288 1.5804 0.2309  -0.1790 -0.0544 267 ARG A NH2 
1496 N  N   . ALA A 198 ? 1.8411 1.3554 1.3204 0.2372  -0.2507 -0.0797 268 ALA A N   
1497 C  CA  . ALA A 198 ? 1.8653 1.3491 1.2903 0.2361  -0.2263 -0.0735 268 ALA A CA  
1498 C  C   . ALA A 198 ? 1.9314 1.3959 1.3409 0.2347  -0.2345 -0.0804 268 ALA A C   
1499 O  O   . ALA A 198 ? 1.9114 1.3840 1.3191 0.2309  -0.2078 -0.0771 268 ALA A O   
1500 C  CB  . ALA A 198 ? 1.9347 1.3625 1.2870 0.2407  -0.2244 -0.0675 268 ALA A CB  
1501 N  N   . GLY A 199 ? 1.9208 1.3590 1.3205 0.2382  -0.2718 -0.0906 269 GLY A N   
1502 C  CA  . GLY A 199 ? 1.9377 1.3602 1.3319 0.2367  -0.2857 -0.1000 269 GLY A CA  
1503 C  C   . GLY A 199 ? 1.9176 1.3926 1.3769 0.2297  -0.2672 -0.1033 269 GLY A C   
1504 O  O   . GLY A 199 ? 1.9175 1.3847 1.3592 0.2265  -0.2494 -0.1023 269 GLY A O   
1505 N  N   . VAL A 200 ? 1.8149 1.3399 1.3453 0.2270  -0.2669 -0.1063 270 VAL A N   
1506 C  CA  . VAL A 200 ? 1.7611 1.3286 1.3465 0.2203  -0.2465 -0.1088 270 VAL A CA  
1507 C  C   . VAL A 200 ? 1.7777 1.3587 1.3497 0.2181  -0.2086 -0.0964 270 VAL A C   
1508 O  O   . VAL A 200 ? 1.7620 1.3499 1.3404 0.2146  -0.1924 -0.0969 270 VAL A O   
1509 C  CB  . VAL A 200 ? 1.7704 1.3777 1.4264 0.2176  -0.2526 -0.1154 270 VAL A CB  
1510 C  CG1 . VAL A 200 ? 1.7241 1.3664 1.4202 0.2108  -0.2226 -0.1142 270 VAL A CG1 
1511 C  CG2 . VAL A 200 ? 1.7890 1.3878 1.4768 0.2188  -0.2894 -0.1323 270 VAL A CG2 
1512 N  N   . PHE A 201 ? 1.7237 1.3049 1.2762 0.2207  -0.1960 -0.0862 271 PHE A N   
1513 C  CA  . PHE A 201 ? 1.7001 1.2907 1.2417 0.2200  -0.1639 -0.0761 271 PHE A CA  
1514 C  C   . PHE A 201 ? 1.7698 1.3249 1.2641 0.2204  -0.1539 -0.0752 271 PHE A C   
1515 O  O   . PHE A 201 ? 1.7447 1.3123 1.2481 0.2186  -0.1326 -0.0725 271 PHE A O   
1516 C  CB  . PHE A 201 ? 1.7207 1.3124 1.2506 0.2227  -0.1548 -0.0680 271 PHE A CB  
1517 C  CG  . PHE A 201 ? 1.7583 1.3318 1.2533 0.2238  -0.1286 -0.0607 271 PHE A CG  
1518 C  CD1 . PHE A 201 ? 1.7785 1.3680 1.2877 0.2224  -0.1063 -0.0583 271 PHE A CD1 
1519 C  CD2 . PHE A 201 ? 1.8229 1.3628 1.2749 0.2263  -0.1247 -0.0569 271 PHE A CD2 
1520 C  CE1 . PHE A 201 ? 1.8054 1.3779 1.2913 0.2233  -0.0821 -0.0541 271 PHE A CE1 
1521 C  CE2 . PHE A 201 ? 1.8751 1.3972 1.3024 0.2261  -0.0960 -0.0523 271 PHE A CE2 
1522 C  CZ  . PHE A 201 ? 1.8288 1.3695 1.2776 0.2246  -0.0751 -0.0516 271 PHE A CZ  
1523 N  N   . LEU A 202 ? 1.7732 1.2803 1.2152 0.2230  -0.1707 -0.0781 272 LEU A N   
1524 C  CA  . LEU A 202 ? 1.8113 1.2757 1.2007 0.2228  -0.1619 -0.0784 272 LEU A CA  
1525 C  C   . LEU A 202 ? 1.8263 1.3033 1.2396 0.2193  -0.1633 -0.0851 272 LEU A C   
1526 O  O   . LEU A 202 ? 1.8232 1.2925 1.2219 0.2178  -0.1408 -0.0823 272 LEU A O   
1527 C  CB  . LEU A 202 ? 1.8843 1.2878 1.2074 0.2266  -0.1845 -0.0813 272 LEU A CB  
1528 C  CG  . LEU A 202 ? 2.0032 1.3507 1.2547 0.2266  -0.1642 -0.0778 272 LEU A CG  
1529 C  CD1 . LEU A 202 ? 2.0820 1.3642 1.2600 0.2310  -0.1812 -0.0780 272 LEU A CD1 
1530 C  CD2 . LEU A 202 ? 2.0433 1.3721 1.2793 0.2247  -0.1697 -0.0841 272 LEU A CD2 
1531 N  N   . GLY A 203 ? 1.7527 1.2511 1.2087 0.2178  -0.1865 -0.0943 273 GLY A N   
1532 C  CA  . GLY A 203 ? 1.7337 1.2449 1.2185 0.2135  -0.1862 -0.1020 273 GLY A CA  
1533 C  C   . GLY A 203 ? 1.7280 1.2693 1.2380 0.2108  -0.1541 -0.0955 273 GLY A C   
1534 O  O   . GLY A 203 ? 1.7324 1.2634 1.2319 0.2089  -0.1430 -0.0969 273 GLY A O   
1535 N  N   . LEU A 204 ? 1.6318 1.2065 1.1716 0.2113  -0.1402 -0.0883 274 LEU A N   
1536 C  CA  . LEU A 204 ? 1.5905 1.1907 1.1523 0.2106  -0.1147 -0.0821 274 LEU A CA  
1537 C  C   . LEU A 204 ? 1.6404 1.2236 1.1706 0.2130  -0.0938 -0.0756 274 LEU A C   
1538 O  O   . LEU A 204 ? 1.6304 1.2156 1.1663 0.2122  -0.0814 -0.0758 274 LEU A O   
1539 C  CB  . LEU A 204 ? 1.5543 1.1859 1.1463 0.2115  -0.1092 -0.0767 274 LEU A CB  
1540 C  CG  . LEU A 204 ? 1.5857 1.2436 1.2238 0.2075  -0.1122 -0.0818 274 LEU A CG  
1541 C  CD1 . LEU A 204 ? 1.5997 1.2531 1.2569 0.2045  -0.1362 -0.0936 274 LEU A CD1 
1542 C  CD2 . LEU A 204 ? 1.5883 1.2693 1.2448 0.2087  -0.1064 -0.0759 274 LEU A CD2 
1543 N  N   . GLY A 205 ? 1.6050 1.1696 1.1043 0.2159  -0.0886 -0.0709 275 GLY A N   
1544 C  CA  . GLY A 205 ? 1.6141 1.1598 1.0881 0.2176  -0.0654 -0.0665 275 GLY A CA  
1545 C  C   . GLY A 205 ? 1.6877 1.1968 1.1254 0.2158  -0.0647 -0.0713 275 GLY A C   
1546 O  O   . GLY A 205 ? 1.6817 1.1897 1.1218 0.2159  -0.0468 -0.0703 275 GLY A O   
1547 N  N   . LEU A 206 ? 1.6663 1.1461 1.0738 0.2145  -0.0876 -0.0774 276 LEU A N   
1548 C  CA  . LEU A 206 ? 1.7055 1.1429 1.0701 0.2129  -0.0924 -0.0833 276 LEU A CA  
1549 C  C   . LEU A 206 ? 1.7223 1.1739 1.1131 0.2098  -0.0955 -0.0893 276 LEU A C   
1550 O  O   . LEU A 206 ? 1.7461 1.1715 1.1099 0.2085  -0.0846 -0.0912 276 LEU A O   
1551 C  CB  . LEU A 206 ? 1.7562 1.1526 1.0768 0.2139  -0.1209 -0.0888 276 LEU A CB  
1552 C  CG  . LEU A 206 ? 1.8421 1.2134 1.1261 0.2171  -0.1203 -0.0835 276 LEU A CG  
1553 C  CD1 . LEU A 206 ? 1.9116 1.2274 1.1369 0.2191  -0.1484 -0.0894 276 LEU A CD1 
1554 C  CD2 . LEU A 206 ? 1.8859 1.2417 1.1466 0.2170  -0.0822 -0.0757 276 LEU A CD2 
1555 N  N   . SER A 207 ? 1.6219 1.1113 1.0643 0.2081  -0.1075 -0.0930 277 SER A N   
1556 C  CA  . SER A 207 ? 1.5978 1.1006 1.0697 0.2043  -0.1070 -0.0995 277 SER A CA  
1557 C  C   . SER A 207 ? 1.6128 1.1218 1.0871 0.2049  -0.0789 -0.0933 277 SER A C   
1558 O  O   . SER A 207 ? 1.6219 1.1198 1.0934 0.2022  -0.0756 -0.0985 277 SER A O   
1559 C  CB  . SER A 207 ? 1.6037 1.1433 1.1314 0.2017  -0.1161 -0.1040 277 SER A CB  
1560 O  OG  . SER A 207 ? 1.7110 1.2583 1.2657 0.1971  -0.1106 -0.1110 277 SER A OG  
1561 N  N   . GLY A 208 ? 1.5259 1.0511 1.0074 0.2089  -0.0610 -0.0836 278 GLY A N   
1562 C  CA  . GLY A 208 ? 1.5009 1.0329 0.9896 0.2118  -0.0373 -0.0777 278 GLY A CA  
1563 C  C   . GLY A 208 ? 1.5580 1.0571 1.0128 0.2118  -0.0232 -0.0786 278 GLY A C   
1564 O  O   . GLY A 208 ? 1.5459 1.0472 1.0103 0.2126  -0.0103 -0.0780 278 GLY A O   
1565 N  N   . VAL A 209 ? 1.5369 0.9996 0.9476 0.2107  -0.0256 -0.0807 279 VAL A N   
1566 C  CA  . VAL A 209 ? 1.5673 0.9897 0.9375 0.2099  -0.0085 -0.0820 279 VAL A CA  
1567 C  C   . VAL A 209 ? 1.6129 1.0171 0.9703 0.2062  -0.0134 -0.0891 279 VAL A C   
1568 O  O   . VAL A 209 ? 1.6146 1.0085 0.9679 0.2065  0.0071  -0.0884 279 VAL A O   
1569 C  CB  . VAL A 209 ? 1.6644 1.0435 0.9813 0.2094  -0.0080 -0.0823 279 VAL A CB  
1570 C  CG1 . VAL A 209 ? 1.7171 1.0448 0.9838 0.2071  0.0105  -0.0852 279 VAL A CG1 
1571 C  CG2 . VAL A 209 ? 1.6425 1.0377 0.9756 0.2126  0.0065  -0.0756 279 VAL A CG2 
1572 N  N   . VAL A 210 ? 1.5603 0.9605 0.9155 0.2029  -0.0403 -0.0970 280 VAL A N   
1573 C  CA  . VAL A 210 ? 1.5693 0.9546 0.9195 0.1988  -0.0475 -0.1060 280 VAL A CA  
1574 C  C   . VAL A 210 ? 1.5660 0.9800 0.9562 0.1988  -0.0287 -0.1034 280 VAL A C   
1575 O  O   . VAL A 210 ? 1.5802 0.9744 0.9547 0.1975  -0.0149 -0.1053 280 VAL A O   
1576 C  CB  . VAL A 210 ? 1.6219 1.0093 0.9848 0.1958  -0.0815 -0.1170 280 VAL A CB  
1577 C  CG1 . VAL A 210 ? 1.6336 1.0111 1.0034 0.1909  -0.0881 -0.1281 280 VAL A CG1 
1578 C  CG2 . VAL A 210 ? 1.6637 1.0149 0.9802 0.1975  -0.1048 -0.1198 280 VAL A CG2 
1579 N  N   . PRO A 211 ? 1.4637 0.9187 0.8997 0.2006  -0.0278 -0.0990 281 PRO A N   
1580 C  CA  . PRO A 211 ? 1.4326 0.9059 0.8973 0.2014  -0.0121 -0.0963 281 PRO A CA  
1581 C  C   . PRO A 211 ? 1.4665 0.9357 0.9253 0.2069  0.0109  -0.0885 281 PRO A C   
1582 O  O   . PRO A 211 ? 1.4665 0.9289 0.9276 0.2071  0.0230  -0.0892 281 PRO A O   
1583 C  CB  . PRO A 211 ? 1.4167 0.9246 0.9189 0.2026  -0.0170 -0.0928 281 PRO A CB  
1584 C  CG  . PRO A 211 ? 1.4708 0.9839 0.9683 0.2038  -0.0293 -0.0912 281 PRO A CG  
1585 C  CD  . PRO A 211 ? 1.4547 0.9356 0.9160 0.2010  -0.0433 -0.0982 281 PRO A CD  
1586 N  N   . THR A 212 ? 1.4070 0.8808 0.8629 0.2115  0.0166  -0.0822 282 THR A N   
1587 C  CA  . THR A 212 ? 1.3972 0.8709 0.8589 0.2175  0.0370  -0.0765 282 THR A CA  
1588 C  C   . THR A 212 ? 1.4682 0.9076 0.9013 0.2158  0.0528  -0.0799 282 THR A C   
1589 O  O   . THR A 212 ? 1.4594 0.8994 0.9060 0.2196  0.0677  -0.0782 282 THR A O   
1590 C  CB  . THR A 212 ? 1.4864 0.9738 0.9593 0.2219  0.0403  -0.0714 282 THR A CB  
1591 O  OG1 . THR A 212 ? 1.4958 0.9692 0.9670 0.2253  0.0619  -0.0705 282 THR A OG1 
1592 C  CG2 . THR A 212 ? 1.4866 0.9627 0.9361 0.2184  0.0303  -0.0731 282 THR A CG2 
1593 N  N   . MET A 213 ? 1.4527 0.8585 0.8439 0.2107  0.0493  -0.0849 283 MET A N   
1594 C  CA  . MET A 213 ? 1.4895 0.8545 0.8445 0.2081  0.0657  -0.0890 283 MET A CA  
1595 C  C   . MET A 213 ? 1.5268 0.8859 0.8814 0.2048  0.0619  -0.0942 283 MET A C   
1596 O  O   . MET A 213 ? 1.5375 0.8794 0.8855 0.2052  0.0812  -0.0949 283 MET A O   
1597 C  CB  . MET A 213 ? 1.5706 0.8911 0.8694 0.2038  0.0614  -0.0930 283 MET A CB  
1598 C  CG  . MET A 213 ? 1.6347 0.9447 0.9119 0.1997  0.0288  -0.0998 283 MET A CG  
1599 S  SD  . MET A 213 ? 1.7660 1.0096 0.9628 0.1967  0.0202  -0.1045 283 MET A SD  
1600 C  CE  . MET A 213 ? 1.7227 0.9636 0.9165 0.2001  0.0485  -0.0958 283 MET A CE  
1601 N  N   . HIS A 214 ? 1.4556 0.8291 0.8221 0.2013  0.0385  -0.0988 284 HIS A N   
1602 C  CA  . HIS A 214 ? 1.4497 0.8211 0.8243 0.1971  0.0343  -0.1056 284 HIS A CA  
1603 C  C   . HIS A 214 ? 1.4641 0.8518 0.8666 0.2016  0.0544  -0.0997 284 HIS A C   
1604 O  O   . HIS A 214 ? 1.4772 0.8472 0.8712 0.1997  0.0653  -0.1031 284 HIS A O   
1605 C  CB  . HIS A 214 ? 1.4385 0.8310 0.8386 0.1932  0.0101  -0.1117 284 HIS A CB  
1606 C  CG  . HIS A 214 ? 1.4831 0.8744 0.8995 0.1876  0.0075  -0.1208 284 HIS A CG  
1607 N  ND1 . HIS A 214 ? 1.4955 0.8912 0.9263 0.1889  0.0282  -0.1175 284 HIS A ND1 
1608 C  CD2 . HIS A 214 ? 1.5143 0.9014 0.9392 0.1813  -0.0133 -0.1334 284 HIS A CD2 
1609 C  CE1 . HIS A 214 ? 1.4953 0.8863 0.9382 0.1823  0.0224  -0.1282 284 HIS A CE1 
1610 N  NE2 . HIS A 214 ? 1.5090 0.8975 0.9543 0.1773  -0.0026 -0.1388 284 HIS A NE2 
1611 N  N   . PHE A 215 ? 1.3766 0.7941 0.8092 0.2081  0.0577  -0.0912 285 PHE A N   
1612 C  CA  . PHE A 215 ? 1.3556 0.7842 0.8107 0.2148  0.0717  -0.0852 285 PHE A CA  
1613 C  C   . PHE A 215 ? 1.4232 0.8316 0.8682 0.2187  0.0922  -0.0838 285 PHE A C   
1614 O  O   . PHE A 215 ? 1.4234 0.8234 0.8723 0.2207  0.1031  -0.0838 285 PHE A O   
1615 C  CB  . PHE A 215 ? 1.3437 0.8019 0.8263 0.2218  0.0668  -0.0773 285 PHE A CB  
1616 C  CG  . PHE A 215 ? 1.3541 0.8175 0.8545 0.2308  0.0760  -0.0711 285 PHE A CG  
1617 C  CD1 . PHE A 215 ? 1.3936 0.8531 0.8962 0.2303  0.0772  -0.0710 285 PHE A CD1 
1618 C  CD2 . PHE A 215 ? 1.3760 0.8442 0.8913 0.2402  0.0834  -0.0664 285 PHE A CD2 
1619 C  CE1 . PHE A 215 ? 1.4059 0.8621 0.9164 0.2401  0.0832  -0.0648 285 PHE A CE1 
1620 C  CE2 . PHE A 215 ? 1.4084 0.8781 0.9402 0.2504  0.0864  -0.0616 285 PHE A CE2 
1621 C  CZ  . PHE A 215 ? 1.3896 0.8512 0.9144 0.2509  0.0850  -0.0600 285 PHE A CZ  
1622 N  N   . THR A 216 ? 1.3938 0.7917 0.8262 0.2194  0.0996  -0.0835 286 THR A N   
1623 C  CA  . THR A 216 ? 1.4150 0.7919 0.8426 0.2221  0.1234  -0.0839 286 THR A CA  
1624 C  C   . THR A 216 ? 1.5074 0.8487 0.9014 0.2158  0.1328  -0.0904 286 THR A C   
1625 O  O   . THR A 216 ? 1.5099 0.8416 0.9127 0.2191  0.1513  -0.0902 286 THR A O   
1626 C  CB  . THR A 216 ? 1.5196 0.8873 0.9379 0.2219  0.1324  -0.0838 286 THR A CB  
1627 O  OG1 . THR A 216 ? 1.4808 0.8835 0.9336 0.2277  0.1228  -0.0786 286 THR A OG1 
1628 C  CG2 . THR A 216 ? 1.5213 0.8656 0.9404 0.2236  0.1621  -0.0861 286 THR A CG2 
1629 N  N   . ILE A 217 ? 1.4943 0.8130 0.8501 0.2074  0.1199  -0.0967 287 ILE A N   
1630 C  CA  . ILE A 217 ? 1.5369 0.8177 0.8570 0.2012  0.1265  -0.1042 287 ILE A CA  
1631 C  C   . ILE A 217 ? 1.5844 0.8759 0.9266 0.2015  0.1282  -0.1052 287 ILE A C   
1632 O  O   . ILE A 217 ? 1.6007 0.8708 0.9343 0.2015  0.1470  -0.1071 287 ILE A O   
1633 C  CB  . ILE A 217 ? 1.6096 0.8623 0.8846 0.1934  0.1046  -0.1121 287 ILE A CB  
1634 C  CG1 . ILE A 217 ? 1.6418 0.8694 0.8809 0.1934  0.1081  -0.1106 287 ILE A CG1 
1635 C  CG2 . ILE A 217 ? 1.6626 0.8769 0.9024 0.1870  0.1057  -0.1214 287 ILE A CG2 
1636 C  CD1 . ILE A 217 ? 1.7535 0.9563 0.9509 0.1888  0.0800  -0.1167 287 ILE A CD1 
1637 N  N   . ALA A 218 ? 1.5169 0.8385 0.8871 0.2018  0.1114  -0.1042 288 ALA A N   
1638 C  CA  . ALA A 218 ? 1.5107 0.8386 0.8991 0.2012  0.1141  -0.1056 288 ALA A CA  
1639 C  C   . ALA A 218 ? 1.5640 0.8991 0.9741 0.2107  0.1323  -0.0975 288 ALA A C   
1640 O  O   . ALA A 218 ? 1.5717 0.8923 0.9798 0.2104  0.1440  -0.0993 288 ALA A O   
1641 C  CB  . ALA A 218 ? 1.4933 0.8461 0.9047 0.1983  0.0959  -0.1074 288 ALA A CB  
1642 N  N   . GLU A 219 ? 1.5121 0.8681 0.9440 0.2196  0.1328  -0.0893 289 GLU A N   
1643 C  CA  . GLU A 219 ? 1.5082 0.8707 0.9647 0.2310  0.1436  -0.0824 289 GLU A CA  
1644 C  C   . GLU A 219 ? 1.5914 0.9406 1.0520 0.2354  0.1623  -0.0829 289 GLU A C   
1645 O  O   . GLU A 219 ? 1.5848 0.9355 1.0692 0.2452  0.1711  -0.0794 289 GLU A O   
1646 C  CB  . GLU A 219 ? 1.4943 0.8853 0.9762 0.2392  0.1302  -0.0749 289 GLU A CB  
1647 C  CG  . GLU A 219 ? 1.6163 1.0146 1.0963 0.2352  0.1187  -0.0746 289 GLU A CG  
1648 C  CD  . GLU A 219 ? 1.9004 1.2806 1.3736 0.2347  0.1277  -0.0755 289 GLU A CD  
1649 O  OE1 . GLU A 219 ? 1.8672 1.2358 1.3441 0.2437  0.1374  -0.0714 289 GLU A OE1 
1650 O  OE2 . GLU A 219 ? 1.8253 1.2016 1.2922 0.2251  0.1255  -0.0813 289 GLU A OE2 
1651 N  N   . GLY A 220 ? 1.5821 0.9135 1.0180 0.2282  0.1690  -0.0879 290 GLY A N   
1652 C  CA  . GLY A 220 ? 1.6075 0.9209 1.0450 0.2301  0.1921  -0.0900 290 GLY A CA  
1653 C  C   . GLY A 220 ? 1.6506 0.9859 1.1178 0.2361  0.1916  -0.0867 290 GLY A C   
1654 O  O   . GLY A 220 ? 1.6099 0.9770 1.1065 0.2432  0.1747  -0.0812 290 GLY A O   
1655 N  N   . PHE A 221 ? 1.6470 0.9615 1.1028 0.2325  0.2109  -0.0907 291 PHE A N   
1656 C  CA  . PHE A 221 ? 1.6356 0.9670 1.1206 0.2367  0.2149  -0.0896 291 PHE A CA  
1657 C  C   . PHE A 221 ? 1.6727 1.0335 1.2224 0.2497  0.2163  -0.0875 291 PHE A C   
1658 O  O   . PHE A 221 ? 1.6351 1.0269 1.2161 0.2559  0.2005  -0.0841 291 PHE A O   
1659 C  CB  . PHE A 221 ? 1.7003 0.9937 1.1568 0.2293  0.2425  -0.0955 291 PHE A CB  
1660 C  CG  . PHE A 221 ? 1.7059 1.0151 1.2001 0.2331  0.2527  -0.0961 291 PHE A CG  
1661 C  CD1 . PHE A 221 ? 1.7431 1.0536 1.2156 0.2290  0.2430  -0.0944 291 PHE A CD1 
1662 C  CD2 . PHE A 221 ? 1.7220 1.0451 1.2779 0.2412  0.2709  -0.0994 291 PHE A CD2 
1663 C  CE1 . PHE A 221 ? 1.7413 1.0661 1.2507 0.2319  0.2540  -0.0958 291 PHE A CE1 
1664 C  CE2 . PHE A 221 ? 1.7425 1.0837 1.3425 0.2447  0.2787  -0.1018 291 PHE A CE2 
1665 C  CZ  . PHE A 221 ? 1.7167 1.0576 1.2918 0.2394  0.2723  -0.1000 291 PHE A CZ  
1666 N  N   . VAL A 222 ? 1.6595 1.0070 1.2290 0.2539  0.2353  -0.0909 292 VAL A N   
1667 C  CA  . VAL A 222 ? 1.6461 1.0144 1.2784 0.2675  0.2357  -0.0911 292 VAL A CA  
1668 C  C   . VAL A 222 ? 1.6807 1.0756 1.3269 0.2773  0.2046  -0.0837 292 VAL A C   
1669 O  O   . VAL A 222 ? 1.6529 1.0732 1.3407 0.2869  0.1911  -0.0825 292 VAL A O   
1670 C  CB  . VAL A 222 ? 1.7233 1.0685 1.3736 0.2699  0.2625  -0.0971 292 VAL A CB  
1671 C  CG1 . VAL A 222 ? 1.7421 1.0631 1.3467 0.2645  0.2637  -0.0955 292 VAL A CG1 
1672 C  CG2 . VAL A 222 ? 1.7033 1.0710 1.4255 0.2863  0.2567  -0.0984 292 VAL A CG2 
1673 N  N   . LYS A 223 ? 1.6537 1.0399 1.2650 0.2747  0.1939  -0.0795 293 LYS A N   
1674 C  CA  . LYS A 223 ? 1.6403 1.0414 1.2560 0.2832  0.1693  -0.0725 293 LYS A CA  
1675 C  C   . LYS A 223 ? 1.6806 1.1053 1.2937 0.2821  0.1485  -0.0684 293 LYS A C   
1676 O  O   . LYS A 223 ? 1.6605 1.1005 1.2954 0.2930  0.1304  -0.0641 293 LYS A O   
1677 C  CB  . LYS A 223 ? 1.6874 1.0690 1.2647 0.2775  0.1697  -0.0709 293 LYS A CB  
1678 C  CG  . LYS A 223 ? 1.8505 1.2357 1.4272 0.2865  0.1513  -0.0640 293 LYS A CG  
1679 C  CD  . LYS A 223 ? 1.9780 1.3492 1.5162 0.2767  0.1509  -0.0635 293 LYS A CD  
1680 C  CE  . LYS A 223 ? 2.1299 1.4748 1.6547 0.2738  0.1688  -0.0670 293 LYS A CE  
1681 N  NZ  . LYS A 223 ? 2.2457 1.5778 1.7397 0.2637  0.1689  -0.0686 293 LYS A NZ  
1682 N  N   . ALA A 224 ? 1.6498 1.0741 1.2346 0.2698  0.1495  -0.0702 294 ALA A N   
1683 C  CA  . ALA A 224 ? 1.6308 1.0767 1.2131 0.2679  0.1307  -0.0668 294 ALA A CA  
1684 C  C   . ALA A 224 ? 1.6796 1.1476 1.3014 0.2757  0.1262  -0.0666 294 ALA A C   
1685 O  O   . ALA A 224 ? 1.6549 1.1422 1.2874 0.2813  0.1066  -0.0621 294 ALA A O   
1686 C  CB  . ALA A 224 ? 1.6477 1.0842 1.1926 0.2542  0.1315  -0.0699 294 ALA A CB  
1687 N  N   . THR A 225 ? 1.6593 1.1230 1.3029 0.2756  0.1452  -0.0722 295 THR A N   
1688 C  CA  . THR A 225 ? 1.6450 1.1319 1.3349 0.2829  0.1410  -0.0739 295 THR A CA  
1689 C  C   . THR A 225 ? 1.6982 1.1987 1.4333 0.2989  0.1261  -0.0730 295 THR A C   
1690 O  O   . THR A 225 ? 1.6729 1.1948 1.4306 0.3063  0.1053  -0.0709 295 THR A O   
1691 C  CB  . THR A 225 ? 1.7733 1.2476 1.4774 0.2775  0.1702  -0.0818 295 THR A CB  
1692 O  OG1 . THR A 225 ? 1.7856 1.2432 1.4395 0.2645  0.1768  -0.0815 295 THR A OG1 
1693 C  CG2 . THR A 225 ? 1.7412 1.2388 1.5064 0.2852  0.1706  -0.0866 295 THR A CG2 
1694 N  N   . THR A 226 ? 1.6839 1.1687 1.4292 0.3046  0.1351  -0.0749 296 THR A N   
1695 C  CA  . THR A 226 ? 1.6864 1.1773 1.4730 0.3216  0.1191  -0.0749 296 THR A CA  
1696 C  C   . THR A 226 ? 1.7453 1.2346 1.5036 0.3287  0.0908  -0.0659 296 THR A C   
1697 O  O   . THR A 226 ? 1.7362 1.2354 1.5201 0.3420  0.0670  -0.0648 296 THR A O   
1698 C  CB  . THR A 226 ? 1.8168 1.2891 1.6240 0.3261  0.1376  -0.0799 296 THR A CB  
1699 O  OG1 . THR A 226 ? 1.8316 1.2798 1.5861 0.3151  0.1528  -0.0773 296 THR A OG1 
1700 C  CG2 . THR A 226 ? 1.8041 1.2797 1.6651 0.3258  0.1624  -0.0911 296 THR A CG2 
1701 N  N   . VAL A 227 ? 1.7187 1.1918 1.4240 0.3197  0.0939  -0.0606 297 VAL A N   
1702 C  CA  . VAL A 227 ? 1.7273 1.1908 1.4008 0.3242  0.0748  -0.0530 297 VAL A CA  
1703 C  C   . VAL A 227 ? 1.7677 1.2436 1.4155 0.3150  0.0655  -0.0495 297 VAL A C   
1704 O  O   . VAL A 227 ? 1.7618 1.2392 1.4030 0.3221  0.0457  -0.0448 297 VAL A O   
1705 C  CB  . VAL A 227 ? 1.8025 1.2377 1.4422 0.3214  0.0858  -0.0509 297 VAL A CB  
1706 C  CG1 . VAL A 227 ? 1.8162 1.2342 1.4241 0.3276  0.0696  -0.0435 297 VAL A CG1 
1707 C  CG2 . VAL A 227 ? 1.8175 1.2402 1.4847 0.3300  0.0974  -0.0548 297 VAL A CG2 
1708 N  N   . GLY A 228 ? 1.7238 1.2027 1.3528 0.2999  0.0790  -0.0522 298 GLY A N   
1709 C  CA  . GLY A 228 ? 1.7082 1.1996 1.3179 0.2904  0.0709  -0.0505 298 GLY A CA  
1710 C  C   . GLY A 228 ? 1.7438 1.2591 1.3805 0.2952  0.0588  -0.0502 298 GLY A C   
1711 O  O   . GLY A 228 ? 1.7279 1.2523 1.3542 0.2942  0.0446  -0.0466 298 GLY A O   
1712 N  N   . GLN A 229 ? 1.7013 1.2250 1.3774 0.3016  0.0648  -0.0548 299 GLN A N   
1713 C  CA  . GLN A 229 ? 1.6831 1.2293 1.3951 0.3068  0.0556  -0.0569 299 GLN A CA  
1714 C  C   . GLN A 229 ? 1.7258 1.2804 1.4228 0.2939  0.0636  -0.0580 299 GLN A C   
1715 O  O   . GLN A 229 ? 1.7043 1.2774 1.4235 0.2959  0.0561  -0.0590 299 GLN A O   
1716 C  CB  . GLN A 229 ? 1.6953 1.2487 1.4083 0.3169  0.0283  -0.0518 299 GLN A CB  
1717 C  CG  . GLN A 229 ? 1.9216 1.4521 1.6174 0.3267  0.0187  -0.0476 299 GLN A CG  
1718 C  CD  . GLN A 229 ? 2.1685 1.6978 1.8541 0.3349  -0.0055 -0.0431 299 GLN A CD  
1719 O  OE1 . GLN A 229 ? 2.1069 1.6498 1.8276 0.3448  -0.0210 -0.0461 299 GLN A OE1 
1720 N  NE2 . GLN A 229 ? 2.0785 1.5900 1.7176 0.3300  -0.0069 -0.0372 299 GLN A NE2 
1721 N  N   . MET A 230 ? 1.6971 1.2366 1.3564 0.2816  0.0759  -0.0585 300 MET A N   
1722 C  CA  . MET A 230 ? 1.6934 1.2337 1.3313 0.2703  0.0803  -0.0599 300 MET A CA  
1723 C  C   . MET A 230 ? 1.7458 1.2898 1.4084 0.2702  0.0944  -0.0646 300 MET A C   
1724 O  O   . MET A 230 ? 1.7272 1.2836 1.3903 0.2672  0.0886  -0.0640 300 MET A O   
1725 C  CB  . MET A 230 ? 1.7459 1.2613 1.3422 0.2596  0.0900  -0.0620 300 MET A CB  
1726 C  CG  . MET A 230 ? 1.7927 1.3067 1.3612 0.2499  0.0837  -0.0627 300 MET A CG  
1727 S  SD  . MET A 230 ? 1.8288 1.3562 1.3869 0.2466  0.0616  -0.0596 300 MET A SD  
1728 C  CE  . MET A 230 ? 1.7861 1.3143 1.3267 0.2387  0.0541  -0.0617 300 MET A CE  
1729 N  N   . GLY A 231 ? 1.7224 1.2546 1.4073 0.2733  0.1144  -0.0698 301 GLY A N   
1730 C  CA  . GLY A 231 ? 1.7252 1.2574 1.4417 0.2730  0.1343  -0.0765 301 GLY A CA  
1731 C  C   . GLY A 231 ? 1.7487 1.3121 1.5189 0.2827  0.1194  -0.0777 301 GLY A C   
1732 O  O   . GLY A 231 ? 1.7361 1.3086 1.5202 0.2796  0.1246  -0.0805 301 GLY A O   
1733 N  N   . TRP A 232 ? 1.6947 1.2714 1.4907 0.2948  0.0987  -0.0757 302 TRP A N   
1734 C  CA  . TRP A 232 ? 1.6716 1.2739 1.5118 0.3057  0.0766  -0.0768 302 TRP A CA  
1735 C  C   . TRP A 232 ? 1.6921 1.3072 1.5030 0.3007  0.0594  -0.0705 302 TRP A C   
1736 O  O   . TRP A 232 ? 1.6722 1.3055 1.5118 0.3021  0.0544  -0.0735 302 TRP A O   
1737 C  CB  . TRP A 232 ? 1.6635 1.2649 1.5210 0.3204  0.0555  -0.0753 302 TRP A CB  
1738 C  CG  . TRP A 232 ? 1.6677 1.2785 1.5141 0.3281  0.0229  -0.0691 302 TRP A CG  
1739 C  CD1 . TRP A 232 ? 1.7142 1.3115 1.5110 0.3279  0.0094  -0.0603 302 TRP A CD1 
1740 C  CD2 . TRP A 232 ? 1.6534 1.2842 1.5379 0.3370  0.0015  -0.0724 302 TRP A CD2 
1741 N  NE1 . TRP A 232 ? 1.7035 1.3069 1.4991 0.3360  -0.0174 -0.0572 302 TRP A NE1 
1742 C  CE2 . TRP A 232 ? 1.7085 1.3332 1.5564 0.3419  -0.0249 -0.0644 302 TRP A CE2 
1743 C  CE3 . TRP A 232 ? 1.6585 1.3098 1.6052 0.3405  0.0035  -0.0825 302 TRP A CE3 
1744 C  CZ2 . TRP A 232 ? 1.6944 1.3310 1.5596 0.3503  -0.0511 -0.0654 302 TRP A CZ2 
1745 C  CZ3 . TRP A 232 ? 1.6663 1.3336 1.6378 0.3495  -0.0244 -0.0844 302 TRP A CZ3 
1746 C  CH2 . TRP A 232 ? 1.6835 1.3424 1.6120 0.3548  -0.0528 -0.0756 302 TRP A CH2 
1747 N  N   . PHE A 233 ? 1.6424 1.2469 1.4003 0.2931  0.0551  -0.0636 303 PHE A N   
1748 C  CA  . PHE A 233 ? 1.6222 1.2350 1.3501 0.2869  0.0414  -0.0582 303 PHE A CA  
1749 C  C   . PHE A 233 ? 1.6565 1.2692 1.3735 0.2764  0.0546  -0.0605 303 PHE A C   
1750 O  O   . PHE A 233 ? 1.6361 1.2602 1.3419 0.2725  0.0438  -0.0577 303 PHE A O   
1751 C  CB  . PHE A 233 ? 1.6557 1.2525 1.3399 0.2820  0.0378  -0.0534 303 PHE A CB  
1752 C  CG  . PHE A 233 ? 1.6673 1.2673 1.3213 0.2720  0.0313  -0.0508 303 PHE A CG  
1753 C  CD1 . PHE A 233 ? 1.7130 1.3057 1.3471 0.2618  0.0408  -0.0533 303 PHE A CD1 
1754 C  CD2 . PHE A 233 ? 1.6863 1.2930 1.3313 0.2731  0.0155  -0.0465 303 PHE A CD2 
1755 C  CE1 . PHE A 233 ? 1.7167 1.3146 1.3317 0.2543  0.0309  -0.0522 303 PHE A CE1 
1756 C  CE2 . PHE A 233 ? 1.7138 1.3254 1.3408 0.2639  0.0106  -0.0458 303 PHE A CE2 
1757 C  CZ  . PHE A 233 ? 1.6909 1.3006 1.3067 0.2551  0.0165  -0.0489 303 PHE A CZ  
1758 N  N   . PHE A 234 ? 1.6215 1.2175 1.3404 0.2724  0.0790  -0.0658 304 PHE A N   
1759 C  CA  . PHE A 234 ? 1.6262 1.2091 1.3246 0.2629  0.0953  -0.0682 304 PHE A CA  
1760 C  C   . PHE A 234 ? 1.6401 1.2447 1.3698 0.2646  0.0917  -0.0698 304 PHE A C   
1761 O  O   . PHE A 234 ? 1.6378 1.2359 1.3426 0.2575  0.0949  -0.0688 304 PHE A O   
1762 C  CB  . PHE A 234 ? 1.6808 1.2356 1.3788 0.2600  0.1259  -0.0746 304 PHE A CB  
1763 C  CG  . PHE A 234 ? 1.7260 1.2571 1.4037 0.2516  0.1493  -0.0784 304 PHE A CG  
1764 C  CD1 . PHE A 234 ? 1.7600 1.3016 1.4811 0.2532  0.1635  -0.0840 304 PHE A CD1 
1765 C  CD2 . PHE A 234 ? 1.7884 1.2822 1.4021 0.2424  0.1571  -0.0773 304 PHE A CD2 
1766 C  CE1 . PHE A 234 ? 1.8011 1.3143 1.4974 0.2449  0.1884  -0.0873 304 PHE A CE1 
1767 C  CE2 . PHE A 234 ? 1.8576 1.3195 1.4409 0.2353  0.1782  -0.0801 304 PHE A CE2 
1768 C  CZ  . PHE A 234 ? 1.8279 1.2985 1.4506 0.2363  0.1957  -0.0846 304 PHE A CZ  
1769 N  N   . LEU A 235 ? 1.5667 1.1940 1.3513 0.2746  0.0845  -0.0732 305 LEU A N   
1770 C  CA  . LEU A 235 ? 1.5393 1.1902 1.3624 0.2776  0.0780  -0.0762 305 LEU A CA  
1771 C  C   . LEU A 235 ? 1.5600 1.2238 1.3563 0.2741  0.0581  -0.0695 305 LEU A C   
1772 O  O   . LEU A 235 ? 1.5473 1.2187 1.3533 0.2706  0.0627  -0.0715 305 LEU A O   
1773 C  CB  . LEU A 235 ? 1.5262 1.1982 1.4096 0.2909  0.0627  -0.0812 305 LEU A CB  
1774 C  CG  . LEU A 235 ? 1.5850 1.2572 1.4620 0.3012  0.0379  -0.0764 305 LEU A CG  
1775 C  CD1 . LEU A 235 ? 1.5858 1.2496 1.4042 0.2964  0.0253  -0.0663 305 LEU A CD1 
1776 C  CD2 . LEU A 235 ? 1.6066 1.2975 1.5242 0.3137  0.0116  -0.0791 305 LEU A CD2 
1777 N  N   . MET A 236 ? 1.5032 1.1676 1.2685 0.2746  0.0386  -0.0625 306 MET A N   
1778 C  CA  . MET A 236 ? 1.4818 1.1569 1.2251 0.2710  0.0215  -0.0571 306 MET A CA  
1779 C  C   . MET A 236 ? 1.5276 1.1924 1.2405 0.2606  0.0309  -0.0565 306 MET A C   
1780 O  O   . MET A 236 ? 1.5083 1.1858 1.2264 0.2587  0.0254  -0.0558 306 MET A O   
1781 C  CB  . MET A 236 ? 1.5123 1.1827 1.2294 0.2720  0.0069  -0.0517 306 MET A CB  
1782 C  CG  . MET A 236 ? 1.5470 1.2251 1.2434 0.2663  -0.0054 -0.0477 306 MET A CG  
1783 S  SD  . MET A 236 ? 1.6110 1.2736 1.2710 0.2602  -0.0080 -0.0450 306 MET A SD  
1784 C  CE  . MET A 236 ? 1.5763 1.2340 1.2429 0.2695  -0.0138 -0.0431 306 MET A CE  
1785 N  N   . ALA A 237 ? 1.5018 1.1403 1.1809 0.2546  0.0436  -0.0571 307 ALA A N   
1786 C  CA  . ALA A 237 ? 1.5139 1.1325 1.1550 0.2461  0.0492  -0.0570 307 ALA A CA  
1787 C  C   . ALA A 237 ? 1.5592 1.1732 1.2126 0.2449  0.0663  -0.0603 307 ALA A C   
1788 O  O   . ALA A 237 ? 1.5528 1.1669 1.1916 0.2413  0.0613  -0.0587 307 ALA A O   
1789 C  CB  . ALA A 237 ? 1.5568 1.1420 1.1586 0.2414  0.0589  -0.0585 307 ALA A CB  
1790 N  N   . VAL A 238 ? 1.5132 1.1254 1.2004 0.2484  0.0863  -0.0658 308 VAL A N   
1791 C  CA  . VAL A 238 ? 1.5139 1.1217 1.2246 0.2469  0.1082  -0.0715 308 VAL A CA  
1792 C  C   . VAL A 238 ? 1.5199 1.1600 1.2630 0.2498  0.0931  -0.0708 308 VAL A C   
1793 O  O   . VAL A 238 ? 1.5227 1.1539 1.2521 0.2448  0.1016  -0.0710 308 VAL A O   
1794 C  CB  . VAL A 238 ? 1.5727 1.1760 1.3270 0.2504  0.1323  -0.0798 308 VAL A CB  
1795 C  CG1 . VAL A 238 ? 1.5749 1.1780 1.3677 0.2486  0.1567  -0.0880 308 VAL A CG1 
1796 C  CG2 . VAL A 238 ? 1.6097 1.1732 1.3227 0.2455  0.1525  -0.0807 308 VAL A CG2 
1797 N  N   . MET A 239 ? 1.4396 1.1114 1.2164 0.2576  0.0697  -0.0695 309 MET A N   
1798 C  CA  . MET A 239 ? 1.4067 1.1076 1.2126 0.2610  0.0527  -0.0693 309 MET A CA  
1799 C  C   . MET A 239 ? 1.4443 1.1452 1.2135 0.2548  0.0426  -0.0632 309 MET A C   
1800 O  O   . MET A 239 ? 1.4303 1.1398 1.2129 0.2529  0.0456  -0.0649 309 MET A O   
1801 C  CB  . MET A 239 ? 1.4169 1.1388 1.2481 0.2707  0.0278  -0.0682 309 MET A CB  
1802 C  CG  . MET A 239 ? 1.4636 1.1929 1.3493 0.2796  0.0312  -0.0765 309 MET A CG  
1803 S  SD  . MET A 239 ? 1.5047 1.2504 1.4106 0.2932  -0.0048 -0.0751 309 MET A SD  
1804 C  CE  . MET A 239 ? 1.4758 1.2009 1.3243 0.2917  -0.0102 -0.0656 309 MET A CE  
1805 N  N   . TYR A 240 ? 1.4019 1.0920 1.1282 0.2513  0.0318  -0.0574 310 TYR A N   
1806 C  CA  . TYR A 240 ? 1.3938 1.0832 1.0903 0.2459  0.0203  -0.0531 310 TYR A CA  
1807 C  C   . TYR A 240 ? 1.4541 1.1201 1.1256 0.2402  0.0351  -0.0542 310 TYR A C   
1808 O  O   . TYR A 240 ? 1.4395 1.1138 1.1123 0.2385  0.0302  -0.0530 310 TYR A O   
1809 C  CB  . TYR A 240 ? 1.4156 1.0970 1.0811 0.2433  0.0072  -0.0497 310 TYR A CB  
1810 C  CG  . TYR A 240 ? 1.4183 1.1207 1.0986 0.2468  -0.0099 -0.0471 310 TYR A CG  
1811 C  CD1 . TYR A 240 ? 1.4349 1.1496 1.1439 0.2546  -0.0127 -0.0478 310 TYR A CD1 
1812 C  CD2 . TYR A 240 ? 1.4226 1.1273 1.0873 0.2426  -0.0227 -0.0450 310 TYR A CD2 
1813 C  CE1 . TYR A 240 ? 1.4368 1.1597 1.1472 0.2581  -0.0275 -0.0450 310 TYR A CE1 
1814 C  CE2 . TYR A 240 ? 1.4218 1.1374 1.0943 0.2448  -0.0328 -0.0431 310 TYR A CE2 
1815 C  CZ  . TYR A 240 ? 1.5133 1.2349 1.2030 0.2526  -0.0349 -0.0424 310 TYR A CZ  
1816 O  OH  . TYR A 240 ? 1.5241 1.2458 1.2101 0.2554  -0.0443 -0.0401 310 TYR A OH  
1817 N  N   . ILE A 241 ? 1.4343 1.0677 1.0829 0.2377  0.0555  -0.0569 311 ILE A N   
1818 C  CA  . ILE A 241 ? 1.4644 1.0617 1.0773 0.2325  0.0739  -0.0582 311 ILE A CA  
1819 C  C   . ILE A 241 ? 1.4938 1.1000 1.1422 0.2327  0.0920  -0.0623 311 ILE A C   
1820 O  O   . ILE A 241 ? 1.5032 1.0938 1.1291 0.2292  0.0969  -0.0612 311 ILE A O   
1821 C  CB  . ILE A 241 ? 1.5513 1.1033 1.1230 0.2292  0.0933  -0.0605 311 ILE A CB  
1822 C  CG1 . ILE A 241 ? 1.5667 1.1069 1.0989 0.2280  0.0719  -0.0574 311 ILE A CG1 
1823 C  CG2 . ILE A 241 ? 1.6116 1.1156 1.1413 0.2241  0.1186  -0.0625 311 ILE A CG2 
1824 C  CD1 . ILE A 241 ? 1.6542 1.1958 1.1604 0.2264  0.0449  -0.0538 311 ILE A CD1 
1825 N  N   . THR A 242 ? 1.4202 1.0504 1.1262 0.2373  0.1004  -0.0679 312 THR A N   
1826 C  CA  . THR A 242 ? 1.4055 1.0490 1.1594 0.2379  0.1163  -0.0747 312 THR A CA  
1827 C  C   . THR A 242 ? 1.4157 1.0863 1.1804 0.2386  0.0963  -0.0714 312 THR A C   
1828 O  O   . THR A 242 ? 1.4207 1.0813 1.1845 0.2347  0.1113  -0.0736 312 THR A O   
1829 C  CB  . THR A 242 ? 1.4838 1.1528 1.3061 0.2447  0.1196  -0.0828 312 THR A CB  
1830 O  OG1 . THR A 242 ? 1.4948 1.1470 1.3078 0.2459  0.1278  -0.0837 312 THR A OG1 
1831 C  CG2 . THR A 242 ? 1.4724 1.1404 1.3436 0.2431  0.1479  -0.0937 312 THR A CG2 
1832 N  N   . GLY A 243 ? 1.3335 1.0318 1.1024 0.2426  0.0658  -0.0663 313 GLY A N   
1833 C  CA  . GLY A 243 ? 1.3020 1.0244 1.0778 0.2429  0.0461  -0.0629 313 GLY A CA  
1834 C  C   . GLY A 243 ? 1.3582 1.0603 1.0877 0.2369  0.0462  -0.0580 313 GLY A C   
1835 O  O   . GLY A 243 ? 1.3471 1.0544 1.0850 0.2351  0.0496  -0.0587 313 GLY A O   
1836 N  N   . ALA A 244 ? 1.3322 1.0080 1.0127 0.2342  0.0419  -0.0540 314 ALA A N   
1837 C  CA  . ALA A 244 ? 1.3508 1.0009 0.9834 0.2301  0.0364  -0.0502 314 ALA A CA  
1838 C  C   . ALA A 244 ? 1.4282 1.0430 1.0379 0.2268  0.0619  -0.0524 314 ALA A C   
1839 O  O   . ALA A 244 ? 1.4262 1.0364 1.0248 0.2253  0.0595  -0.0505 314 ALA A O   
1840 C  CB  . ALA A 244 ? 1.3826 1.0095 0.9732 0.2289  0.0249  -0.0481 314 ALA A CB  
1841 N  N   . GLY A 245 ? 1.4080 0.9970 1.0134 0.2255  0.0886  -0.0568 315 GLY A N   
1842 C  CA  . GLY A 245 ? 1.4458 0.9939 1.0295 0.2214  0.1212  -0.0603 315 GLY A CA  
1843 C  C   . GLY A 245 ? 1.4601 1.0339 1.0953 0.2211  0.1335  -0.0647 315 GLY A C   
1844 O  O   . GLY A 245 ? 1.4810 1.0301 1.0921 0.2178  0.1460  -0.0642 315 GLY A O   
1845 N  N   . LEU A 246 ? 1.3623 0.9856 1.0662 0.2254  0.1246  -0.0689 316 LEU A N   
1846 C  CA  . LEU A 246 ? 1.3300 0.9840 1.0932 0.2263  0.1302  -0.0751 316 LEU A CA  
1847 C  C   . LEU A 246 ? 1.3569 1.0271 1.1132 0.2258  0.1116  -0.0701 316 LEU A C   
1848 O  O   . LEU A 246 ? 1.3595 1.0244 1.1286 0.2227  0.1287  -0.0739 316 LEU A O   
1849 C  CB  . LEU A 246 ? 1.2913 0.9879 1.1226 0.2328  0.1182  -0.0811 316 LEU A CB  
1850 C  CG  . LEU A 246 ? 1.3480 1.0546 1.2473 0.2333  0.1423  -0.0944 316 LEU A CG  
1851 C  CD1 . LEU A 246 ? 1.3984 1.0587 1.2795 0.2262  0.1869  -0.1001 316 LEU A CD1 
1852 C  CD2 . LEU A 246 ? 1.3568 1.0910 1.3098 0.2413  0.1291  -0.1003 316 LEU A CD2 
1853 N  N   . TYR A 247 ? 1.2884 0.9749 1.0248 0.2280  0.0799  -0.0624 317 TYR A N   
1854 C  CA  . TYR A 247 ? 1.2650 0.9682 0.9983 0.2276  0.0617  -0.0581 317 TYR A CA  
1855 C  C   . TYR A 247 ? 1.3400 1.0042 1.0219 0.2235  0.0709  -0.0544 317 TYR A C   
1856 O  O   . TYR A 247 ? 1.3275 0.9981 1.0203 0.2221  0.0740  -0.0548 317 TYR A O   
1857 C  CB  . TYR A 247 ? 1.2551 0.9822 0.9847 0.2303  0.0302  -0.0526 317 TYR A CB  
1858 C  CG  . TYR A 247 ? 1.2987 1.0049 0.9789 0.2282  0.0160  -0.0465 317 TYR A CG  
1859 C  CD1 . TYR A 247 ? 1.3629 1.0323 0.9982 0.2271  0.0197  -0.0452 317 TYR A CD1 
1860 C  CD2 . TYR A 247 ? 1.2903 1.0128 0.9717 0.2278  -0.0031 -0.0433 317 TYR A CD2 
1861 C  CE1 . TYR A 247 ? 1.3964 1.0438 0.9895 0.2262  0.0028  -0.0417 317 TYR A CE1 
1862 C  CE2 . TYR A 247 ? 1.3192 1.0239 0.9651 0.2267  -0.0188 -0.0398 317 TYR A CE2 
1863 C  CZ  . TYR A 247 ? 1.4566 1.1239 1.0591 0.2263  -0.0178 -0.0394 317 TYR A CZ  
1864 O  OH  . TYR A 247 ? 1.4932 1.1414 1.0641 0.2264  -0.0381 -0.0379 317 TYR A OH  
1865 N  N   . ALA A 248 ? 1.3321 0.9519 0.9555 0.2221  0.0745  -0.0512 318 ALA A N   
1866 C  CA  . ALA A 248 ? 1.3760 0.9472 0.9378 0.2199  0.0785  -0.0474 318 ALA A CA  
1867 C  C   . ALA A 248 ? 1.4464 0.9893 1.0068 0.2162  0.1150  -0.0519 318 ALA A C   
1868 O  O   . ALA A 248 ? 1.4565 0.9836 0.9982 0.2150  0.1181  -0.0498 318 ALA A O   
1869 C  CB  . ALA A 248 ? 1.4316 0.9578 0.9315 0.2201  0.0729  -0.0449 318 ALA A CB  
1870 N  N   . ALA A 249 ? 1.4013 0.9421 0.9910 0.2145  0.1434  -0.0592 319 ALA A N   
1871 C  CA  . ALA A 249 ? 1.4238 0.9399 1.0265 0.2098  0.1845  -0.0666 319 ALA A CA  
1872 C  C   . ALA A 249 ? 1.4161 0.9770 1.0828 0.2099  0.1832  -0.0710 319 ALA A C   
1873 O  O   . ALA A 249 ? 1.4351 0.9729 1.0974 0.2058  0.2083  -0.0741 319 ALA A O   
1874 C  CB  . ALA A 249 ? 1.4406 0.9534 1.0751 0.2086  0.2107  -0.0751 319 ALA A CB  
1875 N  N   . ARG A 250 ? 1.3045 0.9247 1.0245 0.2145  0.1534  -0.0710 320 ARG A N   
1876 C  CA  . ARG A 250 ? 1.2573 0.9198 1.0360 0.2151  0.1475  -0.0757 320 ARG A CA  
1877 C  C   . ARG A 250 ? 1.2902 0.9629 1.1353 0.2135  0.1767  -0.0895 320 ARG A C   
1878 O  O   . ARG A 250 ? 1.2718 0.9621 1.1599 0.2118  0.1847  -0.0963 320 ARG A O   
1879 C  CB  . ARG A 250 ? 1.2742 0.9238 1.0206 0.2128  0.1435  -0.0700 320 ARG A CB  
1880 C  CG  . ARG A 250 ? 1.3692 1.0502 1.1112 0.2164  0.1048  -0.0623 320 ARG A CG  
1881 C  CD  . ARG A 250 ? 1.5304 1.1788 1.2113 0.2155  0.0962  -0.0539 320 ARG A CD  
1882 N  NE  . ARG A 250 ? 1.6252 1.2930 1.2942 0.2188  0.0610  -0.0474 320 ARG A NE  
1883 C  CZ  . ARG A 250 ? 1.8264 1.4809 1.4605 0.2197  0.0427  -0.0413 320 ARG A CZ  
1884 N  NH1 . ARG A 250 ? 1.7068 1.3256 1.3062 0.2184  0.0533  -0.0393 320 ARG A NH1 
1885 N  NH2 . ARG A 250 ? 1.6427 1.3171 1.2775 0.2219  0.0138  -0.0380 320 ARG A NH2 
1886 N  N   . ILE A 251 ? 1.2485 0.9125 1.1086 0.2141  0.1914  -0.0950 321 ILE A N   
1887 C  CA  . ILE A 251 ? 1.2359 0.9142 1.1726 0.2135  0.2164  -0.1105 321 ILE A CA  
1888 C  C   . ILE A 251 ? 1.2184 0.9560 1.2228 0.2217  0.1804  -0.1148 321 ILE A C   
1889 O  O   . ILE A 251 ? 1.1926 0.9457 1.1745 0.2271  0.1478  -0.1060 321 ILE A O   
1890 C  CB  . ILE A 251 ? 1.3104 0.9560 1.2395 0.2117  0.2449  -0.1152 321 ILE A CB  
1891 C  CG1 . ILE A 251 ? 1.3792 0.9577 1.2136 0.2057  0.2676  -0.1068 321 ILE A CG1 
1892 C  CG2 . ILE A 251 ? 1.3208 0.9732 1.3314 0.2096  0.2785  -0.1333 321 ILE A CG2 
1893 C  CD1 . ILE A 251 ? 1.5077 1.0540 1.3183 0.2049  0.2854  -0.1082 321 ILE A CD1 
1894 N  N   . PRO A 252 ? 1.1474 0.9135 1.2327 0.2229  0.1861  -0.1292 322 PRO A N   
1895 C  CA  . PRO A 252 ? 1.1627 0.9162 1.2935 0.2163  0.2265  -0.1433 322 PRO A CA  
1896 C  C   . PRO A 252 ? 1.2087 0.9583 1.3260 0.2109  0.2330  -0.1415 322 PRO A C   
1897 O  O   . PRO A 252 ? 1.2199 0.9582 1.3757 0.2048  0.2680  -0.1538 322 PRO A O   
1898 C  CB  . PRO A 252 ? 1.1556 0.9505 1.3883 0.2227  0.2163  -0.1604 322 PRO A CB  
1899 C  CG  . PRO A 252 ? 1.1712 1.0049 1.4027 0.2319  0.1626  -0.1529 322 PRO A CG  
1900 C  CD  . PRO A 252 ? 1.1235 0.9374 1.2648 0.2321  0.1478  -0.1337 322 PRO A CD  
1901 N  N   . GLU A 253 ? 1.1453 0.9043 1.2134 0.2130  0.2011  -0.1275 323 GLU A N   
1902 C  CA  . GLU A 253 ? 1.1400 0.8984 1.1945 0.2090  0.2020  -0.1247 323 GLU A CA  
1903 C  C   . GLU A 253 ? 1.2395 0.9434 1.2474 0.2007  0.2442  -0.1236 323 GLU A C   
1904 O  O   . GLU A 253 ? 1.2370 0.9393 1.2697 0.1960  0.2632  -0.1303 323 GLU A O   
1905 C  CB  . GLU A 253 ? 1.1343 0.9077 1.1430 0.2124  0.1633  -0.1102 323 GLU A CB  
1906 C  CG  . GLU A 253 ? 1.2316 1.0395 1.2556 0.2201  0.1256  -0.1074 323 GLU A CG  
1907 C  CD  . GLU A 253 ? 1.5086 1.2920 1.4726 0.2213  0.1204  -0.0966 323 GLU A CD  
1908 O  OE1 . GLU A 253 ? 1.4824 1.2253 1.3843 0.2171  0.1352  -0.0890 323 GLU A OE1 
1909 O  OE2 . GLU A 253 ? 1.4067 1.2087 1.3892 0.2269  0.1022  -0.0975 323 GLU A OE2 
1910 N  N   . ARG A 254 ? 1.2425 0.8975 1.1808 0.1988  0.2595  -0.1158 324 ARG A N   
1911 C  CA  . ARG A 254 ? 1.3061 0.8943 1.1828 0.1916  0.2999  -0.1140 324 ARG A CA  
1912 C  C   . ARG A 254 ? 1.3809 0.9553 1.3155 0.1845  0.3499  -0.1313 324 ARG A C   
1913 O  O   . ARG A 254 ? 1.4077 0.9491 1.3235 0.1783  0.3787  -0.1332 324 ARG A O   
1914 C  CB  . ARG A 254 ? 1.3552 0.8934 1.1539 0.1918  0.3051  -0.1054 324 ARG A CB  
1915 C  CG  . ARG A 254 ? 1.5570 1.0148 1.2847 0.1848  0.3493  -0.1048 324 ARG A CG  
1916 C  CD  . ARG A 254 ? 1.7069 1.1140 1.3638 0.1849  0.3555  -0.0991 324 ARG A CD  
1917 N  NE  . ARG A 254 ? 1.8504 1.1965 1.3998 0.1855  0.3466  -0.0861 324 ARG A NE  
1918 C  CZ  . ARG A 254 ? 2.0049 1.3609 1.5110 0.1918  0.3002  -0.0739 324 ARG A CZ  
1919 N  NH1 . ARG A 254 ? 1.7642 1.1928 1.3266 0.1972  0.2601  -0.0722 324 ARG A NH1 
1920 N  NH2 . ARG A 254 ? 1.8944 1.1907 1.3075 0.1931  0.2915  -0.0643 324 ARG A NH2 
1921 N  N   . PHE A 255 ? 1.3254 0.9245 1.3339 0.1855  0.3599  -0.1449 325 PHE A N   
1922 C  CA  . PHE A 255 ? 1.3444 0.9331 1.4222 0.1788  0.4083  -0.1645 325 PHE A CA  
1923 C  C   . PHE A 255 ? 1.3606 0.9930 1.5222 0.1779  0.4052  -0.1771 325 PHE A C   
1924 O  O   . PHE A 255 ? 1.3860 0.9929 1.5748 0.1695  0.4507  -0.1895 325 PHE A O   
1925 C  CB  . PHE A 255 ? 1.3605 0.9617 1.4924 0.1814  0.4161  -0.1752 325 PHE A CB  
1926 C  CG  . PHE A 255 ? 1.4188 0.9744 1.4649 0.1817  0.4198  -0.1629 325 PHE A CG  
1927 C  CD1 . PHE A 255 ? 1.5298 1.0078 1.4821 0.1743  0.4566  -0.1561 325 PHE A CD1 
1928 C  CD2 . PHE A 255 ? 1.4140 1.0003 1.4688 0.1899  0.3849  -0.1584 325 PHE A CD2 
1929 C  CE1 . PHE A 255 ? 1.5816 1.0149 1.4510 0.1750  0.4561  -0.1455 325 PHE A CE1 
1930 C  CE2 . PHE A 255 ? 1.4855 1.0299 1.4631 0.1898  0.3881  -0.1482 325 PHE A CE2 
1931 C  CZ  . PHE A 255 ? 1.5333 1.0024 1.4183 0.1825  0.4218  -0.1418 325 PHE A CZ  
1932 N  N   . PHE A 256 ? 1.2593 0.9536 1.4599 0.1863  0.3530  -0.1749 326 PHE A N   
1933 C  CA  . PHE A 256 ? 1.2225 0.9607 1.5039 0.1865  0.3432  -0.1878 326 PHE A CA  
1934 C  C   . PHE A 256 ? 1.2455 1.0064 1.4889 0.1900  0.3027  -0.1741 326 PHE A C   
1935 O  O   . PHE A 256 ? 1.1932 1.0035 1.4752 0.1977  0.2587  -0.1752 326 PHE A O   
1936 C  CB  . PHE A 256 ? 1.2065 0.9961 1.5979 0.1931  0.3246  -0.2062 326 PHE A CB  
1937 C  CG  . PHE A 256 ? 1.2549 1.0252 1.7012 0.1891  0.3684  -0.2233 326 PHE A CG  
1938 C  CD1 . PHE A 256 ? 1.3170 1.0629 1.7257 0.1909  0.3756  -0.2171 326 PHE A CD1 
1939 C  CD2 . PHE A 256 ? 1.2880 1.0665 1.8313 0.1835  0.4020  -0.2473 326 PHE A CD2 
1940 C  CE1 . PHE A 256 ? 1.3576 1.0820 1.8160 0.1864  0.4200  -0.2332 326 PHE A CE1 
1941 C  CE2 . PHE A 256 ? 1.3504 1.1112 1.9529 0.1793  0.4453  -0.2650 326 PHE A CE2 
1942 C  CZ  . PHE A 256 ? 1.3495 1.0824 1.9078 0.1807  0.4548  -0.2575 326 PHE A CZ  
1943 N  N   . PRO A 257 ? 1.2351 0.9563 1.4014 0.1847  0.3173  -0.1618 327 PRO A N   
1944 C  CA  . PRO A 257 ? 1.2051 0.9476 1.3414 0.1876  0.2817  -0.1500 327 PRO A CA  
1945 C  C   . PRO A 257 ? 1.2128 1.0060 1.4303 0.1887  0.2645  -0.1625 327 PRO A C   
1946 O  O   . PRO A 257 ? 1.2154 1.0102 1.4961 0.1832  0.2945  -0.1794 327 PRO A O   
1947 C  CB  . PRO A 257 ? 1.2777 0.9631 1.3364 0.1811  0.3106  -0.1405 327 PRO A CB  
1948 C  CG  . PRO A 257 ? 1.3906 1.0197 1.4058 0.1773  0.3474  -0.1403 327 PRO A CG  
1949 C  CD  . PRO A 257 ? 1.3198 0.9723 1.4269 0.1760  0.3677  -0.1597 327 PRO A CD  
1950 N  N   . GLY A 258 ? 1.1287 0.9598 1.3439 0.1954  0.2172  -0.1553 328 GLY A N   
1951 C  CA  . GLY A 258 ? 1.0892 0.9646 1.3686 0.1976  0.1936  -0.1657 328 GLY A CA  
1952 C  C   . GLY A 258 ? 1.1118 1.0240 1.4768 0.2038  0.1753  -0.1826 328 GLY A C   
1953 O  O   . GLY A 258 ? 1.0808 1.0271 1.4977 0.2071  0.1497  -0.1924 328 GLY A O   
1954 N  N   . LYS A 259 ? 1.0785 0.9820 1.4580 0.2063  0.1856  -0.1867 329 LYS A N   
1955 C  CA  . LYS A 259 ? 1.0565 0.9911 1.5176 0.2138  0.1666  -0.2030 329 LYS A CA  
1956 C  C   . LYS A 259 ? 1.0833 1.0305 1.5090 0.2241  0.1224  -0.1912 329 LYS A C   
1957 O  O   . LYS A 259 ? 1.0631 1.0363 1.5427 0.2331  0.0924  -0.2016 329 LYS A O   
1958 C  CB  . LYS A 259 ? 1.1155 1.0318 1.6254 0.2097  0.2099  -0.2176 329 LYS A CB  
1959 C  CG  . LYS A 259 ? 1.3119 1.2608 1.9238 0.2176  0.1932  -0.2386 329 LYS A CG  
1960 C  CD  . LYS A 259 ? 1.4368 1.4159 2.1454 0.2169  0.1894  -0.2612 329 LYS A CD  
1961 C  CE  . LYS A 259 ? 1.5734 1.5827 2.3875 0.2263  0.1684  -0.2837 329 LYS A CE  
1962 N  NZ  . LYS A 259 ? 1.7117 1.7020 2.5625 0.2231  0.2097  -0.2936 329 LYS A NZ  
1963 N  N   . PHE A 260 ? 1.0418 0.9679 1.3770 0.2230  0.1175  -0.1702 330 PHE A N   
1964 C  CA  . PHE A 260 ? 1.0253 0.9578 1.3206 0.2310  0.0818  -0.1584 330 PHE A CA  
1965 C  C   . PHE A 260 ? 1.0513 0.9877 1.2885 0.2312  0.0557  -0.1435 330 PHE A C   
1966 O  O   . PHE A 260 ? 1.0464 0.9742 1.2282 0.2337  0.0402  -0.1299 330 PHE A O   
1967 C  CB  . PHE A 260 ? 1.0704 0.9737 1.3199 0.2298  0.1004  -0.1496 330 PHE A CB  
1968 C  CG  . PHE A 260 ? 1.1041 1.0023 1.4114 0.2301  0.1262  -0.1645 330 PHE A CG  
1969 C  CD1 . PHE A 260 ? 1.1300 1.0516 1.4939 0.2395  0.1029  -0.1745 330 PHE A CD1 
1970 C  CD2 . PHE A 260 ? 1.1642 1.0298 1.4682 0.2211  0.1749  -0.1689 330 PHE A CD2 
1971 C  CE1 . PHE A 260 ? 1.1538 1.0723 1.5805 0.2399  0.1274  -0.1900 330 PHE A CE1 
1972 C  CE2 . PHE A 260 ? 1.2149 1.0740 1.5779 0.2202  0.2036  -0.1845 330 PHE A CE2 
1973 C  CZ  . PHE A 260 ? 1.1709 1.0594 1.5999 0.2297  0.1796  -0.1954 330 PHE A CZ  
1974 N  N   . ASP A 261 ? 0.9891 0.9383 1.2432 0.2282  0.0519  -0.1474 331 ASP A N   
1975 C  CA  . ASP A 261 ? 0.9721 0.9247 1.1783 0.2275  0.0309  -0.1353 331 ASP A CA  
1976 C  C   . ASP A 261 ? 1.0013 0.9660 1.1902 0.2353  -0.0084 -0.1302 331 ASP A C   
1977 O  O   . ASP A 261 ? 0.9956 0.9509 1.1267 0.2346  -0.0180 -0.1161 331 ASP A O   
1978 C  CB  . ASP A 261 ? 0.9865 0.9511 1.2222 0.2230  0.0352  -0.1427 331 ASP A CB  
1979 C  CG  . ASP A 261 ? 1.1215 1.0651 1.3568 0.2143  0.0768  -0.1447 331 ASP A CG  
1980 O  OD1 . ASP A 261 ? 1.1497 1.0639 1.3471 0.2115  0.1008  -0.1378 331 ASP A OD1 
1981 O  OD2 . ASP A 261 ? 1.1874 1.1395 1.4549 0.2101  0.0857  -0.1530 331 ASP A OD2 
1982 N  N   . ILE A 262 ? 0.9468 0.9283 1.1852 0.2429  -0.0305 -0.1424 332 ILE A N   
1983 C  CA  . ILE A 262 ? 0.9406 0.9248 1.1568 0.2511  -0.0680 -0.1385 332 ILE A CA  
1984 C  C   . ILE A 262 ? 0.9883 0.9661 1.2059 0.2589  -0.0771 -0.1385 332 ILE A C   
1985 O  O   . ILE A 262 ? 0.9878 0.9549 1.1570 0.2628  -0.0958 -0.1280 332 ILE A O   
1986 C  CB  . ILE A 262 ? 0.9774 0.9771 1.2307 0.2557  -0.0961 -0.1506 332 ILE A CB  
1987 C  CG1 . ILE A 262 ? 0.9960 0.9890 1.2277 0.2665  -0.1368 -0.1497 332 ILE A CG1 
1988 C  CG2 . ILE A 262 ? 0.9849 1.0021 1.3251 0.2564  -0.0878 -0.1713 332 ILE A CG2 
1989 C  CD1 . ILE A 262 ? 1.0981 1.0720 1.2533 0.2660  -0.1452 -0.1328 332 ILE A CD1 
1990 N  N   . TRP A 263 ? 0.9404 0.9234 1.2150 0.2609  -0.0630 -0.1509 333 TRP A N   
1991 C  CA  . TRP A 263 ? 0.9429 0.9206 1.2251 0.2691  -0.0726 -0.1521 333 TRP A CA  
1992 C  C   . TRP A 263 ? 0.9899 0.9558 1.2783 0.2644  -0.0365 -0.1520 333 TRP A C   
1993 O  O   . TRP A 263 ? 0.9842 0.9479 1.2974 0.2564  -0.0035 -0.1581 333 TRP A O   
1994 C  CB  . TRP A 263 ? 0.9292 0.9216 1.2780 0.2806  -0.1028 -0.1693 333 TRP A CB  
1995 C  CG  . TRP A 263 ? 0.9454 0.9411 1.2820 0.2867  -0.1422 -0.1706 333 TRP A CG  
1996 C  CD1 . TRP A 263 ? 0.9783 0.9897 1.3679 0.2887  -0.1576 -0.1859 333 TRP A CD1 
1997 C  CD2 . TRP A 263 ? 0.9555 0.9334 1.2226 0.2920  -0.1711 -0.1579 333 TRP A CD2 
1998 N  NE1 . TRP A 263 ? 0.9849 0.9870 1.3369 0.2953  -0.1959 -0.1828 333 TRP A NE1 
1999 C  CE2 . TRP A 263 ? 1.0146 0.9943 1.2897 0.2971  -0.2030 -0.1656 333 TRP A CE2 
2000 C  CE3 . TRP A 263 ? 0.9809 0.9384 1.1790 0.2923  -0.1713 -0.1415 333 TRP A CE3 
2001 C  CZ2 . TRP A 263 ? 1.0282 0.9847 1.2376 0.3021  -0.2321 -0.1566 333 TRP A CZ2 
2002 C  CZ3 . TRP A 263 ? 1.0175 0.9554 1.1577 0.2968  -0.1983 -0.1334 333 TRP A CZ3 
2003 C  CH2 . TRP A 263 ? 1.0392 0.9743 1.1820 0.3016  -0.2272 -0.1405 333 TRP A CH2 
2004 N  N   . PHE A 264 ? 0.9475 0.9030 1.2160 0.2698  -0.0426 -0.1468 334 PHE A N   
2005 C  CA  . PHE A 264 ? 0.9550 0.8934 1.2149 0.2662  -0.0121 -0.1446 334 PHE A CA  
2006 C  C   . PHE A 264 ? 1.0002 0.9156 1.2014 0.2549  0.0199  -0.1329 334 PHE A C   
2007 O  O   . PHE A 264 ? 1.0113 0.9086 1.2165 0.2500  0.0529  -0.1359 334 PHE A O   
2008 C  CB  . PHE A 264 ? 0.9829 0.9296 1.3261 0.2679  0.0058  -0.1637 334 PHE A CB  
2009 C  CG  . PHE A 264 ? 0.9980 0.9651 1.3987 0.2809  -0.0326 -0.1760 334 PHE A CG  
2010 C  CD1 . PHE A 264 ? 1.0453 1.0067 1.4275 0.2912  -0.0590 -0.1712 334 PHE A CD1 
2011 C  CD2 . PHE A 264 ? 1.0182 1.0067 1.4906 0.2836  -0.0440 -0.1932 334 PHE A CD2 
2012 C  CE1 . PHE A 264 ? 1.0614 1.0344 1.4918 0.3050  -0.0976 -0.1828 334 PHE A CE1 
2013 C  CE2 . PHE A 264 ? 1.0564 1.0594 1.5827 0.2973  -0.0844 -0.2063 334 PHE A CE2 
2014 C  CZ  . PHE A 264 ? 1.0446 1.0378 1.5469 0.3086  -0.1122 -0.2006 334 PHE A CZ  
2015 N  N   . GLN A 265 ? 0.9390 0.8513 1.0860 0.2511  0.0101  -0.1205 335 GLN A N   
2016 C  CA  . GLN A 265 ? 0.9448 0.8329 1.0322 0.2427  0.0310  -0.1090 335 GLN A CA  
2017 C  C   . GLN A 265 ? 0.9925 0.8615 1.0354 0.2441  0.0308  -0.1001 335 GLN A C   
2018 O  O   . GLN A 265 ? 0.9800 0.8566 1.0311 0.2510  0.0124  -0.1004 335 GLN A O   
2019 C  CB  . GLN A 265 ? 0.9505 0.8444 1.0033 0.2400  0.0153  -0.1001 335 GLN A CB  
2020 C  CG  . GLN A 265 ? 1.1415 1.0399 1.1580 0.2439  -0.0138 -0.0904 335 GLN A CG  
2021 C  CD  . GLN A 265 ? 1.3787 1.2859 1.3787 0.2414  -0.0275 -0.0858 335 GLN A CD  
2022 O  OE1 . GLN A 265 ? 1.3124 1.2294 1.3366 0.2388  -0.0231 -0.0911 335 GLN A OE1 
2023 N  NE2 . GLN A 265 ? 1.2872 1.1891 1.2464 0.2414  -0.0414 -0.0764 335 GLN A NE2 
2024 N  N   . SER A 266 ? 0.9619 0.8025 0.9560 0.2378  0.0510  -0.0928 336 SER A N   
2025 C  CA  . SER A 266 ? 0.9751 0.7915 0.9225 0.2373  0.0548  -0.0854 336 SER A CA  
2026 C  C   . SER A 266 ? 1.0043 0.8297 0.9220 0.2406  0.0259  -0.0764 336 SER A C   
2027 O  O   . SER A 266 ? 1.0051 0.8253 0.9138 0.2438  0.0211  -0.0748 336 SER A O   
2028 C  CB  . SER A 266 ? 1.0525 0.8308 0.9462 0.2304  0.0773  -0.0799 336 SER A CB  
2029 O  OG  . SER A 266 ? 1.1558 0.9307 1.0202 0.2271  0.0706  -0.0736 336 SER A OG  
2030 N  N   . HIS A 267 ? 0.9378 0.7756 0.8426 0.2394  0.0088  -0.0713 337 HIS A N   
2031 C  CA  . HIS A 267 ? 0.9217 0.7650 0.7998 0.2411  -0.0146 -0.0639 337 HIS A CA  
2032 C  C   . HIS A 267 ? 0.9562 0.8137 0.8573 0.2484  -0.0325 -0.0669 337 HIS A C   
2033 O  O   . HIS A 267 ? 0.9539 0.8038 0.8311 0.2503  -0.0411 -0.0622 337 HIS A O   
2034 C  CB  . HIS A 267 ? 0.9189 0.7697 0.7830 0.2377  -0.0246 -0.0594 337 HIS A CB  
2035 C  CG  . HIS A 267 ? 0.9592 0.8058 0.7898 0.2365  -0.0389 -0.0522 337 HIS A CG  
2036 N  ND1 . HIS A 267 ? 0.9941 0.8223 0.7907 0.2327  -0.0357 -0.0474 337 HIS A ND1 
2037 C  CD2 . HIS A 267 ? 0.9713 0.8269 0.8004 0.2384  -0.0549 -0.0506 337 HIS A CD2 
2038 C  CE1 . HIS A 267 ? 0.9798 0.8116 0.7644 0.2321  -0.0495 -0.0441 337 HIS A CE1 
2039 N  NE2 . HIS A 267 ? 0.9712 0.8177 0.7719 0.2347  -0.0588 -0.0455 337 HIS A NE2 
2040 N  N   . GLN A 268 ? 0.9015 0.7760 0.8482 0.2530  -0.0388 -0.0756 338 GLN A N   
2041 C  CA  . GLN A 268 ? 0.8964 0.7782 0.8619 0.2621  -0.0608 -0.0793 338 GLN A CA  
2042 C  C   . GLN A 268 ? 0.9496 0.8229 0.9250 0.2669  -0.0561 -0.0817 338 GLN A C   
2043 O  O   . GLN A 268 ? 0.9519 0.8188 0.9094 0.2726  -0.0728 -0.0782 338 GLN A O   
2044 C  CB  . GLN A 268 ? 0.9064 0.8057 0.9180 0.2670  -0.0746 -0.0893 338 GLN A CB  
2045 C  CG  . GLN A 268 ? 1.0950 1.0040 1.1563 0.2642  -0.0548 -0.0998 338 GLN A CG  
2046 C  CD  . GLN A 268 ? 1.3180 1.2438 1.4093 0.2652  -0.0683 -0.1069 338 GLN A CD  
2047 O  OE1 . GLN A 268 ? 1.2618 1.1986 1.4042 0.2652  -0.0597 -0.1183 338 GLN A OE1 
2048 N  NE2 . GLN A 268 ? 1.2037 1.1312 1.2685 0.2650  -0.0863 -0.1019 338 GLN A NE2 
2049 N  N   . ILE A 269 ? 0.9074 0.7755 0.9045 0.2640  -0.0307 -0.0871 339 ILE A N   
2050 C  CA  . ILE A 269 ? 0.9147 0.7723 0.9218 0.2675  -0.0213 -0.0899 339 ILE A CA  
2051 C  C   . ILE A 269 ? 0.9674 0.8066 0.9168 0.2651  -0.0221 -0.0788 339 ILE A C   
2052 O  O   . ILE A 269 ? 0.9670 0.8011 0.9119 0.2708  -0.0317 -0.0777 339 ILE A O   
2053 C  CB  . ILE A 269 ? 0.9645 0.8137 1.0014 0.2628  0.0124  -0.0984 339 ILE A CB  
2054 C  CG1 . ILE A 269 ? 0.9592 0.8292 1.0689 0.2658  0.0136  -0.1130 339 ILE A CG1 
2055 C  CG2 . ILE A 269 ? 0.9911 0.8232 1.0259 0.2643  0.0269  -0.0997 339 ILE A CG2 
2056 C  CD1 . ILE A 269 ? 1.0552 0.9142 1.1934 0.2586  0.0522  -0.1220 339 ILE A CD1 
2057 N  N   . PHE A 270 ? 0.9253 0.7537 0.8326 0.2569  -0.0137 -0.0715 340 PHE A N   
2058 C  CA  . PHE A 270 ? 0.9318 0.7438 0.7895 0.2538  -0.0163 -0.0629 340 PHE A CA  
2059 C  C   . PHE A 270 ? 0.9704 0.7896 0.8153 0.2576  -0.0400 -0.0584 340 PHE A C   
2060 O  O   . PHE A 270 ? 0.9718 0.7799 0.7964 0.2591  -0.0431 -0.0552 340 PHE A O   
2061 C  CB  . PHE A 270 ? 0.9614 0.7610 0.7845 0.2459  -0.0082 -0.0582 340 PHE A CB  
2062 C  CG  . PHE A 270 ? 0.9863 0.7751 0.7675 0.2431  -0.0188 -0.0511 340 PHE A CG  
2063 C  CD1 . PHE A 270 ? 1.0449 0.8141 0.8019 0.2424  -0.0136 -0.0498 340 PHE A CD1 
2064 C  CD2 . PHE A 270 ? 1.0011 0.7995 0.7722 0.2407  -0.0331 -0.0473 340 PHE A CD2 
2065 C  CE1 . PHE A 270 ? 1.0612 0.8217 0.7872 0.2396  -0.0243 -0.0456 340 PHE A CE1 
2066 C  CE2 . PHE A 270 ? 1.0411 0.8309 0.7845 0.2377  -0.0417 -0.0435 340 PHE A CE2 
2067 C  CZ  . PHE A 270 ? 1.0346 0.8062 0.7571 0.2372  -0.0381 -0.0431 340 PHE A CZ  
2068 N  N   . HIS A 271 ? 0.9143 0.7479 0.7697 0.2592  -0.0545 -0.0587 341 HIS A N   
2069 C  CA  . HIS A 271 ? 0.9129 0.7453 0.7510 0.2625  -0.0739 -0.0552 341 HIS A CA  
2070 C  C   . HIS A 271 ? 0.9706 0.7970 0.8191 0.2723  -0.0854 -0.0579 341 HIS A C   
2071 O  O   . HIS A 271 ? 0.9790 0.7905 0.7978 0.2740  -0.0922 -0.0532 341 HIS A O   
2072 C  CB  . HIS A 271 ? 0.9142 0.7580 0.7602 0.2623  -0.0851 -0.0564 341 HIS A CB  
2073 C  CG  . HIS A 271 ? 0.9508 0.7938 0.7713 0.2539  -0.0813 -0.0510 341 HIS A CG  
2074 N  ND1 . HIS A 271 ? 0.9779 0.8133 0.7738 0.2525  -0.0900 -0.0473 341 HIS A ND1 
2075 C  CD2 . HIS A 271 ? 0.9669 0.8122 0.7846 0.2474  -0.0696 -0.0497 341 HIS A CD2 
2076 C  CE1 . HIS A 271 ? 0.9618 0.8005 0.7490 0.2449  -0.0837 -0.0448 341 HIS A CE1 
2077 N  NE2 . HIS A 271 ? 0.9599 0.8037 0.7575 0.2423  -0.0738 -0.0457 341 HIS A NE2 
2078 N  N   . VAL A 272 ? 0.9224 0.7578 0.8149 0.2785  -0.0853 -0.0662 342 VAL A N   
2079 C  CA  . VAL A 272 ? 0.9306 0.7613 0.8434 0.2896  -0.0987 -0.0708 342 VAL A CA  
2080 C  C   . VAL A 272 ? 0.9836 0.7995 0.8789 0.2891  -0.0863 -0.0674 342 VAL A C   
2081 O  O   . VAL A 272 ? 0.9931 0.7952 0.8734 0.2962  -0.0989 -0.0653 342 VAL A O   
2082 C  CB  . VAL A 272 ? 0.9744 0.8218 0.9525 0.2955  -0.1000 -0.0836 342 VAL A CB  
2083 C  CG1 . VAL A 272 ? 0.9860 0.8282 0.9922 0.3080  -0.1152 -0.0898 342 VAL A CG1 
2084 C  CG2 . VAL A 272 ? 0.9636 0.8248 0.9606 0.2966  -0.1155 -0.0882 342 VAL A CG2 
2085 N  N   . LEU A 273 ? 0.9308 0.7455 0.8266 0.2813  -0.0614 -0.0676 343 LEU A N   
2086 C  CA  . LEU A 273 ? 0.9385 0.7373 0.8172 0.2794  -0.0467 -0.0656 343 LEU A CA  
2087 C  C   . LEU A 273 ? 0.9906 0.7752 0.8212 0.2769  -0.0530 -0.0571 343 LEU A C   
2088 O  O   . LEU A 273 ? 0.9988 0.7708 0.8204 0.2801  -0.0516 -0.0562 343 LEU A O   
2089 C  CB  . LEU A 273 ? 0.9426 0.7346 0.8184 0.2708  -0.0202 -0.0672 343 LEU A CB  
2090 C  CG  . LEU A 273 ? 1.0165 0.7965 0.9116 0.2717  0.0008  -0.0730 343 LEU A CG  
2091 C  CD1 . LEU A 273 ? 1.0159 0.8086 0.9688 0.2823  -0.0072 -0.0822 343 LEU A CD1 
2092 C  CD2 . LEU A 273 ? 1.0571 0.8263 0.9533 0.2638  0.0284  -0.0767 343 LEU A CD2 
2093 N  N   . VAL A 274 ? 0.9360 0.7223 0.7400 0.2710  -0.0588 -0.0520 344 VAL A N   
2094 C  CA  . VAL A 274 ? 0.9387 0.7121 0.7043 0.2673  -0.0624 -0.0460 344 VAL A CA  
2095 C  C   . VAL A 274 ? 1.0009 0.7627 0.7574 0.2755  -0.0760 -0.0446 344 VAL A C   
2096 O  O   . VAL A 274 ? 1.0092 0.7549 0.7441 0.2752  -0.0725 -0.0421 344 VAL A O   
2097 C  CB  . VAL A 274 ? 0.9758 0.7549 0.7262 0.2598  -0.0652 -0.0432 344 VAL A CB  
2098 C  CG1 . VAL A 274 ? 0.9813 0.7472 0.7022 0.2553  -0.0662 -0.0396 344 VAL A CG1 
2099 C  CG2 . VAL A 274 ? 0.9657 0.7496 0.7183 0.2531  -0.0543 -0.0440 344 VAL A CG2 
2100 N  N   . VAL A 275 ? 0.9582 0.7242 0.7290 0.2831  -0.0921 -0.0468 345 VAL A N   
2101 C  CA  . VAL A 275 ? 0.9797 0.7262 0.7340 0.2928  -0.1089 -0.0456 345 VAL A CA  
2102 C  C   . VAL A 275 ? 1.0394 0.7786 0.8092 0.3011  -0.1091 -0.0481 345 VAL A C   
2103 O  O   . VAL A 275 ? 1.0559 0.7720 0.7966 0.3044  -0.1114 -0.0443 345 VAL A O   
2104 C  CB  . VAL A 275 ? 1.0362 0.7841 0.7993 0.3002  -0.1303 -0.0486 345 VAL A CB  
2105 C  CG1 . VAL A 275 ? 1.0718 0.7866 0.7993 0.3101  -0.1491 -0.0460 345 VAL A CG1 
2106 C  CG2 . VAL A 275 ? 1.0184 0.7772 0.7738 0.2912  -0.1269 -0.0471 345 VAL A CG2 
2107 N  N   . ALA A 276 ? 0.9828 0.7398 0.7998 0.3039  -0.1040 -0.0552 346 ALA A N   
2108 C  CA  . ALA A 276 ? 0.9890 0.7417 0.8317 0.3114  -0.1013 -0.0596 346 ALA A CA  
2109 C  C   . ALA A 276 ? 1.0460 0.7852 0.8608 0.3048  -0.0822 -0.0550 346 ALA A C   
2110 O  O   . ALA A 276 ? 1.0602 0.7824 0.8645 0.3112  -0.0862 -0.0536 346 ALA A O   
2111 C  CB  . ALA A 276 ? 0.9835 0.7569 0.8854 0.3125  -0.0923 -0.0696 346 ALA A CB  
2112 N  N   . ALA A 277 ? 0.9941 0.7370 0.7920 0.2927  -0.0647 -0.0525 347 ALA A N   
2113 C  CA  . ALA A 277 ? 1.0010 0.7301 0.7718 0.2858  -0.0492 -0.0495 347 ALA A CA  
2114 C  C   . ALA A 277 ? 1.0655 0.7777 0.7969 0.2844  -0.0552 -0.0437 347 ALA A C   
2115 O  O   . ALA A 277 ? 1.0713 0.7682 0.7903 0.2854  -0.0490 -0.0429 347 ALA A O   
2116 C  CB  . ALA A 277 ? 1.0008 0.7343 0.7626 0.2749  -0.0350 -0.0495 347 ALA A CB  
2117 N  N   . ALA A 278 ? 1.0245 0.7367 0.7382 0.2826  -0.0656 -0.0405 348 ALA A N   
2118 C  CA  . ALA A 278 ? 1.0415 0.7329 0.7190 0.2807  -0.0673 -0.0362 348 ALA A CA  
2119 C  C   . ALA A 278 ? 1.1246 0.7938 0.7917 0.2923  -0.0771 -0.0349 348 ALA A C   
2120 O  O   . ALA A 278 ? 1.1361 0.7841 0.7782 0.2912  -0.0704 -0.0325 348 ALA A O   
2121 C  CB  . ALA A 278 ? 1.0469 0.7396 0.7108 0.2763  -0.0730 -0.0344 348 ALA A CB  
2122 N  N   . PHE A 279 ? 1.0926 0.7655 0.7813 0.3038  -0.0939 -0.0374 349 PHE A N   
2123 C  CA  . PHE A 279 ? 1.1251 0.7745 0.8061 0.3176  -0.1095 -0.0371 349 PHE A CA  
2124 C  C   . PHE A 279 ? 1.1819 0.8286 0.8790 0.3209  -0.0999 -0.0389 349 PHE A C   
2125 O  O   . PHE A 279 ? 1.2035 0.8227 0.8752 0.3270  -0.1030 -0.0359 349 PHE A O   
2126 C  CB  . PHE A 279 ? 1.1524 0.8096 0.8625 0.3295  -0.1335 -0.0420 349 PHE A CB  
2127 C  CG  . PHE A 279 ? 1.2132 0.8406 0.9113 0.3459  -0.1565 -0.0421 349 PHE A CG  
2128 C  CD1 . PHE A 279 ? 1.2942 0.8839 0.9386 0.3513  -0.1723 -0.0372 349 PHE A CD1 
2129 C  CD2 . PHE A 279 ? 1.2451 0.8768 0.9829 0.3562  -0.1619 -0.0476 349 PHE A CD2 
2130 C  CE1 . PHE A 279 ? 1.3523 0.9058 0.9766 0.3679  -0.1965 -0.0369 349 PHE A CE1 
2131 C  CE2 . PHE A 279 ? 1.3219 0.9231 1.0486 0.3729  -0.1866 -0.0480 349 PHE A CE2 
2132 C  CZ  . PHE A 279 ? 1.3411 0.9017 1.0082 0.3794  -0.2057 -0.0424 349 PHE A CZ  
2133 N  N   . VAL A 280 ? 1.1192 0.7900 0.8561 0.3170  -0.0867 -0.0441 350 VAL A N   
2134 C  CA  . VAL A 280 ? 1.1234 0.7911 0.8772 0.3183  -0.0729 -0.0470 350 VAL A CA  
2135 C  C   . VAL A 280 ? 1.1897 0.8385 0.9017 0.3101  -0.0587 -0.0419 350 VAL A C   
2136 O  O   . VAL A 280 ? 1.2045 0.8354 0.9094 0.3151  -0.0560 -0.0412 350 VAL A O   
2137 C  CB  . VAL A 280 ? 1.1521 0.8412 0.9456 0.3127  -0.0555 -0.0535 350 VAL A CB  
2138 C  CG1 . VAL A 280 ? 1.1580 0.8367 0.9552 0.3105  -0.0351 -0.0557 350 VAL A CG1 
2139 C  CG2 . VAL A 280 ? 1.1424 0.8491 0.9899 0.3221  -0.0674 -0.0614 350 VAL A CG2 
2140 N  N   . HIS A 281 ? 1.1399 0.7924 0.8275 0.2978  -0.0512 -0.0391 351 HIS A N   
2141 C  CA  . HIS A 281 ? 1.1497 0.7866 0.8040 0.2888  -0.0398 -0.0365 351 HIS A CA  
2142 C  C   . HIS A 281 ? 1.2396 0.8493 0.8655 0.2947  -0.0456 -0.0327 351 HIS A C   
2143 O  O   . HIS A 281 ? 1.2498 0.8426 0.8618 0.2937  -0.0360 -0.0322 351 HIS A O   
2144 C  CB  . HIS A 281 ? 1.1428 0.7894 0.7854 0.2768  -0.0365 -0.0361 351 HIS A CB  
2145 C  CG  . HIS A 281 ? 1.1916 0.8254 0.8119 0.2671  -0.0257 -0.0366 351 HIS A CG  
2146 N  ND1 . HIS A 281 ? 1.2251 0.8440 0.8243 0.2638  -0.0249 -0.0350 351 HIS A ND1 
2147 C  CD2 . HIS A 281 ? 1.2122 0.8442 0.8304 0.2604  -0.0158 -0.0397 351 HIS A CD2 
2148 C  CE1 . HIS A 281 ? 1.2201 0.8327 0.8124 0.2550  -0.0148 -0.0382 351 HIS A CE1 
2149 N  NE2 . HIS A 281 ? 1.2176 0.8375 0.8188 0.2529  -0.0113 -0.0410 351 HIS A NE2 
2150 N  N   . PHE A 282 ? 1.2162 0.8172 0.8305 0.3014  -0.0610 -0.0301 352 PHE A N   
2151 C  CA  . PHE A 282 ? 1.2573 0.8217 0.8333 0.3081  -0.0674 -0.0259 352 PHE A CA  
2152 C  C   . PHE A 282 ? 1.3443 0.8894 0.9219 0.3217  -0.0754 -0.0256 352 PHE A C   
2153 O  O   . PHE A 282 ? 1.3671 0.8818 0.9131 0.3225  -0.0680 -0.0226 352 PHE A O   
2154 C  CB  . PHE A 282 ? 1.2937 0.8483 0.8517 0.3122  -0.0830 -0.0239 352 PHE A CB  
2155 C  CG  . PHE A 282 ? 1.3661 0.8713 0.8729 0.3201  -0.0896 -0.0193 352 PHE A CG  
2156 C  CD1 . PHE A 282 ? 1.4284 0.9042 0.8974 0.3119  -0.0698 -0.0167 352 PHE A CD1 
2157 C  CD2 . PHE A 282 ? 1.4247 0.9082 0.9191 0.3359  -0.1157 -0.0184 352 PHE A CD2 
2158 C  CE1 . PHE A 282 ? 1.4972 0.9185 0.9109 0.3187  -0.0719 -0.0122 352 PHE A CE1 
2159 C  CE2 . PHE A 282 ? 1.5200 0.9473 0.9550 0.3440  -0.1228 -0.0136 352 PHE A CE2 
2160 C  CZ  . PHE A 282 ? 1.5224 0.9166 0.9141 0.3351  -0.0988 -0.0100 352 PHE A CZ  
2161 N  N   . TYR A 283 ? 1.3029 0.8650 0.9207 0.3323  -0.0894 -0.0296 353 TYR A N   
2162 C  CA  . TYR A 283 ? 1.3283 0.8756 0.9591 0.3464  -0.0990 -0.0311 353 TYR A CA  
2163 C  C   . TYR A 283 ? 1.3826 0.9291 1.0179 0.3404  -0.0764 -0.0318 353 TYR A C   
2164 O  O   . TYR A 283 ? 1.4078 0.9247 1.0193 0.3465  -0.0761 -0.0290 353 TYR A O   
2165 C  CB  . TYR A 283 ? 1.3315 0.9022 1.0184 0.3574  -0.1166 -0.0383 353 TYR A CB  
2166 C  CG  . TYR A 283 ? 1.3718 0.9353 1.0903 0.3706  -0.1231 -0.0427 353 TYR A CG  
2167 C  CD1 . TYR A 283 ? 1.4413 0.9692 1.1370 0.3868  -0.1463 -0.0403 353 TYR A CD1 
2168 C  CD2 . TYR A 283 ? 1.3574 0.9462 1.1283 0.3673  -0.1055 -0.0498 353 TYR A CD2 
2169 C  CE1 . TYR A 283 ? 1.4675 0.9892 1.1977 0.4002  -0.1544 -0.0451 353 TYR A CE1 
2170 C  CE2 . TYR A 283 ? 1.3828 0.9659 1.1901 0.3793  -0.1094 -0.0551 353 TYR A CE2 
2171 C  CZ  . TYR A 283 ? 1.5192 1.0714 1.3100 0.3961  -0.1352 -0.0531 353 TYR A CZ  
2172 O  OH  . TYR A 283 ? 1.5475 1.0947 1.3798 0.4089  -0.1407 -0.0592 353 TYR A OH  
2173 N  N   . GLY A 284 ? 1.3141 0.8878 0.9729 0.3283  -0.0579 -0.0354 354 GLY A N   
2174 C  CA  . GLY A 284 ? 1.3147 0.8861 0.9732 0.3206  -0.0359 -0.0370 354 GLY A CA  
2175 C  C   . GLY A 284 ? 1.3915 0.9395 1.0051 0.3126  -0.0257 -0.0328 354 GLY A C   
2176 O  O   . GLY A 284 ? 1.4043 0.9331 1.0072 0.3144  -0.0169 -0.0325 354 GLY A O   
2177 N  N   . VAL A 285 ? 1.3527 0.9004 0.9426 0.3043  -0.0263 -0.0305 355 VAL A N   
2178 C  CA  . VAL A 285 ? 1.3707 0.8969 0.9252 0.2952  -0.0148 -0.0287 355 VAL A CA  
2179 C  C   . VAL A 285 ? 1.4723 0.9593 0.9945 0.3047  -0.0176 -0.0243 355 VAL A C   
2180 O  O   . VAL A 285 ? 1.4838 0.9502 0.9862 0.2996  -0.0028 -0.0244 355 VAL A O   
2181 C  CB  . VAL A 285 ? 1.4074 0.9424 0.9526 0.2844  -0.0135 -0.0289 355 VAL A CB  
2182 C  CG1 . VAL A 285 ? 1.4223 0.9428 0.9485 0.2914  -0.0265 -0.0249 355 VAL A CG1 
2183 C  CG2 . VAL A 285 ? 1.4139 0.9351 0.9412 0.2720  0.0029  -0.0313 355 VAL A CG2 
2184 N  N   . SER A 286 ? 1.4578 0.9305 0.9708 0.3182  -0.0373 -0.0209 356 SER A N   
2185 C  CA  . SER A 286 ? 1.5089 0.9353 0.9814 0.3296  -0.0445 -0.0161 356 SER A CA  
2186 C  C   . SER A 286 ? 1.5800 0.9971 1.0634 0.3374  -0.0419 -0.0167 356 SER A C   
2187 O  O   . SER A 286 ? 1.6109 0.9904 1.0584 0.3394  -0.0341 -0.0135 356 SER A O   
2188 C  CB  . SER A 286 ? 1.5743 0.9869 1.0372 0.3443  -0.0723 -0.0138 356 SER A CB  
2189 O  OG  . SER A 286 ? 1.6869 1.0927 1.1231 0.3370  -0.0712 -0.0121 356 SER A OG  
2190 N  N   . ASN A 287 ? 1.5170 0.9652 1.0486 0.3403  -0.0441 -0.0214 357 ASN A N   
2191 C  CA  . ASN A 287 ? 1.5307 0.9697 1.0755 0.3468  -0.0385 -0.0228 357 ASN A CA  
2192 C  C   . ASN A 287 ? 1.5912 1.0235 1.1195 0.3330  -0.0118 -0.0235 357 ASN A C   
2193 O  O   . ASN A 287 ? 1.6147 1.0202 1.1279 0.3380  -0.0060 -0.0221 357 ASN A O   
2194 C  CB  . ASN A 287 ? 1.5098 0.9826 1.1128 0.3508  -0.0414 -0.0293 357 ASN A CB  
2195 C  CG  . ASN A 287 ? 1.7917 1.2703 1.4252 0.3673  -0.0694 -0.0316 357 ASN A CG  
2196 O  OD1 . ASN A 287 ? 1.7489 1.2001 1.3551 0.3790  -0.0910 -0.0278 357 ASN A OD1 
2197 N  ND2 . ASN A 287 ? 1.6623 1.1719 1.3532 0.3697  -0.0708 -0.0390 357 ASN A ND2 
2198 N  N   . LEU A 288 ? 1.5285 0.9815 1.0575 0.3162  0.0018  -0.0261 358 LEU A N   
2199 C  CA  . LEU A 288 ? 1.5310 0.9777 1.0463 0.3025  0.0229  -0.0288 358 LEU A CA  
2200 C  C   . LEU A 288 ? 1.6264 1.0336 1.1003 0.3019  0.0308  -0.0255 358 LEU A C   
2201 O  O   . LEU A 288 ? 1.6350 1.0265 1.0997 0.2974  0.0461  -0.0274 358 LEU A O   
2202 C  CB  . LEU A 288 ? 1.5020 0.9748 1.0263 0.2872  0.0285  -0.0331 358 LEU A CB  
2203 C  CG  . LEU A 288 ? 1.5577 1.0332 1.0841 0.2754  0.0438  -0.0389 358 LEU A CG  
2204 C  CD1 . LEU A 288 ? 1.5328 1.0347 1.0758 0.2667  0.0425  -0.0434 358 LEU A CD1 
2205 C  CD2 . LEU A 288 ? 1.6069 1.0637 1.1125 0.2669  0.0541  -0.0406 358 LEU A CD2 
2206 N  N   . GLN A 289 ? 1.6106 0.9977 1.0570 0.3060  0.0224  -0.0209 359 GLN A N   
2207 C  CA  . GLN A 289 ? 1.6571 0.9967 1.0565 0.3059  0.0330  -0.0175 359 GLN A CA  
2208 C  C   . GLN A 289 ? 1.7469 1.0524 1.1283 0.3190  0.0316  -0.0139 359 GLN A C   
2209 O  O   . GLN A 289 ? 1.7667 1.0438 1.1247 0.3134  0.0509  -0.0144 359 GLN A O   
2210 C  CB  . GLN A 289 ? 1.6998 1.0163 1.0664 0.3100  0.0232  -0.0130 359 GLN A CB  
2211 C  CG  . GLN A 289 ? 1.9196 1.2312 1.2860 0.3292  -0.0064 -0.0086 359 GLN A CG  
2212 C  CD  . GLN A 289 ? 2.2128 1.4806 1.5291 0.3382  -0.0195 -0.0031 359 GLN A CD  
2213 O  OE1 . GLN A 289 ? 2.1633 1.4306 1.4832 0.3529  -0.0478 -0.0014 359 GLN A OE1 
2214 N  NE2 . GLN A 289 ? 2.1502 1.3773 1.4195 0.3297  0.0012  -0.0014 359 GLN A NE2 
2215 N  N   . GLU A 290 ? 1.7091 1.0191 1.1078 0.3360  0.0091  -0.0117 360 GLU A N   
2216 C  CA  . GLU A 290 ? 1.7437 1.0231 1.1326 0.3511  0.0025  -0.0089 360 GLU A CA  
2217 C  C   . GLU A 290 ? 1.7734 1.0652 1.1854 0.3442  0.0222  -0.0132 360 GLU A C   
2218 O  O   . GLU A 290 ? 1.8035 1.0595 1.1897 0.3480  0.0314  -0.0110 360 GLU A O   
2219 C  CB  . GLU A 290 ? 1.7627 1.0514 1.1797 0.3702  -0.0282 -0.0087 360 GLU A CB  
2220 C  CG  . GLU A 290 ? 1.9463 1.2024 1.3247 0.3822  -0.0529 -0.0036 360 GLU A CG  
2221 C  CD  . GLU A 290 ? 2.2333 1.5035 1.6481 0.4005  -0.0876 -0.0061 360 GLU A CD  
2222 O  OE1 . GLU A 290 ? 2.2001 1.4432 1.5832 0.4110  -0.1120 -0.0030 360 GLU A OE1 
2223 O  OE2 . GLU A 290 ? 2.1442 1.4501 1.6202 0.4042  -0.0899 -0.0122 360 GLU A OE2 
2224 N  N   . PHE A 291 ? 1.6798 1.0165 1.1337 0.3332  0.0300  -0.0194 361 PHE A N   
2225 C  CA  . PHE A 291 ? 1.6655 1.0112 1.1359 0.3248  0.0493  -0.0245 361 PHE A CA  
2226 C  C   . PHE A 291 ? 1.7246 1.0463 1.1619 0.3119  0.0703  -0.0255 361 PHE A C   
2227 O  O   . PHE A 291 ? 1.7371 1.0406 1.1684 0.3119  0.0831  -0.0267 361 PHE A O   
2228 C  CB  . PHE A 291 ? 1.6461 1.0343 1.1528 0.3143  0.0535  -0.0307 361 PHE A CB  
2229 C  CG  . PHE A 291 ? 1.6610 1.0524 1.1685 0.3003  0.0742  -0.0367 361 PHE A CG  
2230 C  CD1 . PHE A 291 ? 1.6987 1.0886 1.1884 0.2850  0.0842  -0.0400 361 PHE A CD1 
2231 C  CD2 . PHE A 291 ? 1.6907 1.0842 1.2185 0.3025  0.0834  -0.0404 361 PHE A CD2 
2232 C  CE1 . PHE A 291 ? 1.7106 1.0991 1.1993 0.2732  0.0989  -0.0468 361 PHE A CE1 
2233 C  CE2 . PHE A 291 ? 1.7283 1.1188 1.2498 0.2898  0.1012  -0.0463 361 PHE A CE2 
2234 C  CZ  . PHE A 291 ? 1.7033 1.0909 1.2039 0.2755  0.1067  -0.0495 361 PHE A CZ  
2235 N  N   . ARG A 292 ? 1.6711 0.9915 1.0908 0.3010  0.0749  -0.0260 362 ARG A N   
2236 C  CA  . ARG A 292 ? 1.6803 0.9810 1.0796 0.2871  0.0965  -0.0299 362 ARG A CA  
2237 C  C   . ARG A 292 ? 1.7767 1.0256 1.1353 0.2934  0.1069  -0.0253 362 ARG A C   
2238 O  O   . ARG A 292 ? 1.7850 1.0190 1.1380 0.2848  0.1269  -0.0298 362 ARG A O   
2239 C  CB  . ARG A 292 ? 1.6615 0.9747 1.0615 0.2746  0.0993  -0.0332 362 ARG A CB  
2240 C  CG  . ARG A 292 ? 1.7172 1.0737 1.1534 0.2630  0.0969  -0.0409 362 ARG A CG  
2241 C  CD  . ARG A 292 ? 1.7982 1.1546 1.2433 0.2540  0.1102  -0.0484 362 ARG A CD  
2242 N  NE  . ARG A 292 ? 1.8341 1.2209 1.3032 0.2507  0.1028  -0.0527 362 ARG A NE  
2243 C  CZ  . ARG A 292 ? 1.9833 1.3757 1.4601 0.2400  0.1088  -0.0613 362 ARG A CZ  
2244 N  NH1 . ARG A 292 ? 1.8399 1.2144 1.3107 0.2304  0.1222  -0.0680 362 ARG A NH1 
2245 N  NH2 . ARG A 292 ? 1.7826 1.1922 1.2701 0.2382  0.1029  -0.0643 362 ARG A NH2 
2246 N  N   . TYR A 293 ? 1.7620 0.9800 1.0902 0.3089  0.0927  -0.0170 363 TYR A N   
2247 C  CA  . TYR A 293 ? 1.8180 0.9763 1.0967 0.3167  0.1013  -0.0116 363 TYR A CA  
2248 C  C   . TYR A 293 ? 1.8654 1.0117 1.1497 0.3252  0.1039  -0.0109 363 TYR A C   
2249 O  O   . TYR A 293 ? 1.8983 1.0046 1.1518 0.3225  0.1236  -0.0105 363 TYR A O   
2250 C  CB  . TYR A 293 ? 1.8797 0.9995 1.1154 0.3321  0.0820  -0.0031 363 TYR A CB  
2251 C  CG  . TYR A 293 ? 1.9705 1.0239 1.1413 0.3292  0.1024  0.0004  363 TYR A CG  
2252 C  CD1 . TYR A 293 ? 1.9965 1.0451 1.1558 0.3123  0.1239  -0.0037 363 TYR A CD1 
2253 C  CD2 . TYR A 293 ? 2.0441 1.0373 1.1666 0.3424  0.1034  0.0067  363 TYR A CD2 
2254 C  CE1 . TYR A 293 ? 2.0722 1.0554 1.1731 0.3079  0.1492  -0.0019 363 TYR A CE1 
2255 C  CE2 . TYR A 293 ? 2.1233 1.0474 1.1796 0.3391  0.1265  0.0098  363 TYR A CE2 
2256 C  CZ  . TYR A 293 ? 2.2199 1.1383 1.2654 0.3210  0.1516  0.0051  363 TYR A CZ  
2257 O  OH  . TYR A 293 ? 2.3033 1.1488 1.2839 0.3162  0.1803  0.0069  363 TYR A OH  
2258 N  N   . GLY A 294 ? 1.7789 0.9589 1.1046 0.3342  0.0873  -0.0119 364 GLY A N   
2259 C  CA  . GLY A 294 ? 1.7789 0.9536 1.1204 0.3424  0.0897  -0.0126 364 GLY A CA  
2260 C  C   . GLY A 294 ? 1.8055 0.9817 1.1513 0.3267  0.1177  -0.0190 364 GLY A C   
2261 O  O   . GLY A 294 ? 1.8319 0.9752 1.1599 0.3311  0.1288  -0.0176 364 GLY A O   
2262 N  N   . LEU A 295 ? 1.7109 0.9210 1.0771 0.3085  0.1281  -0.0264 365 LEU A N   
2263 C  CA  . LEU A 295 ? 1.6954 0.9098 1.0693 0.2931  0.1499  -0.0347 365 LEU A CA  
2264 C  C   . LEU A 295 ? 1.7240 0.9380 1.0894 0.2757  0.1632  -0.0407 365 LEU A C   
2265 O  O   . LEU A 295 ? 1.6881 0.9302 1.0685 0.2685  0.1553  -0.0435 365 LEU A O   
2266 C  CB  . LEU A 295 ? 1.6602 0.9115 1.0716 0.2889  0.1483  -0.0409 365 LEU A CB  
2267 C  CG  . LEU A 295 ? 1.6771 0.9701 1.1148 0.2841  0.1353  -0.0436 365 LEU A CG  
2268 C  CD1 . LEU A 295 ? 1.6732 0.9739 1.1150 0.2967  0.1155  -0.0367 365 LEU A CD1 
2269 C  CD2 . LEU A 295 ? 1.6909 0.9994 1.1291 0.2660  0.1402  -0.0510 365 LEU A CD2 
2270 N  N   . GLU A 296 ? 1.7008 0.8817 1.0454 0.2691  0.1842  -0.0436 366 GLU A N   
2271 C  CA  . GLU A 296 ? 1.6918 0.8707 1.0377 0.2518  0.2002  -0.0522 366 GLU A CA  
2272 C  C   . GLU A 296 ? 1.6868 0.9090 1.0714 0.2388  0.1954  -0.0633 366 GLU A C   
2273 O  O   . GLU A 296 ? 1.6501 0.9006 1.0521 0.2334  0.1843  -0.0659 366 GLU A O   
2274 C  CB  . GLU A 296 ? 1.7504 0.8859 1.0733 0.2470  0.2262  -0.0551 366 GLU A CB  
2275 C  CG  . GLU A 296 ? 1.9211 1.0032 1.1951 0.2625  0.2294  -0.0431 366 GLU A CG  
2276 C  CD  . GLU A 296 ? 2.1831 1.2208 1.4341 0.2571  0.2577  -0.0464 366 GLU A CD  
2277 O  OE1 . GLU A 296 ? 2.0854 1.0869 1.3084 0.2698  0.2601  -0.0392 366 GLU A OE1 
2278 O  OE2 . GLU A 296 ? 2.1104 1.1476 1.3734 0.2393  0.2786  -0.0574 366 GLU A OE2 
2279 N  N   . GLY A 297 ? 1.6385 0.8613 1.0316 0.2351  0.2022  -0.0690 367 GLY A N   
2280 C  CA  . GLY A 297 ? 1.6073 0.8584 1.0251 0.2233  0.1972  -0.0801 367 GLY A CA  
2281 C  C   . GLY A 297 ? 1.6564 0.9012 1.0721 0.2267  0.2014  -0.0809 367 GLY A C   
2282 O  O   . GLY A 297 ? 1.6756 0.8937 1.0761 0.2354  0.2121  -0.0753 367 GLY A O   
2283 N  N   . GLY A 298 ? 1.5893 0.8549 1.0171 0.2206  0.1929  -0.0874 368 GLY A N   
2284 C  CA  . GLY A 298 ? 1.8900 1.1484 1.3140 0.2222  0.1983  -0.0894 368 GLY A CA  
2285 C  C   . GLY A 298 ? 2.0618 1.3324 1.4881 0.2116  0.1901  -0.0993 368 GLY A C   
2286 O  O   . GLY A 298 ? 1.5412 0.8055 0.9667 0.1992  0.1908  -0.1110 368 GLY A O   
2287 N  N   . GLU B 1   ? 0.8915 1.2174 0.7768 -0.2558 0.0060  -0.1093 1   GLU H N   
2288 C  CA  . GLU B 1   ? 0.8630 1.1704 0.7745 -0.2253 0.0034  -0.1114 1   GLU H CA  
2289 C  C   . GLU B 1   ? 0.8780 1.1802 0.8162 -0.2033 0.0015  -0.1094 1   GLU H C   
2290 O  O   . GLU B 1   ? 0.8739 1.1878 0.8136 -0.2100 0.0029  -0.1077 1   GLU H O   
2291 C  CB  . GLU B 1   ? 0.8799 1.1674 0.7818 -0.2229 -0.0132 -0.0915 1   GLU H CB  
2292 C  CG  . GLU B 1   ? 1.0240 1.2997 0.9391 -0.2051 -0.0094 -0.1020 1   GLU H CG  
2293 C  CD  . GLU B 1   ? 1.3429 1.6062 1.2464 -0.2086 -0.0219 -0.0875 1   GLU H CD  
2294 O  OE1 . GLU B 1   ? 1.2833 1.5323 1.1943 -0.1979 -0.0363 -0.0683 1   GLU H OE1 
2295 O  OE2 . GLU B 1   ? 1.3049 1.5735 1.1928 -0.2226 -0.0168 -0.0963 1   GLU H OE2 
2296 N  N   . VAL B 2   ? 0.8067 1.0925 0.7650 -0.1790 -0.0012 -0.1110 2   VAL H N   
2297 C  CA  . VAL B 2   ? 0.7803 1.0589 0.7616 -0.1590 -0.0044 -0.1087 2   VAL H CA  
2298 C  C   . VAL B 2   ? 0.8155 1.0819 0.7890 -0.1605 -0.0189 -0.0861 2   VAL H C   
2299 O  O   . VAL B 2   ? 0.8139 1.0664 0.7756 -0.1634 -0.0298 -0.0709 2   VAL H O   
2300 C  CB  . VAL B 2   ? 0.8141 1.0761 0.8147 -0.1356 -0.0052 -0.1141 2   VAL H CB  
2301 C  CG1 . VAL B 2   ? 0.7944 1.0468 0.8141 -0.1176 -0.0114 -0.1081 2   VAL H CG1 
2302 C  CG2 . VAL B 2   ? 0.8185 1.0901 0.8311 -0.1329 0.0091  -0.1375 2   VAL H CG2 
2303 N  N   . LEU B 3   ? 0.7569 1.0285 0.7397 -0.1581 -0.0190 -0.0848 3   LEU H N   
2304 C  CA  . LEU B 3   ? 0.7484 1.0065 0.7261 -0.1588 -0.0315 -0.0660 3   LEU H CA  
2305 C  C   . LEU B 3   ? 0.7718 1.0248 0.7683 -0.1431 -0.0325 -0.0675 3   LEU H C   
2306 O  O   . LEU B 3   ? 0.7617 1.0314 0.7722 -0.1409 -0.0241 -0.0802 3   LEU H O   
2307 C  CB  . LEU B 3   ? 0.7681 1.0378 0.7265 -0.1832 -0.0336 -0.0578 3   LEU H CB  
2308 C  CG  . LEU B 3   ? 0.8334 1.0836 0.7816 -0.1878 -0.0495 -0.0350 3   LEU H CG  
2309 C  CD1 . LEU B 3   ? 0.8408 1.0768 0.7809 -0.1885 -0.0594 -0.0229 3   LEU H CD1 
2310 C  CD2 . LEU B 3   ? 0.8861 1.1468 0.8181 -0.2110 -0.0518 -0.0274 3   LEU H CD2 
2311 N  N   . LEU B 4   ? 0.7145 0.9450 0.7120 -0.1332 -0.0429 -0.0545 4   LEU H N   
2312 C  CA  . LEU B 4   ? 0.6988 0.9208 0.7085 -0.1215 -0.0458 -0.0534 4   LEU H CA  
2313 C  C   . LEU B 4   ? 0.7504 0.9616 0.7502 -0.1301 -0.0543 -0.0391 4   LEU H C   
2314 O  O   . LEU B 4   ? 0.7511 0.9462 0.7430 -0.1318 -0.0619 -0.0274 4   LEU H O   
2315 C  CB  . LEU B 4   ? 0.6870 0.8908 0.7060 -0.1033 -0.0486 -0.0538 4   LEU H CB  
2316 C  CG  . LEU B 4   ? 0.7386 0.9478 0.7689 -0.0933 -0.0422 -0.0667 4   LEU H CG  
2317 C  CD1 . LEU B 4   ? 0.7323 0.9221 0.7678 -0.0789 -0.0466 -0.0642 4   LEU H CD1 
2318 C  CD2 . LEU B 4   ? 0.7661 0.9946 0.8127 -0.0915 -0.0355 -0.0790 4   LEU H CD2 
2319 N  N   . GLN B 5   ? 0.7040 0.9251 0.7055 -0.1368 -0.0532 -0.0401 5   GLN H N   
2320 C  CA  . GLN B 5   ? 0.7103 0.9199 0.7018 -0.1468 -0.0611 -0.0273 5   GLN H CA  
2321 C  C   . GLN B 5   ? 0.7517 0.9491 0.7509 -0.1379 -0.0642 -0.0266 5   GLN H C   
2322 O  O   . GLN B 5   ? 0.7369 0.9473 0.7475 -0.1329 -0.0599 -0.0356 5   GLN H O   
2323 C  CB  . GLN B 5   ? 0.7416 0.9714 0.7224 -0.1681 -0.0586 -0.0264 5   GLN H CB  
2324 C  CG  . GLN B 5   ? 0.9477 1.1741 0.9099 -0.1841 -0.0641 -0.0151 5   GLN H CG  
2325 C  CD  . GLN B 5   ? 1.2129 1.4616 1.1609 -0.2088 -0.0604 -0.0152 5   GLN H CD  
2326 O  OE1 . GLN B 5   ? 1.1510 1.4256 1.1059 -0.2128 -0.0489 -0.0294 5   GLN H OE1 
2327 N  NE2 . GLN B 5   ? 1.1430 1.3830 1.0719 -0.2267 -0.0703 0.0008  5   GLN H NE2 
2328 N  N   . GLN B 6   ? 0.7153 0.8880 0.7090 -0.1368 -0.0720 -0.0162 6   GLN H N   
2329 C  CA  . GLN B 6   ? 0.7120 0.8698 0.7090 -0.1309 -0.0745 -0.0162 6   GLN H CA  
2330 C  C   . GLN B 6   ? 0.7806 0.9300 0.7685 -0.1445 -0.0799 -0.0079 6   GLN H C   
2331 O  O   . GLN B 6   ? 0.7895 0.9374 0.7682 -0.1572 -0.0842 0.0013  6   GLN H O   
2332 C  CB  . GLN B 6   ? 0.7241 0.8578 0.7247 -0.1170 -0.0764 -0.0151 6   GLN H CB  
2333 C  CG  . GLN B 6   ? 0.8658 1.0056 0.8741 -0.1044 -0.0717 -0.0230 6   GLN H CG  
2334 C  CD  . GLN B 6   ? 1.0894 1.2082 1.1002 -0.0930 -0.0722 -0.0239 6   GLN H CD  
2335 O  OE1 . GLN B 6   ? 1.0190 1.1352 1.0336 -0.0850 -0.0704 -0.0258 6   GLN H OE1 
2336 N  NE2 . GLN B 6   ? 1.0008 1.1051 1.0087 -0.0938 -0.0737 -0.0236 6   GLN H NE2 
2337 N  N   . SER B 7   ? 0.7409 0.8837 0.7302 -0.1433 -0.0806 -0.0103 7   SER H N   
2338 C  CA  . SER B 7   ? 0.7570 0.8887 0.7374 -0.1559 -0.0856 -0.0039 7   SER H CA  
2339 C  C   . SER B 7   ? 0.8268 0.9250 0.8029 -0.1546 -0.0917 0.0046  7   SER H C   
2340 O  O   . SER B 7   ? 0.8173 0.9022 0.7998 -0.1420 -0.0914 0.0041  7   SER H O   
2341 C  CB  . SER B 7   ? 0.7974 0.9325 0.7803 -0.1555 -0.0848 -0.0098 7   SER H CB  
2342 O  OG  . SER B 7   ? 0.8905 1.0169 0.8793 -0.1408 -0.0829 -0.0161 7   SER H OG  
2343 N  N   . GLY B 8   ? 0.8054 0.8914 0.7729 -0.1680 -0.0974 0.0123  8   GLY H N   
2344 C  CA  . GLY B 8   ? 0.8227 0.8754 0.7896 -0.1681 -0.1043 0.0206  8   GLY H CA  
2345 C  C   . GLY B 8   ? 0.8738 0.9016 0.8460 -0.1564 -0.1014 0.0130  8   GLY H C   
2346 O  O   . GLY B 8   ? 0.8565 0.8916 0.8277 -0.1523 -0.0957 0.0028  8   GLY H O   
2347 N  N   . PRO B 9   ? 0.8487 0.8467 0.8277 -0.1522 -0.1059 0.0180  9   PRO H N   
2348 C  CA  . PRO B 9   ? 0.8533 0.8261 0.8379 -0.1430 -0.1010 0.0084  9   PRO H CA  
2349 C  C   . PRO B 9   ? 0.9126 0.8788 0.8844 -0.1529 -0.0987 0.0018  9   PRO H C   
2350 O  O   . PRO B 9   ? 0.9205 0.8882 0.8821 -0.1680 -0.1040 0.0083  9   PRO H O   
2351 C  CB  . PRO B 9   ? 0.8967 0.8404 0.8941 -0.1402 -0.1078 0.0165  9   PRO H CB  
2352 C  CG  . PRO B 9   ? 0.9495 0.9066 0.9499 -0.1431 -0.1162 0.0305  9   PRO H CG  
2353 C  CD  . PRO B 9   ? 0.8847 0.8702 0.8677 -0.1572 -0.1161 0.0327  9   PRO H CD  
2354 N  N   . GLU B 10  ? 0.8648 0.8250 0.8353 -0.1463 -0.0909 -0.0109 10  GLU H N   
2355 C  CA  . GLU B 10  ? 0.8734 0.8280 0.8299 -0.1564 -0.0887 -0.0181 10  GLU H CA  
2356 C  C   . GLU B 10  ? 0.9396 0.8611 0.8960 -0.1545 -0.0834 -0.0279 10  GLU H C   
2357 O  O   . GLU B 10  ? 0.9293 0.8434 0.8949 -0.1423 -0.0764 -0.0359 10  GLU H O   
2358 C  CB  . GLU B 10  ? 0.8711 0.8516 0.8225 -0.1547 -0.0854 -0.0241 10  GLU H CB  
2359 C  CG  . GLU B 10  ? 0.9968 1.0096 0.9480 -0.1615 -0.0899 -0.0174 10  GLU H CG  
2360 C  CD  . GLU B 10  ? 1.2877 1.3047 1.2289 -0.1791 -0.0947 -0.0135 10  GLU H CD  
2361 O  OE1 . GLU B 10  ? 1.2372 1.2277 1.1696 -0.1877 -0.0961 -0.0139 10  GLU H OE1 
2362 O  OE2 . GLU B 10  ? 1.2129 1.2604 1.1567 -0.1847 -0.0965 -0.0109 10  GLU H OE2 
2363 N  N   . LEU B 11  ? 0.9196 0.8216 0.8655 -0.1678 -0.0856 -0.0288 11  LEU H N   
2364 C  CA  . LEU B 11  ? 0.9426 0.8117 0.8868 -0.1684 -0.0786 -0.0413 11  LEU H CA  
2365 C  C   . LEU B 11  ? 1.0017 0.8732 0.9236 -0.1829 -0.0762 -0.0492 11  LEU H C   
2366 O  O   . LEU B 11  ? 0.9993 0.8801 0.9102 -0.1970 -0.0834 -0.0418 11  LEU H O   
2367 C  CB  . LEU B 11  ? 0.9716 0.8088 0.9246 -0.1713 -0.0836 -0.0364 11  LEU H CB  
2368 C  CG  . LEU B 11  ? 1.0636 0.8629 1.0206 -0.1703 -0.0751 -0.0516 11  LEU H CG  
2369 C  CD1 . LEU B 11  ? 1.0594 0.8587 1.0226 -0.1586 -0.0610 -0.0687 11  LEU H CD1 
2370 C  CD2 . LEU B 11  ? 1.1129 0.8855 1.0917 -0.1642 -0.0811 -0.0446 11  LEU H CD2 
2371 N  N   . VAL B 12  ? 0.9647 0.8295 0.8791 -0.1816 -0.0666 -0.0637 12  VAL H N   
2372 C  CA  . VAL B 12  ? 0.9736 0.8435 0.8645 -0.1976 -0.0664 -0.0693 12  VAL H CA  
2373 C  C   . VAL B 12  ? 1.0493 0.8943 0.9272 -0.2035 -0.0550 -0.0873 12  VAL H C   
2374 O  O   . VAL B 12  ? 1.0472 0.8781 0.9356 -0.1926 -0.0446 -0.0980 12  VAL H O   
2375 C  CB  . VAL B 12  ? 0.9946 0.9019 0.8821 -0.1964 -0.0712 -0.0631 12  VAL H CB  
2376 C  CG1 . VAL B 12  ? 0.9740 0.9085 0.8686 -0.1987 -0.0815 -0.0486 12  VAL H CG1 
2377 C  CG2 . VAL B 12  ? 0.9712 0.8869 0.8701 -0.1797 -0.0655 -0.0663 12  VAL H CG2 
2378 N  N   . LYS B 13  ? 1.0264 0.8698 0.8807 -0.2225 -0.0570 -0.0908 13  LYS H N   
2379 C  CA  . LYS B 13  ? 1.0562 0.8788 0.8897 -0.2352 -0.0471 -0.1080 13  LYS H CA  
2380 C  C   . LYS B 13  ? 1.0950 0.9364 0.9171 -0.2354 -0.0439 -0.1120 13  LYS H C   
2381 O  O   . LYS B 13  ? 1.0630 0.9346 0.8834 -0.2358 -0.0545 -0.0994 13  LYS H O   
2382 C  CB  . LYS B 13  ? 1.1156 0.9306 0.9257 -0.2587 -0.0529 -0.1078 13  LYS H CB  
2383 C  CG  . LYS B 13  ? 1.2907 1.1414 1.0914 -0.2685 -0.0666 -0.0935 13  LYS H CG  
2384 C  CD  . LYS B 13  ? 1.4443 1.2922 1.2266 -0.2912 -0.0741 -0.0908 13  LYS H CD  
2385 C  CE  . LYS B 13  ? 1.5563 1.4444 1.3384 -0.2975 -0.0879 -0.0762 13  LYS H CE  
2386 N  NZ  . LYS B 13  ? 1.6286 1.5443 1.4374 -0.2810 -0.0937 -0.0627 13  LYS H NZ  
2387 N  N   . PRO B 14  ? 1.0747 0.8976 0.8868 -0.2386 -0.0296 -0.1301 14  PRO H N   
2388 C  CA  . PRO B 14  ? 1.0701 0.9081 0.8629 -0.2461 -0.0278 -0.1334 14  PRO H CA  
2389 C  C   . PRO B 14  ? 1.1263 0.9835 0.8951 -0.2652 -0.0419 -0.1228 14  PRO H C   
2390 O  O   . PRO B 14  ? 1.1440 0.9929 0.8975 -0.2824 -0.0465 -0.1230 14  PRO H O   
2391 C  CB  . PRO B 14  ? 1.1282 0.9388 0.9060 -0.2562 -0.0097 -0.1570 14  PRO H CB  
2392 C  CG  . PRO B 14  ? 1.1939 0.9796 0.9971 -0.2430 -0.0007 -0.1656 14  PRO H CG  
2393 C  CD  . PRO B 14  ? 1.1273 0.9141 0.9390 -0.2423 -0.0151 -0.1495 14  PRO H CD  
2394 N  N   . GLY B 15  ? 1.0654 0.9479 0.8334 -0.2619 -0.0497 -0.1131 15  GLY H N   
2395 C  CA  . GLY B 15  ? 1.0651 0.9698 0.8186 -0.2763 -0.0657 -0.1003 15  GLY H CA  
2396 C  C   . GLY B 15  ? 1.0882 1.0179 0.8646 -0.2671 -0.0796 -0.0833 15  GLY H C   
2397 O  O   . GLY B 15  ? 1.0769 1.0301 0.8513 -0.2750 -0.0940 -0.0715 15  GLY H O   
2398 N  N   . ALA B 16  ? 1.0300 0.9565 0.8299 -0.2509 -0.0757 -0.0819 16  ALA H N   
2399 C  CA  . ALA B 16  ? 1.0030 0.9537 0.8241 -0.2432 -0.0860 -0.0679 16  ALA H CA  
2400 C  C   . ALA B 16  ? 1.0198 0.9959 0.8598 -0.2264 -0.0901 -0.0599 16  ALA H C   
2401 O  O   . ALA B 16  ? 1.0103 0.9817 0.8475 -0.2196 -0.0849 -0.0646 16  ALA H O   
2402 C  CB  . ALA B 16  ? 1.0117 0.9476 0.8465 -0.2354 -0.0810 -0.0685 16  ALA H CB  
2403 N  N   . SER B 17  ? 0.9554 0.9592 0.8136 -0.2215 -0.0993 -0.0488 17  SER H N   
2404 C  CA  . SER B 17  ? 0.9236 0.9515 0.8026 -0.2054 -0.1029 -0.0424 17  SER H CA  
2405 C  C   . SER B 17  ? 0.9514 0.9904 0.8514 -0.1943 -0.1009 -0.0385 17  SER H C   
2406 O  O   . SER B 17  ? 0.9537 0.9927 0.8529 -0.2031 -0.1023 -0.0362 17  SER H O   
2407 C  CB  . SER B 17  ? 0.9654 1.0201 0.8492 -0.2113 -0.1162 -0.0339 17  SER H CB  
2408 O  OG  . SER B 17  ? 1.0680 1.1469 0.9677 -0.2143 -0.1226 -0.0274 17  SER H OG  
2409 N  N   . VAL B 18  ? 0.8843 0.9325 0.8006 -0.1774 -0.0980 -0.0374 18  VAL H N   
2410 C  CA  . VAL B 18  ? 0.8648 0.9240 0.7977 -0.1692 -0.0960 -0.0339 18  VAL H CA  
2411 C  C   . VAL B 18  ? 0.8826 0.9699 0.8356 -0.1570 -0.0983 -0.0308 18  VAL H C   
2412 O  O   . VAL B 18  ? 0.8714 0.9617 0.8268 -0.1502 -0.0999 -0.0316 18  VAL H O   
2413 C  CB  . VAL B 18  ? 0.9201 0.9538 0.8516 -0.1626 -0.0880 -0.0372 18  VAL H CB  
2414 C  CG1 . VAL B 18  ? 0.9069 0.9346 0.8430 -0.1485 -0.0824 -0.0414 18  VAL H CG1 
2415 C  CG2 . VAL B 18  ? 0.9120 0.9527 0.8534 -0.1620 -0.0888 -0.0311 18  VAL H CG2 
2416 N  N   . ARG B 19  ? 0.8240 0.9295 0.7904 -0.1553 -0.0975 -0.0279 19  ARG H N   
2417 C  CA  . ARG B 19  ? 0.7989 0.9304 0.7853 -0.1447 -0.0972 -0.0277 19  ARG H CA  
2418 C  C   . ARG B 19  ? 0.8340 0.9626 0.8240 -0.1377 -0.0908 -0.0279 19  ARG H C   
2419 O  O   . ARG B 19  ? 0.8343 0.9573 0.8185 -0.1454 -0.0896 -0.0249 19  ARG H O   
2420 C  CB  . ARG B 19  ? 0.8017 0.9645 0.8025 -0.1517 -0.1013 -0.0259 19  ARG H CB  
2421 C  CG  . ARG B 19  ? 0.9357 1.1252 0.9613 -0.1401 -0.1019 -0.0282 19  ARG H CG  
2422 C  CD  . ARG B 19  ? 1.0962 1.3176 1.1389 -0.1458 -0.0998 -0.0296 19  ARG H CD  
2423 N  NE  . ARG B 19  ? 1.2368 1.4877 1.3082 -0.1395 -0.1037 -0.0319 19  ARG H NE  
2424 C  CZ  . ARG B 19  ? 1.4397 1.7238 1.5326 -0.1441 -0.1019 -0.0350 19  ARG H CZ  
2425 N  NH1 . ARG B 19  ? 1.2879 1.5805 1.3726 -0.1575 -0.0961 -0.0355 19  ARG H NH1 
2426 N  NH2 . ARG B 19  ? 1.2802 1.5904 1.4050 -0.1360 -0.1059 -0.0376 19  ARG H NH2 
2427 N  N   . ILE B 20  ? 0.7746 0.9069 0.7736 -0.1246 -0.0881 -0.0305 20  ILE H N   
2428 C  CA  . ILE B 20  ? 0.7633 0.8949 0.7657 -0.1184 -0.0831 -0.0305 20  ILE H CA  
2429 C  C   . ILE B 20  ? 0.8005 0.9612 0.8190 -0.1152 -0.0810 -0.0332 20  ILE H C   
2430 O  O   . ILE B 20  ? 0.7860 0.9601 0.8174 -0.1089 -0.0827 -0.0366 20  ILE H O   
2431 C  CB  . ILE B 20  ? 0.7990 0.9108 0.7979 -0.1077 -0.0803 -0.0323 20  ILE H CB  
2432 C  CG1 . ILE B 20  ? 0.8192 0.9046 0.8045 -0.1109 -0.0803 -0.0336 20  ILE H CG1 
2433 C  CG2 . ILE B 20  ? 0.8042 0.9131 0.8053 -0.1040 -0.0770 -0.0301 20  ILE H CG2 
2434 C  CD1 . ILE B 20  ? 0.9316 0.9989 0.9088 -0.1193 -0.0800 -0.0313 20  ILE H CD1 
2435 N  N   . THR B 21  ? 0.7610 0.9308 0.7790 -0.1205 -0.0775 -0.0321 21  THR H N   
2436 C  CA  . THR B 21  ? 0.7518 0.9500 0.7834 -0.1202 -0.0727 -0.0375 21  THR H CA  
2437 C  C   . THR B 21  ? 0.7981 0.9937 0.8283 -0.1146 -0.0682 -0.0391 21  THR H C   
2438 O  O   . THR B 21  ? 0.8005 0.9812 0.8183 -0.1189 -0.0693 -0.0328 21  THR H O   
2439 C  CB  . THR B 21  ? 0.8694 1.0858 0.8987 -0.1364 -0.0714 -0.0359 21  THR H CB  
2440 O  OG1 . THR B 21  ? 0.8805 1.0886 0.9027 -0.1449 -0.0770 -0.0311 21  THR H OG1 
2441 C  CG2 . THR B 21  ? 0.8436 1.0946 0.8918 -0.1374 -0.0654 -0.0448 21  THR H CG2 
2442 N  N   . CYS B 22  ? 0.7454 0.9569 0.7902 -0.1063 -0.0639 -0.0472 22  CYS H N   
2443 C  CA  . CYS B 22  ? 0.7388 0.9530 0.7839 -0.1025 -0.0587 -0.0512 22  CYS H CA  
2444 C  C   . CYS B 22  ? 0.7860 1.0295 0.8417 -0.1085 -0.0508 -0.0606 22  CYS H C   
2445 O  O   . CYS B 22  ? 0.7763 1.0365 0.8522 -0.1026 -0.0486 -0.0687 22  CYS H O   
2446 C  CB  . CYS B 22  ? 0.7341 0.9372 0.7861 -0.0877 -0.0595 -0.0545 22  CYS H CB  
2447 S  SG  . CYS B 22  ? 0.7827 0.9754 0.8253 -0.0853 -0.0565 -0.0539 22  CYS H SG  
2448 N  N   . LYS B 23  ? 0.7474 0.9984 0.7906 -0.1215 -0.0468 -0.0596 23  LYS H N   
2449 C  CA  . LYS B 23  ? 0.7468 1.0276 0.7963 -0.1316 -0.0368 -0.0703 23  LYS H CA  
2450 C  C   . LYS B 23  ? 0.7910 1.0732 0.8392 -0.1283 -0.0304 -0.0781 23  LYS H C   
2451 O  O   . LYS B 23  ? 0.7912 1.0595 0.8209 -0.1336 -0.0336 -0.0702 23  LYS H O   
2452 C  CB  . LYS B 23  ? 0.7934 1.0818 0.8248 -0.1533 -0.0372 -0.0631 23  LYS H CB  
2453 C  CG  . LYS B 23  ? 0.9791 1.3017 1.0152 -0.1674 -0.0251 -0.0757 23  LYS H CG  
2454 C  CD  . LYS B 23  ? 1.1217 1.4505 1.1364 -0.1916 -0.0267 -0.0666 23  LYS H CD  
2455 C  CE  . LYS B 23  ? 1.2628 1.6276 1.2797 -0.2086 -0.0128 -0.0805 23  LYS H CE  
2456 N  NZ  . LYS B 23  ? 1.3998 1.7707 1.3926 -0.2355 -0.0151 -0.0704 23  LYS H NZ  
2457 N  N   . ALA B 24  ? 0.7397 1.0383 0.8095 -0.1196 -0.0221 -0.0935 24  ALA H N   
2458 C  CA  . ALA B 24  ? 0.7376 1.0363 0.8071 -0.1166 -0.0151 -0.1032 24  ALA H CA  
2459 C  C   . ALA B 24  ? 0.7932 1.1199 0.8623 -0.1317 -0.0011 -0.1177 24  ALA H C   
2460 O  O   . ALA B 24  ? 0.7886 1.1402 0.8778 -0.1333 0.0069  -0.1295 24  ALA H O   
2461 C  CB  . ALA B 24  ? 0.7372 1.0292 0.8304 -0.0963 -0.0156 -0.1109 24  ALA H CB  
2462 N  N   . SER B 25  ? 0.7567 1.0806 0.8032 -0.1441 0.0018  -0.1172 25  SER H N   
2463 C  CA  . SER B 25  ? 0.7689 1.1180 0.8081 -0.1626 0.0159  -0.1316 25  SER H CA  
2464 C  C   . SER B 25  ? 0.8207 1.1630 0.8502 -0.1634 0.0209  -0.1394 25  SER H C   
2465 O  O   . SER B 25  ? 0.8089 1.1266 0.8302 -0.1544 0.0108  -0.1281 25  SER H O   
2466 C  CB  . SER B 25  ? 0.8291 1.1854 0.8407 -0.1879 0.0128  -0.1196 25  SER H CB  
2467 O  OG  . SER B 25  ? 0.9466 1.2843 0.9301 -0.1975 0.0034  -0.1045 25  SER H OG  
2468 N  N   . GLY B 26  ? 0.7894 1.1543 0.8193 -0.1757 0.0371  -0.1594 26  GLY H N   
2469 C  CA  . GLY B 26  ? 0.7964 1.1577 0.8137 -0.1814 0.0441  -0.1698 26  GLY H CA  
2470 C  C   . GLY B 26  ? 0.8309 1.1825 0.8745 -0.1592 0.0488  -0.1845 26  GLY H C   
2471 O  O   . GLY B 26  ? 0.8352 1.1786 0.8679 -0.1623 0.0527  -0.1916 26  GLY H O   
2472 N  N   . TYR B 27  ? 0.7659 1.1178 0.8439 -0.1380 0.0476  -0.1886 27  TYR H N   
2473 C  CA  . TYR B 27  ? 0.7548 1.0957 0.8604 -0.1169 0.0500  -0.2010 27  TYR H CA  
2474 C  C   . TYR B 27  ? 0.7893 1.1434 0.9360 -0.1009 0.0517  -0.2091 27  TYR H C   
2475 O  O   . TYR B 27  ? 0.7775 1.1451 0.9279 -0.1048 0.0481  -0.2013 27  TYR H O   
2476 C  CB  . TYR B 27  ? 0.7568 1.0645 0.8527 -0.1037 0.0343  -0.1837 27  TYR H CB  
2477 C  CG  . TYR B 27  ? 0.7586 1.0531 0.8641 -0.0895 0.0192  -0.1658 27  TYR H CG  
2478 C  CD1 . TYR B 27  ? 0.7773 1.0681 0.8638 -0.0973 0.0097  -0.1472 27  TYR H CD1 
2479 C  CD2 . TYR B 27  ? 0.7596 1.0433 0.8929 -0.0690 0.0139  -0.1677 27  TYR H CD2 
2480 C  CE1 . TYR B 27  ? 0.7723 1.0504 0.8654 -0.0861 -0.0024 -0.1333 27  TYR H CE1 
2481 C  CE2 . TYR B 27  ? 0.7576 1.0310 0.8970 -0.0593 0.0006  -0.1522 27  TYR H CE2 
2482 C  CZ  . TYR B 27  ? 0.8431 1.1142 0.9619 -0.0681 -0.0066 -0.1362 27  TYR H CZ  
2483 O  OH  . TYR B 27  ? 0.8436 1.1024 0.9653 -0.0602 -0.0187 -0.1226 27  TYR H OH  
2484 N  N   . THR B 28  ? 0.7427 1.0924 0.9218 -0.0832 0.0558  -0.2241 28  THR H N   
2485 C  CA  . THR B 28  ? 0.7313 1.0922 0.9544 -0.0662 0.0539  -0.2292 28  THR H CA  
2486 C  C   . THR B 28  ? 0.7583 1.0972 0.9792 -0.0540 0.0328  -0.2047 28  THR H C   
2487 O  O   . THR B 28  ? 0.7500 1.0607 0.9609 -0.0453 0.0229  -0.1950 28  THR H O   
2488 C  CB  . THR B 28  ? 0.8387 1.1988 1.0995 -0.0508 0.0624  -0.2508 28  THR H CB  
2489 O  OG1 . THR B 28  ? 0.8475 1.2231 1.1020 -0.0649 0.0834  -0.2748 28  THR H OG1 
2490 C  CG2 . THR B 28  ? 0.8152 1.1910 1.1277 -0.0338 0.0599  -0.2566 28  THR H CG2 
2491 N  N   . PHE B 29  ? 0.7029 1.0555 0.9294 -0.0565 0.0270  -0.1950 29  PHE H N   
2492 C  CA  . PHE B 29  ? 0.6865 1.0212 0.9074 -0.0492 0.0087  -0.1731 29  PHE H CA  
2493 C  C   . PHE B 29  ? 0.7241 1.0404 0.9705 -0.0287 -0.0034 -0.1691 29  PHE H C   
2494 O  O   . PHE B 29  ? 0.7142 1.0042 0.9421 -0.0248 -0.0165 -0.1527 29  PHE H O   
2495 C  CB  . PHE B 29  ? 0.7058 1.0629 0.9330 -0.0571 0.0070  -0.1680 29  PHE H CB  
2496 C  CG  . PHE B 29  ? 0.7174 1.0567 0.9355 -0.0529 -0.0106 -0.1470 29  PHE H CG  
2497 C  CD1 . PHE B 29  ? 0.7555 1.0745 0.9359 -0.0619 -0.0172 -0.1312 29  PHE H CD1 
2498 C  CD2 . PHE B 29  ? 0.7412 1.0839 0.9895 -0.0406 -0.0208 -0.1433 29  PHE H CD2 
2499 C  CE1 . PHE B 29  ? 0.7618 1.0640 0.9334 -0.0592 -0.0312 -0.1148 29  PHE H CE1 
2500 C  CE2 . PHE B 29  ? 0.7730 1.0990 1.0090 -0.0397 -0.0364 -0.1250 29  PHE H CE2 
2501 C  CZ  . PHE B 29  ? 0.7475 1.0532 0.9444 -0.0493 -0.0403 -0.1121 29  PHE H CZ  
2502 N  N   . THR B 30  ? 0.6773 1.0079 0.9668 -0.0168 0.0008  -0.1838 30  THR H N   
2503 C  CA  . THR B 30  ? 0.6711 0.9853 0.9893 0.0018  -0.0123 -0.1793 30  THR H CA  
2504 C  C   . THR B 30  ? 0.7139 0.9977 1.0207 0.0084  -0.0144 -0.1799 30  THR H C   
2505 O  O   . THR B 30  ? 0.7107 0.9741 1.0310 0.0208  -0.0286 -0.1708 30  THR H O   
2506 C  CB  . THR B 30  ? 0.7812 1.1216 1.1550 0.0129  -0.0077 -0.1951 30  THR H CB  
2507 O  OG1 . THR B 30  ? 0.7809 1.1067 1.1812 0.0286  -0.0268 -0.1829 30  THR H OG1 
2508 C  CG2 . THR B 30  ? 0.7761 1.1257 1.1715 0.0161  0.0116  -0.2224 30  THR H CG2 
2509 N  N   . ASP B 31  ? 0.6647 0.9467 0.9479 -0.0014 -0.0006 -0.1909 31  ASP H N   
2510 C  CA  . ASP B 31  ? 0.6660 0.9228 0.9391 0.0024  0.0001  -0.1947 31  ASP H CA  
2511 C  C   . ASP B 31  ? 0.6960 0.9220 0.9423 0.0043  -0.0158 -0.1734 31  ASP H C   
2512 O  O   . ASP B 31  ? 0.6970 0.9008 0.9499 0.0132  -0.0215 -0.1732 31  ASP H O   
2513 C  CB  . ASP B 31  ? 0.6982 0.9631 0.9481 -0.0125 0.0175  -0.2096 31  ASP H CB  
2514 C  CG  . ASP B 31  ? 0.8447 1.1272 1.1255 -0.0103 0.0352  -0.2377 31  ASP H CG  
2515 O  OD1 . ASP B 31  ? 0.8566 1.1401 1.1814 0.0065  0.0327  -0.2455 31  ASP H OD1 
2516 O  OD2 . ASP B 31  ? 0.9280 1.2224 1.1897 -0.0259 0.0511  -0.2520 31  ASP H OD2 
2517 N  N   . PHE B 32  ? 0.6316 0.8558 0.8490 -0.0045 -0.0223 -0.1566 32  PHE H N   
2518 C  CA  . PHE B 32  ? 0.6204 0.8177 0.8125 -0.0041 -0.0344 -0.1391 32  PHE H CA  
2519 C  C   . PHE B 32  ? 0.6587 0.8532 0.8453 -0.0042 -0.0467 -0.1224 32  PHE H C   
2520 O  O   . PHE B 32  ? 0.6497 0.8632 0.8408 -0.0090 -0.0449 -0.1220 32  PHE H O   
2521 C  CB  . PHE B 32  ? 0.6389 0.8304 0.7959 -0.0163 -0.0286 -0.1367 32  PHE H CB  
2522 C  CG  . PHE B 32  ? 0.6655 0.8638 0.8211 -0.0218 -0.0150 -0.1537 32  PHE H CG  
2523 C  CD1 . PHE B 32  ? 0.7119 0.8921 0.8677 -0.0174 -0.0146 -0.1594 32  PHE H CD1 
2524 C  CD2 . PHE B 32  ? 0.6928 0.9152 0.8452 -0.0335 -0.0025 -0.1646 32  PHE H CD2 
2525 C  CE1 . PHE B 32  ? 0.7348 0.9204 0.8872 -0.0245 -0.0014 -0.1765 32  PHE H CE1 
2526 C  CE2 . PHE B 32  ? 0.7406 0.9698 0.8888 -0.0416 0.0109  -0.1818 32  PHE H CE2 
2527 C  CZ  . PHE B 32  ? 0.7256 0.9361 0.8738 -0.0369 0.0117  -0.1882 32  PHE H CZ  
2528 N  N   . ASN B 33  ? 0.6117 0.7823 0.7853 -0.0014 -0.0583 -0.1092 33  ASN H N   
2529 C  CA  . ASN B 33  ? 0.6031 0.7677 0.7658 -0.0040 -0.0693 -0.0941 33  ASN H CA  
2530 C  C   . ASN B 33  ? 0.6404 0.8069 0.7752 -0.0149 -0.0647 -0.0887 33  ASN H C   
2531 O  O   . ASN B 33  ? 0.6333 0.7997 0.7535 -0.0201 -0.0566 -0.0925 33  ASN H O   
2532 C  CB  . ASN B 33  ? 0.6144 0.7535 0.7682 -0.0009 -0.0811 -0.0832 33  ASN H CB  
2533 C  CG  . ASN B 33  ? 0.8842 1.0179 1.0664 0.0092  -0.0912 -0.0830 33  ASN H CG  
2534 O  OD1 . ASN B 33  ? 0.8187 0.9664 1.0317 0.0166  -0.0874 -0.0942 33  ASN H OD1 
2535 N  ND2 . ASN B 33  ? 0.7774 0.8910 0.9509 0.0087  -0.1046 -0.0703 33  ASN H ND2 
2536 N  N   . MET B 34  ? 0.5914 0.7594 0.7203 -0.0191 -0.0709 -0.0797 34  MET H N   
2537 C  CA  . MET B 34  ? 0.5831 0.7497 0.6890 -0.0286 -0.0682 -0.0740 34  MET H CA  
2538 C  C   . MET B 34  ? 0.6235 0.7696 0.7121 -0.0302 -0.0759 -0.0634 34  MET H C   
2539 O  O   . MET B 34  ? 0.6236 0.7646 0.7177 -0.0282 -0.0851 -0.0584 34  MET H O   
2540 C  CB  . MET B 34  ? 0.6123 0.7988 0.7249 -0.0346 -0.0664 -0.0750 34  MET H CB  
2541 C  CG  . MET B 34  ? 0.6607 0.8455 0.7517 -0.0451 -0.0629 -0.0702 34  MET H CG  
2542 S  SD  . MET B 34  ? 0.7166 0.9041 0.7958 -0.0504 -0.0536 -0.0746 34  MET H SD  
2543 C  CE  . MET B 34  ? 0.6757 0.8935 0.7692 -0.0570 -0.0451 -0.0854 34  MET H CE  
2544 N  N   . ASP B 35  ? 0.5677 0.7026 0.6365 -0.0345 -0.0723 -0.0603 35  ASP H N   
2545 C  CA  . ASP B 35  ? 0.5644 0.6810 0.6165 -0.0374 -0.0760 -0.0535 35  ASP H CA  
2546 C  C   . ASP B 35  ? 0.6052 0.7198 0.6455 -0.0442 -0.0735 -0.0506 35  ASP H C   
2547 O  O   . ASP B 35  ? 0.5962 0.7196 0.6374 -0.0468 -0.0690 -0.0519 35  ASP H O   
2548 C  CB  . ASP B 35  ? 0.5854 0.6891 0.6291 -0.0353 -0.0736 -0.0538 35  ASP H CB  
2549 C  CG  . ASP B 35  ? 0.6826 0.7819 0.7355 -0.0297 -0.0780 -0.0552 35  ASP H CG  
2550 O  OD1 . ASP B 35  ? 0.6839 0.7945 0.7549 -0.0248 -0.0784 -0.0603 35  ASP H OD1 
2551 O  OD2 . ASP B 35  ? 0.7444 0.8289 0.7876 -0.0307 -0.0810 -0.0518 35  ASP H OD2 
2552 N  N   . TRP B 36  ? 0.5614 0.6633 0.5897 -0.0485 -0.0766 -0.0467 36  TRP H N   
2553 C  CA  . TRP B 36  ? 0.5591 0.6549 0.5771 -0.0548 -0.0737 -0.0453 36  TRP H CA  
2554 C  C   . TRP B 36  ? 0.5965 0.6760 0.6030 -0.0558 -0.0695 -0.0459 36  TRP H C   
2555 O  O   . TRP B 36  ? 0.5959 0.6670 0.5955 -0.0565 -0.0710 -0.0459 36  TRP H O   
2556 C  CB  . TRP B 36  ? 0.5521 0.6496 0.5670 -0.0614 -0.0791 -0.0430 36  TRP H CB  
2557 C  CG  . TRP B 36  ? 0.5608 0.6783 0.5904 -0.0611 -0.0815 -0.0433 36  TRP H CG  
2558 C  CD1 . TRP B 36  ? 0.5937 0.7244 0.6399 -0.0565 -0.0866 -0.0441 36  TRP H CD1 
2559 C  CD2 . TRP B 36  ? 0.5552 0.6831 0.5869 -0.0659 -0.0783 -0.0438 36  TRP H CD2 
2560 N  NE1 . TRP B 36  ? 0.5828 0.7339 0.6425 -0.0582 -0.0852 -0.0465 36  TRP H NE1 
2561 C  CE2 . TRP B 36  ? 0.6009 0.7506 0.6495 -0.0652 -0.0801 -0.0460 36  TRP H CE2 
2562 C  CE3 . TRP B 36  ? 0.5759 0.6963 0.5981 -0.0715 -0.0747 -0.0420 36  TRP H CE3 
2563 C  CZ2 . TRP B 36  ? 0.5913 0.7572 0.6440 -0.0719 -0.0771 -0.0471 36  TRP H CZ2 
2564 C  CZ3 . TRP B 36  ? 0.5954 0.7285 0.6203 -0.0782 -0.0740 -0.0409 36  TRP H CZ3 
2565 C  CH2 . TRP B 36  ? 0.5988 0.7551 0.6370 -0.0793 -0.0745 -0.0437 36  TRP H CH2 
2566 N  N   . VAL B 37  ? 0.5397 0.6156 0.5462 -0.0564 -0.0645 -0.0463 37  VAL H N   
2567 C  CA  . VAL B 37  ? 0.5363 0.5997 0.5389 -0.0559 -0.0589 -0.0484 37  VAL H CA  
2568 C  C   . VAL B 37  ? 0.5842 0.6373 0.5839 -0.0603 -0.0560 -0.0497 37  VAL H C   
2569 O  O   . VAL B 37  ? 0.5769 0.6332 0.5804 -0.0621 -0.0583 -0.0466 37  VAL H O   
2570 C  CB  . VAL B 37  ? 0.5742 0.6424 0.5859 -0.0502 -0.0564 -0.0477 37  VAL H CB  
2571 C  CG1 . VAL B 37  ? 0.5758 0.6348 0.5905 -0.0490 -0.0505 -0.0500 37  VAL H CG1 
2572 C  CG2 . VAL B 37  ? 0.5648 0.6387 0.5773 -0.0469 -0.0582 -0.0484 37  VAL H CG2 
2573 N  N   . LYS B 38  ? 0.5455 0.5857 0.5390 -0.0628 -0.0501 -0.0550 38  LYS H N   
2574 C  CA  . LYS B 38  ? 0.5531 0.5806 0.5460 -0.0664 -0.0454 -0.0591 38  LYS H CA  
2575 C  C   . LYS B 38  ? 0.6054 0.6268 0.6101 -0.0612 -0.0374 -0.0640 38  LYS H C   
2576 O  O   . LYS B 38  ? 0.6010 0.6227 0.6029 -0.0611 -0.0322 -0.0687 38  LYS H O   
2577 C  CB  . LYS B 38  ? 0.5973 0.6156 0.5719 -0.0767 -0.0440 -0.0641 38  LYS H CB  
2578 C  CG  . LYS B 38  ? 0.7391 0.7413 0.7117 -0.0815 -0.0365 -0.0720 38  LYS H CG  
2579 C  CD  . LYS B 38  ? 0.8488 0.8415 0.8008 -0.0933 -0.0316 -0.0800 38  LYS H CD  
2580 C  CE  . LYS B 38  ? 0.9562 0.9317 0.9066 -0.0987 -0.0224 -0.0906 38  LYS H CE  
2581 N  NZ  . LYS B 38  ? 1.0697 1.0361 0.9948 -0.1144 -0.0174 -0.0993 38  LYS H NZ  
2582 N  N   . GLN B 39  ? 0.5685 0.5833 0.5869 -0.0582 -0.0366 -0.0633 39  GLN H N   
2583 C  CA  . GLN B 39  ? 0.5722 0.5818 0.6082 -0.0522 -0.0296 -0.0682 39  GLN H CA  
2584 C  C   . GLN B 39  ? 0.6528 0.6450 0.6944 -0.0541 -0.0239 -0.0757 39  GLN H C   
2585 O  O   . GLN B 39  ? 0.6520 0.6375 0.7004 -0.0538 -0.0298 -0.0698 39  GLN H O   
2586 C  CB  . GLN B 39  ? 0.5742 0.5933 0.6295 -0.0445 -0.0357 -0.0589 39  GLN H CB  
2587 C  CG  . GLN B 39  ? 0.6924 0.7116 0.7696 -0.0376 -0.0295 -0.0633 39  GLN H CG  
2588 C  CD  . GLN B 39  ? 0.8614 0.8914 0.9565 -0.0320 -0.0379 -0.0520 39  GLN H CD  
2589 O  OE1 . GLN B 39  ? 0.7808 0.8152 0.8720 -0.0343 -0.0479 -0.0412 39  GLN H OE1 
2590 N  NE2 . GLN B 39  ? 0.7536 0.7896 0.8682 -0.0263 -0.0341 -0.0543 39  GLN H NE2 
2591 N  N   . SER B 40  ? 0.6333 0.6176 0.6709 -0.0576 -0.0117 -0.0895 40  SER H N   
2592 C  CA  . SER B 40  ? 0.6563 0.6225 0.7013 -0.0594 -0.0031 -0.1007 40  SER H CA  
2593 C  C   . SER B 40  ? 0.7128 0.6765 0.7937 -0.0471 -0.0025 -0.0996 40  SER H C   
2594 O  O   . SER B 40  ? 0.6944 0.6721 0.7901 -0.0397 -0.0043 -0.0947 40  SER H O   
2595 C  CB  . SER B 40  ? 0.7194 0.6800 0.7501 -0.0683 0.0115  -0.1175 40  SER H CB  
2596 O  OG  . SER B 40  ? 0.8380 0.7950 0.8365 -0.0821 0.0087  -0.1177 40  SER H OG  
2597 N  N   . PRO B 41  ? 0.6931 0.6392 0.7888 -0.0449 -0.0033 -0.1010 41  PRO H N   
2598 C  CA  . PRO B 41  ? 0.6940 0.6367 0.8283 -0.0326 -0.0060 -0.0973 41  PRO H CA  
2599 C  C   . PRO B 41  ? 0.7450 0.6954 0.9041 -0.0249 0.0067  -0.1096 41  PRO H C   
2600 O  O   . PRO B 41  ? 0.7508 0.6969 0.9029 -0.0299 0.0229  -0.1282 41  PRO H O   
2601 C  CB  . PRO B 41  ? 0.7408 0.6582 0.8832 -0.0340 -0.0059 -0.1015 41  PRO H CB  
2602 C  CG  . PRO B 41  ? 0.7996 0.7126 0.9058 -0.0472 -0.0097 -0.0990 41  PRO H CG  
2603 C  CD  . PRO B 41  ? 0.7321 0.6594 0.8121 -0.0542 -0.0025 -0.1059 41  PRO H CD  
2604 N  N   . GLY B 42  ? 0.6920 0.6558 0.8777 -0.0149 -0.0010 -0.0988 42  GLY H N   
2605 C  CA  . GLY B 42  ? 0.6890 0.6656 0.9031 -0.0071 0.0084  -0.1073 42  GLY H CA  
2606 C  C   . GLY B 42  ? 0.7325 0.7236 0.9220 -0.0146 0.0191  -0.1161 42  GLY H C   
2607 O  O   . GLY B 42  ? 0.7361 0.7337 0.9401 -0.0134 0.0340  -0.1312 42  GLY H O   
2608 N  N   . LYS B 43  ? 0.6759 0.6718 0.8288 -0.0232 0.0118  -0.1074 43  LYS H N   
2609 C  CA  . LYS B 43  ? 0.6687 0.6743 0.7941 -0.0321 0.0183  -0.1128 43  LYS H CA  
2610 C  C   . LYS B 43  ? 0.6923 0.7120 0.8057 -0.0319 0.0061  -0.0979 43  LYS H C   
2611 O  O   . LYS B 43  ? 0.6771 0.6993 0.7968 -0.0276 -0.0069 -0.0840 43  LYS H O   
2612 C  CB  . LYS B 43  ? 0.7163 0.7091 0.8076 -0.0449 0.0230  -0.1206 43  LYS H CB  
2613 C  CG  . LYS B 43  ? 0.8999 0.8875 0.9847 -0.0534 0.0416  -0.1410 43  LYS H CG  
2614 C  CD  . LYS B 43  ? 1.0364 1.0135 1.1533 -0.0467 0.0534  -0.1554 43  LYS H CD  
2615 C  CE  . LYS B 43  ? 1.1917 1.1720 1.3108 -0.0535 0.0749  -0.1775 43  LYS H CE  
2616 N  NZ  . LYS B 43  ? 1.2936 1.2952 1.4172 -0.0530 0.0779  -0.1761 43  LYS H NZ  
2617 N  N   . SER B 44  ? 0.6427 0.6708 0.7375 -0.0384 0.0105  -0.1011 44  SER H N   
2618 C  CA  . SER B 44  ? 0.6219 0.6610 0.7043 -0.0390 0.0006  -0.0897 44  SER H CA  
2619 C  C   . SER B 44  ? 0.6633 0.6970 0.7192 -0.0446 -0.0082 -0.0833 44  SER H C   
2620 O  O   . SER B 44  ? 0.6694 0.6920 0.7121 -0.0503 -0.0060 -0.0879 44  SER H O   
2621 C  CB  . SER B 44  ? 0.6641 0.7115 0.7383 -0.0444 0.0080  -0.0955 44  SER H CB  
2622 O  OG  . SER B 44  ? 0.7458 0.8009 0.8090 -0.0447 -0.0017 -0.0851 44  SER H OG  
2623 N  N   . LEU B 45  ? 0.6025 0.6452 0.6522 -0.0433 -0.0176 -0.0735 45  LEU H N   
2624 C  CA  . LEU B 45  ? 0.5946 0.6369 0.6264 -0.0467 -0.0261 -0.0675 45  LEU H CA  
2625 C  C   . LEU B 45  ? 0.6531 0.6907 0.6626 -0.0550 -0.0244 -0.0713 45  LEU H C   
2626 O  O   . LEU B 45  ? 0.6543 0.6923 0.6584 -0.0587 -0.0190 -0.0756 45  LEU H O   
2627 C  CB  . LEU B 45  ? 0.5797 0.6337 0.6153 -0.0428 -0.0340 -0.0591 45  LEU H CB  
2628 C  CG  . LEU B 45  ? 0.6314 0.6918 0.6855 -0.0378 -0.0381 -0.0526 45  LEU H CG  
2629 C  CD1 . LEU B 45  ? 0.6237 0.6957 0.6800 -0.0367 -0.0421 -0.0479 45  LEU H CD1 
2630 C  CD2 . LEU B 45  ? 0.6615 0.7196 0.7149 -0.0390 -0.0442 -0.0472 45  LEU H CD2 
2631 N  N   . GLU B 46  ? 0.6152 0.6488 0.6116 -0.0593 -0.0302 -0.0687 46  GLU H N   
2632 C  CA  . GLU B 46  ? 0.6251 0.6541 0.6006 -0.0684 -0.0328 -0.0690 46  GLU H CA  
2633 C  C   . GLU B 46  ? 0.6670 0.7024 0.6414 -0.0662 -0.0443 -0.0607 46  GLU H C   
2634 O  O   . GLU B 46  ? 0.6525 0.6930 0.6354 -0.0623 -0.0480 -0.0577 46  GLU H O   
2635 C  CB  . GLU B 46  ? 0.6612 0.6795 0.6233 -0.0781 -0.0284 -0.0753 46  GLU H CB  
2636 C  CG  . GLU B 46  ? 0.8092 0.8209 0.7731 -0.0816 -0.0143 -0.0872 46  GLU H CG  
2637 C  CD  . GLU B 46  ? 1.0933 1.0931 1.0440 -0.0920 -0.0084 -0.0957 46  GLU H CD  
2638 O  OE1 . GLU B 46  ? 1.0263 1.0197 0.9908 -0.0886 0.0004  -0.1042 46  GLU H OE1 
2639 O  OE2 . GLU B 46  ? 1.0363 1.0323 0.9637 -0.1039 -0.0137 -0.0936 46  GLU H OE2 
2640 N  N   . TRP B 47  ? 0.6294 0.6644 0.5947 -0.0691 -0.0500 -0.0573 47  TRP H N   
2641 C  CA  . TRP B 47  ? 0.6223 0.6633 0.5919 -0.0656 -0.0606 -0.0509 47  TRP H CA  
2642 C  C   . TRP B 47  ? 0.6883 0.7261 0.6471 -0.0736 -0.0679 -0.0478 47  TRP H C   
2643 O  O   . TRP B 47  ? 0.6988 0.7286 0.6417 -0.0830 -0.0712 -0.0459 47  TRP H O   
2644 C  CB  . TRP B 47  ? 0.6055 0.6464 0.5761 -0.0631 -0.0646 -0.0482 47  TRP H CB  
2645 C  CG  . TRP B 47  ? 0.6139 0.6604 0.5947 -0.0577 -0.0745 -0.0437 47  TRP H CG  
2646 C  CD1 . TRP B 47  ? 0.6364 0.6942 0.6336 -0.0493 -0.0744 -0.0451 47  TRP H CD1 
2647 C  CD2 . TRP B 47  ? 0.6233 0.6646 0.6008 -0.0607 -0.0857 -0.0377 47  TRP H CD2 
2648 N  NE1 . TRP B 47  ? 0.6316 0.6927 0.6387 -0.0456 -0.0828 -0.0428 47  TRP H NE1 
2649 C  CE2 . TRP B 47  ? 0.6644 0.7149 0.6617 -0.0514 -0.0912 -0.0371 47  TRP H CE2 
2650 C  CE3 . TRP B 47  ? 0.6587 0.6887 0.6186 -0.0717 -0.0923 -0.0324 47  TRP H CE3 
2651 C  CZ2 . TRP B 47  ? 0.6641 0.7121 0.6694 -0.0500 -0.1037 -0.0313 47  TRP H CZ2 
2652 C  CZ3 . TRP B 47  ? 0.6871 0.7142 0.6512 -0.0722 -0.1068 -0.0241 47  TRP H CZ3 
2653 C  CH2 . TRP B 47  ? 0.6844 0.7201 0.6736 -0.0601 -0.1127 -0.0235 47  TRP H CH2 
2654 N  N   . ILE B 48  ? 0.6446 0.6897 0.6113 -0.0717 -0.0713 -0.0463 48  ILE H N   
2655 C  CA  . ILE B 48  ? 0.6564 0.7013 0.6154 -0.0798 -0.0793 -0.0426 48  ILE H CA  
2656 C  C   . ILE B 48  ? 0.7238 0.7735 0.6890 -0.0780 -0.0918 -0.0354 48  ILE H C   
2657 O  O   . ILE B 48  ? 0.7335 0.7777 0.6866 -0.0875 -0.1006 -0.0300 48  ILE H O   
2658 C  CB  . ILE B 48  ? 0.6882 0.7403 0.6541 -0.0798 -0.0789 -0.0433 48  ILE H CB  
2659 C  CG1 . ILE B 48  ? 0.6942 0.7376 0.6566 -0.0811 -0.0682 -0.0495 48  ILE H CG1 
2660 C  CG2 . ILE B 48  ? 0.7078 0.7617 0.6663 -0.0895 -0.0882 -0.0389 48  ILE H CG2 
2661 C  CD1 . ILE B 48  ? 0.7738 0.8226 0.7442 -0.0804 -0.0682 -0.0487 48  ILE H CD1 
2662 N  N   . GLY B 49  ? 0.6825 0.7417 0.6670 -0.0667 -0.0929 -0.0354 49  GLY H N   
2663 C  CA  . GLY B 49  ? 0.6900 0.7535 0.6880 -0.0620 -0.1042 -0.0302 49  GLY H CA  
2664 C  C   . GLY B 49  ? 0.7421 0.8208 0.7650 -0.0505 -0.1025 -0.0341 49  GLY H C   
2665 O  O   . GLY B 49  ? 0.7246 0.8110 0.7508 -0.0478 -0.0932 -0.0396 49  GLY H O   
2666 N  N   . ASP B 50  ? 0.7185 0.8015 0.7598 -0.0443 -0.1116 -0.0316 50  ASP H N   
2667 C  CA  . ASP B 50  ? 0.7136 0.8120 0.7804 -0.0340 -0.1080 -0.0384 50  ASP H CA  
2668 C  C   . ASP B 50  ? 0.7780 0.8917 0.8692 -0.0306 -0.1164 -0.0369 50  ASP H C   
2669 O  O   . ASP B 50  ? 0.7839 0.8928 0.8756 -0.0341 -0.1293 -0.0279 50  ASP H O   
2670 C  CB  . ASP B 50  ? 0.7393 0.8301 0.8129 -0.0268 -0.1064 -0.0419 50  ASP H CB  
2671 C  CG  . ASP B 50  ? 0.9034 0.9822 0.9850 -0.0243 -0.1197 -0.0351 50  ASP H CG  
2672 O  OD1 . ASP B 50  ? 0.9176 1.0049 1.0227 -0.0195 -0.1293 -0.0326 50  ASP H OD1 
2673 O  OD2 . ASP B 50  ? 0.9946 1.0568 1.0616 -0.0272 -0.1212 -0.0319 50  ASP H OD2 
2674 N  N   . PHE B 51  ? 0.7335 0.8663 0.8467 -0.0242 -0.1096 -0.0457 51  PHE H N   
2675 C  CA  . PHE B 51  ? 0.7355 0.8882 0.8783 -0.0201 -0.1149 -0.0470 51  PHE H CA  
2676 C  C   . PHE B 51  ? 0.7885 0.9531 0.9598 -0.0092 -0.1080 -0.0590 51  PHE H C   
2677 O  O   . PHE B 51  ? 0.7747 0.9426 0.9395 -0.0094 -0.0948 -0.0685 51  PHE H O   
2678 C  CB  . PHE B 51  ? 0.7532 0.9223 0.8911 -0.0283 -0.1104 -0.0478 51  PHE H CB  
2679 C  CG  . PHE B 51  ? 0.7728 0.9677 0.9427 -0.0255 -0.1138 -0.0505 51  PHE H CG  
2680 C  CD1 . PHE B 51  ? 0.8055 1.0213 1.0006 -0.0192 -0.1034 -0.0634 51  PHE H CD1 
2681 C  CD2 . PHE B 51  ? 0.8089 1.0093 0.9840 -0.0307 -0.1267 -0.0411 51  PHE H CD2 
2682 C  CE1 . PHE B 51  ? 0.8169 1.0594 1.0465 -0.0161 -0.1052 -0.0678 51  PHE H CE1 
2683 C  CE2 . PHE B 51  ? 0.8435 1.0711 1.0524 -0.0280 -0.1302 -0.0436 51  PHE H CE2 
2684 C  CZ  . PHE B 51  ? 0.8114 1.0606 1.0498 -0.0197 -0.1191 -0.0574 51  PHE H CZ  
2685 N  N   . ASN B 52  ? 0.7583 0.9312 0.9633 -0.0008 -0.1170 -0.0591 52  ASN H N   
2686 C  CA  . ASN B 52  ? 0.7573 0.9422 0.9956 0.0104  -0.1099 -0.0730 52  ASN H CA  
2687 C  C   . ASN B 52  ? 0.8108 1.0280 1.0777 0.0113  -0.1037 -0.0822 52  ASN H C   
2688 O  O   . ASN B 52  ? 0.8102 1.0384 1.1017 0.0141  -0.1155 -0.0761 52  ASN H O   
2689 C  CB  . ASN B 52  ? 0.7742 0.9437 1.0359 0.0211  -0.1234 -0.0687 52  ASN H CB  
2690 C  CG  . ASN B 52  ? 1.0178 1.1955 1.3168 0.0338  -0.1154 -0.0852 52  ASN H CG  
2691 O  OD1 . ASN B 52  ? 0.9297 1.1316 1.2464 0.0352  -0.1014 -0.1004 52  ASN H OD1 
2692 N  ND2 . ASN B 52  ? 0.9143 1.0713 1.2251 0.0419  -0.1234 -0.0835 52  ASN H ND2 
2693 N  N   . PRO B 53  ? 0.7662 1.0006 1.0323 0.0081  -0.0860 -0.0968 53  PRO H N   
2694 C  CA  . PRO B 53  ? 0.7627 1.0311 1.0588 0.0078  -0.0783 -0.1078 53  PRO H CA  
2695 C  C   . PRO B 53  ? 0.8273 1.1095 1.1764 0.0224  -0.0822 -0.1162 53  PRO H C   
2696 O  O   . PRO B 53  ? 0.8209 1.1266 1.1998 0.0239  -0.0874 -0.1153 53  PRO H O   
2697 C  CB  . PRO B 53  ? 0.7805 1.0589 1.0617 0.0004  -0.0585 -0.1226 53  PRO H CB  
2698 C  CG  . PRO B 53  ? 0.8345 1.0861 1.0731 -0.0058 -0.0592 -0.1137 53  PRO H CG  
2699 C  CD  . PRO B 53  ? 0.7825 1.0086 1.0241 0.0039  -0.0723 -0.1050 53  PRO H CD  
2700 N  N   . ASN B 54  ? 0.7983 1.0652 1.1610 0.0332  -0.0805 -0.1241 54  ASN H N   
2701 C  CA  . ASN B 54  ? 0.8085 1.0809 1.2235 0.0493  -0.0847 -0.1326 54  ASN H CA  
2702 C  C   . ASN B 54  ? 0.8651 1.1317 1.3034 0.0562  -0.1094 -0.1140 54  ASN H C   
2703 O  O   . ASN B 54  ? 0.8620 1.1525 1.3481 0.0644  -0.1135 -0.1182 54  ASN H O   
2704 C  CB  . ASN B 54  ? 0.8323 1.0803 1.2460 0.0567  -0.0795 -0.1419 54  ASN H CB  
2705 C  CG  . ASN B 54  ? 1.1543 1.4027 1.6234 0.0743  -0.0842 -0.1513 54  ASN H CG  
2706 O  OD1 . ASN B 54  ? 1.0929 1.3704 1.6063 0.0810  -0.0758 -0.1667 54  ASN H OD1 
2707 N  ND2 . ASN B 54  ? 1.0635 1.2793 1.5320 0.0815  -0.0976 -0.1423 54  ASN H ND2 
2708 N  N   . SER B 55  ? 0.8273 1.0643 1.2329 0.0513  -0.1259 -0.0937 55  SER H N   
2709 C  CA  . SER B 55  ? 0.8360 1.0652 1.2578 0.0542  -0.1511 -0.0740 55  SER H CA  
2710 C  C   . SER B 55  ? 0.8775 1.1166 1.2765 0.0404  -0.1597 -0.0595 55  SER H C   
2711 O  O   . SER B 55  ? 0.8839 1.1212 1.2951 0.0396  -0.1810 -0.0428 55  SER H O   
2712 C  CB  . SER B 55  ? 0.8957 1.0867 1.2971 0.0550  -0.1649 -0.0609 55  SER H CB  
2713 O  OG  . SER B 55  ? 0.9992 1.1719 1.3453 0.0397  -0.1670 -0.0482 55  SER H OG  
2714 N  N   . GLY B 56  ? 0.8174 1.0646 1.1825 0.0285  -0.1446 -0.0646 56  GLY H N   
2715 C  CA  . GLY B 56  ? 0.8129 1.0628 1.1481 0.0135  -0.1506 -0.0522 56  GLY H CA  
2716 C  C   . GLY B 56  ? 0.8699 1.0895 1.1732 0.0063  -0.1676 -0.0333 56  GLY H C   
2717 O  O   . GLY B 56  ? 0.8728 1.0944 1.1700 -0.0027 -0.1824 -0.0195 56  GLY H O   
2718 N  N   . GLY B 57  ? 0.8244 1.0178 1.1129 0.0102  -0.1671 -0.0330 57  GLY H N   
2719 C  CA  . GLY B 57  ? 0.8338 0.9979 1.0923 0.0028  -0.1814 -0.0171 57  GLY H CA  
2720 C  C   . GLY B 57  ? 0.8683 1.0164 1.0787 -0.0078 -0.1686 -0.0191 57  GLY H C   
2721 O  O   . GLY B 57  ? 0.8530 1.0000 1.0577 -0.0036 -0.1524 -0.0314 57  GLY H O   
2722 N  N   . SER B 58  ? 0.8249 0.9615 1.0018 -0.0221 -0.1757 -0.0076 58  SER H N   
2723 C  CA  . SER B 58  ? 0.8145 0.9370 0.9500 -0.0318 -0.1633 -0.0104 58  SER H CA  
2724 C  C   . SER B 58  ? 0.8694 0.9675 0.9726 -0.0435 -0.1724 0.0009  58  SER H C   
2725 O  O   . SER B 58  ? 0.8821 0.9758 0.9870 -0.0495 -0.1905 0.0139  58  SER H O   
2726 C  CB  . SER B 58  ? 0.8520 0.9877 0.9751 -0.0400 -0.1544 -0.0143 58  SER H CB  
2727 O  OG  . SER B 58  ? 0.9743 1.1187 1.1010 -0.0483 -0.1677 -0.0049 58  SER H OG  
2728 N  N   . ILE B 59  ? 0.8127 0.8964 0.8878 -0.0475 -0.1601 -0.0040 59  ILE H N   
2729 C  CA  . ILE B 59  ? 0.8225 0.8846 0.8650 -0.0599 -0.1638 0.0031  59  ILE H CA  
2730 C  C   . ILE B 59  ? 0.8533 0.9130 0.8672 -0.0701 -0.1504 -0.0027 59  ILE H C   
2731 O  O   . ILE B 59  ? 0.8299 0.8977 0.8484 -0.0639 -0.1362 -0.0127 59  ILE H O   
2732 C  CB  . ILE B 59  ? 0.8654 0.9124 0.9062 -0.0546 -0.1617 0.0018  59  ILE H CB  
2733 C  CG1 . ILE B 59  ? 0.8691 0.9201 0.9473 -0.0389 -0.1687 0.0009  59  ILE H CG1 
2734 C  CG2 . ILE B 59  ? 0.8999 0.9262 0.9104 -0.0696 -0.1699 0.0120  59  ILE H CG2 
2735 C  CD1 . ILE B 59  ? 0.9733 1.0292 1.0790 -0.0359 -0.1894 0.0120  59  ILE H CD1 
2736 N  N   . TYR B 60  ? 0.8175 0.8657 0.8024 -0.0865 -0.1549 0.0033  60  TYR H N   
2737 C  CA  . TYR B 60  ? 0.8099 0.8538 0.7698 -0.0964 -0.1414 -0.0041 60  TYR H CA  
2738 C  C   . TYR B 60  ? 0.8635 0.8907 0.7954 -0.1073 -0.1361 -0.0050 60  TYR H C   
2739 O  O   . TYR B 60  ? 0.8786 0.8960 0.7981 -0.1169 -0.1480 0.0045  60  TYR H O   
2740 C  CB  . TYR B 60  ? 0.8342 0.8824 0.7838 -0.1091 -0.1477 -0.0004 60  TYR H CB  
2741 C  CG  . TYR B 60  ? 0.8378 0.9058 0.8160 -0.1006 -0.1534 0.0009  60  TYR H CG  
2742 C  CD1 . TYR B 60  ? 0.8669 0.9441 0.8676 -0.0971 -0.1712 0.0113  60  TYR H CD1 
2743 C  CD2 . TYR B 60  ? 0.8310 0.9088 0.8145 -0.0976 -0.1423 -0.0073 60  TYR H CD2 
2744 C  CE1 . TYR B 60  ? 0.8636 0.9625 0.8938 -0.0899 -0.1753 0.0111  60  TYR H CE1 
2745 C  CE2 . TYR B 60  ? 0.8314 0.9295 0.8395 -0.0926 -0.1466 -0.0066 60  TYR H CE2 
2746 C  CZ  . TYR B 60  ? 0.9273 1.0376 0.9597 -0.0886 -0.1623 0.0018  60  TYR H CZ  
2747 O  OH  . TYR B 60  ? 0.9287 1.0626 0.9890 -0.0839 -0.1652 0.0010  60  TYR H OH  
2748 N  N   . ASN B 61  ? 0.8039 0.8283 0.7255 -0.1079 -0.1187 -0.0162 61  ASN H N   
2749 C  CA  . ASN B 61  ? 0.8133 0.8252 0.7094 -0.1198 -0.1102 -0.0202 61  ASN H CA  
2750 C  C   . ASN B 61  ? 0.8877 0.8928 0.7568 -0.1404 -0.1158 -0.0168 61  ASN H C   
2751 O  O   . ASN B 61  ? 0.8825 0.8931 0.7535 -0.1431 -0.1197 -0.0160 61  ASN H O   
2752 C  CB  . ASN B 61  ? 0.7967 0.8095 0.6947 -0.1148 -0.0911 -0.0334 61  ASN H CB  
2753 C  CG  . ASN B 61  ? 1.0512 1.0550 0.9302 -0.1247 -0.0791 -0.0406 61  ASN H CG  
2754 O  OD1 . ASN B 61  ? 1.0081 1.0036 0.8615 -0.1424 -0.0802 -0.0397 61  ASN H OD1 
2755 N  ND2 . ASN B 61  ? 0.9145 0.9216 0.8062 -0.1149 -0.0670 -0.0482 61  ASN H ND2 
2756 N  N   . GLN B 62  ? 0.8667 0.8606 0.7093 -0.1569 -0.1176 -0.0139 62  GLN H N   
2757 C  CA  . GLN B 62  ? 0.8947 0.8816 0.7056 -0.1808 -0.1221 -0.0113 62  GLN H CA  
2758 C  C   . GLN B 62  ? 0.9420 0.9288 0.7434 -0.1865 -0.1066 -0.0254 62  GLN H C   
2759 O  O   . GLN B 62  ? 0.9537 0.9394 0.7401 -0.2005 -0.1133 -0.0227 62  GLN H O   
2760 C  CB  . GLN B 62  ? 0.9404 0.9158 0.7209 -0.2000 -0.1215 -0.0093 62  GLN H CB  
2761 C  CG  . GLN B 62  ? 1.1505 1.1187 0.8946 -0.2286 -0.1308 -0.0030 62  GLN H CG  
2762 C  CD  . GLN B 62  ? 1.3787 1.3500 1.1311 -0.2300 -0.1572 0.0162  62  GLN H CD  
2763 O  OE1 . GLN B 62  ? 1.3041 1.2780 1.0824 -0.2151 -0.1721 0.0282  62  GLN H OE1 
2764 N  NE2 . GLN B 62  ? 1.2967 1.2677 1.0281 -0.2489 -0.1638 0.0190  62  GLN H NE2 
2765 N  N   . LYS B 63  ? 0.8809 0.8684 0.6932 -0.1757 -0.0873 -0.0397 63  LYS H N   
2766 C  CA  . LYS B 63  ? 0.8794 0.8642 0.6889 -0.1779 -0.0718 -0.0541 63  LYS H CA  
2767 C  C   . LYS B 63  ? 0.9162 0.9069 0.7393 -0.1716 -0.0788 -0.0508 63  LYS H C   
2768 O  O   . LYS B 63  ? 0.9281 0.9129 0.7372 -0.1831 -0.0738 -0.0577 63  LYS H O   
2769 C  CB  . LYS B 63  ? 0.8914 0.8772 0.7188 -0.1638 -0.0539 -0.0665 63  LYS H CB  
2770 C  CG  . LYS B 63  ? 1.0650 1.0471 0.8794 -0.1721 -0.0437 -0.0727 63  LYS H CG  
2771 C  CD  . LYS B 63  ? 1.1689 1.1548 1.0057 -0.1579 -0.0272 -0.0843 63  LYS H CD  
2772 C  CE  . LYS B 63  ? 1.3168 1.3020 1.1425 -0.1676 -0.0151 -0.0924 63  LYS H CE  
2773 N  NZ  . LYS B 63  ? 1.4581 1.4364 1.2612 -0.1869 -0.0002 -0.1077 63  LYS H NZ  
2774 N  N   . PHE B 64  ? 0.8474 0.8498 0.6963 -0.1556 -0.0902 -0.0408 64  PHE H N   
2775 C  CA  . PHE B 64  ? 0.8343 0.8460 0.6989 -0.1496 -0.0957 -0.0382 64  PHE H CA  
2776 C  C   . PHE B 64  ? 0.9033 0.9245 0.7727 -0.1533 -0.1154 -0.0245 64  PHE H C   
2777 O  O   . PHE B 64  ? 0.8800 0.9145 0.7711 -0.1441 -0.1203 -0.0216 64  PHE H O   
2778 C  CB  . PHE B 64  ? 0.8233 0.8444 0.7171 -0.1289 -0.0901 -0.0405 64  PHE H CB  
2779 C  CG  . PHE B 64  ? 0.8323 0.8465 0.7285 -0.1226 -0.0739 -0.0511 64  PHE H CG  
2780 C  CD1 . PHE B 64  ? 0.8720 0.8791 0.7674 -0.1240 -0.0625 -0.0606 64  PHE H CD1 
2781 C  CD2 . PHE B 64  ? 0.8486 0.8629 0.7496 -0.1159 -0.0707 -0.0513 64  PHE H CD2 
2782 C  CE1 . PHE B 64  ? 0.8776 0.8794 0.7811 -0.1171 -0.0490 -0.0696 64  PHE H CE1 
2783 C  CE2 . PHE B 64  ? 0.8773 0.8880 0.7839 -0.1104 -0.0567 -0.0604 64  PHE H CE2 
2784 C  CZ  . PHE B 64  ? 0.8552 0.8604 0.7650 -0.1103 -0.0462 -0.0693 64  PHE H CZ  
2785 N  N   . LYS B 65  ? 0.8985 0.9143 0.7492 -0.1675 -0.1274 -0.0156 65  LYS H N   
2786 C  CA  . LYS B 65  ? 0.9100 0.9350 0.7694 -0.1708 -0.1492 -0.0002 65  LYS H CA  
2787 C  C   . LYS B 65  ? 0.9791 1.0139 0.8413 -0.1774 -0.1553 0.0016  65  LYS H C   
2788 O  O   . LYS B 65  ? 0.9590 1.0106 0.8507 -0.1662 -0.1652 0.0081  65  LYS H O   
2789 C  CB  . LYS B 65  ? 0.9735 0.9883 0.8080 -0.1889 -0.1628 0.0109  65  LYS H CB  
2790 C  CG  . LYS B 65  ? 1.1712 1.1823 1.0173 -0.1782 -0.1672 0.0166  65  LYS H CG  
2791 C  CD  . LYS B 65  ? 1.3378 1.3440 1.1742 -0.1917 -0.1907 0.0349  65  LYS H CD  
2792 C  CE  . LYS B 65  ? 1.4836 1.4839 1.3342 -0.1808 -0.1974 0.0418  65  LYS H CE  
2793 N  NZ  . LYS B 65  ? 1.6358 1.6312 1.4862 -0.1905 -0.2246 0.0627  65  LYS H NZ  
2794 N  N   . ASP B 66  ? 0.9682 0.9933 0.8015 -0.1957 -0.1481 -0.0054 66  ASP H N   
2795 C  CA  . ASP B 66  ? 0.9778 1.0105 0.8104 -0.2047 -0.1539 -0.0037 66  ASP H CA  
2796 C  C   . ASP B 66  ? 1.0164 1.0523 0.8636 -0.1936 -0.1397 -0.0148 66  ASP H C   
2797 O  O   . ASP B 66  ? 1.0054 1.0546 0.8665 -0.1932 -0.1464 -0.0109 66  ASP H O   
2798 C  CB  . ASP B 66  ? 1.0406 1.0606 0.8328 -0.2332 -0.1559 -0.0047 66  ASP H CB  
2799 C  CG  . ASP B 66  ? 1.2000 1.2238 0.9810 -0.2490 -0.1796 0.0132  66  ASP H CG  
2800 O  OD1 . ASP B 66  ? 1.1926 1.2306 1.0041 -0.2356 -0.1962 0.0270  66  ASP H OD1 
2801 O  OD2 . ASP B 66  ? 1.3141 1.3268 1.0570 -0.2754 -0.1819 0.0134  66  ASP H OD2 
2802 N  N   . LYS B 67  ? 0.9695 0.9940 0.8154 -0.1850 -0.1214 -0.0272 67  LYS H N   
2803 C  CA  . LYS B 67  ? 0.9543 0.9777 0.8125 -0.1754 -0.1087 -0.0365 67  LYS H CA  
2804 C  C   . LYS B 67  ? 0.9765 1.0192 0.8675 -0.1579 -0.1129 -0.0313 67  LYS H C   
2805 O  O   . LYS B 67  ? 0.9666 1.0137 0.8645 -0.1579 -0.1105 -0.0333 67  LYS H O   
2806 C  CB  . LYS B 67  ? 0.9861 0.9942 0.8396 -0.1698 -0.0906 -0.0491 67  LYS H CB  
2807 C  CG  . LYS B 67  ? 1.1669 1.1660 1.0247 -0.1673 -0.0786 -0.0590 67  LYS H CG  
2808 C  CD  . LYS B 67  ? 1.3323 1.3142 1.1619 -0.1874 -0.0725 -0.0684 67  LYS H CD  
2809 C  CE  . LYS B 67  ? 1.4830 1.4538 1.3188 -0.1849 -0.0629 -0.0770 67  LYS H CE  
2810 N  NZ  . LYS B 67  ? 1.6020 1.5694 1.4491 -0.1717 -0.0521 -0.0830 67  LYS H NZ  
2811 N  N   . ALA B 68  ? 0.9188 0.9719 0.8289 -0.1444 -0.1180 -0.0258 68  ALA H N   
2812 C  CA  . ALA B 68  ? 0.8922 0.9636 0.8322 -0.1290 -0.1186 -0.0243 68  ALA H CA  
2813 C  C   . ALA B 68  ? 0.9368 1.0276 0.8996 -0.1235 -0.1330 -0.0152 68  ALA H C   
2814 O  O   . ALA B 68  ? 0.9404 1.0278 0.9017 -0.1242 -0.1425 -0.0087 68  ALA H O   
2815 C  CB  . ALA B 68  ? 0.8847 0.9520 0.8334 -0.1149 -0.1072 -0.0301 68  ALA H CB  
2816 N  N   . THR B 69  ? 0.8817 0.9929 0.8673 -0.1184 -0.1344 -0.0150 69  THR H N   
2817 C  CA  . THR B 69  ? 0.8708 1.0049 0.8874 -0.1105 -0.1453 -0.0094 69  THR H CA  
2818 C  C   . THR B 69  ? 0.8967 1.0469 0.9375 -0.0973 -0.1355 -0.0166 69  THR H C   
2819 O  O   . THR B 69  ? 0.8852 1.0384 0.9214 -0.1007 -0.1265 -0.0213 69  THR H O   
2820 C  CB  . THR B 69  ? 0.9844 1.1327 1.0051 -0.1224 -0.1576 -0.0026 69  THR H CB  
2821 O  OG1 . THR B 69  ? 1.0018 1.1332 0.9932 -0.1385 -0.1656 0.0032  69  THR H OG1 
2822 C  CG2 . THR B 69  ? 0.9590 1.1332 1.0183 -0.1135 -0.1702 0.0033  69  THR H CG2 
2823 N  N   . PHE B 70  ? 0.8434 1.0036 0.9095 -0.0839 -0.1378 -0.0172 70  PHE H N   
2824 C  CA  . PHE B 70  ? 0.8240 1.0005 0.9115 -0.0735 -0.1274 -0.0257 70  PHE H CA  
2825 C  C   . PHE B 70  ? 0.8760 1.0816 0.9985 -0.0691 -0.1321 -0.0269 70  PHE H C   
2826 O  O   . PHE B 70  ? 0.8758 1.0874 1.0189 -0.0643 -0.1445 -0.0215 70  PHE H O   
2827 C  CB  . PHE B 70  ? 0.8380 1.0044 0.9283 -0.0620 -0.1218 -0.0300 70  PHE H CB  
2828 C  CG  . PHE B 70  ? 0.8601 1.0005 0.9206 -0.0655 -0.1174 -0.0291 70  PHE H CG  
2829 C  CD1 . PHE B 70  ? 0.8984 1.0291 0.9376 -0.0731 -0.1091 -0.0313 70  PHE H CD1 
2830 C  CD2 . PHE B 70  ? 0.8897 1.0154 0.9458 -0.0613 -0.1212 -0.0266 70  PHE H CD2 
2831 C  CE1 . PHE B 70  ? 0.9146 1.0238 0.9319 -0.0755 -0.1039 -0.0322 70  PHE H CE1 
2832 C  CE2 . PHE B 70  ? 0.9293 1.0345 0.9601 -0.0654 -0.1155 -0.0272 70  PHE H CE2 
2833 C  CZ  . PHE B 70  ? 0.9050 1.0032 0.9183 -0.0719 -0.1063 -0.0308 70  PHE H CZ  
2834 N  N   . THR B 71  ? 0.8296 1.0538 0.9601 -0.0712 -0.1222 -0.0339 71  THR H N   
2835 C  CA  . THR B 71  ? 0.8242 1.0809 0.9895 -0.0685 -0.1225 -0.0383 71  THR H CA  
2836 C  C   . THR B 71  ? 0.8679 1.1378 1.0421 -0.0641 -0.1066 -0.0506 71  THR H C   
2837 O  O   . THR B 71  ? 0.8619 1.1167 1.0104 -0.0679 -0.0979 -0.0522 71  THR H O   
2838 C  CB  . THR B 71  ? 0.9343 1.2047 1.0959 -0.0826 -0.1267 -0.0339 71  THR H CB  
2839 O  OG1 . THR B 71  ? 0.9313 1.1933 1.0660 -0.0927 -0.1163 -0.0363 71  THR H OG1 
2840 C  CG2 . THR B 71  ? 0.9319 1.1898 1.0804 -0.0909 -0.1427 -0.0218 71  THR H CG2 
2841 N  N   . VAL B 72  ? 0.8217 1.1204 1.0323 -0.0575 -0.1027 -0.0596 72  VAL H N   
2842 C  CA  . VAL B 72  ? 0.8137 1.1267 1.0308 -0.0564 -0.0865 -0.0729 72  VAL H CA  
2843 C  C   . VAL B 72  ? 0.8631 1.2146 1.1103 -0.0604 -0.0799 -0.0822 72  VAL H C   
2844 O  O   . VAL B 72  ? 0.8585 1.2290 1.1388 -0.0556 -0.0880 -0.0815 72  VAL H O   
2845 C  CB  . VAL B 72  ? 0.8605 1.1634 1.0889 -0.0421 -0.0827 -0.0803 72  VAL H CB  
2846 C  CG1 . VAL B 72  ? 0.8613 1.1756 1.1320 -0.0286 -0.0909 -0.0827 72  VAL H CG1 
2847 C  CG2 . VAL B 72  ? 0.8542 1.1694 1.0822 -0.0444 -0.0656 -0.0944 72  VAL H CG2 
2848 N  N   . ASP B 73  ? 0.8186 1.1826 1.0566 -0.0691 -0.0651 -0.0916 73  ASP H N   
2849 C  CA  . ASP B 73  ? 0.8159 1.2177 1.0785 -0.0755 -0.0545 -0.1035 73  ASP H CA  
2850 C  C   . ASP B 73  ? 0.8590 1.2706 1.1338 -0.0700 -0.0387 -0.1208 73  ASP H C   
2851 O  O   . ASP B 73  ? 0.8554 1.2578 1.1008 -0.0789 -0.0297 -0.1231 73  ASP H O   
2852 C  CB  . ASP B 73  ? 0.8450 1.2522 1.0796 -0.0961 -0.0513 -0.0982 73  ASP H CB  
2853 C  CG  . ASP B 73  ? 0.9779 1.4267 1.2358 -0.1055 -0.0383 -0.1117 73  ASP H CG  
2854 O  OD1 . ASP B 73  ? 0.9861 1.4525 1.2676 -0.0985 -0.0256 -0.1284 73  ASP H OD1 
2855 O  OD2 . ASP B 73  ? 1.0593 1.5254 1.3177 -0.1187 -0.0408 -0.1074 73  ASP H OD2 
2856 N  N   . LYS B 74  ? 0.8104 1.2414 1.1300 -0.0563 -0.0358 -0.1334 74  LYS H N   
2857 C  CA  . LYS B 74  ? 0.8084 1.2486 1.1437 -0.0505 -0.0198 -0.1529 74  LYS H CA  
2858 C  C   . LYS B 74  ? 0.8587 1.3308 1.1930 -0.0667 -0.0002 -0.1688 74  LYS H C   
2859 O  O   . LYS B 74  ? 0.8585 1.3273 1.1763 -0.0719 0.0130  -0.1798 74  LYS H O   
2860 C  CB  . LYS B 74  ? 0.8395 1.2871 1.2260 -0.0300 -0.0236 -0.1615 74  LYS H CB  
2861 C  CG  . LYS B 74  ? 1.0069 1.4210 1.3901 -0.0169 -0.0438 -0.1446 74  LYS H CG  
2862 C  CD  . LYS B 74  ? 1.1337 1.5417 1.5551 0.0025  -0.0460 -0.1533 74  LYS H CD  
2863 C  CE  . LYS B 74  ? 1.2698 1.7011 1.7474 0.0142  -0.0559 -0.1538 74  LYS H CE  
2864 N  NZ  . LYS B 74  ? 1.3901 1.8098 1.9064 0.0342  -0.0610 -0.1600 74  LYS H NZ  
2865 N  N   . SER B 75  ? 0.8149 1.3179 1.1635 -0.0772 0.0015  -0.1695 75  SER H N   
2866 C  CA  . SER B 75  ? 0.8202 1.3564 1.1651 -0.0967 0.0204  -0.1840 75  SER H CA  
2867 C  C   . SER B 75  ? 0.8697 1.3865 1.1570 -0.1171 0.0229  -0.1746 75  SER H C   
2868 O  O   . SER B 75  ? 0.8742 1.4007 1.1465 -0.1297 0.0385  -0.1869 75  SER H O   
2869 C  CB  . SER B 75  ? 0.8659 1.4373 1.2356 -0.1051 0.0194  -0.1838 75  SER H CB  
2870 O  OG  . SER B 75  ? 0.9741 1.5289 1.3095 -0.1173 0.0054  -0.1622 75  SER H OG  
2871 N  N   . SER B 76  ? 0.8183 1.3061 1.0741 -0.1204 0.0067  -0.1523 76  SER H N   
2872 C  CA  . SER B 76  ? 0.8221 1.2861 1.0285 -0.1362 0.0047  -0.1400 76  SER H CA  
2873 C  C   . SER B 76  ? 0.8639 1.2960 1.0526 -0.1260 0.0019  -0.1368 76  SER H C   
2874 O  O   . SER B 76  ? 0.8664 1.2820 1.0193 -0.1383 0.0013  -0.1284 76  SER H O   
2875 C  CB  . SER B 76  ? 0.8695 1.3164 1.0535 -0.1445 -0.0098 -0.1200 76  SER H CB  
2876 O  OG  . SER B 76  ? 0.9755 1.4069 1.1716 -0.1301 -0.0243 -0.1105 76  SER H OG  
2877 N  N   . SER B 77  ? 0.8067 1.2305 1.0205 -0.1048 -0.0001 -0.1431 77  SER H N   
2878 C  CA  . SER B 77  ? 0.7997 1.1940 0.9980 -0.0952 -0.0024 -0.1410 77  SER H CA  
2879 C  C   . SER B 77  ? 0.8386 1.1996 1.0031 -0.0975 -0.0162 -0.1200 77  SER H C   
2880 O  O   . SER B 77  ? 0.8354 1.1771 0.9729 -0.1016 -0.0162 -0.1150 77  SER H O   
2881 C  CB  . SER B 77  ? 0.8549 1.2575 1.0382 -0.1067 0.0128  -0.1537 77  SER H CB  
2882 O  OG  . SER B 77  ? 0.9697 1.4079 1.1815 -0.1102 0.0286  -0.1749 77  SER H OG  
2883 N  N   . THR B 78  ? 0.7867 1.1435 0.9531 -0.0970 -0.0274 -0.1087 78  THR H N   
2884 C  CA  . THR B 78  ? 0.7831 1.1100 0.9205 -0.1001 -0.0385 -0.0919 78  THR H CA  
2885 C  C   . THR B 78  ? 0.8212 1.1289 0.9661 -0.0861 -0.0502 -0.0850 78  THR H C   
2886 O  O   . THR B 78  ? 0.8138 1.1353 0.9851 -0.0794 -0.0547 -0.0872 78  THR H O   
2887 C  CB  . THR B 78  ? 0.8938 1.2288 1.0182 -0.1173 -0.0405 -0.0846 78  THR H CB  
2888 O  OG1 . THR B 78  ? 0.8990 1.2492 1.0110 -0.1333 -0.0305 -0.0891 78  THR H OG1 
2889 C  CG2 . THR B 78  ? 0.8793 1.1833 0.9779 -0.1204 -0.0508 -0.0697 78  THR H CG2 
2890 N  N   . ALA B 79  ? 0.7731 1.0501 0.8946 -0.0835 -0.0559 -0.0757 79  ALA H N   
2891 C  CA  . ALA B 79  ? 0.7675 1.0239 0.8883 -0.0743 -0.0665 -0.0685 79  ALA H CA  
2892 C  C   . ALA B 79  ? 0.8159 1.0542 0.9134 -0.0833 -0.0729 -0.0577 79  ALA H C   
2893 O  O   . ALA B 79  ? 0.8146 1.0444 0.8929 -0.0922 -0.0698 -0.0543 79  ALA H O   
2894 C  CB  . ALA B 79  ? 0.7743 1.0110 0.8889 -0.0645 -0.0658 -0.0693 79  ALA H CB  
2895 N  N   . TYR B 80  ? 0.7710 1.0028 0.8706 -0.0820 -0.0824 -0.0523 80  TYR H N   
2896 C  CA  . TYR B 80  ? 0.7766 0.9903 0.8542 -0.0914 -0.0877 -0.0445 80  TYR H CA  
2897 C  C   . TYR B 80  ? 0.8282 1.0187 0.8950 -0.0869 -0.0942 -0.0402 80  TYR H C   
2898 O  O   . TYR B 80  ? 0.8193 1.0121 0.8993 -0.0784 -0.0992 -0.0403 80  TYR H O   
2899 C  CB  . TYR B 80  ? 0.7964 1.0278 0.8816 -0.1015 -0.0929 -0.0421 80  TYR H CB  
2900 C  CG  . TYR B 80  ? 0.8135 1.0758 0.9155 -0.1068 -0.0864 -0.0478 80  TYR H CG  
2901 C  CD1 . TYR B 80  ? 0.8451 1.1085 0.9315 -0.1206 -0.0820 -0.0461 80  TYR H CD1 
2902 C  CD2 . TYR B 80  ? 0.8151 1.1054 0.9494 -0.0992 -0.0847 -0.0551 80  TYR H CD2 
2903 C  CE1 . TYR B 80  ? 0.8553 1.1489 0.9543 -0.1291 -0.0755 -0.0514 80  TYR H CE1 
2904 C  CE2 . TYR B 80  ? 0.8245 1.1459 0.9750 -0.1056 -0.0763 -0.0628 80  TYR H CE2 
2905 C  CZ  . TYR B 80  ? 0.9261 1.2501 1.0570 -0.1218 -0.0714 -0.0609 80  TYR H CZ  
2906 O  OH  . TYR B 80  ? 0.9389 1.2953 1.0830 -0.1314 -0.0623 -0.0687 80  TYR H OH  
2907 N  N   . MET B 81  ? 0.7940 0.9622 0.8371 -0.0942 -0.0943 -0.0367 81  MET H N   
2908 C  CA  . MET B 81  ? 0.8011 0.9474 0.8287 -0.0948 -0.0986 -0.0340 81  MET H CA  
2909 C  C   . MET B 81  ? 0.8680 1.0051 0.8790 -0.1085 -0.1015 -0.0314 81  MET H C   
2910 O  O   . MET B 81  ? 0.8653 0.9983 0.8693 -0.1148 -0.0970 -0.0320 81  MET H O   
2911 C  CB  . MET B 81  ? 0.8283 0.9545 0.8445 -0.0892 -0.0918 -0.0362 81  MET H CB  
2912 C  CG  . MET B 81  ? 0.8853 0.9903 0.8838 -0.0924 -0.0937 -0.0355 81  MET H CG  
2913 S  SD  . MET B 81  ? 0.9374 1.0213 0.9251 -0.0876 -0.0839 -0.0396 81  MET H SD  
2914 C  CE  . MET B 81  ? 0.8973 0.9767 0.8838 -0.0914 -0.0786 -0.0403 81  MET H CE  
2915 N  N   . GLU B 82  ? 0.8404 0.9734 0.8443 -0.1146 -0.1099 -0.0279 82  GLU H N   
2916 C  CA  . GLU B 82  ? 0.8579 0.9820 0.8440 -0.1298 -0.1130 -0.0263 82  GLU H CA  
2917 C  C   . GLU B 82  ? 0.9180 1.0152 0.8788 -0.1358 -0.1108 -0.0286 82  GLU H C   
2918 O  O   . GLU B 82  ? 0.9157 1.0084 0.8721 -0.1343 -0.1151 -0.0267 82  GLU H O   
2919 C  CB  . GLU B 82  ? 0.8819 1.0264 0.8788 -0.1369 -0.1252 -0.0205 82  GLU H CB  
2920 C  CG  . GLU B 82  ? 1.0219 1.1970 1.0465 -0.1331 -0.1256 -0.0205 82  GLU H CG  
2921 C  CD  . GLU B 82  ? 1.3325 1.5293 1.3704 -0.1414 -0.1378 -0.0148 82  GLU H CD  
2922 O  OE1 . GLU B 82  ? 1.2885 1.4743 1.3082 -0.1538 -0.1463 -0.0098 82  GLU H OE1 
2923 O  OE2 . GLU B 82  ? 1.2731 1.4995 1.3404 -0.1367 -0.1385 -0.0157 82  GLU H OE2 
2924 N  N   . LEU B 83  ? 0.8851 0.9639 0.8293 -0.1440 -0.1039 -0.0331 83  LEU H N   
2925 C  CA  . LEU B 83  ? 0.9015 0.9546 0.8224 -0.1511 -0.0984 -0.0390 83  LEU H CA  
2926 C  C   . LEU B 83  ? 0.9769 1.0221 0.8788 -0.1695 -0.1020 -0.0397 83  LEU H C   
2927 O  O   . LEU B 83  ? 0.9723 1.0189 0.8760 -0.1748 -0.1019 -0.0394 83  LEU H O   
2928 C  CB  . LEU B 83  ? 0.8997 0.9348 0.8207 -0.1439 -0.0860 -0.0461 83  LEU H CB  
2929 C  CG  . LEU B 83  ? 0.9358 0.9766 0.8723 -0.1277 -0.0821 -0.0458 83  LEU H CG  
2930 C  CD1 . LEU B 83  ? 0.9371 0.9633 0.8778 -0.1218 -0.0729 -0.0502 83  LEU H CD1 
2931 C  CD2 . LEU B 83  ? 0.9643 1.0023 0.8944 -0.1255 -0.0824 -0.0468 83  LEU H CD2 
2932 N  N   . ARG B 84  ? 0.9574 0.9950 0.8396 -0.1812 -0.1060 -0.0400 84  ARG H N   
2933 C  CA  . ARG B 84  ? 0.9833 1.0141 0.8437 -0.2020 -0.1105 -0.0406 84  ARG H CA  
2934 C  C   . ARG B 84  ? 1.0545 1.0586 0.8864 -0.2137 -0.1005 -0.0517 84  ARG H C   
2935 O  O   . ARG B 84  ? 1.0464 1.0432 0.8764 -0.2066 -0.0934 -0.0562 84  ARG H O   
2936 C  CB  . ARG B 84  ? 0.9998 1.0513 0.8626 -0.2100 -0.1282 -0.0287 84  ARG H CB  
2937 C  CG  . ARG B 84  ? 1.1569 1.2134 1.0243 -0.2026 -0.1345 -0.0229 84  ARG H CG  
2938 C  CD  . ARG B 84  ? 1.3254 1.4048 1.2073 -0.2054 -0.1540 -0.0090 84  ARG H CD  
2939 N  NE  . ARG B 84  ? 1.5069 1.5794 1.3608 -0.2284 -0.1649 -0.0038 84  ARG H NE  
2940 C  CZ  . ARG B 84  ? 1.7193 1.8079 1.5812 -0.2347 -0.1849 0.0103  84  ARG H CZ  
2941 N  NH1 . ARG B 84  ? 1.5537 1.6656 1.4537 -0.2181 -0.1951 0.0191  84  ARG H NH1 
2942 N  NH2 . ARG B 84  ? 1.5869 1.6680 1.4189 -0.2588 -0.1954 0.0158  84  ARG H NH2 
2943 N  N   . SER B 85  ? 1.0339 1.0244 0.8432 -0.2332 -0.0992 -0.0573 85  SER H N   
2944 C  CA  . SER B 85  ? 1.0600 1.0248 0.8401 -0.2481 -0.0875 -0.0713 85  SER H CA  
2945 C  C   . SER B 85  ? 1.0869 1.0352 0.8781 -0.2327 -0.0700 -0.0837 85  SER H C   
2946 O  O   . SER B 85  ? 1.0890 1.0299 0.8722 -0.2319 -0.0612 -0.0912 85  SER H O   
2947 C  CB  . SER B 85  ? 1.1249 1.0927 0.8832 -0.2610 -0.0940 -0.0678 85  SER H CB  
2948 O  OG  . SER B 85  ? 1.2485 1.2363 1.0066 -0.2704 -0.1141 -0.0522 85  SER H OG  
2949 N  N   . LEU B 86  ? 1.0160 0.9624 0.8291 -0.2196 -0.0669 -0.0833 86  LEU H N   
2950 C  CA  . LEU B 86  ? 0.9998 0.9325 0.8298 -0.2037 -0.0538 -0.0918 86  LEU H CA  
2951 C  C   . LEU B 86  ? 1.0619 0.9682 0.8769 -0.2124 -0.0381 -0.1102 86  LEU H C   
2952 O  O   . LEU B 86  ? 1.0859 0.9785 0.8784 -0.2312 -0.0361 -0.1177 86  LEU H O   
2953 C  CB  . LEU B 86  ? 0.9891 0.9207 0.8400 -0.1939 -0.0557 -0.0867 86  LEU H CB  
2954 C  CG  . LEU B 86  ? 1.0204 0.9796 0.8883 -0.1857 -0.0681 -0.0712 86  LEU H CG  
2955 C  CD1 . LEU B 86  ? 1.0162 0.9730 0.8991 -0.1802 -0.0689 -0.0669 86  LEU H CD1 
2956 C  CD2 . LEU B 86  ? 1.0250 1.0027 0.9051 -0.1722 -0.0704 -0.0660 86  LEU H CD2 
2957 N  N   . THR B 87  ? 0.9996 0.9010 0.8266 -0.2001 -0.0265 -0.1183 87  THR H N   
2958 C  CA  . THR B 87  ? 1.0195 0.8994 0.8375 -0.2067 -0.0089 -0.1384 87  THR H CA  
2959 C  C   . THR B 87  ? 1.0392 0.9104 0.8894 -0.1865 0.0011  -0.1445 87  THR H C   
2960 O  O   . THR B 87  ? 1.0037 0.8860 0.8781 -0.1697 -0.0069 -0.1317 87  THR H O   
2961 C  CB  . THR B 87  ? 1.1451 1.0305 0.9405 -0.2179 -0.0038 -0.1442 87  THR H CB  
2962 O  OG1 . THR B 87  ? 1.1224 1.0247 0.9350 -0.2018 -0.0066 -0.1357 87  THR H OG1 
2963 C  CG2 . THR B 87  ? 1.1440 1.0367 0.9064 -0.2406 -0.0162 -0.1364 87  THR H CG2 
2964 N  N   . PHE B 88  ? 1.0084 0.8606 0.8594 -0.1893 0.0185  -0.1645 88  PHE H N   
2965 C  CA  . PHE B 88  ? 0.9952 0.8386 0.8800 -0.1711 0.0286  -0.1722 88  PHE H CA  
2966 C  C   . PHE B 88  ? 0.9954 0.8613 0.8992 -0.1542 0.0258  -0.1625 88  PHE H C   
2967 O  O   . PHE B 88  ? 0.9678 0.8378 0.9009 -0.1368 0.0207  -0.1535 88  PHE H O   
2968 C  CB  . PHE B 88  ? 1.0547 0.8772 0.9341 -0.1804 0.0500  -0.1988 88  PHE H CB  
2969 C  CG  . PHE B 88  ? 1.1073 0.9033 0.9776 -0.1924 0.0536  -0.2094 88  PHE H CG  
2970 C  CD1 . PHE B 88  ? 1.1459 0.9411 0.9976 -0.2032 0.0382  -0.1958 88  PHE H CD1 
2971 C  CD2 . PHE B 88  ? 1.1674 0.9397 1.0455 -0.1952 0.0734  -0.2345 88  PHE H CD2 
2972 C  CE1 . PHE B 88  ? 1.1904 0.9601 1.0308 -0.2165 0.0415  -0.2058 88  PHE H CE1 
2973 C  CE2 . PHE B 88  ? 1.2362 0.9809 1.1061 -0.2065 0.0771  -0.2454 88  PHE H CE2 
2974 C  CZ  . PHE B 88  ? 1.2123 0.9552 1.0612 -0.2180 0.0607  -0.2305 88  PHE H CZ  
2975 N  N   . GLU B 89  ? 0.9412 0.8218 0.8252 -0.1618 0.0253  -0.1608 89  GLU H N   
2976 C  CA  . GLU B 89  ? 0.9098 0.8082 0.8048 -0.1510 0.0250  -0.1553 89  GLU H CA  
2977 C  C   . GLU B 89  ? 0.9091 0.8231 0.8187 -0.1378 0.0085  -0.1350 89  GLU H C   
2978 O  O   . GLU B 89  ? 0.8800 0.8048 0.8103 -0.1235 0.0081  -0.1300 89  GLU H O   
2979 C  CB  . GLU B 89  ? 0.9392 0.8449 0.8016 -0.1683 0.0264  -0.1576 89  GLU H CB  
2980 C  CG  . GLU B 89  ? 1.1111 1.0050 0.9589 -0.1826 0.0471  -0.1809 89  GLU H CG  
2981 C  CD  . GLU B 89  ? 1.4195 1.2906 1.2628 -0.1923 0.0603  -0.2001 89  GLU H CD  
2982 O  OE1 . GLU B 89  ? 1.3706 1.2322 1.2100 -0.1951 0.0511  -0.1943 89  GLU H OE1 
2983 O  OE2 . GLU B 89  ? 1.3709 1.2341 1.2116 -0.1998 0.0806  -0.2223 89  GLU H OE2 
2984 N  N   . ASP B 90  ? 0.8526 0.7683 0.7527 -0.1434 -0.0041 -0.1243 90  ASP H N   
2985 C  CA  . ASP B 90  ? 0.8167 0.7492 0.7290 -0.1336 -0.0185 -0.1068 90  ASP H CA  
2986 C  C   . ASP B 90  ? 0.8379 0.7678 0.7757 -0.1207 -0.0211 -0.1011 90  ASP H C   
2987 O  O   . ASP B 90  ? 0.8103 0.7550 0.7555 -0.1154 -0.0320 -0.0877 90  ASP H O   
2988 C  CB  . ASP B 90  ? 0.8443 0.7828 0.7403 -0.1449 -0.0299 -0.0985 90  ASP H CB  
2989 C  CG  . ASP B 90  ? 1.0038 0.9457 0.8742 -0.1595 -0.0319 -0.1000 90  ASP H CG  
2990 O  OD1 . ASP B 90  ? 1.0177 0.9591 0.8811 -0.1605 -0.0242 -0.1066 90  ASP H OD1 
2991 O  OD2 . ASP B 90  ? 1.0975 1.0411 0.9527 -0.1726 -0.0407 -0.0953 90  ASP H OD2 
2992 N  N   . THR B 91  ? 0.7996 0.7108 0.7521 -0.1164 -0.0114 -0.1113 91  THR H N   
2993 C  CA  . THR B 91  ? 0.7847 0.6914 0.7636 -0.1045 -0.0161 -0.1037 91  THR H CA  
2994 C  C   . THR B 91  ? 0.7990 0.7215 0.7978 -0.0903 -0.0174 -0.0975 91  THR H C   
2995 O  O   . THR B 91  ? 0.7959 0.7150 0.8105 -0.0830 -0.0077 -0.1065 91  THR H O   
2996 C  CB  . THR B 91  ? 0.9025 0.7824 0.8957 -0.1034 -0.0075 -0.1155 91  THR H CB  
2997 O  OG1 . THR B 91  ? 0.9152 0.7800 0.8863 -0.1189 -0.0067 -0.1215 91  THR H OG1 
2998 C  CG2 . THR B 91  ? 0.8778 0.7513 0.8999 -0.0919 -0.0158 -0.1044 91  THR H CG2 
2999 N  N   . ALA B 92  ? 0.7260 0.6667 0.7246 -0.0874 -0.0289 -0.0828 92  ALA H N   
3000 C  CA  . ALA B 92  ? 0.6980 0.6543 0.7120 -0.0762 -0.0314 -0.0760 92  ALA H CA  
3001 C  C   . ALA B 92  ? 0.7205 0.6905 0.7358 -0.0756 -0.0435 -0.0613 92  ALA H C   
3002 O  O   . ALA B 92  ? 0.7175 0.6897 0.7201 -0.0841 -0.0491 -0.0571 92  ALA H O   
3003 C  CB  . ALA B 92  ? 0.6977 0.6664 0.6996 -0.0772 -0.0274 -0.0802 92  ALA H CB  
3004 N  N   . VAL B 93  ? 0.6552 0.6355 0.6860 -0.0672 -0.0472 -0.0538 93  VAL H N   
3005 C  CA  . VAL B 93  ? 0.6362 0.6321 0.6662 -0.0686 -0.0569 -0.0414 93  VAL H CA  
3006 C  C   . VAL B 93  ? 0.6587 0.6735 0.6776 -0.0688 -0.0566 -0.0426 93  VAL H C   
3007 O  O   . VAL B 93  ? 0.6451 0.6627 0.6650 -0.0639 -0.0517 -0.0477 93  VAL H O   
3008 C  CB  . VAL B 93  ? 0.6816 0.6799 0.7305 -0.0625 -0.0624 -0.0321 93  VAL H CB  
3009 C  CG1 . VAL B 93  ? 0.6763 0.6733 0.7417 -0.0526 -0.0562 -0.0377 93  VAL H CG1 
3010 C  CG2 . VAL B 93  ? 0.6649 0.6836 0.7086 -0.0656 -0.0695 -0.0225 93  VAL H CG2 
3011 N  N   . TYR B 94  ? 0.6045 0.6317 0.6145 -0.0749 -0.0619 -0.0382 94  TYR H N   
3012 C  CA  . TYR B 94  ? 0.5859 0.6302 0.5904 -0.0744 -0.0628 -0.0394 94  TYR H CA  
3013 C  C   . TYR B 94  ? 0.6241 0.6865 0.6345 -0.0728 -0.0660 -0.0342 94  TYR H C   
3014 O  O   . TYR B 94  ? 0.6192 0.6869 0.6302 -0.0785 -0.0696 -0.0286 94  TYR H O   
3015 C  CB  . TYR B 94  ? 0.6027 0.6493 0.5965 -0.0825 -0.0652 -0.0409 94  TYR H CB  
3016 C  CG  . TYR B 94  ? 0.6334 0.6630 0.6164 -0.0864 -0.0612 -0.0477 94  TYR H CG  
3017 C  CD1 . TYR B 94  ? 0.6746 0.6856 0.6544 -0.0915 -0.0583 -0.0508 94  TYR H CD1 
3018 C  CD2 . TYR B 94  ? 0.6410 0.6721 0.6161 -0.0868 -0.0604 -0.0513 94  TYR H CD2 
3019 C  CE1 . TYR B 94  ? 0.6999 0.6954 0.6682 -0.0972 -0.0525 -0.0598 94  TYR H CE1 
3020 C  CE2 . TYR B 94  ? 0.6692 0.6860 0.6300 -0.0943 -0.0564 -0.0579 94  TYR H CE2 
3021 C  CZ  . TYR B 94  ? 0.7788 0.7780 0.7359 -0.0995 -0.0510 -0.0635 94  TYR H CZ  
3022 O  OH  . TYR B 94  ? 0.8089 0.7937 0.7502 -0.1089 -0.0449 -0.0727 94  TYR H OH  
3023 N  N   . TYR B 95  ? 0.5737 0.6453 0.5868 -0.0668 -0.0644 -0.0366 95  TYR H N   
3024 C  CA  . TYR B 95  ? 0.5617 0.6503 0.5794 -0.0657 -0.0655 -0.0348 95  TYR H CA  
3025 C  C   . TYR B 95  ? 0.6164 0.7182 0.6352 -0.0641 -0.0656 -0.0392 95  TYR H C   
3026 O  O   . TYR B 95  ? 0.6124 0.7090 0.6291 -0.0614 -0.0660 -0.0420 95  TYR H O   
3027 C  CB  . TYR B 95  ? 0.5672 0.6540 0.5900 -0.0599 -0.0638 -0.0342 95  TYR H CB  
3028 C  CG  . TYR B 95  ? 0.5902 0.6663 0.6192 -0.0596 -0.0652 -0.0289 95  TYR H CG  
3029 C  CD1 . TYR B 95  ? 0.6181 0.6983 0.6493 -0.0650 -0.0704 -0.0207 95  TYR H CD1 
3030 C  CD2 . TYR B 95  ? 0.6019 0.6650 0.6365 -0.0542 -0.0614 -0.0322 95  TYR H CD2 
3031 C  CE1 . TYR B 95  ? 0.6350 0.7046 0.6762 -0.0640 -0.0744 -0.0137 95  TYR H CE1 
3032 C  CE2 . TYR B 95  ? 0.6191 0.6736 0.6667 -0.0518 -0.0629 -0.0280 95  TYR H CE2 
3033 C  CZ  . TYR B 95  ? 0.7099 0.7668 0.7621 -0.0560 -0.0706 -0.0177 95  TYR H CZ  
3034 O  OH  . TYR B 95  ? 0.7221 0.7696 0.7910 -0.0530 -0.0747 -0.0115 95  TYR H OH  
3035 N  N   . CYS B 96  ? 0.5788 0.6977 0.6021 -0.0659 -0.0651 -0.0400 96  CYS H N   
3036 C  CA  . CYS B 96  ? 0.5745 0.7066 0.6054 -0.0620 -0.0642 -0.0459 96  CYS H CA  
3037 C  C   . CYS B 96  ? 0.6158 0.7530 0.6489 -0.0593 -0.0610 -0.0486 96  CYS H C   
3038 O  O   . CYS B 96  ? 0.6152 0.7571 0.6446 -0.0651 -0.0599 -0.0459 96  CYS H O   
3039 C  CB  . CYS B 96  ? 0.5822 0.7324 0.6185 -0.0681 -0.0640 -0.0477 96  CYS H CB  
3040 S  SG  . CYS B 96  ? 0.6371 0.7991 0.6680 -0.0787 -0.0610 -0.0455 96  CYS H SG  
3041 N  N   . ALA B 97  ? 0.5639 0.6980 0.6013 -0.0521 -0.0605 -0.0527 97  ALA H N   
3042 C  CA  . ALA B 97  ? 0.5570 0.6931 0.5952 -0.0501 -0.0575 -0.0561 97  ALA H CA  
3043 C  C   . ALA B 97  ? 0.5962 0.7411 0.6457 -0.0454 -0.0556 -0.0647 97  ALA H C   
3044 O  O   . ALA B 97  ? 0.5899 0.7313 0.6470 -0.0400 -0.0593 -0.0655 97  ALA H O   
3045 C  CB  . ALA B 97  ? 0.5665 0.6870 0.5995 -0.0463 -0.0585 -0.0530 97  ALA H CB  
3046 N  N   . ARG B 98  ? 0.5465 0.7024 0.5976 -0.0485 -0.0503 -0.0711 98  ARG H N   
3047 C  CA  . ARG B 98  ? 0.5410 0.7052 0.6062 -0.0439 -0.0465 -0.0822 98  ARG H CA  
3048 C  C   . ARG B 98  ? 0.5855 0.7379 0.6487 -0.0397 -0.0460 -0.0851 98  ARG H C   
3049 O  O   . ARG B 98  ? 0.5837 0.7348 0.6354 -0.0454 -0.0438 -0.0839 98  ARG H O   
3050 C  CB  . ARG B 98  ? 0.5393 0.7250 0.6076 -0.0521 -0.0384 -0.0912 98  ARG H CB  
3051 C  CG  . ARG B 98  ? 0.6312 0.8281 0.7211 -0.0462 -0.0328 -0.1054 98  ARG H CG  
3052 C  CD  . ARG B 98  ? 0.6946 0.9078 0.7817 -0.0559 -0.0216 -0.1178 98  ARG H CD  
3053 N  NE  . ARG B 98  ? 0.7433 0.9468 0.8258 -0.0548 -0.0184 -0.1242 98  ARG H NE  
3054 C  CZ  . ARG B 98  ? 0.8869 1.1000 0.9615 -0.0651 -0.0089 -0.1351 98  ARG H CZ  
3055 N  NH1 . ARG B 98  ? 0.7317 0.9663 0.8012 -0.0785 -0.0012 -0.1407 98  ARG H NH1 
3056 N  NH2 . ARG B 98  ? 0.6893 0.8918 0.7589 -0.0648 -0.0067 -0.1407 98  ARG H NH2 
3057 N  N   . GLU B 99  ? 0.5349 0.6787 0.6101 -0.0308 -0.0493 -0.0881 99  GLU H N   
3058 C  CA  . GLU B 99  ? 0.5340 0.6644 0.6081 -0.0273 -0.0497 -0.0909 99  GLU H CA  
3059 C  C   . GLU B 99  ? 0.5851 0.7240 0.6699 -0.0271 -0.0419 -0.1053 99  GLU H C   
3060 O  O   . GLU B 99  ? 0.5800 0.7366 0.6757 -0.0289 -0.0358 -0.1139 99  GLU H O   
3061 C  CB  . GLU B 99  ? 0.5542 0.6683 0.6340 -0.0200 -0.0586 -0.0855 99  GLU H CB  
3062 C  CG  . GLU B 99  ? 0.6653 0.7846 0.7591 -0.0159 -0.0646 -0.0828 99  GLU H CG  
3063 C  CD  . GLU B 99  ? 0.8662 0.9683 0.9563 -0.0138 -0.0756 -0.0728 99  GLU H CD  
3064 O  OE1 . GLU B 99  ? 0.7579 0.8456 0.8511 -0.0103 -0.0804 -0.0723 99  GLU H OE1 
3065 O  OE2 . GLU B 99  ? 0.7664 0.8690 0.8497 -0.0173 -0.0800 -0.0654 99  GLU H OE2 
3066 N  N   . THR B 100 ? 0.5450 0.6717 0.6260 -0.0265 -0.0408 -0.1093 100 THR H N   
3067 C  CA  . THR B 100 ? 0.5507 0.6820 0.6403 -0.0273 -0.0322 -0.1252 100 THR H CA  
3068 C  C   . THR B 100 ? 0.6020 0.7134 0.7029 -0.0186 -0.0366 -0.1285 100 THR H C   
3069 O  O   . THR B 100 ? 0.6032 0.7016 0.6918 -0.0223 -0.0365 -0.1287 100 THR H O   
3070 C  CB  . THR B 100 ? 0.6583 0.7954 0.7272 -0.0403 -0.0257 -0.1278 100 THR H CB  
3071 O  OG1 . THR B 100 ? 0.6523 0.7987 0.7069 -0.0481 -0.0278 -0.1167 100 THR H OG1 
3072 C  CG2 . THR B 100 ? 0.6471 0.7977 0.7203 -0.0467 -0.0137 -0.1458 100 THR H CG2 
3073 N  N   . GLY B 101 ? 0.5570 0.6657 0.6815 -0.0080 -0.0419 -0.1294 101 GLY H N   
3074 C  CA  . GLY B 101 ? 0.5663 0.6537 0.7047 0.0007  -0.0493 -0.1298 101 GLY H CA  
3075 C  C   . GLY B 101 ? 0.6105 0.6793 0.7340 0.0001  -0.0622 -0.1120 101 GLY H C   
3076 O  O   . GLY B 101 ? 0.6115 0.6693 0.7483 0.0068  -0.0737 -0.1048 101 GLY H O   
3077 N  N   . THR B 102 ? 0.5578 0.6239 0.6546 -0.0089 -0.0607 -0.1049 102 THR H N   
3078 C  CA  . THR B 102 ? 0.5538 0.6065 0.6339 -0.0122 -0.0692 -0.0903 102 THR H CA  
3079 C  C   . THR B 102 ? 0.5820 0.6482 0.6502 -0.0169 -0.0669 -0.0838 102 THR H C   
3080 O  O   . THR B 102 ? 0.5665 0.6495 0.6355 -0.0193 -0.0594 -0.0892 102 THR H O   
3081 C  CB  . THR B 102 ? 0.6726 0.7109 0.7372 -0.0179 -0.0689 -0.0890 102 THR H CB  
3082 O  OG1 . THR B 102 ? 0.6796 0.7294 0.7366 -0.0237 -0.0590 -0.0967 102 THR H OG1 
3083 C  CG2 . THR B 102 ? 0.6724 0.6900 0.7477 -0.0134 -0.0753 -0.0915 102 THR H CG2 
3084 N  N   . ALA B 103 ? 0.5347 0.5927 0.5915 -0.0196 -0.0731 -0.0727 103 ALA H N   
3085 C  CA  . ALA B 103 ? 0.5183 0.5859 0.5664 -0.0233 -0.0708 -0.0678 103 ALA H CA  
3086 C  C   . ALA B 103 ? 0.5559 0.6280 0.5912 -0.0291 -0.0643 -0.0670 103 ALA H C   
3087 O  O   . ALA B 103 ? 0.5535 0.6214 0.5787 -0.0327 -0.0644 -0.0611 103 ALA H O   
3088 C  CB  . ALA B 103 ? 0.5322 0.5905 0.5734 -0.0253 -0.0786 -0.0588 103 ALA H CB  
3089 N  N   . TRP B 104 ? 0.4997 0.5818 0.5371 -0.0308 -0.0585 -0.0732 104 TRP H N   
3090 C  CA  . TRP B 104 ? 0.4891 0.5785 0.5182 -0.0367 -0.0548 -0.0705 104 TRP H CA  
3091 C  C   . TRP B 104 ? 0.5355 0.6405 0.5680 -0.0389 -0.0519 -0.0724 104 TRP H C   
3092 O  O   . TRP B 104 ? 0.5337 0.6456 0.5738 -0.0377 -0.0493 -0.0803 104 TRP H O   
3093 C  CB  . TRP B 104 ? 0.4769 0.5640 0.5012 -0.0408 -0.0528 -0.0737 104 TRP H CB  
3094 C  CG  . TRP B 104 ? 0.4919 0.5845 0.5199 -0.0423 -0.0487 -0.0841 104 TRP H CG  
3095 C  CD1 . TRP B 104 ? 0.5395 0.6230 0.5747 -0.0383 -0.0483 -0.0926 104 TRP H CD1 
3096 C  CD2 . TRP B 104 ? 0.4913 0.5992 0.5155 -0.0498 -0.0440 -0.0880 104 TRP H CD2 
3097 N  NE1 . TRP B 104 ? 0.5372 0.6301 0.5745 -0.0422 -0.0414 -0.1041 104 TRP H NE1 
3098 C  CE2 . TRP B 104 ? 0.5498 0.6586 0.5781 -0.0507 -0.0386 -0.1012 104 TRP H CE2 
3099 C  CE3 . TRP B 104 ? 0.5007 0.6211 0.5188 -0.0569 -0.0444 -0.0812 104 TRP H CE3 
3100 C  CZ2 . TRP B 104 ? 0.5469 0.6702 0.5694 -0.0607 -0.0321 -0.1090 104 TRP H CZ2 
3101 C  CZ3 . TRP B 104 ? 0.5253 0.6588 0.5370 -0.0671 -0.0406 -0.0858 104 TRP H CZ3 
3102 C  CH2 . TRP B 104 ? 0.5440 0.6799 0.5564 -0.0698 -0.0337 -0.1002 104 TRP H CH2 
3103 N  N   . PHE B 105 ? 0.4872 0.5971 0.5161 -0.0421 -0.0524 -0.0655 105 PHE H N   
3104 C  CA  . PHE B 105 ? 0.4828 0.6054 0.5130 -0.0460 -0.0512 -0.0653 105 PHE H CA  
3105 C  C   . PHE B 105 ? 0.5301 0.6628 0.5543 -0.0549 -0.0503 -0.0631 105 PHE H C   
3106 O  O   . PHE B 105 ? 0.5233 0.6549 0.5456 -0.0575 -0.0537 -0.0543 105 PHE H O   
3107 C  CB  . PHE B 105 ? 0.5040 0.6232 0.5347 -0.0446 -0.0540 -0.0589 105 PHE H CB  
3108 C  CG  . PHE B 105 ? 0.5270 0.6338 0.5583 -0.0391 -0.0564 -0.0584 105 PHE H CG  
3109 C  CD1 . PHE B 105 ? 0.5703 0.6768 0.6080 -0.0351 -0.0585 -0.0624 105 PHE H CD1 
3110 C  CD2 . PHE B 105 ? 0.5567 0.6530 0.5831 -0.0390 -0.0569 -0.0541 105 PHE H CD2 
3111 C  CE1 . PHE B 105 ? 0.5867 0.6813 0.6226 -0.0328 -0.0633 -0.0595 105 PHE H CE1 
3112 C  CE2 . PHE B 105 ? 0.5980 0.6833 0.6203 -0.0377 -0.0590 -0.0535 105 PHE H CE2 
3113 C  CZ  . PHE B 105 ? 0.5773 0.6612 0.6026 -0.0354 -0.0633 -0.0550 105 PHE H CZ  
3114 N  N   . ALA B 106 ? 0.4911 0.6346 0.5137 -0.0605 -0.0459 -0.0714 106 ALA H N   
3115 C  CA  . ALA B 106 ? 0.4958 0.6507 0.5086 -0.0731 -0.0451 -0.0700 106 ALA H CA  
3116 C  C   . ALA B 106 ? 0.5449 0.7082 0.5549 -0.0798 -0.0476 -0.0627 106 ALA H C   
3117 O  O   . ALA B 106 ? 0.5450 0.7124 0.5471 -0.0897 -0.0524 -0.0534 106 ALA H O   
3118 C  CB  . ALA B 106 ? 0.5147 0.6784 0.5255 -0.0786 -0.0372 -0.0843 106 ALA H CB  
3119 N  N   . TYR B 107 ? 0.4971 0.6625 0.5140 -0.0753 -0.0459 -0.0656 107 TYR H N   
3120 C  CA  . TYR B 107 ? 0.4967 0.6697 0.5101 -0.0831 -0.0479 -0.0596 107 TYR H CA  
3121 C  C   . TYR B 107 ? 0.5398 0.7022 0.5588 -0.0757 -0.0523 -0.0529 107 TYR H C   
3122 O  O   . TYR B 107 ? 0.5291 0.6852 0.5560 -0.0659 -0.0514 -0.0573 107 TYR H O   
3123 C  CB  . TYR B 107 ? 0.5167 0.7077 0.5312 -0.0899 -0.0400 -0.0711 107 TYR H CB  
3124 C  CG  . TYR B 107 ? 0.5472 0.7484 0.5554 -0.0985 -0.0329 -0.0818 107 TYR H CG  
3125 C  CD1 . TYR B 107 ? 0.5851 0.7960 0.5762 -0.1163 -0.0334 -0.0776 107 TYR H CD1 
3126 C  CD2 . TYR B 107 ? 0.5555 0.7550 0.5737 -0.0901 -0.0265 -0.0955 107 TYR H CD2 
3127 C  CE1 . TYR B 107 ? 0.6076 0.8277 0.5892 -0.1270 -0.0262 -0.0885 107 TYR H CE1 
3128 C  CE2 . TYR B 107 ? 0.5784 0.7850 0.5900 -0.0987 -0.0188 -0.1074 107 TYR H CE2 
3129 C  CZ  . TYR B 107 ? 0.6894 0.9072 0.6814 -0.1180 -0.0178 -0.1048 107 TYR H CZ  
3130 O  OH  . TYR B 107 ? 0.7280 0.9532 0.7104 -0.1293 -0.0092 -0.1180 107 TYR H OH  
3131 N  N   . TRP B 108 ? 0.4999 0.6596 0.5143 -0.0820 -0.0578 -0.0420 108 TRP H N   
3132 C  CA  . TRP B 108 ? 0.4937 0.6414 0.5118 -0.0773 -0.0615 -0.0361 108 TRP H CA  
3133 C  C   . TRP B 108 ? 0.5537 0.7063 0.5668 -0.0876 -0.0642 -0.0305 108 TRP H C   
3134 O  O   . TRP B 108 ? 0.5570 0.7187 0.5620 -0.0998 -0.0662 -0.0258 108 TRP H O   
3135 C  CB  . TRP B 108 ? 0.4770 0.6102 0.4986 -0.0726 -0.0662 -0.0280 108 TRP H CB  
3136 C  CG  . TRP B 108 ? 0.4810 0.6085 0.5068 -0.0636 -0.0634 -0.0330 108 TRP H CG  
3137 C  CD1 . TRP B 108 ? 0.5169 0.6497 0.5411 -0.0644 -0.0619 -0.0359 108 TRP H CD1 
3138 C  CD2 . TRP B 108 ? 0.4753 0.5899 0.5054 -0.0550 -0.0618 -0.0352 108 TRP H CD2 
3139 N  NE1 . TRP B 108 ? 0.5041 0.6281 0.5320 -0.0564 -0.0600 -0.0391 108 TRP H NE1 
3140 C  CE2 . TRP B 108 ? 0.5206 0.6339 0.5515 -0.0511 -0.0597 -0.0387 108 TRP H CE2 
3141 C  CE3 . TRP B 108 ? 0.4928 0.5966 0.5238 -0.0523 -0.0616 -0.0351 108 TRP H CE3 
3142 C  CZ2 . TRP B 108 ? 0.5110 0.6137 0.5432 -0.0454 -0.0575 -0.0414 108 TRP H CZ2 
3143 C  CZ3 . TRP B 108 ? 0.5103 0.6037 0.5417 -0.0470 -0.0587 -0.0389 108 TRP H CZ3 
3144 C  CH2 . TRP B 108 ? 0.5160 0.6094 0.5476 -0.0440 -0.0566 -0.0417 108 TRP H CH2 
3145 N  N   . GLY B 109 ? 0.5116 0.6570 0.5275 -0.0846 -0.0651 -0.0300 109 GLY H N   
3146 C  CA  . GLY B 109 ? 0.5187 0.6646 0.5296 -0.0946 -0.0686 -0.0235 109 GLY H CA  
3147 C  C   . GLY B 109 ? 0.5771 0.7057 0.5882 -0.0953 -0.0760 -0.0119 109 GLY H C   
3148 O  O   . GLY B 109 ? 0.5683 0.6856 0.5864 -0.0860 -0.0767 -0.0111 109 GLY H O   
3149 N  N   . GLN B 110 ? 0.5472 0.6732 0.5527 -0.1067 -0.0819 -0.0025 110 GLN H N   
3150 C  CA  . GLN B 110 ? 0.5566 0.6636 0.5667 -0.1069 -0.0906 0.0095  110 GLN H CA  
3151 C  C   . GLN B 110 ? 0.6090 0.6964 0.6285 -0.0952 -0.0884 0.0053  110 GLN H C   
3152 O  O   . GLN B 110 ? 0.6111 0.6835 0.6422 -0.0885 -0.0917 0.0096  110 GLN H O   
3153 C  CB  . GLN B 110 ? 0.5905 0.6962 0.5916 -0.1231 -0.0989 0.0217  110 GLN H CB  
3154 C  CG  . GLN B 110 ? 0.7247 0.8284 0.7198 -0.1293 -0.0972 0.0193  110 GLN H CG  
3155 C  CD  . GLN B 110 ? 0.9227 1.0517 0.9101 -0.1364 -0.0893 0.0096  110 GLN H CD  
3156 O  OE1 . GLN B 110 ? 0.8545 1.0016 0.8422 -0.1346 -0.0828 0.0013  110 GLN H OE1 
3157 N  NE2 . GLN B 110 ? 0.8157 0.9464 0.7973 -0.1461 -0.0900 0.0108  110 GLN H NE2 
3158 N  N   . GLY B 111 ? 0.5600 0.6494 0.5757 -0.0933 -0.0826 -0.0039 111 GLY H N   
3159 C  CA  . GLY B 111 ? 0.5606 0.6331 0.5797 -0.0861 -0.0796 -0.0094 111 GLY H CA  
3160 C  C   . GLY B 111 ? 0.6265 0.6877 0.6406 -0.0941 -0.0825 -0.0065 111 GLY H C   
3161 O  O   . GLY B 111 ? 0.6331 0.6923 0.6446 -0.1036 -0.0891 0.0031  111 GLY H O   
3162 N  N   . THR B 112 ? 0.5865 0.6392 0.5972 -0.0923 -0.0786 -0.0141 112 THR H N   
3163 C  CA  . THR B 112 ? 0.6009 0.6409 0.6054 -0.1006 -0.0806 -0.0131 112 THR H CA  
3164 C  C   . THR B 112 ? 0.6685 0.6838 0.6768 -0.0953 -0.0771 -0.0188 112 THR H C   
3165 O  O   . THR B 112 ? 0.6570 0.6708 0.6644 -0.0893 -0.0708 -0.0277 112 THR H O   
3166 C  CB  . THR B 112 ? 0.6813 0.7363 0.6769 -0.1070 -0.0794 -0.0176 112 THR H CB  
3167 O  OG1 . THR B 112 ? 0.6594 0.7396 0.6556 -0.1112 -0.0803 -0.0152 112 THR H OG1 
3168 C  CG2 . THR B 112 ? 0.6749 0.7183 0.6620 -0.1182 -0.0821 -0.0162 112 THR H CG2 
3169 N  N   . LEU B 113 ? 0.6498 0.6451 0.6616 -0.0992 -0.0808 -0.0143 113 LEU H N   
3170 C  CA  . LEU B 113 ? 0.6652 0.6359 0.6826 -0.0949 -0.0755 -0.0226 113 LEU H CA  
3171 C  C   . LEU B 113 ? 0.7393 0.7006 0.7411 -0.1051 -0.0733 -0.0289 113 LEU H C   
3172 O  O   . LEU B 113 ? 0.7444 0.7003 0.7397 -0.1157 -0.0792 -0.0228 113 LEU H O   
3173 C  CB  . LEU B 113 ? 0.6813 0.6318 0.7169 -0.0911 -0.0804 -0.0160 113 LEU H CB  
3174 C  CG  . LEU B 113 ? 0.7605 0.6831 0.8063 -0.0870 -0.0738 -0.0268 113 LEU H CG  
3175 C  CD1 . LEU B 113 ? 0.7536 0.6783 0.8028 -0.0783 -0.0608 -0.0421 113 LEU H CD1 
3176 C  CD2 . LEU B 113 ? 0.8062 0.7102 0.8758 -0.0818 -0.0810 -0.0185 113 LEU H CD2 
3177 N  N   . VAL B 114 ? 0.7083 0.6669 0.7029 -0.1037 -0.0651 -0.0409 114 VAL H N   
3178 C  CA  . VAL B 114 ? 0.7278 0.6772 0.7057 -0.1148 -0.0628 -0.0479 114 VAL H CA  
3179 C  C   . VAL B 114 ? 0.8164 0.7376 0.7985 -0.1133 -0.0545 -0.0593 114 VAL H C   
3180 O  O   . VAL B 114 ? 0.8086 0.7273 0.7959 -0.1061 -0.0457 -0.0689 114 VAL H O   
3181 C  CB  . VAL B 114 ? 0.7653 0.7323 0.7295 -0.1177 -0.0614 -0.0521 114 VAL H CB  
3182 C  CG1 . VAL B 114 ? 0.7829 0.7387 0.7283 -0.1310 -0.0595 -0.0594 114 VAL H CG1 
3183 C  CG2 . VAL B 114 ? 0.7427 0.7377 0.7083 -0.1183 -0.0688 -0.0428 114 VAL H CG2 
3184 N  N   . THR B 115 ? 0.8120 0.7117 0.7928 -0.1209 -0.0566 -0.0593 115 THR H N   
3185 C  CA  . THR B 115 ? 0.8434 0.7138 0.8305 -0.1199 -0.0476 -0.0725 115 THR H CA  
3186 C  C   . THR B 115 ? 0.9331 0.7926 0.8958 -0.1357 -0.0435 -0.0823 115 THR H C   
3187 O  O   . THR B 115 ? 0.9328 0.7939 0.8824 -0.1477 -0.0516 -0.0749 115 THR H O   
3188 C  CB  . THR B 115 ? 0.9600 0.8090 0.9683 -0.1155 -0.0535 -0.0654 115 THR H CB  
3189 O  OG1 . THR B 115 ? 0.9311 0.7971 0.9485 -0.1114 -0.0652 -0.0476 115 THR H OG1 
3190 C  CG2 . THR B 115 ? 0.9598 0.7877 0.9930 -0.1037 -0.0438 -0.0778 115 THR H CG2 
3191 N  N   . VAL B 116 ? 0.9186 0.7690 0.8737 -0.1377 -0.0309 -0.0992 116 VAL H N   
3192 C  CA  . VAL B 116 ? 0.9475 0.7870 0.8759 -0.1553 -0.0265 -0.1098 116 VAL H CA  
3193 C  C   . VAL B 116 ? 1.0465 0.8524 0.9816 -0.1569 -0.0148 -0.1267 116 VAL H C   
3194 O  O   . VAL B 116 ? 1.0462 0.8453 0.9950 -0.1482 -0.0021 -0.1403 116 VAL H O   
3195 C  CB  . VAL B 116 ? 0.9899 0.8467 0.8963 -0.1627 -0.0226 -0.1152 116 VAL H CB  
3196 C  CG1 . VAL B 116 ? 1.0151 0.8620 0.8911 -0.1844 -0.0212 -0.1233 116 VAL H CG1 
3197 C  CG2 . VAL B 116 ? 0.9536 0.8423 0.8609 -0.1574 -0.0341 -0.0992 116 VAL H CG2 
3198 N  N   . SER B 117 ? 1.0415 0.8265 0.9671 -0.1692 -0.0181 -0.1275 117 SER H N   
3199 C  CA  . SER B 117 ? 1.0828 0.8325 1.0160 -0.1710 -0.0066 -0.1452 117 SER H CA  
3200 C  C   . SER B 117 ? 1.1783 0.9129 1.0792 -0.1939 -0.0027 -0.1564 117 SER H C   
3201 O  O   . SER B 117 ? 1.1724 0.9150 1.0547 -0.2069 -0.0149 -0.1441 117 SER H O   
3202 C  CB  . SER B 117 ? 1.1367 0.8661 1.0983 -0.1611 -0.0147 -0.1357 117 SER H CB  
3203 O  OG  . SER B 117 ? 1.2567 0.9858 1.2040 -0.1734 -0.0294 -0.1199 117 SER H OG  
3204 N  N   . ALA B 118 ? 1.1747 0.8878 1.0699 -0.1998 0.0149  -0.1808 118 ALA H N   
3205 C  CA  . ALA B 118 ? 1.2135 0.9078 1.0767 -0.2237 0.0204  -0.1945 118 ALA H CA  
3206 C  C   . ALA B 118 ? 1.2904 0.9567 1.1595 -0.2283 0.0128  -0.1900 118 ALA H C   
3207 O  O   . ALA B 118 ? 1.3009 0.9640 1.1420 -0.2487 0.0060  -0.1867 118 ALA H O   
3208 C  CB  . ALA B 118 ? 1.2549 0.9311 1.1138 -0.2286 0.0431  -0.2237 118 ALA H CB  
3209 N  N   . ALA B 119 ? 1.2537 0.9021 1.1601 -0.2099 0.0112  -0.1866 119 ALA H N   
3210 C  CA  . ALA B 119 ? 1.7435 1.3631 1.6622 -0.2111 0.0016  -0.1788 119 ALA H CA  
3211 C  C   . ALA B 119 ? 2.2017 1.8347 2.0950 -0.2276 -0.0161 -0.1583 119 ALA H C   
3212 O  O   . ALA B 119 ? 1.7598 1.3670 1.6456 -0.2403 -0.0215 -0.1568 119 ALA H O   
3213 C  CB  . ALA B 119 ? 1.7371 1.3546 1.6985 -0.1873 -0.0057 -0.1658 119 ALA H CB  
3214 N  N   . ASP C 1   ? 0.8545 0.7930 0.6068 0.0980  -0.1085 -0.0313 1   ASP L N   
3215 C  CA  . ASP C 1   ? 0.8189 0.7624 0.6027 0.0838  -0.1022 -0.0382 1   ASP L CA  
3216 C  C   . ASP C 1   ? 0.8487 0.7682 0.6309 0.0759  -0.0861 -0.0306 1   ASP L C   
3217 O  O   . ASP C 1   ? 0.8573 0.7649 0.6206 0.0738  -0.0793 -0.0288 1   ASP L O   
3218 C  CB  . ASP C 1   ? 0.8369 0.7987 0.6335 0.0726  -0.1079 -0.0547 1   ASP L CB  
3219 C  CG  . ASP C 1   ? 0.9876 0.9788 0.7897 0.0771  -0.1251 -0.0642 1   ASP L CG  
3220 O  OD1 . ASP C 1   ? 1.0084 1.0080 0.8028 0.0920  -0.1334 -0.0575 1   ASP L OD1 
3221 O  OD2 . ASP C 1   ? 1.0605 1.0667 0.8766 0.0655  -0.1306 -0.0782 1   ASP L OD2 
3222 N  N   . ILE C 2   ? 0.7730 0.6880 0.5752 0.0718  -0.0802 -0.0267 2   ILE L N   
3223 C  CA  . ILE C 2   ? 0.7554 0.6518 0.5602 0.0634  -0.0664 -0.0200 2   ILE L CA  
3224 C  C   . ILE C 2   ? 0.7783 0.6796 0.5954 0.0514  -0.0608 -0.0288 2   ILE L C   
3225 O  O   . ILE C 2   ? 0.7572 0.6735 0.5931 0.0460  -0.0656 -0.0389 2   ILE L O   
3226 C  CB  . ILE C 2   ? 0.7804 0.6703 0.6006 0.0631  -0.0631 -0.0145 2   ILE L CB  
3227 C  CG1 . ILE C 2   ? 0.8085 0.6871 0.6128 0.0771  -0.0682 -0.0054 2   ILE L CG1 
3228 C  CG2 . ILE C 2   ? 0.7772 0.6519 0.6023 0.0525  -0.0503 -0.0091 2   ILE L CG2 
3229 C  CD1 . ILE C 2   ? 0.8907 0.7698 0.7099 0.0809  -0.0696 -0.0052 2   ILE L CD1 
3230 N  N   . GLN C 3   ? 0.7318 0.6204 0.5382 0.0476  -0.0501 -0.0245 3   GLN L N   
3231 C  CA  . GLN C 3   ? 0.7145 0.6046 0.5303 0.0391  -0.0437 -0.0317 3   GLN L CA  
3232 C  C   . GLN C 3   ? 0.7312 0.6154 0.5630 0.0322  -0.0335 -0.0254 3   GLN L C   
3233 O  O   . GLN C 3   ? 0.7324 0.6066 0.5573 0.0324  -0.0270 -0.0147 3   GLN L O   
3234 C  CB  . GLN C 3   ? 0.7546 0.6393 0.5469 0.0421  -0.0392 -0.0329 3   GLN L CB  
3235 C  CG  . GLN C 3   ? 1.0073 0.8943 0.8042 0.0374  -0.0378 -0.0455 3   GLN L CG  
3236 C  CD  . GLN C 3   ? 1.3333 1.2151 1.1034 0.0428  -0.0335 -0.0481 3   GLN L CD  
3237 O  OE1 . GLN C 3   ? 1.2951 1.1764 1.0602 0.0421  -0.0357 -0.0609 3   GLN L OE1 
3238 N  NE2 . GLN C 3   ? 1.2668 1.1433 1.0178 0.0482  -0.0267 -0.0363 3   GLN L NE2 
3239 N  N   . MET C 4   ? 0.6566 0.5470 0.5097 0.0252  -0.0327 -0.0318 4   MET L N   
3240 C  CA  . MET C 4   ? 0.6298 0.5177 0.4989 0.0191  -0.0247 -0.0270 4   MET L CA  
3241 C  C   . MET C 4   ? 0.6633 0.5491 0.5335 0.0162  -0.0165 -0.0293 4   MET L C   
3242 O  O   . MET C 4   ? 0.6603 0.5473 0.5331 0.0149  -0.0185 -0.0385 4   MET L O   
3243 C  CB  . MET C 4   ? 0.6408 0.5370 0.5313 0.0152  -0.0288 -0.0304 4   MET L CB  
3244 C  CG  . MET C 4   ? 0.6881 0.5891 0.5788 0.0205  -0.0366 -0.0292 4   MET L CG  
3245 S  SD  . MET C 4   ? 0.7460 0.6330 0.6294 0.0237  -0.0329 -0.0178 4   MET L SD  
3246 C  CE  . MET C 4   ? 0.6828 0.5747 0.5879 0.0171  -0.0296 -0.0187 4   MET L CE  
3247 N  N   . THR C 5   ? 0.6107 0.4934 0.4792 0.0152  -0.0071 -0.0210 5   THR L N   
3248 C  CA  . THR C 5   ? 0.6046 0.4885 0.4756 0.0148  0.0018  -0.0219 5   THR L CA  
3249 C  C   . THR C 5   ? 0.6221 0.5105 0.5136 0.0096  0.0057  -0.0178 5   THR L C   
3250 O  O   . THR C 5   ? 0.6085 0.4981 0.5045 0.0060  0.0072  -0.0100 5   THR L O   
3251 C  CB  . THR C 5   ? 0.7381 0.6214 0.5921 0.0183  0.0099  -0.0159 5   THR L CB  
3252 O  OG1 . THR C 5   ? 0.7656 0.6442 0.5979 0.0234  0.0046  -0.0174 5   THR L OG1 
3253 C  CG2 . THR C 5   ? 0.7272 0.6138 0.5804 0.0218  0.0186  -0.0196 5   THR L CG2 
3254 N  N   . GLN C 6   ? 0.5636 0.4530 0.4656 0.0094  0.0072  -0.0230 6   GLN L N   
3255 C  CA  . GLN C 6   ? 0.5405 0.4348 0.4603 0.0060  0.0100  -0.0191 6   GLN L CA  
3256 C  C   . GLN C 6   ? 0.5925 0.4914 0.5153 0.0097  0.0188  -0.0167 6   GLN L C   
3257 O  O   . GLN C 6   ? 0.6034 0.4975 0.5176 0.0156  0.0221  -0.0222 6   GLN L O   
3258 C  CB  . GLN C 6   ? 0.5474 0.4391 0.4774 0.0034  0.0049  -0.0246 6   GLN L CB  
3259 C  CG  . GLN C 6   ? 0.6333 0.5308 0.5782 -0.0008 0.0044  -0.0195 6   GLN L CG  
3260 C  CD  . GLN C 6   ? 0.7737 0.6701 0.7265 -0.0042 -0.0003 -0.0238 6   GLN L CD  
3261 O  OE1 . GLN C 6   ? 0.6664 0.5615 0.6159 -0.0054 -0.0057 -0.0300 6   GLN L OE1 
3262 N  NE2 . GLN C 6   ? 0.6849 0.5842 0.6487 -0.0063 0.0016  -0.0200 6   GLN L NE2 
3263 N  N   . SER C 7   ? 0.5340 0.4432 0.4693 0.0068  0.0222  -0.0092 7   SER L N   
3264 C  CA  . SER C 7   ? 0.5304 0.4504 0.4725 0.0110  0.0303  -0.0057 7   SER L CA  
3265 C  C   . SER C 7   ? 0.5560 0.4849 0.5156 0.0094  0.0296  -0.0017 7   SER L C   
3266 O  O   . SER C 7   ? 0.5399 0.4728 0.5062 0.0023  0.0253  0.0019  7   SER L O   
3267 C  CB  . SER C 7   ? 0.5827 0.5134 0.5213 0.0089  0.0365  0.0011  7   SER L CB  
3268 O  OG  . SER C 7   ? 0.7114 0.6570 0.6580 0.0146  0.0449  0.0037  7   SER L OG  
3269 N  N   . PRO C 8   ? 0.5070 0.4391 0.4725 0.0173  0.0339  -0.0021 8   PRO L N   
3270 C  CA  . PRO C 8   ? 0.5195 0.4436 0.4760 0.0276  0.0394  -0.0075 8   PRO L CA  
3271 C  C   . PRO C 8   ? 0.5760 0.4776 0.5253 0.0286  0.0347  -0.0159 8   PRO L C   
3272 O  O   . PRO C 8   ? 0.5622 0.4581 0.5155 0.0211  0.0281  -0.0164 8   PRO L O   
3273 C  CB  . PRO C 8   ? 0.5400 0.4800 0.5093 0.0357  0.0454  -0.0022 8   PRO L CB  
3274 C  CG  . PRO C 8   ? 0.5794 0.5252 0.5626 0.0301  0.0395  0.0032  8   PRO L CG  
3275 C  CD  . PRO C 8   ? 0.5129 0.4536 0.4930 0.0178  0.0326  0.0025  8   PRO L CD  
3276 N  N   . ALA C 9   ? 0.5516 0.4407 0.4909 0.0376  0.0388  -0.0227 9   ALA L N   
3277 C  CA  . ALA C 9   ? 0.5637 0.4288 0.4959 0.0372  0.0349  -0.0314 9   ALA L CA  
3278 C  C   . ALA C 9   ? 0.6066 0.4665 0.5514 0.0364  0.0338  -0.0263 9   ALA L C   
3279 O  O   . ALA C 9   ? 0.6009 0.4496 0.5476 0.0280  0.0282  -0.0284 9   ALA L O   
3280 C  CB  . ALA C 9   ? 0.6004 0.4511 0.5177 0.0480  0.0402  -0.0400 9   ALA L CB  
3281 N  N   . SER C 10  ? 0.5572 0.4289 0.5113 0.0448  0.0389  -0.0186 10  SER L N   
3282 C  CA  . SER C 10  ? 0.5501 0.4191 0.5142 0.0464  0.0380  -0.0118 10  SER L CA  
3283 C  C   . SER C 10  ? 0.5813 0.4764 0.5581 0.0526  0.0409  -0.0022 10  SER L C   
3284 O  O   . SER C 10  ? 0.5727 0.4849 0.5509 0.0583  0.0460  -0.0016 10  SER L O   
3285 C  CB  . SER C 10  ? 0.6225 0.4634 0.5784 0.0546  0.0406  -0.0160 10  SER L CB  
3286 O  OG  . SER C 10  ? 0.7504 0.5932 0.7035 0.0710  0.0479  -0.0160 10  SER L OG  
3287 N  N   . LEU C 11  ? 0.5274 0.4280 0.5137 0.0511  0.0377  0.0054  11  LEU L N   
3288 C  CA  . LEU C 11  ? 0.5144 0.4422 0.5137 0.0560  0.0383  0.0141  11  LEU L CA  
3289 C  C   . LEU C 11  ? 0.5679 0.4923 0.5713 0.0606  0.0357  0.0216  11  LEU L C   
3290 O  O   . LEU C 11  ? 0.5685 0.4714 0.5658 0.0555  0.0334  0.0213  11  LEU L O   
3291 C  CB  . LEU C 11  ? 0.4933 0.4446 0.4999 0.0441  0.0349  0.0160  11  LEU L CB  
3292 C  CG  . LEU C 11  ? 0.5377 0.4898 0.5466 0.0326  0.0277  0.0181  11  LEU L CG  
3293 C  CD1 . LEU C 11  ? 0.5257 0.4997 0.5419 0.0240  0.0250  0.0203  11  LEU L CD1 
3294 C  CD2 . LEU C 11  ? 0.5708 0.5018 0.5702 0.0246  0.0250  0.0119  11  LEU L CD2 
3295 N  N   . SER C 12  ? 0.5222 0.4702 0.5362 0.0700  0.0363  0.0291  12  SER L N   
3296 C  CA  . SER C 12  ? 0.5244 0.4722 0.5407 0.0764  0.0333  0.0377  12  SER L CA  
3297 C  C   . SER C 12  ? 0.5571 0.5408 0.5867 0.0749  0.0284  0.0442  12  SER L C   
3298 O  O   . SER C 12  ? 0.5397 0.5504 0.5798 0.0737  0.0293  0.0433  12  SER L O   
3299 C  CB  . SER C 12  ? 0.5958 0.5271 0.6073 0.0952  0.0384  0.0403  12  SER L CB  
3300 O  OG  . SER C 12  ? 0.7120 0.6727 0.7348 0.1092  0.0409  0.0442  12  SER L OG  
3301 N  N   . ALA C 13  ? 0.5168 0.5010 0.5452 0.0741  0.0231  0.0508  13  ALA L N   
3302 C  CA  . ALA C 13  ? 0.5047 0.5216 0.5433 0.0725  0.0165  0.0562  13  ALA L CA  
3303 C  C   . ALA C 13  ? 0.5666 0.5787 0.5992 0.0798  0.0127  0.0652  13  ALA L C   
3304 O  O   . ALA C 13  ? 0.5769 0.5582 0.5977 0.0831  0.0158  0.0676  13  ALA L O   
3305 C  CB  . ALA C 13  ? 0.4955 0.5219 0.5356 0.0543  0.0118  0.0508  13  ALA L CB  
3306 N  N   . SER C 14  ? 0.5181 0.5613 0.5586 0.0822  0.0059  0.0705  14  SER L N   
3307 C  CA  . SER C 14  ? 0.5285 0.5718 0.5617 0.0901  0.0013  0.0801  14  SER L CA  
3308 C  C   . SER C 14  ? 0.5692 0.6156 0.5957 0.0754  -0.0047 0.0781  14  SER L C   
3309 O  O   . SER C 14  ? 0.5483 0.6025 0.5788 0.0608  -0.0068 0.0695  14  SER L O   
3310 C  CB  . SER C 14  ? 0.5771 0.6549 0.6219 0.1048  -0.0034 0.0872  14  SER L CB  
3311 O  OG  . SER C 14  ? 0.6940 0.7643 0.7415 0.1234  0.0032  0.0907  14  SER L OG  
3312 N  N   . VAL C 15  ? 0.5416 0.5796 0.5557 0.0802  -0.0069 0.0864  15  VAL L N   
3313 C  CA  . VAL C 15  ? 0.5346 0.5764 0.5395 0.0692  -0.0119 0.0851  15  VAL L CA  
3314 C  C   . VAL C 15  ? 0.5724 0.6497 0.5861 0.0625  -0.0215 0.0798  15  VAL L C   
3315 O  O   . VAL C 15  ? 0.5707 0.6754 0.5939 0.0713  -0.0268 0.0840  15  VAL L O   
3316 C  CB  . VAL C 15  ? 0.6066 0.6364 0.5952 0.0776  -0.0118 0.0972  15  VAL L CB  
3317 C  CG1 . VAL C 15  ? 0.6029 0.6406 0.5803 0.0679  -0.0165 0.0954  15  VAL L CG1 
3318 C  CG2 . VAL C 15  ? 0.6193 0.6104 0.5995 0.0799  -0.0020 0.1017  15  VAL L CG2 
3319 N  N   . GLY C 16  ? 0.5196 0.5955 0.5305 0.0470  -0.0236 0.0704  16  GLY L N   
3320 C  CA  . GLY C 16  ? 0.5117 0.6139 0.5282 0.0373  -0.0328 0.0635  16  GLY L CA  
3321 C  C   . GLY C 16  ? 0.5492 0.6604 0.5812 0.0284  -0.0317 0.0562  16  GLY L C   
3322 O  O   . GLY C 16  ? 0.5403 0.6668 0.5766 0.0163  -0.0383 0.0492  16  GLY L O   
3323 N  N   . GLU C 17  ? 0.5029 0.6028 0.5416 0.0335  -0.0233 0.0574  17  GLU L N   
3324 C  CA  . GLU C 17  ? 0.4908 0.5991 0.5425 0.0263  -0.0204 0.0521  17  GLU L CA  
3325 C  C   . GLU C 17  ? 0.5341 0.6197 0.5785 0.0130  -0.0177 0.0437  17  GLU L C   
3326 O  O   . GLU C 17  ? 0.5279 0.5912 0.5592 0.0114  -0.0167 0.0420  17  GLU L O   
3327 C  CB  . GLU C 17  ? 0.5111 0.6184 0.5705 0.0394  -0.0123 0.0563  17  GLU L CB  
3328 C  CG  . GLU C 17  ? 0.6544 0.7897 0.7246 0.0544  -0.0149 0.0644  17  GLU L CG  
3329 C  CD  . GLU C 17  ? 0.9160 1.0530 0.9947 0.0683  -0.0064 0.0669  17  GLU L CD  
3330 O  OE1 . GLU C 17  ? 0.8478 0.9715 0.9264 0.0634  0.0009  0.0614  17  GLU L OE1 
3331 O  OE2 . GLU C 17  ? 0.8432 0.9959 0.9277 0.0856  -0.0071 0.0744  17  GLU L OE2 
3332 N  N   . THR C 18  ? 0.4876 0.5806 0.5406 0.0035  -0.0164 0.0393  18  THR L N   
3333 C  CA  . THR C 18  ? 0.4835 0.5549 0.5288 -0.0076 -0.0142 0.0324  18  THR L CA  
3334 C  C   . THR C 18  ? 0.5347 0.5945 0.5813 -0.0041 -0.0056 0.0323  18  THR L C   
3335 O  O   . THR C 18  ? 0.5277 0.6048 0.5854 0.0003  -0.0019 0.0354  18  THR L O   
3336 C  CB  . THR C 18  ? 0.5959 0.6786 0.6454 -0.0228 -0.0198 0.0276  18  THR L CB  
3337 O  OG1 . THR C 18  ? 0.6050 0.6990 0.6514 -0.0254 -0.0288 0.0263  18  THR L OG1 
3338 C  CG2 . THR C 18  ? 0.5816 0.6390 0.6209 -0.0327 -0.0180 0.0215  18  THR L CG2 
3339 N  N   . VAL C 19  ? 0.4961 0.5296 0.5314 -0.0058 -0.0026 0.0283  19  VAL L N   
3340 C  CA  . VAL C 19  ? 0.4976 0.5182 0.5305 -0.0031 0.0045  0.0266  19  VAL L CA  
3341 C  C   . VAL C 19  ? 0.5506 0.5556 0.5750 -0.0128 0.0038  0.0213  19  VAL L C   
3342 O  O   . VAL C 19  ? 0.5457 0.5405 0.5629 -0.0171 -0.0006 0.0182  19  VAL L O   
3343 C  CB  . VAL C 19  ? 0.5522 0.5553 0.5794 0.0077  0.0086  0.0274  19  VAL L CB  
3344 C  CG1 . VAL C 19  ? 0.5565 0.5710 0.5899 0.0194  0.0093  0.0340  19  VAL L CG1 
3345 C  CG2 . VAL C 19  ? 0.5492 0.5331 0.5667 0.0044  0.0065  0.0247  19  VAL L CG2 
3346 N  N   . THR C 20  ? 0.5124 0.5149 0.5359 -0.0143 0.0087  0.0206  20  THR L N   
3347 C  CA  . THR C 20  ? 0.5138 0.4997 0.5271 -0.0212 0.0081  0.0169  20  THR L CA  
3348 C  C   . THR C 20  ? 0.5669 0.5390 0.5720 -0.0152 0.0129  0.0147  20  THR L C   
3349 O  O   . THR C 20  ? 0.5657 0.5443 0.5732 -0.0095 0.0187  0.0163  20  THR L O   
3350 C  CB  . THR C 20  ? 0.6275 0.6211 0.6436 -0.0320 0.0081  0.0187  20  THR L CB  
3351 O  OG1 . THR C 20  ? 0.6264 0.6385 0.6529 -0.0374 0.0034  0.0202  20  THR L OG1 
3352 C  CG2 . THR C 20  ? 0.6209 0.5931 0.6242 -0.0388 0.0055  0.0157  20  THR L CG2 
3353 N  N   . ILE C 21  ? 0.5235 0.4782 0.5188 -0.0159 0.0101  0.0104  21  ILE L N   
3354 C  CA  . ILE C 21  ? 0.5264 0.4683 0.5126 -0.0117 0.0122  0.0068  21  ILE L CA  
3355 C  C   . ILE C 21  ? 0.5764 0.5096 0.5526 -0.0161 0.0108  0.0061  21  ILE L C   
3356 O  O   . ILE C 21  ? 0.5698 0.4973 0.5434 -0.0201 0.0061  0.0052  21  ILE L O   
3357 C  CB  . ILE C 21  ? 0.5667 0.4988 0.5513 -0.0088 0.0095  0.0027  21  ILE L CB  
3358 C  CG1 . ILE C 21  ? 0.5707 0.5076 0.5633 -0.0049 0.0108  0.0055  21  ILE L CG1 
3359 C  CG2 . ILE C 21  ? 0.5867 0.5076 0.5625 -0.0056 0.0104  -0.0025 21  ILE L CG2 
3360 C  CD1 . ILE C 21  ? 0.6616 0.5892 0.6535 -0.0049 0.0092  0.0033  21  ILE L CD1 
3361 N  N   . THR C 22  ? 0.5415 0.4722 0.5099 -0.0140 0.0152  0.0067  22  THR L N   
3362 C  CA  . THR C 22  ? 0.5487 0.4694 0.5049 -0.0170 0.0144  0.0080  22  THR L CA  
3363 C  C   . THR C 22  ? 0.6085 0.5180 0.5520 -0.0112 0.0121  0.0032  22  THR L C   
3364 O  O   . THR C 22  ? 0.6049 0.5150 0.5466 -0.0058 0.0140  -0.0008 22  THR L O   
3365 C  CB  . THR C 22  ? 0.6457 0.5736 0.6008 -0.0212 0.0211  0.0144  22  THR L CB  
3366 O  OG1 . THR C 22  ? 0.6373 0.5757 0.5946 -0.0147 0.0278  0.0141  22  THR L OG1 
3367 C  CG2 . THR C 22  ? 0.6244 0.5625 0.5913 -0.0308 0.0208  0.0187  22  THR L CG2 
3368 N  N   . CYS C 23  ? 0.5783 0.4769 0.5122 -0.0119 0.0074  0.0033  23  CYS L N   
3369 C  CA  . CYS C 23  ? 0.5859 0.4767 0.5075 -0.0062 0.0033  -0.0007 23  CYS L CA  
3370 C  C   . CYS C 23  ? 0.6413 0.5218 0.5464 -0.0057 0.0039  0.0047  23  CYS L C   
3371 O  O   . CYS C 23  ? 0.6402 0.5123 0.5433 -0.0097 0.0030  0.0094  23  CYS L O   
3372 C  CB  . CYS C 23  ? 0.5856 0.4757 0.5122 -0.0045 -0.0040 -0.0058 23  CYS L CB  
3373 S  SG  . CYS C 23  ? 0.6490 0.5352 0.5630 0.0027  -0.0112 -0.0105 23  CYS L SG  
3374 N  N   . ARG C 24  ? 0.6054 0.4840 0.4963 -0.0004 0.0050  0.0039  24  ARG L N   
3375 C  CA  . ARG C 24  ? 0.6214 0.4892 0.4930 0.0015  0.0059  0.0105  24  ARG L CA  
3376 C  C   . ARG C 24  ? 0.6710 0.5343 0.5289 0.0102  -0.0022 0.0059  24  ARG L C   
3377 O  O   . ARG C 24  ? 0.6660 0.5365 0.5234 0.0139  -0.0047 -0.0020 24  ARG L O   
3378 C  CB  . ARG C 24  ? 0.6403 0.5126 0.5043 -0.0001 0.0161  0.0161  24  ARG L CB  
3379 C  CG  . ARG C 24  ? 0.8361 0.6966 0.6768 0.0020  0.0182  0.0243  24  ARG L CG  
3380 C  CD  . ARG C 24  ? 1.0476 0.9152 0.8816 -0.0006 0.0301  0.0313  24  ARG L CD  
3381 N  NE  . ARG C 24  ? 1.2214 1.1021 1.0559 0.0057  0.0340  0.0236  24  ARG L NE  
3382 C  CZ  . ARG C 24  ? 1.4259 1.3220 1.2748 0.0037  0.0423  0.0232  24  ARG L CZ  
3383 N  NH1 . ARG C 24  ? 1.2707 1.1751 1.1364 -0.0059 0.0471  0.0303  24  ARG L NH1 
3384 N  NH2 . ARG C 24  ? 1.2700 1.1735 1.1163 0.0116  0.0456  0.0156  24  ARG L NH2 
3385 N  N   . ALA C 25  ? 0.6316 0.4824 0.4774 0.0136  -0.0066 0.0110  25  ALA L N   
3386 C  CA  . ALA C 25  ? 0.6371 0.4865 0.4700 0.0236  -0.0155 0.0078  25  ALA L CA  
3387 C  C   . ALA C 25  ? 0.7044 0.5440 0.5109 0.0288  -0.0135 0.0154  25  ALA L C   
3388 O  O   . ALA C 25  ? 0.7118 0.5395 0.5095 0.0243  -0.0060 0.0259  25  ALA L O   
3389 C  CB  . ALA C 25  ? 0.6454 0.4890 0.4825 0.0278  -0.0228 0.0077  25  ALA L CB  
3390 N  N   . SER C 26  ? 0.6671 0.5128 0.4608 0.0375  -0.0205 0.0100  26  SER L N   
3391 C  CA  . SER C 26  ? 0.6926 0.5310 0.4577 0.0446  -0.0200 0.0165  26  SER L CA  
3392 C  C   . SER C 26  ? 0.7589 0.5777 0.5085 0.0499  -0.0220 0.0287  26  SER L C   
3393 O  O   . SER C 26  ? 0.7789 0.5843 0.5068 0.0504  -0.0156 0.0402  26  SER L O   
3394 C  CB  . SER C 26  ? 0.7439 0.5945 0.4994 0.0529  -0.0299 0.0063  26  SER L CB  
3395 O  OG  . SER C 26  ? 0.8553 0.7108 0.6156 0.0601  -0.0425 0.0030  26  SER L OG  
3396 N  N   . GLY C 27  ? 0.7019 0.5188 0.4616 0.0544  -0.0304 0.0263  27  GLY L N   
3397 C  CA  . GLY C 27  ? 0.7191 0.5142 0.4657 0.0613  -0.0332 0.0361  27  GLY L CA  
3398 C  C   . GLY C 27  ? 0.7459 0.5343 0.5118 0.0562  -0.0327 0.0342  27  GLY L C   
3399 O  O   . GLY C 27  ? 0.7112 0.5157 0.5010 0.0493  -0.0321 0.0250  27  GLY L O   
3400 N  N   . ASN C 28  ? 0.7232 0.4850 0.4766 0.0598  -0.0326 0.0432  28  ASN L N   
3401 C  CA  . ASN C 28  ? 0.7113 0.4622 0.4779 0.0565  -0.0327 0.0408  28  ASN L CA  
3402 C  C   . ASN C 28  ? 0.7355 0.5066 0.5188 0.0666  -0.0419 0.0293  28  ASN L C   
3403 O  O   . ASN C 28  ? 0.7402 0.5171 0.5154 0.0816  -0.0503 0.0287  28  ASN L O   
3404 C  CB  . ASN C 28  ? 0.7565 0.4699 0.5017 0.0603  -0.0318 0.0519  28  ASN L CB  
3405 C  CG  . ASN C 28  ? 1.0392 0.7359 0.7937 0.0565  -0.0317 0.0485  28  ASN L CG  
3406 O  OD1 . ASN C 28  ? 0.9503 0.6651 0.7265 0.0539  -0.0334 0.0378  28  ASN L OD1 
3407 N  ND2 . ASN C 28  ? 0.9563 0.6159 0.6922 0.0556  -0.0294 0.0576  28  ASN L ND2 
3408 N  N   . ILE C 29  ? 0.6610 0.4449 0.4677 0.0584  -0.0400 0.0211  29  ILE L N   
3409 C  CA  . ILE C 29  ? 0.6392 0.4451 0.4637 0.0657  -0.0465 0.0110  29  ILE L CA  
3410 C  C   . ILE C 29  ? 0.6937 0.4862 0.5211 0.0708  -0.0474 0.0094  29  ILE L C   
3411 O  O   . ILE C 29  ? 0.6749 0.4866 0.5176 0.0767  -0.0509 0.0016  29  ILE L O   
3412 C  CB  . ILE C 29  ? 0.6465 0.4803 0.4934 0.0556  -0.0447 0.0025  29  ILE L CB  
3413 C  CG1 . ILE C 29  ? 0.6378 0.4670 0.4953 0.0412  -0.0364 0.0028  29  ILE L CG1 
3414 C  CG2 . ILE C 29  ? 0.6562 0.5026 0.4976 0.0551  -0.0463 0.0012  29  ILE L CG2 
3415 C  CD1 . ILE C 29  ? 0.7005 0.5522 0.5781 0.0333  -0.0345 -0.0042 29  ILE L CD1 
3416 N  N   . HIS C 30  ? 0.6733 0.4325 0.4854 0.0675  -0.0435 0.0164  30  HIS L N   
3417 C  CA  . HIS C 30  ? 0.6840 0.4208 0.4915 0.0729  -0.0443 0.0148  30  HIS L CA  
3418 C  C   . HIS C 30  ? 0.7007 0.4526 0.5282 0.0675  -0.0429 0.0049  30  HIS L C   
3419 O  O   . HIS C 30  ? 0.7025 0.4511 0.5302 0.0791  -0.0458 -0.0003 30  HIS L O   
3420 C  CB  . HIS C 30  ? 0.7190 0.4479 0.5138 0.0953  -0.0516 0.0160  30  HIS L CB  
3421 C  CG  . HIS C 30  ? 0.7927 0.5037 0.5637 0.1024  -0.0536 0.0272  30  HIS L CG  
3422 N  ND1 . HIS C 30  ? 0.8083 0.5445 0.5796 0.1082  -0.0582 0.0278  30  HIS L ND1 
3423 C  CD2 . HIS C 30  ? 0.8508 0.5225 0.5978 0.1016  -0.0507 0.0379  30  HIS L CD2 
3424 C  CE1 . HIS C 30  ? 0.8340 0.5456 0.5793 0.1142  -0.0586 0.0392  30  HIS L CE1 
3425 N  NE2 . HIS C 30  ? 0.8655 0.5373 0.5955 0.1101  -0.0536 0.0465  30  HIS L NE2 
3426 N  N   . ASN C 31  ? 0.6249 0.3929 0.4675 0.0513  -0.0380 0.0028  31  ASN L N   
3427 C  CA  . ASN C 31  ? 0.5986 0.3808 0.4581 0.0451  -0.0362 -0.0050 31  ASN L CA  
3428 C  C   . ASN C 31  ? 0.6220 0.4361 0.4987 0.0526  -0.0387 -0.0122 31  ASN L C   
3429 O  O   . ASN C 31  ? 0.6028 0.4291 0.4915 0.0491  -0.0368 -0.0177 31  ASN L O   
3430 C  CB  . ASN C 31  ? 0.6185 0.3745 0.4684 0.0460  -0.0363 -0.0075 31  ASN L CB  
3431 C  CG  . ASN C 31  ? 0.8840 0.6127 0.7231 0.0318  -0.0330 -0.0018 31  ASN L CG  
3432 O  OD1 . ASN C 31  ? 0.7802 0.5203 0.6288 0.0170  -0.0290 0.0005  31  ASN L OD1 
3433 N  ND2 . ASN C 31  ? 0.8241 0.5168 0.6439 0.0361  -0.0345 0.0002  31  ASN L ND2 
3434 N  N   . PHE C 32  ? 0.5715 0.4011 0.4497 0.0610  -0.0429 -0.0119 32  PHE L N   
3435 C  CA  . PHE C 32  ? 0.5465 0.4088 0.4429 0.0654  -0.0454 -0.0183 32  PHE L CA  
3436 C  C   . PHE C 32  ? 0.5733 0.4532 0.4829 0.0518  -0.0425 -0.0195 32  PHE L C   
3437 O  O   . PHE C 32  ? 0.5629 0.4559 0.4746 0.0522  -0.0458 -0.0203 32  PHE L O   
3438 C  CB  . PHE C 32  ? 0.5791 0.4509 0.4712 0.0806  -0.0528 -0.0182 32  PHE L CB  
3439 C  CG  . PHE C 32  ? 0.6161 0.4799 0.5012 0.0984  -0.0561 -0.0192 32  PHE L CG  
3440 C  CD1 . PHE C 32  ? 0.6796 0.5069 0.5462 0.1020  -0.0540 -0.0158 32  PHE L CD1 
3441 C  CD2 . PHE C 32  ? 0.6378 0.5300 0.5346 0.1121  -0.0613 -0.0236 32  PHE L CD2 
3442 C  CE1 . PHE C 32  ? 0.7127 0.5283 0.5705 0.1205  -0.0568 -0.0175 32  PHE L CE1 
3443 C  CE2 . PHE C 32  ? 0.6930 0.5790 0.5834 0.1315  -0.0638 -0.0247 32  PHE L CE2 
3444 C  CZ  . PHE C 32  ? 0.6958 0.5413 0.5653 0.1367  -0.0615 -0.0219 32  PHE L CZ  
3445 N  N   . LEU C 33  ? 0.5193 0.3979 0.4360 0.0404  -0.0369 -0.0198 33  LEU L N   
3446 C  CA  . LEU C 33  ? 0.4970 0.3880 0.4246 0.0292  -0.0334 -0.0202 33  LEU L CA  
3447 C  C   . LEU C 33  ? 0.5213 0.4269 0.4643 0.0241  -0.0301 -0.0234 33  LEU L C   
3448 O  O   . LEU C 33  ? 0.5187 0.4188 0.4602 0.0254  -0.0287 -0.0242 33  LEU L O   
3449 C  CB  . LEU C 33  ? 0.5031 0.3784 0.4219 0.0208  -0.0292 -0.0147 33  LEU L CB  
3450 C  CG  . LEU C 33  ? 0.5495 0.4346 0.4786 0.0111  -0.0245 -0.0147 33  LEU L CG  
3451 C  CD1 . LEU C 33  ? 0.5596 0.4397 0.4802 0.0090  -0.0225 -0.0114 33  LEU L CD1 
3452 C  CD2 . LEU C 33  ? 0.5741 0.4570 0.5086 0.0040  -0.0206 -0.0131 33  LEU L CD2 
3453 N  N   . ALA C 34  ? 0.4613 0.3827 0.4168 0.0178  -0.0287 -0.0252 34  ALA L N   
3454 C  CA  . ALA C 34  ? 0.4450 0.3788 0.4136 0.0123  -0.0247 -0.0262 34  ALA L CA  
3455 C  C   . ALA C 34  ? 0.4877 0.4209 0.4612 0.0030  -0.0208 -0.0241 34  ALA L C   
3456 O  O   . ALA C 34  ? 0.4846 0.4143 0.4552 0.0012  -0.0216 -0.0244 34  ALA L O   
3457 C  CB  . ALA C 34  ? 0.4492 0.4047 0.4303 0.0152  -0.0264 -0.0302 34  ALA L CB  
3458 N  N   . TRP C 35  ? 0.4378 0.3740 0.4170 -0.0015 -0.0166 -0.0220 35  TRP L N   
3459 C  CA  . TRP C 35  ? 0.4303 0.3654 0.4140 -0.0078 -0.0126 -0.0191 35  TRP L CA  
3460 C  C   . TRP C 35  ? 0.4750 0.4213 0.4697 -0.0116 -0.0099 -0.0189 35  TRP L C   
3461 O  O   . TRP C 35  ? 0.4665 0.4219 0.4642 -0.0102 -0.0087 -0.0187 35  TRP L O   
3462 C  CB  . TRP C 35  ? 0.4144 0.3435 0.3942 -0.0095 -0.0105 -0.0149 35  TRP L CB  
3463 C  CG  . TRP C 35  ? 0.4315 0.3501 0.4028 -0.0094 -0.0112 -0.0135 35  TRP L CG  
3464 C  CD1 . TRP C 35  ? 0.4778 0.3874 0.4405 -0.0084 -0.0133 -0.0132 35  TRP L CD1 
3465 C  CD2 . TRP C 35  ? 0.4318 0.3468 0.4015 -0.0108 -0.0090 -0.0117 35  TRP L CD2 
3466 N  NE1 . TRP C 35  ? 0.4764 0.3784 0.4335 -0.0108 -0.0120 -0.0101 35  TRP L NE1 
3467 C  CE2 . TRP C 35  ? 0.4892 0.3962 0.4503 -0.0113 -0.0091 -0.0093 35  TRP L CE2 
3468 C  CE3 . TRP C 35  ? 0.4462 0.3626 0.4198 -0.0113 -0.0063 -0.0121 35  TRP L CE3 
3469 C  CZ2 . TRP C 35  ? 0.4843 0.3891 0.4417 -0.0122 -0.0057 -0.0066 35  TRP L CZ2 
3470 C  CZ3 . TRP C 35  ? 0.4699 0.3822 0.4385 -0.0105 -0.0036 -0.0109 35  TRP L CZ3 
3471 C  CH2 . TRP C 35  ? 0.4841 0.3928 0.4452 -0.0108 -0.0029 -0.0079 35  TRP L CH2 
3472 N  N   . TYR C 36  ? 0.4331 0.3769 0.4322 -0.0165 -0.0083 -0.0188 36  TYR L N   
3473 C  CA  . TYR C 36  ? 0.4310 0.3812 0.4399 -0.0224 -0.0051 -0.0176 36  TYR L CA  
3474 C  C   . TYR C 36  ? 0.4919 0.4305 0.4999 -0.0254 -0.0009 -0.0130 36  TYR L C   
3475 O  O   . TYR C 36  ? 0.4922 0.4198 0.4946 -0.0234 -0.0012 -0.0136 36  TYR L O   
3476 C  CB  . TYR C 36  ? 0.4482 0.4053 0.4642 -0.0268 -0.0083 -0.0234 36  TYR L CB  
3477 C  CG  . TYR C 36  ? 0.4643 0.4362 0.4824 -0.0215 -0.0133 -0.0277 36  TYR L CG  
3478 C  CD1 . TYR C 36  ? 0.4857 0.4771 0.5142 -0.0215 -0.0119 -0.0278 36  TYR L CD1 
3479 C  CD2 . TYR C 36  ? 0.4768 0.4441 0.4859 -0.0153 -0.0189 -0.0311 36  TYR L CD2 
3480 C  CE1 . TYR C 36  ? 0.4946 0.5009 0.5254 -0.0138 -0.0164 -0.0318 36  TYR L CE1 
3481 C  CE2 . TYR C 36  ? 0.4899 0.4693 0.4996 -0.0080 -0.0239 -0.0342 36  TYR L CE2 
3482 C  CZ  . TYR C 36  ? 0.5781 0.5775 0.5993 -0.0065 -0.0229 -0.0349 36  TYR L CZ  
3483 O  OH  . TYR C 36  ? 0.5893 0.6021 0.6115 0.0033  -0.0278 -0.0379 36  TYR L OH  
3484 N  N   . GLN C 37  ? 0.4531 0.3942 0.4662 -0.0294 0.0034  -0.0082 37  GLN L N   
3485 C  CA  . GLN C 37  ? 0.4595 0.3876 0.4711 -0.0308 0.0075  -0.0026 37  GLN L CA  
3486 C  C   . GLN C 37  ? 0.5249 0.4488 0.5433 -0.0399 0.0100  -0.0028 37  GLN L C   
3487 O  O   . GLN C 37  ? 0.5197 0.4570 0.5456 -0.0451 0.0116  -0.0018 37  GLN L O   
3488 C  CB  . GLN C 37  ? 0.4740 0.4060 0.4826 -0.0274 0.0105  0.0055  37  GLN L CB  
3489 C  CG  . GLN C 37  ? 0.6344 0.5531 0.6405 -0.0264 0.0144  0.0128  37  GLN L CG  
3490 C  CD  . GLN C 37  ? 0.8568 0.7814 0.8608 -0.0258 0.0180  0.0217  37  GLN L CD  
3491 O  OE1 . GLN C 37  ? 0.8114 0.7434 0.8185 -0.0312 0.0210  0.0235  37  GLN L OE1 
3492 N  NE2 . GLN C 37  ? 0.7374 0.6610 0.7359 -0.0189 0.0177  0.0276  37  GLN L NE2 
3493 N  N   . GLN C 38  ? 0.4976 0.4026 0.5131 -0.0419 0.0108  -0.0040 38  GLN L N   
3494 C  CA  . GLN C 38  ? 0.5143 0.4095 0.5348 -0.0524 0.0128  -0.0049 38  GLN L CA  
3495 C  C   . GLN C 38  ? 0.5972 0.4687 0.6116 -0.0514 0.0180  0.0024  38  GLN L C   
3496 O  O   . GLN C 38  ? 0.5986 0.4538 0.6049 -0.0440 0.0178  0.0008  38  GLN L O   
3497 C  CB  . GLN C 38  ? 0.5345 0.4267 0.5562 -0.0574 0.0071  -0.0163 38  GLN L CB  
3498 C  CG  . GLN C 38  ? 0.6637 0.5468 0.6922 -0.0716 0.0081  -0.0187 38  GLN L CG  
3499 C  CD  . GLN C 38  ? 0.8776 0.7600 0.9067 -0.0774 0.0009  -0.0315 38  GLN L CD  
3500 O  OE1 . GLN C 38  ? 0.8081 0.6846 0.8270 -0.0694 -0.0033 -0.0381 38  GLN L OE1 
3501 N  NE2 . GLN C 38  ? 0.7969 0.6868 0.8378 -0.0920 -0.0008 -0.0352 38  GLN L NE2 
3502 N  N   . LYS C 39  ? 0.5754 0.4448 0.5932 -0.0583 0.0233  0.0108  39  LYS L N   
3503 C  CA  . LYS C 39  ? 0.6014 0.4448 0.6123 -0.0578 0.0287  0.0194  39  LYS L CA  
3504 C  C   . LYS C 39  ? 0.6852 0.5063 0.6972 -0.0689 0.0281  0.0123  39  LYS L C   
3505 O  O   . LYS C 39  ? 0.6752 0.5088 0.6968 -0.0802 0.0247  0.0042  39  LYS L O   
3506 C  CB  . LYS C 39  ? 0.6388 0.4877 0.6508 -0.0618 0.0350  0.0321  39  LYS L CB  
3507 C  CG  . LYS C 39  ? 0.7927 0.6629 0.8014 -0.0514 0.0347  0.0377  39  LYS L CG  
3508 C  CD  . LYS C 39  ? 0.9190 0.7765 0.9168 -0.0388 0.0357  0.0464  39  LYS L CD  
3509 C  CE  . LYS C 39  ? 1.0291 0.9090 1.0235 -0.0311 0.0344  0.0512  39  LYS L CE  
3510 N  NZ  . LYS C 39  ? 1.1333 1.0291 1.1289 -0.0375 0.0385  0.0561  39  LYS L NZ  
3511 N  N   . GLN C 40  ? 0.6785 0.4669 0.6803 -0.0648 0.0306  0.0142  40  GLN L N   
3512 C  CA  . GLN C 40  ? 0.7107 0.4713 0.7101 -0.0752 0.0299  0.0061  40  GLN L CA  
3513 C  C   . GLN C 40  ? 0.7817 0.5427 0.7915 -0.0959 0.0324  0.0087  40  GLN L C   
3514 O  O   . GLN C 40  ? 0.7846 0.5437 0.7951 -0.0991 0.0392  0.0223  40  GLN L O   
3515 C  CB  . GLN C 40  ? 0.7603 0.4819 0.7449 -0.0651 0.0335  0.0093  40  GLN L CB  
3516 C  CG  . GLN C 40  ? 1.0252 0.7105 1.0042 -0.0763 0.0331  0.0004  40  GLN L CG  
3517 C  CD  . GLN C 40  ? 1.2866 0.9734 1.2631 -0.0773 0.0257  -0.0179 40  GLN L CD  
3518 O  OE1 . GLN C 40  ? 1.2042 0.9126 1.1798 -0.0658 0.0222  -0.0230 40  GLN L OE1 
3519 N  NE2 . GLN C 40  ? 1.2261 0.8877 1.1998 -0.0914 0.0234  -0.0280 40  GLN L NE2 
3520 N  N   . GLY C 41  ? 0.7482 0.5138 0.7658 -0.1095 0.0269  -0.0042 41  GLY L N   
3521 C  CA  . GLY C 41  ? 0.7616 0.5326 0.7929 -0.1318 0.0282  -0.0043 41  GLY L CA  
3522 C  C   . GLY C 41  ? 0.7885 0.6024 0.8360 -0.1363 0.0301  0.0016  41  GLY L C   
3523 O  O   . GLY C 41  ? 0.7942 0.6174 0.8546 -0.1538 0.0342  0.0057  41  GLY L O   
3524 N  N   . LYS C 42  ? 0.7132 0.5536 0.7603 -0.1208 0.0276  0.0016  42  LYS L N   
3525 C  CA  . LYS C 42  ? 0.6867 0.5661 0.7461 -0.1210 0.0295  0.0059  42  LYS L CA  
3526 C  C   . LYS C 42  ? 0.7073 0.6137 0.7720 -0.1140 0.0209  -0.0054 42  LYS L C   
3527 O  O   . LYS C 42  ? 0.7015 0.5966 0.7565 -0.1048 0.0149  -0.0131 42  LYS L O   
3528 C  CB  . LYS C 42  ? 0.7113 0.5932 0.7617 -0.1082 0.0359  0.0191  42  LYS L CB  
3529 C  CG  . LYS C 42  ? 0.9280 0.7847 0.9709 -0.1129 0.0448  0.0332  42  LYS L CG  
3530 C  CD  . LYS C 42  ? 1.0670 0.9431 1.1205 -0.1260 0.0528  0.0425  42  LYS L CD  
3531 C  CE  . LYS C 42  ? 1.2242 1.0801 1.2651 -0.1243 0.0620  0.0597  42  LYS L CE  
3532 N  NZ  . LYS C 42  ? 1.3368 1.2142 1.3862 -0.1363 0.0714  0.0700  42  LYS L NZ  
3533 N  N   . SER C 43  ? 0.6424 0.5844 0.7214 -0.1168 0.0211  -0.0055 43  SER L N   
3534 C  CA  . SER C 43  ? 0.6166 0.5841 0.6996 -0.1077 0.0132  -0.0145 43  SER L CA  
3535 C  C   . SER C 43  ? 0.6391 0.6049 0.7085 -0.0892 0.0132  -0.0113 43  SER L C   
3536 O  O   . SER C 43  ? 0.6310 0.5932 0.6947 -0.0848 0.0200  -0.0014 43  SER L O   
3537 C  CB  . SER C 43  ? 0.6570 0.6634 0.7593 -0.1137 0.0141  -0.0152 43  SER L CB  
3538 O  OG  . SER C 43  ? 0.7775 0.7968 0.8812 -0.1109 0.0235  -0.0044 43  SER L OG  
3539 N  N   . PRO C 44  ? 0.5777 0.5458 0.6413 -0.0792 0.0055  -0.0194 44  PRO L N   
3540 C  CA  . PRO C 44  ? 0.5583 0.5241 0.6100 -0.0643 0.0052  -0.0167 44  PRO L CA  
3541 C  C   . PRO C 44  ? 0.5903 0.5783 0.6454 -0.0583 0.0080  -0.0129 44  PRO L C   
3542 O  O   . PRO C 44  ? 0.5812 0.5935 0.6489 -0.0614 0.0079  -0.0151 44  PRO L O   
3543 C  CB  . PRO C 44  ? 0.5755 0.5400 0.6213 -0.0579 -0.0031 -0.0256 44  PRO L CB  
3544 C  CG  . PRO C 44  ? 0.6376 0.6170 0.6951 -0.0666 -0.0083 -0.0332 44  PRO L CG  
3545 C  CD  . PRO C 44  ? 0.5965 0.5703 0.6631 -0.0816 -0.0035 -0.0307 44  PRO L CD  
3546 N  N   . GLN C 45  ? 0.5393 0.5205 0.5834 -0.0491 0.0101  -0.0080 45  GLN L N   
3547 C  CA  . GLN C 45  ? 0.5278 0.5249 0.5702 -0.0420 0.0123  -0.0059 45  GLN L CA  
3548 C  C   . GLN C 45  ? 0.5609 0.5523 0.5926 -0.0312 0.0070  -0.0098 45  GLN L C   
3549 O  O   . GLN C 45  ? 0.5574 0.5320 0.5806 -0.0293 0.0054  -0.0086 45  GLN L O   
3550 C  CB  . GLN C 45  ? 0.5509 0.5456 0.5883 -0.0428 0.0196  0.0038  45  GLN L CB  
3551 C  CG  . GLN C 45  ? 0.7760 0.7682 0.8207 -0.0547 0.0262  0.0106  45  GLN L CG  
3552 C  CD  . GLN C 45  ? 1.0620 1.0784 1.1226 -0.0633 0.0296  0.0093  45  GLN L CD  
3553 O  OE1 . GLN C 45  ? 0.9973 1.0341 1.0661 -0.0599 0.0258  0.0019  45  GLN L OE1 
3554 N  NE2 . GLN C 45  ? 0.9941 1.0090 1.0598 -0.0747 0.0371  0.0173  45  GLN L NE2 
3555 N  N   . VAL C 46  ? 0.5055 0.5110 0.5377 -0.0240 0.0049  -0.0140 46  VAL L N   
3556 C  CA  . VAL C 46  ? 0.4967 0.4938 0.5176 -0.0145 0.0002  -0.0174 46  VAL L CA  
3557 C  C   . VAL C 46  ? 0.5361 0.5237 0.5459 -0.0120 0.0022  -0.0136 46  VAL L C   
3558 O  O   . VAL C 46  ? 0.5336 0.5295 0.5427 -0.0120 0.0069  -0.0103 46  VAL L O   
3559 C  CB  . VAL C 46  ? 0.5490 0.5602 0.5717 -0.0056 -0.0027 -0.0230 46  VAL L CB  
3560 C  CG1 . VAL C 46  ? 0.5489 0.5775 0.5745 -0.0021 0.0030  -0.0221 46  VAL L CG1 
3561 C  CG2 . VAL C 46  ? 0.5513 0.5466 0.5604 0.0031  -0.0081 -0.0260 46  VAL L CG2 
3562 N  N   . LEU C 47  ? 0.4832 0.4556 0.4838 -0.0099 -0.0015 -0.0143 47  LEU L N   
3563 C  CA  . LEU C 47  ? 0.4772 0.4430 0.4686 -0.0087 -0.0015 -0.0120 47  LEU L CA  
3564 C  C   . LEU C 47  ? 0.5239 0.4832 0.5057 -0.0028 -0.0055 -0.0173 47  LEU L C   
3565 O  O   . LEU C 47  ? 0.5232 0.4838 0.4978 0.0002  -0.0053 -0.0191 47  LEU L O   
3566 C  CB  . LEU C 47  ? 0.4746 0.4301 0.4649 -0.0122 -0.0022 -0.0082 47  LEU L CB  
3567 C  CG  . LEU C 47  ? 0.5312 0.4855 0.5281 -0.0163 0.0014  -0.0034 47  LEU L CG  
3568 C  CD1 . LEU C 47  ? 0.5325 0.4771 0.5281 -0.0164 0.0006  -0.0019 47  LEU L CD1 
3569 C  CD2 . LEU C 47  ? 0.5629 0.5226 0.5597 -0.0172 0.0056  0.0030  47  LEU L CD2 
3570 N  N   . VAL C 48  ? 0.4783 0.4279 0.4578 -0.0013 -0.0093 -0.0196 48  VAL L N   
3571 C  CA  . VAL C 48  ? 0.4836 0.4203 0.4521 0.0035  -0.0131 -0.0232 48  VAL L CA  
3572 C  C   . VAL C 48  ? 0.5358 0.4723 0.5047 0.0099  -0.0158 -0.0259 48  VAL L C   
3573 O  O   . VAL C 48  ? 0.5267 0.4677 0.5018 0.0076  -0.0164 -0.0249 48  VAL L O   
3574 C  CB  . VAL C 48  ? 0.5343 0.4565 0.4966 -0.0021 -0.0147 -0.0206 48  VAL L CB  
3575 C  CG1 . VAL C 48  ? 0.5463 0.4501 0.4964 0.0005  -0.0182 -0.0231 48  VAL L CG1 
3576 C  CG2 . VAL C 48  ? 0.5300 0.4565 0.4925 -0.0071 -0.0137 -0.0185 48  VAL L CG2 
3577 N  N   . TYR C 49  ? 0.5052 0.4353 0.4657 0.0187  -0.0181 -0.0298 49  TYR L N   
3578 C  CA  . TYR C 49  ? 0.5103 0.4395 0.4691 0.0273  -0.0218 -0.0316 49  TYR L CA  
3579 C  C   . TYR C 49  ? 0.5715 0.4758 0.5134 0.0338  -0.0249 -0.0327 49  TYR L C   
3580 O  O   . TYR C 49  ? 0.5746 0.4660 0.5081 0.0314  -0.0241 -0.0343 49  TYR L O   
3581 C  CB  . TYR C 49  ? 0.5257 0.4789 0.4956 0.0348  -0.0210 -0.0349 49  TYR L CB  
3582 C  CG  . TYR C 49  ? 0.5600 0.5163 0.5255 0.0431  -0.0185 -0.0389 49  TYR L CG  
3583 C  CD1 . TYR C 49  ? 0.6030 0.5462 0.5564 0.0566  -0.0213 -0.0429 49  TYR L CD1 
3584 C  CD2 . TYR C 49  ? 0.5650 0.5366 0.5368 0.0390  -0.0128 -0.0387 49  TYR L CD2 
3585 C  CE1 . TYR C 49  ? 0.6258 0.5701 0.5729 0.0660  -0.0186 -0.0481 49  TYR L CE1 
3586 C  CE2 . TYR C 49  ? 0.5891 0.5648 0.5545 0.0478  -0.0098 -0.0431 49  TYR L CE2 
3587 C  CZ  . TYR C 49  ? 0.7055 0.6678 0.6587 0.0617  -0.0127 -0.0486 49  TYR L CZ  
3588 O  OH  . TYR C 49  ? 0.7399 0.7044 0.6846 0.0721  -0.0094 -0.0545 49  TYR L OH  
3589 N  N   . ASN C 50  ? 0.5346 0.4306 0.4700 0.0415  -0.0289 -0.0319 50  ASN L N   
3590 C  CA  . ASN C 50  ? 0.5544 0.4214 0.4714 0.0479  -0.0317 -0.0313 50  ASN L CA  
3591 C  C   . ASN C 50  ? 0.6099 0.4557 0.5185 0.0352  -0.0302 -0.0275 50  ASN L C   
3592 O  O   . ASN C 50  ? 0.6219 0.4443 0.5177 0.0350  -0.0310 -0.0291 50  ASN L O   
3593 C  CB  . ASN C 50  ? 0.5604 0.4215 0.4705 0.0605  -0.0321 -0.0371 50  ASN L CB  
3594 C  CG  . ASN C 50  ? 0.7709 0.6469 0.6849 0.0769  -0.0349 -0.0391 50  ASN L CG  
3595 O  OD1 . ASN C 50  ? 0.6844 0.5629 0.5983 0.0804  -0.0387 -0.0355 50  ASN L OD1 
3596 N  ND2 . ASN C 50  ? 0.6517 0.5394 0.5685 0.0877  -0.0331 -0.0449 50  ASN L ND2 
3597 N  N   . ALA C 51  ? 0.5544 0.4097 0.4712 0.0243  -0.0280 -0.0233 51  ALA L N   
3598 C  CA  . ALA C 51  ? 0.5543 0.3992 0.4683 0.0120  -0.0258 -0.0188 51  ALA L CA  
3599 C  C   . ALA C 51  ? 0.5969 0.4457 0.5158 0.0034  -0.0243 -0.0209 51  ALA L C   
3600 O  O   . ALA C 51  ? 0.5782 0.4391 0.5065 -0.0049 -0.0218 -0.0180 51  ALA L O   
3601 C  CB  . ALA C 51  ? 0.5897 0.4065 0.4869 0.0120  -0.0270 -0.0147 51  ALA L CB  
3602 N  N   . LYS C 52  ? 0.5668 0.4048 0.4779 0.0063  -0.0261 -0.0261 52  LYS L N   
3603 C  CA  . LYS C 52  ? 0.5634 0.4044 0.4760 -0.0022 -0.0262 -0.0288 52  LYS L CA  
3604 C  C   . LYS C 52  ? 0.6090 0.4618 0.5224 0.0046  -0.0260 -0.0350 52  LYS L C   
3605 O  O   . LYS C 52  ? 0.6060 0.4610 0.5173 -0.0010 -0.0269 -0.0380 52  LYS L O   
3606 C  CB  . LYS C 52  ? 0.6213 0.4360 0.5213 -0.0103 -0.0288 -0.0297 52  LYS L CB  
3607 C  CG  . LYS C 52  ? 0.8315 0.6170 0.7140 -0.0012 -0.0313 -0.0335 52  LYS L CG  
3608 C  CD  . LYS C 52  ? 0.9886 0.7460 0.8583 -0.0116 -0.0339 -0.0358 52  LYS L CD  
3609 C  CE  . LYS C 52  ? 1.1529 0.8785 1.0031 -0.0003 -0.0365 -0.0418 52  LYS L CE  
3610 N  NZ  . LYS C 52  ? 1.3002 0.9914 1.1360 -0.0124 -0.0392 -0.0439 52  LYS L NZ  
3611 N  N   . THR C 53  ? 0.5617 0.4247 0.4781 0.0163  -0.0247 -0.0370 53  THR L N   
3612 C  CA  . THR C 53  ? 0.5598 0.4365 0.4768 0.0230  -0.0228 -0.0422 53  THR L CA  
3613 C  C   . THR C 53  ? 0.5893 0.4927 0.5209 0.0183  -0.0188 -0.0383 53  THR L C   
3614 O  O   . THR C 53  ? 0.5702 0.4869 0.5136 0.0184  -0.0170 -0.0346 53  THR L O   
3615 C  CB  . THR C 53  ? 0.6702 0.5469 0.5834 0.0387  -0.0228 -0.0467 53  THR L CB  
3616 O  OG1 . THR C 53  ? 0.7021 0.5479 0.5985 0.0439  -0.0266 -0.0497 53  THR L OG1 
3617 C  CG2 . THR C 53  ? 0.6476 0.5417 0.5615 0.0466  -0.0191 -0.0520 53  THR L CG2 
3618 N  N   . LEU C 54  ? 0.5465 0.4567 0.4753 0.0154  -0.0176 -0.0396 54  LEU L N   
3619 C  CA  . LEU C 54  ? 0.5283 0.4602 0.4673 0.0119  -0.0133 -0.0348 54  LEU L CA  
3620 C  C   . LEU C 54  ? 0.5802 0.5296 0.5240 0.0203  -0.0085 -0.0364 54  LEU L C   
3621 O  O   . LEU C 54  ? 0.5892 0.5372 0.5234 0.0294  -0.0080 -0.0428 54  LEU L O   
3622 C  CB  . LEU C 54  ? 0.5336 0.4664 0.4649 0.0072  -0.0147 -0.0353 54  LEU L CB  
3623 C  CG  . LEU C 54  ? 0.5794 0.5293 0.5186 0.0027  -0.0114 -0.0276 54  LEU L CG  
3624 C  CD1 . LEU C 54  ? 0.5681 0.5171 0.5181 -0.0043 -0.0120 -0.0209 54  LEU L CD1 
3625 C  CD2 . LEU C 54  ? 0.6174 0.5707 0.5457 0.0014  -0.0137 -0.0291 54  LEU L CD2 
3626 N  N   . ALA C 55  ? 0.5250 0.4910 0.4837 0.0170  -0.0047 -0.0308 55  ALA L N   
3627 C  CA  . ALA C 55  ? 0.5217 0.5094 0.4894 0.0216  0.0007  -0.0310 55  ALA L CA  
3628 C  C   . ALA C 55  ? 0.5773 0.5761 0.5391 0.0222  0.0061  -0.0296 55  ALA L C   
3629 O  O   . ALA C 55  ? 0.5738 0.5665 0.5288 0.0169  0.0053  -0.0262 55  ALA L O   
3630 C  CB  . ALA C 55  ? 0.5183 0.5176 0.5028 0.0143  0.0027  -0.0256 55  ALA L CB  
3631 N  N   . ASP C 56  ? 0.5381 0.5552 0.5020 0.0298  0.0116  -0.0321 56  ASP L N   
3632 C  CA  . ASP C 56  ? 0.5424 0.5721 0.4984 0.0319  0.0180  -0.0307 56  ASP L CA  
3633 C  C   . ASP C 56  ? 0.5694 0.6091 0.5327 0.0213  0.0233  -0.0197 56  ASP L C   
3634 O  O   . ASP C 56  ? 0.5522 0.6006 0.5322 0.0142  0.0260  -0.0144 56  ASP L O   
3635 C  CB  . ASP C 56  ? 0.5786 0.6283 0.5360 0.0435  0.0241  -0.0356 56  ASP L CB  
3636 C  CG  . ASP C 56  ? 0.7556 0.7902 0.6981 0.0574  0.0196  -0.0470 56  ASP L CG  
3637 O  OD1 . ASP C 56  ? 0.7725 0.7804 0.6993 0.0560  0.0127  -0.0511 56  ASP L OD1 
3638 O  OD2 . ASP C 56  ? 0.8532 0.9026 0.7997 0.0696  0.0231  -0.0518 56  ASP L OD2 
3639 N  N   . GLY C 57  ? 0.5263 0.5621 0.4756 0.0202  0.0238  -0.0167 57  GLY L N   
3640 C  CA  . GLY C 57  ? 0.5168 0.5579 0.4678 0.0126  0.0285  -0.0051 57  GLY L CA  
3641 C  C   . GLY C 57  ? 0.5417 0.5671 0.4962 0.0052  0.0229  0.0001  57  GLY L C   
3642 O  O   . GLY C 57  ? 0.5414 0.5668 0.4952 0.0008  0.0257  0.0101  57  GLY L O   
3643 N  N   . VAL C 58  ? 0.4743 0.4858 0.4313 0.0050  0.0154  -0.0060 58  VAL L N   
3644 C  CA  . VAL C 58  ? 0.4561 0.4550 0.4172 -0.0007 0.0109  -0.0019 58  VAL L CA  
3645 C  C   . VAL C 58  ? 0.4999 0.4945 0.4487 -0.0001 0.0058  -0.0015 58  VAL L C   
3646 O  O   . VAL C 58  ? 0.5057 0.4962 0.4434 0.0030  0.0010  -0.0099 58  VAL L O   
3647 C  CB  . VAL C 58  ? 0.4933 0.4817 0.4623 -0.0020 0.0063  -0.0070 58  VAL L CB  
3648 C  CG1 . VAL C 58  ? 0.4845 0.4617 0.4559 -0.0065 0.0025  -0.0037 58  VAL L CG1 
3649 C  CG2 . VAL C 58  ? 0.4842 0.4801 0.4664 -0.0035 0.0098  -0.0071 58  VAL L CG2 
3650 N  N   . PRO C 59  ? 0.4432 0.4372 0.3945 -0.0031 0.0057  0.0075  59  PRO L N   
3651 C  CA  . PRO C 59  ? 0.4435 0.4374 0.3870 -0.0028 -0.0009 0.0079  59  PRO L CA  
3652 C  C   . PRO C 59  ? 0.4867 0.4726 0.4295 -0.0052 -0.0085 -0.0010 59  PRO L C   
3653 O  O   . PRO C 59  ? 0.4717 0.4489 0.4229 -0.0076 -0.0089 -0.0034 59  PRO L O   
3654 C  CB  . PRO C 59  ? 0.4614 0.4540 0.4129 -0.0041 0.0005  0.0183  59  PRO L CB  
3655 C  CG  . PRO C 59  ? 0.5168 0.5083 0.4734 -0.0052 0.0088  0.0246  59  PRO L CG  
3656 C  CD  . PRO C 59  ? 0.4554 0.4460 0.4177 -0.0068 0.0099  0.0161  59  PRO L CD  
3657 N  N   . SER C 60  ? 0.4530 0.4417 0.3847 -0.0055 -0.0148 -0.0055 60  SER L N   
3658 C  CA  . SER C 60  ? 0.4534 0.4336 0.3828 -0.0103 -0.0223 -0.0138 60  SER L CA  
3659 C  C   . SER C 60  ? 0.4906 0.4712 0.4331 -0.0161 -0.0249 -0.0096 60  SER L C   
3660 O  O   . SER C 60  ? 0.4910 0.4624 0.4345 -0.0217 -0.0286 -0.0149 60  SER L O   
3661 C  CB  . SER C 60  ? 0.5142 0.4982 0.4284 -0.0109 -0.0290 -0.0202 60  SER L CB  
3662 O  OG  . SER C 60  ? 0.6298 0.6298 0.5449 -0.0110 -0.0320 -0.0129 60  SER L OG  
3663 N  N   . ARG C 61  ? 0.4327 0.4228 0.3841 -0.0141 -0.0222 0.0002  61  ARG L N   
3664 C  CA  . ARG C 61  ? 0.4186 0.4118 0.3826 -0.0170 -0.0232 0.0044  61  ARG L CA  
3665 C  C   . ARG C 61  ? 0.4682 0.4486 0.4389 -0.0196 -0.0199 0.0021  61  ARG L C   
3666 O  O   . ARG C 61  ? 0.4672 0.4482 0.4443 -0.0241 -0.0217 0.0018  61  ARG L O   
3667 C  CB  . ARG C 61  ? 0.4015 0.4039 0.3713 -0.0113 -0.0203 0.0149  61  ARG L CB  
3668 C  CG  . ARG C 61  ? 0.4826 0.4767 0.4525 -0.0070 -0.0126 0.0203  61  ARG L CG  
3669 C  CD  . ARG C 61  ? 0.5324 0.5317 0.5030 -0.0008 -0.0107 0.0312  61  ARG L CD  
3670 N  NE  . ARG C 61  ? 0.5752 0.5627 0.5462 0.0007  -0.0030 0.0366  61  ARG L NE  
3671 C  CZ  . ARG C 61  ? 0.7061 0.6927 0.6694 0.0018  0.0012  0.0417  61  ARG L CZ  
3672 N  NH1 . ARG C 61  ? 0.5358 0.5336 0.4876 0.0038  -0.0017 0.0420  61  ARG L NH1 
3673 N  NH2 . ARG C 61  ? 0.5157 0.4913 0.4816 0.0004  0.0082  0.0466  61  ARG L NH2 
3674 N  N   . PHE C 62  ? 0.4234 0.3942 0.3919 -0.0169 -0.0156 0.0001  62  PHE L N   
3675 C  CA  . PHE C 62  ? 0.4179 0.3775 0.3902 -0.0180 -0.0136 -0.0023 62  PHE L CA  
3676 C  C   . PHE C 62  ? 0.4834 0.4321 0.4482 -0.0206 -0.0173 -0.0095 62  PHE L C   
3677 O  O   . PHE C 62  ? 0.4844 0.4301 0.4399 -0.0186 -0.0192 -0.0149 62  PHE L O   
3678 C  CB  . PHE C 62  ? 0.4362 0.3937 0.4108 -0.0144 -0.0088 -0.0018 62  PHE L CB  
3679 C  CG  . PHE C 62  ? 0.4537 0.4160 0.4339 -0.0131 -0.0045 0.0056  62  PHE L CG  
3680 C  CD1 . PHE C 62  ? 0.4888 0.4462 0.4757 -0.0132 -0.0022 0.0086  62  PHE L CD1 
3681 C  CD2 . PHE C 62  ? 0.4852 0.4544 0.4617 -0.0112 -0.0022 0.0097  62  PHE L CD2 
3682 C  CE1 . PHE C 62  ? 0.5022 0.4582 0.4923 -0.0115 0.0018  0.0151  62  PHE L CE1 
3683 C  CE2 . PHE C 62  ? 0.5226 0.4915 0.5023 -0.0102 0.0022  0.0180  62  PHE L CE2 
3684 C  CZ  . PHE C 62  ? 0.4949 0.4554 0.4815 -0.0104 0.0039  0.0204  62  PHE L CZ  
3685 N  N   . SER C 63  ? 0.4491 0.3900 0.4164 -0.0244 -0.0177 -0.0095 63  SER L N   
3686 C  CA  . SER C 63  ? 0.4619 0.3871 0.4206 -0.0273 -0.0207 -0.0146 63  SER L CA  
3687 C  C   . SER C 63  ? 0.5174 0.4327 0.4771 -0.0273 -0.0184 -0.0126 63  SER L C   
3688 O  O   . SER C 63  ? 0.5052 0.4276 0.4728 -0.0274 -0.0151 -0.0079 63  SER L O   
3689 C  CB  . SER C 63  ? 0.5163 0.4415 0.4724 -0.0358 -0.0256 -0.0166 63  SER L CB  
3690 O  OG  . SER C 63  ? 0.6216 0.5634 0.5893 -0.0406 -0.0252 -0.0109 63  SER L OG  
3691 N  N   . GLY C 64  ? 0.4894 0.3873 0.4392 -0.0256 -0.0201 -0.0162 64  GLY L N   
3692 C  CA  . GLY C 64  ? 0.4899 0.3766 0.4365 -0.0244 -0.0187 -0.0138 64  GLY L CA  
3693 C  C   . GLY C 64  ? 0.5559 0.4227 0.4923 -0.0303 -0.0207 -0.0138 64  GLY L C   
3694 O  O   . GLY C 64  ? 0.5632 0.4183 0.4915 -0.0322 -0.0242 -0.0187 64  GLY L O   
3695 N  N   . SER C 65  ? 0.5184 0.3800 0.4539 -0.0342 -0.0180 -0.0083 65  SER L N   
3696 C  CA  . SER C 65  ? 0.5380 0.3792 0.4636 -0.0419 -0.0184 -0.0059 65  SER L CA  
3697 C  C   . SER C 65  ? 0.6023 0.4355 0.5215 -0.0392 -0.0148 0.0003  65  SER L C   
3698 O  O   . SER C 65  ? 0.5819 0.4298 0.5071 -0.0343 -0.0119 0.0022  65  SER L O   
3699 C  CB  . SER C 65  ? 0.5785 0.4295 0.5128 -0.0560 -0.0180 -0.0038 65  SER L CB  
3700 O  OG  . SER C 65  ? 0.6705 0.5426 0.6170 -0.0581 -0.0129 0.0021  65  SER L OG  
3701 N  N   . GLY C 66  ? 0.5914 0.3999 0.4970 -0.0429 -0.0150 0.0035  66  GLY L N   
3702 C  CA  . GLY C 66  ? 0.6038 0.4020 0.4991 -0.0405 -0.0115 0.0109  66  GLY L CA  
3703 C  C   . GLY C 66  ? 0.6812 0.4541 0.5586 -0.0293 -0.0150 0.0108  66  GLY L C   
3704 O  O   . GLY C 66  ? 0.6775 0.4438 0.5521 -0.0209 -0.0197 0.0040  66  GLY L O   
3705 N  N   . SER C 67  ? 0.6640 0.4234 0.5280 -0.0278 -0.0123 0.0189  67  SER L N   
3706 C  CA  . SER C 67  ? 0.6905 0.4248 0.5349 -0.0155 -0.0156 0.0213  67  SER L CA  
3707 C  C   . SER C 67  ? 0.7482 0.4837 0.5821 -0.0116 -0.0124 0.0298  67  SER L C   
3708 O  O   . SER C 67  ? 0.7326 0.4829 0.5727 -0.0206 -0.0061 0.0342  67  SER L O   
3709 C  CB  . SER C 67  ? 0.7718 0.4697 0.6013 -0.0214 -0.0165 0.0237  67  SER L CB  
3710 O  OG  . SER C 67  ? 0.8972 0.5887 0.7266 -0.0396 -0.0106 0.0315  67  SER L OG  
3711 N  N   . GLY C 68  ? 0.7232 0.4454 0.5412 0.0034  -0.0168 0.0316  68  GLY L N   
3712 C  CA  . GLY C 68  ? 0.7309 0.4532 0.5345 0.0099  -0.0154 0.0392  68  GLY L CA  
3713 C  C   . GLY C 68  ? 0.7482 0.5034 0.5642 0.0114  -0.0146 0.0345  68  GLY L C   
3714 O  O   . GLY C 68  ? 0.7246 0.4977 0.5520 0.0191  -0.0200 0.0256  68  GLY L O   
3715 N  N   . THR C 69  ? 0.7002 0.4638 0.5151 0.0032  -0.0071 0.0399  69  THR L N   
3716 C  CA  . THR C 69  ? 0.6741 0.4636 0.4964 0.0056  -0.0056 0.0351  69  THR L CA  
3717 C  C   . THR C 69  ? 0.6858 0.4964 0.5310 -0.0038 -0.0012 0.0298  69  THR L C   
3718 O  O   . THR C 69  ? 0.6647 0.4935 0.5168 -0.0007 -0.0009 0.0241  69  THR L O   
3719 C  CB  . THR C 69  ? 0.7977 0.5844 0.6007 0.0070  0.0000  0.0435  69  THR L CB  
3720 O  OG1 . THR C 69  ? 0.8124 0.5914 0.6141 -0.0061 0.0096  0.0530  69  THR L OG1 
3721 C  CG2 . THR C 69  ? 0.8005 0.5708 0.5790 0.0199  -0.0059 0.0484  69  THR L CG2 
3722 N  N   . GLN C 70  ? 0.6326 0.4403 0.4888 -0.0149 0.0015  0.0312  70  GLN L N   
3723 C  CA  . GLN C 70  ? 0.6026 0.4320 0.4796 -0.0223 0.0051  0.0275  70  GLN L CA  
3724 C  C   . GLN C 70  ? 0.6186 0.4513 0.5097 -0.0243 0.0000  0.0207  70  GLN L C   
3725 O  O   . GLN C 70  ? 0.6264 0.4431 0.5138 -0.0285 -0.0025 0.0214  70  GLN L O   
3726 C  CB  . GLN C 70  ? 0.6289 0.4637 0.5095 -0.0344 0.0139  0.0353  70  GLN L CB  
3727 C  CG  . GLN C 70  ? 0.9063 0.7467 0.7758 -0.0314 0.0213  0.0409  70  GLN L CG  
3728 C  CD  . GLN C 70  ? 1.2069 1.0673 1.0894 -0.0408 0.0309  0.0454  70  GLN L CD  
3729 O  OE1 . GLN C 70  ? 1.1368 1.0186 1.0350 -0.0386 0.0326  0.0403  70  GLN L OE1 
3730 N  NE2 . GLN C 70  ? 1.1496 1.0038 1.0259 -0.0510 0.0377  0.0556  70  GLN L NE2 
3731 N  N   . TYR C 71  ? 0.5388 0.3904 0.4440 -0.0211 -0.0011 0.0143  71  TYR L N   
3732 C  CA  . TYR C 71  ? 0.5157 0.3733 0.4330 -0.0218 -0.0050 0.0085  71  TYR L CA  
3733 C  C   . TYR C 71  ? 0.5404 0.4181 0.4738 -0.0253 -0.0019 0.0074  71  TYR L C   
3734 O  O   . TYR C 71  ? 0.5255 0.4126 0.4613 -0.0226 0.0020  0.0078  71  TYR L O   
3735 C  CB  . TYR C 71  ? 0.5225 0.3797 0.4384 -0.0118 -0.0108 0.0024  71  TYR L CB  
3736 C  CG  . TYR C 71  ? 0.5591 0.3977 0.4593 -0.0049 -0.0149 0.0036  71  TYR L CG  
3737 C  CD1 . TYR C 71  ? 0.5958 0.4295 0.4834 0.0013  -0.0156 0.0065  71  TYR L CD1 
3738 C  CD2 . TYR C 71  ? 0.5768 0.4016 0.4728 -0.0034 -0.0182 0.0017  71  TYR L CD2 
3739 C  CE1 . TYR C 71  ? 0.6260 0.4417 0.4976 0.0094  -0.0196 0.0091  71  TYR L CE1 
3740 C  CE2 . TYR C 71  ? 0.6092 0.4141 0.4894 0.0054  -0.0219 0.0033  71  TYR L CE2 
3741 C  CZ  . TYR C 71  ? 0.7026 0.5033 0.5709 0.0122  -0.0228 0.0076  71  TYR L CZ  
3742 O  OH  . TYR C 71  ? 0.7239 0.5046 0.5752 0.0229  -0.0268 0.0105  71  TYR L OH  
3743 N  N   . SER C 72  ? 0.4909 0.3740 0.4335 -0.0298 -0.0039 0.0055  72  SER L N   
3744 C  CA  . SER C 72  ? 0.4743 0.3764 0.4313 -0.0316 -0.0018 0.0056  72  SER L CA  
3745 C  C   . SER C 72  ? 0.5084 0.4156 0.4710 -0.0290 -0.0056 0.0013  72  SER L C   
3746 O  O   . SER C 72  ? 0.5110 0.4099 0.4687 -0.0294 -0.0097 -0.0019 72  SER L O   
3747 C  CB  . SER C 72  ? 0.5260 0.4370 0.4899 -0.0413 0.0006  0.0100  72  SER L CB  
3748 O  OG  . SER C 72  ? 0.6560 0.5671 0.6164 -0.0440 0.0064  0.0154  72  SER L OG  
3749 N  N   . LEU C 73  ? 0.4442 0.3643 0.4161 -0.0259 -0.0036 0.0016  73  LEU L N   
3750 C  CA  . LEU C 73  ? 0.4300 0.3566 0.4071 -0.0240 -0.0057 -0.0002 73  LEU L CA  
3751 C  C   . LEU C 73  ? 0.4708 0.4121 0.4570 -0.0264 -0.0047 0.0036  73  LEU L C   
3752 O  O   . LEU C 73  ? 0.4609 0.4098 0.4529 -0.0242 -0.0008 0.0069  73  LEU L O   
3753 C  CB  . LEU C 73  ? 0.4247 0.3515 0.4039 -0.0185 -0.0043 -0.0018 73  LEU L CB  
3754 C  CG  . LEU C 73  ? 0.4758 0.4095 0.4602 -0.0172 -0.0044 -0.0013 73  LEU L CG  
3755 C  CD1 . LEU C 73  ? 0.4775 0.4106 0.4576 -0.0174 -0.0077 -0.0045 73  LEU L CD1 
3756 C  CD2 . LEU C 73  ? 0.5028 0.4345 0.4901 -0.0148 -0.0021 -0.0020 73  LEU L CD2 
3757 N  N   . LYS C 74  ? 0.4311 0.3773 0.4178 -0.0296 -0.0087 0.0027  74  LYS L N   
3758 C  CA  . LYS C 74  ? 0.4282 0.3916 0.4234 -0.0314 -0.0096 0.0062  74  LYS L CA  
3759 C  C   . LYS C 74  ? 0.4799 0.4494 0.4749 -0.0269 -0.0116 0.0066  74  LYS L C   
3760 O  O   . LYS C 74  ? 0.4761 0.4389 0.4633 -0.0269 -0.0142 0.0026  74  LYS L O   
3761 C  CB  . LYS C 74  ? 0.4655 0.4329 0.4616 -0.0414 -0.0134 0.0052  74  LYS L CB  
3762 C  CG  . LYS C 74  ? 0.6230 0.6137 0.6297 -0.0438 -0.0163 0.0080  74  LYS L CG  
3763 C  CD  . LYS C 74  ? 0.7565 0.7532 0.7666 -0.0567 -0.0202 0.0066  74  LYS L CD  
3764 C  CE  . LYS C 74  ? 0.9154 0.8975 0.9136 -0.0632 -0.0270 -0.0007 74  LYS L CE  
3765 N  NZ  . LYS C 74  ? 1.0374 1.0269 1.0313 -0.0573 -0.0317 -0.0032 74  LYS L NZ  
3766 N  N   . ILE C 75  ? 0.4392 0.4210 0.4415 -0.0219 -0.0099 0.0120  75  ILE L N   
3767 C  CA  . ILE C 75  ? 0.4420 0.4292 0.4426 -0.0170 -0.0111 0.0149  75  ILE L CA  
3768 C  C   . ILE C 75  ? 0.5075 0.5148 0.5136 -0.0171 -0.0155 0.0183  75  ILE L C   
3769 O  O   . ILE C 75  ? 0.4985 0.5179 0.5145 -0.0146 -0.0140 0.0223  75  ILE L O   
3770 C  CB  . ILE C 75  ? 0.4796 0.4593 0.4810 -0.0097 -0.0057 0.0191  75  ILE L CB  
3771 C  CG1 . ILE C 75  ? 0.4822 0.4464 0.4818 -0.0108 -0.0021 0.0149  75  ILE L CG1 
3772 C  CG2 . ILE C 75  ? 0.4914 0.4712 0.4869 -0.0070 -0.0059 0.0222  75  ILE L CG2 
3773 C  CD1 . ILE C 75  ? 0.5717 0.5260 0.5717 -0.0067 0.0023  0.0169  75  ILE L CD1 
3774 N  N   . ASN C 76  ? 0.4816 0.4942 0.4810 -0.0193 -0.0211 0.0161  76  ASN L N   
3775 C  CA  . ASN C 76  ? 0.4891 0.5230 0.4921 -0.0199 -0.0275 0.0182  76  ASN L CA  
3776 C  C   . ASN C 76  ? 0.5446 0.5846 0.5432 -0.0100 -0.0273 0.0252  76  ASN L C   
3777 O  O   . ASN C 76  ? 0.5469 0.5734 0.5362 -0.0069 -0.0237 0.0259  76  ASN L O   
3778 C  CB  . ASN C 76  ? 0.5301 0.5636 0.5245 -0.0288 -0.0347 0.0101  76  ASN L CB  
3779 C  CG  . ASN C 76  ? 0.9147 0.9569 0.9174 -0.0403 -0.0392 0.0063  76  ASN L CG  
3780 O  OD1 . ASN C 76  ? 0.8726 0.9077 0.8676 -0.0494 -0.0447 -0.0015 76  ASN L OD1 
3781 N  ND2 . ASN C 76  ? 0.8265 0.8838 0.8445 -0.0403 -0.0366 0.0117  76  ASN L ND2 
3782 N  N   . SER C 77  ? 0.4991 0.5607 0.5043 -0.0051 -0.0315 0.0310  77  SER L N   
3783 C  CA  . SER C 77  ? 0.5018 0.5687 0.5004 0.0057  -0.0321 0.0395  77  SER L CA  
3784 C  C   . SER C 77  ? 0.5396 0.5843 0.5339 0.0126  -0.0228 0.0453  77  SER L C   
3785 O  O   . SER C 77  ? 0.5407 0.5737 0.5233 0.0129  -0.0202 0.0465  77  SER L O   
3786 C  CB  . SER C 77  ? 0.5563 0.6271 0.5400 0.0030  -0.0383 0.0360  77  SER L CB  
3787 O  OG  . SER C 77  ? 0.6817 0.7565 0.6563 0.0138  -0.0380 0.0458  77  SER L OG  
3788 N  N   . LEU C 78  ? 0.4833 0.5217 0.4873 0.0166  -0.0173 0.0475  78  LEU L N   
3789 C  CA  . LEU C 78  ? 0.4798 0.4954 0.4811 0.0215  -0.0093 0.0512  78  LEU L CA  
3790 C  C   . LEU C 78  ? 0.5350 0.5434 0.5264 0.0293  -0.0075 0.0611  78  LEU L C   
3791 O  O   . LEU C 78  ? 0.5361 0.5591 0.5255 0.0372  -0.0117 0.0682  78  LEU L O   
3792 C  CB  . LEU C 78  ? 0.4793 0.4935 0.4904 0.0276  -0.0053 0.0522  78  LEU L CB  
3793 C  CG  . LEU C 78  ? 0.5400 0.5290 0.5493 0.0268  0.0019  0.0491  78  LEU L CG  
3794 C  CD1 . LEU C 78  ? 0.5305 0.5101 0.5365 0.0151  0.0021  0.0405  78  LEU L CD1 
3795 C  CD2 . LEU C 78  ? 0.5716 0.5634 0.5889 0.0322  0.0052  0.0475  78  LEU L CD2 
3796 N  N   . GLN C 79  ? 0.4914 0.4787 0.4762 0.0261  -0.0015 0.0618  79  GLN L N   
3797 C  CA  . GLN C 79  ? 0.5016 0.4790 0.4758 0.0307  0.0019  0.0721  79  GLN L CA  
3798 C  C   . GLN C 79  ? 0.5640 0.5155 0.5384 0.0339  0.0093  0.0771  79  GLN L C   
3799 O  O   . GLN C 79  ? 0.5522 0.4922 0.5331 0.0292  0.0121  0.0695  79  GLN L O   
3800 C  CB  . GLN C 79  ? 0.5143 0.4916 0.4801 0.0224  0.0034  0.0695  79  GLN L CB  
3801 C  CG  . GLN C 79  ? 0.5889 0.5871 0.5492 0.0206  -0.0039 0.0645  79  GLN L CG  
3802 C  CD  . GLN C 79  ? 0.7354 0.7476 0.6868 0.0294  -0.0088 0.0736  79  GLN L CD  
3803 O  OE1 . GLN C 79  ? 0.6515 0.6827 0.6065 0.0315  -0.0170 0.0708  79  GLN L OE1 
3804 N  NE2 . GLN C 79  ? 0.6312 0.6352 0.5707 0.0343  -0.0040 0.0850  79  GLN L NE2 
3805 N  N   . PRO C 80  ? 0.5476 0.4871 0.5124 0.0411  0.0126  0.0897  80  PRO L N   
3806 C  CA  . PRO C 80  ? 0.5654 0.4738 0.5279 0.0425  0.0198  0.0944  80  PRO L CA  
3807 C  C   . PRO C 80  ? 0.6163 0.5078 0.5816 0.0282  0.0250  0.0870  80  PRO L C   
3808 O  O   . PRO C 80  ? 0.6180 0.4888 0.5863 0.0274  0.0281  0.0832  80  PRO L O   
3809 C  CB  . PRO C 80  ? 0.6133 0.5127 0.5621 0.0497  0.0222  0.1102  80  PRO L CB  
3810 C  CG  . PRO C 80  ? 0.6635 0.5923 0.6100 0.0586  0.0143  0.1136  80  PRO L CG  
3811 C  CD  . PRO C 80  ? 0.5805 0.5307 0.5335 0.0473  0.0100  0.1004  80  PRO L CD  
3812 N  N   . GLU C 81  ? 0.5680 0.4700 0.5324 0.0178  0.0257  0.0843  81  GLU L N   
3813 C  CA  . GLU C 81  ? 0.5639 0.4574 0.5333 0.0045  0.0298  0.0778  81  GLU L CA  
3814 C  C   . GLU C 81  ? 0.6031 0.5027 0.5822 0.0003  0.0261  0.0635  81  GLU L C   
3815 O  O   . GLU C 81  ? 0.5980 0.4916 0.5822 -0.0090 0.0281  0.0573  81  GLU L O   
3816 C  CB  . GLU C 81  ? 0.5795 0.4857 0.5450 -0.0028 0.0328  0.0807  81  GLU L CB  
3817 C  CG  . GLU C 81  ? 0.6783 0.6103 0.6414 -0.0002 0.0273  0.0753  81  GLU L CG  
3818 C  CD  . GLU C 81  ? 0.8698 0.8126 0.8213 0.0091  0.0242  0.0839  81  GLU L CD  
3819 O  OE1 . GLU C 81  ? 0.7569 0.6910 0.7047 0.0178  0.0236  0.0929  81  GLU L OE1 
3820 O  OE2 . GLU C 81  ? 0.7462 0.7064 0.6910 0.0089  0.0219  0.0814  81  GLU L OE2 
3821 N  N   . ASP C 82  ? 0.5509 0.4636 0.5328 0.0066  0.0206  0.0589  82  ASP L N   
3822 C  CA  . ASP C 82  ? 0.5341 0.4515 0.5228 0.0031  0.0177  0.0473  82  ASP L CA  
3823 C  C   . ASP C 82  ? 0.6019 0.5012 0.5931 0.0038  0.0200  0.0429  82  ASP L C   
3824 O  O   . ASP C 82  ? 0.5834 0.4845 0.5780 0.0005  0.0182  0.0339  82  ASP L O   
3825 C  CB  . ASP C 82  ? 0.5419 0.4787 0.5326 0.0073  0.0121  0.0450  82  ASP L CB  
3826 C  CG  . ASP C 82  ? 0.6464 0.5991 0.6329 0.0044  0.0086  0.0445  82  ASP L CG  
3827 O  OD1 . ASP C 82  ? 0.6553 0.6061 0.6375 0.0004  0.0114  0.0460  82  ASP L OD1 
3828 O  OD2 . ASP C 82  ? 0.7089 0.6763 0.6962 0.0057  0.0032  0.0422  82  ASP L OD2 
3829 N  N   . PHE C 83  ? 0.5924 0.4722 0.5799 0.0087  0.0238  0.0490  83  PHE L N   
3830 C  CA  . PHE C 83  ? 0.6062 0.4657 0.5933 0.0101  0.0259  0.0432  83  PHE L CA  
3831 C  C   . PHE C 83  ? 0.6525 0.5032 0.6416 -0.0028 0.0262  0.0349  83  PHE L C   
3832 O  O   . PHE C 83  ? 0.6528 0.5046 0.6433 -0.0119 0.0276  0.0377  83  PHE L O   
3833 C  CB  . PHE C 83  ? 0.6621 0.4975 0.6425 0.0190  0.0301  0.0514  83  PHE L CB  
3834 C  CG  . PHE C 83  ? 0.7104 0.5230 0.6861 0.0102  0.0343  0.0568  83  PHE L CG  
3835 C  CD1 . PHE C 83  ? 0.7529 0.5757 0.7277 0.0041  0.0354  0.0652  83  PHE L CD1 
3836 C  CD2 . PHE C 83  ? 0.7683 0.5494 0.7399 0.0066  0.0373  0.0529  83  PHE L CD2 
3837 C  CE1 . PHE C 83  ? 0.7882 0.5926 0.7601 -0.0064 0.0405  0.0708  83  PHE L CE1 
3838 C  CE2 . PHE C 83  ? 0.8288 0.5885 0.7973 -0.0048 0.0414  0.0579  83  PHE L CE2 
3839 C  CZ  . PHE C 83  ? 0.8015 0.5740 0.7711 -0.0117 0.0435  0.0677  83  PHE L CZ  
3840 N  N   . GLY C 84  ? 0.5992 0.4453 0.5887 -0.0032 0.0247  0.0248  84  GLY L N   
3841 C  CA  . GLY C 84  ? 0.5924 0.4331 0.5839 -0.0145 0.0232  0.0156  84  GLY L CA  
3842 C  C   . GLY C 84  ? 0.6207 0.4678 0.6113 -0.0128 0.0198  0.0055  84  GLY L C   
3843 O  O   . GLY C 84  ? 0.6109 0.4614 0.5987 -0.0033 0.0203  0.0053  84  GLY L O   
3844 N  N   . SER C 85  ? 0.5668 0.4172 0.5598 -0.0219 0.0164  -0.0026 85  SER L N   
3845 C  CA  . SER C 85  ? 0.5540 0.4100 0.5438 -0.0206 0.0125  -0.0117 85  SER L CA  
3846 C  C   . SER C 85  ? 0.5727 0.4505 0.5669 -0.0225 0.0088  -0.0118 85  SER L C   
3847 O  O   . SER C 85  ? 0.5615 0.4485 0.5622 -0.0287 0.0079  -0.0103 85  SER L O   
3848 C  CB  . SER C 85  ? 0.6154 0.4579 0.6022 -0.0277 0.0099  -0.0217 85  SER L CB  
3849 O  OG  . SER C 85  ? 0.7538 0.5729 0.7315 -0.0222 0.0129  -0.0247 85  SER L OG  
3850 N  N   . TYR C 86  ? 0.5149 0.4004 0.5050 -0.0169 0.0073  -0.0130 86  TYR L N   
3851 C  CA  . TYR C 86  ? 0.4947 0.3953 0.4862 -0.0175 0.0038  -0.0130 86  TYR L CA  
3852 C  C   . TYR C 86  ? 0.5389 0.4400 0.5245 -0.0171 -0.0002 -0.0199 86  TYR L C   
3853 O  O   . TYR C 86  ? 0.5409 0.4341 0.5190 -0.0137 0.0008  -0.0229 86  TYR L O   
3854 C  CB  . TYR C 86  ? 0.5005 0.4084 0.4915 -0.0130 0.0052  -0.0070 86  TYR L CB  
3855 C  CG  . TYR C 86  ? 0.5221 0.4337 0.5177 -0.0127 0.0074  0.0000  86  TYR L CG  
3856 C  CD1 . TYR C 86  ? 0.5556 0.4593 0.5514 -0.0088 0.0111  0.0047  86  TYR L CD1 
3857 C  CD2 . TYR C 86  ? 0.5248 0.4467 0.5223 -0.0148 0.0058  0.0021  86  TYR L CD2 
3858 C  CE1 . TYR C 86  ? 0.5639 0.4708 0.5616 -0.0073 0.0127  0.0124  86  TYR L CE1 
3859 C  CE2 . TYR C 86  ? 0.5373 0.4634 0.5358 -0.0137 0.0075  0.0088  86  TYR L CE2 
3860 C  CZ  . TYR C 86  ? 0.6424 0.5615 0.6411 -0.0102 0.0107  0.0146  86  TYR L CZ  
3861 O  OH  . TYR C 86  ? 0.6688 0.5928 0.6665 -0.0083 0.0118  0.0221  86  TYR L OH  
3862 N  N   . TYR C 87  ? 0.4857 0.3966 0.4739 -0.0193 -0.0047 -0.0224 87  TYR L N   
3863 C  CA  . TYR C 87  ? 0.4843 0.3973 0.4661 -0.0175 -0.0098 -0.0282 87  TYR L CA  
3864 C  C   . TYR C 87  ? 0.5232 0.4430 0.5022 -0.0136 -0.0125 -0.0260 87  TYR L C   
3865 O  O   . TYR C 87  ? 0.5107 0.4367 0.4952 -0.0138 -0.0117 -0.0230 87  TYR L O   
3866 C  CB  . TYR C 87  ? 0.5044 0.4227 0.4923 -0.0231 -0.0143 -0.0349 87  TYR L CB  
3867 C  CG  . TYR C 87  ? 0.5386 0.4444 0.5272 -0.0287 -0.0124 -0.0385 87  TYR L CG  
3868 C  CD1 . TYR C 87  ? 0.5784 0.4733 0.5560 -0.0272 -0.0144 -0.0454 87  TYR L CD1 
3869 C  CD2 . TYR C 87  ? 0.5501 0.4525 0.5478 -0.0351 -0.0084 -0.0352 87  TYR L CD2 
3870 C  CE1 . TYR C 87  ? 0.6071 0.4857 0.5829 -0.0318 -0.0128 -0.0502 87  TYR L CE1 
3871 C  CE2 . TYR C 87  ? 0.5790 0.4642 0.5754 -0.0404 -0.0065 -0.0382 87  TYR L CE2 
3872 C  CZ  . TYR C 87  ? 0.6912 0.5632 0.6766 -0.0387 -0.0090 -0.0466 87  TYR L CZ  
3873 O  OH  . TYR C 87  ? 0.7344 0.5847 0.7162 -0.0434 -0.0073 -0.0511 87  TYR L OH  
3874 N  N   . CYS C 88  ? 0.4831 0.4002 0.4517 -0.0095 -0.0158 -0.0280 88  CYS L N   
3875 C  CA  . CYS C 88  ? 0.4780 0.3961 0.4407 -0.0047 -0.0188 -0.0260 88  CYS L CA  
3876 C  C   . CYS C 88  ? 0.5243 0.4480 0.4831 -0.0011 -0.0256 -0.0311 88  CYS L C   
3877 O  O   . CYS C 88  ? 0.5286 0.4514 0.4834 -0.0023 -0.0277 -0.0357 88  CYS L O   
3878 C  CB  . CYS C 88  ? 0.4898 0.3979 0.4414 -0.0030 -0.0157 -0.0210 88  CYS L CB  
3879 S  SG  . CYS C 88  ? 0.5561 0.4578 0.4933 -0.0002 -0.0154 -0.0229 88  CYS L SG  
3880 N  N   . GLN C 89  ? 0.4733 0.4030 0.4325 0.0042  -0.0297 -0.0309 89  GLN L N   
3881 C  CA  . GLN C 89  ? 0.4750 0.4137 0.4314 0.0099  -0.0373 -0.0349 89  GLN L CA  
3882 C  C   . GLN C 89  ? 0.5322 0.4649 0.4778 0.0200  -0.0402 -0.0312 89  GLN L C   
3883 O  O   . GLN C 89  ? 0.5249 0.4512 0.4710 0.0215  -0.0371 -0.0279 89  GLN L O   
3884 C  CB  . GLN C 89  ? 0.4827 0.4425 0.4567 0.0065  -0.0404 -0.0404 89  GLN L CB  
3885 C  CG  . GLN C 89  ? 0.6396 0.6103 0.6237 0.0100  -0.0389 -0.0387 89  GLN L CG  
3886 C  CD  . GLN C 89  ? 0.8648 0.8599 0.8598 0.0149  -0.0451 -0.0431 89  GLN L CD  
3887 O  OE1 . GLN C 89  ? 0.7959 0.8061 0.8029 0.0164  -0.0428 -0.0431 89  GLN L OE1 
3888 N  NE2 . GLN C 89  ? 0.7778 0.7799 0.7688 0.0179  -0.0531 -0.0470 89  GLN L NE2 
3889 N  N   . GLN C 90  ? 0.5015 0.4356 0.4365 0.0276  -0.0468 -0.0322 90  GLN L N   
3890 C  CA  . GLN C 90  ? 0.5146 0.4399 0.4372 0.0391  -0.0501 -0.0279 90  GLN L CA  
3891 C  C   . GLN C 90  ? 0.5761 0.5231 0.5072 0.0483  -0.0583 -0.0324 90  GLN L C   
3892 O  O   . GLN C 90  ? 0.5717 0.5358 0.5069 0.0478  -0.0646 -0.0375 90  GLN L O   
3893 C  CB  . GLN C 90  ? 0.5493 0.4561 0.4490 0.0427  -0.0504 -0.0223 90  GLN L CB  
3894 C  CG  . GLN C 90  ? 0.6684 0.5841 0.5600 0.0445  -0.0563 -0.0262 90  GLN L CG  
3895 C  CD  . GLN C 90  ? 0.8237 0.7507 0.7100 0.0577  -0.0668 -0.0273 90  GLN L CD  
3896 O  OE1 . GLN C 90  ? 0.7677 0.6875 0.6485 0.0683  -0.0687 -0.0224 90  GLN L OE1 
3897 N  NE2 . GLN C 90  ? 0.6789 0.6251 0.5683 0.0573  -0.0745 -0.0347 90  GLN L NE2 
3898 N  N   . PHE C 91  ? 0.5419 0.4898 0.4762 0.0570  -0.0583 -0.0312 91  PHE L N   
3899 C  CA  . PHE C 91  ? 0.5463 0.5182 0.4899 0.0683  -0.0654 -0.0349 91  PHE L CA  
3900 C  C   . PHE C 91  ? 0.6289 0.5873 0.5544 0.0860  -0.0706 -0.0303 91  PHE L C   
3901 O  O   . PHE C 91  ? 0.6327 0.6092 0.5644 0.0996  -0.0762 -0.0324 91  PHE L O   
3902 C  CB  . PHE C 91  ? 0.5544 0.5459 0.5186 0.0668  -0.0615 -0.0385 91  PHE L CB  
3903 C  CG  . PHE C 91  ? 0.5746 0.5458 0.5336 0.0661  -0.0537 -0.0357 91  PHE L CG  
3904 C  CD1 . PHE C 91  ? 0.6014 0.5621 0.5622 0.0519  -0.0467 -0.0343 91  PHE L CD1 
3905 C  CD2 . PHE C 91  ? 0.6157 0.5784 0.5674 0.0804  -0.0539 -0.0351 91  PHE L CD2 
3906 C  CE1 . PHE C 91  ? 0.6135 0.5577 0.5690 0.0507  -0.0411 -0.0325 91  PHE L CE1 
3907 C  CE2 . PHE C 91  ? 0.6540 0.5964 0.5989 0.0787  -0.0477 -0.0343 91  PHE L CE2 
3908 C  CZ  . PHE C 91  ? 0.6161 0.5510 0.5634 0.0631  -0.0419 -0.0331 91  PHE L CZ  
3909 N  N   . TRP C 92  ? 0.6038 0.5317 0.5068 0.0861  -0.0687 -0.0235 92  TRP L N   
3910 C  CA  . TRP C 92  ? 0.6310 0.5379 0.5121 0.1015  -0.0726 -0.0169 92  TRP L CA  
3911 C  C   . TRP C 92  ? 0.6965 0.6196 0.5710 0.1127  -0.0830 -0.0170 92  TRP L C   
3912 O  O   . TRP C 92  ? 0.7117 0.6352 0.5787 0.1309  -0.0893 -0.0146 92  TRP L O   
3913 C  CB  . TRP C 92  ? 0.6294 0.5006 0.4895 0.0944  -0.0663 -0.0086 92  TRP L CB  
3914 C  CG  . TRP C 92  ? 0.6715 0.5170 0.5053 0.1079  -0.0697 0.0004  92  TRP L CG  
3915 C  CD1 . TRP C 92  ? 0.7319 0.5674 0.5456 0.1090  -0.0712 0.0072  92  TRP L CD1 
3916 C  CD2 . TRP C 92  ? 0.7004 0.5268 0.5232 0.1242  -0.0723 0.0038  92  TRP L CD2 
3917 N  NE1 . TRP C 92  ? 0.7581 0.5678 0.5485 0.1238  -0.0741 0.0162  92  TRP L NE1 
3918 C  CE2 . TRP C 92  ? 0.7816 0.5853 0.5775 0.1345  -0.0756 0.0138  92  TRP L CE2 
3919 C  CE3 . TRP C 92  ? 0.7130 0.5379 0.5442 0.1325  -0.0717 -0.0007 92  TRP L CE3 
3920 C  CZ2 . TRP C 92  ? 0.8091 0.5848 0.5863 0.1522  -0.0784 0.0202  92  TRP L CZ2 
3921 C  CZ3 . TRP C 92  ? 0.7678 0.5658 0.5807 0.1504  -0.0743 0.0039  92  TRP L CZ3 
3922 C  CH2 . TRP C 92  ? 0.8095 0.5813 0.5957 0.1599  -0.0776 0.0146  92  TRP L CH2 
3923 N  N   . SER C 93  ? 0.6472 0.5823 0.5223 0.1029  -0.0851 -0.0201 93  SER L N   
3924 C  CA  . SER C 93  ? 0.6604 0.6111 0.5265 0.1119  -0.0959 -0.0213 93  SER L CA  
3925 C  C   . SER C 93  ? 0.6921 0.6776 0.5786 0.1024  -0.1016 -0.0324 93  SER L C   
3926 O  O   . SER C 93  ? 0.6668 0.6544 0.5663 0.0858  -0.0953 -0.0373 93  SER L O   
3927 C  CB  . SER C 93  ? 0.7285 0.6532 0.5650 0.1122  -0.0944 -0.0135 93  SER L CB  
3928 O  OG  . SER C 93  ? 0.8591 0.8006 0.6856 0.1173  -0.1045 -0.0166 93  SER L OG  
3929 N  N   . THR C 94  ? 0.6597 0.6711 0.5472 0.1132  -0.1142 -0.0359 94  THR L N   
3930 C  CA  . THR C 94  ? 0.6451 0.6907 0.5499 0.1041  -0.1225 -0.0470 94  THR L CA  
3931 C  C   . THR C 94  ? 0.7056 0.7434 0.5878 0.1008  -0.1276 -0.0492 94  THR L C   
3932 O  O   . THR C 94  ? 0.7261 0.7504 0.5812 0.1147  -0.1320 -0.0419 94  THR L O   
3933 C  CB  . THR C 94  ? 0.7422 0.8277 0.6659 0.1165  -0.1337 -0.0511 94  THR L CB  
3934 O  OG1 . THR C 94  ? 0.7163 0.8041 0.6563 0.1212  -0.1264 -0.0485 94  THR L OG1 
3935 C  CG2 . THR C 94  ? 0.7188 0.8436 0.6663 0.1030  -0.1421 -0.0635 94  THR L CG2 
3936 N  N   . PRO C 95  ? 0.6496 0.6942 0.5409 0.0831  -0.1268 -0.0590 95  PRO L N   
3937 C  CA  . PRO C 95  ? 0.6197 0.6769 0.5399 0.0658  -0.1216 -0.0666 95  PRO L CA  
3938 C  C   . PRO C 95  ? 0.6468 0.6764 0.5677 0.0588  -0.1064 -0.0602 95  PRO L C   
3939 O  O   . PRO C 95  ? 0.6497 0.6509 0.5490 0.0602  -0.0999 -0.0539 95  PRO L O   
3940 C  CB  . PRO C 95  ? 0.6482 0.7127 0.5667 0.0525  -0.1278 -0.0784 95  PRO L CB  
3941 C  CG  . PRO C 95  ? 0.7271 0.7670 0.6117 0.0595  -0.1274 -0.0747 95  PRO L CG  
3942 C  CD  . PRO C 95  ? 0.6860 0.7257 0.5558 0.0801  -0.1322 -0.0641 95  PRO L CD  
3943 N  N   . TYR C 96  ? 0.5752 0.6156 0.5206 0.0518  -0.1009 -0.0613 96  TYR L N   
3944 C  CA  . TYR C 96  ? 0.5556 0.5743 0.5035 0.0446  -0.0879 -0.0562 96  TYR L CA  
3945 C  C   . TYR C 96  ? 0.6028 0.6078 0.5475 0.0305  -0.0829 -0.0601 96  TYR L C   
3946 O  O   . TYR C 96  ? 0.6050 0.6227 0.5566 0.0218  -0.0884 -0.0691 96  TYR L O   
3947 C  CB  . TYR C 96  ? 0.5516 0.5872 0.5240 0.0415  -0.0836 -0.0566 96  TYR L CB  
3948 C  CG  . TYR C 96  ? 0.5746 0.6241 0.5502 0.0581  -0.0876 -0.0536 96  TYR L CG  
3949 C  CD1 . TYR C 96  ? 0.6130 0.6389 0.5662 0.0730  -0.0877 -0.0462 96  TYR L CD1 
3950 C  CD2 . TYR C 96  ? 0.5762 0.6599 0.5753 0.0599  -0.0907 -0.0577 96  TYR L CD2 
3951 C  CE1 . TYR C 96  ? 0.6301 0.6647 0.5833 0.0908  -0.0919 -0.0438 96  TYR L CE1 
3952 C  CE2 . TYR C 96  ? 0.5935 0.6909 0.5949 0.0782  -0.0942 -0.0555 96  TYR L CE2 
3953 C  CZ  . TYR C 96  ? 0.7038 0.7736 0.6811 0.0946  -0.0945 -0.0486 96  TYR L CZ  
3954 O  OH  . TYR C 96  ? 0.7342 0.8119 0.7111 0.1148  -0.0975 -0.0464 96  TYR L OH  
3955 N  N   . THR C 97  ? 0.5538 0.5325 0.4862 0.0291  -0.0734 -0.0538 97  THR L N   
3956 C  CA  . THR C 97  ? 0.5493 0.5143 0.4760 0.0195  -0.0682 -0.0570 97  THR L CA  
3957 C  C   . THR C 97  ? 0.5799 0.5327 0.5155 0.0121  -0.0571 -0.0527 97  THR L C   
3958 O  O   . THR C 97  ? 0.5666 0.5154 0.5051 0.0155  -0.0527 -0.0458 97  THR L O   
3959 C  CB  . THR C 97  ? 0.6538 0.6027 0.5534 0.0260  -0.0682 -0.0544 97  THR L CB  
3960 O  OG1 . THR C 97  ? 0.6485 0.5814 0.5384 0.0316  -0.0613 -0.0434 97  THR L OG1 
3961 C  CG2 . THR C 97  ? 0.6419 0.6029 0.5287 0.0344  -0.0803 -0.0585 97  THR L CG2 
3962 N  N   . PHE C 98  ? 0.5335 0.4787 0.4711 0.0032  -0.0531 -0.0571 98  PHE L N   
3963 C  CA  . PHE C 98  ? 0.5183 0.4527 0.4632 -0.0026 -0.0433 -0.0531 98  PHE L CA  
3964 C  C   . PHE C 98  ? 0.5888 0.5061 0.5187 -0.0011 -0.0372 -0.0517 98  PHE L C   
3965 O  O   . PHE C 98  ? 0.6050 0.5183 0.5209 0.0009  -0.0403 -0.0574 98  PHE L O   
3966 C  CB  . PHE C 98  ? 0.5330 0.4726 0.4948 -0.0134 -0.0428 -0.0584 98  PHE L CB  
3967 C  CG  . PHE C 98  ? 0.5377 0.4979 0.5183 -0.0162 -0.0455 -0.0582 98  PHE L CG  
3968 C  CD1 . PHE C 98  ? 0.5793 0.5595 0.5672 -0.0176 -0.0547 -0.0649 98  PHE L CD1 
3969 C  CD2 . PHE C 98  ? 0.5483 0.5102 0.5394 -0.0176 -0.0389 -0.0516 98  PHE L CD2 
3970 C  CE1 . PHE C 98  ? 0.5788 0.5827 0.5861 -0.0196 -0.0560 -0.0644 98  PHE L CE1 
3971 C  CE2 . PHE C 98  ? 0.5747 0.5575 0.5823 -0.0192 -0.0400 -0.0515 98  PHE L CE2 
3972 C  CZ  . PHE C 98  ? 0.5540 0.5587 0.5705 -0.0200 -0.0479 -0.0576 98  PHE L CZ  
3973 N  N   . GLY C 99  ? 0.5388 0.4485 0.4725 -0.0022 -0.0287 -0.0451 99  GLY L N   
3974 C  CA  . GLY C 99  ? 0.5438 0.4419 0.4679 -0.0005 -0.0214 -0.0432 99  GLY L CA  
3975 C  C   . GLY C 99  ? 0.6037 0.4947 0.5305 -0.0045 -0.0198 -0.0504 99  GLY L C   
3976 O  O   . GLY C 99  ? 0.5951 0.4890 0.5336 -0.0111 -0.0232 -0.0547 99  GLY L O   
3977 N  N   . GLY C 100 ? 0.5751 0.4560 0.4906 -0.0004 -0.0142 -0.0515 100 GLY L N   
3978 C  CA  . GLY C 100 ? 0.5870 0.4553 0.5014 -0.0018 -0.0117 -0.0587 100 GLY L CA  
3979 C  C   . GLY C 100 ? 0.6307 0.4953 0.5614 -0.0065 -0.0080 -0.0549 100 GLY L C   
3980 O  O   . GLY C 100 ? 0.6367 0.4898 0.5700 -0.0114 -0.0089 -0.0610 100 GLY L O   
3981 N  N   . GLY C 101 ? 0.5727 0.4460 0.5132 -0.0058 -0.0045 -0.0450 101 GLY L N   
3982 C  CA  . GLY C 101 ? 0.5614 0.4336 0.5151 -0.0087 -0.0010 -0.0395 101 GLY L CA  
3983 C  C   . GLY C 101 ? 0.6150 0.4833 0.5681 -0.0019 0.0065  -0.0339 101 GLY L C   
3984 O  O   . GLY C 101 ? 0.6208 0.4835 0.5637 0.0047  0.0102  -0.0369 101 GLY L O   
3985 N  N   . THR C 102 ? 0.5648 0.4386 0.5287 -0.0024 0.0090  -0.0259 102 THR L N   
3986 C  CA  . THR C 102 ? 0.5646 0.4392 0.5310 0.0047  0.0151  -0.0199 102 THR L CA  
3987 C  C   . THR C 102 ? 0.6226 0.4875 0.5948 0.0044  0.0166  -0.0165 102 THR L C   
3988 O  O   . THR C 102 ? 0.6087 0.4770 0.5875 -0.0022 0.0142  -0.0135 102 THR L O   
3989 C  CB  . THR C 102 ? 0.6459 0.5385 0.6178 0.0051  0.0157  -0.0125 102 THR L CB  
3990 O  OG1 . THR C 102 ? 0.6485 0.5454 0.6126 0.0054  0.0156  -0.0144 102 THR L OG1 
3991 C  CG2 . THR C 102 ? 0.6202 0.5205 0.5983 0.0118  0.0206  -0.0059 102 THR L CG2 
3992 N  N   . LYS C 103 ? 0.5992 0.4521 0.5680 0.0126  0.0214  -0.0160 103 LYS L N   
3993 C  CA  . LYS C 103 ? 0.6100 0.4494 0.5815 0.0144  0.0236  -0.0111 103 LYS L CA  
3994 C  C   . LYS C 103 ? 0.6507 0.5056 0.6294 0.0224  0.0261  -0.0005 103 LYS L C   
3995 O  O   . LYS C 103 ? 0.6433 0.5103 0.6229 0.0308  0.0289  0.0007  103 LYS L O   
3996 C  CB  . LYS C 103 ? 0.6739 0.4867 0.6353 0.0201  0.0268  -0.0175 103 LYS L CB  
3997 C  CG  . LYS C 103 ? 0.9280 0.7176 0.8889 0.0194  0.0286  -0.0133 103 LYS L CG  
3998 C  CD  . LYS C 103 ? 1.1272 0.8901 1.0770 0.0313  0.0333  -0.0173 103 LYS L CD  
3999 C  CE  . LYS C 103 ? 1.2975 1.0742 1.2491 0.0488  0.0382  -0.0111 103 LYS L CE  
4000 N  NZ  . LYS C 103 ? 1.4568 1.2077 1.3968 0.0634  0.0434  -0.0155 103 LYS L NZ  
4001 N  N   . LEU C 104 ? 0.6032 0.4602 0.5871 0.0193  0.0249  0.0072  104 LEU L N   
4002 C  CA  . LEU C 104 ? 0.5928 0.4663 0.5826 0.0261  0.0253  0.0167  104 LEU L CA  
4003 C  C   . LEU C 104 ? 0.6632 0.5214 0.6505 0.0339  0.0281  0.0245  104 LEU L C   
4004 O  O   . LEU C 104 ? 0.6680 0.5080 0.6518 0.0277  0.0286  0.0262  104 LEU L O   
4005 C  CB  . LEU C 104 ? 0.5730 0.4658 0.5681 0.0176  0.0209  0.0195  104 LEU L CB  
4006 C  CG  . LEU C 104 ? 0.6249 0.5380 0.6253 0.0224  0.0191  0.0277  104 LEU L CG  
4007 C  CD1 . LEU C 104 ? 0.6203 0.5523 0.6264 0.0269  0.0192  0.0272  104 LEU L CD1 
4008 C  CD2 . LEU C 104 ? 0.6401 0.5641 0.6415 0.0142  0.0150  0.0289  104 LEU L CD2 
4009 N  N   . GLU C 105 ? 0.6283 0.4959 0.6181 0.0475  0.0300  0.0303  105 GLU L N   
4010 C  CA  . GLU C 105 ? 0.6480 0.5026 0.6345 0.0587  0.0322  0.0395  105 GLU L CA  
4011 C  C   . GLU C 105 ? 0.6830 0.5657 0.6766 0.0644  0.0289  0.0493  105 GLU L C   
4012 O  O   . GLU C 105 ? 0.6600 0.5714 0.6625 0.0649  0.0266  0.0478  105 GLU L O   
4013 C  CB  . GLU C 105 ? 0.6897 0.5281 0.6712 0.0738  0.0372  0.0367  105 GLU L CB  
4014 C  CG  . GLU C 105 ? 0.8668 0.6818 0.8413 0.0869  0.0400  0.0457  105 GLU L CG  
4015 C  CD  . GLU C 105 ? 1.1741 0.9637 1.1400 0.1018  0.0455  0.0407  105 GLU L CD  
4016 O  OE1 . GLU C 105 ? 1.1603 0.9365 1.1207 0.0968  0.0472  0.0283  105 GLU L OE1 
4017 O  OE2 . GLU C 105 ? 1.0878 0.8699 1.0509 0.1199  0.0479  0.0488  105 GLU L OE2 
4018 N  N   . ILE C 106 ? 0.6508 0.5250 0.6397 0.0677  0.0284  0.0594  106 ILE L N   
4019 C  CA  . ILE C 106 ? 0.6389 0.5391 0.6317 0.0736  0.0240  0.0688  106 ILE L CA  
4020 C  C   . ILE C 106 ? 0.7127 0.6052 0.7018 0.0928  0.0258  0.0789  106 ILE L C   
4021 O  O   . ILE C 106 ? 0.7327 0.5912 0.7112 0.0970  0.0301  0.0831  106 ILE L O   
4022 C  CB  . ILE C 106 ? 0.6678 0.5733 0.6567 0.0617  0.0206  0.0726  106 ILE L CB  
4023 C  CG1 . ILE C 106 ? 0.6480 0.5628 0.6410 0.0456  0.0185  0.0621  106 ILE L CG1 
4024 C  CG2 . ILE C 106 ? 0.6731 0.6050 0.6630 0.0686  0.0150  0.0814  106 ILE L CG2 
4025 C  CD1 . ILE C 106 ? 0.7414 0.6355 0.7314 0.0369  0.0217  0.0563  106 ILE L CD1 
4026 N  N   . ASN C 107 ? 0.6632 0.5878 0.6616 0.1043  0.0221  0.0832  107 ASN L N   
4027 C  CA  . ASN C 107 ? 1.0763 1.0012 1.0731 0.1259  0.0226  0.0934  107 ASN L CA  
4028 C  C   . ASN C 107 ? 1.5380 1.4822 1.5326 0.1303  0.0159  0.1054  107 ASN L C   
4029 O  O   . ASN C 107 ? 1.0508 1.0134 1.0468 0.1166  0.0106  0.1037  107 ASN L O   
4030 C  CB  . ASN C 107 ? 1.0754 1.0252 1.0856 0.1386  0.0240  0.0895  107 ASN L CB  
4031 C  CG  . ASN C 107 ? 1.3413 1.2765 1.3517 0.1335  0.0305  0.0769  107 ASN L CG  
4032 O  OD1 . ASN C 107 ? 1.2629 1.1608 1.2614 0.1269  0.0344  0.0717  107 ASN L OD1 
4033 N  ND2 . ASN C 107 ? 1.2283 1.1948 1.2522 0.1356  0.0313  0.0720  107 ASN L ND2 
4034 ZN ZN  . ZN  D .   ? 0.9297 0.7694 0.7054 0.2326  -0.0718 -0.0415 401 ZN  A ZN  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -17 ?   ?   ?   A . n 
A 1 2   ASP 2   -16 ?   ?   ?   A . n 
A 1 3   TYR 3   -15 ?   ?   ?   A . n 
A 1 4   LYS 4   -14 ?   ?   ?   A . n 
A 1 5   ASP 5   -13 ?   ?   ?   A . n 
A 1 6   ASP 6   -12 ?   ?   ?   A . n 
A 1 7   ASP 7   -11 ?   ?   ?   A . n 
A 1 8   ASP 8   -10 ?   ?   ?   A . n 
A 1 9   LYS 9   -9  ?   ?   ?   A . n 
A 1 10  GLU 10  -8  ?   ?   ?   A . n 
A 1 11  ASN 11  -7  ?   ?   ?   A . n 
A 1 12  LEU 12  -6  ?   ?   ?   A . n 
A 1 13  TYR 13  -5  ?   ?   ?   A . n 
A 1 14  PHE 14  -4  ?   ?   ?   A . n 
A 1 15  GLN 15  -3  ?   ?   ?   A . n 
A 1 16  GLY 16  -2  ?   ?   ?   A . n 
A 1 17  GLY 17  -1  -1  GLY GLY A . n 
A 1 18  SER 18  0   0   SER SER A . n 
A 1 19  GLU 19  89  89  GLU GLU A . n 
A 1 20  GLY 20  90  90  GLY GLY A . n 
A 1 21  ARG 21  91  91  ARG ARG A . n 
A 1 22  TRP 22  92  92  TRP TRP A . n 
A 1 23  ARG 23  93  93  ARG ARG A . n 
A 1 24  VAL 24  94  94  VAL VAL A . n 
A 1 25  ILE 25  95  95  ILE ILE A . n 
A 1 26  PRO 26  96  96  PRO PRO A . n 
A 1 27  TYR 27  97  97  TYR TYR A . n 
A 1 28  ASP 28  98  98  ASP ASP A . n 
A 1 29  VAL 29  99  99  VAL VAL A . n 
A 1 30  LEU 30  100 100 LEU LEU A . n 
A 1 31  PRO 31  101 101 PRO PRO A . n 
A 1 32  ASP 32  102 102 ASP ASP A . n 
A 1 33  TRP 33  103 103 TRP TRP A . n 
A 1 34  LEU 34  104 104 LEU LEU A . n 
A 1 35  LYS 35  105 105 LYS LYS A . n 
A 1 36  ASP 36  106 106 ASP ASP A . n 
A 1 37  ASN 37  107 107 ASN ASN A . n 
A 1 38  ASP 38  108 108 ASP ASP A . n 
A 1 39  TYR 39  109 109 TYR TYR A . n 
A 1 40  LEU 40  110 110 LEU LEU A . n 
A 1 41  LEU 41  111 111 LEU LEU A . n 
A 1 42  HIS 42  112 112 HIS HIS A . n 
A 1 43  GLY 43  113 113 GLY GLY A . n 
A 1 44  HIS 44  114 114 HIS HIS A . n 
A 1 45  ARG 45  115 115 ARG ARG A . n 
A 1 46  PRO 46  116 116 PRO PRO A . n 
A 1 47  PRO 47  117 117 PRO PRO A . n 
A 1 48  MET 48  118 118 MET MET A . n 
A 1 49  PRO 49  119 119 PRO PRO A . n 
A 1 50  SER 50  120 120 SER SER A . n 
A 1 51  PHE 51  121 121 PHE PHE A . n 
A 1 52  ARG 52  122 122 ARG ARG A . n 
A 1 53  ALA 53  123 123 ALA ALA A . n 
A 1 54  CYS 54  124 124 CYS CYS A . n 
A 1 55  PHE 55  125 125 PHE PHE A . n 
A 1 56  LYS 56  126 126 LYS LYS A . n 
A 1 57  SER 57  127 127 SER SER A . n 
A 1 58  ILE 58  128 128 ILE ILE A . n 
A 1 59  PHE 59  129 129 PHE PHE A . n 
A 1 60  ARG 60  130 130 ARG ARG A . n 
A 1 61  ILE 61  131 131 ILE ILE A . n 
A 1 62  HIS 62  132 132 HIS HIS A . n 
A 1 63  THR 63  133 133 THR THR A . n 
A 1 64  GLU 64  134 134 GLU GLU A . n 
A 1 65  THR 65  135 135 THR THR A . n 
A 1 66  GLY 66  136 136 GLY GLY A . n 
A 1 67  ASN 67  137 137 ASN ASN A . n 
A 1 68  ILE 68  138 138 ILE ILE A . n 
A 1 69  TRP 69  139 139 TRP TRP A . n 
A 1 70  THR 70  140 140 THR THR A . n 
A 1 71  HIS 71  141 141 HIS HIS A . n 
A 1 72  LEU 72  142 142 LEU LEU A . n 
A 1 73  LEU 73  143 143 LEU LEU A . n 
A 1 74  GLY 74  144 144 GLY GLY A . n 
A 1 75  PHE 75  145 145 PHE PHE A . n 
A 1 76  VAL 76  146 146 VAL VAL A . n 
A 1 77  LEU 77  147 147 LEU LEU A . n 
A 1 78  PHE 78  148 148 PHE PHE A . n 
A 1 79  LEU 79  149 149 LEU LEU A . n 
A 1 80  PHE 80  150 150 PHE PHE A . n 
A 1 81  LEU 81  151 151 LEU LEU A . n 
A 1 82  GLY 82  152 152 GLY GLY A . n 
A 1 83  ILE 83  153 153 ILE ILE A . n 
A 1 84  LEU 84  154 154 LEU LEU A . n 
A 1 85  THR 85  155 155 THR THR A . n 
A 1 86  MET 86  156 156 MET MET A . n 
A 1 87  LEU 87  157 157 LEU LEU A . n 
A 1 88  ARG 88  158 158 ARG ARG A . n 
A 1 89  PRO 89  159 159 PRO PRO A . n 
A 1 90  ASN 90  160 160 ASN ASN A . n 
A 1 91  MET 91  161 161 MET MET A . n 
A 1 92  TYR 92  162 162 TYR TYR A . n 
A 1 93  PHE 93  163 163 PHE PHE A . n 
A 1 94  MET 94  164 164 MET MET A . n 
A 1 95  ALA 95  165 165 ALA ALA A . n 
A 1 96  PRO 96  166 166 PRO PRO A . n 
A 1 97  LEU 97  167 167 LEU LEU A . n 
A 1 98  GLN 98  168 168 GLN GLN A . n 
A 1 99  GLU 99  169 169 GLU GLU A . n 
A 1 100 LYS 100 170 170 LYS LYS A . n 
A 1 101 VAL 101 171 171 VAL VAL A . n 
A 1 102 VAL 102 172 172 VAL VAL A . n 
A 1 103 PHE 103 173 173 PHE PHE A . n 
A 1 104 GLY 104 174 174 GLY GLY A . n 
A 1 105 MET 105 175 175 MET MET A . n 
A 1 106 PHE 106 176 176 PHE PHE A . n 
A 1 107 PHE 107 177 177 PHE PHE A . n 
A 1 108 LEU 108 178 178 LEU LEU A . n 
A 1 109 GLY 109 179 179 GLY GLY A . n 
A 1 110 ALA 110 180 180 ALA ALA A . n 
A 1 111 VAL 111 181 181 VAL VAL A . n 
A 1 112 LEU 112 182 182 LEU LEU A . n 
A 1 113 CYS 113 183 183 CYS CYS A . n 
A 1 114 LEU 114 184 184 LEU LEU A . n 
A 1 115 SER 115 185 185 SER SER A . n 
A 1 116 PHE 116 186 186 PHE PHE A . n 
A 1 117 SER 117 187 187 SER SER A . n 
A 1 118 TRP 118 188 188 TRP TRP A . n 
A 1 119 LEU 119 189 189 LEU LEU A . n 
A 1 120 PHE 120 190 190 PHE PHE A . n 
A 1 121 HIS 121 191 191 HIS HIS A . n 
A 1 122 THR 122 192 192 THR THR A . n 
A 1 123 VAL 123 193 193 VAL VAL A . n 
A 1 124 TYR 124 194 194 TYR TYR A . n 
A 1 125 CYS 125 195 195 CYS CYS A . n 
A 1 126 HIS 126 196 196 HIS HIS A . n 
A 1 127 SER 127 197 197 SER SER A . n 
A 1 128 GLU 128 198 198 GLU GLU A . n 
A 1 129 LYS 129 199 199 LYS LYS A . n 
A 1 130 VAL 130 200 200 VAL VAL A . n 
A 1 131 SER 131 201 201 SER SER A . n 
A 1 132 ARG 132 202 202 ARG ARG A . n 
A 1 133 THR 133 203 203 THR THR A . n 
A 1 134 PHE 134 204 204 PHE PHE A . n 
A 1 135 SER 135 205 205 SER SER A . n 
A 1 136 LYS 136 206 206 LYS LYS A . n 
A 1 137 LEU 137 207 207 LEU LEU A . n 
A 1 138 ASP 138 208 208 ASP ASP A . n 
A 1 139 TYR 139 209 209 TYR TYR A . n 
A 1 140 SER 140 210 210 SER SER A . n 
A 1 141 GLY 141 211 211 GLY GLY A . n 
A 1 142 ILE 142 212 212 ILE ILE A . n 
A 1 143 ALA 143 213 213 ALA ALA A . n 
A 1 144 LEU 144 214 214 LEU LEU A . n 
A 1 145 LEU 145 215 215 LEU LEU A . n 
A 1 146 ILE 146 216 216 ILE ILE A . n 
A 1 147 MET 147 217 217 MET MET A . n 
A 1 148 GLY 148 218 218 GLY GLY A . n 
A 1 149 SER 149 219 219 SER SER A . n 
A 1 150 PHE 150 220 220 PHE PHE A . n 
A 1 151 VAL 151 221 221 VAL VAL A . n 
A 1 152 PRO 152 222 222 PRO PRO A . n 
A 1 153 TRP 153 223 223 TRP TRP A . n 
A 1 154 LEU 154 224 224 LEU LEU A . n 
A 1 155 TYR 155 225 225 TYR TYR A . n 
A 1 156 TYR 156 226 226 TYR TYR A . n 
A 1 157 SER 157 227 227 SER SER A . n 
A 1 158 PHE 158 228 228 PHE PHE A . n 
A 1 159 TYR 159 229 229 TYR TYR A . n 
A 1 160 CYS 160 230 230 CYS CYS A . n 
A 1 161 SER 161 231 231 SER SER A . n 
A 1 162 PRO 162 232 232 PRO PRO A . n 
A 1 163 GLN 163 233 233 GLN GLN A . n 
A 1 164 PRO 164 234 234 PRO PRO A . n 
A 1 165 ARG 165 235 235 ARG ARG A . n 
A 1 166 LEU 166 236 236 LEU LEU A . n 
A 1 167 ILE 167 237 237 ILE ILE A . n 
A 1 168 TYR 168 238 238 TYR TYR A . n 
A 1 169 LEU 169 239 239 LEU LEU A . n 
A 1 170 SER 170 240 240 SER SER A . n 
A 1 171 ILE 171 241 241 ILE ILE A . n 
A 1 172 VAL 172 242 242 VAL VAL A . n 
A 1 173 CYS 173 243 243 CYS CYS A . n 
A 1 174 VAL 174 244 244 VAL VAL A . n 
A 1 175 LEU 175 245 245 LEU LEU A . n 
A 1 176 GLY 176 246 246 GLY GLY A . n 
A 1 177 ILE 177 247 247 ILE ILE A . n 
A 1 178 SER 178 248 248 SER SER A . n 
A 1 179 ALA 179 249 249 ALA ALA A . n 
A 1 180 ILE 180 250 250 ILE ILE A . n 
A 1 181 ILE 181 251 251 ILE ILE A . n 
A 1 182 VAL 182 252 252 VAL VAL A . n 
A 1 183 ALA 183 253 253 ALA ALA A . n 
A 1 184 GLN 184 254 254 GLN GLN A . n 
A 1 185 TRP 185 255 255 TRP TRP A . n 
A 1 186 ASP 186 256 256 ASP ASP A . n 
A 1 187 ARG 187 257 257 ARG ARG A . n 
A 1 188 PHE 188 258 258 PHE PHE A . n 
A 1 189 ALA 189 259 259 ALA ALA A . n 
A 1 190 THR 190 260 260 THR THR A . n 
A 1 191 PRO 191 261 261 PRO PRO A . n 
A 1 192 LYS 192 262 262 LYS LYS A . n 
A 1 193 HIS 193 263 263 HIS HIS A . n 
A 1 194 ARG 194 264 264 ARG ARG A . n 
A 1 195 GLN 195 265 265 GLN GLN A . n 
A 1 196 THR 196 266 266 THR THR A . n 
A 1 197 ARG 197 267 267 ARG ARG A . n 
A 1 198 ALA 198 268 268 ALA ALA A . n 
A 1 199 GLY 199 269 269 GLY GLY A . n 
A 1 200 VAL 200 270 270 VAL VAL A . n 
A 1 201 PHE 201 271 271 PHE PHE A . n 
A 1 202 LEU 202 272 272 LEU LEU A . n 
A 1 203 GLY 203 273 273 GLY GLY A . n 
A 1 204 LEU 204 274 274 LEU LEU A . n 
A 1 205 GLY 205 275 275 GLY GLY A . n 
A 1 206 LEU 206 276 276 LEU LEU A . n 
A 1 207 SER 207 277 277 SER SER A . n 
A 1 208 GLY 208 278 278 GLY GLY A . n 
A 1 209 VAL 209 279 279 VAL VAL A . n 
A 1 210 VAL 210 280 280 VAL VAL A . n 
A 1 211 PRO 211 281 281 PRO PRO A . n 
A 1 212 THR 212 282 282 THR THR A . n 
A 1 213 MET 213 283 283 MET MET A . n 
A 1 214 HIS 214 284 284 HIS HIS A . n 
A 1 215 PHE 215 285 285 PHE PHE A . n 
A 1 216 THR 216 286 286 THR THR A . n 
A 1 217 ILE 217 287 287 ILE ILE A . n 
A 1 218 ALA 218 288 288 ALA ALA A . n 
A 1 219 GLU 219 289 289 GLU GLU A . n 
A 1 220 GLY 220 290 290 GLY GLY A . n 
A 1 221 PHE 221 291 291 PHE PHE A . n 
A 1 222 VAL 222 292 292 VAL VAL A . n 
A 1 223 LYS 223 293 293 LYS LYS A . n 
A 1 224 ALA 224 294 294 ALA ALA A . n 
A 1 225 THR 225 295 295 THR THR A . n 
A 1 226 THR 226 296 296 THR THR A . n 
A 1 227 VAL 227 297 297 VAL VAL A . n 
A 1 228 GLY 228 298 298 GLY GLY A . n 
A 1 229 GLN 229 299 299 GLN GLN A . n 
A 1 230 MET 230 300 300 MET MET A . n 
A 1 231 GLY 231 301 301 GLY GLY A . n 
A 1 232 TRP 232 302 302 TRP TRP A . n 
A 1 233 PHE 233 303 303 PHE PHE A . n 
A 1 234 PHE 234 304 304 PHE PHE A . n 
A 1 235 LEU 235 305 305 LEU LEU A . n 
A 1 236 MET 236 306 306 MET MET A . n 
A 1 237 ALA 237 307 307 ALA ALA A . n 
A 1 238 VAL 238 308 308 VAL VAL A . n 
A 1 239 MET 239 309 309 MET MET A . n 
A 1 240 TYR 240 310 310 TYR TYR A . n 
A 1 241 ILE 241 311 311 ILE ILE A . n 
A 1 242 THR 242 312 312 THR THR A . n 
A 1 243 GLY 243 313 313 GLY GLY A . n 
A 1 244 ALA 244 314 314 ALA ALA A . n 
A 1 245 GLY 245 315 315 GLY GLY A . n 
A 1 246 LEU 246 316 316 LEU LEU A . n 
A 1 247 TYR 247 317 317 TYR TYR A . n 
A 1 248 ALA 248 318 318 ALA ALA A . n 
A 1 249 ALA 249 319 319 ALA ALA A . n 
A 1 250 ARG 250 320 320 ARG ARG A . n 
A 1 251 ILE 251 321 321 ILE ILE A . n 
A 1 252 PRO 252 322 322 PRO PRO A . n 
A 1 253 GLU 253 323 323 GLU GLU A . n 
A 1 254 ARG 254 324 324 ARG ARG A . n 
A 1 255 PHE 255 325 325 PHE PHE A . n 
A 1 256 PHE 256 326 326 PHE PHE A . n 
A 1 257 PRO 257 327 327 PRO PRO A . n 
A 1 258 GLY 258 328 328 GLY GLY A . n 
A 1 259 LYS 259 329 329 LYS LYS A . n 
A 1 260 PHE 260 330 330 PHE PHE A . n 
A 1 261 ASP 261 331 331 ASP ASP A . n 
A 1 262 ILE 262 332 332 ILE ILE A . n 
A 1 263 TRP 263 333 333 TRP TRP A . n 
A 1 264 PHE 264 334 334 PHE PHE A . n 
A 1 265 GLN 265 335 335 GLN GLN A . n 
A 1 266 SER 266 336 336 SER SER A . n 
A 1 267 HIS 267 337 337 HIS HIS A . n 
A 1 268 GLN 268 338 338 GLN GLN A . n 
A 1 269 ILE 269 339 339 ILE ILE A . n 
A 1 270 PHE 270 340 340 PHE PHE A . n 
A 1 271 HIS 271 341 341 HIS HIS A . n 
A 1 272 VAL 272 342 342 VAL VAL A . n 
A 1 273 LEU 273 343 343 LEU LEU A . n 
A 1 274 VAL 274 344 344 VAL VAL A . n 
A 1 275 VAL 275 345 345 VAL VAL A . n 
A 1 276 ALA 276 346 346 ALA ALA A . n 
A 1 277 ALA 277 347 347 ALA ALA A . n 
A 1 278 ALA 278 348 348 ALA ALA A . n 
A 1 279 PHE 279 349 349 PHE PHE A . n 
A 1 280 VAL 280 350 350 VAL VAL A . n 
A 1 281 HIS 281 351 351 HIS HIS A . n 
A 1 282 PHE 282 352 352 PHE PHE A . n 
A 1 283 TYR 283 353 353 TYR TYR A . n 
A 1 284 GLY 284 354 354 GLY GLY A . n 
A 1 285 VAL 285 355 355 VAL VAL A . n 
A 1 286 SER 286 356 356 SER SER A . n 
A 1 287 ASN 287 357 357 ASN ASN A . n 
A 1 288 LEU 288 358 358 LEU LEU A . n 
A 1 289 GLN 289 359 359 GLN GLN A . n 
A 1 290 GLU 290 360 360 GLU GLU A . n 
A 1 291 PHE 291 361 361 PHE PHE A . n 
A 1 292 ARG 292 362 362 ARG ARG A . n 
A 1 293 TYR 293 363 363 TYR TYR A . n 
A 1 294 GLY 294 364 364 GLY GLY A . n 
A 1 295 LEU 295 365 365 LEU LEU A . n 
A 1 296 GLU 296 366 366 GLU GLU A . n 
A 1 297 GLY 297 367 367 GLY GLY A . n 
A 1 298 GLY 298 368 368 GLY GLY A . n 
A 1 299 CYS 299 369 ?   ?   ?   A . n 
A 1 300 THR 300 370 ?   ?   ?   A . n 
A 1 301 ASP 301 371 ?   ?   ?   A . n 
A 1 302 ASP 302 372 ?   ?   ?   A . n 
A 1 303 THR 303 373 ?   ?   ?   A . n 
A 1 304 LEU 304 374 ?   ?   ?   A . n 
A 1 305 LEU 305 375 ?   ?   ?   A . n 
B 2 1   GLU 1   1   1   GLU GLU H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   LEU 3   3   3   LEU LEU H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   GLN 5   5   5   GLN GLN H . n 
B 2 6   GLN 6   6   6   GLN GLN H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   PRO 9   9   9   PRO PRO H . n 
B 2 10  GLU 10  10  10  GLU GLU H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  VAL 12  12  12  VAL VAL H . n 
B 2 13  LYS 13  13  13  LYS LYS H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  ALA 16  16  16  ALA ALA H . n 
B 2 17  SER 17  17  17  SER SER H . n 
B 2 18  VAL 18  18  18  VAL VAL H . n 
B 2 19  ARG 19  19  19  ARG ARG H . n 
B 2 20  ILE 20  20  20  ILE ILE H . n 
B 2 21  THR 21  21  21  THR THR H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  LYS 23  23  23  LYS LYS H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  TYR 27  27  27  TYR TYR H . n 
B 2 28  THR 28  28  28  THR THR H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  THR 30  30  30  THR THR H . n 
B 2 31  ASP 31  31  31  ASP ASP H . n 
B 2 32  PHE 32  32  32  PHE PHE H . n 
B 2 33  ASN 33  33  33  ASN ASN H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  ASP 35  35  35  ASP ASP H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  LYS 38  38  38  LYS LYS H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  SER 40  40  40  SER SER H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  LYS 43  43  43  LYS LYS H . n 
B 2 44  SER 44  44  44  SER SER H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  GLU 46  46  46  GLU GLU H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  ILE 48  48  48  ILE ILE H . n 
B 2 49  GLY 49  49  49  GLY GLY H . n 
B 2 50  ASP 50  50  50  ASP ASP H . n 
B 2 51  PHE 51  51  51  PHE PHE H . n 
B 2 52  ASN 52  52  52  ASN ASN H . n 
B 2 53  PRO 53  53  53  PRO PRO H . n 
B 2 54  ASN 54  54  54  ASN ASN H . n 
B 2 55  SER 55  55  55  SER SER H . n 
B 2 56  GLY 56  56  56  GLY GLY H . n 
B 2 57  GLY 57  57  57  GLY GLY H . n 
B 2 58  SER 58  58  58  SER SER H . n 
B 2 59  ILE 59  59  59  ILE ILE H . n 
B 2 60  TYR 60  60  60  TYR TYR H . n 
B 2 61  ASN 61  61  61  ASN ASN H . n 
B 2 62  GLN 62  62  62  GLN GLN H . n 
B 2 63  LYS 63  63  63  LYS LYS H . n 
B 2 64  PHE 64  64  64  PHE PHE H . n 
B 2 65  LYS 65  65  65  LYS LYS H . n 
B 2 66  ASP 66  66  66  ASP ASP H . n 
B 2 67  LYS 67  67  67  LYS LYS H . n 
B 2 68  ALA 68  68  68  ALA ALA H . n 
B 2 69  THR 69  69  69  THR THR H . n 
B 2 70  PHE 70  70  70  PHE PHE H . n 
B 2 71  THR 71  71  71  THR THR H . n 
B 2 72  VAL 72  72  72  VAL VAL H . n 
B 2 73  ASP 73  73  73  ASP ASP H . n 
B 2 74  LYS 74  74  74  LYS LYS H . n 
B 2 75  SER 75  75  75  SER SER H . n 
B 2 76  SER 76  76  76  SER SER H . n 
B 2 77  SER 77  77  77  SER SER H . n 
B 2 78  THR 78  78  78  THR THR H . n 
B 2 79  ALA 79  79  79  ALA ALA H . n 
B 2 80  TYR 80  80  80  TYR TYR H . n 
B 2 81  MET 81  81  81  MET MET H . n 
B 2 82  GLU 82  82  82  GLU GLU H . n 
B 2 83  LEU 83  83  83  LEU LEU H . n 
B 2 84  ARG 84  84  84  ARG ARG H . n 
B 2 85  SER 85  85  85  SER SER H . n 
B 2 86  LEU 86  86  86  LEU LEU H . n 
B 2 87  THR 87  87  87  THR THR H . n 
B 2 88  PHE 88  88  88  PHE PHE H . n 
B 2 89  GLU 89  89  89  GLU GLU H . n 
B 2 90  ASP 90  90  90  ASP ASP H . n 
B 2 91  THR 91  91  91  THR THR H . n 
B 2 92  ALA 92  92  92  ALA ALA H . n 
B 2 93  VAL 93  93  93  VAL VAL H . n 
B 2 94  TYR 94  94  94  TYR TYR H . n 
B 2 95  TYR 95  95  95  TYR TYR H . n 
B 2 96  CYS 96  96  96  CYS CYS H . n 
B 2 97  ALA 97  97  97  ALA ALA H . n 
B 2 98  ARG 98  98  98  ARG ARG H . n 
B 2 99  GLU 99  99  99  GLU GLU H . n 
B 2 100 THR 100 100 100 THR THR H . n 
B 2 101 GLY 101 101 101 GLY GLY H . n 
B 2 102 THR 102 102 102 THR THR H . n 
B 2 103 ALA 103 103 103 ALA ALA H . n 
B 2 104 TRP 104 104 104 TRP TRP H . n 
B 2 105 PHE 105 105 105 PHE PHE H . n 
B 2 106 ALA 106 106 106 ALA ALA H . n 
B 2 107 TYR 107 107 107 TYR TYR H . n 
B 2 108 TRP 108 108 108 TRP TRP H . n 
B 2 109 GLY 109 109 109 GLY GLY H . n 
B 2 110 GLN 110 110 110 GLN GLN H . n 
B 2 111 GLY 111 111 111 GLY GLY H . n 
B 2 112 THR 112 112 112 THR THR H . n 
B 2 113 LEU 113 113 113 LEU LEU H . n 
B 2 114 VAL 114 114 114 VAL VAL H . n 
B 2 115 THR 115 115 115 THR THR H . n 
B 2 116 VAL 116 116 116 VAL VAL H . n 
B 2 117 SER 117 117 117 SER SER H . n 
B 2 118 ALA 118 118 118 ALA ALA H . n 
B 2 119 ALA 119 119 119 ALA ALA H . n 
C 3 1   ASP 1   1   1   ASP ASP L . n 
C 3 2   ILE 2   2   2   ILE ILE L . n 
C 3 3   GLN 3   3   3   GLN GLN L . n 
C 3 4   MET 4   4   4   MET MET L . n 
C 3 5   THR 5   5   5   THR THR L . n 
C 3 6   GLN 6   6   6   GLN GLN L . n 
C 3 7   SER 7   7   7   SER SER L . n 
C 3 8   PRO 8   8   8   PRO PRO L . n 
C 3 9   ALA 9   9   9   ALA ALA L . n 
C 3 10  SER 10  10  10  SER SER L . n 
C 3 11  LEU 11  11  11  LEU LEU L . n 
C 3 12  SER 12  12  12  SER SER L . n 
C 3 13  ALA 13  13  13  ALA ALA L . n 
C 3 14  SER 14  14  14  SER SER L . n 
C 3 15  VAL 15  15  15  VAL VAL L . n 
C 3 16  GLY 16  16  16  GLY GLY L . n 
C 3 17  GLU 17  17  17  GLU GLU L . n 
C 3 18  THR 18  18  18  THR THR L . n 
C 3 19  VAL 19  19  19  VAL VAL L . n 
C 3 20  THR 20  20  20  THR THR L . n 
C 3 21  ILE 21  21  21  ILE ILE L . n 
C 3 22  THR 22  22  22  THR THR L . n 
C 3 23  CYS 23  23  23  CYS CYS L . n 
C 3 24  ARG 24  24  24  ARG ARG L . n 
C 3 25  ALA 25  25  25  ALA ALA L . n 
C 3 26  SER 26  26  26  SER SER L . n 
C 3 27  GLY 27  27  27  GLY GLY L . n 
C 3 28  ASN 28  28  28  ASN ASN L . n 
C 3 29  ILE 29  29  29  ILE ILE L . n 
C 3 30  HIS 30  30  30  HIS HIS L . n 
C 3 31  ASN 31  31  31  ASN ASN L . n 
C 3 32  PHE 32  32  32  PHE PHE L . n 
C 3 33  LEU 33  33  33  LEU LEU L . n 
C 3 34  ALA 34  34  34  ALA ALA L . n 
C 3 35  TRP 35  35  35  TRP TRP L . n 
C 3 36  TYR 36  36  36  TYR TYR L . n 
C 3 37  GLN 37  37  37  GLN GLN L . n 
C 3 38  GLN 38  38  38  GLN GLN L . n 
C 3 39  LYS 39  39  39  LYS LYS L . n 
C 3 40  GLN 40  40  40  GLN GLN L . n 
C 3 41  GLY 41  41  41  GLY GLY L . n 
C 3 42  LYS 42  42  42  LYS LYS L . n 
C 3 43  SER 43  43  43  SER SER L . n 
C 3 44  PRO 44  44  44  PRO PRO L . n 
C 3 45  GLN 45  45  45  GLN GLN L . n 
C 3 46  VAL 46  46  46  VAL VAL L . n 
C 3 47  LEU 47  47  47  LEU LEU L . n 
C 3 48  VAL 48  48  48  VAL VAL L . n 
C 3 49  TYR 49  49  49  TYR TYR L . n 
C 3 50  ASN 50  50  50  ASN ASN L . n 
C 3 51  ALA 51  51  51  ALA ALA L . n 
C 3 52  LYS 52  52  52  LYS LYS L . n 
C 3 53  THR 53  53  53  THR THR L . n 
C 3 54  LEU 54  54  54  LEU LEU L . n 
C 3 55  ALA 55  55  55  ALA ALA L . n 
C 3 56  ASP 56  56  56  ASP ASP L . n 
C 3 57  GLY 57  57  57  GLY GLY L . n 
C 3 58  VAL 58  58  58  VAL VAL L . n 
C 3 59  PRO 59  59  59  PRO PRO L . n 
C 3 60  SER 60  60  60  SER SER L . n 
C 3 61  ARG 61  61  61  ARG ARG L . n 
C 3 62  PHE 62  62  62  PHE PHE L . n 
C 3 63  SER 63  63  63  SER SER L . n 
C 3 64  GLY 64  64  64  GLY GLY L . n 
C 3 65  SER 65  65  65  SER SER L . n 
C 3 66  GLY 66  66  66  GLY GLY L . n 
C 3 67  SER 67  67  67  SER SER L . n 
C 3 68  GLY 68  68  68  GLY GLY L . n 
C 3 69  THR 69  69  69  THR THR L . n 
C 3 70  GLN 70  70  70  GLN GLN L . n 
C 3 71  TYR 71  71  71  TYR TYR L . n 
C 3 72  SER 72  72  72  SER SER L . n 
C 3 73  LEU 73  73  73  LEU LEU L . n 
C 3 74  LYS 74  74  74  LYS LYS L . n 
C 3 75  ILE 75  75  75  ILE ILE L . n 
C 3 76  ASN 76  76  76  ASN ASN L . n 
C 3 77  SER 77  77  77  SER SER L . n 
C 3 78  LEU 78  78  78  LEU LEU L . n 
C 3 79  GLN 79  79  79  GLN GLN L . n 
C 3 80  PRO 80  80  80  PRO PRO L . n 
C 3 81  GLU 81  81  81  GLU GLU L . n 
C 3 82  ASP 82  82  82  ASP ASP L . n 
C 3 83  PHE 83  83  83  PHE PHE L . n 
C 3 84  GLY 84  84  84  GLY GLY L . n 
C 3 85  SER 85  85  85  SER SER L . n 
C 3 86  TYR 86  86  86  TYR TYR L . n 
C 3 87  TYR 87  87  87  TYR TYR L . n 
C 3 88  CYS 88  88  88  CYS CYS L . n 
C 3 89  GLN 89  89  89  GLN GLN L . n 
C 3 90  GLN 90  90  90  GLN GLN L . n 
C 3 91  PHE 91  91  91  PHE PHE L . n 
C 3 92  TRP 92  92  92  TRP TRP L . n 
C 3 93  SER 93  93  93  SER SER L . n 
C 3 94  THR 94  94  94  THR THR L . n 
C 3 95  PRO 95  95  95  PRO PRO L . n 
C 3 96  TYR 96  96  96  TYR TYR L . n 
C 3 97  THR 97  97  97  THR THR L . n 
C 3 98  PHE 98  98  98  PHE PHE L . n 
C 3 99  GLY 99  99  99  GLY GLY L . n 
C 3 100 GLY 100 100 100 GLY GLY L . n 
C 3 101 GLY 101 101 101 GLY GLY L . n 
C 3 102 THR 102 102 102 THR THR L . n 
C 3 103 LYS 103 103 103 LYS LYS L . n 
C 3 104 LEU 104 104 104 LEU LEU L . n 
C 3 105 GLU 105 105 105 GLU GLU L . n 
C 3 106 ILE 106 106 106 ILE ILE L . n 
C 3 107 ASN 107 107 107 ASN ASN L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   401 401 ZN  ZN  A . 
E 5 SO4 1   402 1   SO4 SO4 A . 
F 5 SO4 1   201 2   SO4 SO4 L . 
G 6 HOH 1   501 70  HOH HOH A . 
G 6 HOH 2   502 61  HOH HOH A . 
G 6 HOH 3   503 118 HOH HOH A . 
G 6 HOH 4   504 54  HOH HOH A . 
G 6 HOH 5   505 152 HOH HOH A . 
G 6 HOH 6   506 9   HOH HOH A . 
G 6 HOH 7   507 1   HOH HOH A . 
G 6 HOH 8   508 13  HOH HOH A . 
G 6 HOH 9   509 63  HOH HOH A . 
G 6 HOH 10  510 90  HOH HOH A . 
G 6 HOH 11  511 3   HOH HOH A . 
G 6 HOH 12  512 108 HOH HOH A . 
G 6 HOH 13  513 17  HOH HOH A . 
G 6 HOH 14  514 158 HOH HOH A . 
G 6 HOH 15  515 10  HOH HOH A . 
G 6 HOH 16  516 35  HOH HOH A . 
G 6 HOH 17  517 21  HOH HOH A . 
G 6 HOH 18  518 13  HOH HOH A . 
G 6 HOH 19  519 33  HOH HOH A . 
G 6 HOH 20  520 43  HOH HOH A . 
G 6 HOH 21  521 34  HOH HOH A . 
G 6 HOH 22  522 7   HOH HOH A . 
G 6 HOH 23  523 11  HOH HOH A . 
G 6 HOH 24  524 76  HOH HOH A . 
G 6 HOH 25  525 79  HOH HOH A . 
G 6 HOH 26  526 4   HOH HOH A . 
G 6 HOH 27  527 53  HOH HOH A . 
G 6 HOH 28  528 147 HOH HOH A . 
G 6 HOH 29  529 88  HOH HOH A . 
G 6 HOH 30  530 104 HOH HOH A . 
G 6 HOH 31  531 60  HOH HOH A . 
G 6 HOH 32  532 15  HOH HOH A . 
G 6 HOH 33  533 89  HOH HOH A . 
G 6 HOH 34  534 153 HOH HOH A . 
G 6 HOH 35  535 143 HOH HOH A . 
G 6 HOH 36  536 28  HOH HOH A . 
G 6 HOH 37  537 12  HOH HOH A . 
G 6 HOH 38  538 151 HOH HOH A . 
G 6 HOH 39  539 121 HOH HOH A . 
G 6 HOH 40  540 73  HOH HOH A . 
G 6 HOH 41  541 30  HOH HOH A . 
G 6 HOH 42  542 123 HOH HOH A . 
G 6 HOH 43  543 133 HOH HOH A . 
G 6 HOH 44  544 5   HOH HOH A . 
G 6 HOH 45  545 98  HOH HOH A . 
G 6 HOH 46  546 115 HOH HOH A . 
G 6 HOH 47  547 110 HOH HOH A . 
G 6 HOH 48  548 78  HOH HOH A . 
G 6 HOH 49  549 27  HOH HOH A . 
G 6 HOH 50  550 155 HOH HOH A . 
G 6 HOH 51  551 46  HOH HOH A . 
G 6 HOH 52  552 29  HOH HOH A . 
G 6 HOH 53  553 111 HOH HOH A . 
G 6 HOH 54  554 139 HOH HOH A . 
G 6 HOH 55  555 44  HOH HOH A . 
G 6 HOH 56  556 40  HOH HOH A . 
G 6 HOH 57  557 87  HOH HOH A . 
G 6 HOH 58  558 128 HOH HOH A . 
G 6 HOH 59  559 18  HOH HOH A . 
G 6 HOH 60  560 84  HOH HOH A . 
G 6 HOH 61  561 36  HOH HOH A . 
G 6 HOH 62  562 130 HOH HOH A . 
G 6 HOH 63  563 136 HOH HOH A . 
G 6 HOH 64  564 124 HOH HOH A . 
G 6 HOH 65  565 45  HOH HOH A . 
G 6 HOH 66  566 120 HOH HOH A . 
G 6 HOH 67  567 50  HOH HOH A . 
G 6 HOH 68  568 103 HOH HOH A . 
G 6 HOH 69  569 140 HOH HOH A . 
G 6 HOH 70  570 59  HOH HOH A . 
G 6 HOH 71  571 102 HOH HOH A . 
G 6 HOH 72  572 150 HOH HOH A . 
G 6 HOH 73  573 127 HOH HOH A . 
G 6 HOH 74  574 10  HOH HOH A . 
G 6 HOH 75  575 51  HOH HOH A . 
G 6 HOH 76  576 117 HOH HOH A . 
G 6 HOH 77  577 134 HOH HOH A . 
G 6 HOH 78  578 72  HOH HOH A . 
G 6 HOH 79  579 105 HOH HOH A . 
G 6 HOH 80  580 2   HOH HOH A . 
G 6 HOH 81  581 129 HOH HOH A . 
G 6 HOH 82  582 137 HOH HOH A . 
G 6 HOH 83  583 131 HOH HOH A . 
G 6 HOH 84  584 97  HOH HOH A . 
G 6 HOH 85  585 77  HOH HOH A . 
G 6 HOH 86  586 67  HOH HOH A . 
G 6 HOH 87  587 68  HOH HOH A . 
G 6 HOH 88  588 32  HOH HOH A . 
G 6 HOH 89  589 132 HOH HOH A . 
G 6 HOH 90  590 116 HOH HOH A . 
G 6 HOH 91  591 92  HOH HOH A . 
G 6 HOH 92  592 112 HOH HOH A . 
G 6 HOH 93  593 6   HOH HOH A . 
G 6 HOH 94  594 146 HOH HOH A . 
G 6 HOH 95  595 58  HOH HOH A . 
G 6 HOH 96  596 56  HOH HOH A . 
G 6 HOH 97  597 66  HOH HOH A . 
G 6 HOH 98  598 113 HOH HOH A . 
G 6 HOH 99  599 122 HOH HOH A . 
G 6 HOH 100 600 141 HOH HOH A . 
G 6 HOH 101 601 93  HOH HOH A . 
G 6 HOH 102 602 109 HOH HOH A . 
H 6 HOH 1   201 159 HOH HOH H . 
H 6 HOH 2   202 160 HOH HOH H . 
H 6 HOH 3   203 7   HOH HOH H . 
H 6 HOH 4   204 82  HOH HOH H . 
H 6 HOH 5   205 80  HOH HOH H . 
H 6 HOH 6   206 74  HOH HOH H . 
H 6 HOH 7   207 149 HOH HOH H . 
H 6 HOH 8   208 3   HOH HOH H . 
H 6 HOH 9   209 49  HOH HOH H . 
H 6 HOH 10  210 8   HOH HOH H . 
H 6 HOH 11  211 138 HOH HOH H . 
H 6 HOH 12  212 94  HOH HOH H . 
H 6 HOH 13  213 39  HOH HOH H . 
H 6 HOH 14  214 85  HOH HOH H . 
H 6 HOH 15  215 144 HOH HOH H . 
H 6 HOH 16  216 55  HOH HOH H . 
H 6 HOH 17  217 16  HOH HOH H . 
H 6 HOH 18  218 107 HOH HOH H . 
H 6 HOH 19  219 52  HOH HOH H . 
H 6 HOH 20  220 19  HOH HOH H . 
H 6 HOH 21  221 65  HOH HOH H . 
H 6 HOH 22  222 26  HOH HOH H . 
H 6 HOH 23  223 148 HOH HOH H . 
H 6 HOH 24  224 119 HOH HOH H . 
H 6 HOH 25  225 57  HOH HOH H . 
H 6 HOH 26  226 125 HOH HOH H . 
H 6 HOH 27  227 135 HOH HOH H . 
H 6 HOH 28  228 157 HOH HOH H . 
H 6 HOH 29  229 126 HOH HOH H . 
I 6 HOH 1   301 11  HOH HOH L . 
I 6 HOH 2   302 2   HOH HOH L . 
I 6 HOH 3   303 4   HOH HOH L . 
I 6 HOH 4   304 69  HOH HOH L . 
I 6 HOH 5   305 62  HOH HOH L . 
I 6 HOH 6   306 71  HOH HOH L . 
I 6 HOH 7   307 12  HOH HOH L . 
I 6 HOH 8   308 96  HOH HOH L . 
I 6 HOH 9   309 1   HOH HOH L . 
I 6 HOH 10  310 24  HOH HOH L . 
I 6 HOH 11  311 5   HOH HOH L . 
I 6 HOH 12  312 47  HOH HOH L . 
I 6 HOH 13  313 25  HOH HOH L . 
I 6 HOH 14  314 8   HOH HOH L . 
I 6 HOH 15  315 83  HOH HOH L . 
I 6 HOH 16  316 14  HOH HOH L . 
I 6 HOH 17  317 6   HOH HOH L . 
I 6 HOH 18  318 156 HOH HOH L . 
I 6 HOH 19  319 9   HOH HOH L . 
I 6 HOH 20  320 23  HOH HOH L . 
I 6 HOH 21  321 95  HOH HOH L . 
I 6 HOH 22  322 22  HOH HOH L . 
I 6 HOH 23  323 37  HOH HOH L . 
I 6 HOH 24  324 100 HOH HOH L . 
I 6 HOH 25  325 64  HOH HOH L . 
I 6 HOH 26  326 42  HOH HOH L . 
I 6 HOH 27  327 106 HOH HOH L . 
I 6 HOH 28  328 99  HOH HOH L . 
I 6 HOH 29  329 48  HOH HOH L . 
I 6 HOH 30  330 91  HOH HOH L . 
I 6 HOH 31  331 81  HOH HOH L . 
I 6 HOH 32  332 20  HOH HOH L . 
I 6 HOH 33  333 101 HOH HOH L . 
I 6 HOH 34  334 31  HOH HOH L . 
I 6 HOH 35  335 86  HOH HOH L . 
I 6 HOH 36  336 75  HOH HOH L . 
I 6 HOH 37  337 38  HOH HOH L . 
I 6 HOH 38  338 41  HOH HOH L . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3800  ? 
1 MORE         -82   ? 
1 'SSA (A^2)'  24100 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 121 ? A HIS 191 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 267 ? A HIS 337 ? 1_555 78.1 ? 
2 NE2 ? A HIS 121 ? A HIS 191 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 271 ? A HIS 341 ? 1_555 93.6 ? 
3 NE2 ? A HIS 267 ? A HIS 337 ? 1_555 ZN ? D ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 271 ? A HIS 341 ? 1_555 72.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-03-22 
2 'Structure model' 1 1 2017-04-05 
3 'Structure model' 1 2 2017-04-12 
4 'Structure model' 1 3 2018-01-31 
5 'Structure model' 1 4 2019-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' Advisory                     
4 4 'Structure model' 'Author supporting evidence' 
5 4 'Structure model' 'Database references'        
6 5 'Structure model' 'Data collection'            
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_audit_support              
2 4 'Structure model' pdbx_related_exp_data_set       
3 4 'Structure model' pdbx_unobs_or_zero_occ_atoms    
4 4 'Structure model' pdbx_unobs_or_zero_occ_residues 
5 5 'Structure model' reflns_shell                    
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 21.0960 43.9982 -5.9642  0.1532  -0.0857 -0.1505 0.2381  -0.0627 -0.0389 0.4843 5.6808 0.7566 
-0.1315 -0.4713 1.3397  0.0784  0.0073  0.0549  -0.0368 -0.0165 0.1380 -0.3042 -0.0735 -0.0619 
'X-RAY DIFFRACTION' 2 ? refined 14.2210 -3.2063 -20.1650 -0.0804 0.0328  -0.0614 -0.0700 -0.0759 -0.0421 2.3672 2.1445 1.6984 
1.8685  0.3653  0.1214  -0.0402 -0.0852 0.0372  -0.1734 0.0304  0.1447 0.1507  -0.3099 0.0097  
'X-RAY DIFFRACTION' 3 ? refined 34.5165 3.7607  -15.8313 0.0058  -0.0730 -0.0147 -0.0125 -0.0061 -0.0117 1.8567 1.5727 2.9459 
-0.4116 -0.0562 -0.0499 -0.0172 -0.0033 -0.0925 -0.1164 -0.0755 0.0308 -0.0262 -0.0504 0.0927  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{ A|* }' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{ H|* }' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '{ L|* }' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER   ? ? ? 2.10.2 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS      ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .      4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 H ASP 35  ? ? OE2 H GLU 99  ? ? 1.90 
2 1 O   A ALA 165 ? ? OE2 A GLU 169 ? ? 2.01 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OE2 A GLU 366 ? ? 1_555 O H PHE 88 ? ? 7_554 1.77 
2 1 OE2 A GLU 366 ? ? 1_555 C H PHE 88 ? ? 7_554 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 167 ? ? 81.49 -6.77  
2 1 ALA A 259 ? ? 71.92 169.76 
3 1 THR A 260 ? ? 75.74 161.69 
4 1 ALA L 51  ? ? 70.15 -53.51 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 583 ? 6.23 .    
2  1 O ? A HOH 584 ? 6.26 .    
3  1 O ? A HOH 585 ? 6.44 .    
4  1 O ? A HOH 586 ? 6.44 .    
5  1 O ? A HOH 587 ? 6.47 .    
6  1 O ? A HOH 588 ? 6.49 .    
7  1 O ? A HOH 589 ? 6.51 .    
8  1 O ? A HOH 590 ? 6.71 .    
9  1 O ? A HOH 591 ? 6.84 .    
10 1 O ? A HOH 592 ? 7.03 .    
11 1 O ? A HOH 593 ? 7.08 .    
12 1 O ? A HOH 594 ? 7.24 .    
13 1 O ? A HOH 595 ? 7.40 .    
14 1 O ? A HOH 596 ? 7.57 .    
15 1 O ? A HOH 597 ? 7.96 .    
16 1 O ? A HOH 598 ? 8.00 .    
17 1 O ? A HOH 599 ? 8.11 .    
18 1 O ? A HOH 600 ? .    8.16 
19 1 O ? A HOH 601 ? 8.35 .    
20 1 O ? A HOH 602 ? 9.29 .    
21 1 O ? H HOH 229 ? 7.20 .    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -17 ? A MET 1   
2  1 Y 1 A ASP -16 ? A ASP 2   
3  1 Y 1 A TYR -15 ? A TYR 3   
4  1 Y 1 A LYS -14 ? A LYS 4   
5  1 Y 1 A ASP -13 ? A ASP 5   
6  1 Y 1 A ASP -12 ? A ASP 6   
7  1 Y 1 A ASP -11 ? A ASP 7   
8  1 Y 1 A ASP -10 ? A ASP 8   
9  1 Y 1 A LYS -9  ? A LYS 9   
10 1 Y 1 A GLU -8  ? A GLU 10  
11 1 Y 1 A ASN -7  ? A ASN 11  
12 1 Y 1 A LEU -6  ? A LEU 12  
13 1 Y 1 A TYR -5  ? A TYR 13  
14 1 Y 1 A PHE -4  ? A PHE 14  
15 1 Y 1 A GLN -3  ? A GLN 15  
16 1 Y 1 A GLY -2  ? A GLY 16  
17 1 Y 1 A CYS 369 ? A CYS 299 
18 1 Y 1 A THR 370 ? A THR 300 
19 1 Y 1 A ASP 371 ? A ASP 301 
20 1 Y 1 A ASP 372 ? A ASP 302 
21 1 Y 1 A THR 373 ? A THR 303 
22 1 Y 1 A LEU 374 ? A LEU 304 
23 1 Y 1 A LEU 375 ? A LEU 305 
# 
_pdbx_audit_support.funding_organization   'European Research Council' 
_pdbx_audit_support.country                France 
_pdbx_audit_support.grant_number           647687 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'    ZN  
5 'SULFATE ION' SO4 
6 water         HOH 
#